2X4GA

Crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
330
structure length
302
Chain Sequence
AHVKYAVLGATGLLGHHAARAIRAAGHDLVLIHRPSSQIQRLAYLEPECRVAEMLDHAGLERALRGLDGVIFSEEVASALGQTNPFYAACLQARVPRILYVGSAYAMPRHPQGLPGHEGLFYDSLPSGKSSYVLCKWALDEQAREQARNGLPVVIGIPGMVLGELDIGPTTGRVITAIGNGEMTHYVAGQRNVIDAAEAGRGLLMALERGRIGERYLLTGHNLEMADLTRRIAELLGQPAPQPMSMAMARALATLGRLEVMAGGQFLDGRKAREELGFFSTTALDDTLLRAIDWFRDNGYFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 104
structure length 302
sequence length 330
ec nomenclature
pdb deposition date 2010-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x4gA00
1RPNA 4ALKA 5G2OA 2Q50A 4KUHA 3U62A 1R0LA 3QE3A 3V2GA 1P0FA 3AI1A 4YJFB 1DSSG 3GUYA 1R16A 2BD0A 3RIHA 3ROMA 1FK8A 4CLHA 5CPBA 4YT2A 4PRKA 3SEFA 2EXXA 4YYZA 4Q3EA 1QSGA 3GNQA 4BV9A 1ZJYA 4WASA 3JQFA 1H9BA 4Z9YA 4RVSA 1XQ1A 3Q9UA 3IUSA 4PG7A 4IUYA 2Y1GA 3D1LA 3W8EA 3KEOA 4JX8A 3HN7A 4I5FA 3RBXA 2Y0CA 4HNHA 3VDQA 2FR1A 4LRSB 3W1VA 2B37A 1HE5A 4CMHA 2NVWA 4ZQFA 1N5DA 1ISGA 2GDZA 2P4QA 4WECA 2W2LD 5EJ2A 5FF9A 2Y1CA 4AVYA 3F1LA 4Y98A 3HG7A 3JQ7A 5IZCC 2HKIA 1G0OA 1ZXBA 3O4RA 2J3KA 2VYVA 4XRGA 3JD0A 2QRJA 3WYCA 4ZGWA 3D4OA 1U3VA 4BO3A 5BSFA 1U2GA 2G0TA 4PLPA 3WFJA 1JQBA 5DCWA 5BSGA 4UVEA 1V6AA 3VH4A 1SEPA 3V1TC 4EJ6A 1K0UA 1CQIA 3I9JA 1PGPA 3QVWA 1KOLA 2JFFA 3QIVA 1DHTA 2VUSA 2NACA 5A04A 3IJRA 1G1AA 2EV9A 4MVJH 1IZ9A 4BHTA 5A06A 1DAPA 1ZUD1 3G3EA 2WM3A 3GRKA 3PLRA 3KYCA 4FCCA 2CY0A 1H2HA 2BGKA 4AL4A 4MIEA 2ZB3A 5I8ZA 4NJMB 5L45A 3HN2A 3WQQA 2RIRA 1JA9A 1NQTA 2NV6A 2PZMA 1AXGA 4II3A 5DOZA 1N7GA 1FXSA 5DCUA 4AJHA 1FDWA 3PI7A 4I08A 1NHGA 3JQEA 4NFHA 3ULKA 1I3MA 1ZZEA 1SEVA 1U7TA 4Y6RA 1QP8A 4O0LA 4OJNA 3JYNA 3GEDA 5ILOA 3RUEA 4UVGA 3STHA 4WEQA 4CLDA 4BKPA 5BR7A 3D4PA 3WWZA 5I8WA 4WCFB 2FR8A 4J43A 1UJMA 4M8SA 1GYQA 1N92A 2HMWA 1O94A 2XXBA 1GPJA 4AJKA 3QRWA 4RORA 2GASA 2R00A 1TLTA 2OP1A 3RUIA 1NWHA 2V7PA 2VRBA 1BDBA 1DFGA 2IODA 3D5QA 3E6AA 1WW8A 2E82A 3W4IA 2PWZA 3DEYX 3O38A 1T2DA 1HEUA 3HDYA 5CDGA 2D1YA 4FPXA 1IB6A 3WXBA 3I5MA 4B3JA 4W99A 1A7KA 4D79A 1I30A 3OIFA 3TDKA 4J1SA 4CL3A 1BHSA 4CMIB 2YQ5A 1UDCA 3RFTA 3IAHA 1D3AA 4KUGA 4W82A 3WWYA 6ADHA 4YB8A 2OORA 1LLDA 1GYPA 2VHXA 2GO1A 4KWHA 1DPGA 2EWMA 3NKLA 3WBBA 1EUCA 1Q0QA 3L6EA 3BAZA 2I76A 3FWNA 1KY4A 2VRCA 3WGHA 1LDEA 4YAGA 1C1XB 4GWKA 2NVUB 3PEFA 4BNIA 3OQ6A 4NJOA 3EDMA 4PN3A 2X9VA 3GRPA 4WPGA 3PQDA 4HP8A 4E2XA 3NDIA 2BGLA 4R69A 5ENVA 1BW9A 2WEKA 1HZJA 4XA8A 1VC2A 1T2EA 2QW8A 4JBGA 4IZHA 4CLRA 3ONFA 2E4AA 2J5RA 1U4SA 3JQ8B 4RVFA 4LVCA 1YBAA 1I3KA 2Z5LA 5KJFA 1XGKA 1IUKA 2CVZA 1NASA 2D5CA 1H2BA 1ML3A 3KB6A 1QYCA 1U7HA 1VJTA 5KWEA 2OUIA 1KC1A 3OQBA 5JPIA 3U4IA 4MVJD 1PWZA 2GRAA 3BXXA 4YPOA 4PFJA 3H2ZA 4ND1A 5IN5A 2DC1A 4OMUA 1PQWA 1ZJZA 3GZNB 1SNYA 2IXBA 4PLTA 3ETDA 4O1MA 4WLFA 4E13A 1QR6A 3H9EO 4XGKA 3NEPX 4JIGA 1MV8A 4K26A 3H3FA 3HDQA 3H9JA 1NAIA 1H6DA 5L53A 1C0KA 1VJ0A 2YV2A 3U4DA 3MOIA 3M2PA 3PHIA 4YJGB 1F8FA 3KBOA 2X1HA 3ZWNA 2EEZA 3AWDA 1Y9AA 1HETA 3F1KA 4UEJA 1S6YA 2Y0EA 5TS3A 1H94A 3QY9A 1SOVA 5C37A 4OOFA 1GTMA 3TFQA 4EEZA 2DUUA 1Q2XA 4PZDA 1HDZA 1WAMA 2OL4A 1V9LA 1JW9B 1O6ZA 3AU8A 2EHDA 2VZ0A 4IJVA 3BIOA 4INAA 1AXEA 3RUFA 2AW5A 3D3EA 2IRWA 5H82A 5JNLA 5AOVA 1YOVA 2WE7A 5F5LA 4QTZA 3OF2A 2ZTLA 1U3TA 4DQUA 4UUPA 3JQAB 1EZ4A 3MJVA 1ENYA 3NTQA 5ES3A 4KTTE 4OSOA 4J1NA 5C7LO 1CERA 1ZEMA 4LK3A 1PGOA 4AICA 1O0SA 2HO5A 1TT5A 4CMAA 3BMQA 3D3WA 4D42A 4IQ0A 1GDHA 2P9CA 2AG5A 4UEKA 5JAZA 3KYDA 1ONPA 2W4QA 3HZZA 1LU9A 5ITVA 4CUKA 3FBGA 4K1LA 3P7MA 2CF6A 3K96A 4OM8A 4Y9DA 5IXSA 1E3JA 4IM7A 2CVQA 4J3FA 5JBIA 2RHRA 3TWOA 5DCYA 2TMDA 2X7HA 2NU8A 1JKFA 2PA3A 4M1QA 1JVSA 5JCJD 1I0ZA 1NBOA 4MINA 2HJRA 5KVQA 1GADO 3FNHA 2A4KA 1R66A 4IMPA 5FI3A 3E48A 4NK5A 3NDJA 2E37A 2C54A 4NR0A 3GGPA 1E7YA 4FOOA 3U3XA 2AMFA 3RC7A 4YXFA 1XIVA 4AJ2A 3ZH2A 5DP1A 3UXYA 1PTJA 3AOEA 3Q6IA 4AJEA 2GN9A 3HUDA 4FFNA 4CM1A 4YVFA 3Q1LA 3C1AA 1DJQA 1I01A 4J4TA 1EVIA 1W73A 3GGGA 4W6ZA 4YJHB 5C7IO 3ZW8A 5CDYA 5BNTA 3E9QA 4ZHSA 3PXXA 3R0IA 2V65A 4ID9A 4EJ0A 3FF4A 4Z9FA 3EC7A 4HKTA 2Y68A 3WJ7A 3ZHYA 1U28A 4GQAA 1Z73A 3PZBA 5LDHA 2B5VA 2Y66A 5CDTA 4GI2A 3F46A 1HZZA 4OQZA 3OJEA 3VPFA 1H0KA 2C2XA 4XQGA 5L4SA 2DBZA 5AXCA 3RUAA 3GAFA 4GKBA 3WG9A 1WPQA 2H63A 4TVOA 1UP6A 4XRRA 3OEWA 3VZRA 4ESOA 1MFPA 3ZNNA 2DFDA 1BXGB 3VPXA 2FRDA 3HADA 4JP3A 5IZ4A 1BVRA 4NZ9A 2FPGA 4I5EA 3ZWMA 4LGVA 3PK0A 2H6EA 2O2SA 4AJLA 3EZYA 3BHIA 5KVVA 1FJHA 4OYRA 4RVUA 3IL2A 2VHZA 1KY5A 3Q11A 2CDBA 2QZ9A 3JQFC 3MEQA 1HRDA 1WLYA 3V5NA 4KWIA 1O95A 1SZJG 2WMDA 4IPTA 1FDVA 3ASVA 3OJ0A 4CM4B 2B0JA 1GUYA 1P1RA 1WZIA 4MKXA 3X2EA 1X0VA 4CV0A 1C1DB 2DTEA 1PEDA 3RSHA 3UCEA 4BO0A 2J3IA 2I9PA 4L8VA 4IDAA 3WIEA 1MA0A 5TNXA 2ZATA 2VHWA 3KSZO 1GPDG 2AE2A 2OHXA 3JQ9C 5MGBA 2IDZA 4FIZA 2AEJA 4RF2A 5H81A 4CR6A 1DIHA 4XQ9A 4D45A 4UUMA 3L4SO 5G0VA 4P38A 5A9SB 1OI7A 2DLDA 2YV1A 4WOJA 4II2A 4PVDA 3ZZNA 3SVTA 3NV9A 5IDQA 2CZCA 1GYRA 3JD1A 4NNJA 4AJNA 3BTOA 3U5TA 4QECA 2LDXA 1PS8A 3H5RA 2HMUA 1MC5A 1Y1PA 4AJPA 2YQ4A 4DGSA 3ZWAA 4CPDA 4KDFA 3OQ1A 4RLSA 3PQEA 1B7GO 2JD2A 4DQXA 4D0SA 3FPLA 1IHYA 1LSUA 4W7HA 1C14A 1AN9A 2HDHA 1MB4A 3AK4A 5G0SA 4K9DA 3ZHBA 5G4KA 3A9WA 4KP7A 1K6JA 1Q0LA 4YAIA 4LVUA 4J0FA 4RPGA 2FSVA 2JHGA 1O8CA 1Z7BA 3MWDB 4L76A 2JAHA 4BNNA 3KSDO 1Y81A 2OMEA 4MO2A 3QJ5A 5B4UA 3DTYA 2O7QA 4N7RA 1E1LA 2FWMX 3IDSA 2C59A 3IS3A 3BHMA 5KNLA 2B5WA 3BMNB 4TQGA 3IJPA 2VTDA 2JKVA 3C1OA 3CZMA 3JD4A 1GZ6A 1T25A 3JQGA 4FC6A 3K6JA 2QIOA 2PY6A 3GDOA 1DHRA 2R00C 3JYLA 3QHAA 5HS6A 1Y8QA 4N5LA 4J6FA 2CVOA 3C7AA 3E03A 4K6CA 4BNJA 4NBUA 5TX7A 4CLOA 4CMKA 2FHSA 4D46A 3PFFA 3QWAA 5ITWA 3DHEA 1LI4A 4YEDA 3HWRA 3LSYA 1BXZA 1N1EA 1DJNA 4HWKA 4DLAA 5C7OO 1P45A 4R51A 2C5AA 3S2GA 1D7OA 2WSBA 3DO5A 2B35A 4RZIA 4JK3A 4URFA 1I32A 2YZ7A 1YBMA 1NR7A 2VWHA 3H7AA 1RJWA 4W9NA 3F6YA 1NFRA 4WLEA 5U9CA 3ZN2A 1GQYA 3MWEB 3V2UA 1RYEA 2GZ1A 3OJLA 4Q9NA 1ZMTA 1YRLA 3GG9A 1Z45A 2AXQA 1E1NA 3U9LA 3F3SA 2PV7A 1E3WB 1YH3A 2BHLA 1HDGO 3SX2A 2C07A 2VWPA 3EZLA 4J9UE 2YFHA 3SJUA 3TZ6A 2PD4A 1UUFA 5CP8A 4KUEA 3E1KA 1PX0A 5IXYA 1OFGA 1HDRA 4YT5A 5AQ1A 2C2YA 1TXGA 2EERA 3E5RA 2EP7A 1DDOA 3IP1A 4RVHA 1U3UA 4QQRA 4WLUA 1KVTA 4ND5A 5TSDA 4HFRA 1HE2A 1XWFA 1I33A 3GN2A 2YV3A 1N9GA 3ZV3A 1CQJA 1R6DA 2AQKA 2P4HX 2VYNA 3B70A 4OGWA 5JLAA 3DB2A 4BB5A 2JAPA 1XDWA 1PIWA 3EVNA 4DLLA 3S55A 3G49A 2WYUA 1H5QA 1KYQA 3WQRA 1E7MA 5BT9A 2WTBA 1IL0A 5T6BA 1V3TA 4FS3A 5F21A 4XR4A 4YACA 5B37A 2GZ3A 3TZQA 3IMFA 2JL1A 2I3AA 3KETA 4XB1A 3DHYA 2GN8A 1R4MB 2NM0A 3PHLA 1IOLA 4Z0TA 3DZJA 3EY4A 5BNIA 1BG6A 1VSUA 1I3LA 4ALIA 4IS3A 1LDNA 4OOEA 1HL3A 1NPYA 4KZPA 2DBRA 5JDCA 1VE9A 4NBRA 1IPEA 4RQTA 2AE1A 4XJTA 3A14A 1ENZA 4Z9XA 3OA0A 4R3WA 1PJBA 4KTVE 4JN6B 2DM6A 2GR9A 1TT7A 1E7RA 3FRJA 2Y1EA 4A73A 1ZVMA 5AVOA 4GMGA 1YWGO 4F45A 5K0ZA 2ILTA 2F1KA 4ALMA 2JCYA 4B8ZA 4CM9A 3HQ4O 1J4AA 2A9FA 5I9LA 4A5OA 5IN4A 5DBIA 1ZBQA 1O9BA 4D3DA 1Y8RA 1Z82A 2VWGA 5CHEA 3VHRA 1DLIA 1G0NA 3ANMA 3NT5A 4RL6A 1XCBA 4CMEA 1PR9A 3FTNA 1OOEA 2P5UA 3UOGA 4JJFA 3NGXA 2PR2A 2ZQYA 1HTBA 3FI9A 5FFFA 3AUUA 4GLLA 1GR0A 3WGTA 1C0LA 4BGVA 2IE0A 5DOVA 1H93A 3PFWO 4BO9A 2AQIA 2RAFA 3QLJA 2YUTA 4ILKA 1Y9EA 5KVCA 4FQ8A 1J5PA 4J9VA 4YRBA 3TJRA 2DQ4A 1BSVA 3ZV6A 3HFGA 3VTZA 2QG4A 1SAYA 4MVJI 4ZU3A 3C24A 1E0DA 2NU6A 4XYEA 2UUOA 3ZWVA 1LJ8A 4N18A 2HCTA 3CINA 2QZZA 5K6AC 3DBLA 4OO3A 5A3JA 1IPFA 1SO8A 3IOYA 1ZK3A 4GVLA 4JXKA 2UYYA 3DFZA 2YHIA 1JKJA 2I99A 1ULSA 1BWSA 1UXIA 2Q1WA 2VYVD 4ZQHA 2VUTA 5ILGA 2PKQP 1YGYA 4E5YA 2IZZA 2G1UA 1ENOA 1I8TA 5JDIA 2J3JA 3AY3A 1PZGA 2WWRA 4ONEA 3TNLA 1P44A 2EKPA 1LRLA 5A9RA 3WGIA 2FZWA 8LDHA 1D1TA 2X6TA 3NT4A 3PQFA 3ROPA 1PQPA 3LVFO 3VPGA 4Y67A 1GL3A 2QQ5A 1ZCJA 1IE3A 5JCXA 3H9QA 4LMRA 1PZFA 4I9NA 3UAGA 1PGQA 1HDCA 1O5IA 2AG8A 5JAIA 5KTKA 2NTNA 3GY0A 1TA4A 2BRUA 3BMCA 3CPSA 3GHYA 2B4RO 4FJ2A 1D1SA 5FYDA 4DMLA 3EYWA 4ZD6A 4R1NA 4ZQGA 3VKVA 3L4BA 5DNAA 3FNEA 4YT4A 5L7TA 3KVOA 3ANNA 4EI2A 1LQUA 1QRRA 3PPIA 3DBHA 1VL0A 5IG2A 4TMFA 4WNCA 2P9EA 1DIRA 5KIAA 3UFXA 4CODB 1GZ4A 4PG4A 4CUJA 3VDRA 3IKVA 5EINA 3QA9A 1PJQA 4XDYA 1ZKMA 3MCVA 5CEFA 4MIYA 2Y0DA 1HDOA 3TOZA 1MUUA 3DZHA 5EERA 3IUPA 4BNFA 2VTEA 1T4BA 4G65A 3UICA 2C7VA 1ADCA 1TB4A 4NBWA 3GHHA 4P4GA 3GQVA 5KJEA 1YJQA 3JQCA 1BMDA 3L77A 4RF4A 1A5ZA 1YBVA 3RUHA 3GNSA 4D3FA 2PGJA 2V6MA 4IDDA 3K5PA 3WBFA 5CDSA 1LDGA 2WE8A 4IDCA 3QQPA 2XOXA 3NJ8A 3ZGYA 2VUUA 4L4XA 1M2WA 2NTJA 4K28A 3OSUA 2NU9A 1NQAO 3ABIA 1ADFA 1HT0A 2VNAA 5FEUA 1FMCA 3IKTA 2V6GA 4CV3A 1VKNA 1XU9A 3RD5A 1E3SA 1BGVA 2OFPA 2VRCD 4RZHA 4MP8A 4OKNA 2DVMA 1HYHA 3UHAA 1UXHA 1FF9A 4DIOA 1RWBA 3LLSA 4BNUA 1OAAA 3I23A 3PHHA 3GAZA 1YKFA 1DFHA 3RAJA 4R1SA 4J2HA 3O26A 1LRKA 1QYXA 1MP0A 1V35A 3AOGA 1SB9A 4QFCA 4CM8A 1I2ZA 3GMDA 5EPOA 2EKQA 3NDRA 2UUPA 4M49A 1DO8A 4N5MA 2HRZA 1CETA 3G1UA 4XKJA 3UN1A 3K92A 3INGA 3ZU3A 2RCYA 1T24A 4YAEA 4RPKA 1E7QA 5DULA 1FDUA 1GAEO 2FY8A 4X54A 1M76A 3DL2A 1YQGA 1F0YA 2X5OA 4DPMA 2DAPA 1UAYA 3CMMA 2PZKA 4CQMB 2QYSA 2OBNA 4J1TA 3UKOA 5KKAA 4ZVVA 3DZKA 4MIOA 4B4VA 1VM6A 2PZJA 1BXKA 4H7PA 4E5MA 4B3HA 2VCYA 4U7WA 1NVTA 1EBUA 3DZGA 4PZCA 1HYGA 2EGGA 3KSUA 3QWHA 3N74A 5IF3A 4Y8VA 4BNYA 3ZU4A 1XEAA 1NHWA 4UEOA 2WD7A 1B8PA 1ID1A 2QRLA 3LC1O 4W9NC 1LBEA 2J5QA 2XF8A 1ISFA 4NU6A 3PGXA 1O89A 4HXYA 4CV2A 4G81A 3WGZA 2EJWA 5EESA 5JAMA 3GDFA 1D8AA 4B7UA 4HNGA 3OP4A 1QKIA 4LSMA 1ZSVA 3CXRA 4PLFA 1T26A 1YE3A 3RC1A 4WKGA 4Q39A 4ZQBA 4IQ8A 1K5HA 5I9MA 3ON5A 1UXGA 4CM6A 1GQ2A 3LLVA 3FD8A 1N7HA 3O03A 4TRNA 1B3RA 3RBVA 4D0RA 3OH8A 2O3RA 2QHXA 1A9ZA 4UVDA 3ZWCA 4GKVA 1R4NB 1UXKA 4CM4A 2NUAA 1I36A 4L4RA 5DP2A 4QSMA 2FOIA 2A35A 2XAAA 3DXFA 2E49A 2DT5A 2PK3A 1KEWA 4FBGA 1X1EA 3TFOA 4EBFA 5T8KC 3ST7A 5TLSA 1PJCA 3AFNA 5I7FA 2GSDA 3F47A 3E5MA 2HSDA 3LT2A 2C5EA 4S3MA 4FSHA 2ZK7A 3MJCA 1Y7TA 4YA6A 3WLFA 3VTFA 1CF2O 1PGNA 1OC4A 2JD1A 4Q3AA 4TRMA 3COSA 2RHCA 4C4OA 4A27A 2X5JO 3NJ4A 4AJ4A 3ICPA 3KO8A 4L73A 1KEUA 3Q0EA 4WOKA 5EQFA 4K6FA 5JC1A 4TZTA 3BTSA 3GEGA 1VPDA 3W4KA 2I66A 2YDXA 3BTVA 1EBFA 4KQWA 3S8MA 5JFOA 5DZSA 3AM5A 1MG0A 1A72A 2Q4BA 1EUZA 3NT2A 3O8QA 4RCVA 5EN4A 5KOIA 4CLXA 4AJ1A 4BOYA 3NAQA 3JQ7B 4M86A 1YL7A 3V8BA 4BQRA 3JD2A 5DDIP 1F14A 3I6QA 3D64A 4UREA 3H5AA 2X0RA 4TROA 2O3QA 1ORRA 2NADA 3I52A 1WNTA 1GCUA 3C1TA 2ZJ1A 3RFVA 4XJSA 3T7EA 3Q3CA 4A10A 3OMLA 2HAEA 1DFIA 4M55A 4E5PA 1GV1A 4JROA 1YDWA 2NQ8A 1ZSNA 1RM3A 1XYGA 3AUAA 3PYMA 4GVXA 2D5AA 3QVTA 4JBHA 3WGQA 2B83A 1P0CA 2Y1DA 2GCGA 3OETA 1JU9A 1YB5A 2ZQZA 4HFMA 3VH3A 1QYDA 4YAJA 3G1TA 1QLJA 4TKMA 1T4DA 1N1GA 1U8FO 3E9MA 3DBRB 3WR5A 4E31A 3NTOA 4WGGA 5CDUA 2ZB4A 5F1OA 1Z74A 4GL4A 3S2FA 3SXPA 4Z3DA 2HMSA 3H2SA 2P68A 4AJJA 2NWQA 3ENNA 4L9RA 2WD8A 1PR3A 2DTDA 3QWBA 4PLZA 4EITA 4XWYA 3H9UA 2I5PO 3F5QA 1IHXA 2GPTA 4IDGA 4PLVA 1K3TA 1QV7A 4D7AA 4DYVA 5JDIC 1SPXA 4OIMA 7ADHA 3HHPA 4NIMA 4BVAA 3DC2A 3PWSA 4GSKA 2X0IA 3WOHA 3BMOA 1LEHA 4DIFA 3JSAA 3GR6A 4BMSA 1E6EA 2CUKA 4EGFA 1JDJA 3F4LA 1Y5RA 3DBVO 1QLHA 3G17A 2O2YA 3H65A 3IQDB 3QW2A 4JJGA 5COBA 5LCXA 1F8GA 5CG2A 5F1KA 5KJCA 4GLOA 1HYEA 4QFDA 4FN4A 4U6SA 1EK5A 2GF2A 2BKAA 2FR0A 3DHNA 2FP4A 5F1PA 3L07A 1U2DA 1ZH8A 3B1JA 3PYLA 3NGLA 4FC7A 1AHHA 1OZAA 4GX5A 2PKRA 4Z0HO 3VZSA 5TQVA 3QSGA 2RH8A 1NPDA 1PZEA 1R0SA 1P77A 2ZJ0A 3L9XA 2P91A 4IIVA 2BI7A 1U5AA 3DZIA 5F3RA 1NQ5A 1Q1NA 1TVEA 3GDGA 3I4CA 1KS9A 4RPHA 4AJIA 2X0JA 1KEVA 1C0PA 4R5MA 4YRAA 3BYZA 4BUCA 4EUEA 1KIFA 3D4NA 3M2TA 4A03A 3H9GA 1ONNA 4IJKA 5EMHA 2B4QA 3E18A 1WXDA 1GEGA 3RU9A 4RPJA 3EAGA 1LLUA 4RLHA 3FTPA 1DIBA 5J23A 1Q7BA 3WS7A 4CLRB 3R3JA 4TKLA 3M1LA 4A26A 4BO6A 1QMGA 4R5HA 4DC0A 1EDZA 4F3YA 3VPSA 9LDBA 2Z1NA 4DRYA 4DREA 3RC2A 4PLGA 1EVYA 3PHGA 2GLXA 1XU7A 2W2KA 3KUXA 4IXWA 4RVGA 4B4UA 5JYEA 4GPD1 3WFIA 1KERA 2H5LA 3C85A 2CNBA 3ITDA 4J7UA 1L7EA 1H6AA 2CF5A 3AUTA 4IBOA 2C82A 3OIDA 4WUVA 2JD0A 2VHYA 3U4HA 3GFGA 1VKOA 3VC7A 3UCFA 3OJFA 3RROA 5I9NA 1DXYA 4BGUA 4BGIA 4ND3A 1LDBA 2ZYDA 2BMAA 1A7AA 1E7WA 4EUHA 1ULUA 2FPIA 3WX0A 4GH5A 4IMRA 5IZCA 1N8KA 4YWJA 4AJOA 3PIIA 2OP0A 3ZHXA 1DIGA 4YR9A 3DAGA 3VZQA 2OBYA 1MLDA 4RPLA 5HS4A 4IJWA 7MDHA 2Q2VA 4NBTA 4S1VA 5IDXA 1ONOA 4FW8A 4DBVO 4U8GA 3LT4A 3TZHA 2E6UX 2QRKA 3AJRA 2VYND 2JFHA 1RM4A 1YOVB 4P8RA 5U1PA 1EQUA 2UDPA 3WIDA 1RKXA 4JJIA 5G4LA 1C0IA 2VWQA 3G0OA 4FJ0A 1CIVA 5KCZA 3EGOA 4RF5A 4CLEA 2O7SA 3GPIA 3RC9A 4AFNA 3GH3A 1B26A 3TZCA 3ZWBA 2RH4A 2C0CA 4PIVA 2FSSA 4TZKA 3U49A 1AGNA 3VKUA 4RF3A 3T4XA 4DLBA 3GLQA 5T57A 1X7GA 1LA2A 1V0JA 2ZTVA 1TT5B 4HY3A 3BMQB 3D3WB 5ER9A 3VVCA 4ZN6A 1UAGA 4MVJE 3VOSA 5AXDA 2TMGA 3KYDB 4H16A 4HUJA 3A28A 3FHLA 4LSWA 1EVZA 4Q3NA 4ZA2A 3WSVA 5HWSA 1PS9A 4ROSA 3PTZA 4IXTA 3FR7A 1R0KA 3GEMA 4XD2A 5G0WA 1P1IA 3PJFA 2B4TO 2ET6A 4Y6PA 1P1JA 4C7JA 4TRJA 5C3MA 3ZCXA 1P74A 2Q1SA 3DMTA 4GBJA 1K89A 3CSDA 3CE6A 4CR7A 1GQQA 1PJTA 4XDZA 4AG3A 4CM9D 1NVGA 2Z95A 3RU7A 2DKNA 4UUOA 4Z6KA 3SLGA 1B16A 1LDMA 1ZK0A 3M6IA 1E5LA 4YT8A 4YJFA 3INTA 4R54A 4YAKA 1XHLA 4UAGA 4CV1A 2ZYAA 1TEHA 4BNLA 3LC7O 4WEOA 3INRA 3GPDG 4GSLA 5I7SA 3RUCA 3AM3A 3WICA 3QP9A 3H5NA 2Q2QA 3HDHA 4NDNE 1PJ2A 1SB8A 2PKQO 3E82A 4BNHA 4QX6A 4F46A 1HLDA 4IGEA 4A2CA 1J6UA 3MZ0A 1HE3A 4JCOA 4R9RA 3WDSA 3WMXA 2EF1A 1F06A 2O50A 1LDYA 2D4AA 3V2HA 5T64A 4Q3BA 3D5TA 1LSJA 1E3IA 5L9AA 2PTGA 4IGFA 1AHIA 1XA0A 2O3SA 3I1JA 4JGBA 4CQLB 4DUPA 4YJDA 1MXFA 3LC2O 4B4OA 2WDZA 3KZVA 2CMDA 2HRBA 1LTHR 3LF2A 1CDOA 1MX3A 1EQ2A 1SMKA 3S2EA 2VHVA 3RUDA 3PIDA 1OC2A 3ROQA 4U0KA 5K9ZA 5CEEA 2DUWA 2WYVA 1I2CA 1CRWG 1NTOA 3AUSA 3K31A 4QEDA 2NLOA 5A02A 1LSOA 3GZ4A 4RGBA 3PDUA 1WVGA 4NJMA 5B4TA 4XYMA 4UVIA 3AI2A 5CAEA 2Y99A 3K30A 3ZW9A 1MXHA 4PG8A 4R41A 4YCAA 1W6UA 5THQA 2IEBA 2ZB8A 3WNQA 3KM0A 3B1KA 5DN9A 1E1KA 1JWAB 2X58A 1EVJA 4R01A 2SCUA 2JHFA 3VZPA 3JD3A 1HDXA 2B69A 2YYYA 4BO2A 1UH5A 1X13A 3FR8A 3GVXA 4IIUA 4IQGA 4NFYA 4E2WA 2F00A 4L75A 4WCFA 3ZNQA 1NYTA 3Q2IA 3L6OO 4XIJA 1B2LA 1QYVA 3B20A 4J0EA 3HB4X 4IS2A 3A1NA 2BF7A 3WQSB 5ICSA 5A9TA 3PJGA 4XYLA 1B14A 4XYGA 1PJ4A 3ZNOA 3OA2A 4FR5A 3U09A 4CQMA 1U9JA 2JJYA 3B1FA 4XQCA 3WGGA 4U6QA 5A5EA 5G4KB 3F4BA 4QO7A 1NM5A 1I3NA 4NBVA 1B15A 4I5GA 5A3VA 5FI5A 3RASA 4PLYA 2PH5A 4DIBA 3K2BA 3TL3A 3HB5X 5B4VA 4WE3A 3KV3O 4W4TA 3UH1A 3RJ5A 4BNKA 1PSDA 1DIAA 1M67A 1YO6A 2VOJA 4J4BA 4BO4A 1W0CA 3AOEC 2GN4A 5F5NA 3RBZA 3CTMA 4CMIA 3E8XA 2EG9A 2YJZA 3T4EA 2PLAA 2W8ZA 3BHJA 1GEEA 3HFSA 4YTEA 4EJMA 3W6ZA 4P4NA 3NTRA 3GFBA 3JQGB 1KVQA 4BV8A 4DL9A 4E3ZA 4HV4A 1FDSA 4WJZA 3DZBA 5JC8A 2X4GA 3K73O 4OXYA 2UAGA 1WZEA 1Y8QB 4ND2A 5JY1A 1C1XA 2NVUA 4R1UA 3JQAD 5A5FA 1F12A 3I9OA 4CLOB 2O3UA 3A06A 4OQYA 3SJ7A 1E7SA 4DBZA 4RO0A 3GK3A 1LC0A 1PJLA 3EUWA 4LCJA 3O9ZA 4XGNA 3I3OA 3QWIA 5KKCA 4CMBA 1PL8A 2BFAA 4O63O 3JQ8A 3OHSX 5ICMA 3SBOA 1EMDA 3OEYA 3NX4A 4GGOA 1N2SA 4PLCA 1CEQA 4TWRA 4YQZA 1SOWA 4G5HA 2ZB7A 4PGFA 4FJ1A 2I3GA 3CH6A 1CWUA 4M89A 4IJUA 1WMAA 1XR3A 2JCVA 2O4UX 1VRWA 1B8UA 4W7IA 2IXAA 4E33A 4DA9A 2YFQA 3ZDFA 2Q99A 3ZI0A 4EW6A 3ENKA 3GZNA 4HX5A 3I9KA 1ZSYA 2WJPA 3F5SA 3GN1A 4D3SA 1EFLA 3ZWYA 4PRLA 4GGPA 1ZEJA 4Z0PA 4BMNA 2CDAA 2HK8A 3ANLA 4BO8A 2PH3A 3PWZA 3H8VA 1PQUA 3I9MA 2I6TA 4YJGA 1EUDA 4KQXA 3CKYA 1N9GB 2OO5A 3HDJA 4EEXA 4LN1A 2W90A 2Y1OA 2BFOA 1GUZA 4DTIA 1PJ3A 4QUKA 5IDWA 5C5IA 4O6VA 3L9WA 1DB3A 2Q1TA 3SC4A 1GU7A 2GN6A 4E0BA 2V6BA 1LXCA 1DAOA 3OICA 1UDBA 5I7VA 3I6IA 1KETA 2D0IA 3DMYA 2H9IA 2HLPA 2GD1O 2B36A 4L0QA 2BH9A 3LU1A 4PZEA 5ADHA 5FWNA 3TF5A 1WWKA 3IIEA 4I9HA 2DBVO 4BO5A 1VL6A 5THKA 3WGOA 3JQAA 3AFMA 4DC1A 4TVBA 4B4WA 3GVHA 4ALNA 3JQ9A 1T2AA 1P33A 4E5KA 1E6WA 3ZU5A 5L51A 5TT0A 3AU9A 5EL0A 3OFSA 1FDTA 4IDBA 4DWVA 2Q45A 1YS4A 5GZ1A 4DXHA 2GGSA 1HE4A 3WGYA 4BQPA 1RM0A 3TPCA 1LRJA 1BTOA 3FPCA 3WTBA 4IY1A 4NMHA 3RJ9A 3H3JA 3JYPA 1DC3A 4XGIA 3G79A 3ONDA 3S2IA 4RDIA 4D43A 2HQ1A 5COQA 1WP4A 4CJXA 3U4CA 1Y8RB 1NR1A 3PJDA 3W8DA 3ROKA 4CM3A 3DBRA 2DPGA 2GZ2A 1YL6A 3PZRA 4N5NA 2CFCA 2J6IA 2VQ3A 5CPFA 4YRDA 4HFJA 3ETGA 1HDYA 1UZMA 1KVUA 2O3JA 1XSEA 1E92A 3R6DA 5LC1A 5JW6A 2D8AA 4IDEA 3AM4A 5JXWA 3RQSA 1ARZA 2CSUA 1GZ3A 4GWGA 5AXAA 4YJHA 3VH1A 4I9UA 4LRTB 4JQCA 3PYXA 4BL5A 3MOGA 5T5QA 4A7PA 4BB6A 3I4FA 4NFSA 4H3VA 3F9IA 3N7UA 1L7DA 4P4LA 3DMTC 3KLMX 4L4SA 2W2LA 1U3WA 1YVEI 3JYOA 1QG6A 2G76A 2ZTUA 1YL5A 2PNFA 3DQPA 3DBLB 4NPCA 1NXQA 1X7HA 1M6HA 4XCVA 2EP5A 2P9GA 4J7XA 2A94A 5L40A 2YHIB 3PJEA 4CMJA 4EYEA 2AHRA 1DRWA 4C7KA 3QVOA 1DLJA 5B12A 1BXGA 2ZIZA 1E77A 1TI7A 1X15A 2OOSA 4ALLA 3GVCA 1DC6A 4QT0A 5HA5A 3W4JA 3UCXA 4PVCA 4MJLA 4BNTA 3PRJA 4WCDA 2EW8A 4E30A 1WDMA 3EK2A 4Z3KA 4I8XA 4WNIA 2HJSA 1LQTA 3KEQA 3KLPX 2O4CA 2RBEA 5CEJA 4FFOA 5EIOA 3JCZA 2Q4EA 5KJ6A 4RJTA 1LX6A 5JO0A 3UVEA 2BI8A 1K6IA 1X14A 1Q0HA 5T67A 2BFPA 1C1DA 3GVIA 4ZRMA 2DU8A 4Q3DA 1GV0A 3BMCB 2Q2WA 3BZUA 4P22A 1R37A 2GNAA 3FWZA 4BKUA 4J90A 2HUNA 4OH1A 3AY7A 4FB5A 4N54A 1PJSA 4O59O 3N58A 1HSZA 1VL8A 3DBHB 4OAQA 2ZTMA 3NUGA 1IZ0A 1ISJA 2X8LA 5JDCC 1LSSA 2P2SA 3LQFA 2G82A 3LK7A 3QWFA 3TSCA 4E21A 4CM7A 2R6JA 2W98A 3DOOA 1HXHA 5A9SA 1U4OA 4J16A 3ZHZA 4M87A 4J1QA 3ZU2A 1PU2A 1M6WA 1D4FA 1PL7A 1KBZA 1MC4A 1Y5MA 4NHEA 4QXMA 4RV9A 2ZYGA 4XZ3A 3WYBA 2O3TA 3PWKA 2ZCUA 4TSKA 4HADA 5L95A 2X0NA 3ONEA 1B0AA 2YY7A 2YHUA 2PGDA 3FN4A 4E6PA 4FFLA 3WB9A 3PHJA 3Q9NA 4E2YA 3OBBA 4D41A 3UF0A 3GGOA 4MOWA 1LNQA 4PLHA 5ENDA 5JAQA 3VPHA 2V6FA 4MP6A 3DDNA 2EJVA 2G5CA 4NQZA 4CMEC 2P5YA 5IAAA 1XQ6A 1ZMOA 2BFMA 2VOEA 4J91A 1XELA 3VVBA 4U0JA 1EE9A 5G0TA 1YJ8A 2PGLA 1ADGA 3UUWA 1U8XX 2I67A 3H6KA 2G17A 4XQEA 1EDOA 1UP7A 5TGDA 1HF3A 1E6UA 3BMNA 4R16A 4MVJM 4WCFC 4OKIA 2X9GA 1JAYA 4E4YA 3KYCB 1XKQA 3LT0A 4RDHA 4XR9A 3ZV5A 3PLNA 4FDAA 5TRTA 3KOUA 1WMBA 4WLOA 2Q46A 2X86A 4MKZA 4TRRA 3HSKA 4NH4A 1XLTA 3UGKA 4PLWA 1ZK4A 1GCOA 5JYDA 1ISIA 4BNGA 4CR8A 4DQVA 4F6CA 1YDEA 5TC4A 1QORA 3JQBA 4HFNA 2Z1MA 4CMGA 3PDJA 3TZKA 1NPTO 4BS9A 4CM8B 1WDKA 4ZRNA 4MVJA 3FCOA 1ZO8A 1JAXA 1DC5A 1OBFO 1HLPA 4MP3A 3ETEA 2PFGA 3EMKA 1BRMA 4CUZA 1NAHA 5HM8A 4BKQA 1B3BA 1H6BA 4NI5A 3OJOA 3RKRA 3NRCA 2Y1FA 4BKOA 5A4DA 5TF4A 5K6AA 1DBVO 4FGSA 1ISHA 1E3WA 4BO1A 1AUPA 1QXSA 1IYZA 1Z75A 1NVMB 3GA0A 2HK7A 2C20A 2VT2A 4DVJA 1KVRA 2D59A 4NK4A 3TL2A 4XEHA 1I24A 1ZFNA 2XXJA 2EW2A 1E3EA 1GD1O 4YBZA 1J0XO 1NX6A 1P9LA 1I10A 4R1TA 2FMUA 4R9SA 2H1SA 4WK6A 1DRUA 2OXIA 3ASUA 1P3DA 2WD7B 2FPPA 1K6XA 3L4BC 5JMPA 2BGMA 1M66A 3AI3A 5CFZA 5H83A 3WSWA 3P19A 1GY8A 3DOCA 5HTOA 3WNVA 1HSOA 5L7WA 3TRIA 2DPHA 3QVXA 5TJ9A 4B8WA 1RYDA 4OSPA 3CIFA 1DEHA 2PZLA 3EW7A 4B3IA 2A92A 3MJSA 3ZV4A 3FBTA 3RVDA 1VI2A 4IZIA 3BTUA 3ORFA 4EZBA 3KYBA 2GYYA 1R4MA 1BW9B 1A4IA 1P1KA 2POQX 4BNVA 1HKUA 5DF1A 1NQOA 2Q49A 4CQLA 4JNKA 1AE1A 3JV7A 2D3TA 2HMTA 4GX1A 1Q7CA 1DOHA 4B79A 2EIHA 2VN8A 3R3SA 4BKRA 2GUGA 3NYWA 1X7DA 4JP2A 3SC6A 3IC5A 3QVSA 1H6CA 1BVUA 2NU7A 3CMCO 2IEDA 3DAPA 5BSHA 4L74A 1R12A 1YONA 4QO8A 4B7CA 5JCJA 3ADPA 1EK6A 4EDFA 1I5RA 1A9YA 2J3HA 3HJAA 2C7GA 3P2OA 3GUCA 4R68A 1UZLA 3CZRA 1JVBA 4J4HA 1DC4A 1K2WA 9LDTA 1Y6JA 1Z7EA 2NNLD 4FGWA 3LT1A 3V1UA 1J49A 3MTGA 4UVHA 2LDBA 4DPKA 4RQUA 1V3VA 4U5QA 3T7CA 3K8ZA 5GMOA 1YQDA 1LLCA 1DRVA 1NNUA 2IZ0A 5ER6A 3OIGA 2Y93A 4D44A 4O5OA 4KOAA 4MDHA 5LDGA 4FFRA 3DFUA 4BNXA 2ZKLA 2NSDA 1LC3A 1ZK2A 1W4ZA 5G0UA 3Q2KA 4NG5A 3WYEA 2DTXA 1R15A 5L4LA 4LISA 4OXKA 5IFLA 3C8MA 2O48X 1WDLA 4IINA 3RWBA 1KVSA 5TJHA 4ND4A 2FN7A 3O8QB 1ENPA 4NU5A 1I2BA 1C3VA 3W6UA 4WLVA 2PD3A 5JS6A 1VSVA 3PP8A 2EGHA 2AQ8A 4YDRA 4CM5A 3DZFA 3GF4A 4MVJG 1NWCA 3PGJA 4BMVA 4FFPA 2VZ9A 1U1IA 2AEMA 4JBIA 5HBRA 2HU2A 1SC6A 4ITUA 1RM5A 2ZCVA 2NQTA 3GVPA 3AW9A 2O23A 4OXNA 4I1IA 3U0BA 3DWFA 1JKIA 4XX0A 1ZNQO 3SLKA 2Y05A 4B7XA 2AA3A 1T2CA 5JE8A 5I7EA 1NFFA 8ADHA 4RVDA 2QYTA 1NP3A 4DYDA 4DMMA 3DONA 3DTTA 4ZICA 5IDYA 4BNWA 3I9NA 1IY8A 2GERA 3CUKA 3C7DB 3LDHA 5JSFA 4BNZA 3ZWWA 3KHUA 4UULA 1MG5A 4BNMA 3PVZA 1S7CA 4GX0A 4M54A 5IJZA 1U5CA 4GAEA 1PZHA 3L0DA 3VAZA 1H9AA 1P1HA 1X0XA 4YQYA 5HRUA 3E9NA 1UR5A 3UW3A 1LLQA 1QV6A 4FD3A 5GY7A 4E2ZA 2OZPA 5JMWA 2AEFA 4HBGA 1JWBB 3D0OA 5L7YA 2R2GA 3TOXA 3I9LA 3LF1A 1XG5A 1X1TA 1YB4A 3H4VA 2NTVA 3RFXA 1CYDA 1B8VA 1EFKA 2I65A 5L4NA 1MGOA 1YQXA 1QYWA 2X5KO 1E1MA 3BMOB 3I83A 2DBQA 5TIIA 5DT9A 4UUNA 1JTVA 2VNSA 2HMVA 3CEAA 4IDFA 3JQDA 2X9NA 1E5QA 4GMFA 1EEHA 5U4QA 3L6DA 1A4UA 1PL6A 2PD6A 3GOHA 3B6ZA 3RKUA 3P2YA 1PGJA 1P31A 1KC3A 3JQ6A 4J7CA 2WYWA 2JFGA 4CQMD 3ZWPA 1G6KA 4XYBA 3HNPA 1Z6ZA 1IULA 1YB1A 1V8BA 1P1FA 3KXDA 3A4VA 3FSRA 3WJAA 1ADBA 3W8FA 3ITKA 4H15A 4PG5A 4EUFA 5MDHA 5B1YA 4LCEA 2IYPA 3DOJA 3RI3A 2AQHA 5BNFA 2YDYA 4DPLA 1JLLA 1SCUA 2J5KA 1Q7GA 2BELA 3TN7A 2Q1UA 4FFMA 5AYVA 2IZ1A 1ZW1A 5KJ1A 5T8KA 2D2IA 4I5DA 1VJ1A 1L1FA 1F17A 3BA1A 4GX2A 4KMSA 4XB2A 4LMPA 1A27A 6LDHA 5KVSA 5L3ZA 3FNFA 1A71A 2OGUA 5JO9A 3ZWXA 4ALJA 1ISMA 2C29D 2XPCA 1SBYA 3MTJA 1UP4A 2W2KB 3ADOA 3KRTA 2QX7A 3X2FA 1VLLA 1MFZA 3ICCA 2UV8A 5A1TA 1GFSA 4BO7A 1T1RA 5AXBA 1CJCA 5JY6A 1ZK1A 3JYQA 3KTDA 2X23A 1PWXA 2JCXA 5GZ6A 4BGEA 4R3NA 3R1IA 1BDMA 4Y6SA 2CDCA 3K2EA 3GC6A 4J49A 4A0SA 2J8ZA 1W8DA 4JLWA 2Q3EA 2NVBA 3MJTA 3MJ4A 1EE2A 2Y67A 3OM9A 3AY6A 4XIYA 4MPDA 5CG1A 3VH2A 3RCBA 3JTMA 4MVJP 3C7CB 4PCVA 3K9QO 1M75A 3GG2A 5COAA 3DAFA 2BLLA 3C3XA 5A05A 4ZJUA 4CL8A 1OMOA 5DBGA 3LZ6A 4ZQEA 4F6LA 3P5SA 4G2NA 4Q3CA 2VT3A 3JQBC 3S1LA 3LYLA 4FOSA 4OL9A 3OECA 1T1SA 3IP3A 1UZNA 5TT1A 5EQDA 3ZWOA 3GNTA 3DR3A 3TQHA 3V1YA 4J2OA 4BIIA 4WLNA 4MVJF 2EKLA 1KEPA 4MKRA 1UXJA 3EHEA 4LW8A 5DBFA 1PS0A 4PG6A 3GT0A 3WTCA 1HWYA 1UDAA 2FZEA 1T2FA 1NFQA 3MJEA 1LUAA 1E3LA 3ZNPA 2VZ8A 4E5NA 2UVDA 2E48A 2YW9A 3D7LA 2IYOA 3M1AA 4E12A 5A03A 2X22A 2DFVA 1ZIDA 1ZXLA 4KDEA 4CMCA 5BQFA 5BSEA 2HK9A 4OHUA 1GUFA 1V3UA 3FNGA 2CD9A 4E32A 3QV1A 3HE3A 1R4NA 3EVTA 3WLEA 3GMSA 1JN0A 4R4JA 5GZ3A 3WMWA 1YXMA
chains in the Genus database with same CATH superfamily
4K9QA 1C3OB 1RPNA 2YKGA 1NBMD 1P7VA 2GBFA 2Q50A 4KUHA 1QH1B 5FLXA 1R0LA 3O2JA 3QE3A 4BFLA 2V0NA 4Z99A 1X7XA 3EARA 1UL1X 4EB3A 4L3OA 1S9HA 3IT0A 3SC3A 1TO6A 3VGPA 2E1RA 5E8JA 1P91A 4OK6A 2E89A 2XY4A 3OUZA 3UMBA 5CPBA 2Z4TA 3SEZA 2IU6A 1PJZA 2EXXA 3RJMA 1AKMA 3E61A 3L8DA 2RFLA 5K3DA 3NIWA 2CUTA 1H9BA 4A9AA 1Z36A 4C2TA 1VI6A 1CZUA 3Q9UA 4HDMB 4UTRA 3CVWA 1CUDA 4R2MA 1UANA 5HCNA 4IUYA 1L7RA 3SM3A 7ABPA 1Y7HA 4I5FA 1RLJA 2Y0CA 3OLVA 1XMVA 4UDOA 3WO1A 2XGJA 1KYTA 2IYLD 5J4HA 2A78A 4TXHA 4EELA 1XC7A 5AKZA 5JFGA 1XEXB 1ZCFA 3ABOB 3H87A 1N3IA 3SMQA 3GLUA 2MSCB 3W5IA 1U2PA 2QM3A 1N33B 4ZQFA 2GPJA 5HUJA 5FORA 4NZMA 1N5DA 2BJHA 2P4QA 1HG1A 1WCV1 4RENA 3C3CA 5AKIA 1T8SA 4FDLA 4F71A 4PONA 4O33A 3HG7A 2PX5A 1M10A 5B2ZA 5UKDA 3W7AA 4DJDC 1JSCA 3DDWA 1MVNA 1M74A 1G0OA 1MDBA 2J3KA 4X92A 2EZ4A 2LXNA 1NKSA 3WYCA 2HWXA 4JI6B 2CB9A 4G9BA 3TI9A 4DRXB 5BSFA 5CXUA 2G0TA 3H0EA 1U2SA 1NLUA 2V7WA 1IVYA 5DCWA 3FWKA 1ZVVA 4UVEA 2VZLA 5EMMA 4WSOA 1SEPA 3B5JA 4U2DA 3V1TC 1NJ6A 5AFSA 1MHPA 3ZBUA 1K0UA 4EHNA 1ZR2A 2YUIA 3QVWA 2R8RA 1KOLA 3JR7A 1E18A 1Q1BA 1Z6AA 1W5EA 2VUSA 2NACA 3KTAA 4IV5A 1UQUA 4KHZA 2BE9A 4OHFA 4ZQCB 3TUJC 3CF2A 2C2OA 4US2R 1JGTA 1V25A 3QZUA 4BHTA 1IZ9A 1IJFA 1E9FA 3SY8A 5A06A 2HWYA 3PLRA 1QC5B 4KO2S 2D7CA 1RVV1 4AL4A 3V55A 5HKKD 3BILA 4FKBA 1J8QA 2WIKA 4RD4A 4DLSA 1FLVA 2FN9A 3HN2A 3IOEA 4TLDA 1VL2A 2J1LA 3KELA 4L16A 4QRIA 2RIRA 3WP0A 3WQQA 3WIUA 3KSMA 1CPYA 2GHRA 3EVGA 4JXJA 5TV2A 2PZMA 4N9WA 4QYIB 4URUR 2K7ZA 3HP1A 1P2VA 3H05A 4IRXA 1N7GA 5ALWA 3CGWA 1W5AA 4FB4A 3PI7A 4BMDA 1NHGA 1I13A 5LQRA 2VF4X 4NFHA 4Z2YA 4K0KB 4IVRA 1X39A 4OATA 4JEHA 1PYDA 5L3QB 4JYZA 3WZMA 3JYNA 5E7QA 1L0BA 4UVGA 4Z51A 2VK2A 3DGEC 3WWZA 1UBNA 4WCFB 1TUIA 4GMDA 3GLGB 1OZFA 3KT6A 3HKBA 1UJMA 1R0CA 2I4OA 2OVFA 1EESA 1RYFA 1SUFA 1TQDA 3LDAA 2R1TA 1TAGA 1GPJA 1W48A 3HUFA 4RORA 4YIHA 2GASA 4Z9AA 1UMKA 1TLTA 3DE2X 1ESNA 4DCTA 2OP1A 3AX6A 3F2VA 2IUYA 3M8KA 1WRBA 2V7PA 2Y1KA 2VRBA 4YRQA 3VU1A 2NU6B 5BN3B 4YY3B 1EINA 1WDWB 3D5QA 3FHCB 3R9XB 1WW8A 2P4UA 4PZAA 3W4IA 2C99A 2IDJA 3IHTA 2VPQA 3DEYX 2FX3A 2PJDA 3NIGB 4TLCA 3AEQB 3LCJA 4RQBA 1K5GA 1YU6A 2VJAA 3LC0A 3WFZA 3HDYA 2O1WA 4U2FA 5ALLA 2D1YA 3IAFA 3RSZA 5CXXA 2PL3A 4A3SA 4FBMA 1RXSA 1A7KA 1I0IA 1I30A 3WY9A 3C3WA 3IBSA 2IOFA 2O1XA 1ISSA 3BJMA 1BKSB 4J1SA 1F0PA 1W4BA 2P35A 2YQ5A 4CMIB 4ARIA 2C9MA 4UHEA 1ZR4A 1I2DA 3HXTA 4YB8A 2WM8A 3NOVA 2FSIA 4C87A 1GYPA 4CN9A 3SR0A 1E2HA 1NYQA 2GO1A 4IFIA 2NPFA 3X2SA 2AMYA 2R87A 2QDXA 2EWMA 4PBTA 1KHHA 2D2FA 4HAXA 3HVUA 1FTYA 3NKLA 4K87A 4J7AA 4DCNA 1C1HA 2C4NA 1VOTA 2IYVA 3EDMA 2IEAA 3OQ6A 3KZMA 4B71A 3EXFB 1N2ZA 4FFVA 1JEYB 4P3PA 2WKRA 2ZROA 2CSXA 2Y27A 3NDIA 3CSUA 3A6JA 3G6WA 5BOSB 1VC2A 4NESA 1Z4IA 4IZHA 4R84A 4AQ7A 4F96A 2J5RA 1LPNA 5KOJB 1SKQA 4LVCA 2QD5A 2GCNA 2P4SA 3PB3A 4HXEB 5KJFA 3QPVA 1IUKA 3O8RA 1H2BA 2WPDA 3HUTA 4RJ2A 4BX8A 2Z83A 1TMGE 2H9YA 5CU7A 2OUIA 2C9DA 2X0DA 1F0NA 4MJ3A 5JPIA 2FTKE 1V1RB 1AC5A 1LX7A 2Q3JA 4KBGA 3ZWKA 1KTVA 3HU1A 3EIEA 5JU6A 1L5OA 3U7JA 4D4MA 3CUEF 4CCAA 4GE0A 1PQWA 4KPEC 4V1CA 2RHMA 1J21A 5PGMA 2L2QA 4X6YA 1MJGM 1Y9ZA 1VQ1A 1SHTX 4K9RA 1VSTA 4O1MA 3T7TA 4B40A 4NBNA 3S8YA 3KAKA 4QZVA 1CR6A 3H3FA 3IILA 1SKBA 1ABFA 1TEZA 4JSYA 5H3LA 4B6JA 5CA1A 2I03A 3U4DA 5L53A 2IHNA 1OAOC 3OX1A 3M2PA 3OZGA 4YJGB 3IQEA 1F8FA 4B74A 3ETNA 5EHZA 1I51A 1EM8A 3DL4A 5K0CA 3KPUA 3O83A 3ZWNA 3DQQA 1E58A 2ZT5A 3C3AA 4NDZA 1S6YA 3HKDB 4F12A 4GZMA 1KJIA 1ZGAA 3FKQA 1SOVA 3CLUD 1X94A 1T4GA 3LBAA 1N5KA 4KQEA 4OOFA 3MPOA 4EEZA 2G06A 3ORYA 2HLDA 3O3CA 4X97A 4XPZA 3TLZA 1PQYA 2AFHE 4HF7A 1JDPA 3DXZA 4IJVA 3BIOA 3CSSA 1MJFA 3BJEA 4ERXA 1U9CA 1YJBA 1Y3BE 4BMYA 2GCEA 3D3EA 1NA5A 2C1ZA 2R6ZA 1OYYA 2O14A 1ORTA 2FQQA 2WE7A 2WUDA 1FPQA 1Y7PA 2ZTLA 1XMOB 4UUPA 5B3JA 1FDOA 3EW9A 2IZ5A 2JS7A 3W5UA 2ATXA 3LUHA 4KKVA 1KQ3A 1JHDA 4LIPD 3AVYA 3H18A 4O8ZA 1IN7A 4XCQA 2EF0A 4YXWA 1P2TA 1KOFA 2H1HA 4P7GA 2VH1A 4U8HA 3TQQA 1LS1A 3RW9A 4LKRA 3TG2A 3CVVA 1UDWA 1Z0ZA 2H29A 1Z8FA 3A6KA 5B3AA 2IV7A 4LK3A 3THSA 5AICA 3LQQA 5D85A 3IDQA 5E9JA 2OXTA 4EO4A 1QM5A 3QVGB 2NO5A 3I37X 5KYKA 1KYXA 4OEHA 2P9CA 2AG5A 3IA7A 2DLCX 2AD5A 1XF1A 3KYDA 1O96B 3SFTA 1EE1A 1JH9A 1UOEA 2GM5A 1C9YA 2QMHA 3G8YA 4ZV4A 1AHPA 3ZU6A 4CUKA 3V8PA 4DM3A 5JNUA 1ULZA 1YI0A 1V4VA 3K96A 4AX8A 2C8VA 2VHJA 3AB7A 4J3FA 1JQEA 1W35A 4HTAA 4LXUA 1A3CA 3L8EA 1JKFA 4M1QA 1PLJA 4MV1A 5I7HA 3HL4A 1QHHA 1T36B 1U2QA 4M38A 3KG2A 3QUQA 4OMFG 3MC1A 3SZUA 1LTQA 1R9MA 3GCDA 5KVQA 4J3NA 3OKAA 1UMDA 1GADO 2REXB 4KFSA 5C4IA 3NDJA 3ER6A 2P9TA 2QLFA 4MRAA 1DV1A 1UBUS 3BOSA 4OF4A 3RC7A 4NABA 1VMEA 2CLKB 4GKAA 4B2LA 3OTWA 3G8DA 3WK7A 5HSGA 5K0FA 4IDNA 3K9HA 3RARA 1J0EA 2HD4A 4OL0A 4B33A 1W2GA 4YVFA 5ERYA 1DJQA 1I01A 4JLUA 2FWPA 4YJHB 3VKWA 1R4ZA 4E1BA 5AKXA 2HQOA 3ZW8A 1BIFA 3E9QA 5PNTA 4D8WA 3PXXA 4QUBA 2G4VA 3PQ7A 3R0IA 5J58A 3CRW1 3OOWA 4EJ0A 4Z9FA 2G5PA 1PK7A 5DLEA 5E4TA 3T41A 2PUWA 1T29A 2X42A 4WBNF 1U28A 4KX3A 3W2IA 2BONA 1V48A 4GQAA 3MTBA 2ZSFA 1Q83A 1P3Y1 1H8HA 3IBTA 3PZBA 5DX1A 3TE6A 1GPBA 1YA8A 5CDTA 1NULA 4GI2A 1VCNA 1HZZA 3OJEA 3VPFA 2CNWD 5CHYA 4JI2B 2IE8A 5LBTA 2ZYVX 2OD7A 2HRRA 3DEZA 5EHGA 3AR6A 4TVOA 3OEWA 4L22A 4D98A 4E7PA 1MFPA 2I2WA 2IEIA 2LR0A 1BXGB 1N5LA 4UHDA 2FRDA 3VBEA 1JA1A 1XTKA 2HSJA 5AUNB 1KOJA 4XX1A 1SKYB 1YZNA 2FPGA 3ZWMA 1EFPB 3PK0A 2H6EA 4IDHA 4XGQA 1T0UA 1G98A 1RQ7A 4U7PB 4AJLA 2F1IA 2GBGA 3IL2A 2VHZA 1V7ZA 5F51A 1KPHA 1EPUA 2PRYA 5C1OA 3SQNA 3ZYZA 4C6TB 1OI2A 1WLYA 1ZIYA 1XZFA 4MQLA 5FAXA 5I7OA 4CM4B 2A30A 1KU6A 2OBFA 3NHZA 5ITSA 1GUYA 2FMKA 3LX8A 4CV0A 1JXQA 4M37A 3DE4X 5HIIA 1AA6A 1R5BA 1PEDA 1IVSA 2AR7A 4RFLA 4UXIA 1V1JA 1M6VA 3I01A 4XTRA 5CVVA 3EZ6A 4M9QA 3ZQJA 8ABPA 3ZBTA 4QDJA 4AULA 2JLVA 1WF6A 3LUFA 1P2DA 4IDAA 4H6VA 3MD9A 2PX3A 3SS7X 2ZATA 1PFQA 4CYMA 4R2KA 3ESXA 1Y8AA 3R0VA 3HCCA 5CVDA 4BEJA 3BIXA 2GWRA 3VJRA 3OUUA 5IMSA 4CR6A 2AEJA 2PX4A 4PQFA 4RF2A 1GGHA 5D3KA 5IULC 1F1BA 1DU4A 2YNMC 2PGIA 3IMCA 3H04A 4QRDA 5M2QA 1DKQA 1YZYA 4ZI7A 4EUSA 4P38A 3GLIB 1GDDA 3C7TA 1OI7A 1U7WA 2DLDA 2O20A 3C5VA 2C5LA 4WOJA 2ZIAA 3GRZA 2GQ0A 2NXCA 2YC4C 1X7WB 5IDQA 1Q15A 4MB6A 4UU1A 5DSXA 3BTOA 4AJNA 4QECA 5GAJA 5J4VA 4X85A 4KSCA 3HZHA 1ZRSA 3BK1A 4NMMA 4XVQA 2YQ4A 3HPRA 2YOHA 3MF4A 3RYIB 4KDFA 3CRNA 3G7SA 3I9FA 4HH4A 4S0ZA 3W2TA 2HYIC 2XYPA 3PQEA 1B7GO 1QG0A 5DM1A 4FEYA 1VHLA 2XKBA 1JR3D 3FPLA 4RK5A 4ZJPA 1IHYA 1WPRA 4F7DA 5U9CA 5FUXA 4IIDA 2FI1A 2L42A 1WZUA 3AK4A 3HYRA 3ZHBA 3AFOA 3AHCA 1THZA 1G4UR 5B1DA 4YAIA 5FWYA 3HCAA 4J0FA 1OVMA 3GDHA 1B76A 1QAMA 2VJKA 2OEPA 2HSZA 2JHGA 3MSCA 4HAUA 4DVGA 1Z7BA 3MWDB 4BNNA 2H2GA 1N6RA 2JAHA 4MCJA 1TJ3A 4QHTA 4GLBA 1BDJA 1REQB 1RPAA 2CMFA 2H8GA 3LQRA 2IGTA 4N7RA 2E85A 5BP7A 1RMQA 3V1NA 3BZBA 3IS3A 3O2SB 3UB2A 3SKXA 3R3ZA 4TQGA 2C94A 2ZU0C 2VTDA 1I1OA 2WTAA 3QW4B 3T1VA 1Z7GA 4HRAA 1JFVA 2Q8QA 2YL2A 1QGUA 3JD4A 3CUWA 1T9GR 1SBTA 3AV3A 1DKMA 5DHRA 3DOIA 5FUQA 2QTRA 4DSZA 1O94C 3D7MA 3OBIA 4E09A 3KU4A 1GTRA 3WNZA 1PD1A 3GDOA 4FS8A 4M9XA 2NXWA 3CN7A 3T5GA 3EPHA 1BE1A 3CRVA 3A3NA 3E03A 4R6WA 1IQ0A 5GWXA 4BNJA 3T34A 5HR5A 4CMKA 3GB9A 2DFKB 2G80A 2EDAA 5JH7A 4JCCA 3QWAA 2X0EA 3DHEA 4R05A 3OE4A 1M2KA 2B25A 3NXSA 4KIGA 2B8NA 3B9BA 4HWKA 4DLAA 1X92A 4MYCA 2NZVG 4UQLA 2EZ9A 5BSWA 1XO1A 3A58B 2NYRA 4D9FA 4URFA 1WM1A 2ZRNA 3NIFB 4M4SA 2XGMA 4V3BA 2B99A 4PNEA 1QE5A 2XTZA 5BV8A 1NFRA 4JFRA 2QRUA 1DC7A 1DKOA 3KR2A 4W9RA 1EAYA 3R7FA 2Q3FA 3IDAA 2HREA 1RJ9B 3ZN2A 4AUNA 4F5YA 4QKQA 4OHVA 1VE6A 2QW0X 2P6OA 3UY4A 3OJLA 3BL5A 4QDOA 4HGYA 4Q9NA 4Z53A 1OR8A 2UYQA 3UKJA 3CT4A 4GZLA 1JB9A 2BHLA 4F0JA 4PICA 2BF4A 3IVCA 1HDGO 4N47A 2VWPA 1MTZA 2DSNA 3FDIA 5KNDD 1U0EA 2PD4A 2VXBA 1GQRA 2XEDA 3A9UA 3B3GA 1PX0A 3DLAA 3E1SA 2H52A 1HDRA 2XDAA 2PIAA 3DUWA 4FMDB 3FCAA 4NU8X 1TXGA 2PVCA 2EERA 2JJ8A 4FUTA 4B83A 4D6PA 3IP1A 3ZH9B 3J80A 1U3UA 2P3LA 5TSDA 5K45A 4HFRA 1C8LA 1HE2A 3W5SA 3P4UA 3W8NA 5EZ6B 2ZBUA 2WF6A 3R76A 2AQKA 4P7FA 3S2UA 2WQZA 4Q03A 2W2MA 2QRQA 3I28A 1JHUA 1LPAB 1PIWA 1Y63A 3ZK9A 3R2JA 1QWSA 3G49A 4ZK2A 1FQOA 1IPHA 1VECA 1YZUA 2VL7A 2TRSB 3EC2A 5EKTA 5BT9A 4QG3A 4O08A 2BCJQ 4IEEA 1EAMA 3IDFA 1I7SB 1V3TA 2DHEA 1IUNA 2LVBA 4ARCA 5ALZA 3UO8B 5LBIA 2F59A 3KYIB 4XUGB 4V0ME 1D07A 2XWPA 1WQ4A 4RTKA 1DADA 2OHIA 1R4MB 3B53X 4Z0TA 2B1RA 1I3OA 5JPCA 1KP3A 1I3LA 4PHTA 4YH1A 1JI3A 1NPYA 4OQLA 2IUTA 4KZPA 1EQAA 5JDCA 2RK3A 5JOQA 2YC2C 5HGXA 4RQTA 1E32A 1PW7A 2A88A 2GK3A 3COVA 1GRVA 2CHUA 2H48A 3WRXA 4L57A 1Z0JA 4DNQA 4R3WA 1FX0B 3GFFA 5FOVA 4JN6B 2COKA 4RS3A 5BYJA 1W87A 3O4GA 4LSZA 2CNLA 4N40A 4WXYB 4WZAE 2HBZA 2Y1EA 4OYYA 3V4VB 2GTIA 3C4VA 4K6MA 5IAOA 4AECA 4ZVSA 2AKAB 2C1XA 4B8ZA 1IM5A 4CM9A 3C3JA 4CGYA 1AURA 3HQ4O 2XCLA 2A9FA 4OJQA 4A5OA 2GA8A 2QY6A 3FF1A 2AFIE 1FP4A 1JQ5A 1YVUA 4G4IA 1OAKA 4DARA 3HA7A 3SQXA 2E0IA 4WKOA 1XZGA 3FVRA 2GRJA 4JC0A 1Y8RA 3OU6A 5GADl 3WA7A 2VWGA 2CYAA 3EEFA 3EQZA 4GXNA 4QTTB 2RB4A 2C92A 4RVNA 4M0LA 4PSAA 1PR9A 2HHAA 1EHYA 1A9OA 3FTNA 4XW2A 4JB8A 1ZX1A 2ZR7A 5HYVA 4JJFA 1JIVA 2PR2A 3FUUA 1HTBA 1FYEA 3LBNA 4MGEA 3I5XA 3KEGA 3JW8A 5C2JB 2OAGA 1GR0A 1ZNXA 3AESB 1L4KA 3OLQA 3I6MA 2GAJA 1C7RA 4KJZA 1J1ZA 2H2AA 5DGIA 4BGVA 4FHEA 3QYJA 1H93A 3PFWO 5JI2E 3MVEA 5C1DA 4WZBE 2RAFA 3B3QA 3K7EA 3KU1A 3U3KA 3CV3A 3D6UA 4JY7A 4HNAA 4FWTA 5HOQA 2IOYA 2IZ6A 2OVBA 4GI5A 3ZGXA 5DB4A 1WETA 4H0CA 3RE1A 4DV2B 2DQ4A 2C84A 2ZRBA 1NSYA 1UMBB 4UFPA 1EWQA 1MAAA 3N1UA 1IHPA 2CLCX 3VO2A 3KFXA 1D2GA 1E0DA 5GOTA 2ISCA 3AIMA 2GNOA 3KBBA 3COWA 4G1EB 1LJ8A 5C5DA 4TKVB 3LVBA 4N18A 3UH0A 4ATNA 4BP9A 4EQZA 1PNRA 3HTXA 3G13A 2B34A 2R8YA 2QD3A 4M88A 4RY2A 2IYNA 3DBLA 3TGWA 1W94A 1UM8A 4OO3A 3NTLA 4HQ6A 1TW3A 1IPFA 2J48A 3DV2A 4GVLA 4TZ6A 5JS8A 1QTNA 1Y4DE 2QIPA 2W11A 3EE6A 1C80A 3AR3A 3IPCA 2QSZA 1JKJA 3L7CA 2XD4A 5K3AA 1I7DA 3KR1A 3O47A 4WNYA 2VYVD 5ILGA 3VC2A 3Q8WA 4A2QA 2ZWMA 1Y7LA 3O8CA 4XWGA 4XEUA 3UWKA 1WCYA 2XUFA 1I8TA 2PL9A 2A7XA 1MO2A 2AD1A 1GN9A 1NXPA 2JIRA 3WK8A 4EYQA 4URZR 5FV4A 4BTVA 4TVKA 2J9XB 3JPYA 3V7UA 2E5LB 3D7KA 2WWRA 1GNTA 2LUOA 3AF1A 4HLNA 5DBHX 2OA0A 4XDGA 1UJNA 4PYLA 1RHRA 3FKJA 2FZWA 2JLWA 4BB9A 1AKUA 1D1TA 1QJCA 2ZDQA 4WKPA 4EA6A 3PQFA 2E9SA 3ROPA 1QGED 4J0CA 1PQPA 1YFKA 3E8MA 3VPGA 4X93A 3RS2A 4JGIA 2CGEA 5T4EA 2RGDA 3N59A 1N2HA 2VPWA 3UAGA 5KTKA 3VR4A 4CDMA 1TA4A 3CPSA 2I8AA 2V7GA 3PRYA 4W5WA 5AOCA 1D1SA 1KNXA 2P40A 1PT5A 2YFKA 2WJIA 4LVOA 5BUSA 3EYWA 2H51A 3E4DA 3BWBA 3EJWA 3JTEA 2AN1A 1QUFA 2EFJA 1YHZA 2QV7A 3AR4A 4DYHA 3GLVA 4TV9B 4FFDA 5LR6A 3PPIA 4OA8A 3H2BA 4EM6A 3C6YA 5A4FS 4WNCA 2F43B 3WNBA 4B6OA 4IL5A 4EY3A 1N6LA 3FZQA 1DIRA 4QGFA 3IOBA 3UM9A 1E5TA 4HTFB 4CEIA 5L8VA 3GARA 5GJWC 4PG4A 5NLLA 4LQLA 1RYZA 3VDRA 1XYVA 2AG6A 1N5RA 3BXHA 1JFSA 4TVSA 5HE8A 4GVPA 5CEFA 1QUEA 5C7YA 5CCBA 2YWGA 2QNBA 5LL6P 5D7BA 3K4PA 2PWBA 2ID7A 1MUUA 2R5FA 1H2AS 4AYWA 1FJXA 2VTEA 1IBSA 4JYBA 4OB7A 2IU0A 2BDUA 3TNFA 4R9VA 3S0JA 4YLGA 1TB4A 4G25A 3WWDA 2C1EA 4DHWA 1SD5A 3QFHA 3GQVA 1YJQA 2I0FA 3QUSA 3L77A 4KQ9A 4AF7A 3WWOA 2JK1A 2IX9A 3B3FA 1KK1A 4P53A 3VR2D 2I6SA 5EHNA 2NP7A 2V6MA 4JLSA 4FZ5A 4IDDA 1D1PA 2AJ8A 2NSLA 5CDSA 3MXOA 4ZMSA 4G0MA 3GBVA 3QQPA 1MJ5A 4DDMA 1NX9A 3NJ8A 3PR2B 4MGKR 5IASA 4OV6B 4PHGA 4EFDA 1GGMA 4DXAA 4GR9A 4K28A 1XVVA 2D7JA 1J8DA 3OSUA 2P9ZA 2GKSA 3GCZA 2FHPA 1Z3IX 1NQAO 3G5AA 3MTQA 1OFHA 1Y34E 4UCQA 2VSYA 3GCWA 1Z35A 4LYAA 1FMCA 2ORIA 5K4GA 2CUZA 4ID3A 4CV3A 5BMVB 4F91B 3LWBA 5F7JA 2AMJA 3WOVA 4B17A 3RD5A 3OM0A 2J07A 4RZHA 3FPBA 3EZ7A 1OT3A 4MVCA 4Q15A 4UHCA 4ECEA 5KWJA 4UBKA 4DT1B 1IN8A 3A6EA 4FXOA 3UHAA 1MF7A 4OBEA 1TQ4A 5IS2A 1RP7A 1X1RA 2SKDA 1CW2B 1FF9A 3OPYI 4WFKA 4PPFA 3RABA 2X14A 3MINA 3PHHA 3GAZA 3NTVA 3PCRB 4EZEA 2ASVA 3C43A 1T8WA 4R1SA 1XNRB 1EP2B 3Q8KA 3BFJA 3CN9A 1VG0B 1RIFA 5KX5A 4QM7A 1LRKA 1OV6A 3HXMA 3HU3A 1KWGA 4QFCA 1T4CB 3M0EA 3O3MB 3PNLA 3IFSA 4XKJA 3O4VA 5K0LA 2HRZA 1AQJA 4AN4A 2O19A 1V8FA 1HE1C 2XE6A 2ZSDA 1CZNA 4A36A 1E7QA 2HZBA 3GW8A 1EX1A 3KWLA 3RC3A 4YCDA 1A9PA 4FFBB 8ATCA 2XYHA 4ZXFA 4FGJA 1J09A 3QFCA 1XMXA 1W4CA 2CLHB 3M81A 3KSAC 5JQWA 2FW0A 4R1OA 4CQMB 2G9ZA 1QO0D 4NOKA 2CXUA 1VPEA 4X5OA 3DVAA 2H07A 5D2CA 1EJBA 5DM60 4EPTA 3HEAA 4IXDA 3QYAA 5K8IA 1VM6A 1UBHS 1YCDA 2PZJA 2YWCA 3TQRA 3W2FA 1Y8ZA 3A2LA 1FSSA 1QYIA 3H19A 5HMLA 1TM3E 1AKQA 1YZFA 5FBKA 5LB2A 4GPBA 4PZCA 2EGGA 3H8JA 1UKCA 2Q5EA 2YIVX 3TW8B 3K70B 3ISJA 5IF3A 3ZU4A 1Z5WA 1XD2A 1NHWA 2V1UA 3QPCA 1E9AA 4QHYA 3GEIA 3W5HA 1NUQA 1LBEA 2ZR0A 4NCAA 5ALUA 5C53B 2XF8A 1ISFA 1QZUA 1PDWA 2JCSA 3B51X 2IYQA 3D2BA 4CV2A 3AY0A 4MSUA 3WGZA 5EESA 1IMJA 2VJMA 1GRCA 3P9KA 1KK3A 4M0MA 2QSYA 4NSNA 3HKCA 4QLAA 4BMOB 4ZC8A 3HI4A 4Z49A 1LVGA 2VHUA 3FETA 4PLFA 1RCFA 3SICE 1Z07A 1PR4A 2H1RA 2UVPB 4G8JA 3WGVA 1RHKA 4URHA 5JSYA 5EKUA 4RIIA 1BKYA 4WKGA 1CCWA 1SIUA 4Q39A 4IQ8A 1K5HA 3HU5A 5HQJA 4EMTA 3LWZA 2ANCA 1UXGA 4HS9A 3LLVA 1NVBA 3O03A 2E18A 3Q3EA 4TRNA 3SIRA 2BEKA 3K16A 1J7JA 4WY5A 1TM4E 2O3RA 1TK3A 2XQFA 1Q11A 1P5ZB 1JHAA 1W93A 4UVDA 1KE2A 1IEXA 2B1JA 3T7SA 1UXKA 3BHNA 1YMUA 1DMRA 1NVFA 4WXHA 3MGKA 5DGHA 3QITA 4QSMA 2FOIA 2XAAA 3FLAA 4EGSA 2CJFA 2C3UA 2R4UA 3VHXA 3TECE 3KR0A 2AUNA 2E49A 1QHIA 4DZRA 2FV8A 1Q3TA 1TCBA 1GUAA 1GZSA 2DZDA 5TQ2B 3N9IA 1CJBA 4B3MB 4YGXB 3U3ZA 3TFOA 3ZQ4A 3VX3A 4PZUA 4UHJA 3DFIA 1YS7A 4PSUA 4D25A 1HNXB 3DD5A 1YBHA 4EKGA 4ER6A 1Z6GA 5AMXA 1WHSA 3AFNA 1N2XA 3ZUGA 4NNOA 2GSDA 2FKAA 4BAZA 1GILA 1M1UA 1NY5A 4GG1A 5FHRA 2QDKA 10MHA 1NURA 3NEYA 3OZEA 3Q7PA 3I12A 1DXQA 5ECWA 2YZNA 3QMVA 4FSHA 4QUAA 3WZ2A 4LFAB 3MJCA 1Y7TA 4G41A 3K1TA 3U31A 1PGNA 5IXJA 1NE2A 2XQVA 3DDOA 3EPPA 4PAWA 1G5FA 1LS6A 2Q4OA 5BQXA 4RMJA 2CWDA 1E2EA 2CHFA 3KO8A 4LOAA 1KEUA 4DR5B 3N8IA 1WG8A 3SM9A 2PA0A 3RTEA 3O1HB 1VPDA 1FPMA 2YDXA 3EWNA 3OAAA 5JFOA 1TOAA 4R9UC 3AM5A 5FAKA 1PT6A 5SY9A 3B1VA 1A72A 3H8WA 3E3AA 4JLAA 4RCVA 4ZHQB 5GONA 3P1JA 1QK4A 3TLYA 1TYDE 1TZBA 3TLGB 3AKYA 2JI9A 4FKZA 4ZVNA 1J9ZA 1V45E 3M4NA 3A2NA 4LZAA 4MI3A 4LHEA 2M6LA 5AKHA 1A9QA 3CRMA 3EB9A 2IPLA 3JZAA 5FUYA 4ED9A 5CFOA 5K05A 3HBMA 1X86B 1XRJA 3DWIA 3DOHA 2LRHA 2XR1A 4M2LA 5J9FA 4U3JA 5F4ZA 3W5BA 2XECA 2QLNA 2CFSA 3V1KA 1HYBA 4WESA 4BLRA 2PUBA 1JJAA 1WOYA 3Q3CA 5BSVA 3UV7A 1MBZA 1KQPA 5T3YA 4ZCRA 4JROA 4OG2A 5JXJA 4UHBA 2FFAA 1P6QA 4JBHA 2D5AA 3FW1A 2PTHA 1WMSA 4HN2A 1F7UA 1F2DA 4Q1BA 1JU9A 1KH2A 1O95D 1YB5A 2ACVA 4TKUA 3EMDA 5FTKA 3U6KA 4YAJA 1XALA 2FZGA 3JYHA 4GLFA 4WDRA 3V32A 1T4DA 4DNPA 4F9TA 4V24A 4K7JA 3DBRB 3WR5A 4NF2A 4YJ3B 4E31A 4CKCB 2J45A 1R0WA 2YWFA 4GYKA 2VJNA 3TOSA 1VIAA 3SP1A 1Z2DA 2I7CA 3H2SA 3SXPA 3BQ9A 5KWIA 3KNZA 1SWVA 1YU9A 2MOKA 4NKRA 2NWQA 3M7IA 4YP7A 2WD8A 1IZ8A 1XP5A 3ODGA 4EITA 3CX4A 1VL1A 2V4ZA 3FTQA 1QF6A 4ENRA 5C8VA 2YJ5A 2PX8A 4M9ZA 5A6VA 2D13A 2IHKA 3KQUA 2XLCA 1ZOLA 1M34A 4U7TB 1ZWLA 2GPTA 4IDGA 4NDAA 3W77A 2W00A 5CLIA 4D7AA 3CTPA 2VDPB 5IUKC 3AG6A 3NVAA 5JDIC 4MROA 1EGHA 1RJEA 3NUZA 2QW1A 3OT4A 1RR6A 2NG1A 2QN3A 1U7UA 3WOHA 3BMOA 3Q85A 2ATCA 1CRZA 1A9SA 4WNAB 4LRYA 3HYCA 1L5FA 3Q41A 4HDAA 2O0MA 2DJ5A 3M3DA 5JWRA 3R75A 1MRSA 3DBVO 1CNEA 5COBA 2O2YA 1Z4QA 1OY1A 2CW5A 1JIKA 4HVCA 2QI9C 5JXGA 4LYYA 4XM1A 2AN4A 3FYUB 2NUPB 2JH8A 3FSGA 2I22A 2I29A 1EK5A 2GF2A 4RSGA 4Y0AA 4Z86A 4GOOD 2FP4A 2NYVA 3CE9A 3BH6A 4WGFA 3C3DA 5F1PA 3GH1A 3L07A 1U2DA 1ZH8A 1I4LD 3B1JA 5BYAA 2RKWA 4CDGA 2RHWA 2MSKA 4L8YA 4RY9A 1SXQA 4Q4LA 2ID8A 2YIMA 2J6BA 4GX5A 4LE2A 5A5DA 2YWXA 4IEFB 1AUVA 4LG1A 2RH8A 1NPDA 1Z0KA 2ZSBA 4EG5A 3K0FA 1P77A 3UPDA 4J8PA 4LJKA 4MW4A 4IIVA 2BI7A 3KB2A 5F3RA 2EX4A 3DXXA 3LH5A 1KS9A 2P8SA 3WQBA 2X0JA 1KEVA 3IE2A 3AEXA 4IILA 5TE9A 2C31A 4YRAA 1KBQA 4BUCA 1IG3A 2WWGA 5F4BA 3D4NA 5CLFA 3EQ7A 4IJKA 1BE0A 3E18A 4JKIA 1GEGA 4B85A 1SM4A 1LLUA 1MABB 2R65A 1BH6A 1R10A 2D74A 1VIVA 2II6A 1BX0A 3GFQA 4TKLA 3BXZA 2X3UA 2X4IA 4R5HA 2B1QA 2ZUVA 1IY0A 3PUJA 3NVDA 4RA6A 4JEMA 3M6LA 4DREA 4ARUA 3HVJA 4QC2A 4H7FA 3PNPA 5EIHA 4DSOA 1XRMA 3VDXA 1IONA 4RD3A 4W8HA 3L0IB 4KXUA 4GPD1 2X1MA 3GRVA 3OCVA 2HCRA 3HJBA 3VXKA 2ZUBA 4N5IX 1RNLA 4W6QA 4DXDA 3PGKA 1NNEA 1UXOA 3WHPA 1QS0A 2IY9A 3B85A 4J7UA 1L7EA 1H6AA 2CF5A 1GT6A 2IYFA 4GOND 5AOAA 5ELXA 3GEBA 2W43A 2VHYA 4QYXA 1ZIXA 2CZGA 2HIMA 2J7PA 3UCFA 4DR3B 1Y1QA 3SDZA 1G41A 4FMCF 2OY0A 5GV8A 4OTZA 1YZLA 2ZYDA 1QF9A 2TSYB 5CJ2A 1A7AA 2EFGA 3QY0A 5CA0A 3TLEA 1LF5A 3U40A 4UFOA 1DAGA 2FPIA 2G36A 2OHFA 3LPNA 2HPHA 4IMRA 5BN1A 4YWJA 3O4JA 1OPXA 3PIIA 3UJCA 4Q4HA 2XV1A 1ACLA 1AB6A 1LZLA 3SE7A 1EFRA 1YR9A 2D00A 2EFDB 3L18A 2PLRA 1MW8X 1FBNA 2QEQA 5D51S 4FGLA 4RWEA 2AW3A 3K35A 1Q2UA 2XZPA 2Z9CA 3BKWA 3ND9A 3V4RA 4KLRA 4S1VA 3PJRA 3PVSA 4ZRDA 3NP9A 1ONOA 2V6IA 3EA4A 4U8GA 3LT4A 4QTXA 5F76A 5FIUA 3TZHA 4A8TA 4KR3A 2WLTA 2VYND 2QTHA 3F6CA 2WB4A 2H59A 3G5TA 4DTCA 2PS9A 4BQIA 5U1PA 1V5FA 3FJ1A 1RKXA 4JJIA 2QMEA 2VWQA 3M34A 1ESEA 1CIVA 1G5IA 1QYRA 3EGOA 4RF5A 4RMNA 4CLEA 5KCZA 2O7SA 3OT1A 4YRRA 3RC9A 3AFIA 2BGWA 4F3NA 4PAQA 3GH3A 1B26A 4LY3A 1WVMA 4LI3X 2W48A 3RAFC 4Q1FA 3P0RA 1GCAA 2B4YA 3CLKA 1X19A 4KXVA 3MA0A 4PIVA 4JEIA 4NARA 3CYFA 1AGNA 3DR5A 2YJGA 2GN0A 4EFKA 4BRSA 3TR6A 3AHJA 2VDQB 3D6VA 3GLQA 5T57A 4HLCA 1LA2A 3LCUA 3ER9A 5ER9A 3BMQB 3D3WB 2J0QA 4ASUD 5GTDA 1UAGA 2OQIA 2P8JA 1D2MA 4H16A 2OBBA 4I46A 4NENA 1MO6A 2LKDA 5IAEA 1TTPB 2ZS9A 2QQ0A 3QX3A 3KVNA 3GJRA 2UYOA 5IWCA 2XMPA 2J9FA 5HWSA 3R7LA 2MYTA 2H1LA 2ZYIA 5CXQA 2DHQA 3PJFA 2ET6A 5JSKA 4C7JA 4TRJA 4QUGA 1N6OA 2QJOA 3U7QA 5DHSA 4E11A 5IRCD 1Q1AA 1E3MA 5KOHB 3CRQA 1SCQA 4ND8B 1EUYA 4CR7A 3HXOA 1GQQA 2J3LA 2O9JA 2XWBF 4XASA 5FA8A 2J67A 5FYQA 1C3OA 5TB5A 4PRYA 4MWTA 1GGVA 1RRFA 2WA1A 1QH1A 1U0HC 4RK6A 1G9TA 2DKNA 3D4LA 4YP5A 2IYTA 3THYB 1EXWA 2J59A 5FBLB 4QDXA 3FVVA 5JI3E 3TVYA 4D0GA 3M6IA 3C5CA 3G8CA 1E5LA 1L5WA 1NSFA 1OZ0A 5IYZB 3GLFB 3FZNA 3RS7A 1PR5A 4ZT6A 2OCKA 3PC3A 2BGIA 1FVFA 4S12A 1RQRA 4J75A 1PCXA 4MLZA 1KFEB 4X1OA 5DLPA 1P7YA 5DRYA 5JVDB 2CLSA 1JB1A 3LC7O 1ZIOA 3RHFA 1V4BA 1G16A 3IALA 1EG2A 1Q1EA 4CBVA 5LXTF 1NVKA 4AZ3B 3RUCA 1FSGA 4HDMA 3AM3A 4S1NA 4LWZA 4W9MC 1SB8A 1RYBA 1VYVA 2JHAA 2PKQO 2JJ2D 4Q4JB 5G3YA 4ZEMA 4JC8A 4BNHA 4CHTA 4QOIA 4QX6A 5JROA 2OAEA 1CF4A 1XEXA 3THXB 2ZQ5A 3QXSA 3PNMA 4BAGA 3ZQUA 1FVXA 1ECGA 3CR3C 1YQ9A 2GH1A 3ESZA 5B2FA 5ECDA 3MHTA 1UWVA 1HE3A 1WY5A 3WDSA 2CXPA 3WL7A 3ZLVA 1TZ2A 1YUMA 3PA8A 3Q8LA 1F06A 4LJ8A 4IHJF 4B6FA 3BGIA 3Q0IA 2ZAGA 4RA6B 4ZQIA 4DY6A 1LSJA 521PA 2H85A 2NVOA 4Z2AA 1RXCA 2C0QA 2G5TA 1EFTA 1AHIA 4JGBA 1WO8A 1ZI6A 5KQLA 1TTQB 1VE1A 1MXFA 1PYOA 4ZGGA 1TTHA 2QP9X 3JRXA 4DRXA 3PXDA 3HWWA 2GPNA 4DA7A 1QFYA 5JCPA 1XQ9A 2DXIA 3P2MA 1G7SA 1TPZA 4WIAA 3B1ZA 4Y2SA 2CMDA 2HRBA 4ARVA 4DLYA 3DG9A 3LF2A 1MX3A 4WBSA 5ICFA 5DIZA 3RK4A 1EQ2A 3S1AA 3S2EA 3DB1A 1S2MA 3AP3A 1QFZA 3RUDA 4DF3A 1O4VA 4INPA 5K9ZA 1NN5A 1MJNA 1CJVC 5E9WA 3UK7A 2DUWA 2JVKA 2WYVA 2ZVDA 5EHXA 2O52A 2ZW9A 2VK1A 1FVOA 3LRPA 4QEDA 3U3RA 1QC5A 2GKGA 3GZ4A 3KQKA 3NHLA 3PDUA 2VDKB 1JU3A 4BMCA 4IH4A 1KZ4A 5CLJA 3AI2A 4HQOA 3FUCA 4C05A 2XRMA 5B3JC 1XHFA 1CUAA 4IYJA 4MLPA 4PG8A 3HVIA 1MXHA 1SGWA 4MUHA 3B9RA 3M4ZA 4QYIA 4R41A 4DWWA 2PO7A 1RHQA 4IUBS 1MO5A 2QD4A 2IEBA 3O1IC 2FFJA 1INLA 1OXBB 2XVMA 1C1YA 2C4WA 4KG7A 1KXZA 2DH6A 5L3QA 3FCYA 2Z3ZA 3LQKA 1TL7C 1UH5A 4D96A 3FR8A 1NIPA 3AR2A 2CLDX 3G2MA 3M4JA 3UC9A 2FOXA 3JWHA 1C4OA 1F20A 4C0AC 1P2GA 3X1JA 3L8HA 3PITA 4WCFA 3V8QA 4PO1A 4EF5A 2OKCA 1NYTA 5CW2A 3GLGA 1RFLA 2AT1A 1B2LA 1QYVA 2NXJA 3B20A 1GCIA 3M83A 3GPBA 4IQFA 5ICSA 2BF7A 5KWVA 4N01A 1GAQA 1B14A 2Q4TA 3X1MA 1PJ4A 2DY0A 1DTSA 4ZARA 1OA0A 4FR5A 3U09A 2XX3A 4LKOA 1EB9A 2JJYA