2X4GA

Crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
330
structure length
302
Chain Sequence
b'AHVKYAVLGATGLLGHHAARAIRAAGHDLVLIHRPSSQIQRLAYLEPECRVAEMLDHAGLERALRGLDGVIFSEEVASALGQTNPFYAACLQARVPRILYVGSAYAMPRHPQGLPGHEGLFYDSLPSGKSSYVLCKWALDEQAREQARNGLPVVIGIPGMVLGELDIGPTTGRVITAIGNGEMTHYVAGQRNVIDAAEAGRGLLMALERGRIGERYLLTGHNLEMADLTRRIAELLGQPAPQPMSMAMARALATLGRLEVMAGGQFLDGRKAREELGFFSTTALDDTLLRAIDWFRDNGYFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 104
structure length 302
sequence length 330
ec nomenclature
pdb deposition date 2010-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x4gA00
5JO9A 1LNQA 3DZBA 3TL3A 3GC6A 1B26A 1CIVA 5T8KA 4D79A 3PHIA 1XLTA 2FP4A 3L9WA 4WGGA 4WK6A 4CM9D 2ZCUA 4EUEA 2GPTA 4DUPA 2CUKA 4CLRA 1YBVA 5ER9A 3GN2A 4XYBA 2BHLA 4MPDA 2Q99A 2GZ1A 4MVJI 4BO8A 1KETA 2WJPA 2X6TA 1ARZA 2V6GA 3FNGA 2X0NA 2RCYA 2JCYA 1MUUA 2R00C 4NU6A 1N1EA 2PGJA 1DIRA 3ZU4A 4ID9A 1O89A 1JQBA 2Y0CA 3GRKA 4BNMA 5IZ4A 1N2SA 4W9NC 5I7EA 3EYWA 4DIFA 5AQ1A 3CMCO 3GHYA 1D1TA 3GPIA 3PFWO 3QSGA 5ADHA 3GGOA 1U7TA 4PLPA 3L77A 4P4NA 1A5ZA 4QTZA 5BSHA 4M87A 5DCUA 2B5WA 1YE3A 3C8MA 3OBBA 5DCYA 1ZIDA 3ANNA 3G0OA 1LI4A 3H9QA 4FGSA 1O94A 1B8PA 1PS9A 4GQAA 1I5RA 2HJRA 3JQAA 1WLYA 6LDHA 1E6WA 2QYTA 4GI2A 3JQCA 4FIZA 5T5QA 1ZKMA 3S2GA 2YQ5A 3DBHB 5DT9A 2EGHA 1FDVA 3EHEA 4YT5A 5JLAA 4PLTA 1BVRA 4PLFA 4PG7A 3OH8A 1JW9B 1QR6A 1TT5B 3DZHA 1XEAA 3KVOA 1NQAO 4RGBA 4WPGA 2VTDA 5TNXA 4B4OA 5KCZA 1Q0LA 1XHLA 5FYDA 2QRJA 3GDFA 3DFUA 4IY1A 1OZAA 5BT9A 4R1UA 2O2YA 3HN2A 1W6UA 2C07A 3JQ8A 3QWAA 1F8GA 3PEFA 3JQ6A 4KZPA 4BO0A 2GR9A 2OXIA 1R15A 2W90A 2C5AA 3WJ7A 5IDXA 1M76A 2YFQA 3PYLA 1KVUA 2WD7B 4K26A 1NVGA 2G0TA 3D0OA 4UREA 5JCJD 1I01A 1MG0A 1NHWA 3SC4A 4NIMA 3UCEA 4MIEA 4BQPA 4LMRA 3ON5A 1EUZA 2BGKA 4PLYA 3ZU3A 3W8EA 4R01A 1NWCA 4RL6A 1ZK1A 4CMKA 1P1KA 4DC1A 1U5AA 3QY9A 4FBGA 1A72A 2J6IA 3A4VA 4QFCA 2W2KB 2DKNA 3V2HA 1U3VA 4Y9DA 5A9SA 1YL7A 1T24A 3JQEA 1ZZEA 1R4NA 1H6CA 4RQTA 4O63O 5T8KC 3CZMA 3RIHA 4F3YA 1SCUA 4XX0A 3H5AA 3RCBA 1CQJA 4OKIA 2C2YA 4J2OA 3EAGA 3S1LA 3ULKA 3QQPA 4R3NA 2VOJA 3CPSA 4PZCA 3PZBA 2YHIA 3SBOA 1GPDG 2I66A 2J5RA 4CLOB 3GFBA 3L4BA 3QJ5A 4YJHA 5GZ6A 4YDRA 4YAJA 3ZWBA 1D7OA 5BQFA 3EK2A 3P5SA 4XRGA 1XU9A 2Q3EA 3B1FA 3LLVA 3DTTA 3WYCA 5G2OA 3ASUA 5LDHA 1E7WA 4WE3A 5CG2A 1NP3A 1F0YA 3HDHA 4CV0A 1M6WA 3ZWNA 4MINA 1T1RA 2J3IA 3DHEA 4O1MA 5KVSA 5L53A 3MJSA 1BW9B 2VYVD 4E33A 3H5RA 4Z0PA 2HAEA 1IPFA 4Q3AA 2AEJA 2HU2A 1IY8A 1DOHA 1HZJA 1NYTA 3ADPA 3KLMX 4XQ9A 4FQ8A 4HFMA 2VHXA 1BG6A 1B14A 4NZ9A 1ISJA 4GAEA 4FS3A 3DHYA 4JIGA 1U4OA 4FOOA 1I3MA 2EIHA 4GX2A 4BUCA 4DXHA 3G3EA 3GNQA 2O23A 1SNYA 4Y67A 2OORA 5DDIP 1WP4A 4BS9A 3L9XA 1FDUA 1RM5A 2JAHA 3S2EA 4YQYA 3GZ4A 3WMWA 4AICA 2YZ7A 3I6IA 3KB6A 4PG8A 5KVVA 4AJPA 3I9JA 1C0KA 3HSKA 3HDQA 3HDYA 2Y67A 2YYYA 3DBRA 3NDIA 4JGBA 1V3TA 2POQX 2V6BA 3RKRA 4WLUA 3ZV5A 3DBLB 4BMNA 4K6FA 3JD0A 2YV1A 4AJ4A 1QLJA 5A9RA 1K3TA 4OAQA 2PH3A 2PKQP 3LT1A 1RM0A 3IKTA 2O4UX 3WJAA 4CLXA 1X14A 2DAPA 3GEMA 3N7UA 1DLJA 3OQ1A 4B8ZA 4ND2A 2HRBA 4DYDA 3CUKA 3AM4A 3TRIA 4HBGA 2I9PA 2P9GA 1KVQA 2X86A 1FXSA 1NVTA 1TT7A 1XWFA 3ZWOA 2Y68A 2B35A 1X7HA 3NYWA 4IJVA 3HZZA 3PYMA 1H9AA 2BMAA 1HTBA 3TOXA 1KYQA 2X5JO 3JQDA 1SMKA 1EE9A 4F6LA 5KTKA 3I9NA 1EVYA 1E92A 5L45A 2WD8A 3VPGA 4ILKA 3ASVA 4MVJE 4RZHA 4QEDA 3F5QA 5JBIA 1QSGA 1ZUD1 2NSDA 1S6YA 3DTYA 3D4OA 3ZW8A 3T4XA 1ENZA 3I52A 2V6FA 4IQ0A 2ZYDA 2C20A 3OHSX 3GUCA 4K6CA 4RPGA 4E6PA 4ALKA 3ITKA 2ILTA 1C1DB 3L4BC 3KO8A 4BKPA 1NR1A 2NTJA 4NBVA 3VZPA 2RH8A 5B4TA 3ROMA 4YT4A 1EK6A 5HS4A 4CM6A 1HRDA 4BB6A 4BNFA 4NFSA 2FN7A 3BMQA 5I7VA 4YJFB 1X13A 4IS2A 2QW8A 4J3FA 1UUFA 1S7CA 1WDMA 1GY8A 5AXCA 4DREA 2C7GA 2YUTA 1UP6A 3I4FA 1DFIA 1K6IA 2JAPA 3RC9A 3WBBA 4E2YA 2H6EA 2Q1TA 4CMCA 3TJRA 4XQCA 1PJ2A 5BSEA 2LDBA 1YQDA 1W73A 2OL4A 3DL2A 2OMEA 3A06A 5C5IA 3UXYA 4PLGA 4XR4A 4JP2A 3W4KA 5A1TA 1GYRA 4GPD1 5F3RA 3Q1LA 1KEWA 5JXWA 2VHYA 3G49A 4RF5A 1NAIA 2JCXA 1HDCA 2JFHA 4B4VA 3GZNA 3Q0EA 4PLZA 4R9RA 3IS3A 2YHUA 3WFIA 1U5CA 1JA9A 2RIRA 4J1TA 4ONEA 3WQRA 3BMCB 3LT4A 1NXQA 4OSPA 1ONNA 4D3FA 4BL5A 3PDJA 1YQGA 1YB5A 1ZH8A 1IE3A 1T2FA 2HDHA 3U62A 5G0UA 4PGFA 3H7AA 5H82A 3OQBA 4OXNA 1J49A 3S8MA 2BRUA 4MVJF 3FBTA 1PGNA 3RKUA 1K89A 1R37A 2O3JA 4OM8A 2JKVA 5J23A 2Y99A 2PGLA 2AQIA 1NPTO 2I6TA 3H8VA 3OP4A 3BHIA 4GLOA 1P1JA 1ZNQO 1YOVA 1RPNA 1PSDA 4DLBA 4HFNA 4BNYA 3PWSA 4DQUA 4F6CA 4MKZA 4A2CA 4MOWA 1UDCA 3O9ZA 1HE3A 1OFGA 1UDBA 1SB9A 3TDKA 3GNSA 3TZKA 5JO0A 2CZCA 3D5QA 3RU9A 1B0AA 3L6DA 1HYHA 3ZHBA 4J4BA 1RYDA 1A71A 4XQEA 5FFFA 4XDZA 3KYCB 1GDHA 2HK8A 5DCWA 4E12A 5ILGA 3RASA 4CQLA 2FSSA 4BO3A 4YRAA 1Z45A 1MC5A 3PWKA 2A35A 4LK3A 1BSVA 1GADO 2IEBA 4WJZA 2DPHA 4YRDA 4PIVA 1XYGA 1GQQA 4UVGA 4IIVA 4ZU3A 2NTVA 1I8TA 3NV9A 4U6QA 2FHSA 3DEYX 1ZXBA 3GVHA 4DVJA 3ONDA 3PDUA 3BTOA 1LDBA 4IQ8A 1JVSA 5F5NA 3ZU5A 1VLLA 4ALIA 4YWJA 2Q49A 4PCVA 1NBOA 4BO2A 4DIBA 3AM3A 5ICSA 5MGBA 2FPGA 4R16A 2BKAA 1JN0A 2NVWA 2ZQYA 3QVSA 1UJMA 3ONFA 4ZRMA 1T2EA 2PKRA 3TF5A 4R51A 3JV7A 1X1EA 1UZLA 4ZQGA 3TZ6A 3UFXA 2VRCA 1HDZA 3W4IA 1BVUA 4FFOA 4M1QA 1ZK4A 4BNZA 4Z3DA 1T2CA 3NDRA 4NBTA 1SBYA 1WMBA 2B4RO 2JD1A 3GPDG 1U3TA 3DFZA 1R4MA 4E0BA 3LSYA 3WNVA 4JJIA 4IIUA 1N1GA 2DQ4A 1LX6A 2QRLA 1BXGB 1GQYA 3NJ4A 5DOVA 2PK3A 4FCCA 4XJTA 2PNFA 1C3VA 2H5LA 1EK5A 3ETEA 1PGOA 4HUJA 3IQDB 1QYWA 4Z0HO 4E5PA 5LDGA 2XOXA 3AM5A 1PJSA 3BA1A 4I5DA 4J49A 3ZNQA 1IPEA 4C7JA 4BO9A 2OOSA 4CM8B 4TVOA 2NUAA 1QP8A 3CE6A 4FFPA 1H5QA 1BXZA 1CDOA 3T4EA 5CDYA 3JQBA 5CEEA 4ZD6A 5JCXA 1NFFA 1TB4A 4XJSA 2DFVA 4CV1A 4N5LA 4RVGA 5KIAA 1T2DA 4OGWA 1E5QA 1EFLA 3KOUA 4OQYA 3OICA 1ID1A 1EEHA 4R1SA 2X0RA 4D42A 4AJKA 4KQWA 4HXYA 1U4SA 1IHYA 4A26A 4AJEA 5COBA 4MO2A 1I32A 3GMSA 3KXDA 4FFNA 4ZRNA 4GWKA 2P91A 3RI3A 3WGHA 3ICPA 2DBQA 1HF3A 4G2NA 1OOEA 4OXKA 1KS9A 2AG8A 1ZEJA 1N8KA 4P4LA 4DQVA 3E6AA 5JYEA 4ALLA 3QHAA 1F17A 3K30A 3BHJA 3DZGA 1P44A 2EG9A 4RV9A 3C7CB 4IDDA 4BQRA 1UZNA 3G79A 3WSWA 3L6OO 4ZN6A 3U4CA 1E0DA 1LUAA 1VJ0A 2Z5LA 4OQZA 3QVOA 4RLHA 4BNGA 4D0SA 2OZPA 2YFHA 5L7WA 3S2FA 4UAGA 4AJ2A 3P7MA 1EQUA 3FTPA 1Y9AA 3AU8A 4S3MA 1H93A 3OSUA 2CDAA 3DBHA 2VT2A 3I23A 3F5SA 3F1KA 3VZQA 5CHEA 2VT3A 2PA3A 2OO5A 2Y0DA 3Q3CA 8ADHA 4UVDA 5KJCA 1PWXA 3D3WB 4IDCA 1GZ4A 1TT5A 3RC2A 4GL4A 3JCZA 5TRTA 4NFHA 5G0TA 2NU8A 5BNIA 1Y1PA 4PLWA 5IN4A 1QYVA 1LTHR 1I3KA 3P19A 4H15A 4PLVA 2GSDA 3KEQA 2VUUA 1C14A 4JN6B 5DBIA 1H2BA 3GVPA 4CR8A 1U8FO 2O3TA 2B0JA 5A5EA 4LRSB 1HT0A 1NAHA 4J6FA 2HJSA 4W9NA 4J1SA 1F06A 1YDWA 2HMTA 3F1LA 3GGPA 3Q9UA 2FRDA 2W2LD 2ZB3A 2WD7A 2C5EA 3PHLA 5IN5A 2IDZA 5JY6A 3FPCA 1D1SA 2YV3A 4XZ3A 1LLUA 4BV8A 3PFFA 3ZWVA 2TMDA 1ISFA 1AE1A 4QECA 4BNXA 5IJZA 2QZZA 3I9KA 5JMPA 2PZMA 3SVTA 2DBVO 1B16A 1IOLA 2ZJ1A 2B5VA 4UVEA 2C59A 5I8ZA 2W2KA 4JJFA 5HA5A 1ZEMA 3DHNA 1D4FA 9LDBA 2D8AA 3WGIA 1E6EA 2OGUA 1G1AA 4RORA 1WVGA 3JQBC 1E5LA 3MTJA 4PZDA 1Z7BA 1EVZA 3RJ5A 1PL8A 1XELA 3I9LA 1KVTA 3WOHA 3SEFA 3QV1A 2XXJA 5JDIA 4R5HA 5DNAA 2E37A 1VSVA 1H6BA 1HYGA 3ST7A 5C37A 1GYPA 1HDRA 1Y8QA 1LDYA 5T64A 1IZ0A 1QKIA 4FD3A 1EQ2A 4YJGA 1Y6JA 3OECA 3WLFA 2VTEA 2ZCVA 1HSZA 1PL6A 3K8ZA 3F47A 3IC5A 3F4BA 3WWYA 3U4HA 4BMVA 1P1HA 2DBZA 2DM6A 3ZWMA 3Q9NA 1VJTA 1WZEA 1HEUA 3A9WA 5FWNA 1R0KA 3PJGA 2I65A 1WNTA 1KVRA 4HADA 4ZQBA 4K1LA 2NQ8A 4DYVA 3JQGA 4JROA 5TT1A 1A4UA 1TVEA 4EBFA 4YAGA 1X15A 4WOKA 5G0VA 1PGJA 3E03A 1B3RA 1HE5A 3A1NA 1A7AA 3U0BA 1I2CA 3EDMA 3RUIA 3U49A 4WLFA 3FNHA 1XG5A 3GEGA 2ZTMA 3ZV3A 5T57A 1UXKA 4A27A 4PN3A 4XYGA 1O95A 1ZCJA 3RD5A 3OEWA 3TNLA 4DWVA 1LSSA 1E3LA 4HX5A 4NI5A 1E7SA 4TSKA 2UVDA 3I83A 3H2ZA 5A04A 4PRLA 4IPTA 2RBEA 3V2UA 3AUTA 2AG5A 5KWEA 1E3IA 3KZVA 4XGIA 1TXGA 4CQMA 2I3AA 2OBNA 3VTFA 5F21A 2NTNA 2B69A 3E5MA 1UXJA 3VPFA 2EXXA 3LZ6A 5JAQA 3W1VA 1B8UA 3WTCA 4DPKA 1E3WA 2V7PA 2AW5A 2PTGA 1PU2A 1HXHA 2DTXA 1NQTA 5JMWA 1Z74A 1V3UA 5ENDA 1VC2A 1LQUA 3DMYA 3GAZA 3QP9A 4TMFA 1P45A 4CV3A 2O3SA 3D4NA 2FPPA 5FEUA 1YXMA 3LC1O 4BOYA 3LVFO 2IE0A 1U28A 2ZKLA 3BHMA 4Q3DA 4CL8A 3DAFA 1D8AA 1DC6A 4YBZA 3W8FA 4EUFA 1T26A 1C1XB 3AI2A 1KC3A 5IDQA 1N7GA 1LA2A 3DR3A 1ENYA 2IZ0A 3L4SO 3TZHA 4DIOA 1YB1A 4E30A 5DOZA 5TJHA 1M6HA 4CLHA 2B83A 1U1IA 2B36A 3ANMA 3ROKA 5JAIA 1KY5A 4PG6A 5I9NA 2JD2A 1YJQA 3DOCA 3PGJA 4J0FA 5C7OO 4PLHA 1NVMB 3QVTA 5DBFA 1ZMOA 1SB8A 2Q1SA 3GEDA 5JDIC 3ZNNA 3KBOA 3RUEA 3PRJA 3ROPA 2PFGA 4DA9A 1PS0A 3PGXA 5IAAA 1Y8RA 3JYQA 3O8QA 3K96A 5KJEA 1SEVA 3MJ4A 1UP4A 1Q7BA 2E6UX 2IYPA 1K6XA 1C1DA 3COSA 1R0SA 5IXYA 1QRRA 1M66A 1LEHA 4DGSA 1SZJG 5FI3A 3PP8A 2OFPA 3SJUA 1V35A 1JDJA 3PPIA 3V1UA 4OHUA 1M75A 3UH1A 4BNKA 1GL3A 3RVDA 1YWGO 4D46A 3MEQA 3PHGA 4IGEA 4RJTA 2VZ8A 4LVUA 3IL2A 1MV8A 2F1KA 3NDJA 4YJFA 1GTMA 1U2DA 2Y1FA 3C7DB 5TIIA 4GLLA 1I2ZA 4BNVA 1RYEA 3K92A 4OSOA 1ENOA 5EJ2A 4WCFA 4CM4B 4DQXA 2GGSA 3ZNPA 4R4JA 1YBMA 1Q7CA 3UF0A 2Y66A 1VM6A 3CKYA 1HDYA 2R6JA 4IDFA 2O3RA 5IDWA 3ZV6A 1NWHA 3LF1A 1K0UA 1RKXA 1ZBQA 2I76A 4R1NA 3UHAA 3GUYA 1NQOA 4OOEA 2GZ3A 4ZQHA 2VWPA 2ZTUA 3AOEA 3KV3O 3TPCA 4GGPA 4QO8A 3VTZA 2E4AA 2C29D 5TC4A 3PZRA 4YT8A 4I9UA 2DTDA 2H1SA 5JAMA 1Y7TA 4UUOA 3BMCA 3QA9A 1A4IA 1NQ5A 5C3MA 4RPJA 1VKOA 3ETDA 4EJ0A 1HE4A 1P1FA 1JKIA 3GH3A 4KDEA 2EF1A 4D7AA 1PQUA 4OXYA 4DTIA 1MA0A 4R5MA 1UXGA 4RF2A 3PJFA 1QXSA 1R66A 3GMDA 1PZHA 5IF3A 1PGPA 3KYDA 5BNFA 1QYDA 3E9NA 2ZATA 1LJ8A 3H2SA 4J4TA 5AYVA 1LU9A 4IINA 1GUZA 3L6EA 3ZV4A 4AJ1A 4MKRA 4LCEA 1ORRA 1HL3A 2Q45A 3W6UA 1HLPA 3AFNA 3TOZA 4W7IA 1PZFA 3SLKA 5L7YA 3D64A 1DO8A 2Y1CA 3VDRA 1SAYA 1DAOA 3OJFA 1WW8A 2VHVA 3MJTA 2AEFA 5F1OA 3R3JA 4PVCA 3FN4A 4QFDA 3ENKA 3PHJA 2C7VA 4GBJA 4TKLA 2GF2A 1P77A 2X9NA 1CEQA 5KJFA 1NX6A 5TGDA 2VOEA 2O50A 3JQ7B 1GPJA 4MKXA 1MXHA 1BXKA 2ZIZA 4XRRA 3WS7A 1I0ZA 3FSRA 4J91A 2NVUB 4D3DA 3VPSA 1YH3A 1QV6A 3GG9A 1ZMTA 5CFZA 3H9EO 1P9LA 3WLEA 1PJLA 5DP1A 2ZB4A 1JKJA 3LLSA 3LYLA 1AXGA 1X1TA 2VWQA 3W4JA 1U9JA 3A14A 3PTZA 4MVJD 4YACA 3OF2A 1ZW1A 2DLDA 2A4KA 3HB5X 2GD1O 3AUSA 4UEKA 4CLRB 4GKVA 1KY4A 1JKFA 4IZHA 3ZWCA 5A03A 1B7GO 4BNHA 3WGTA 4I5EA 1UR5A 3DOOA 2XF8A 2BLLA 4Y6SA 5JYDA 2RH4A 2AQKA 1I10A 2GN6A 4JK3A 3NRCA 4BGUA 4BKQA 4TRNA 4PG4A 1DLIA 4WCFC 4TZKA 2J5QA 2A9FA 4XA8A 3LF2A 4FFRA 1O5IA 4L4SA 3ZW9A 2FOIA 2UAGA 4CM9A 5CDSA 4GSKA 1GV1A 4Q39A 3ZU2A 2CDCA 2D5CA 4D43A 1EDOA 1Z7EA 4FFLA 4ESOA 2WEKA 3H9UA 3MJCA 5FI5A 1F12A 4MP8A 1VJ1A 3BAZA 1UZMA 3ZHXA 3BXXA 1E6UA 2Q4BA 2X9VA 3CINA 4L4XA 4ROSA 4N5NA 4RPHA 4J9VA 3WICA 3LQFA 1BXGA 2Z95A 1B15A 4DBVO 3BMNB 1EE2A 3AOEC 3OM9A 3GLQA 5DZSA 3FD8A 4FJ1A 1I33A 3BIOA 4R3WA 4XCVA 3D3EA 2D0IA 1VSUA 3DQPA 4MVJG 1MG5A 3HJAA 5T67A 3NT5A 1G0NA 4Z3KA 4CM8A 1Q0HA 3V1TC 1Q2XA 3QE3A 4TRJA 3B70A 4PLCA 1DDOA 5CDGA 1DJNA 5C7IO 2VN8A 4I5GA 1PGQA 4B79A 1NM5A 4MDHA 1IL0A 3R6DA 1IUKA 4O6VA 4WASA 4XGKA 1O0SA 4FPXA 4Q3EA 1TI7A 3F46A 4B3JA 3K5PA 9LDTA 3A28A 4LGVA 1DSSG 5HS6A 3H65A 3ZH2A 4BMSA 3JQ8B 4HKTA 5L9AA 1E1KA 2CNBA 2AQ8A 2BFMA 3ICCA 2VQ3A 3DWFA 2PR2A 4RO0A 4II3A 4DPLA 4CMGA 4W99A 3JYPA 3U5TA 3INTA 3OIGA 3MZ0A 3HN7A 4TWRA 1E1NA 3BMOA 1LRKA 2GNAA 4LSWA 1FDSA 1KVSA 4B3IA 2YDXA 5LCXA 5KKAA 2VNAA 3P2YA 5L3ZA 1P0FA 3OA2A 4XR9A 3STHA 1YL5A 4QUKA 2HMUA 2Q4EA 2VYND 4Y98A 4KUEA 1EUCA 4S1VA 4J90A 1DRWA 4INAA 4XB1A 3X2EA 3DXFA 4IJWA 4WLNA 2V65A 3E82A 1OI7A 4HV4A 5GY7A 2BFPA 5U4QA 2IXAA 1WZIA 2EERA 4NFYA 4MIOA 2AXQA 2LDXA 3I1JA 4JX8A 2ZYGA 5JE8A 5JCJA 2NADA 4GX0A 4PG5A 3FNFA 1PR3A 3GA0A 4EEXA 1MGOA 1XR3A 4TVBA 3PXXA 3VHRA 1ZK3A 3D3WA 3ONEA 4EEZA 3V8BA 4UULA 3AI1A 2RAFA 3TFQA 5CG1A 4E5NA 2GN8A 3UKOA 3EVNA 5B37A 3DC2A 2WDZA 4LSMA 2P9CA 4QX6A 5IFLA 3RWBA 1P31A 4CM5A 4YCAA 1P0CA 4D3SA 2SCUA 1KC1A 3OIDA 3QVXA 5I9MA 4IBOA 1BTOA 1KERA 1GFSA 5TSDA 5JW6A 2WMDA 2UYYA 4MP3A 2XXBA 3OA0A 3UICA 4BNIA 5I7SA 3IP1A 4U6SA 2ZJ0A 2FMUA 3ZHYA 1GYQA 2TMGA 1RWBA 3FHLA 1GU7A 4CR6A 4W4TA 3OEYA 3RJ9A 4QSMA 1VRWA 2J5KA 1FDWA 4K9DA 4KUHA 2O48X 2GUGA 1HLDA 1T4BA 4O0LA 5DULA 2WYUA 2BFAA 4CMBA 5CDTA 4Q3CA 4E31A 4U7WA 2I99A 3OMLA 5G4KB 1XU7A 2XPCA 3OIFA 3ADOA 1R6DA 3MOGA 4ALNA 4NH4A 4E4YA 1ZK2A 3UAGA 2WE7A 3KSZO 4LCJA 3MOIA 4DL9A 1TEHA 2QHXA 1DB3A 1LDEA 4ZA2A 3WGQA 3W8DA 2VYVA 4GGOA 3QWBA 4CODB 4YYZA 3FCOA 5KOIA 5A02A 3W6ZA 3DB2A 4XDYA 4II2A 1XKQA 2RHRA 5B1YA 4CL3A 1M67A 2EW2A 2BF7A 1LC3A 3EY4A 1F14A 4E21A 3GGGA 3EMKA 4I9NA 1JAYA 4CJXA 4AG3A 4NK4A 4Z6KA 4YRBA 3K31A 1AXEA 1DIBA 4D44A 3E9QA 2B37A 4ND1A 3GAFA 3WDSA 3GVCA 2BGMA 3AU9A 2AE1A 2HMWA 1LDMA 2GASA 1LLQA 3QRWA 4NJMA 1YKFA 4CMIA 4AJIA 3NAQA 4H16A 3GR6A 2FZEA 4GMGA 5K9ZA 1I24A 2P2SA 5I7FA 4QT0A 3WQQA 3O03A 5JDCA 1CJCA 1J0XO 3D4PA 4WNIA 1WXDA 2BGLA 1KOLA 1NFQA 1A9YA 3VKVA 3HWRA 1BDMA 1N7HA 1Z82A 2IEDA 4CUJA 1X7GA 3DOJA 4NBWA 3VDQA 3WBFA 2J8ZA 2WTBA 2Z1MA 3F6YA 2GCGA 4IDAA 3HB4X 3I6QA 1D3AA 1B3BA 1GQ2A 1HYEA 3NTQA 3QIVA 4MVJM 4JBIA 3UVEA 3PQFA 4IUYA 2OUIA 2BH9A 5K0ZA 5A4DA 4M55A 2AQHA 5HBRA 3WB9A 1V0JA 3H4VA 4KWIA 4XYEA 1ULSA 2WWRA 4N18A 4ND3A 3BMQB 4CMEA 2HO5A 3BTSA 2HMVA 1QG6A 3E9MA 5A05A 3D7LA 3AY6A 1ULUA 5JY1A 4TRRA 1PL7A 1U7HA 3U4IA 1DC3A 4AL4A 4ZGWA 4YAEA 1P1IA 4WUVA 1GZ3A 1Z75A 1O9BA 1P1RA 2D3TA 2DU8A 4JP3A 4WKGA 5CPBA 4B8WA 4YR9A 5B12A 3IDSA 4U0KA 2FR8A 1GR0A 4GWGA 1U3UA 2H9IA 1WDLA 1DJQA 2AHRA 5JC8A 3WYEA 4Q9NA 4K28A 3I5MA 5HWSA 3AW9A 3B6ZA 1QV7A 4L76A 1AN9A 4D0RA 4YAIA 1YS4A 3ZZNA 3GG2A 4EDFA 1NHGA 2HUNA 3R1IA 4KQXA 3NUGA 2OP1A 1IULA 1E7MA 2EP7A 1E3SA 2UUPA 5A9TA 2VZ0A 1TLTA 4EITA 1CRWG 2PD3A 3RFVA 1IYZA 3UN1A 1HKUA 1MLDA 3LK7A 5H83A 2EKLA 4U8GA 2BD0A 1G6KA 1ML3A 1KEPA 3CTMA 4XYMA 4ALMA 3GRPA 3ITDA 2X5KO 1YGYA 1I30A 4Q3NA 2VUSA 2JHFA 1DFHA 5HRUA 1M2WA 1PX0A 4CMJA 3VH3A 2ET6A 2QRKA 3OJLA 3ENNA 1GEEA 1YOVB 1ISGA 4URFA 1SEPA 1IHXA 4GVLA 1W8DA 3O4RA 4N54A 4RPKA 3ZWAA 5L51A 1HDXA 2CVQA 4AJLA 3C1OA 5ITWA 2JFGA 4CM4A 3ZWWA 3JQ9A 2GO1A 3GK3A 4IXTA 4JQCA 4JBHA 2HCTA 1HWYA 1Y5RA 4E5YA 1EFKA 1N5DA 1SPXA 3R3SA 4HFRA 3PIIA 3PK0A 3UUWA 4CQLB 3LC2O 1PJCA 4YJDA 2BI8A 3IMFA 3PJEA 5JDCC 5EQDA 3HG7A 1DIAA 1U2GA 2P5YA 1N9GB 1RM4A 3BZUA 4KOAA 4NPCA 4CLEA 3U09A 1Q0QA 2G1UA 5DBGA 1KBZA 3S2IA 2UUOA 3L07A 2X22A 1WWKA 3JD4A 2X0JA 1E77A 1V6AA 3GFGA 3WMXA 2FY8A 2OHXA 3G1TA 2C54A 3AWDA 1QLHA 3JD2A 5EPOA 2Z1NA 1I36A 2H63A 3VH2A 4ZQEA 2WM3A 5BR7A 4CLOA 2GZ2A 2Q46A 1ONPA 2PY6A 3VPXA 3WYBA 4E2ZA 2V6MA 2D1YA 2PGDA 1YVEI 2G17A 2Y1OA 4BO1A 4AJNA 2DUUA 3UW3A 1O8CA 2HLPA 3NT2A 4CMEC 1ZSVA 3HE3A 3I3OA 3JYOA 4RDIA 1QYCA 3IAHA 1K2WA 1E1MA 3OJOA 4W6ZA 4YEDA 3WGOA 3FWZA 1HDOA 1V8BA 4BGEA 3FNEA 4E2WA 3LC7O 5TT0A 1BW9A 2CD9A 4WLVA 3TZQA 1T4DA 1R4MB 4R41A 1W0CA 3FR7A 4BB5A 5HM8A 1PIWA 2P68A 3QW2A 1P3DA 2VHZA 3UGKA 3NTRA 3ANLA 2GN9A 3DZKA 3FR8A 4QQRA 2QZ9A 4IDEA 2Q2QA 2GLXA 2EGGA 4MIYA 1UAGA 1QMGA 4C7KA 3VPHA 2NVUA 1NFRA 2NWQA 3EZLA 5L95A 1NASA 3RQSA 4RZIA 1EMDA 1UDAA 3ZI0A 1ZXLA 4E5MA 3B1JA 2DC1A 3I9MA 4LVCA 4OJNA 1ZSNA 1FK8A 5CAEA 1EDZA 2NACA 3C1TA 4H7PA 4J1QA 3DBLA 1JWAB 4UEOA 4LISA 1EVJA 3SJ7A 5IDYA 5KKCA 2G82A 4B7CA 2EJVA 4J2HA 1I3NA 3CZRA 3FWNA 3GOHA 4EGFA 1QORA 1T1SA 5ITVA 3K2BA 1PS8A 1GUFA 3OFSA 2X8LA 3H6KA 4B4UA 1MB4A 2HKIA 3V5NA 3Q2IA 2VRBA 4LW8A 3LT2A 4YXFA 3AUUA 2AEMA 2NV6A 3NTOA 1MFPA 4A10A 2IYOA 4G81A 4L8VA 3BYZA 3CIFA 5MDHA 3QWHA 4UUNA 4B7XA 3EC7A 3FBGA 3JQ9C 4EW6A 2NU6A 3LDHA 4ZICA 3C1AA 1MC4A 1EBFA 4JCOA 3WR5A 1P74A 3D5TA 3I9OA 3NT4A 3DZIA 1VKNA 4JJGA 4L0QA 4I08A 4YT2A 1YBAA 3ROQA 1NPYA 2HSDA 4R68A 3C85A 3ZGYA 4BGVA 4RVHA 4FJ2A 4IXWA 5A3JA 4LN1A 5F1KA 3WX0A 1JLLA 1RM3A 4PRKA 3UCXA 5AOVA 3BMNA 4KP7A 4P22A 4HNHA 4J43A 3PWZA 3VC7A 4AJOA 3DO5A 1PEDA 2O7QA 4E32A 3PI7A 2C0CA 5U1PA 5JNLA 4J0EA 3RAJA 4Z9FA 3U9LA 1LRLA 4GSLA 1PJBA 3MJEA 2PD6A 4CUZA 2WE8A 4N7RA 5EERA 3GNTA 3KSUA 3D1LA 2ZK7A 4O59O 4IDBA 2NU7A 1X0XA 4JLWA 2UDPA 3RBZA 1ONOA 3S55A 1MXFA 1I2BA 4QO7A 4NDNE 5IXSA 2AA3A 4RVDA 3SLGA 5A3VA 1NR7A 3U4DA 1BRMA 1I3LA 5KNLA 1IB6A 2E48A 5BNTA 5ER6A 1DFGA 2PD4A 1VL8A 5CP8A 2GRAA 7ADHA 5TQVA 4FR5A 4BV9A 3WFJA 5KVCA 4JBGA 1ZO8A 3TZCA 4R69A 1XQ6A 4FW8A 4HNGA 1EUDA 2A92A 1PJ3A 4BNJA 4CR7A 3R0IA 1OAAA 3M2PA 3M1AA 1CYDA 3JYLA 5DN9A 2O2SA 3IJRA 1WAMA 3V1YA 1J6UA 4HY3A 1DC5A 5IG2A 2HK7A 1BDBA 4YTEA 2JHGA 5CDUA 4QXMA 5G0SA 3RUAA 2W2LA 3PLNA 5TX7A 5K6AA 1MP0A 3IIEA 1CF2O 4CUKA 5DF1A 2VHWA 2DTEA 1PJTA 4JNKA 4FC6A 4DMMA 1DPGA 1Y8QB 4NK5A 1U8XX 3T7EA 1PQWA 4YAKA 3GF4A 4YJGB 3U3XA 3TSCA 4DBZA 1VL6A 4ND5A 5A5FA 1DBVO 2IXBA 4BNTA 3EVTA 4BKRA 4E3ZA 1ZK0A 2X1HA 2I67A 4CM1A 2GDZA 2ZB7A 3KYCA 2Y93A 3RBXA 2D5AA 2X58A 1SOWA 4ND4A 3ABIA 5AXBA 1GZ6A 1LC0A 3GDGA 4TQGA 3DAPA 3JQGB 3LU1A 1DHRA 3TFOA 1V3VA 1A27A 1JWBB 1LDNA 5GZ1A 1ISMA 2VRCD 3H9GA 2IRWA 2Y0EA 4P4GA 3QVWA 4XIYA 2FR1A 3T7CA 4IMPA 4NBUA 3FF4A 2HK9A 4TRMA 3ZWPA 4WOJA 4M8SA 6ADHA 4IJUA 1KEUA 2GERA 4MP6A 2DFDA 1DRUA 1PJQA 2YJZA 1B2LA 5ES3A 2P9EA 4EJ6A 1EZ4A 3NEPX 5BSGA 2X0IA 3M2TA 2P4QA 4Y8VA 1YB4A 3K9QO 4Z0TA 5G4KA 2NM0A 4BGIA 3PLRA 2G5CA 2PV7A 4RVSA 3HADA 1PZEA 1L7EA 1H6AA 1R16A 2PZJA 3RU7A 3GT0A 1XCBA 4CQMB 2PZKA 1VE9A 3E8XA 1AHIA 1MFZA 4GX5A 4EUHA 3N58A 1Q1NA 2FZWA 4YA6A 1XSEA 2OP0A 4F46A 5TLSA 3MCVA 3VH1A 4G5HA 2IZ1A 1J5PA 1E3WB 2Q2WA 4H3VA 1LBEA 1QYXA 3VZSA 3GY0A 1UH5A 3NKLA 3KUXA 2Y05A 3ETGA 1E7YA 3M1LA 4W7HA 4WEQA 3MWDB 1MX3A 1E7QA 5ICMA 2BELA 1DRVA 1PQPA 1E3EA 1SC6A 3ZDFA 4FJ0A 3KETA 2JD0A 3MJVA 1CERA 2NNLD 4IS3A 1T25A 4OH1A 2W8ZA 2JCVA 4AVYA 1AUPA 4MJLA 3JQAB 3E1KA 3IKVA 3JQFA 3RFTA 1PTJA 4OYRA 1LSJA 1LXCA 3NGLA 2CF6A 3PJDA 1X7DA 4CV2A 4IZIA 2BFOA 2EKPA 2RHCA 1N92A 3F4LA 5EINA 3AJRA 1LRJA 2FR0A 5IZCA 5G4LA 4NU5A 5EL0A 3FTNA 4EI2A 3CSDA 5COQA 5K6AC 4A7PA 4TKMA 5G0WA 2ZYAA 5ILOA 1DXYA 2CMDA 1Y8RB 3O8QB 3TN7A 4F45A 2B4QA 1G0OA 4A03A 2QG4A 2R2GA 4J1NA 3AY7A 4XD2A 3SX2A 3GQVA 1V9LA 1LQTA 2EP5A 3L0DA 3Q11A 4NG5A 5DP2A 4TZTA 3PYXA 4OOFA 4M86A 1ZJYA 4RF4A 4BNUA 4RDHA 3DMTA 2ZTLA 1H94A 3PVZA 4IGFA 2D59A 3DONA 4DPMA 4WEOA 4GVXA 3ZN2A 2E82A 2JL1A 2Q1WA 4IJKA 4JXKA 2Y1GA 7MDHA 2A94A 4WCFB 4BHTA 4GMFA 2FPIA 2VWGA 3N74A 1GV0A 4DRYA 2W4QA 1HDGO 4I9HA 4PFJA 4GH5A 1BHSA 2G76A 4ZQFA 4BKUA 5A9SB 3RC1A 4XIJA 4KDFA 4B7UA 1PJ4A 1R4NB 2X7HA 4DLLA 3WIEA 3B20A 2YV2A 1TA4A 1ADBA 2JFFA 4CPDA 1B8VA 4J7CA 2E49A 2QIOA 4U5QA 5KVQA 4FGWA 2D2IA 4I1IA 2J3JA 3WGGA 2YHIB 1R0LA 3QLJA 2I5PO 2HMSA 3MTGA 2EKQA 4YJHB 5THKA 1DIHA 2CF5A 5CEFA 1L7DA 4NJOA 4DC0A 1CWUA 4NNJA 1HE2A 5L4NA 1Z6ZA 4G65A 3TL2A 4PVDA 3WGZA 4UVIA 3EZYA 3X2FA 3PQEA 2GN4A 2CY0A 2PH5A 2F00A 3Q6IA 3KYDB 1E1LA 2HRZA 3JD3A 1E3JA 1NPDA 4KTVE 3IOYA 4R9SA 1HZZA 4E5KA 4XGNA 3RFXA 3KSDO 1OC2A 5HTOA 2C2XA 4E2XA 4EJMA 3HQ4O 2CSUA 4J4HA 2AMFA 4A73A 3WGYA 1EBUA 2P5UA 4MVJH 3K73O 2WYVA 3JQFC 4CMAA 4J16A 5I8WA 2QQ5A 4OIMA 2PZLA 3HFGA 3DBVO 3WTBA 1JAXA 1XDWA 3AUAA 3BTUA 2CVZA 3GVIA 3O38A 3PQDA 4Y6RA 3JTMA 3TQHA 5B4UA 1DIGA 5F5LA 4NMHA 8LDHA 5JPIA 3C24A 4XYLA 4BO4A 5IZCC 2VNSA 1N9GA 3DBRB 1ADCA 1OC4A 4IMRA 1GCOA 3OETA 3WQSB 2EV9A 4BIIA 4DMLA 4ZVVA 2J3HA 4XKJA 5C7LO 1FF9A 5ENVA 2Y1EA 2ZB8A 4P8RA 3CXRA 2HQ1A 1AHHA 2NU9A 2X23A 4RCVA 2CVOA 2DBRA 4B4WA 3ZCXA 4ITUA 2NVBA 5H81A 3DZJA 3HUDA 1VPDA 3C7AA 3AI3A 2PKQO 3V2GA 4N5MA 4AJJA 1K5HA 2CDBA 1L1FA 3DMTC 1KIFA 1E7RA 1YRLA 3AFMA 4RVFA 1OBFO 2YQ4A 2BI7A 1H0KA 4BNWA 2EHDA 4A5OA 4BO6A 3GVXA 1DEHA 2NLOA 4L75A 1WDKA 3CEAA 2PWZA 3FI9A 5TS3A 3SC6A 5GZ3A 4CQMD 3IUPA 3KHUA 4M49A 3JD1A 3K2EA 3M6IA 2EW8A 4MVJA 4RQUA 2O3UA 3RUCA 4KUGA 1GUYA 4D41A 4Y6PA 3UCFA 2IODA 5AVOA 3WIDA 3PIDA 3KM0A 1LLDA 2C82A 3OJEA 3RROA 1NTOA 2Q1UA 4FSHA 3RC7A 1PZGA 3FPLA 3DDNA 1LDGA 4L9RA 4RF3A 3DAGA 5EQFA 4BO5A 3EW7A 1LSOA 2ZTVA 4J7XA 3HFSA 4KMSA 1ZFNA 1NNUA 1BMDA 5L4SA 1ENPA 1H2HA 2JJYA 1ISHA 4I8XA 4KWHA 1DHTA 3MWEB 2YDYA 4J9UE 1VL0A 4NR0A 4BO7A 3EUWA 1FJHA 2Q50A 3ORFA 3P2OA 3WNQA 4IM7A 5KJ1A 3E18A 1C0IA 4UUMA 2ZQZA 4A0SA 3JQAD 4HP8A 1ZJZA 2EWMA 2X9GA 1JVBA 5TJ9A 1BGVA 4LRTB 2O3QA 2QX7A 5KJ6A 3O26A 3H3FA 1J4AA 4UEJA 1CQIA 3ZWYA 5A06A 4GKBA 1P33A 2OBYA 4Z9XA 4NQZA 1FMCA 4CM3A 1AGNA 4L73A 3WG9A 5GMOA 4C4OA 2FSVA 2X5OA 3E5RA 4I5FA 4R54A 1YO6A 2Y1DA 3E48A 3G17A 3GDOA 3WSVA 3F3SA 4HWKA 5AXAA 1YONA 4EZBA 4WLOA 3VZRA 3AOGA 2Q2VA 3ZNOA 1C1XA 4BKOA 4O5OA 3BMOB 1PWZA 5COAA 3WWZA 2W98A 4AJHA 2WSBA 5AXDA 4R1TA 5L4LA 1DC4A 3VKUA 3KYBA 3HNPA 4UVHA 4UUPA 1WMAA 5JS6A 3GZNB 5EN4A 4EYEA 3KTDA 2FWMX 4W82A 3AK4A 3INGA 5BSFA 1W4ZA 1Y9EA 1A7KA 1JU9A 1Y5MA 3DZFA 1PR9A 4HFJA 4U0JA 3OQ6A 3INRA 5CPFA 1A9ZA 2P4HX 3Q2KA 3CMMA 5L7TA 1F8FA 1UXHA 2VWHA 1LLCA 4YQZA 4NBRA 3HHPA 3JSAA 3AY3A 2D4AA 3NJ8A 2X4GA 5JC1A 3H9JA 3BTVA 4L74A 5FF9A 1KEVA 5F1PA 3GHHA 4FN4A 1H9BA 3IJPA 5LC1A 4OO3A 1XQ1A 1SO8A 3C3XA 3NX4A 1R12A 2J3KA 4WLEA 2O4CA 4MVJP 3HDJA 5EIOA 4XEHA 1EVIA 2EJWA 1C0PA 3UOGA 1U3WA 4L4RA 4RLSA 4IDGA 4X54A 4YB8A 4RVUA 2VYNA 4Z9YA 4NHEA 2NQTA 2R00A 1ADGA 1OMOA 2DPGA 1HETA 3QWFA 4FB5A 2WYWA 5EMHA 3ZWXA 1VI2A 5JAZA 2I3GA 3QWIA 4ZJUA 4IQGA 2DT5A 4OL9A 4Q3BA 2VZ9A 1Q7GA 4P38A 4YVFA 4BNLA 1H6DA 4FFMA 2PLAA 3VVBA 1ISIA 4ZHSA 4RPLA 1UXIA 1UP7A 2AE2A 4AFNA 3VOSA 4E13A 1GEGA 3RUFA 1GD1O 1Y81A 5CEJA 2IZZA 3ZHZA 2CFCA 2VUTA 3RUDA 3GN1A 4ALJA 4KTTE 4D45A 2DVMA 1ZVMA 1YQXA 1CETA 1GAEO 3RUHA 1XA0A 5THQA 2YW9A 1DAPA 4CLDA 2EEZA 1LSUA 4GX1A 1RJWA 4WCDA 3VVCA 5JSFA 4FDAA 3CH6A 2GYYA 4TROA 4LMPA 1Z73A 3RBVA 4BVAA 2XAAA 1GCUA 1HSOA 4FOSA 4B3HA 4CMHA 1IZ9A 3H5NA 2O7SA 1YL6A 1O6ZA 1YJ8A 1FDTA 1WPQA 3KLPX 1K6JA 3OJ0A 3NGXA 4OKNA 1BWSA 4XWYA 3K6JA 3LT0A 3EGOA 3PHHA 3IP3A 1SOVA 3RSHA 3F9IA 4WECA 3G1UA 3SXPA 4BNNA 1ZSYA 1YDEA 5TF4A 3WXBA 3VH4A 1XGKA 4CM7A 3KEOA 4M89A 4XB2A 4OMUA 5I9LA 3KRTA 2B4TO 4FC7A 1X0VA 4XQGA 3I4CA 4YPOA 5U9CA 2VCYA 1T2AA 1UAYA 3VAZA 4WNCA 2QYSA 4DLAA 3JYNA 4M54A 5B4VA 2DUWA 4NJMB 2UV8A 3JQ7A 4J7UA 1XIVA 3TWOA 4CMIB 3FRJA 1ADFA 1C0LA 5EESA 2YY7A 1JTVA 4PZEA 5JFOA 3H3JA 3IUSA 5T6BA 5L40A 3B1KA
chains in the Genus database with same CATH superfamily
3PIRA 1DEKA 1LNQA 2QY9A 2AEEA 1D04A 3DZBA 4MVYA 4D9IA 4AWXA 4HHEA 3KQHA 3O3CA 2V7WA 3PHIA 3KE9A 4L5IA 3W79A 2W4MA 4C88A 2FP4A 3B7WA 2IIQA 4WK6A 4CCWA 1OI4A 2XHZA 4S12A 4RTJA 3E81A 2H8GA 3P9RA 3R7WA 2VYFA 1ZX1A 1EXNA 1J8VA 5EWLA 4BV2A 4MEBA 2AJTA 2NZXA 1W87A 2ORED 2P62A 3EAFA 1FSZA 2QRVB 2WJPA 4URVR 5JSZA 3N8HA 2X0NA 1RPAA 1FYDA 3AR3A 3AIOA 2BKEA 2XW6A 1JA1A 3ILHA 5JJIA 2J3QA 1DG3A 2K87A 4Y1FA 1D2RA 3CRVA 3R9IA 3COZA 4KR9A 1US8B 2YYSA 4TMXA 1C9JA 4KH1A 2PIDA 4MS1A 3WZLA 1PFYA 3OEHD 2VZEA 1JQBA 1XZJA 3QPUA 4Q1EA 4H9GA 1CY7A 1YFLA 3GEBA 4P2GA 4ARCA 3AVWA 3PC6A 4A0RA 3WGVA 1E9AA 5I7EA 4DIFA 2XUJA 1DAGA 4LDQA 2IKQA 4KDRA 3GHYA 4JQZA 5JZMA 1JLHA 5ADHA 1A9QA 3WB0A 5FL7A 2WP0A 3R5HA 2EDCA 2OFXA 2Y71A 1V96A 1O77A 4QTZA 1YZVA 4YRFA 4WKBA 5DCUA 2B5WA 4JKYA 1KMCA 3OBBA 2BKXA 3CQ9A 2ZR7A 1Z6AA 1LI4A 2W83A 4HRAA 1B8PA 4HH3C 1KMHB 4KRFA 4KPUA 1JQAA 4F2HA 1TEZA 4XEUA 3JSXA 1E6WA 2E21A 3CW8X 3JQCA 3GQBB 3HDVA 5T5QA 2WTAA 4WX2B 2ASEA 4JR1A 3KFVA 2BY4A 2P3QA 4PWYA 5C8YB 3QEAZ 4L85A 5DT9A 4KYVA 5FWDA 1FDVA 4YT5A 5JLAA 4A4DA 1A1VA 2ZITA 5B1HA 1YZNA 4NDZA 4PG7A 4QC2A 3OH8A 4RGBA 1JXOA 1XEAA 3KVOA 5ESDA 2WQ7A 2OUKA 1N7IA 2VTDA 1TO2E 3EXG1 1USIA 1ATZA 1DBSA 1WVMA 2NU8B 1XHLA 5FYDA 1QGOA 3DFUA 3TI9A 5DNVA 4AURA 4EY8A 4OXXA 2PSDA 4JZYA 4HZGA 1EVQA 4IIYA 1GVNB 2H0AA 1WMFA 4MLCA 3E84A 3JQ8A 4F3CA 3DAOA 1BIFA 1GHTA 3KDSE 3QWAA 1NBIA 4BVKA 5LD2C 4BO0A 5FTWA 3CLTD 4Y2JA 3PEEA 1YDGA 4G63A 4H08A 1M76A 1QFSA 3PYLA 2B4AA 1U8AA 2IW3A 2BEUA 2RHGB 3JZFA 2WD7B 3IELA 4ND8B 4XOIA 4YI3A 1U2PA 4HDQB 4CDRA 5T3UA 5HKAA 1R0BA 5IM4F 3F6CA 1MG0A 3BGSA 4PPGA 4QUJA 3RRZA 3CJQA 3B2EA 2W5UA 3A6JA 1AG9A 4KYIB 2IFTA 2YUIA 1XL0A 5KDOA 1C9MA 2HMYB 2CLHB 1ZK1A 2EFEB 1P1KA 3WK6A 3NM5A 4BVJA 1Y34E 3O4IA 1WZUA 3SJBA 4QFCA 2CL6X 3KVNA 5DM70 2DKNA 2VSFA 1RXWA 4P53A 1IHPA 3K05A 1NI5A 1BEEA 2ZTSA 2JCGA 3F5FA 2Y8EA 1YL7A 3BWMA 5D3KA 4JV5B 3ROGA 2Z0MA 1TADA 4C30A 4WK4B 1NLUA 3A6LA 4R9UC 1XF9A 3S7TA 1H6CA 1M5TA 4C6TB 1GKKA 2CNDA 3CZMA 3OT1B 2WG2A 1V4VA 3RCBA 3WAJA 1QE3A 2BGIA 3DJFA 2PJZA 3H19A 4EBFA 2D2FA 1IHUA 5KOYA 5IT9A 3DJYA 3S1LA 2E4YA 1VIYA 4YAWA 3ULKA 4DADA 1KI3A 2G5GX 3QQPA 4R3NA 3W2TA 1XA3A 3DOIA 4PZCA 1C9EA 2AMYA 1TC2A 2HF2A 3PZBA 3GX1A 1I1OA 2N9UA 1Q84A 3PNMA 3QJ5A 4WKNA 2EFJA 4YJHA 2QRNA 3UAYA 1XFAA 3TVYA 3PTAA 4L27A 1L4FA 1W2WB 1JT9A 2QTHA 1YSCA 3QI7A 2Q7XA 3P5SA 3OUZA 4EGQA 1XU9A 2I7VA 5ALPA 3LLVA 5A4FS 5A4KA 3DTTA 4N0EA 3W3AD 3CHYA 1DKOA 2NO1A 1CEXA 5EHZA 5FV4A 3CVVA 1JDSA 3TAXA 4C5CA 4HT3B 3T7JA 4OA8A 3ILSA 2GEKA 1II9A 5CG2A 2IS1A 4HEHA 5EMJA 4BB0A 4TS1A 4B4DA 4Z5XA 5C52B 3VTKA 1AO3A 3QU4A 3VZCA 1HUQA 4R0VA 3GWGA 4BRSA 4E33A 3IPRA 2I2DA 1CF4A 1NMEA 1NY6A 2GZAA 4LZWA 4N0QA 3HO8A 1DOHA 5TARA 1NYTA 2IXEA 3BF7A 4N6OA 1DWUA 3FLMA 4XQ9A 3GLIA 1J99A 4HFMA 5DGDA 1BNCA 1VXRA 4NZ9A 4LHXA 5FD8A 4FS3A 3DHYA 3T38A 4RTRA 1U4OA 4FOOA 1HH4A 1QV9A 4HUQA 4Q82A 3VMFA 4BUCA 2H31A 3L05A 2PR7A 4DXHA 5CDTA 4KN9S 1DT5A 3G3EA 3GNQA 1J21A 3K70B 4DNOA 3TDMA 2HW8A 4D8UA 4DIUA 1Q92A 1QRAA 1N1DA 3TEJA 2JAHA 1RM5A 1JSCA 3B7GA 3FDFA 3GZ4A 5DYYA 5I8PA 4YY3B 2HSZA 3I6IA 4H6WA 3DB1A 4GOOD 3A2NA 3CO0S 4CETA 1MC1A 5TQ0A 2UVQA 2YYYA 3DBRA 4WA7A 4YI5A 2O06A 4HGRA 5E9WA 3DF9A 1HORA 3ZV5A 2YL2A 1VHDA 1NVXQ 4N65A 4WADA 5DX0A 1KSJA 1RACA 1NMXA 5DGXA 1QLJA 2NVOA 3Q7SA 3U56A 4OAQA 1HT1E 2E4UA 2JEYA 1ZLXA 3A4MA 1RM0A 3IKTA 1G59A 5ALGA 3R7AA 2DAPA 3OQ1A 3N7UA 5KWIA 3EEYA 1CU1A 2Q6LA 5KOHB 4B8ZA 2HRBA 3GFPA 3R7NA 3AM4A 2AYXA 1O08A 1YZYA 2WUFA 5D5QA 3WSTA 5IULC 3J81k 2JG3A 2HCJB 2NYAA 4HCJA 2REXB 5IP5A 2NZWA 4ABTA 3NYWA 5IJ0A 3HZZA 2XA9A 1H9AA 3MWJA 3PYMA 3RFUA 1J8QA 2J6BA 5AKKA 3UOAB 4BVBA 1PVVA 1FX0B 4S1OA 1KQFA 3ZHOA 4AQYB 4HNSA 5K05A 3NHLA 1S01A 3ZIUA 1SKYE 1XA4A 3W3ZB 1XDUA 1EVYA 2BEWB 2BF4A 2JLXA 3NXSA 2OENG 2HH9A 3C41J 1HY3A 2WD8A 3IGFA 3LI2A 4ILKA 3LOQA 4MVJE 2D1QA 4RZHA 2IYVA 5K45A 1CB7A 1ZW6A 2JI6A 3F5QA 4LMAA 4QEDA 2ZJ3A 1ZUD1 3ZW8A 3AG5A 1S6YA 1Z22A 3IXMA 1E1RD 3VR4D 3BJIC 2CMKA 3EH1A 4AYXA 1ENZA 2QVCA 2P1ZA 4IQ0A 3OHSX 2C20A 2OAQ1 3GUCA 4NWIA 2RFLA 1AH2A 4C2TA 4ALKA 4H1VA 4L4UA 4NNOA 2QD4A 1OB2A 2AZTA 2BKUA 2ILTA 2LCQA 3AHIA 3LGXA 1FUKA 5EUQB 1RPZA 2F3UA 4S24A 4F92B 2ZJ6A 3WLQA 2COUA 3A9CA 3WLPA 3FYTA 4TYPA 1UBEA 1OU0A 1JXAA 2NTJA 4L28A 4CKYA 1GAWA 1UBFA 1XNJA 4CI9A 5B4TA 3DD1A 4KXXA 1QPZA 5HS4A 2HIGA 1GPBA 4BNFA 1YKGA 2FN7A 2ZDGA 3HCPA 3TMAA 1SU6A 1JEDA 1F6WA 3GGCA 4G85A 4OU5A 1P4SA 2HWKA 1WRBA 4IS2A 1WU7A 1OWNA 1WDMA 4RD1A 4X6YA 2C7GA 1RZVA 2YUTA 4JVMA 5KI6A 5C0OE 2R65A 1ECLA 4FUQA 1WB9A 4LYAA 1TX4B 1TFRA 3TH5A 3ZHRA 3HUTA 2AOTA 3QUBA 4AY2A 4UCQA 3WIOA 1SXJA 2LDBA 1QG4A 3EDRA 1W73A 3NP9A 2QJWA 1JIXA 4AMGA 5AW3A 4WUTA 3U16A 2WM9B 2YCBA 3LZCA 4XR4A 5E8JA 1GFZA 4E5VA 3Q1LA 3WRYC 3O1JC 2ZYIA 3IHTA 3G49A 2HQRA 3T5AA 1L4MA 4B6QA 3E9CA 1ILWA 4J7AA 4NONA 4EO4A 4R0NA 3GZNA 5SV2A 4AY3A 3Q0EA 1U02A 1XVVA 2VNKA 1MAHA 4R9RA 4CIDA 4YRKA 3ZHSA 5IKPA 2BGWA 2QSZA 2GD6A 1H1LA 2PO7A 4TQUS 3U31A 1U5CA 3ZDQA 1EUDB 4HX2A 4ONEA 5AW9A 4IP0A 3B5IA 1J5EB 4K87A 2X6RA 2ZT5A 3OZIA 3PR3A 1WZNA 3OX2A 1J2JA 5KREA 4BX2A 2R6R1 1YB5A 1BFDA 1ZQ1A 2ILVA 2G63A 1IE3A 4RGQA 1T2FA 4A92A 4HEQA 4CTJA 2FMXA 3BFKA 1RQ2A 2WJ4A 1XALA 3G2PA 3OQBA 4WNAB 4OXNA 3GARA 1J49A 3D8RA 2WKQA 3S8MA 4AM8A 3H11B 3FBTA 4MVJF 4BDTA 3HI6A 1PGNA 2DWPA 4G23A 1K89A 1TMGE 2HTFA 2IL1A 4U2BA 5EKDA 3ZEAA 1BDIA 4CFSA 3C8UA 2R48A 3PA8A 4TTIA 5J23A 2ODTX 1TU3A 3MTBA 4YMSA 3VXKA 3BHIA 1P1JA 4UHCA 1ZNQO 4FHEA 4E46A 3FAKA 1PSDA 4W1PA 3TKLA 2B8JA 3UT0A 1T9DA 3R6WA 3TRDA 2XDYA 4QTUB 4A2CA 3EXG2 4KZKA 4AQ7A 1OFGA 5LXTA 1H4QA 3GNSA 3TZKA 2JH8A 2X0KA 3FVRA 3PUXA 3AF1A 4G4IA 3M0EA 3EEQA 5AW8A 5FOTA 2H51A 4PNZA 3ZHBA 3BMXA 5NLLA 1S2LA 3NLLA 5FFFA 4MW6A 4F5YA 3SQXA 4OJKA 3Q3IA 5DWVA 1Z0FA 2AN1A 2XMPA 2WKWA 1JR4A 1CVLA 2RB4A 3LL7A 3RASA 3HXOA 1WUHS 1FYEA 1Z45A 1V2GA 1BSVA 2IEBA 1AQLA 2POCA 2DPHA 4LK3A 1P61B 4YRDA 2A7QA 2K7FA 4GYYA 3LKDA 1GQQA 3A6DA 3PNKA 4GDMA 2ZYTX 1YU6A 2XGJA 3SBEA 4LDRA 4R98A 4BTVA 4NV0A 4ZU3A 2NTVA 1PNRA 2BSQA 2ZB2A 2SKDA 4X6LA 2FHSA 1ZXBA 3UHOA 2VDRB 4G25A 4XGQA 1L4LA 4XPZA 2ORVA 2V0GA 1LDBA 1FNSA 2F8SA 4IQ8A 4PQRA 4QTYA 4FTWA 4HRXA 2AN5A 1P6QA 3OQVA 5F5NA 1JFFA 5M04A 1VLLA 1Q91A 1SIWA 2Q49A 2QUKA 3IP7A 4D3XA 1I3CA 3AM3A 4QATA 2V4ZA 3G02A 3QBDA 3X44A 4EFLA 4Q21A 2HHAA 1QNLA 3CN9A 3STYA 1Q77A 3NBXX 3ONFA 4ZRMA 5H02A 2AVNA 3VC2A 4O8ZA 1QCYA 3PXEA 2OWDA 2GB4A 2EFHB 1QHEA 4PZUA 4ZALA 2VRCA 3K9BA 4DILA 3L7NA 2PQ0A 1CNEA 1GZ7A 1AVTA 2WILA 4PHGA 4BFYA 3NDRA 4TL7A 4LY0A 3LCUA 5GVRA 3VV3A 2XADA 4IJQA 3D7KA 1DINA 4J3NA 5BQOA 1Q0PA 3N0XA 3N2EA 4LZJA 4ZK6A 3JWHA 3EX7C 4NVRA 1L5NA 2ZT7A 1H2EA 3D1VA 3LM8A 4FGUA 2GHTA 3GUHA 5B6IA 4JQSA 1ZNXA 5HFAA 4CG1A 4FYXA 3Q8LA 4FXPA 3IA2A 3K9GA 4JJIA 2P4SA 4G86A 4KAAA 1N1GA 2LW7A 3D9QX 3H84A 2DQ4A 3BOSA 4Q3LA 3WQBA 1TUBA 1OHHA 3ZDZB 2XCRB 2IHJA 3DCIA 3QKTA 4QREA 1SHKA 5DOVA 5I47A 3IQFA 4JI8B 4FCCA 1ZKDA 4YUAA 5IBPA 1EM6A 1XBTA 4P58A 4CG0A 3EA4A 1DX4A 1C3VA 1OV6A 1P4AA 4MWGA 3ZTYA 1FMFA 4E08A 3IQDB 1QYWA 4J1TC 5TE9A 1KDVA 4Q37A 1IWOA 1XJWA 1PJSA 4M21A 1I2MA 2IUTA 4BO9A 2OOSA 1X8XA 5LJLA 1CEEA 3IJEB 4ZVLA 1YZTA 2Q5QA 1EX9A 3SG0A 2JLZA 1M34B 3PXUA 4DIEA 3DOEA 1HE8B 2Q41A 1NRWA 3N7TA 3JQBA 4P0TA 5CEEA 5HOEA 3IQWA 5JCXA 3QE9Y 1YGPA 2BRUC 1DJOA 2PRIA 3PC4A 5KIAA 1RVV1 4PQFA 1SIOA 1Y6ZA 4E3WA 4BJ3A 3WNDA 4OGWA 1E5QA 1EFLA 5GJVC 3OICA 1O6CA 1Z15A 4XIFA 1TYAE 1X7ZB 2QGFA 4R1SA 2QRVA 3OFKA 2JLSA 3SM3A 1MJGA 5MHTA 1F5NA 3L8MA 4D42A 4AJKA 1U4SA 1TM4E 3AKDA 3O7WA 4DCCA 1WMEA 3RU2A 5C1DA 1NW3A 4W6QA 3MUEA 2PUAA 5A3SA 1R8JA 4RS3A 3WGHA 3L8HA 1FW8A 1G3QA 1HF3A 1US8A 2AOWA 2C8JA 3FGOA 4RKFA 3B48A 3UY4A 2O1SA 2PS3A 5G1NA 2NXEA 2X77A 1KAHA 2FPKA 2X2FA 3EULA 1F17A 1XXLA 3DZGA 4R2KA 4W9MC 2EG9A 4RV9A 1QDLB 4TSFA 3PVSA 2UXDB 3H0CA 3WGLA 1RZRD 1QANA 5HPYB 3PQ6A 3CT4A 5C51B 1CHDA 2DHDA 2Z5LA 5M5BA 4BZWA 3VFDA 2YOFA 5KBYA 3EN0A 3OKFA 3PC8C 4RLHA 1NJGA 2JEZA 4B6GA 2F59A 2QTNA 2YRFA 1N6NA 1PD1A 3DT8A 3I45A 3UMBA 1JMVA 1Y9AA 4S3MA 4BFWA 4MEAA 3KV1A 4W7SA 1EDBA 1BKYA 2IYYA 4HG2A 5BV7A 3E7FA 3OSUA 2GEBA 1VG8A 3IPXA 1HKHA 2HF8A 2B9EA 3R8XA 3CN7A 2C3UA 3ODPA 1ESEA 3R2JA 2PGOA 3I8SA 5D3ZA 1PBTA 3I23A 1G55A 1HRKA 1UC9A 1ZOSA 2OV3A 5HIJA 1QGUA 3N2LA 4KR3A 1GU0A 3D5EA 1N0HA 3Q3CA 5B2ZA 3W2FA 2NOAA 8ADHA 4IDCA 1E9CA 1ZMXA 4V2IA 2M6RA 1IQRA 4GL4A 4UBNA 1QKJA 1YAHA 3HVUA 5G0TA 2NU8A 5K99A 4OBEA 4AKHA 4TLLB 4PLWA 1NNEA 4OI2A 3B1WA 2GSDA 4X8HA 5A6SB 1GPMA 3SR3A 1JNXX 1EUQA 1C14A 1KPHA 4RY8A 1ZD1A 1H2BA 3KDPA 3PB3A 2HO4A 1U8FO 2O3TA 1SHUX 4RTPA 2QE7A 1RS0A 5A5EA 1P2GA 2XE6A 1HT0A 3GFTA 4LRSB 3R4VA 4CU5A 1GUAA 2OOKA 1F06A 1YDWA 1KQPA 1ESCA 1P2TA 3T35A 2BT4A 3Q9UA 1V47A 4ND8A 1F0NA 2WD7A 1FSFA 3EVFA 1T91A 5E7QA 5FULA 5JY6A 4MRSA 1D1SA 3DF7A 4E14A 4EAQA 2I0FA 3OHMA 2F4VB 4BV8A 2DHEA 1G18A 3LAWA 5IJZA 4KRGA 1QO9A 2GZMA 2W2QA 3FAZA 4JSRA 3VSBA 3V4RA 1UPXA 3G8YA 1F4LA 2OEPA 2ZJ1A 2B5VA 1QH9A 2FFJA 3W6UA 5ELXA 1DS6A 3W77A 1KMIY 1ZEMA 4L1KA 2CKMA 2GO7A 5CD9A 2SKEA 1XQVA 4WZBA 1I7NA 4JCCA 1B23P 3KQUA 3RVJA 2C0PA 4EQZA 1YVDA 2AH5A 4LA4A 1OKKA 3UHFA 4EG5A 1Z7BA 1EVZA 3WZ2A 1K4YA 1PL8A 1DBQA 4UBLA 3STTA 3ZCSA 1LY1A 1Y7LA 4ZEXA 5B3LA 2XTJA 4H60A 4P2BA 3WOHA 3AR7A 1H3NA 1QOZA 1VZ2A 4LNUB 5DNAA 4URYR 4AKSA 1GDTA 2GCPA 4M36A 3ST7A 2DULA 4DG5A 1E2NA 4OY3A 2EKZA 1GYPA 2NU9B 1JFSA 4IIXA 5GONB 4Y2HA 2GTHA 1YOBA 4K05A 2GA8A 1EINA 1X8LA 4FD3A 4UOQA 1EVEA 2FPRA 3OECA 4IL5A 4GSYA 1DTSA 1HSZA 1S2NA 2AV6A 1CUXA 3S27A 1G5IA 1XRNA 3USES 4BMVA 3UQYS 1GQRA 1BX3A 4DABA 3LX5A 4Z9BA 4MGHA 1AZSC 3DVAB 3EC2A 4IOMA 1V7CA 1DAHA 2DBZA 4JX9A 5E0KB 5K8TA 1TF7A 3HZHA 1WZEA 4YNBA 3WP0A 5FWNA 1R0KA 1GSHA 1SZPA 2A30A 2P9FA 1CR1A 1WNTA 3LCJA 1KVRA 3OE7A 3PJGA 4HADA 1KOJA 3LYHA 2PCJA 4MWEA 2PL1A 4WN3A 3VYUB 4DYVA 4YAGA 5TT1A 1TVEA 2IPNA 3C16C 5C8XA 2C7RA 1HMPA 1X15A 4C87A 3G59A 4WOKA 3LOPA 2ENWA 1HE5A 4Q24A 3SEZA 3TTVA 5BUQA 6GPBA 4OMCA 3BK7A 3EXIA 3GEGA 3DDUA 4F3NA 1E96A 4GUDA 1EWVA 2MDTA 1JSZA 3RD5A 1LBHA 3Q9SA 4IUCS 4KXQA 1MX9A 2P4UA 4IGIA 3KJZA 5AOCA 5C1PA 4AN4A 2HDNB 2AJLI 4X6XA 1DDGA 4FYPA 2IHZA 3QVGB 4FVTA 5CLGA 3F0TA 1Q19A 2B1GA 3M3DA 3VZDA 1NTRA 2FHPA 3UT5A 3V1NA 4LHYA 3SXJA 1E64A 2V7BA 3PU6A 2LKCA 4JI1B 3NHBA 3V2UA 3W90A 4BLTA 1PKXA 5B7GA 3MT9A 4YRZA 2FPUA 4W9RA 2BR3A 4DLYA 2CT8A 1T3GA 4C6RA 5KQLA 2XCSB 2DFTA 2A5DA 1K8XB 2OBNA 4H3KB 4O1HA 5F21A 5FQOA 3VTFA 1KXJA 4UNRA 5LVAA 1UXJA 3AL0C 2EXXA 3LZ6A 4U3JB 5JAQA 3W1VA 1B8UA 3KHSA 3MQ2A 1PT6A 4DDTA 4R8KA 1E3WA 4H35A 3BZBA 2QLTA 3FPGA 5HOQA 2FQYA 3M49A 1UIMA 1VMDA 2QUZA 2XUDA 3ME5A 1LQUA 3MWDA 4ZOBA 1TK3A 3FYHA 4TMFA 3L0BA 2PV0A 3ZD8A 2BCJQ 3EW9A 1P2FA 4NFLA 4V3BA 2B5OA 2G5TA 2H92A 4JVOA 5I3ZA 4BOYA 3LVFO 1HGXA 3TTTA 1KY2A 2ZXEA 1KBOA 2R8ZA 4EUFA 3AZOA 2M6LA 1DUIA 4LNAA 1C1XB 2IEIA 3MHTA 3QELB 1KC3A 4F9EA 1N7GA 3DR3A 3LHDA 4QGAA 1FX0A 3L4SO 3TZHA 1CUEA 3R3UA 4OHWA 1YB1A 2Z5FA 2RHTA 3R5KA 5TJHA 1M6HA 1YI8A 4OUKX 4YRIA 2JLVA 1YK0A 2XCLA 4OMDA 2B83A 4P7BA 1RKVA 4XUEA 3W8RA 4WY8A 3VDXA 5B1EA 2BEWA 3TOCA 3L46A 3BH6A 3OKPA 3AW8A 2YXLA 4Y6OA 3H4TA 2ZE5A 1S8OA 4OQXA 2XT0A 2IOFK 3EG9B 1TZKA 5DBFA 4BLWA 1SB8A 2Q1SA 2VTVA 5JDIC 3B82A 3KTFA 1GPYA 1SVOA 3PRJA 4O4HB 4RPCA 4ZOAA 1PS0A 4IO0A 2YMPA 4YXWD 4MV7A 2NZ8A 2ZUTA 1C1HA 3VDNB 1SEVA 3OQIB 3ZTTA 2IPXA 3D4LA 3JR7A 1M66A 2IYFA 4FOLA 1ETUA 4MPTA 5JT1A 5FI3A 1V35A 1YZFA 1N77A 1SKQA 1J33A 2QX8A 3LQRA 3ED1A 5DBHX 5EUBA 4AMZA 5KU7A 5F7XA 3NC0C 3TFWA 1YWGO 4D46A 3MEQA 4MRMB 2VZ8A 4G1CA 3RF6A 5DYIA 3WLIA 4LVUA 2FVXA 3H1GA 5CT9A 1GTMA 2H59A 3CO5A 1Z6YA 4TUYA 4P7GA 5B5SA 1BX1A 2JLQA 4F96A 4GLLA 3EB9A 5J5CA 1JL3A 1RYEA 2XMDA 3K92A 1J2EA 2NPIA 1SVSA 2QN1A 4MLPA 4TXHA 4NZNA 1ESMA 2GFIA 1T43A 1D6SA 1E69A 1KORA 4BE7B 1PDOA 2KPOA 3I53A 1FUEA 2ZBUA 4R4JA 3AILA 1UJ5A 4NXNB 2Y66A 1MJHA 1VM6A 2XKAA 3PNQA 4MGYR 4FDMA 5HBGA 5LWHA 4PC7A 2PL9A 3C7AA 5IDWA 1QCCA 1O95C 1ZMBA 4YRJA 3MA0A 1JIVA 5C2JB 2XUGA 1QX3A 1QIFA 3ZC3A 1L9KA 3AC0A 4OOEA 4DLSA 1EQAA 1TU0A 2PA0A 5C34B 3CWQA 2ZTUA 2X4DA 1P39A 3AOEA 3LNTA 3MCTA 4XJVA 5FPSA 4QO8A 1O96A 3TPCA 2ZJAA 3VTZA 4BTEA 2C29D 2C5BA 2DTDA 3BX1A 4DAEA 1JHYA 1SCDA 1XDZA 3ELUA 3QA9A 2X3UA 5C3MA 3AFHA 3U1TA 3LVQE 4F5DA 2FSGA 1AC5A 1W93A 4RQBA 5K6RA 1JKIA 5LUBA 1MORA 3U9TA 4BCCA 3AEQA 4KO4S 4Y6GB 1NW7A 1MA0A 4R5MA 1AZLA 1O57A 1D9XA 1VBNA 1GTZA 1QXSA 1PD0A 1SUWA 3SS9X 4YMVA 3GMDA 1PZHA 2FSPA 3LG2A 3M4XA 4C4YA 1BYIA 3UYLA 3DV9A 2VAVA 1LJ8A 5AM2A 2C7BA 5CFRA 2XLCA 1LU9A 4E07A 5IEBA 3ZV4A 3QEBZ 3O0TA 5LD2B 4XLTA 3N8GA 4LDJA 2WM2A 1U28C 2GLUA 3SNKA 3H18A 2WHXA 3RJMA 1RIFA 3VDRA 4ZFNA 1FLVA 1SAYA 1DAOA 2R6GA 2TS1A 5AM3A 1Q21A 2ORIA 2VJLA 4JI2B 2QXYA 4IIFA 5F1OA 1CUJA 3M4YA 4EG3A 4RD6A 3ENKA 1GTJ1 1KAEA 2GBIA 2ZFUA 2GF2A 1W0JD 3QG5A 1CEQA 4U2KA 4M0EA 3BQNB 3EZGA 5KJFA 3E3LA 2HD4A 1NX6A 3E53A 2JFVA 3A6KA 1EIZA 2BV3A 3HGMA 3R5FA 5TGDA 1O8BA 4DCSA 3UT6A 3ZJTA 1I0ZA 3FSRA 5K3OA 1OGJA 4D3DA 1YH3A 1GRCA 3I76A 2R8YA 3C39A 1XEWX 1R27A 1KP3A 3H9EO 3KJHA 3Q7IA 4ZI2A 1ZD8A 1AUQA 1OXMA 5DP1A 3THRA 2AG0A 3K15A 3WBJA 1JBQA 3ZW7A 1QP4A 3ZGVA 3N70A 1ZCFA 2KLBA 4I4TA 4AWAA 3FVQA 2VWQA 1X1TA 1KE1A 1H5UA 2P0EA 1ZAYA 1DELA 2Q0SA 1N2BA 5H0IA 2R8OA 4R2IA 1YJAA 2ZAYA 3ABSB 4F4DA 2A4KA 4UEKA 4R8SA 3T94A 4CLRB 1ZIXA 4P3PA 2CUTA 1PEKE 4IZHA 3FCEA 4XFKA 2RC6A 4TX1A 5K3FB 5DXJA 3MHPA 4MJ3A 5ABPA 1W35A 4CGYA 2C7OA 1WU8A 2XF8A 5M34A 2R60A 5EHIA 1I4OA 4U6NA 1SWWA 1AF7A 4KREA 3C8DA 1EE1A 5AM0A 3ABRB 1JSXA 1EFTA 2WVJA 4JJAA 4WCFC 5AI5A 1REQB 2J5QA 2QTMA 4OXQA 2NU6B 2A9FA 3K2QA 3VO9A 4XA8A 4LFAB 3EWNA 1Z6XA 1T4CA 3ZW9A 4IKEA 5ALDA 1R18A 1B4DA 4LDNA 2WSSD 3ZE1B 1WD7A 1Y4DE 1KAOA 1T35A 3FOZA 4FYKA 1KZGB 1Z7EA 2B98A 2EVWX 2OC9A 4Q4LA 3Q98A 3H9UA 5DSTA 1ILEA 3EGWA 2FF5A 4MP8A 1E58A 3CINA 4ROSA 2Q4BA 2X9VA 2IYSA 4N5NA 1TJPB 3FSEA 2VJDA 4CI0B 4ITVA 2GVDC 3IMKA 3OHPA 3G23A 3HY3A 5K8LA 1WTCA 2YXPX 3QXSA 4JXZA 4C4ZA 2OBFA 2WJJA 3PC7A 3VBEA 3LQYA 4DZZA 1TAGA 4N8SA 5DZSA 3FD8A 1KTIA 4FJ1A 3TG8A 2ES4A 3IH5A 1JYEA 4BJ5A 4YGXB 5E6SA 1I33A 1KP9A 4R3WA 1Z3IX 1BEUB 2D0IA 3DWGA 3VGPA 3VU9B 5JNWA 1BCSA 4A0FA 1FSSA 2QMEA 1FFXB 1MG5A 3M7IA 4B73A 1H5NA 2ORYA 1Q1AA 1Q0HA 1BFUA 3H1AA 2BM8A 3O4GA 1ZRMA 5JROA 1M34A 2LRHA 1C9YA 3G8AA 3U0VA 4TRJA 1DKMA 1LV7A 1XCJA 1DDOA 4BFTA 2ZXFA 4DLPA 2VN8A 3DL4A 4I5GA 1PGQA 4JP5A 3JS5A 3ERCA 2A33A 4MDHA 4WASA 4CNBA 1IUKA 4O6VA 3SKXA 4B3JA 3P2MA 1VBFA 4HYEA 3RSQA 3F46A 2JH3A 9LDTA 5MFZA 1DSSG 3GFOA 1X7ZA 1VB5A 1Y9JA 2RGNA 3MW8A 4BMSA 5L9AA 1E1KA 2C2GA 5KTMA 4DLRA 1U0SY 1Q57A 2CYBA 1Y1SA 2BP7A 1M6NA 2AJDA 4ON9A 2CVPA 3RVQA 3E2IA 3MJDA 3OX3A 4DMCA 3LBNA 2BFBB 2GFHA 1QO0D 4RHXA 4WN9A 1O4VA 3INTA 2H7CA 2CL0X 4QUBA 3U5TA 3OIGA 3MZ0A 5KTTA 2X8BA 4M1SA 3VNVA 3PBKA 1L9XA 3LQ1A 4EELA 1LRKA 4LSWA 1S02A 1FDSA 4DJTA 5J5VA 1WS6A 4B3IA 2PRYA 2YDXA 5EKSA 3ITNA 4GEGA 5KKAA 1MD9A 4B84A 1P0FA 3U7RA 1RZUA 3TLEA 3D1JA 2V74B 3DL0A 3T4UA 5HZHA 1A8IA 1MQSA 1UJ6A 4QUKA 3WC4A 2Q4EA 4FONA 4Z4EA 4KUEA 2YOGA 4S1VA 1NMSA 3ZDBA 3S81A 4KQGA 2GA9A 5FYQA 1DRWA 2NGRA 2Q5HA 1BEZA 4XB1A 4YAOA 5T4EA 3X2EA 2YWRA 4JLPA 5D5PA 5GV8A 4J03A 4PE5B 3ZDDA 3TD6A 4KE9A 2NO9A 4IIEA 2GH1A 3VR2D 4ADSG 5U4QA 3K6SB 1WZIA 4MQ5A 1SCUB 4JENA 1DOZA 2NO5A 3DDZX 4XPIA 2BAGA 1KU6A 1I7DA 1M73E 1Z4PX 5J63A 3I1JA 3C3KA 2HWUA 4O8CA 4RZQA 5TV2A 1QQ5A 1Z8DA 1E5VA 4KPYA 2NADA 3OCVA 4G0OA 3PXDA 4MQEB 4U2FA 1PR3A 1V8ZA 1NUHA 3GA0A 4EEXA 1VB3A 2W6NA 3VHRA 3TBHA 4C7VA 3GFFA 1GZVA 4M53A 1VDMA 4Q01A 1DAIA 1CIJA 2Q3HA 1M0EA 1TKRA 5FOXA 1JG6A 3O8NA 3RBAA 3V8BA 2DHQA 3N2NA 5CFOA 4UULA 1GILA 3AI1A 3B52X 2CXNA 5FQNA 5BMOA 1DAFA 4E5NA 3UKOA 4CHTA 1OIXA 4QX6A 4C5BA 5A3RA 3R9XB 3BIXA 4KRYA 3RWBA 5CK4A 3E3OA 1M8PA 5HMLA 1P0CA 5DHRA 5DLEA 4FZ5A 3ECSA 1U0RA 1VIMA 3KOOA 3K32A 4D5EA 1OWLA 1PFWA 1KAGA 1UMBA 2D13A 3PKIA 5JZSA 4DEVA 2QNBA 4MP3A 3OA0A 3UICA 4FR0A 3X1YA 2Q3FA 7MHTA 3UTDA 2Q3BA 4WY2A 1GYQA 4Q7KA 1ORIA 5REQA 1FDRA 2B9VA 5JAUA 4CR6A 3IV9A 4EUSA 2LR0A 1C1YA 1KU0A 1VRWA 1ZD2P 2J5KA 1VKRA 2O0LA 3H04A 4QSMA 1NSYA 2V55B 3OTWA 4Y18A 2VJMB 1M6EX 2HADA 2WHPA 621PA 5TPZA 1TF5A 4C06A 2OXCA 4XUGB 4LCBA 5CFPA 2AWOA 4OYLA 5G4KB 4N5IX 2Q5JA 3HYRA 3S1SA 1L6RA 3ADOA 3MOGA 1ZK2A 3T99A 3I2GA 2JI7A 3PPXA 4ETIA 1Y7IA 3NTUA 2A9RA 1G7SA 2VYVA 4QJ4A 4CODB 4YYZA 1NM5C 3TRKA 2Q5FA 3DZ8A 3P94A 4LNUA 4RETA 3RRFA 1NNSA 4GYKA 3B1XA 5C53B 4LK2A 5BMVF 3DW3X 3LFUA 1XKQA 3ENQA 4OAOA 2W2XA 3TX6A 1L7RA 2BF7A 2V7VA 2GAIA 4C7BA 3EY4A 1NXOA 1UINA 2H2FA 3EMKA 1JAYA 4Z6KA 2QVXX 3GA7A 2W2MA 3SBDA 3H5WA 4YRBA 4ZIRB 2A1UA 2NPOA 3HJCA 3ICOA 5BSVA 1R3DA 4ZVOA 4D44A 4WFQA 4EVIA 2AK2A 2ECFA 3P1JA 3GAFA 3G0GA 3BULA 1TRKA 3F96A 2X4IA 5EHXA 4HH0A 1LDMA 3D0RA 5G3ZA 5CNIA 5JOQA 4FEYA 5A2QA 3DP9A 3LPLA 3A6PC 2I2AA 4J07A 2XD9A 2Z58A 3MQ4A 3RSLA 2BFEB 4PGMA 2N46A 2C2MA 3JY6A 4AS2A 2FZEA 1I24A 1L5ZA 2F3TA 3V80A 3OY7A 3QW4B 2BM9A 1MJ5A 4L3OA 1GGHA 1Q6YA 5H1YA 4ZVUA 4Q7EA 1SHTX 4JJZA 3D6VA 5ALMA 3MG9A 4JJEA 3WQQA 3CLTC 2W2OA 2OK8A 3D4PA 2IHVA 1H2RS 1UKYA 4B82A 1GNVA 3PENA 2V54A 1GZUA 1A9YA 5IKMA 3KQMA 1NVBA 2O2ZA 4MQUA 4ZOEA 1N7HA 1Z82A 5EGSA 5SZJA 4NBWA 2DY0A 5FL7D 2VL7A 3EVCA 2J8ZA 3GLVA 3RO7A 4W5RA 1XLUA 4MAMA 3BILA 3DBOB 3CUWA 1L7QA 5BNZA 3E22B 3FUTA 5AM5A 3WLLA 1QJ4A 4MVJM 4NABA 4ECAA 1T1GA 2WT9A 2VATA 4IUYA 2BDEA 2GJ4A 5A4DA 1UL1X 1ORVA 3A9UA 2JGFA 1KFBB 2MMGA 3K9HA 2GM3A 3FPKA 4NXMB 1NF3A 1V0JA 3OZFA 4KWIA 3THSA 1V16B 4GC9A 1PR4A 4CF3A 2G4VA 3MB8A 3W05A 2RKOA 2YVKA 3G0CA 4KWTA 4CMEA 2JCBA 3BTSA 3FHCB 4P80A 5DFAA 3RADC 3AY6A 1PYOA 2QVLA 1Q1EA 2R1UA 2ZUBA 1F7VA 4CEJA 2OR3A 1NIPA 1U7HA 2GEDA 2LD4A 3HYNA 4TRRA 3CEPB 2PUGA 2HNKA 4ZOQI 3CH4B 4UE2A 2FJ0A 1U1GA 4KGVA 3Q5GA 1FC0A 2XVAA 1TIPA 1GZ3A 2XB6A 3ZE8A 4B8WA 2HJGA 2CZQA 1F2VA 4RMNA 3ECAA 1RWOA 2CE7A 4PS1A 1WDLA 2AHRA 2C99A 4MB0A 3SLRA 2FOXA 2Z4SA 3I5MA 2XXAA 4KQKA 3X43A 5BYKA 2OCGA 1J7KA 1QV7A 2P6NA 5E0OA 4G97A 2H7XA 4U7FA 5D8DA 2CXOA 5EJMA 1NHGA 4TN5A 2XH8A 3DWEX 3E2PA 3NUGA 1YS1X 3ET5A 2IUSA 5JNLA 1E7MA 1JUDA 4L22A 2ADOA 3VR3A 4DRXB 5KZMB 1E2GA 2C5GA 1ULZA 4F4JA 4HQOA 1R1DA 1Q3HA 3LK6A 5A9TA 3N39C 1ODLA 3OJXA 1KNQA 4DIKA 4EITA 2AFIA 1L1RA 2PD3A 3RFVA 3WO1A 3TIVA 2C4VA 3DTVB 4OXRA 2DPXA 3WLKX 5H83A 3A27A 1D6NA 1QLWA 1ZGHA 3ZJVA 4FNMA 4EKYA 4GE0A 4NBKA 4B7ZA 1S5PA 3P2EA 4ALMA 3LUAA 3L5OA 4NECA 2H07A 3T9EA 2KS6A 3V3KA 3TM4A 1QBGA 1XZNA 1YGYA 2DYKA 2I4MA 1FYVA 2VHCA 2JEOA 1AGYA 3IVXA 3LQ4A 2JHFA 1GTRA 1DFHA 5ITZA 2N3ZA 5HRUA 1P19A 1XHEA 1KZYC 3UV7A 3BFJA 2Z83A 3C3BA 4AS3A 1QG0A 2ET6A 4UPEA 3WHPA 4DIDA 2DWCA 1Z62A 1VRVA 2PX3A 2WWFA 4BQQA 3T5MA 2JFUA 3WDMA 2CB0A 3RRJA 1SEPA 4GVLA 4N54A 2XMZA 4FZJA 1E18A 4RPKA 4GR9A 1HDXA 4NPAA 3T3MB 3ZWAA 4AJLA 5CIWA 5B7QA 3A11A 3K09A 1Y82A 5KYTA 4N82A 1R88A 1JSRA 2H1VA 4MWCA 3I9V1 3GK3A 1OXSC 1TZ2A 1NW8A 3OPYA 4IXTA 4XSVA 5GM1A 1MDBA 4ZCRA 4OATA 4AKGA 1URPA 3R3SA 4L4ZA 3UUWA 1VP3A 3EIUA 3PK0A 1IM5A 1SKUA 1PJCA 3LC2O 3PCTA 4PR3A 3L2OB 3T61A 4CQLB 3FUCA 2DP4E 4COOA 3HG7A 1SVMA 2CBGA 4N3BA 3FIUA 3HUFA 2F1OA 1Y5NA 3VPAA 1W1UA 3H2IA 4UHBA 1JA0A 3DGEC 4US2R 4QQKA 1X7YA 2COKA 1Q0QA 2LVBA 4QYMA 5DBGA 4AMYA 4C08A 1QP0A 1Y63A 3FJ1A 5CM8B 2IH4A 1AKTA 3ETLA 2JPDA 3WMXA 1AV6A 1C7QA 2PS0A 4YIKA 4KODA 2CCJA 2GBPA 1XLVA 2CLIB 4OBBA 5H4HA 3KELA 5FTJA 4CLOA 1AOXA 1FFDA 2Q46A 4KQFA 1ONPA 4D9MA 3THXA 1P4JA 2WF6A 3WYBA 4MR8B 4REMA 3ESRA 2V6MA 1Q0SA 1QS0A 1QIIA 4QFMA 4WW0A 3FGZA 2YN4A 3KZNA 3IIJA 3UW3A 1PX2A 5CBKA 3HE3A 4RDIA 5EXXA 4V3CA 4YCJA 1FMTA 3R5SA 4W6ZA 2V9ZA 3K4QA 2BZ1A 5K7SA 3FCCA 4OX9Y 1SKYB 2O7NA