2X4HA

Crystal structure of the hypothetical protein sso2273 from sulfolobus solfataricus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
129
Chain Sequence
LSRREFSYLLTIKRYNDSGEGAKINRIAKDLKIAPSSVFEEVSHLEEKGLVKKKEDGVWITNNGTRSINYLIKAHRVIEILLVNIGIDKQTACEYSKQFDYLIPEEIIDKLYNYLGKPSYCPHGLEIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transcription
molecule keywords HYPOTHETICAL PROTEIN SSO2273
total genus 47
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2x4hA00
5TRDA 5K5QA 3BPXA 1MGTA 1RZ4A 5K1YA 5HOOA 3EYYA 4UHTA 1XGOA 1FBSA 3U9GA 5FD6A 5FGMA 3WGIA 1O3TA 4KFCA 2HKOA 1FPQA 3RI4A 1I5ZA 1U5TC 3CUOA 2AS5F 2J5OA 4B09A 2NYXA 3FZVA 3V8LA 1K79A 5DD4A 1W5SA 1TQMA 4IHSA 4AIKA 3E6DA 1FYKA 4XRFA 3FWEA 4IJAA 2JZYA 2XUBA 3HRSA 3OOPA 1J2XA 2D45A 4R79A 2VBZA 4AD9A 1HBXG 3DV8A 2G7HA 1ZG3A 2P7VB 1YS6A 3WU1B 3V8KA 2VC0A 4UVAA 3E5QA 3F6VA 3K1MA 2CG4A 4EJWA 4I7HA 2O6GE 1RI7A 2VE8A 1PP7U 1XSVA 2DAOA 3R61A 5KVRA 3ZN0A 4G7HF 3JTHA 2WTEA 1KU3A 2EFOA 2P6TA 4P9FA 1FSEA 3VEPA 5BPDA 5CVIA 3WTTC 4GO1A 3NEUA 1TQIA 3GO5A 2D2WA 2DLLA 3LQRA 3SQNA 2GXBA 2ACJA 3KP4A 2ISZA 3B02A 3ZQ7A 1WKMA 2XVCA 3WTWC 1TLHB 5BS6A 3ML6A 1XB4A 4KIGA 2DQRA 5E18F 5L3DA 2K4JA 4ZYGA 3V7SA 4DQ2A 3CO6C 2D1VA 1YFHA 5DCMA 1FT9A 1FP2A 2O3FA 4OINF 5AIQA 5HDGA 4WCGA 5LBQA 4BNCA 5H6RA 3DP7A 3GW2A 3GFMA 2GAUA 2QBYB 3QP6A 2DU9A 4KMFA 1ZARA 4U0WA 5ICGA 2XV4S 1UCRA 1ZGAA 3HSRA 1FBQA 1BOAA 4QWQA 3L9FA 3BY6A 3HTSB 3C3WA 2JPCA 2P5LC 4KIBA 1W7PD 4MEXF 4DNCA 3G73A 1OYWA 1RNLA 2PEXA 4K2EA 2V1XA 2H6BA 2BYVE 3JW4A 3I58A 4EGZA 2YSRA 3JAMZ 3ZP5A 4YFNF 1FY7A 2HTSA 3DPLC 3IWZA 2FEZA 5L3EA 5H20A 1Z7UA 2GA1A 5FLXZ 2V1UA 5DD8A 1KYWA 1FLIA 3P9CA 1SFUA 4LMYA 1ZRDA 3BWGA 1ZRCA 3R6SA 2HR3A 1ZHFA 1IN4A 2JSCA 1A04A 3H3ZA 2RDPA 1ZAOA 5BQTA 1IW7F 1XGSA 3KLNA 4YG2F 4LK1F 3L2CA 2QM3A 4Y15A 4F7ZA 4R8HA 4RB2C 1XCBA 4LLNA 2EFWA 5E8GA 3ZMZA 3EETA 5LHGA 1E2XA 3V7CA 2GA2A 1GVJA 3L7WA 4L9TA 2FU4A 3RYPA 3BJ6A 1X3UA 6PAXA 3GXOA 1LVAA 1G3YA 3KEOA 2EK5A 2FBIA 1SD6A 2DK5A 5D6FA 1B9NA 4LD5A 1Z6TA 3GFJA 2OU2A 4EJOA 3I53A 4MEYF 1H9TA 4HA8A 1KU7A 4I2OA 5K5RA 2JTVA 1FOKA 3Q9VA 5HS9A 2K86A 4PGHA 3MZYA 3KCCA 3WE3A 4ZYDA 3TO6A 3P9KA 3DQVC 3N4MA 3JSOA 2QZ8A 3V4GA 2ZNYA 4KN7X 3MZHA 4WXDA 1HKTA 2QWWA 4OIRF 4M72A 4RGUA 4GCVA 3FM3A 2ZBKA 2JT1A 5A2QZ 4OIOF 1GHCA 2LDUA 3QPTA 2A5YB 1H0MA 4ZYHA 1J7KA 2PLYA 4ENKA 1R7JA 2OBPA 2FNPA 3M7GA 1S7OA 3F8CA 1HW2A 3CUQA 1USTA 1Y0UA 4KT5C 1IRGA 3LSTA 4CO8A 4HOBA 2XRNA 1AOYA 3QU3A 1I6XA 1T39A 3R0JA 5TJJA 1T6SA 3PQKA 1YS7A 5LLQA 2PMHA 4OU0A 1G3SA 3J81K 4WWCA 4RAZA 1EV7A 3WTVC 3U1DA 3IL2A 1R36A 1XD7A 2EV5A 2UXNA 1PP8F 2FOKA 5A2QK 2EFPA 3HTUA 3I54A 4A0ZA 4M9XA 3RDIA 2MC3A 5CVJA 1P4WA 4RB3C 1QGPA 5EEHA 3BJOA 3RYRA 2EV6A 2VBWA 2W57A 4N0BA 1F9NA 1MZBA 2CSOA 3FMQA 3E6BA 1DPRA 1EH7A 2ZKZA 4XLNF 1YYVA 3RTRA 2XKOA 2FQ3A 1FP1D 3SFZA 2R7DA 2VT2A 1QZYA 1FX7A 2BE5F 2NNYA 3ZMSA 1SD4A 4A0XA 1IZ1A 5LEKA 2G9WA 4H0EA 1Z1DA 3WODF 1BC7C 4HDVA 2D1HA 1BJAA 2RKHA 3BROA 4HF1A 4YIIA 1Z91A 4EM1A 3D5LA 4MTDA 1JHHA 3I71A 3FMRA 3O2PE 3O6BB 2YX7A 2KIFA 3HRMA 2XAGA 3RKXA 5J8CA 5DV5A 3M9AA 4B8XA 1I1GA 3IKTA 1BI2A 2ADUA 2MLKA 1Z9CA 1FNNA 4OMYA 4NQWA 1F4KA 2O8XA 1DDNA 1CGPA 3GWZA 2PBIA 2MBFA 5E1ZB 5F64A 3HOSA 4ESJA 4KN4X 4KYWA 4N9IA 2FF4A 5E1XA 5L3FA 2LNBA 3M8FA 4U7DA 2W24A 3ZMDA 4Q5SF 2FMYA 2K4BA 3T1BA 4IXAA 2ZO4A 3NQOA 5FLXK 1R58A 2WWYA 2IA1A 3I64A 2UZKA 3TO7A 5FB2A 5DYMA 3ZMUA 2ETHA 1HKSA 2F5FA 3B73A 3LAPA 4KDPA 4BAYA 2Q2EA 3O3KA 2V1DA 2ZFWA 2M87A 4G6QA 4M71A 3VODA 3J7AO 3ZPLA 4BXUA 3HSFA 2CWEA 2Y0MA 2L3DA 1O57A 3KP6A 1CF7A 1TW2A 1XGNA 2Z9OA 2KJCA 4AWXB 2IA0A 5CJ9A 2QENA 3BZ6A 1EH6A 2KIMA 5BOXA 3K1NA 2QVOA 4LG0B 4HV5A 4EM2A 2IJLA 1SMTA 3G3ZA 2K27A 2QUFA 5HLHA 2OZUA 2UXXA 3EQLF 2PN6A 1J59A 2YU3A 3C18A 2GZWA 3QPHA 3VFZA 1OR7A 1YLFA 1LEBA 4A5NA 3GF2A 3PFIA 2VOOA 4CDGA 4I98B 2VE9A 3P9IA 4JBAA 2FA5A 3V7RA 2VT3A 4UNOA 4ESBA 3KP3A 3CJNA 2QQAA 4UVBA 1UFMA 1MDMA 1XGMA 4D0PA 2HGCA 1I1SA 5LGNA 2IRFG 2XAHA 4HQEA 1WRJA 1O7FA 2ESNA 3LA2A 1S6LA 4MTEA 5DUIA 1MJBA 1V3FA 1S8NA 1REPC 3IHUA 4XSZF 2PJPA 2Z99A 4PZJA 4ZZDA 4G7OF 1BIAA 2FSWA 3N97A 5IT9Z 3T5XA 2CYYA 1U5TA 5FD5A 5ILVA 1K78A 5L3BA 2VC1A 2PFBA 1ZLJA 5CVRA 1ONVA 2EA2A 4JK1X 3E6MA 1R5GA 4G8XA 3FHZA 4EGYA 5JFRA 3R60A 1ZG5A 3EYIA 3HYIA 5JI6A 1R1VA 2R3SA 1VTNC 4AIJA 2BV6A 1W7PA 2EWNA 2P5VA 2WV0A 5K5OA 2KKOA 2KRFA 3QOPA 5CYVA 4CYDA 2KJBA 4XSXF 2PG4A 4A2UA 4IRHA 1SD7A 2PQ8A 3MAJA 2L4MA 4PDKA 1AWCA 5HLGA 1TBXA 1TTYA 1XMAA 2HFHA 3MQ0A 1YW9A 3FX3A 5D6EA 3WU0A 1F1ZA 1YW8A 2K02A 3KLOA 3VB2A 4G94A 1QZZA 3F23A 1LDJA 2VBYA 1U2WA 2F5CA 4HF0A 1RUOA 5LRRA 4IHTA 3ZN1A 3GLXA 2CFXA 5HDNA 1USSA 5FO5A 4AIHA 1J0RA 2XROA 2GXGA 4GXOA 4GGGA 2COMA 3AAFA 3RKWA 2CQKA 3NRVA 1ZREA 1YIOA 3KP7A 5HS7A 3IRRA 2M1BA 4ZZLA 3T8TA 5D4RA 4FT8A 3CDHA 4Z2YA 3ELKA 3WGGA 3Q9SA 4BH9A 5BMZA 2O0YA 4M9ZA 5HVQC 3ULQB 5DUKA 1IN8A 2XHKA 1O3QA 2UWMA 1MKMA 1OMIA 1W5TA 3WGHA 2GQQA 4LB6B 2RQPA 1OYIA 1WWXA 4YFKF 4HF2A 1YQAA 4EVIA 1MD0A 3WTUC 3F8FA 5BPIA 2GWRA 5LRSA 2XAJA 2XKPA 2P7CB 4BQAA 2XASA 1IXRC 5CVUA 4UVCA 5CLSA 2RGVA 2MH2A 2PI0A 5FFXA 3KEQA 4FX0A 3C7JA 1XDUA 4WXCA 2FMLA 3M8EA 1KYZA 2JRTA 2YPRA 1Q1HA 1IXSB 3WTZA 3ECOA 1E17A 2E7WA 3QAHA 2O03A 2A3SA 1YTYA 5DCMB 1MJ9A 2W85A 5H6QA 2X4HA 2CGPA 1LDKB 1JE8A 1LQ1A 1LDDA 5HDKA 4U0YA 4Y13A 4KIFA 4LLLA 2QBYA 2XAFA 4KMUX 3RKYA 5AONA 1FSHA 2VXZA 5HS8A 3KETA 2STWA 3RPQA 4LG0A 4ON0A 1HKQA 3CLOA 1O3RA 1SFXA 2Z33A 2Q0OA 1HQCA 3ZMTA 3OV8A 5HLIA 5D5VB 2DW4A 4CZZA 1QPMA 5D5XB 1G3WA 3JSPA 4RAYA 3IWFA 2P5KA 5ERIA 4MQVA 5ILUA 1S7AA 2C6YA 2RVCA 3E5UA 1U8RA 2M30A 5D4SA 2RV8A 3KP5A 2B0LA 1GXPA 1QO0D 3GVAA 1STZA 4CXFA 1P2FA 1U6GA 1P92A 3TQNA 2HWVA 4EV0A 2EFQA 4TV7A 4A6DA 1QQIA 1XSXA 4LK0F 4Q4ZF 1R5HA 1XSDA 4G9YA 3MWMA 4UV9A 1UB9A 2MD5A 4EJUA 1BI3A 4RB1A 1MDMB 4M73A 3BJAA 2DPDA 1B1BA 4ETSA 2IVMA 1LJ9A 1S3JA 2O61A 2CO5A 1KA8A 2EFNA 3VOEA 4OIPF 3R4KA 2Q8KA 5LEJA 5DDGA 3GZ5A 3MFKA 2BGCA 2ZXJA 2G7UA 4P9UA 5L3CA 2IPQX 3J81Z 3GUDA 3TOAA 3DPTA 2STTA 1Z6RA 3KZZA 4E70A 1OYYA 1K6OA 4G7ZF 3F8NA 2ISYA 2LKPA 3ABTA 4HQMA 4P96A 2GIVA 3BP8A 3FXQA 1XN7A 4L9VA 4HX7A 1C0WA 1W7PB 3IKVA 2V79A 4O5VA 2CW0F 5E8IA 4I01A 4LGWA 1FZPB 4FX4A 4ESFA 1P6RA 4M9SA 3GYHX 1ZLKA 4CICA 3HOTA 4R1HA 3RJPA 1RUNA 3FMSA 2P4WA 2P6SA 4ZH4F 1JHFA 1FBUA 5D5UB 2V9VA 1XMKA 3R0AA 3QRFF 3KE2A 2M45A 3K69A 3IC7A 3REOA 1FWZA 4Q48A 3I0TA 3FM5A 3U2RA 5E1WA 1HSJA 2DQLA 2IT0A 1JXSA 4HDUA 3ZMVA 4UUVA 2DBBA 3ROUA 3GEZA 5JR3A 1W4MA 1BC8C 5CVVA 3ERED 4ZYEA 3F72A 3FXUA 5E17F 2OD5A 5IT3A 3WTXC 2Z3YA 2HDCA 1ZYRF 4LJZF 1J5YA 4G6DA 2J5PA 2LF8A 1IAWA 3RPUA 4N9HA 3KZYA 4HAMA 4BHCA 3DFGA 4KA4A 2L02A 2RC4A 1B9MA 3SHFA 1D3YA 1G6NA 2HS5A 2VOPA 4BHPA 1BIBA 4MQ9F 2NAZA 3I59B 3CUQB 2DFIA 4O3MA 4HX8A 4A0YA 3JAMK 1R1TA 3HUGA 3QP5A 4I09A 4Y17A 1EH8A 2H27A 1KU9A 3DF8A 3E6CC 1WSUA 3JTGA 2MA3A 4OIQF 4HW0A 4LFUA 1YW7A 2HEOA 1YG2A 1D8JA 1R1UA 3K2ZA 3WTSC 1D5VA 2FBHA 4EJTA 1KU2A 1TW3A 1FYLA 1U78A 3LWFA 3HSEA 2ZNZA 1LEAA 4L5JA 4CHUA 4KUMA 2FBKA 2M5WA 1KQ9A 1B4AA 3H3UA 1DPUA 1P4XA 3ABUA 4M6YA 3TGNA 4A5MA 2P8TA 1SD5A 4YIFA 2DI3A 2VODA 4U0VA 1BN5A 2XGXA 1YO5C 4U88A 5EEGA 3SZTA 3KP2A 1KQ8A 2VBXA 3I4PA 2Y48A 2HZTA 4L18B 1V4RA 4RGRA 4EM0B 4HZFA 3BDDA 1HW1A 1FC3A 1TQPA 4IPAA 5JVTA 2BEOA 4L9NA 1P4AA 2AXLA 2YR2A 3L00A 2EV0A 2LF7A 2X0LA 4HYEA 1BBYA 2ELHA 1XCVA 2HYGD 3P7NA 1ULYA 3FF5A 2OZ6A 1OPCA 4I0AA 2ZMEA 2ZCWA 3ISPA 2IW5A 1DP7P 2E1NA 2QYOA 5DEQA 4QLCU 2IP2A 2L54A 3SXYA 5LGTA 2F5EA 2QQ9A 4YFXF 2IA2A 5LHHA 4IRIA 2E1CA 3WE2A 2F2EA 2FE3A 3T0YA 2A68F 2L01A 1IXCA 3HHHA 4XLPF 3TDUC 1ODDA 2A07F 2A6EF 5JHUA 3QU6A 3BOQA 3F8BA 2A69F 4RS8A 1IRFA 1WQ2A 1I27A 1ZRFA 4IRGA 4A6EA 2FXAA 4WF2A 4A12A 5IT9K 2TDXA 1OKRA 2HKXA 4HLYA 3RIRA 4L0YB 4NHJA 3FXRA 3HRTA 3GFLA 4PGGA 3L09A 1KQ0A 3F22A 2VONA 2DT5A 2NNNA 2EJRA 3C1DA 2EB7A 3E5XA 5ED4A 4L5IA 2ZMEB 2DPUA 1DUXC 1J9IA 1IN7A 3DKWA 1F5TA 1K7AA 4XBFA 2H09A 4IVNA 1HW5A 1CF7B 1B59A 4S05A 1L0OC 4I02A 1PUEE 4ENJA 3HIFA 1GXQA 4WK8F 1JGSA 1IUYA 3I5UA 1HSTA 2BBYA 3CTAA 4MGRA 2RNJA 4IF4A 1U3EM 3TOBA 2Z5UA 4HLXA 1B6AA 2MLGA 2M8EA 4KICA 1QBJA 4UV8A 3GZ6A 2ESHA 5D8KB 2WC2A 4WX9A 3E97A 2V6CA 2F5DA 4NB5A 3BPVA 4Q47A 3SZPA 3LFKA 1QNTA 4FHTA 1O3SA 3IRQA 5D8LB 1IN5A 2K7LA 4ENMA 1HXDA 1U5TB 3EDPA 2DK8A 4OMZA 4L0ZB 2NS0A 1LNWA 4AVPA 5FFZA 2OA4A 5L3GA 5E20A 4M6XA 2FNAA 3F3XA 4UXNA 4ASNA 1IN6A 3ECHA 4S04A 2LSOA 1ZH5A 2DTRA 5ICCA 3GX4X 4U7BA 1ON1A 2L4AA 5ICFA 3KFWX 1ZG1A 1K78B 4GYIA 2YX4A 1PDNC 1TNSA 4ENNA 2R7FA 2QLZA 1LB2A 5AIPA 4RGSA 3K0LA 1FYMA 3F21A 2OQRA 3MEXA 1UHWA 2A6HF 2MH9A 4BHBA 2DO7A 1ON2A 1R22A 3H92A 4O6JA 3K9TA 4I0BA 1RIOH 1J75A 1SAXA 4M74A 3CO7C 3J80K 3DEUA 3F8MA 3TKYA 2H94A 4CGZA 4P5OA 3T8RA 2W84A 3W6KB 1UHMA 2XAQA 2VN2A 3CUQC 3K1PA 1L3LA 4MHGA 4GYGA 1BI1A 2RN7A 2HYFA 3WTYC 1ZN2A 4P55A 3V8JA 5ICEA 3EUHA 4EQQA 5DCFA 3M1EA 4MNUA 3WG9A 4EJVA 1NHAA 2QQBA 4PCQA 1T0FA 2HOEA 3PQJA 1KGSA 1BI0A 5LGUA 1T2KA 3DXJF 2H6CA 1D8KA 3LA3A 1R00A 1IF1A 1S29A 5KK1A 3LA7A 1G4DA 4RGXA 3COAC 1TNTA 1SMYF 1Z05A 1ZGJA 3LQQA 4HV6A 2Y75A 2W25A 3J80Z 2ZJ2A 5LHIA 2NRAC 3W6JB 4LB5A 1H9GA 3GFIA 2HQNA 2JPBA 2FRHA 4HX4A 1SFEA 4WXHA 3HHGA 1R23A 2HQRA 4L9JA 1MJAA 3TDZC 1WI9A 4LLGF 2KIUA 3LAJA 3D0SA 1T38A 1XDSA 3I59A 3S2WA 5ILSA 3HRUA 4EMSA 5J8FA 5F1RA 4JQFA 5J6XA 3Q5FA 4OOIA 1T98A 3MCZA 2OQGA 4KNYA 5F6FA 2E7XA 1G3TA 2XIGA 2EA4A 2HTJA 2PMUA 4BYYA 3F6OA 4RB0A 5D5WB 1BM9A 3TO9A 4HBLA 1O7LA 2A61A 2OAZA 3E3VA
chains in the Genus database with same CATH superfamily
2DA4A 1SAUA 5TISC 2DYRH 5TRDA 2WAQN 5K5QA 2V9KA 3BPXA 1MGTA 4NUBA 1RZ4A 5K1YA 1ZR4A 1N75A 5HOOA 2JWTA 1VQPI 3EYYA 3S16J 1UG0A 1KZHA 1YX3A 2DA3A 3DLAA 1TWFJ 4M3FA 2EZIA 5FLVA 4UHTA 1XGOA 2L9RA 2XGDA 4H4KC 1FBSA 2X6WA 3U9GA 5FD6A 4MIMA 2EIJH 4XN0A 5FGMA 3WGIA 2E1OA 3ZQIA 2VXDA 3QPSA 2DMTA 2F48A 4U87A 3L2RA 3HKZN 3BG7A 1O3TA 4KFCA 2HKOA 1A6IA 3PL8A 3O8GA 2DA6A 2NVXJ 3H5RA 3KX2A 1FPQA 1B8IA 4EATA 1G2HA 1OFCX 3RI4A 1I5ZA 1U5TC 3CUOA 2AS5F 1N25A 2O5RA 4BY1J 3ZOBA 2J5OA 4B09A 4XLAA 2NYXA 3FXLA 1IRXA 1FMWA 3FZVA 1JKOC 1MBJA 2TCTA 2HXOA 3V8LA 1K79A 3CC2I 5DD4A 1W5SA 1TQMA 4IHSA 4AIKA 2IS6A 3HJEA 3E6DA 2BHYA 2XC7A 1PYVA 3HPHA 2GXAA 3IAM2 1FYKA 4XRFA 4I99C 3FWEA 2V4JC 4IJAA 4HNUA 2JZYA 2XUBA 1EA3A 3G1LA 3HRSA 3OOPA 1J2XA 2K3FA 3I56I 2D45A 4R79A 2KFDA 2VBZA 4AD9A 1HBXG 1MIJA 4BE1A 2Y0SN 3DV8A 2G7HA 3NAUA 2V26A 4DZPA 1WZ2A 3OYNA 1ZG3A 1RESA 2P7VB 3CCEI 1YS6A 3WU1B 3V8KA 2O7OA 2VC0A 4PJNA 4UVAA 3AG3H 3E5QA 4XNFA 3F6VA 3FXOA 1I3QJ 5IP6A 3K1MA 5EGOB 3CMMA 3OSFA 2CG4A 1JKQC 4A3MJ 1ETWA 2CMPA 1NG7A 3K2AA 4EJWA 4I7HA 4XLEA 2O6GE 1RI7A 2VE8A 1PP7U 3RPUD 1JKRC 1XSVA 2DAOA 3R61A 5KVRA 3ZN0A 4BU2A 4G7HF 3JTHA 2VJIA 2WTEA 3K10A 2FUG2 4LIUA 3DEWA 3MMYB 5GPCA 2BXZA 1BW6A 2EPFA 1KU3A 2EFOA 2QEXI 5F08A 2P6TA 4P9FA 2EH3A 5HNFA 1FSEA 3VEPA 3P5JA 2VJ4A 4BXXJ 2RREA 5BPDA 3ZQHA 1OCTC 5CVIA 3HOYJ 3WTTC 2YU9J 4N4OB 4GO1A 3OIOA 3NEUA 3LOCA 1TQIA 1WPKA 3ABMH 3GO5A 2D2WA 2NXNB 2DLLA 4DYQA 2F6CA 1I50J 3LQRA 3ZRGA 2W82A 3SQNA 2CQNA 2GXBA 2X6OA 2ACJA 3KP4A 1ZTRA 2QF7A 3DCFA 2ISZA 3B02A 3W6VA 1MMGA 3ZQ7A 4V19K 1WKMA 2XVCA 3H36A 4N4NB 3GMEA 3WTWC 2BVLA 1D0YA 1TLHB 4DBRA 5BS6A 3ML6A 1XB4A 4KIGA 2DQRA 2EZLA 5E18F 3EUKL 5L3DA 1V55H 2K4JA 4IKFA 2X1DA 3DU5A 1WJ5A 4ZYGA 3V7SA 4DQ2A 3CO6C 2D1VA 1Y8QB 2XAUA 1YFHA 5DCMA 1FT9A 4C3JJ 5K7FA 1FP2A 2DYSH 1SEUA 2DT7B 2O3FA 4OINF 5J1RA 3H3VK 3CF5F 2IXSA 5AIQA 5HDGA 4WCGA 1QZEA 4J00A 1VQLI 5LBQA 4C2TA 4BNCA 5H6RA 1BOBA 3DP7A 3GW2A 4FQGA 3GFMA 2KPMA 2XRLA 1T56A 1WFXA 4NNJA 4A3LJ 2GAUA 2QBYB 1XTAA 1UG2A 3QP6A 2DU9A 4KMFA 3JRBA 1ZARA 2Z1DA 4U0WA 4DYRA 5ICGA 2R7XA 4RMNA 1BJZA 3TW6A 3BLYA 2XV4S 1UCRA 1ZGAA 3ABKH 3HSRA 1FBQA 1BOAA 3MKWB 4QWQA 4RLFA 4ZYAA 3L9FA 3A01A 1MBFA 3BY6A 3HTSB 1PUFB 3B6AA 3KIOA 3C3WA 3IH2A 2E1MC 1VQ6I 2JPCA 3FKIJ 3KYDB 2P5LC 4RAGA 2DA1A 2JRMA 2OCCH 4KIBA 1W7PD 2DCEA 2MC4A 3JRDA 4MEXF 4DNCA 3G73A 1ZK8A 2Q2EB 5GAGJ 2RAEA 1OYWA 1RNLA 2PEXA 4K2EA 4BQOA 2V1XA 2H6BA 5EZGA 4B1RA 2BYVE 3JW4A 3Q0WA 4C3IJ 3I58A 2DODA 4EGZA 1DU0A 1VQ5I 1XC5A 4RLQA 3I4MJ 2YSRA 3JAMZ 3CCQI 2CUZA 1FY7A 4YFNF 3ZP5A 3BG6A 1JT0A 4G6TB 2HTSA 3DPLC 3K4JA 4YRVA 3A4CA 4PK4A 3IWZA 2FEZA 2MABA 5IOYA 3DPUA 5L3EA 4BY7J 4UUSB 3DBLB 5H20A 2MSYA 4XLFA 1Z7UA 2GA1A 5FLXZ 3H5NA 3EUHC 5FLMJ 2V1UA 1PUFA 2KP6A 4HEA2 1KYWA 5DD8A 3OYCA 3PUBA 3H9QA 4CUGA 2A6TA 2XF7A 1QPIA 1T33A 4E6KG 1JJ8C 1FLIA 3P9CA 1SFUA 4LMYA 1ZRDA 3BWGA 2K85A 1XG1A 1ZRCA 3GTPJ 1BR1A 3R6SA 2HR3A 2X1EA 1ZHFA 2Y0SA 3L1PA 1IN4A 2W4SA 3GCMA 2JSCA 3JCUC 2R7RA 1A04A 3H3ZA 4I76A 4Y33A 2RDPA 2CUJA 1ZAOA 1RETA 1IW7F 2L0KA 3QYBA 1XGSA 2IEKA 3KLNA 2KRHA 5BQTA 3U21A 4PJ0C 5E3LA 4PSXA 4V2FA 3MKYB 3CJQB 4YG2F 3VWBA 4LK1F 3L2CA 2QM3A 4Y15A 4F7ZA 4R8HA 4XOPA 4RB2C 1XCBA 3JRAA 2EFWA 4LLNA 2PJRB 4B3AA 1X4PA 5E8GA 3ZMZA 3VYTB 5M3FJ 3EETA 3D5RC 5LHGA 1E2XA 3V7CA 2GA2A 3MKLA 4CZCA 3CDIA 1JGGA 1YITI 1GVJA 3L7WA 1JTXA 2DMPA 3MN2A 3HC7A 4L9TA 4G12A 4DIQA 2IGKA 2DTZA 1S9HA 2FU4A 1Y0NA 3BJ6A 3RYPA 4M3EA 1X3UA 6PAXA 4ZDPA 1VNDA 3GXOA 1LVAA 1W5CC 3OL4A 1G3YA 3PSIA 3KEOA 4HSRA 2EK5A 2FBIA 2IS4A 1FOWA 1SD6A 2XSJC 9ANTA 4X0GA 2LVSA 3JRGA 2I10A 3VSLA 2DK5A 4C30A 5JHFA 5D6FA 1A6QA 1B9NA 4LD5A 1Z6TA 3GFJA 4CCLA 2OU2A 4F52A 4EJOA 2OTJI 3I53A 5C4XJ 4MEYF 2R4GA 1H9TA 1LFPA 3RZDJ 3ESWB 3HEFA 4HA8A 5GTIC 1KU7A 4I2OA 2K5CA 5K5RA 2JTVA 1FOKA 3Q9VA 1D1BA 2E35A 2XPWA 3HGYA 5HS9A 2K86A 4PGHA 1P7JA 3MZYA 3VYSB 4XONA 1U8BA 1UZCA 2K9QA 3KCCA 3MZ8A 3WE3A 4ZYDA 1MBEA 1ORKA 3TO6A 3P9KA 3V42A 2E2HJ 3DQVC 3N4MA 2JQ7A 3JSOA 2BY2A 3W2AA 3HKZA 2QZ8A 3V4GA 2ZNYA 4KN7X 3MZHA 4WXDA 2ZXIA 1HKTA 1A35A 2QWWA 5B66C 2ICWG 4OIRF 4M72A 4RGUA 4GCVA 3FM3A 1V54H 2ZBKA 2JT1A 5M5YJ 2LYCA 4HPQA 1MSEC 2QSHX 5A2QZ 4OIOF 1TT5B 1GHCA 3SEZA 2LDUA 3QPTA 2A5YB 1H0MA 4ZYHA 2GLOA 3M8JA 1TZLA 3GTGJ 1J7KA 2PLYA 4ENKA 1R7JA 2OBPA 2BZTA 2FNPA 3M7GA 2ELJA 3H0GJ 1FMVA 4CCOA 4IL6C 1APLC 4XK4A 1Q1VA 1S7OA 3F8CA 2R5ZA 1HW2A 3S1MJ 3CUQA 1USTA 1Y0UA 4KT5C 2GM4A 3DLLF 1IRGA 2L9SA 2GOMA 3FBIB 4F93B 3LSTA 4CO8A 4HOBA 2NVTJ 2XRNA 1AOYA 3QU3A 2WB1N 2OF7A 1I6XA 1T39A 4LITA 5IOZA 2Z2SB 3RCOA 2W00A 4M3BA 5C44J 4PSWA 1YHQI 3R0JA 2VKVA 5TJJA 1T6SA 3ZQFA 4BE2A 3PQKA 1YS7A 2CW8A 5LLQA 2HDWA 2LK2A 4CCMA 4BE0A 2PMHA 4OU0A 1QVTA 1G3SA 2LTPA 3J81K 5EGOA 4WWCA 4RAZA 2JA5J 2IAIA 1EV7A 1FIPA 3WTVC 3U1DA 1MMNA 3IL2A 1R36A 4DW6A 3S32A 2M2EA 2UV1A 2R5ZB 1XD7A 2EV5A 1ETYA 2UXNA 1PP8F 1UMQA 2FOKA 2BY3A 5A2QK 2EFPA 5GPAA 3HTUA 3I54A 4A0ZA 3BTLA 1ACIA 4M9XA 4UUTA 3CQZJ 3RDIA 2MC3A 4JX4A 5CVJA 1P4WA 4JX5A 4RB3C 1QGPA 2HNHA 3BJOA 3CDLA 1JUMA 4YELA 5EEHA 5F0FA 3RYRA 4IHVA 2DA2A 2EV6A 2FD5A 2VBWA 1Z0XA 2HQ5A 3G6EI 2W57A 4N0BA 1EKEA 4ZTFA 3QPLA 1MMAA 1F9NA 1MZBA 3RKQA 5F04A 1X19A 4XKWA 1X2NA 2CSOA 2HXIA 3PNTA 3FMQA 3E6BA 2BVMA 1DPRA 2RNGA 1EH7A 1A36A 1ETOA 4AUXA 2ZKZA 4XLNF 1YYVA 3RTRA 2XKOA 1FP1D 1E3HA 2FQ3A 2XSDC 1WJDA 2HOAA 3SFZA 2R7DA 2LMDA 3HOXJ 2VT2A 1QZYA 3OS1A 1W36D 1FX7A 2BE5F 3ONQA 4AC0A 2NNYA 4RM3A 2OPTA 1T95A 3ZMSA 3KYCB 1EJ9A 1SD4A 4X6AJ 4A0XA 1ETVA 2DN0A 2X9DA 1IZ1A 5LEKA 2G9WA 5KAIC 4H0EA 1Z1DA 1SVLA 3BCAA 4JYKA 1W0UA 3WODF 2VB6A 4HDVA 1BC7C 2HOSA 2D1HA 4ANJA 1BJAA 2RKHA 3BROA 2CQXA 1JI8A 4HF1A 4YIIA 4E7ZA 3MD2A 1UELB 2R7SA 1X3WB 1Z91A 2G0EA 3D5LA 4EM1A 5LFAA 4MTDA 1JHHA 3I71A 3FMRA 2I8DA 3O2PE 4B4CA 1D5YA 3AG2H 3O6BB 4CCJA 2VQGA 2KQRA 2YX7A 1KONA 2KIFA 3HRMA 3QWLA 2XAGA 3RKXA 5J8CA 1ETXA 5DV5A 1S5LC 3M9AA 1I1GA 4B8XA 3IKTA 1U9OA 4DYCA 1X1AA 1BI2A 2ADUA 2MLKA 1Z9CA 1FNNA 4OMYA 4IO9F 3ZQGA 1R4MB 4NQWA 1F4KA 1GT0C 3HPGA 2IGOA 2KISA 2O8XA 1DDNA 1CGPA 3GWZA 1MW7A 2PBIA 2MBFA 5E1ZB 2M9HA 2L9VA 3PNYA 5F64A 3HOSA 1VQ7I 4ESJA 4KN4X 4KYWA 4QTRA 4N9IA 3HGGA 5IYCJ 2FF4A 1ITYA 1EF4A 5E1XA 5L3FA 3OYAA 2LNBA 2DT6A 2LG4A 3M8FA 4BUPA 2GBYA 4E7SA 2ELKA 2B7EA 2AHQA 4U7DA 3IH4A 2KL4A 2DDAA 5EZHA 2W24A 1JJ6C 3GBGA 3ZMDA 4D7NA 3A1YA 3K70D 4FASD 2ZJQF 4Q5SF 2FMYA 1IO2A 2K4BA 1D0XA 3T1BA 4BJ6C 2R0QC 2B63J 3S17J 4IXAA 2ZO4A 3NQOA 5FLXK 1R58A 3OS2A 2WWYA 2JA2A 2IA1A 3I64A 2UZKA 3TO7A 5FB2A 1LVKA 5DYMA 4GFBA 2PX9A 2MW8A 3ZMUA 2ETHA 1HKSA 2KIQA 2XF5A 1TWGJ 2HYJA 4S0HB 3K4BA 1MNDA 2F5FA 2MYSA 3JR9A 3B73A 3LAPA 3DWLE 1HOMA 3IV5A 3G4SI 4KDPA 4BAYA 4B3XA 2Q2EA 3GTLJ 4A93J 3O3KA 1RPWA 2GIZA 2V1DA 4E4HA 4PJJA 2ZFWA 2M87A 4G6QA 2AO9A 2E1MB 2X48A 5FRNA 4M71A 4QIWN 1OJLA 3SDBA 3VODA 3J7AO 3M3YJ 3ZPLA 4FE7A 4BXUA 1VI0A 3HSFA 2CWEA 2Y0MA 2L3DA 1O57A 3KP6A 1PJRA 1TW2A 4DOZA 2LKXA 1CF7A 3GTJJ 1XGNA 3OIPA 2Z9OA 4IEJA 2JK3A 2KJCA 4AWXB 2NS8A 2IA0A 3D5SC 1D1AA 3CMYA 3LSJA 5CJ9A 2QENA 3BZ6A 1EH6A 4QPQA 2KIMA 5BOXA 3K1NA 2E5NA 3H1CA 5B1BH 2QVOA 4MLOA 2JVHA 4LG0B 4HV5A 4EM2A 2IJLA 3M4OJ 1U0JA 4J19A 1WJCA 2K9LA 1I3AA 1V5EA 1SMTA 3G3ZA 3DEEA 5FKKA 3OYIA 2K27A 2CH0A 2QUFA 5HLHA 2OZUA 2UXXA 3EQLF 2PN6A 1J59A 4B44A 2YU3A 3C18A 1RR7A 4XICA 3CZ6A 3E0JB 4PJLA 3OY9A 2GZWA 1WH5A 3QPHA 3TP3A 3VFZA 1FJLA 1MH3A 2ECCA 2FJ1A 1OR7A 1E3PA 3ZCOA 3NWTA 1YLFA 4AYBN 1LEBA 4A5NA 4P1WA 4UY8I 2WAQA 4KJZA 3TBIA 2DA7A 3GF2A 1Z67A 3CP2A 1IDYA 3QYEA 3PFIA 2VOOA 4CDGA 1RKWA 4I98B 4I6ZA 2VE9A 2O9LA 4XIDA 3P9IA 2ZSHB 4JBAA 2FA5A 3HOUJ 2CU7A 3V7RA 2VT3A 4UNOA 2DFEA 4ESBA 3KP3A 3FBNB 3CJNA 3FXKA 2PJRA 2ID3A 2QQAA 4UVBA 1QVUA 1UFMA 1MDMA 2JA7J 1XGMA 4D0PA 2HGCA 3OL3A 1LPQA 1I1SA 5IYBJ 2NS7A 3W2VA 1OQYA 5LGNA 2XAHA 4HQEA 2IRFG 1WRJA 3LSMA 1O7FA 2ESNA 3FK6A 4F92B 3LA2A 2B9SA 4B43A 1S6LA 4MTEA 5DUIA 4M3DA 1MJBA 1V3FA 1S8NA 1REPC 3IHUA 4XSZF 3HUGB 2PJPA 2Z99A 4PZJA 4ZZDA 4G7OF 1BIAA 2IS2A 2FSWA 3N97A 5IT9Z 4FETA 3T5XA 2CYYA 1U5TA 2R7OA 4IOCF 3J7ZI 4L5EA 1TT0A 5FD5A 5ILVA 1K78A 5L3BA 1H8AC 1RC9A 2VC1A 3PSFA 4X1EA 2PFBA 1ZLJA 5CVRA 5FROA 1ONVA 2EA2A 4JK1X 1XX5A 3E6MA 1X1CA 3CCRI 3A03A 3FK7A 1R5GA 2JVGA 4G8XA 3FHZA 3BG9A 4EGYA 5JFRA 3R60A 4XKBA 3ZQLA 1MBHA 1ZG5A 3FDYA 1IUFA 3EYIA 3LSKA 3HYIA 5JI6A 1R1VA 2R3SA 1VTNC 4AIJA 2BV6A 2VQLA 3OWTA 2H8RA 1W7PA 2K3PA 5TGTA 5J4VA 2CV2A 1VFCA 2EWNA 3BR2A 2QSGX 3I4NJ 2P5VA 2P81A 2WV0A 2QGUA 3M07A 1VQMI 2KKOA 2KRFA 3QOPA 5K5OA 2Y69H 3CC4I 5CYVA 4NDLA 4CYDA 4AU7A 2K40A 2KJBA 4XSXF 2PG4A 2MG4A 4A2UA 4IRHA 1SD7A 2BW3B 3PUFA 5HNHA 3HM5A 2PQ8A 4XM3A 4Y4RA 3MAJA 2L4MA 1JTYA 2NOGA 2HU9A 5JLWA 4CSWA 1IDZA 4PDKA 1AWCA 5HLGA 1TBXA 1TTYA 1XMAA 2HFHA 3MQ0A 1X3ZB 1YW9A 3FX3A 1ZGWA 2F4MB 3C2HA 5D6EA 4QPOA 3WU0A 1FEXA 2E36A 1A31A 1F1ZA 1YW8A 2K02A 3KLOA 3VB2A 1OISA 4G94A 4XMYA 1QZZA 2A05A 3F23A 2L2OA 1LDJA 3FKJA 2VBYA 2DFHA 2UUZA 1U2WA 1WCMJ 2F5CA 4HF0A 3ZR8X 5EF6A 3BTIA 1RUOA 2WV1A 5LRRA 1FTTA 4IHTA 3ZN1A 2AQEA 3GLXA 2CFXA 2VQHA 1HDPA 2KMUA 4MO7A 5HDNA 1USSA 5FO5A 4AIHA 1B8IB 1J0RA 2XF6A 2GXGA 2XROA 2CQ7A 4A69C 2XDVA 5DM7F 1AHDP 1IC8A 2GOXB 4GXOA 3CCJI 4GGGA 2COMA 1Z3XA 3OYFA 2QQ8A 5EJCA 3G71I 5GADJ 3AAFA 1GLNA 3RKWA 1T8IA 2CQKA 2WY8Q 5DM6F 4NBQA 2LLKA 3NRVA 1ZREA 1YIOA 3AFHA 3KP7A 5HS7A 2XB5A 5J47A 4A3JJ 3IRRA 2M1BA 2CQQA 4ZZLA 3UR3C 3T8TA 3BTJA 3SDGA 4ZJZA 5D4RA 4LOCA 4FT8A 1Y8RB 3CDHA 2DOFA 4Z2YA 1JT6A 2NVUB 2LY2A 3ELKA 3WGGA 1NH3A 1VQNI 3Q9SA 4OAZA 4BH9A 1GDTA 5BMZA 2O0YA 4M9ZA 3ULQB 5HVQC 1IGNA 5DUKA 1IN8A 1WI3A 5C3EJ 2XHKA 3O8HA 2ME0A 4FE4A 4D9JA 3DU6A 1O3QA 5J4YA 2UWMA 1MKMA 1OMIA 1W5TA 1XMXA 3IP4B 3WGHA 2X85A 2GQQA 2A5WA 1G8XA 3F0CA 4LB6B 2RQPA 1OYIA 1WWXA 2L5QA 3CD6I 4YFKF 4HF2A 3G2BA 1ERDA 1YQAA 4FTHA 4KITB 4EVIA 3JREA 1BR2A 3BR3A 3EPZA 1SVMA 3BT9A 1MD0A 3HOVJ 3WTUC 3F8FA 3PO3J 3LSHA 4ZTJA 5BPIA 2R7ZJ 2GWRA 5LRSA 3KZIC 5EG0B 2XAJA 3K7AJ 2XKPA 4IHYA 3RQ4A 2AXTC 5CPRB 2MGQA 2P7CB 4BQAA 3S2HJ 3X2QH 2XASA 5JLXA 2M7BA 2EZKA 1IXRC 5CVUA 3HDDA 5KNLA 3LSGA 2L7KA 4UVCA 4JOMA 5CLSA 2JA8J 2W1OA 2RGVA 2MH2A 2PI0A 2DOEA 1SFOJ 3K6GA 2R92J 2HZDA 5FFXA 3CP8A 3G1OA 3KEQA 1XPXA 4FX0A 2JA6J 2FX0A 4ZC3A 5IP9J 5M5WJ 4RA2A 3C7JA 1XDUA 4WXCA 4IX7A 1HC8A 2F5VA 2FMLA 2LBFB 2O8KA 1UJ8A 3M8EA 1X4OA 1Y6IA 1KYZA 2LREA 1ENHA 3QYFA 4XORA 2JRTA 3GLLA 2YPRA 1Q1HA 1IXSB 2OTLI 3SFIA 3WTZA 1T0FC 3ECOA 4BKXA 1E17A 2TRTA 1MMDA 4AVZA 2E7WA 3QAHA 2O03A 2D5VA 2QCOA 1GV5A 3VSKA 2A3SA 2YUSA 4M6VA 5CQEA 2JMWA 3CLQA 3OYEA 1YTYA 3C2GA 3ASOH 5DCMB 3L2WA 1MJ9A 1TWCJ 2W85A 2OJED 3BC8A 2ZXHA 3HXLA 3I3LA 5H6QA 2HDDA 2NVYJ 2X4HA 3DTKA 2CGPA 1LDKB 2ZJRF 3OYJA 1JE8A 1LQ1A 1Z7LA 4MFDA 1LDDA 2DMNA 5HDKA 4U0YA 1YE9A 4Y13A 2HOTA 5FKLA 4KIFA 2WAEA 3CCVI 4LLLA 2ME6A 2QBYA 2I5UA 2XAFA 3DBRB 1I6HJ 3S3OA 4KMUX 3RKYA 3GZNB 3PJRA 5AONA 2E60A 1FSHA 2VXZA 5HS8A 3TL4X 3KETA 2LRDA 2STWA 3J7AY 4XOTA 3RPQA 4LG0A 2EQRA 4ON0A 1HKQA 3CLOA 1O3RA 1SFXA 2Z33A 2Q0OA 1HQCA 3ZMTA 3OV8A 4XRMA 5HLIA 3EUAA 2M0CA 3UKGA 5D5VB 2DW4A 3MKZA 4CZZA 1Y1VJ 1QPMA 1W36C 5D5XB 1G3WA 4RBOA 3JSPA 4CCKA 4V2GA 1LUJB 3WU2C 3LNQA 2V6EA 4RAYA 1I39A 3IWFA 2E34A 2P5KA 2V9PA 5ERIA 4MQVA 4BXFA 4CH7A 2ZFUA 4NC6A 1S7AA 1YOVB 1ETQA 4KT6A 5ILUA 5E3OA 4ZDOA 2C6YA 2RVCA 3E5UA 4ZDLA 1U8RA 2M30A 5D4SA 2RV8A 3BR6A 1D0ZA 5IP7J 3KP5A 5KHDA 2B0LA 1M1EB 3N05A 4A3BJ 1GXPA 1QO0D 3GVAA 1STZA 4CXFA 3S1QJ 1P2FA 1U6GA 1P92A 2KHMA 1WGXA 1E3OC 1TC3C 4LIVA 3TQNA 2HWVA 4NQWB 5FRMA 4EV0A 1X1PA 2EFQA 4FISA 3BZCA 3DBHB 4TV7A 4A6DA 1NG6A 1QQIA 1XSXA 3TP0A 4LK0F 4Q4ZF 3CCUI 1R5HA 4JX6A 4IHWA 3S93A 1TP4A 4G9YA 1OCPA 3MWMA 4E7IA 1XSDA 3ERMA 4UV9A 1K61A 1UB9A 1ZELA 3S15J 1G59A 3B6CA 3GTMJ 1YRNA 2MD5A 4EJUA 1BI3A 4RB1A 1MDMB 1E0EA 2WB1A 3A0BC 3BCBA 3WG7H 2HQAA 2LFBA 4M73A 2X1CA 1X2MA 1FTZA 4Y7NJ 3BJAA 2DPDA 4CYCA 1B1BA 4ETSA 5GAHJ 2IVMA 1LJ9A 1S3JA 2V7FA 3U1KA 2O61A 2VASA 3BR5A 4PJMA 3UNGC 2CO5A 3KPHA 3OYDA 1H88C 1KA8A 2EFNA 3VDXA 1CQTA 3PO2J 3VOEA 5KCMA 4OIPF 3R4KA 2Q8KA 4Z6YA 2LH9A 3AG1H 3QODA 1IRZA 5LEJA 5DDGA 3GZ5A 3MFKA 2BGCA 1WVRA 2ZXJA 2G7UA 1UAAA 4P9UA 5L3CA 2IPQX 3J81Z 3GUDA 3TOAA 2Y2ZA 2IBDA 3DPTA 4IZZA 3W2WA 4J01A 2STTA 2CUFA 1Z6RA 3KZZA 3OR1C 4D5CA 1UHSA 4E70A 2VLAA 1OYYA 1K6OA 4BDYA 4G7ZF 3F8NA 4A3EJ 2ISYA 2LKPA 3ABTA 3GTOJ 2K9MA 4HQMA 3K4NA 4P96A 4E7JA 2GIVA 3PNVA 3Q3SA 4Y52J 3BP8A 3FXQA 1XN7A 4L9VA 2VUMJ 4HX7A 2WBMA 1C0WA 1W7PB 2R7QA 3IKVA 2V79A 4O5VA 2CW0F 3SEQA 5E8IA 2ID6A 4I01A 3BTCA 4LGWA 1FZPB 1R5ID 4JP0A 4FX4A 2K9NA 1X1BA 3C2BA 3OYGA 4ESFA 2CS3A 1R9TJ 1P6RA 1Y39A 2ZC2A 4M9SA 3CCSI 2KZVA 3GYHX 1FOYA 1ZLKA 4IQ4A 4CICA 3HOTA 4R1HA 3RJPA 3JRFA 1RUNA 3FMSA 2M8GX 4IQJA 2DMUA 2P4WA 2P6SA 4ZH4F 4XLCA 1YJNI 1YIJI 4Y3OA 2FOWA 2HPIA 1JHFA 1FBUA 2V9VA 5D5UB 1XMKA 4E7KA 2VL8A 3R0AA 2DJIA 3QRFF 1NK2P 1MBGA 3KE2A 1RRJA 4IOAF 1HCRA 2M45A 3K69A 2E19A 3IC7A 2DFFA 3REOA 1FWZA 4Q48A 1Y56A 3I0TA 3FM5A 1JUPA 4IHXA 4UB8C 1HF0A 2QKMB 3DTEA 4RAFA 2LKSA 3H5AA 3U2RA 1BA5A 3OIQA 5FKMA 3TEDA 4C2MJ 1NK3P 2BXYA 5E1WA 2H1LA 1K6YA 1HSJA 2DQLA 2IT0A 2LC2A 1JXSA 5DTDA 3L2QA 4HDUA 1VZ0A 1GUUA 3ZMVA 3D1NI 4UUVA 1A5JA 2DBBA 3ROUA 3GEZA 5JR3A 1W4MA 1BC8C 5CVVA 3LFUA 5KAFC 4ZYEA 1JUSA 3ERED 3F72A 3W3CA 1SVOA 3FXUA 2WAFA 5E17F 1Y1WJ 3LSPA 2OD5A 5F1JA 2KLOA 2AQFA 4BJTA 5IT3A 3WTXC 2Z3YA 2HDCA 1ZYRF 1J5YA 4II3A 4LJZF 4G6DA 2J5PA 2LF8A 4BBRJ 1IAWA 3RPUA 4N9HA 1HDDC 2BY1A 3KZYA 4HAMA 1OLTA 4BHCA 2BOLA 3DFGA 3K4MA 4KA4A 1RR8C 2L02A 2RC4A 4B47A 1B9MA 3SHFA 1D3YA 2LY1A 4BACA 3BZKA 1G6NA 2HS5A 5EDNA 2VOPA 2KDZA 2M3AA 4OAYA 4BHPA 2LP0A 1F36A 2VJ5A 1BIBA 1R4NB 2M4KA 1K83J 4MQ9F 2R7TA 2NAZA 3I59B 5HODA 2VJJA 3S3NA 3CUQB 3BG5A 4BL0B 2DFIA 4XLHA 4O3MA 1ZR2A 4W97A 4HX8A 3S8PA 3L2UA 4A0YA 3S14J 3JAMK 1R1TA 1S7EA 3HUGA 4HG2A 3ZGKA 3QP5A 4I09A 2KT0A 4XKCA 1EH8A 4Y17A 4ABZA 1KU9A 2H27A 3DF8A 1T08B 4C3HJ 3E6CC 2EINH 1WSUA 3WHCA 2E71A 3JTGA 2MA3A 3LL7A 5JVGF 4EEFG 4OIQF 4HW0A 3FHNA 4LFUA 4RDUA 1YW7A 5BNGA 4XN3A 2HEOA 1YG2A 1D8JA 1R1UA 3K2ZA 3WTSC 1D5VA 3OYKA 2FBHA 4EJTA 2L7ZA 1KU2A 3NWSA 1TW3A 3FISA 1FYLA 1U78A 2EILH 3LWFA 3HSEA 2ZNZA 1LEAA 4L5JA 4CHUA 2WY7Q 2NOJB 2LBFA 4BBSJ 4KUMA 2FBKA 3GTQJ 2M5WA 4E7LA 3IAS2 1KQ9A 1B4AA 4A3IJ 2M4GA 3H3UA 5FJ8J 4GDFA 1MNEA 1P4XA 4QSHA 2DXIA 1DPUA 3ABUA 4M6YA 3TGNA 4A5MA 1MH4A 1POGA 1W1WE 2CJJA 2P8TA 3M1CA 2QKLB 1SD5A 4YIFA 2DI3A 4F91B 2VODA 4U0VA 3JRHA 2WADA 1BN5A 3LSIA 2XGXA 4DBQA 1YX5A 1V5GA 5M5XJ 4U88A 1YO5C 1QRYA 5EEGA 3SZTA 3KP2A 2E2IJ 1KQ8A 3OMYA 1VQ4I 2VBXA 3I4PA 3CMEI 2CRGA 3OOUA 2Y48A 3HB9A 2HZTA 1R71A 1BR4A 5EYRA 4L18B 3K70C 2CV1A 3RQIA 1X1DA 1V4RA 1HA8A 2EZHA 2OC6A 4RGRA 4EM0B 1XS9A 1IV6A 5J3LA 4YIRX 2RQQA 3Q0UA 4HZFA 3FXMA 3BDDA 1HW1A 1FC3A 3BR1A 1DU6A 3I55I 1TQPA 3CCMI 3DKXA 3KYLA 5H2FC 2CW7A 4IPAA 1MBKA 2KRCA 5JVTA 1VQ8I 1WJFA 2BEOA 4L9NA 1P4AA 2AXLA 2YR2A 3G1MA 3I9V2 3L00A 1WHUA 2EV0A 2LF7A 2X0LA 2LOOA 4HYEA 4CCNA 4AM3A 4DGWB 1BBYA 2ELHA 5GTHC 1XCVA 4MFEA 2HYGD 2ZJPF 3P7NA 2KZGA 4D7MA 5GAEJ 1ULYA 5EEAA 2JUGA 1OR7C 3FF5A 3CMAI 2OZ6A 1OPCA 4DJAA 4HNVA 1NTCA 2X6YA 4I0AA 1O4XA 4HRIA 2ZMEA 2ZCWA 3ISPA 2IW5A 1LFBA 1DP7P 2E1NA 2QYOA 2K9SA 5DEQA 2M7AA 5C4JJ 4QLCU 2IP2A 2L54A 3SXYA 4HSTA 4PUSA 5LGTA 3H35A 2F5EA 2QQ9A 5LD2C 1BL0A 3WHBA 4BDZA 2IS1A 4YFXF 1F43A 1N77A 2IA2A 5LHHA 4AIDA 1ETKA 4IRIA 2H8WA 2E1CA 3WE2A 2X6XA 4PFPA 1OCCH 2L7FP 2F2EA 3ASNH 4XR6A 1IV8A 2EIKH 2FE3A 2JSPA 3T0YA 2QSFX 2A68F 2ECBA 2L01A 3A0HC 1IXCA 3GTKJ 5FKNA 3HHHA 3CJRB 4XLPF 3TDUC 1ODDA 3OS0A 2A07F 2A6EF 5JHUA 3QU6A 3DTIA 3BOQA 2OV7A 3F8BA 1VQKI 2A69F 1HLVA 3VPRA 3RZOJ 4OWRB 4RS8A 1IRFA 1WQ2A 2MD0A 3H0DA 3CCYA 2L7MP 2R7VA 5K7HA 2KDOA 4AYBA 3BR0A 1I27A 3JRIA 2R7WA 1ZRFA 4IRGA 3TW7A 4A6EA 2FXAA 2LY9A 4XRSA 4WF2A 1IG7A 5F0HA 3AG4H 4A12A 5IT9K 2VQCA 3CC7I 1DP3A 2TDXA 3A01B 1OKRA 2HKXA 4HLYA 3RIRA 3AL0C 3J7YJ 1Z77A 1K4TA 4L0YB 4NHJA 3FXRA 3HRTA 1VQ9I 3GFLA 2P0WA 4PGGA 3L09A 1KQ0A 1AKHA 3TMOA 3SYTA 3F22A 4A3KJ 2BHZA 2DT5A 2WA0A 2VONA 2NNNA 2EJRA 4CA0A 1OCOH 3HG9A 3C1DA 2E5ZA 5K7ZA 2EB7A 3E5XA 5ED4A 4L5IA 2ZMEB 4W1UA 2DPUA 1DUXC 1J9IA 1IN7A 2JJ7A 1Z3YA 3DKWA 2F4OB 4F55A 1F5TA 1K7AA 4XBFA 1X58A 1SC7A 3OYMA 2R93J 2H09A 4IVNA 4II2A 1HW5A 3A02A 1CF7B 1B59A 4S05A 1QHHD 3SJMA 1L0OC 4I02A 1PUEE 4XKVA 2Y9ZA 1YI2I 3S1RJ 1GVDA 2EIMH 1GV2A 2XB0X 4BQQA 4ENJA 3HIFA 1GXQA 1PVEA 4WK8F 1JGSA 1IUYA 3I5UA 3KEYA 4KISA 3CJTB 1HSTA 2BBYA 3CTAA 4GRIA 5IPAA 4MGRA 2RNJA 2DMQA 4IF4A 1U3EM 1ZQ3P 3TOBA 4RM2A 2L9NA 2Z5UA 2XGCA 1YJWI 4HLXA 2LD5A 1B6AA 2MLGA 2M8EA 1QA6A 4KICA 1QBJA 4UV8A 3GZ6A 2Z16A 1AKHB 2ESHA 5D8KB 2WC2A 3A2KA 4E7HA 3E7LA 5B5EC 4WX9A 3E97A 2V6CA 2F5DA 4NB5A 1QU3A 2HVSA 3ZQQA 2M34A 3BPVA 2CUEA 4Q47A 2XPVA 3SZPA 3LFKA 1DQUA 3K4LA 5J40A 1QNTA 4XRSG 1MSFC 4FHTA 5IYDJ 1O3SA 3IRQA 3OYHA 5D8LB 1IN5A 4LG3A 5CKTA 2VKEA 2K7LA 1WJBA 5F27A 1DGWY 4ENMA 1HXDA 1U5TB 2ZMEC 3EDPA 4UUSA 2DK8A 2M0MA 4A3FJ 3NARA 4OMZA 4L0ZB 2NS0A 1LNWA 4AVPA 2JN6A 5FFZA 2OA4A 2Y9YA 5L3GA 5E20A 4M6XA 2FNAA 3F3XA 1W0TA 2HI3A 4UXNA 4ASNA 3CF2A 2DJNA 3QOEA 1H89C 1TWHJ 1IN6A 3PIOF 1SFKA 3ECHA 1P7IA 4S04A 4FCYA 3H9GA 2LSOA 1ZH5A 2DTRA 5ICCA 3GX4X 4U7BA 3BG3A 4NC7A 2FQ4A 2NVQJ 2VKDA 4DZJA 2IGMA 1S72I 5DS9A 1YJ9I 1ON1A 2L4AA 5ICFA 2ZB9A 3KFWX 1ZG1A 4UB6C 3LSRA 1K78B 4GYIA 1LE8A 2YX4A 3HL2A 1J09A 1PDNC 1TNSA 1FOXA 4ENNA 2CFOA 2R7FA 2VIXA 2QLZA 2Y30A 3ABLH 5J1UA 1LB2A 2R5YB 4PFOA 1AU7A 1YRNB 5AIPA 3FXJA 1DGRM 3CESA 3MVPA 3K0LA 4RGSA 3VYRB 1FYMA 2X51A 3S2DJ 5IY5H 1Z21A 2PMZA 2R7UA 4CYCB 3F21A 2OQRA 3MEXA 4ITVA 2MH9A 1UHWA 2A6HF 4BHBA 2DO7A 1ON2A 1R22A 3HOWJ 3H92A 4O6JA 1B72A 3K9TA 4I0BA 1RIOH 4A3DJ 1J75A 1SAXA 2PMZN 4M74A 3CO7C 3J80K 1V5FA 1SANA 3DEUA 4B48A 3F8MA 2DOAA 4F3QA 3TKYA 2ZSIB 3L2VA 2H94A 4CGZA 3AL0B 4P5OA 4D1QA 3T8RA 2W84A 2W48A 3W6KB 1UHMA 2XAQA 2VN2A 3CUQC 3K1PA 1L3LA 4C2UA 4MHGA 4GYGA 1BI1A 2RN7A 1AA7A 2HYFA 3HOZJ 3WTYC 1ZN2A 2DDBA 4P55A 2LR8A 4HNTA 2R5YA 4BQNA 3IH3A 3V8JA 5ICEA 2JUCA 3EUHA 4EQQA 5M3MJ 5DCFA 5E3NA 3M1EA 1TL8A 4MNUA 5CQGA 3WG9A 1ZKGA 4EJVA 1NHAA 3FIWA 2YS9A 2QQBA 4NC8A 2COBA 3JRCA 3OYBA 4PCQA 1T0FA 3HZJA 5F0CA 2HOEA 3PQJA 1KGSA 2EBIA 1BI0A 1N78A 1BW5A 3Q0VA 5LGUA 2BY0A 2W7NA 1K4SA 1T2KA 4A3CJ 3DXJF 2H6CA 1D8KA 3S3MA 4D5FA 3LA3A 1IJWC 2HVRA 1R00A 1IF1A 3VYUB 1LKXA 2Q1ZB 1WJEA 1LE8B 3E1SA 2HPMA 5GP9A 4BEHB 1VQOI 1S29A 5KK1A 1U9NA 1VF9A 3OYLA 3LA7A 1G4DA 1MNMC 3PM1A 1QHGA 3LMMA 3ZQCA 3K4KA 2XGEA 4RGXA 3COAC 3OR2C 1TNTA 1SMYF 1Z05A 4A3GJ 2HVQA 2VPLA 1ZGJA 3HBLA 4BS9A 5E3MA 1D1CA 3H9JA 3BQYA 5J1YA 3LQQA 4HV6A 3PFYA 2Y75A 5B3SH 1B72B 2CV0A 4BGDA 1R6RA 2W25A 2H1KA 2N8GA 3J80Z 2ZJ2A 5LHIA 3S1NJ 2DA5A 5FKOA 2NRAC 3W6JB 4LB5A 2ZXWH 1P9QC 1H9GA 3GFIA 2IGNA 2HQNA 5E79C 2JPBA 2FRHA 4HX4A 1SFEA 5B1AH 3CCLI 2OUMA 4C9YA 3DKYA 2V1NA 1JKPC 3RSNA 2E2JJ 1LFUP 3IUOA 3OSGA 3QQAA 4BEHA 4WXHA 2BW3A 3HHGA 1R23A 2HQRA 3K4CA 4L9JA 1MJAA 3TDZC 1WI9A 4LLGF 2MFZA 2KIUA 3LAJA 2F4IA 4XL9A 2VPRA 3D0SA 1OCZH 1T38A 2Y31A 2XPUA 3SZGA 4M3GA 1WJAA 1XDSA 3I59A 3S2WA 2VKHA 5ILSA 4XQFA 2QA4I 3HRUA 4EMSA 4BJ5C 5F1RA 4JQFA 1OCRH 5J8FA 5J6XA 3Q5FA 4OOIA 3PIPF 3ZXSA 1T98A 3F9KA 5EG0A 5HLTA 1FIAA 3MCZA 2OQGA 4KNYA 5F6FA 2E7XA 1R49A 1WH7A 1G3TA 2XIGA 2EA4A 3BQZA 4YEJA 2HTJA 2PMUA 4BYYA 3F6OA 4RB0A 2VI6A 5D5WB 2OCEA 1BM9A 3TO9A 4HBLA 1O7LA 2A61A 1RKTA 2OAZA 3E3VA 1TWAJ 3AKZA 1MMSA
chains in the Genus database with same CATH topology
5TRDA 5K5QA 3BPXA 1MGTA 1RZ4A 5K1YA 5HOOA 3EYYA 4UHTA 1XGOA 1FBSA 3U9GA 5FD6A 5FGMA 3WGIA 1O3TA 4KFCA 2HKOA 1FPQA 3RI4A 1I5ZA 1U5TC 3CUOA 2AS5F 2J5OA 4B09A 2NYXA 3FZVA 3V8LA 1K79A 5DD4A 1W5SA 1TQMA 4IHSA 4AIKA 3E6DA 1FYKA 4XRFA 3FWEA 4IJAA 2JZYA 2XUBA 3HRSA 3OOPA 1J2XA 2D45A 4R79A 2VBZA 4AD9A 1HBXG 3DV8A 2G7HA 1ZG3A 2P7VB 1YS6A 3WU1B 3V8KA 2VC0A 4UVAA 3E5QA 3F6VA 3K1MA 2CG4A 4EJWA 4I7HA 2O6GE 1RI7A 2VE8A 1PP7U 1XSVA 2DAOA 3R61A 5KVRA 3ZN0A 4G7HF 3JTHA 2WTEA 1KU3A 2EFOA 2P6TA 4P9FA 1FSEA 3VEPA 5BPDA 5CVIA 3WTTC 4GO1A 3NEUA 1TQIA 3GO5A 2D2WA 2DLLA 3LQRA 3SQNA 2GXBA 2ACJA 3KP4A 2ISZA 3B02A 3ZQ7A 1WKMA 2XVCA 3WTWC 1TLHB 5BS6A 3ML6A 1XB4A 4KIGA 2DQRA 5E18F 5L3DA 2K4JA 4ZYGA 3V7SA 4DQ2A 3CO6C 2D1VA 1YFHA 5DCMA 1FT9A 1FP2A 2O3FA 4OINF 5AIQA 5HDGA 4WCGA 5LBQA 4BNCA 5H6RA 3DP7A 3GW2A 3GFMA 2GAUA 2QBYB 3QP6A 2DU9A 4KMFA 1ZARA 4U0WA 5ICGA 2XV4S 1UCRA 1ZGAA 3HSRA 1FBQA 1BOAA 4QWQA 3L9FA 3BY6A 3HTSB 3C3WA 2JPCA 2P5LC 4KIBA 1W7PD 4MEXF 4DNCA 3G73A 1OYWA 1RNLA 2PEXA 4K2EA 2V1XA 2H6BA 2BYVE 3JW4A 3I58A 4EGZA 2YSRA 3JAMZ 3ZP5A 4YFNF 1FY7A 2HTSA 3DPLC 3IWZA 2FEZA 5L3EA 5H20A 1Z7UA 2GA1A 5FLXZ 2V1UA 5DD8A 1KYWA 1FLIA 3P9CA 1SFUA 4LMYA 1ZRDA 3BWGA 1ZRCA 3R6SA 2HR3A 1ZHFA 1IN4A 2JSCA 1A04A 3H3ZA 2RDPA 1ZAOA 5BQTA 1IW7F 1XGSA 3KLNA 4YG2F 4LK1F 3L2CA 2QM3A 4Y15A 4F7ZA 4R8HA 4RB2C 1XCBA 4LLNA 2EFWA 5E8GA 3ZMZA 3EETA 5LHGA 1E2XA 3V7CA 2GA2A 1GVJA 3L7WA 4L9TA 2FU4A 3RYPA 3BJ6A 1X3UA 6PAXA 3GXOA 1LVAA 1G3YA 3KEOA 2EK5A 2FBIA 1SD6A 2DK5A 5D6FA 1B9NA 4LD5A 1Z6TA 3GFJA 2OU2A 4EJOA 3I53A 4MEYF 1H9TA 4HA8A 1KU7A 4I2OA 5K5RA 2JTVA 1FOKA 3Q9VA 5HS9A 2K86A 4PGHA 3MZYA 3KCCA 3WE3A 4ZYDA 3TO6A 3P9KA 3DQVC 3N4MA 3JSOA 2QZ8A 3V4GA 2ZNYA 4KN7X 3MZHA 4WXDA 1HKTA 2QWWA 4OIRF 4M72A 4RGUA 4GCVA 3FM3A 2ZBKA 2JT1A 5A2QZ 4OIOF 1GHCA 2LDUA 3QPTA 2A5YB 1H0MA 4ZYHA 1J7KA 2PLYA 4ENKA 1R7JA 2OBPA 2FNPA 3M7GA 1S7OA 3F8CA 1HW2A 3CUQA 1USTA 1Y0UA 4KT5C 1IRGA 3LSTA 4CO8A 4HOBA 2XRNA 1AOYA 3QU3A 1I6XA 1T39A 3R0JA 5TJJA 1T6SA 3PQKA 1YS7A 5LLQA 2PMHA 4OU0A 1G3SA 3J81K 4WWCA 4RAZA 1EV7A 3WTVC 3U1DA 3IL2A 1R36A 1XD7A 2EV5A 2UXNA 1PP8F 2FOKA 5A2QK 2EFPA 3HTUA 3I54A 4A0ZA 4M9XA 3RDIA 2MC3A 5CVJA 1P4WA 4RB3C 1QGPA 5EEHA 3BJOA 3RYRA 2EV6A 2VBWA 2W57A 4N0BA 1F9NA 1MZBA 2CSOA 3FMQA 3E6BA 1DPRA 1EH7A 2ZKZA 4XLNF 1YYVA 3RTRA 2XKOA 2FQ3A 1FP1D 3SFZA 2R7DA 2VT2A 1QZYA 1FX7A 2BE5F 2NNYA 3ZMSA 1SD4A 4A0XA 1IZ1A 5LEKA 2G9WA 4H0EA 1Z1DA 3WODF 1BC7C 4HDVA 2D1HA 1BJAA 2RKHA 3BROA 4HF1A 4YIIA 1Z91A 4EM1A 3D5LA 4MTDA 1JHHA 3I71A 3FMRA 3O2PE 3O6BB 2YX7A 2KIFA 3HRMA 2XAGA 3RKXA 5J8CA 5DV5A 3M9AA 4B8XA 1I1GA 3IKTA 1BI2A 2ADUA 2MLKA 1Z9CA 1FNNA 4OMYA 4NQWA 1F4KA 2O8XA 1DDNA 1CGPA 3GWZA 2PBIA 2MBFA 5E1ZB 5F64A 3HOSA 4ESJA 4KN4X 4KYWA 4N9IA 2FF4A 5E1XA 5L3FA 2LNBA 3M8FA 4U7DA 2W24A 3ZMDA 4Q5SF 2FMYA 2K4BA 3T1BA 4IXAA 2ZO4A 3NQOA 5FLXK 1R58A 2WWYA 2IA1A 3I64A 2UZKA 3TO7A 5FB2A 5DYMA 3ZMUA 2ETHA 1HKSA 2F5FA 3B73A 3LAPA 4KDPA 4BAYA 2Q2EA 3O3KA 2V1DA 2ZFWA 2M87A 4G6QA 4M71A 3VODA 3J7AO 3ZPLA 4BXUA 3HSFA 2CWEA 2Y0MA 2L3DA 1O57A 3KP6A 1CF7A 1TW2A 1XGNA 2Z9OA 2KJCA 4AWXB 2IA0A 5CJ9A 2QENA 3BZ6A 1EH6A 2KIMA 5BOXA 3K1NA 2QVOA 4LG0B 4HV5A 4EM2A 2IJLA 1SMTA 3G3ZA 2K27A 2QUFA 5HLHA 2OZUA 2UXXA 3EQLF 2PN6A 1J59A 2YU3A 3C18A 2GZWA 3QPHA 3VFZA 1OR7A 1YLFA 1LEBA 4A5NA 3GF2A 3PFIA 2VOOA 4CDGA 4I98B 2VE9A 3P9IA 4JBAA 2FA5A 3V7RA 2VT3A 4UNOA 4ESBA 3KP3A 3CJNA 2QQAA 4UVBA 1UFMA 1MDMA 1XGMA 4D0PA 2HGCA 1I1SA 5LGNA 2IRFG 2XAHA 4HQEA 1WRJA 1O7FA 2ESNA 3LA2A 1S6LA 4MTEA 5DUIA 1MJBA 1V3FA 1S8NA 1REPC 3IHUA 4XSZF 2PJPA 2Z99A 4PZJA 4ZZDA 4G7OF 1BIAA 2FSWA 3N97A 5IT9Z 3T5XA 2CYYA 1U5TA 5FD5A 5ILVA 1K78A 5L3BA 2VC1A 2PFBA 1ZLJA 5CVRA 1ONVA 2EA2A 4JK1X 3E6MA 1R5GA 4G8XA 3FHZA 4EGYA 5JFRA 3R60A 1ZG5A 3EYIA 3HYIA 5JI6A 1R1VA 2R3SA 1VTNC 4AIJA 2BV6A 1W7PA 2EWNA 2P5VA 2WV0A 5K5OA 2KKOA 2KRFA 3QOPA 5CYVA 4CYDA 2KJBA 4XSXF 2PG4A 4A2UA 4IRHA 1SD7A 2PQ8A 3MAJA 2L4MA 4PDKA 1AWCA 5HLGA 1TBXA 1TTYA 1XMAA 2HFHA 3MQ0A 1YW9A 3FX3A 5D6EA 3WU0A 1F1ZA 1YW8A 2K02A 3KLOA 3VB2A 4G94A 1QZZA 3F23A 1LDJA 2VBYA 1U2WA 2F5CA 4HF0A 1RUOA 5LRRA 4IHTA 3ZN1A 3GLXA 2CFXA 5HDNA 1USSA 5FO5A 4AIHA 1J0RA 2XROA 2GXGA 4GXOA 4GGGA 2COMA 3AAFA 3RKWA 2CQKA 3NRVA 1ZREA 1YIOA 3KP7A 5HS7A 3IRRA 2M1BA 4ZZLA 3T8TA 5D4RA 4FT8A 3CDHA 4Z2YA 3ELKA 3WGGA 3Q9SA 4BH9A 5BMZA 2O0YA 4M9ZA 5HVQC 3ULQB 5DUKA 1IN8A 2XHKA 1O3QA 2UWMA 1MKMA 1OMIA 1W5TA 3WGHA 2GQQA 4LB6B 2RQPA 1OYIA 1WWXA 4YFKF 4HF2A 1YQAA 4EVIA 1MD0A 3WTUC 3F8FA 5BPIA 2GWRA 5LRSA 2XAJA 2XKPA 2P7CB 4BQAA 2XASA 1IXRC 5CVUA 4UVCA 5CLSA 2RGVA 2MH2A 2PI0A 5FFXA 3KEQA 4FX0A 3C7JA 1XDUA 4WXCA 2FMLA 3M8EA 1KYZA 2JRTA 2YPRA 1Q1HA 1IXSB 3WTZA 3ECOA 1E17A 2E7WA 3QAHA 2O03A 2A3SA 1YTYA 5DCMB 1MJ9A 2W85A 5H6QA 2X4HA 2CGPA 1LDKB 1JE8A 1LQ1A 1LDDA 5HDKA 4U0YA 4Y13A 4KIFA 4LLLA 2QBYA 2XAFA 4KMUX 3RKYA 5AONA 1FSHA 2VXZA 5HS8A 3KETA 2STWA 3RPQA 4LG0A 4ON0A 1HKQA 3CLOA 1O3RA 1SFXA 2Z33A 2Q0OA 1HQCA 3ZMTA 3OV8A 5HLIA 5D5VB 2DW4A 4CZZA 1QPMA 5D5XB 1G3WA 3JSPA 4RAYA 3IWFA 2P5KA 5ERIA 4MQVA 5ILUA 1S7AA 2C6YA 2RVCA 3E5UA 1U8RA 2M30A 5D4SA 2RV8A 3KP5A 2B0LA 1GXPA 1QO0D 3GVAA 1STZA 4CXFA 1P2FA 1U6GA 1P92A 3TQNA 2HWVA 4EV0A 2EFQA 4TV7A 4A6DA 1QQIA 1XSXA 4LK0F 4Q4ZF 1R5HA 1XSDA 4G9YA 3MWMA 4UV9A 1UB9A 2MD5A 4EJUA 1BI3A 4RB1A 1MDMB 4M73A 3BJAA 2DPDA 1B1BA 4ETSA 2IVMA 1LJ9A 1S3JA 2O61A 2CO5A 1KA8A 2EFNA 3VOEA 4OIPF 3R4KA 2Q8KA 5LEJA 5DDGA 3GZ5A 3MFKA 2BGCA 2ZXJA 2G7UA 4P9UA 5L3CA 2IPQX 3J81Z 3GUDA 3TOAA 3DPTA 2STTA 1Z6RA 3KZZA 4E70A 1OYYA 1K6OA 4G7ZF 3F8NA 2ISYA 2LKPA 3ABTA 4HQMA 4P96A 2GIVA 3BP8A 3FXQA 1XN7A 4L9VA 4HX7A 1C0WA 1W7PB 3IKVA 2V79A 4O5VA 2CW0F 5E8IA 4I01A 4LGWA 1FZPB 4FX4A 4ESFA 1P6RA 4M9SA 3GYHX 1ZLKA 4CICA 3HOTA 4R1HA 3RJPA 1RUNA 3FMSA 2P4WA 2P6SA 4ZH4F 1JHFA 1FBUA 5D5UB 2V9VA 1XMKA 3R0AA 3QRFF 3KE2A 2M45A 3K69A 3IC7A 3REOA 1FWZA 4Q48A 3I0TA 3FM5A 3U2RA 5E1WA 1HSJA 2DQLA 2IT0A 1JXSA 4HDUA 3ZMVA 4UUVA 2DBBA 3ROUA 3GEZA 5JR3A 1W4MA 1BC8C 5CVVA 3ERED 4ZYEA 3F72A 3FXUA 5E17F 2OD5A 5IT3A 3WTXC 2Z3YA 2HDCA 1ZYRF 4LJZF 1J5YA 4G6DA 2J5PA 2LF8A 1IAWA 3RPUA 4N9HA 3KZYA 4HAMA 4BHCA 3DFGA 4KA4A 2L02A 2RC4A 1B9MA 3SHFA 1D3YA 1G6NA 2HS5A 2VOPA 4BHPA 1BIBA 4MQ9F 2NAZA 3I59B 3CUQB 2DFIA 4O3MA 4HX8A 4A0YA 3JAMK 1R1TA 3HUGA 3QP5A 4I09A 4Y17A 1EH8A 2H27A 1KU9A 3DF8A 3E6CC 1WSUA 3JTGA 2MA3A 4OIQF 4HW0A 4LFUA 1YW7A 2HEOA 1YG2A 1D8JA 1R1UA 3K2ZA 3WTSC 1D5VA 2FBHA 4EJTA 1KU2A 1TW3A 1FYLA 1U78A 3LWFA 3HSEA 2ZNZA 1LEAA 4L5JA 4CHUA 4KUMA 2FBKA 2M5WA 1KQ9A 1B4AA 3H3UA 1DPUA 1P4XA 3ABUA 4M6YA 3TGNA 4A5MA 2P8TA 1SD5A 4YIFA 2DI3A 2VODA 4U0VA 1BN5A 2XGXA 1YO5C 4U88A 5EEGA 3SZTA 3KP2A 1KQ8A 2VBXA 3I4PA 2Y48A 2HZTA 4L18B 1V4RA 4RGRA 4EM0B 4HZFA 3BDDA 1HW1A 1FC3A 1TQPA 4IPAA 5JVTA 2BEOA 4L9NA 1P4AA 2AXLA 2YR2A 3L00A 2EV0A 2LF7A 2X0LA 4HYEA 1BBYA 2ELHA 1XCVA 2HYGD 3P7NA 1ULYA 3FF5A 2OZ6A 1OPCA 4I0AA 2ZMEA 2ZCWA 3ISPA 2IW5A 1DP7P 2E1NA 2QYOA 5DEQA 4QLCU 2IP2A 2L54A 3SXYA 5LGTA 2F5EA 2QQ9A 4YFXF 2IA2A 5LHHA 4IRIA 2E1CA 3WE2A 2F2EA 2FE3A 3T0YA 2A68F 2L01A 1IXCA 3HHHA 4XLPF 3TDUC 1ODDA 2A07F 2A6EF 5JHUA 3QU6A 3BOQA 3F8BA 2A69F 4RS8A 1IRFA 1WQ2A 1I27A 1ZRFA 4IRGA 4A6EA 2FXAA 4WF2A 4A12A 5IT9K 2TDXA 1OKRA 2HKXA 4HLYA 3RIRA 4L0YB 4NHJA 3FXRA 3HRTA 3GFLA 4PGGA 3L09A 1KQ0A 3F22A 2VONA 2DT5A 2NNNA 2EJRA 3C1DA 2EB7A 3E5XA 5ED4A 4L5IA 2ZMEB 2DPUA 1DUXC 1J9IA 1IN7A 3DKWA 1F5TA 1K7AA 4XBFA 2H09A 4IVNA 1HW5A 1CF7B 1B59A 4S05A 1L0OC 4I02A 1PUEE 4ENJA 3HIFA 1GXQA 4WK8F 1JGSA 1IUYA 3I5UA 1HSTA 2BBYA 3CTAA 4MGRA 2RNJA 4IF4A 1U3EM 3TOBA 2Z5UA 4HLXA 1B6AA 2MLGA 2M8EA 4KICA 1QBJA 4UV8A 3GZ6A 2ESHA 5D8KB 2WC2A 4WX9A 3E97A 2V6CA 2F5DA 4NB5A 3BPVA 4Q47A 3SZPA 3LFKA 1QNTA 4FHTA 1O3SA 3IRQA 5D8LB 1IN5A 2K7LA 4ENMA 1HXDA 1U5TB 3EDPA 2DK8A 4OMZA 4L0ZB 2NS0A 1LNWA 4AVPA 5FFZA 2OA4A 5L3GA 5E20A 4M6XA 2FNAA 3F3XA 4UXNA 4ASNA 1IN6A 3ECHA 4S04A 2LSOA 1ZH5A 2DTRA 5ICCA 3GX4X 4U7BA 1ON1A 2L4AA 5ICFA 3KFWX 1ZG1A 1K78B 4GYIA 2YX4A 1PDNC 1TNSA 4ENNA 2R7FA 2QLZA 1LB2A 5AIPA 4RGSA 3K0LA 1FYMA 3F21A 2OQRA 3MEXA 1UHWA 2A6HF 2MH9A 4BHBA 2DO7A 1ON2A 1R22A 3H92A 4O6JA 3K9TA 4I0BA 1RIOH 1J75A 1SAXA 4M74A 3CO7C 3J80K 3DEUA 3F8MA 3TKYA 2H94A 4CGZA 4P5OA 3T8RA 2W84A 3W6KB 1UHMA 2XAQA 2VN2A 3CUQC 3K1PA 1L3LA 4MHGA 4GYGA 1BI1A 2RN7A 2HYFA 3WTYC 1ZN2A 4P55A 3V8JA 5ICEA 3EUHA 4EQQA 5DCFA 3M1EA 4MNUA 3WG9A 4EJVA 1NHAA 2QQBA 4PCQA 1T0FA 2HOEA 3PQJA 1KGSA 1BI0A 5LGUA 1T2KA 3DXJF 2H6CA 1D8KA 3LA3A 1R00A 1IF1A 1S29A 5KK1A 3LA7A 1G4DA 4RGXA 3COAC 1TNTA 1SMYF 1Z05A 1ZGJA 3LQQA 4HV6A 2Y75A 2W25A 3J80Z 2ZJ2A 5LHIA 2NRAC 3W6JB 4LB5A 1H9GA 3GFIA 2HQNA 2JPBA 2FRHA 4HX4A 1SFEA 4WXHA 3HHGA 1R23A 2HQRA 4L9JA 1MJAA 3TDZC 1WI9A 4LLGF 2KIUA 3LAJA 3D0SA 1T38A 1XDSA 3I59A 3S2WA 5ILSA 3HRUA 4EMSA 5J8FA 5F1RA 4JQFA 5J6XA 3Q5FA 4OOIA 1T98A 3MCZA 2OQGA 4KNYA 5F6FA 2E7XA 1G3TA 2XIGA 2EA4A 2HTJA 2PMUA 4BYYA 3F6OA 4RB0A 5D5WB 1BM9A 3TO9A 4HBLA 1O7LA 2A61A 2OAZA 3E3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TRD A;  5K5Q A;  3BPX A;  1MGT A;  1RZ4 A;  5K1Y A;  5HOO A;  3EYY A;  4UHT A;  1XGO A;  1FBS A;  3U9G A;  5FD6 A;  5FGM A;  3WGI A;  1O3T A;  4KFC A;  2HKO A;  1FPQ A;  3RI4 A;  1I5Z A;  1U5T C;  3CUO A;  2AS5 F;  2J5O A;  4B09 A;  2NYX A;  3FZV A;  3V8L A;  1K79 A;  5DD4 A;  1W5S A;  1TQM A;  4IHS A;  4AIK A;  3E6D A;  1FYK A;  4XRF A;  3FWE A;  4IJA A;  2JZY A;  2XUB A;  3HRS A;  3OOP A;  1J2X A;  2D45 A;  4R79 A;  2VBZ A;  4AD9 A;  1HBX G;  3DV8 A;  2G7H A;  1ZG3 A;  2P7V B;  1YS6 A;  3WU1 B;  3V8K A;  2VC0 A;  4UVA A;  3E5Q A;  3F6V A;  3K1M A;  2CG4 A;  4EJW A;  4I7H A;  2O6G E;  1RI7 A;  2VE8 A;  1PP7 U;  1XSV A;  2DAO A;  3R61 A;  5KVR A;  3ZN0 A;  4G7H F;  3JTH A;  2WTE A;  1KU3 A;  2EFO A;  2P6T A;  4P9F A;  1FSE A;  3VEP A;  5BPD A;  5CVI A;  3WTT C;  4GO1 A;  3NEU A;  1TQI A;  3GO5 A;  2D2W A;  2DLL A;  3LQR A;  3SQN A;  2GXB A;  2ACJ A;  3KP4 A;  2ISZ A;  3B02 A;  3ZQ7 A;  1WKM A;  2XVC A;  3WTW C;  1TLH B;  5BS6 A;  3ML6 A;  1XB4 A;  4KIG A;  2DQR A;  5E18 F;  5L3D A;  2K4J A;  4ZYG A;  3V7S A;  4DQ2 A;  3CO6 C;  2D1V A;  1YFH A;  5DCM A;  1FT9 A;  1FP2 A;  2O3F A;  4OIN F;  5AIQ A;  5HDG A;  4WCG A;  5LBQ A;  4BNC A;  5H6R A;  3DP7 A;  3GW2 A;  3GFM A;  2GAU A;  2QBY B;  3QP6 A;  2DU9 A;  4KMF A;  1ZAR A;  4U0W A;  5ICG A;  2XV4 S;  1UCR A;  1ZGA A;  3HSR A;  1FBQ A;  1BOA A;  4QWQ A;  3L9F A;  3BY6 A;  3HTS B;  3C3W A;  2JPC A;  2P5L C;  4KIB A;  1W7P D;  4MEX F;  4DNC A;  3G73 A;  1OYW A;  1RNL A;  2PEX A;  4K2E A;  2V1X A;  2H6B A;  2BYV E;  3JW4 A;  3I58 A;  4EGZ A;  2YSR A;  3JAM Z;  3ZP5 A;  4YFN F;  1FY7 A;  2HTS A;  3DPL C;  3IWZ A;  2FEZ A;  5L3E A;  5H20 A;  1Z7U A;  2GA1 A;  5FLX Z;  2V1U A;  5DD8 A;  1KYW A;  1FLI A;  3P9C A;  1SFU A;  4LMY A;  1ZRD A;  3BWG A;  1ZRC A;  3R6S A;  2HR3 A;  1ZHF A;  1IN4 A;  2JSC A;  1A04 A;  3H3Z A;  2RDP A;  1ZAO A;  5BQT A;  1IW7 F;  1XGS A;  3KLN A;  4YG2 F;  4LK1 F;  3L2C A;  2QM3 A;  4Y15 A;  4F7Z A;  4R8H A;  4RB2 C;  1XCB A;  4LLN A;  2EFW A;  5E8G A;  3ZMZ A;  3EET A;  5LHG A;  1E2X A;  3V7C A;  2GA2 A;  1GVJ A;  3L7W A;  4L9T A;  2FU4 A;  3RYP A;  3BJ6 A;  1X3U A;  6PAX A;  3GXO A;  1LVA A;  1G3Y A;  3KEO A;  2EK5 A;  2FBI A;  1SD6 A;  2DK5 A;  5D6F A;  1B9N A;  4LD5 A;  1Z6T A;  3GFJ A;  2OU2 A;  4EJO A;  3I53 A;  4MEY F;  1H9T A;  4HA8 A;  1KU7 A;  4I2O A;  5K5R A;  2JTV A;  1FOK A;  3Q9V A;  5HS9 A;  2K86 A;  4PGH A;  3MZY A;  3KCC A;  3WE3 A;  4ZYD A;  3TO6 A;  3P9K A;  3DQV C;  3N4M A;  3JSO A;  2QZ8 A;  3V4G A;  2ZNY A;  4KN7 X;  3MZH A;  4WXD A;  1HKT A;  2QWW A;  4OIR F;  4M72 A;  4RGU A;  4GCV A;  3FM3 A;  2ZBK A;  2JT1 A;  5A2Q Z;  4OIO F;  1GHC A;  2LDU A;  3QPT A;  2A5Y B;  1H0M A;  4ZYH A;  1J7K A;  2PLY A;  4ENK A;  1R7J A;  2OBP A;  2FNP A;  3M7G A;  1S7O A;  3F8C A;  1HW2 A;  3CUQ A;  1UST A;  1Y0U A;  4KT5 C;  1IRG A;  3LST A;  4CO8 A;  4HOB A;  2XRN A;  1AOY A;  3QU3 A;  1I6X A;  1T39 A;  3R0J A;  5TJJ A;  1T6S A;  3PQK A;  1YS7 A;  5LLQ A;  2PMH A;  4OU0 A;  1G3S A;  3J81 K;  4WWC A;  4RAZ A;  1EV7 A;  3WTV C;  3U1D A;  3IL2 A;  1R36 A;  1XD7 A;  2EV5 A;  2UXN A;  1PP8 F;  2FOK A;  5A2Q K;  2EFP A;  3HTU A;  3I54 A;  4A0Z A;  4M9X A;  3RDI A;  2MC3 A;  5CVJ A;  1P4W A;  4RB3 C;  1QGP A;  5EEH A;  3BJO A;  3RYR A;  2EV6 A;  2VBW A;  2W57 A;  4N0B A;  1F9N A;  1MZB A;  2CSO A;  3FMQ A;  3E6B A;  1DPR A;  1EH7 A;  2ZKZ A;  4XLN F;  1YYV A;  3RTR A;  2XKO A;  2FQ3 A;  1FP1 D;  3SFZ A;  2R7D A;  2VT2 A;  1QZY A;  1FX7 A;  2BE5 F;  2NNY A;  3ZMS A;  1SD4 A;  4A0X A;  1IZ1 A;  5LEK A;  2G9W A;  4H0E A;  1Z1D A;  3WOD F;  1BC7 C;  4HDV A;  2D1H A;  1BJA A;  2RKH A;  3BRO A;  4HF1 A;  4YII A;  1Z91 A;  4EM1 A;  3D5L A;  4MTD A;  1JHH A;  3I71 A;  3FMR A;  3O2P E;  3O6B B;  2YX7 A;  2KIF A;  3HRM A;  2XAG A;  3RKX A;  5J8C A;  5DV5 A;  3M9A A;  4B8X A;  1I1G A;  3IKT A;  1BI2 A;  2ADU A;  2MLK A;  1Z9C A;  1FNN A;  4OMY A;  4NQW A;  1F4K A;  2O8X A;  1DDN A;  1CGP A;  3GWZ A;  2PBI A;  2MBF A;  5E1Z B;  5F64 A;  3HOS A;  4ESJ A;  4KN4 X;  4KYW A;  4N9I A;  2FF4 A;  5E1X A;  5L3F A;  2LNB A;  3M8F A;  4U7D A;  2W24 A;  3ZMD A;  4Q5S F;  2FMY A;  2K4B A;  3T1B A;  4IXA A;  2ZO4 A;  3NQO A;  5FLX K;  1R58 A;  2WWY A;  2IA1 A;  3I64 A;  2UZK A;  3TO7 A;  5FB2 A;  5DYM A;  3ZMU A;  2ETH A;  1HKS A;  2F5F A;  3B73 A;  3LAP A;  4KDP A;  4BAY A;  2Q2E A;  3O3K A;  2V1D A;  2ZFW A;  2M87 A;  4G6Q A;  4M71 A;  3VOD A;  3J7A O;  3ZPL A;  4BXU A;  3HSF A;  2CWE A;  2Y0M A;  2L3D A;  1O57 A;  3KP6 A;  1CF7 A;  1TW2 A;  1XGN A;  2Z9O A;  2KJC A;  4AWX B;  2IA0 A;  5CJ9 A;  2QEN A;  3BZ6 A;  1EH6 A;  2KIM A;  5BOX A;  3K1N A;  2QVO A;  4LG0 B;  4HV5 A;  4EM2 A;  2IJL A;  1SMT A;  3G3Z A;  2K27 A;  2QUF A;  5HLH A;  2OZU A;  2UXX A;  3EQL F;  2PN6 A;  1J59 A;  2YU3 A;  3C18 A;  2GZW A;  3QPH A;  3VFZ A;  1OR7 A;  1YLF A;  1LEB A;  4A5N A;  3GF2 A;  3PFI A;  2VOO A;  4CDG A;  4I98 B;  2VE9 A;  3P9I A;  4JBA A;  2FA5 A;  3V7R A;  2VT3 A;  4UNO A;  4ESB A;  3KP3 A;  3CJN A;  2QQA A;  4UVB A;  1UFM A;  1MDM A;  1XGM A;  4D0P A;  2HGC A;  1I1S A;  5LGN A;  2IRF G;  2XAH A;  4HQE A;  1WRJ A;  1O7F A;  2ESN A;  3LA2 A;  1S6L A;  4MTE A;  5DUI A;  1MJB A;  1V3F A;  1S8N A;  1REP C;  3IHU A;  4XSZ F;  2PJP A;  2Z99 A;  4PZJ A;  4ZZD A;  4G7O F;  1BIA A;  2FSW A;  3N97 A;  5IT9 Z;  3T5X A;  2CYY A;  1U5T A;  5FD5 A;  5ILV A;  1K78 A;  5L3B A;  2VC1 A;  2PFB A;  1ZLJ A;  5CVR A;  1ONV A;  2EA2 A;  4JK1 X;  3E6M A;  1R5G A;  4G8X A;  3FHZ A;  4EGY A;  5JFR A;  3R60 A;  1ZG5 A;  3EYI A;  3HYI A;  5JI6 A;  1R1V A;  2R3S A;  1VTN C;  4AIJ A;  2BV6 A;  1W7P A;  2EWN A;  2P5V A;  2WV0 A;  5K5O A;  2KKO A;  2KRF A;  3QOP A;  5CYV A;  4CYD A;  2KJB A;  4XSX F;  2PG4 A;  4A2U A;  4IRH A;  1SD7 A;  2PQ8 A;  3MAJ A;  2L4M A;  4PDK A;  1AWC A;  5HLG A;  1TBX A;  1TTY A;  1XMA A;  2HFH A;  3MQ0 A;  1YW9 A;  3FX3 A;  5D6E A;  3WU0 A;  1F1Z A;  1YW8 A;  2K02 A;  3KLO A;  3VB2 A;  4G94 A;  1QZZ A;  3F23 A;  1LDJ A;  2VBY A;  1U2W A;  2F5C A;  4HF0 A;  1RUO A;  5LRR A;  4IHT A;  3ZN1 A;  3GLX A;  2CFX A;  5HDN A;  1USS A;  5FO5 A;  4AIH A;  1J0R A;  2XRO A;  2GXG A;  4GXO A;  4GGG A;  2COM A;  3AAF A;  3RKW A;  2CQK A;  3NRV A;  1ZRE A;  1YIO A;  3KP7 A;  5HS7 A;  3IRR A;  2M1B A;  4ZZL A;  3T8T A;  5D4R A;  4FT8 A;  3CDH A;  4Z2Y A;  3ELK A;  3WGG A;  3Q9S A;  4BH9 A;  5BMZ A;  2O0Y A;  4M9Z A;  5HVQ C;  3ULQ B;  5DUK A;  1IN8 A;  2XHK A;  1O3Q A;  2UWM A;  1MKM A;  1OMI A;  1W5T A;  3WGH A;  2GQQ A;  4LB6 B;  2RQP A;  1OYI A;  1WWX A;  4YFK F;  4HF2 A;  1YQA A;  4EVI A;  1MD0 A;  3WTU C;  3F8F A;  5BPI A;  2GWR A;  5LRS A;  2XAJ A;  2XKP A;  2P7C B;  4BQA A;  2XAS A;  1IXR C;  5CVU A;  4UVC A;  5CLS A;  2RGV A;  2MH2 A;  2PI0 A;  5FFX A;  3KEQ A;  4FX0 A;  3C7J A;  1XDU A;  4WXC A;  2FML A;  3M8E A;  1KYZ A;  2JRT A;  2YPR A;  1Q1H A;  1IXS B;  3WTZ A;  3ECO A;  1E17 A;  2E7W A;  3QAH A;  2O03 A;  2A3S A;  1YTY A;  5DCM B;  1MJ9 A;  2W85 A;  5H6Q A;  2X4H A;  2CGP A;  1LDK B;  1JE8 A;  1LQ1 A;  1LDD A;  5HDK A;  4U0Y A;  4Y13 A;  4KIF A;  4LLL A;  2QBY A;  2XAF A;  4KMU X;  3RKY A;  5AON A;  1FSH A;  2VXZ A;  5HS8 A;  3KET A;  2STW A;  3RPQ A;  4LG0 A;  4ON0 A;  1HKQ A;  3CLO A;  1O3R A;  1SFX A;  2Z33 A;  2Q0O A;  1HQC A;  3ZMT A;  3OV8 A;  5HLI A;  5D5V B;  2DW4 A;  4CZZ A;  1QPM A;  5D5X B;  1G3W A;  3JSP A;  4RAY A;  3IWF A;  2P5K A;  5ERI A;  4MQV A;  5ILU A;  1S7A A;  2C6Y A;  2RVC A;  3E5U A;  1U8R A;  2M30 A;  5D4S A;  2RV8 A;  3KP5 A;  2B0L A;  1GXP A;  1QO0 D;  3GVA A;  1STZ A;  4CXF A;  1P2F A;  1U6G A;  1P92 A;  3TQN A;  2HWV A;  4EV0 A;  2EFQ A;  4TV7 A;  4A6D A;  1QQI A;  1XSX A;  4LK0 F;  4Q4Z F;  1R5H A;  1XSD A;  4G9Y A;  3MWM A;  4UV9 A;  1UB9 A;  2MD5 A;  4EJU A;  1BI3 A;  4RB1 A;  1MDM B;  4M73 A;  3BJA A;  2DPD A;  1B1B A;  4ETS A;  2IVM A;  1LJ9 A;  1S3J A;  2O61 A;  2CO5 A;  1KA8 A;  2EFN A;  3VOE A;  4OIP F;  3R4K A;  2Q8K A;  5LEJ A;  5DDG A;  3GZ5 A;  3MFK A;  2BGC A;  2ZXJ A;  2G7U A;  4P9U A;  5L3C A;  2IPQ X;  3J81 Z;  3GUD A;  3TOA A;  3DPT A;  2STT A;  1Z6R A;  3KZZ A;  4E70 A;  1OYY A;  1K6O A;  4G7Z F;  3F8N A;  2ISY A;  2LKP A;  3ABT A;  4HQM A;  4P96 A;  2GIV A;  3BP8 A;  3FXQ A;  1XN7 A;  4L9V A;  4HX7 A;  1C0W A;  1W7P B;  3IKV A;  2V79 A;  4O5V A;  2CW0 F;  5E8I A;  4I01 A;  4LGW A;  1FZP B;  4FX4 A;  4ESF A;  1P6R A;  4M9S A;  3GYH X;  1ZLK A;  4CIC A;  3HOT A;  4R1H A;  3RJP A;  1RUN A;  3FMS A;  2P4W A;  2P6S A;  4ZH4 F;  1JHF A;  1FBU A;  5D5U B;  2V9V A;  1XMK A;  3R0A A;  3QRF F;  3KE2 A;  2M45 A;  3K69 A;  3IC7 A;  3REO A;  1FWZ A;  4Q48 A;  3I0T A;  3FM5 A;  3U2R A;  5E1W A;  1HSJ A;  2DQL A;  2IT0 A;  1JXS A;  4HDU A;  3ZMV A;  4UUV A;  2DBB A;  3ROU A;  3GEZ A;  5JR3 A;  1W4M A;  1BC8 C;  5CVV A;  3ERE D;  4ZYE A;  3F72 A;  3FXU A;  5E17 F;  2OD5 A;  5IT3 A;  3WTX C;  2Z3Y A;  2HDC A;  1ZYR F;  4LJZ F;  1J5Y A;  4G6D A;  2J5P A;  2LF8 A;  1IAW A;  3RPU A;  4N9H A;  3KZY A;  4HAM A;  4BHC A;  3DFG A;  4KA4 A;  2L02 A;  2RC4 A;  1B9M A;  3SHF A;  1D3Y A;  1G6N A;  2HS5 A;  2VOP A;  4BHP A;  1BIB A;  4MQ9 F;  2NAZ A;  3I59 B;  3CUQ B;  2DFI A;  4O3M A;  4HX8 A;  4A0Y A;  3JAM K;  1R1T A;  3HUG A;  3QP5 A;  4I09 A;  4Y17 A;  1EH8 A;  2H27 A;  1KU9 A;  3DF8 A;  3E6C C;  1WSU A;  3JTG A;  2MA3 A;  4OIQ F;  4HW0 A;  4LFU A;  1YW7 A;  2HEO A;  1YG2 A;  1D8J A;  1R1U A;  3K2Z A;  3WTS C;  1D5V A;  2FBH A;  4EJT A;  1KU2 A;  1TW3 A;  1FYL A;  1U78 A;  3LWF A;  3HSE A;  2ZNZ A;  1LEA A;  4L5J A;  4CHU A;  4KUM A;  2FBK A;  2M5W A;  1KQ9 A;  1B4A A;  3H3U A;  1DPU A;  1P4X A;  3ABU A;  4M6Y A;  3TGN A;  4A5M A;  2P8T A;  1SD5 A;  4YIF A;  2DI3 A;  2VOD A;  4U0V A;  1BN5 A;  2XGX A;  1YO5 C;  4U88 A;  5EEG A;  3SZT A;  3KP2 A;  1KQ8 A;  2VBX A;  3I4P A;  2Y48 A;  2HZT A;  4L18 B;  1V4R A;  4RGR A;  4EM0 B;  4HZF A;  3BDD A;  1HW1 A;  1FC3 A;  1TQP A;  4IPA A;  5JVT A;  2BEO A;  4L9N A;  1P4A A;  2AXL A;  2YR2 A;  3L00 A;  2EV0 A;  2LF7 A;  2X0L A;  4HYE A;  1BBY A;  2ELH A;  1XCV A;  2HYG D;  3P7N A;  1ULY A;  3FF5 A;  2OZ6 A;  1OPC A;  4I0A A;  2ZME A;  2ZCW A;  3ISP A;  2IW5 A;  1DP7 P;  2E1N A;  2QYO A;  5DEQ A;  4QLC U;  2IP2 A;  2L54 A;  3SXY A;  5LGT A;  2F5E A;  2QQ9 A;  4YFX F;  2IA2 A;  5LHH A;  4IRI A;  2E1C A;  3WE2 A;  2F2E A;  2FE3 A;  3T0Y A;  2A68 F;  2L01 A;  1IXC A;  3HHH A;  4XLP F;  3TDU C;  1ODD A;  2A07 F;  2A6E F;  5JHU A;  3QU6 A;  3BOQ A;  3F8B A;  2A69 F;  4RS8 A;  1IRF A;  1WQ2 A;  1I27 A;  1ZRF A;  4IRG A;  4A6E A;  2FXA A;  4WF2 A;  4A12 A;  5IT9 K;  2TDX A;  1OKR A;  2HKX A;  4HLY A;  3RIR A;  4L0Y B;  4NHJ A;  3FXR A;  3HRT A;  3GFL A;  4PGG A;  3L09 A;  1KQ0 A;  3F22 A;  2VON A;  2DT5 A;  2NNN A;  2EJR A;  3C1D A;  2EB7 A;  3E5X A;  5ED4 A;  4L5I A;  2ZME B;  2DPU A;  1DUX C;  1J9I A;  1IN7 A;  3DKW A;  1F5T A;  1K7A A;  4XBF A;  2H09 A;  4IVN A;  1HW5 A;  1CF7 B;  1B59 A;  4S05 A;  1L0O C;  4I02 A;  1PUE E;  4ENJ A;  3HIF A;  1GXQ A;  4WK8 F;  1JGS A;  1IUY A;  3I5U A;  1HST A;  2BBY A;  3CTA A;  4MGR A;  2RNJ A;  4IF4 A;  1U3E M;  3TOB A;  2Z5U A;  4HLX A;  1B6A A;  2MLG A;  2M8E A;  4KIC A;  1QBJ A;  4UV8 A;  3GZ6 A;  2ESH A;  5D8K B;  2WC2 A;  4WX9 A;  3E97 A;  2V6C A;  2F5D A;  4NB5 A;  3BPV A;  4Q47 A;  3SZP A;  3LFK A;  1QNT A;  4FHT A;  1O3S A;  3IRQ A;  5D8L B;  1IN5 A;  2K7L A;  4ENM A;  1HXD A;  1U5T B;  3EDP A;  2DK8 A;  4OMZ A;  4L0Z B;  2NS0 A;  1LNW A;  4AVP A;  5FFZ A;  2OA4 A;  5L3G A;  5E20 A;  4M6X A;  2FNA A;  3F3X A;  4UXN A;  4ASN A;  1IN6 A;  3ECH A;  4S04 A;  2LSO A;  1ZH5 A;  2DTR A;  5ICC A;  3GX4 X;  4U7B A;  1ON1 A;  2L4A A;  5ICF A;  3KFW X;  1ZG1 A;  1K78 B;  4GYI A;  2YX4 A;  1PDN C;  1TNS A;  4ENN A;  2R7F A;  2QLZ A;  1LB2 A;  5AIP A;  4RGS A;  3K0L A;  1FYM A;  3F21 A;  2OQR A;  3MEX A;  1UHW A;  2A6H F;  2MH9 A;  4BHB A;  2DO7 A;  1ON2 A;  1R22 A;  3H92 A;  4O6J A;  3K9T A;  4I0B A;  1RIO H;  1J75 A;  1SAX A;  4M74 A;  3CO7 C;  3J80 K;  3DEU A;  3F8M A;  3TKY A;  2H94 A;  4CGZ A;  4P5O A;  3T8R A;  2W84 A;  3W6K B;  1UHM A;  2XAQ A;  2VN2 A;  3CUQ C;  3K1P A;  1L3L A;  4MHG A;  4GYG A;  1BI1 A;  2RN7 A;  2HYF A;  3WTY C;  1ZN2 A;  4P55 A;  3V8J A;  5ICE A;  3EUH A;  4EQQ A;  5DCF A;  3M1E A;  4MNU A;  3WG9 A;  4EJV A;  1NHA A;  2QQB A;  4PCQ A;  1T0F A;  2HOE A;  3PQJ A;  1KGS A;  1BI0 A;  5LGU A;  1T2K A;  3DXJ F;  2H6C A;  1D8K A;  3LA3 A;  1R00 A;  1IF1 A;  1S29 A;  5KK1 A;  3LA7 A;  1G4D A;  4RGX A;  3COA C;  1TNT A;  1SMY F;  1Z05 A;  1ZGJ A;  3LQQ A;  4HV6 A;  2Y75 A;  2W25 A;  3J80 Z;  2ZJ2 A;  5LHI A;  2NRA C;  3W6J B;  4LB5 A;  1H9G A;  3GFI A;  2HQN A;  2JPB A;  2FRH A;  4HX4 A;  1SFE A;  4WXH A;  3HHG A;  1R23 A;  2HQR A;  4L9J A;  1MJA A;  3TDZ C;  1WI9 A;  4LLG F;  2KIU A;  3LAJ A;  3D0S A;  1T38 A;  1XDS A;  3I59 A;  3S2W A;  5ILS A;  3HRU A;  4EMS A;  5J8F A;  5F1R A;  4JQF A;  5J6X A;  3Q5F A;  4OOI A;  1T98 A;  3MCZ A;  2OQG A;  4KNY A;  5F6F A;  2E7X A;  1G3T A;  2XIG A;  2EA4 A;  2HTJ A;  2PMU A;  4BYY A;  3F6O A;  4RB0 A;  5D5W B;  1BM9 A;  3TO9 A;  4HBL A;  1O7L A;  2A61 A;  2OAZ A;  3E3V A; 
#chains in the Genus database with same CATH topology
 2DA4 A;  1SAU A;  5TIS C;  2DYR H;  5TRD A;  2WAQ N;  5K5Q A;  2V9K A;  3BPX A;  1MGT A;  4NUB A;  1RZ4 A;  5K1Y A;  1ZR4 A;  1N75 A;  5HOO A;  2JWT A;  1VQP I;  3EYY A;  3S16 J;  1UG0 A;  1KZH A;  1YX3 A;  2DA3 A;  3DLA A;  1TWF J;  4M3F A;  2EZI A;  5FLV A;  4UHT A;  1XGO A;  2L9R A;  2XGD A;  4H4K C;  1FBS A;  2X6W A;  3U9G A;  5FD6 A;  4MIM A;  2EIJ H;  4XN0 A;  5FGM A;  3WGI A;  2E1O A;  3ZQI A;  2VXD A;  3QPS A;  2DMT A;  2F48 A;  4U87 A;  3L2R A;  3HKZ N;  3BG7 A;  1O3T A;  4KFC A;  2HKO A;  1A6I A;  3PL8 A;  3O8G A;  2DA6 A;  2NVX J;  3H5R A;  3KX2 A;  1FPQ A;  1B8I A;  4EAT A;  1G2H A;  1OFC X;  3RI4 A;  1I5Z A;  1U5T C;  3CUO A;  2AS5 F;  1N25 A;  2O5R A;  4BY1 J;  3ZOB A;  2J5O A;  4B09 A;  4XLA A;  2NYX A;  3FXL A;  1IRX A;  1FMW A;  3FZV A;  1JKO C;  1MBJ A;  2TCT A;  2HXO A;  3V8L A;  1K79 A;  3CC2 I;  5DD4 A;  1W5S A;  1TQM A;  4IHS A;  4AIK A;  2IS6 A;  3HJE A;  3E6D A;  2BHY A;  2XC7 A;  1PYV A;  3HPH A;  2GXA A;  3IAM 2;  1FYK A;  4XRF A;  4I99 C;  3FWE A;  2V4J C;  4IJA A;  4HNU A;  2JZY A;  2XUB A;  1EA3 A;  3G1L A;  3HRS A;  3OOP A;  1J2X A;  2K3F A;  3I56 I;  2D45 A;  4R79 A;  2KFD A;  2VBZ A;  4AD9 A;  1HBX G;  1MIJ A;  4BE1 A;  2Y0S N;  3DV8 A;  2G7H A;  3NAU A;  2V26 A;  4DZP A;  1WZ2 A;  3OYN A;  1ZG3 A;  1RES A;  2P7V B;  3CCE I;  1YS6 A;  3WU1 B;  3V8K A;  2O7O A;  2VC0 A;  4PJN A;  4UVA A;  3AG3 H;  3E5Q A;  4XNF A;  3F6V A;  3FXO A;  1I3Q J;  5IP6 A;  3K1M A;  5EGO B;  3CMM A;  3OSF A;  2CG4 A;  1JKQ C;  4A3M J;  1ETW A;  2CMP A;  1NG7 A;  3K2A A;  4EJW A;  4I7H A;  4XLE A;  2O6G E;  1RI7 A;  2VE8 A;  1PP7 U;  3RPU D;  1JKR C;  1XSV A;  2DAO A;  3R61 A;  5KVR A;  3ZN0 A;  4BU2 A;  4G7H F;  3JTH A;  2VJI A;  2WTE A;  3K10 A;  2FUG 2;  4LIU A;  3DEW A;  3MMY B;  5GPC A;  2BXZ A;  1BW6 A;  2EPF A;  1KU3 A;  2EFO A;  2QEX I;  5F08 A;  2P6T A;  4P9F A;  2EH3 A;  5HNF A;  1FSE A;  3VEP A;  3P5J A;  2VJ4 A;  4BXX J;  2RRE A;  5BPD A;  3ZQH A;  1OCT C;  5CVI A;  3HOY J;  3WTT C;  2YU9 J;  4N4O B;  4GO1 A;  3OIO A;  3NEU A;  3LOC A;  1TQI A;  1WPK A;  3ABM H;  3GO5 A;  2D2W A;  2NXN B;  2DLL A;  4DYQ A;  2F6C A;  1I50 J;  3LQR A;  3ZRG A;  2W82 A;  3SQN A;  2CQN A;  2GXB A;  2X6O A;  2ACJ A;  3KP4 A;  1ZTR A;  2QF7 A;  3DCF A;  2ISZ A;  3B02 A;  3W6V A;  1MMG A;  3ZQ7 A;  4V19 K;  1WKM A;  2XVC A;  3H36 A;  4N4N B;  3GME A;  3WTW C;  2BVL A;  1D0Y A;  1TLH B;  4DBR A;  5BS6 A;  3ML6 A;  1XB4 A;  4KIG A;  2DQR A;  2EZL A;  5E18 F;  3EUK L;  5L3D A;  1V55 H;  2K4J A;  4IKF A;  2X1D A;  3DU5 A;  1WJ5 A;  4ZYG A;  3V7S A;  4DQ2 A;  3CO6 C;  2D1V A;  1Y8Q B;  2XAU A;  1YFH A;  5DCM A;  1FT9 A;  4C3J J;  5K7F A;  1FP2 A;  2DYS H;  1SEU A;  2DT7 B;  2O3F A;  4OIN F;  5J1R A;  3H3V K;  3CF5 F;  2IXS A;  5AIQ A;  5HDG A;  4WCG A;  1QZE A;  4J00 A;  1VQL I;  5LBQ A;  4C2T A;  4BNC A;  5H6R A;  1BOB A;  3DP7 A;  3GW2 A;  4FQG A;  3GFM A;  2KPM A;  2XRL A;  1T56 A;  1WFX A;  4NNJ A;  4A3L J;  2GAU A;  2QBY B;  1XTA A;  1UG2 A;  3QP6 A;  2DU9 A;  4KMF A;  3JRB A;  1ZAR A;  2Z1D A;  4U0W A;  4DYR A;  5ICG A;  2R7X A;  4RMN A;  1BJZ A;  3TW6 A;  3BLY A;  2XV4 S;  1UCR A;  1ZGA A;  3ABK H;  3HSR A;  1FBQ A;  1BOA A;  3MKW B;  4QWQ A;  4RLF A;  4ZYA A;  3L9F A;  3A01 A;  1MBF A;  3BY6 A;  3HTS B;  1PUF B;  3B6A A;  3KIO A;  3C3W A;  3IH2 A;  2E1M C;  1VQ6 I;  2JPC A;  3FKI J;  3KYD B;  2P5L C;  4RAG A;  2DA1 A;  2JRM A;  2OCC H;  4KIB A;  1W7P D;  2DCE A;  2MC4 A;  3JRD A;  4MEX F;  4DNC A;  3G73 A;  1ZK8 A;  2Q2E B;  5GAG J;  2RAE A;  1OYW A;  1RNL A;  2PEX A;  4K2E A;  4BQO A;  2V1X A;  2H6B A;  5EZG A;  4B1R A;  2BYV E;  3JW4 A;  3Q0W A;  4C3I J;  3I58 A;  2DOD A;  4EGZ A;  1DU0 A;  1VQ5 I;  1XC5 A;  4RLQ A;  3I4M J;  2YSR A;  3JAM Z;  3CCQ I;  2CUZ A;  1FY7 A;  4YFN F;  3ZP5 A;  3BG6 A;  1JT0 A;  4G6T B;  2HTS A;  3DPL C;  3K4J A;  4YRV A;  3A4C A;  4PK4 A;  3IWZ A;  2FEZ A;  2MAB A;  5IOY A;  3DPU A;  5L3E A;  4BY7 J;  4UUS B;  3DBL B;  5H20 A;  2MSY A;  4XLF A;  1Z7U A;  2GA1 A;  5FLX Z;  3H5N A;  3EUH C;  5FLM J;  2V1U A;  1PUF A;  2KP6 A;  4HEA 2;  1KYW A;  5DD8 A;  3OYC A;  3PUB A;  3H9Q A;  4CUG A;  2A6T A;  2XF7 A;  1QPI A;  1T33 A;  4E6K G;  1JJ8 C;  1FLI A;  3P9C A;  1SFU A;  4LMY A;  1ZRD A;  3BWG A;  2K85 A;  1XG1 A;  1ZRC A;  3GTP J;  1BR1 A;  3R6S A;  2HR3 A;  2X1E A;  1ZHF A;  2Y0S A;  3L1P A;  1IN4 A;  2W4S A;  3GCM A;  2JSC A;  3JCU C;  2R7R A;  1A04 A;  3H3Z A;  4I76 A;  4Y33 A;  2RDP A;  2CUJ A;  1ZAO A;  1RET A;  1IW7 F;  2L0K A;  3QYB A;  1XGS A;  2IEK A;  3KLN A;  2KRH A;  5BQT A;  3U21 A;  4PJ0 C;  5E3L A;  4PSX A;  4V2F A;  3MKY B;  3CJQ B;  4YG2 F;  3VWB A;  4LK1 F;  3L2C A;  2QM3 A;  4Y15 A;  4F7Z A;  4R8H A;  4XOP A;  4RB2 C;  1XCB A;  3JRA A;  2EFW A;  4LLN A;  2PJR B;  4B3A A;  1X4P A;  5E8G A;  3ZMZ A;  3VYT B;  5M3F J;  3EET A;  3D5R C;  5LHG A;  1E2X A;  3V7C A;  2GA2 A;  3MKL A;  4CZC A;  3CDI A;  1JGG A;  1YIT I;  1GVJ A;  3L7W A;  1JTX A;  2DMP A;  3MN2 A;  3HC7 A;  4L9T A;  4G12 A;  4DIQ A;  2IGK A;  2DTZ A;  1S9H A;  2FU4 A;  1Y0N A;  3BJ6 A;  3RYP A;  4M3E A;  1X3U A;  6PAX A;  4ZDP A;  1VND A;  3GXO A;  1LVA A;  1W5C C;  3OL4 A;  1G3Y A;  3PSI A;  3KEO A;  4HSR A;  2EK5 A;  2FBI A;  2IS4 A;  1FOW A;  1SD6 A;  2XSJ C;  9ANT A;  4X0G A;  2LVS A;  3JRG A;  2I10 A;  3VSL A;  2DK5 A;  4C30 A;  5JHF A;  5D6F A;  1A6Q A;  1B9N A;  4LD5 A;  1Z6T A;  3GFJ A;  4CCL A;  2OU2 A;  4F52 A;  4EJO A;  2OTJ I;  3I53 A;  5C4X J;  4MEY F;  2R4G A;  1H9T A;  1LFP A;  3RZD J;  3ESW B;  3HEF A;  4HA8 A;  5GTI C;  1KU7 A;  4I2O A;  2K5C A;  5K5R A;  2JTV A;  1FOK A;  3Q9V A;  1D1B A;  2E35 A;  2XPW A;  3HGY A;  5HS9 A;  2K86 A;  4PGH A;  1P7J A;  3MZY A;  3VYS B;  4XON A;  1U8B A;  1UZC A;  2K9Q A;  3KCC A;  3MZ8 A;  3WE3 A;  4ZYD A;  1MBE A;  1ORK A;  3TO6 A;  3P9K A;  3V42 A;  2E2H J;  3DQV C;  3N4M A;  2JQ7 A;  3JSO A;  2BY2 A;  3W2A A;  3HKZ A;  2QZ8 A;  3V4G A;  2ZNY A;  4KN7 X;  3MZH A;  4WXD A;  2ZXI A;  1HKT A;  1A35 A;  2QWW A;  5B66 C;  2ICW G;  4OIR F;  4M72 A;  4RGU A;  4GCV A;  3FM3 A;  1V54 H;  2ZBK A;  2JT1 A;  5M5Y J;  2LYC A;  4HPQ A;  1MSE C;  2QSH X;  5A2Q Z;  4OIO F;  1TT5 B;  1GHC A;  3SEZ A;  2LDU A;  3QPT A;  2A5Y B;  1H0M A;  4ZYH A;  2GLO A;  3M8J A;  1TZL A;  3GTG J;  1J7K A;  2PLY A;  4ENK A;  1R7J A;  2OBP A;  2BZT A;  2FNP A;  3M7G A;  2ELJ A;  3H0G J;  1FMV A;  4CCO A;  4IL6 C;  1APL C;  4XK4 A;  1Q1V A;  1S7O A;  3F8C A;  2R5Z A;  1HW2 A;  3S1M J;  3CUQ A;  1UST A;  1Y0U A;  4KT5 C;  2GM4 A;  3DLL F;  1IRG A;  2L9S A;  2GOM A;  3FBI B;  4F93 B;  3LST A;  4CO8 A;  4HOB A;  2NVT J;  2XRN A;  1AOY A;  3QU3 A;  2WB1 N;  2OF7 A;  1I6X A;  1T39 A;  4LIT A;  5IOZ A;  2Z2S B;  3RCO A;  2W00 A;  4M3B A;  5C44 J;  4PSW A;  1YHQ I;  3R0J A;  2VKV A;  5TJJ A;  1T6S A;  3ZQF A;  4BE2 A;  3PQK A;  1YS7 A;  2CW8 A;  5LLQ A;  2HDW A;  2LK2 A;  4CCM A;  4BE0 A;  2PMH A;  4OU0 A;  1QVT A;  1G3S A;  2LTP A;  3J81 K;  5EGO A;  4WWC A;  4RAZ A;  2JA5 J;  2IAI A;  1EV7 A;  1FIP A;  3WTV C;  3U1D A;  1MMN A;  3IL2 A;  1R36 A;  4DW6 A;  3S32 A;  2M2E A;  2UV1 A;  2R5Z B;  1XD7 A;  2EV5 A;  1ETY A;  2UXN A;  1PP8 F;  1UMQ A;  2FOK A;  2BY3 A;  5A2Q K;  2EFP A;  5GPA A;  3HTU A;  3I54 A;  4A0Z A;  3BTL A;  1ACI A;  4M9X A;  4UUT A;  3CQZ J;  3RDI A;  2MC3 A;  4JX4 A;  5CVJ A;  1P4W A;  4JX5 A;  4RB3 C;  1QGP A;  2HNH A;  3BJO A;  3CDL A;  1JUM A;  4YEL A;  5EEH A;  5F0F A;  3RYR A;  4IHV A;  2DA2 A;  2EV6 A;  2FD5 A;  2VBW A;  1Z0X A;  2HQ5 A;  3G6E I;  2W57 A;  4N0B A;  1EKE A;  4ZTF A;  3QPL A;  1MMA A;  1F9N A;  1MZB A;  3RKQ A;  5F04 A;  1X19 A;  4XKW A;  1X2N A;  2CSO A;  2HXI A;  3PNT A;  3FMQ A;  3E6B A;  2BVM A;  1DPR A;  2RNG A;  1EH7 A;  1A36 A;  1ETO A;  4AUX A;  2ZKZ A;  4XLN F;  1YYV A;  3RTR A;  2XKO A;  1FP1 D;  1E3H A;  2FQ3 A;  2XSD C;  1WJD A;  2HOA A;  3SFZ A;  2R7D A;  2LMD A;  3HOX J;  2VT2 A;  1QZY A;  3OS1 A;  1W36 D;  1FX7 A;  2BE5 F;  3ONQ A;  4AC0 A;  2NNY A;  4RM3 A;  2OPT A;  1T95 A;  3ZMS A;  3KYC B;  1EJ9 A;  1SD4 A;  4X6A J;  4A0X A;  1ETV A;  2DN0 A;  2X9D A;  1IZ1 A;  5LEK A;  2G9W A;  5KAI C;  4H0E A;  1Z1D A;  1SVL A;  3BCA A;  4JYK A;  1W0U A;  3WOD F;  2VB6 A;  4HDV A;  1BC7 C;  2HOS A;  2D1H A;  4ANJ A;  1BJA A;  2RKH A;  3BRO A;  2CQX A;  1JI8 A;  4HF1 A;  4YII A;  4E7Z A;  3MD2 A;  1UEL B;  2R7S A;  1X3W B;  1Z91 A;  2G0E A;  3D5L A;  4EM1 A;  5LFA A;  4MTD A;  1JHH A;  3I71 A;  3FMR A;  2I8D A;  3O2P E;  4B4C A;  1D5Y A;  3AG2 H;  3O6B B;  4CCJ A;  2VQG A;  2KQR A;  2YX7 A;  1KON A;  2KIF A;  3HRM A;  3QWL A;  2XAG A;  3RKX A;  5J8C A;  1ETX A;  5DV5 A;  1S5L C;  3M9A A;  1I1G A;  4B8X A;  3IKT A;  1U9O A;  4DYC A;  1X1A A;  1BI2 A;  2ADU A;  2MLK A;  1Z9C A;  1FNN A;  4OMY A;  4IO9 F;  3ZQG A;  1R4M B;  4NQW A;  1F4K A;  1GT0 C;  3HPG A;  2IGO A;  2KIS A;  2O8X A;  1DDN A;  1CGP A;  3GWZ A;  1MW7 A;  2PBI A;  2MBF A;  5E1Z B;  2M9H A;  2L9V A;  3PNY A;  5F64 A;  3HOS A;  1VQ7 I;  4ESJ A;  4KN4 X;  4KYW A;  4QTR A;  4N9I A;  3HGG A;  5IYC J;  2FF4 A;  1ITY A;  1EF4 A;  5E1X A;  5L3F A;  3OYA A;  2LNB A;  2DT6 A;  2LG4 A;  3M8F A;  4BUP A;  2GBY A;  4E7S A;  2ELK A;  2B7E A;  2AHQ A;  4U7D A;  3IH4 A;  2KL4 A;  2DDA A;  5EZH A;  2W24 A;  1JJ6 C;  3GBG A;  3ZMD A;  4D7N A;  3A1Y A;  3K70 D;  4FAS D;  2ZJQ F;  4Q5S F;  2FMY A;  1IO2 A;  2K4B A;  1D0X A;  3T1B A;  4BJ6 C;  2R0Q C;  2B63 J;  3S17 J;  4IXA A;  2ZO4 A;  3NQO A;  5FLX K;  1R58 A;  3OS2 A;  2WWY A;  2JA2 A;  2IA1 A;  3I64 A;  2UZK A;  3TO7 A;  5FB2 A;  1LVK A;  5DYM A;  4GFB A;  2PX9 A;  2MW8 A;  3ZMU A;  2ETH A;  1HKS A;  2KIQ A;  2XF5 A;  1TWG J;  2HYJ A;  4S0H B;  3K4B A;  1MND A;  2F5F A;  2MYS A;  3JR9 A;  3B73 A;  3LAP A;  3DWL E;  1HOM A;  3IV5 A;  3G4S I;  4KDP A;  4BAY A;  4B3X A;  2Q2E A;  3GTL J;  4A93 J;  3O3K A;  1RPW A;  2GIZ A;  2V1D A;  4E4H A;  4PJJ A;  2ZFW A;  2M87 A;  4G6Q A;  2AO9 A;  2E1M B;  2X48 A;  5FRN A;  4M71 A;  4QIW N;  1OJL A;  3SDB A;  3VOD A;  3J7A O;  3M3Y J;  3ZPL A;  4FE7 A;  4BXU A;  1VI0 A;  3HSF A;  2CWE A;  2Y0M A;  2L3D A;  1O57 A;  3KP6 A;  1PJR A;  1TW2 A;  4DOZ A;  2LKX A;  1CF7 A;  3GTJ J;  1XGN A;  3OIP A;  2Z9O A;  4IEJ A;  2JK3 A;  2KJC A;  4AWX B;  2NS8 A;  2IA0 A;  3D5S C;  1D1A A;  3CMY A;  3LSJ A;  5CJ9 A;  2QEN A;  3BZ6 A;  1EH6 A;  4QPQ A;  2KIM A;  5BOX A;  3K1N A;  2E5N A;  3H1C A;  5B1B H;  2QVO A;  4MLO A;  2JVH A;  4LG0 B;  4HV5 A;  4EM2 A;  2IJL A;  3M4O J;  1U0J A;  4J19 A;  1WJC A;  2K9L A;  1I3A A;  1V5E A;  1SMT A;  3G3Z A;  3DEE A;  5FKK A;  3OYI A;  2K27 A;  2CH0 A;  2QUF A;  5HLH A;  2OZU A;  2UXX A;  3EQL F;  2PN6 A;  1J59 A;  4B44 A;  2YU3 A;  3C18 A;  1RR7 A;  4XIC A;  3CZ6 A;  3E0J B;  4PJL A;  3OY9 A;  2GZW A;  1WH5 A;  3QPH A;  3TP3 A;  3VFZ A;  1FJL A;  1MH3 A;  2ECC A;  2FJ1 A;  1OR7 A;  1E3P A;  3ZCO A;  3NWT A;  1YLF A;  4AYB N;  1LEB A;  4A5N A;  4P1W A;  4UY8 I;  2WAQ A;  4KJZ A;  3TBI A;  2DA7 A;  3GF2 A;  1Z67 A;  3CP2 A;  1IDY A;  3QYE A;  3PFI A;  2VOO A;  4CDG A;  1RKW A;  4I98 B;  4I6Z A;  2VE9 A;  2O9L A;  4XID A;  3P9I A;  2ZSH B;  4JBA A;  2FA5 A;  3HOU J;  2CU7 A;  3V7R A;  2VT3 A;  4UNO A;  2DFE A;  4ESB A;  3KP3 A;  3FBN B;  3CJN A;  3FXK A;  2PJR A;  2ID3 A;  2QQA A;  4UVB A;  1QVU A;  1UFM A;  1MDM A;  2JA7 J;  1XGM A;  4D0P A;  2HGC A;  3OL3 A;  1LPQ A;  1I1S A;  5IYB J;  2NS7 A;  3W2V A;  1OQY A;  5LGN A;  2XAH A;  4HQE A;  2IRF G;  1WRJ A;  3LSM A;  1O7F A;  2ESN A;  3FK6 A;  4F92 B;  3LA2 A;  2B9S A;  4B43 A;  1S6L A;  4MTE A;  5DUI A;  4M3D A;  1MJB A;  1V3F A;  1S8N A;  1REP C;  3IHU A;  4XSZ F;  3HUG B;  2PJP A;  2Z99 A;  4PZJ A;  4ZZD A;  4G7O F;  1BIA A;  2IS2 A;  2FSW A;  3N97 A;  5IT9 Z;  4FET A;  3T5X A;  2CYY A;  1U5T A;  2R7O A;  4IOC F;  3J7Z I;  4L5E A;  1TT0 A;  5FD5 A;  5ILV A;  1K78 A;  5L3B A;  1H8A C;  1RC9 A;  2VC1 A;  3PSF A;  4X1E A;  2PFB A;  1ZLJ A;  5CVR A;  5FRO A;  1ONV A;  2EA2 A;  4JK1 X;  1XX5 A;  3E6M A;  1X1C A;  3CCR I;  3A03 A;  3FK7 A;  1R5G A;  2JVG A;  4G8X A;  3FHZ A;  3BG9 A;  4EGY A;  5JFR A;  3R60 A;  4XKB A;  3ZQL A;  1MBH A;  1ZG5 A;  3FDY A;  1IUF A;  3EYI A;  3LSK A;  3HYI A;  5JI6 A;  1R1V A;  2R3S A;  1VTN C;  4AIJ A;  2BV6 A;  2VQL A;  3OWT A;  2H8R A;  1W7P A;  2K3P A;  5TGT A;  5J4V A;  2CV2 A;  1VFC A;  2EWN A;  3BR2 A;  2QSG X;  3I4N J;  2P5V A;  2P81 A;  2WV0 A;  2QGU A;  3M07 A;  1VQM I;  2KKO A;  2KRF A;  3QOP A;  5K5O A;  2Y69 H;  3CC4 I;  5CYV A;  4NDL A;  4CYD A;  4AU7 A;  2K40 A;  2KJB A;  4XSX F;  2PG4 A;  2MG4 A;  4A2U A;  4IRH A;  1SD7 A;  2BW3 B;  3PUF A;  5HNH A;  3HM5 A;  2PQ8 A;  4XM3 A;  4Y4R A;  3MAJ A;  2L4M A;  1JTY A;  2NOG A;  2HU9 A;  5JLW A;  4CSW A;  1IDZ A;  4PDK A;  1AWC A;  5HLG A;  1TBX A;  1TTY A;  1XMA A;  2HFH A;  3MQ0 A;  1X3Z B;  1YW9 A;  3FX3 A;  1ZGW A;  2F4M B;  3C2H A;  5D6E A;  4QPO A;  3WU0 A;  1FEX A;  2E36 A;  1A31 A;  1F1Z A;  1YW8 A;  2K02 A;  3KLO A;  3VB2 A;  1OIS A;  4G94 A;  4XMY A;  1QZZ A;  2A05 A;  3F23 A;  2L2O A;  1LDJ A;  3FKJ A;  2VBY A;  2DFH A;  2UUZ A;  1U2W A;  1WCM J;  2F5C A;  4HF0 A;  3ZR8 X;  5EF6 A;  3BTI A;  1RUO A;  2WV1 A;  5LRR A;  1FTT A;  4IHT A;  3ZN1 A;  2AQE A;  3GLX A;  2CFX A;  2VQH A;  1HDP A;  2KMU A;  4MO7 A;  5HDN A;  1USS A;  5FO5 A;  4AIH A;  1B8I B;  1J0R A;  2XF6 A;  2GXG A;  2XRO A;  2CQ7 A;  4A69 C;  2XDV A;  5DM7 F;  1AHD P;  1IC8 A;  2GOX B;  4GXO A;  3CCJ I;  4GGG A;  2COM A;  1Z3X A;  3OYF A;  2QQ8 A;  5EJC A;  3G71 I;  5GAD J;  3AAF A;  1GLN A;  3RKW A;  1T8I A;  2CQK A;  2WY8 Q;  5DM6 F;  4NBQ A;  2LLK A;  3NRV A;  1ZRE A;  1YIO A;  3AFH A;  3KP7 A;  5HS7 A;  2XB5 A;  5J47 A;  4A3J J;  3IRR A;  2M1B A;  2CQQ A;  4ZZL A;  3UR3 C;  3T8T A;  3BTJ A;  3SDG A;  4ZJZ A;  5D4R A;  4LOC A;  4FT8 A;  1Y8R B;  3CDH A;  2DOF A;  4Z2Y A;  1JT6 A;  2NVU B;  2LY2 A;  3ELK A;  3WGG A;  1NH3 A;  1VQN I;  3Q9S A;  4OAZ A;  4BH9 A;  1GDT A;  5BMZ A;  2O0Y A;  4M9Z A;  3ULQ B;  5HVQ C;  1IGN A;  5DUK A;  1IN8 A;  1WI3 A;  5C3E J;  2XHK A;  3O8H A;  2ME0 A;  4FE4 A;  4D9J A;  3DU6 A;  1O3Q A;  5J4Y A;  2UWM A;  1MKM A;  1OMI A;  1W5T A;  1XMX A;  3IP4 B;  3WGH A;  2X85 A;  2GQQ A;  2A5W A;  1G8X A;  3F0C A;  4LB6 B;  2RQP A;  1OYI A;  1WWX A;  2L5Q A;  3CD6 I;  4YFK F;  4HF2 A;  3G2B A;  1ERD A;  1YQA A;  4FTH A;  4KIT B;  4EVI A;  3JRE A;  1BR2 A;  3BR3 A;  3EPZ A;  1SVM A;  3BT9 A;  1MD0 A;  3HOV J;  3WTU C;  3F8F A;  3PO3 J;  3LSH A;  4ZTJ A;  5BPI A;  2R7Z J;  2GWR A;  5LRS A;  3KZI C;  5EG0 B;  2XAJ A;  3K7A J;  2XKP A;  4IHY A;  3RQ4 A;  2AXT C;  5CPR B;  2MGQ A;  2P7C B;  4BQA A;  3S2H J;  3X2Q H;  2XAS A;  5JLX A;  2M7B A;  2EZK A;  1IXR C;  5CVU A;  3HDD A;  5KNL A;  3LSG A;  2L7K A;  4UVC A;  4JOM A;  5CLS A;  2JA8 J;  2W1O A;  2RGV A;  2MH2 A;  2PI0 A;  2DOE A;  1SFO J;  3K6G A;  2R92 J;  2HZD A;  5FFX A;  3CP8 A;  3G1O A;  3KEQ A;  1XPX A;  4FX0 A;  2JA6 J;  2FX0 A;  4ZC3 A;  5IP9 J;  5M5W J;  4RA2 A;  3C7J A;  1XDU A;  4WXC A;  4IX7 A;  1HC8 A;  2F5V A;  2FML A;  2LBF B;  2O8K A;  1UJ8 A;  3M8E A;  1X4O A;  1Y6I A;  1KYZ A;  2LRE A;  1ENH A;  3QYF A;  4XOR A;  2JRT A;  3GLL A;  2YPR A;  1Q1H A;  1IXS B;  2OTL I;  3SFI A;  3WTZ A;  1T0F C;  3ECO A;  4BKX A;  1E17 A;  2TRT A;  1MMD A;  4AVZ A;  2E7W A;  3QAH A;  2O03 A;  2D5V A;  2QCO A;  1GV5 A;  3VSK A;  2A3S A;  2YUS A;  4M6V A;  5CQE A;  2JMW A;  3CLQ A;  3OYE A;  1YTY A;  3C2G A;  3ASO H;  5DCM B;  3L2W A;  1MJ9 A;  1TWC J;  2W85 A;  2OJE D;  3BC8 A;  2ZXH A;  3HXL A;  3I3L A;  5H6Q A;  2HDD A;  2NVY J;  2X4H A;  3DTK A;  2CGP A;  1LDK B;  2ZJR F;  3OYJ A;  1JE8 A;  1LQ1 A;  1Z7L A;  4MFD A;  1LDD A;  2DMN A;  5HDK A;  4U0Y A;  1YE9 A;  4Y13 A;  2HOT A;  5FKL A;  4KIF A;  2WAE A;  3CCV I;  4LLL A;  2ME6 A;  2QBY A;  2I5U A;  2XAF A;  3DBR B;  1I6H J;  3S3O A;  4KMU X;  3RKY A;  3GZN B;  3PJR A;  5AON A;  2E60 A;  1FSH A;  2VXZ A;  5HS8 A;  3TL4 X;  3KET A;  2LRD A;  2STW A;  3J7A Y;  4XOT A;  3RPQ A;  4LG0 A;  2EQR A;  4ON0 A;  1HKQ A;  3CLO A;  1O3R A;  1SFX A;  2Z33 A;  2Q0O A;  1HQC A;  3ZMT A;  3OV8 A;  4XRM A;  5HLI A;  3EUA A;  2M0C A;  3UKG A;  5D5V B;  2DW4 A;  3MKZ A;  4CZZ A;  1Y1V J;  1QPM A;  1W36 C;  5D5X B;  1G3W A;  4RBO A;  3JSP A;  4CCK A;  4V2G A;  1LUJ B;  3WU2 C;  3LNQ A;  2V6E A;  4RAY A;  1I39 A;  3IWF A;  2E34 A;  2P5K A;  2V9P A;  5ERI A;  4MQV A;  4BXF A;  4CH7 A;  2ZFU A;  4NC6 A;  1S7A A;  1YOV B;  1ETQ A;  4KT6 A;  5ILU A;  5E3O A;  4ZDO A;  2C6Y A;  2RVC A;  3E5U A;  4ZDL A;  1U8R A;  2M30 A;  5D4S A;  2RV8 A;  3BR6 A;  1D0Z A;  5IP7 J;  3KP5 A;  5KHD A;  2B0L A;  1M1E B;  3N05 A;  4A3B J;  1GXP A;  1QO0 D;  3GVA A;  1STZ A;  4CXF A;  3S1Q J;  1P2F A;  1U6G A;  1P92 A;  2KHM A;  1WGX A;  1E3O C;  1TC3 C;  4LIV A;  3TQN A;  2HWV A;  4NQW B;  5FRM A;  4EV0 A;  1X1P A;  2EFQ A;  4FIS A;  3BZC A;  3DBH B;  4TV7 A;  4A6D A;  1NG6 A;  1QQI A;  1XSX A;  3TP0 A;  4LK0 F;  4Q4Z F;  3CCU I;  1R5H A;  4JX6 A;  4IHW A;  3S93 A;  1TP4 A;  4G9Y A;  1OCP A;  3MWM A;  4E7I A;  1XSD A;  3ERM A;  4UV9 A;  1K61 A;  1UB9 A;  1ZEL A;  3S15 J;  1G59 A;  3B6C A;  3GTM J;  1YRN A;  2MD5 A;  4EJU A;  1BI3 A;  4RB1 A;  1MDM B;  1E0E A;  2WB1 A;  3A0B C;  3BCB A;  3WG7 H;  2HQA A;  2LFB A;  4M73 A;  2X1C A;  1X2M A;  1FTZ A;  4Y7N J;  3BJA A;  2DPD A;  4CYC A;  1B1B A;  4ETS A;  5GAH J;  2IVM A;  1LJ9 A;  1S3J A;  2V7F A;  3U1K A;  2O61 A;  2VAS A;  3BR5 A;  4PJM A;  3UNG C;  2CO5 A;  3KPH A;  3OYD A;  1H88 C;  1KA8 A;  2EFN A;  3VDX A;  1CQT A;  3PO2 J;  3VOE A;  5KCM A;  4OIP F;  3R4K A;  2Q8K A;  4Z6Y A;  2LH9 A;  3AG1 H;  3QOD A;  1IRZ A;  5LEJ A;  5DDG A;  3GZ5 A;  3MFK A;  2BGC A;  1WVR A;  2ZXJ A;  2G7U A;  1UAA A;  4P9U A;  5L3C A;  2IPQ X;  3J81 Z;  3GUD A;  3TOA A;  2Y2Z A;  2IBD A;  3DPT A;  4IZZ A;  3W2W A;  4J01 A;  2STT A;  2CUF A;  1Z6R A;  3KZZ A;  3OR1 C;  4D5C A;  1UHS A;  4E70 A;  2VLA A;  1OYY A;  1K6O A;  4BDY A;  4G7Z F;  3F8N A;  4A3E J;  2ISY A;  2LKP A;  3ABT A;  3GTO J;  2K9M A;  4HQM A;  3K4N A;  4P96 A;  4E7J A;  2GIV A;  3PNV A;  3Q3S A;  4Y52 J;  3BP8 A;  3FXQ A;  1XN7 A;  4L9V A;  2VUM J;  4HX7 A;  2WBM A;  1C0W A;  1W7P B;  2R7Q A;  3IKV A;  2V79 A;  4O5V A;  2CW0 F;  3SEQ A;  5E8I A;  2ID6 A;  4I01 A;  3BTC A;  4LGW A;  1FZP B;  1R5I D;  4JP0 A;  4FX4 A;  2K9N A;  1X1B A;  3C2B A;  3OYG A;  4ESF A;  2CS3 A;  1R9T J;  1P6R A;  1Y39 A;  2ZC2 A;  4M9S A;  3CCS I;  2KZV A;  3GYH X;  1FOY A;  1ZLK A;  4IQ4 A;  4CIC A;  3HOT A;  4R1H A;  3RJP A;  3JRF A;  1RUN A;  3FMS A;  2M8G X;  4IQJ A;  2DMU A;  2P4W A;  2P6S A;  4ZH4 F;  4XLC A;  1YJN I;  1YIJ I;  4Y3O A;  2FOW A;  2HPI A;  1JHF A;  1FBU A;  2V9V A;  5D5U B;  1XMK A;  4E7K A;  2VL8 A;  3R0A A;  2DJI A;  3QRF F;  1NK2 P;  1MBG A;  3KE2 A;  1RRJ A;  4IOA F;  1HCR A;  2M45 A;  3K69 A;  2E19 A;  3IC7 A;  2DFF A;  3REO A;  1FWZ A;  4Q48 A;  1Y56 A;  3I0T A;  3FM5 A;  1JUP A;  4IHX A;  4UB8 C;  1HF0 A;  2QKM B;  3DTE A;  4RAF A;  2LKS A;  3H5A A;  3U2R A;  1BA5 A;  3OIQ A;  5FKM A;  3TED A;  4C2M J;  1NK3 P;  2BXY A;  5E1W A;  2H1L A;  1K6Y A;  1HSJ A;  2DQL A;  2IT0 A;  2LC2 A;  1JXS A;  5DTD A;  3L2Q A;  4HDU A;  1VZ0 A;  1GUU A;  3ZMV A;  3D1N I;  4UUV A;  1A5J A;  2DBB A;  3ROU A;  3GEZ A;  5JR3 A;  1W4M A;  1BC8 C;  5CVV A;  3LFU A;  5KAF C;  4ZYE A;  1JUS A;  3ERE D;  3F72 A;  3W3C A;  1SVO A;  3FXU A;  2WAF A;  5E17 F;  1Y1W J;  3LSP A;  2OD5 A;  5F1J A;  2KLO A;  2AQF A;  4BJT A;  5IT3 A;  3WTX C;  2Z3Y A;  2HDC A;  1ZYR F;  1J5Y A;  4II3 A;  4LJZ F;  4G6D A;  2J5P A;  2LF8 A;  4BBR J;  1IAW A;  3RPU A;  4N9H A;  1HDD C;  2BY1 A;  3KZY A;  4HAM A;  1OLT A;  4BHC A;  2BOL A;  3DFG A;  3K4M A;  4KA4 A;  1RR8 C;  2L02 A;  2RC4 A;  4B47 A;  1B9M A;  3SHF A;  1D3Y A;  2LY1 A;  4BAC A;  3BZK A;  1G6N A;  2HS5 A;  5EDN A;  2VOP A;  2KDZ A;  2M3A A;  4OAY A;  4BHP A;  2LP0 A;  1F36 A;  2VJ5 A;  1BIB A;  1R4N B;  2M4K A;  1K83 J;  4MQ9 F;  2R7T A;  2NAZ A;  3I59 B;  5HOD A;  2VJJ A;  3S3N A;  3CUQ B;  3BG5 A;  4BL0 B;  2DFI A;  4XLH A;  4O3M A;  1ZR2 A;  4W97 A;  4HX8 A;  3S8P A;  3L2U A;  4A0Y A;  3S14 J;  3JAM K;  1R1T A;  1S7E A;  3HUG A;  4HG2 A;  3ZGK A;  3QP5 A;  4I09 A;  2KT0 A;  4XKC A;  1EH8 A;  4Y17 A;  4ABZ A;  1KU9 A;  2H27 A;  3DF8 A;  1T08 B;  4C3H J;  3E6C C;  2EIN H;  1WSU A;  3WHC A;  2E71 A;  3JTG A;  2MA3 A;  3LL7 A;  5JVG F;  4EEF G;  4OIQ F;  4HW0 A;  3FHN A;  4LFU A;  4RDU A;  1YW7 A;  5BNG A;  4XN3 A;  2HEO A;  1YG2 A;  1D8J A;  1R1U A;  3K2Z A;  3WTS C;  1D5V A;  3OYK A;  2FBH A;  4EJT A;  2L7Z A;  1KU2 A;  3NWS A;  1TW3 A;  3FIS A;  1FYL A;  1U78 A;  2EIL H;  3LWF A;  3HSE A;  2ZNZ A;  1LEA A;  4L5J A;  4CHU A;  2WY7 Q;  2NOJ B;  2LBF A;  4BBS J;  4KUM A;  2FBK A;  3GTQ J;  2M5W A;  4E7L A;  3IAS 2;  1KQ9 A;  1B4A A;  4A3I J;  2M4G A;  3H3U A;  5FJ8 J;  4GDF A;  1MNE A;  1P4X A;  4QSH A;  2DXI A;  1DPU A;  3ABU A;  4M6Y A;  3TGN A;  4A5M A;  1MH4 A;  1POG A;  1W1W E;  2CJJ A;  2P8T A;  3M1C A;  2QKL B;  1SD5 A;  4YIF A;  2DI3 A;  4F91 B;  2VOD A;  4U0V A;  3JRH A;  2WAD A;  1BN5 A;  3LSI A;  2XGX A;  4DBQ A;  1YX5 A;  1V5G A;  5M5X J;  4U88 A;  1YO5 C;  1QRY A;  5EEG A;  3SZT A;  3KP2 A;  2E2I J;  1KQ8 A;  3OMY A;  1VQ4 I;  2VBX A;  3I4P A;  3CME I;  2CRG A;  3OOU A;  2Y48 A;  3HB9 A;  2HZT A;  1R71 A;  1BR4 A;  5EYR A;  4L18 B;  3K70 C;  2CV1 A;  3RQI A;  1X1D A;  1V4R A;  1HA8 A;  2EZH A;  2OC6 A;  4RGR A;  4EM0 B;  1XS9 A;  1IV6 A;  5J3L A;  4YIR X;  2RQQ A;  3Q0U A;  4HZF A;  3FXM A;  3BDD A;  1HW1 A;  1FC3 A;  3BR1 A;  1DU6 A;  3I55 I;  1TQP A;  3CCM I;  3DKX A;  3KYL A;  5H2F C;  2CW7 A;  4IPA A;  1MBK A;  2KRC A;  5JVT A;  1VQ8 I;  1WJF A;  2BEO A;  4L9N A;  1P4A A;  2AXL A;  2YR2 A;  3G1M A;  3I9V 2;  3L00 A;  1WHU A;  2EV0 A;  2LF7 A;  2X0L A;  2LOO A;  4HYE A;  4CCN A;  4AM3 A;  4DGW B;  1BBY A;  2ELH A;  5GTH C;  1XCV A;  4MFE A;  2HYG D;  2ZJP F;  3P7N A;  2KZG A;  4D7M A;  5GAE J;  1ULY A;  5EEA A;  2JUG A;  1OR7 C;  3FF5 A;  3CMA I;  2OZ6 A;  1OPC A;  4DJA A;  4HNV A;  1NTC A;  2X6Y A;  4I0A A;  1O4X A;  4HRI A;  2ZME A;  2ZCW A;  3ISP A;  2IW5 A;  1LFB A;  1DP7 P;  2E1N A;  2QYO A;  2K9S A;  5DEQ A;  2M7A A;  5C4J J;  4QLC U;  2IP2 A;  2L54 A;  3SXY A;  4HST A;  4PUS A;  5LGT A;  3H35 A;  2F5E A;  2QQ9 A;  5LD2 C;  1BL0 A;  3WHB A;  4BDZ A;  2IS1 A;  4YFX F;  1F43 A;  1N77 A;  2IA2 A;  5LHH A;  4AID A;  1ETK A;  4IRI A;  2H8W A;  2E1C A;  3WE2 A;  2X6X A;  4PFP A;  1OCC H;  2L7F P;  2F2E A;  3ASN H;  4XR6 A;  1IV8 A;  2EIK H;  2FE3 A;  2JSP A;  3T0Y A;  2QSF X;  2A68 F;  2ECB A;  2L01 A;  3A0H C;  1IXC A;  3GTK J;  5FKN A;  3HHH A;  3CJR B;  4XLP F;  3TDU C;  1ODD A;  3OS0 A;  2A07 F;  2A6E F;  5JHU A;  3QU6 A;  3DTI A;  3BOQ A;  2OV7 A;  3F8B A;  1VQK I;  2A69 F;  1HLV A;  3VPR A;  3RZO J;  4OWR B;  4RS8 A;  1IRF A;  1WQ2 A;  2MD0 A;  3H0D A;  3CCY A;  2L7M P;  2R7V A;  5K7H A;  2KDO A;  4AYB A;  3BR0 A;  1I27 A;  3JRI A;  2R7W A;  1ZRF A;  4IRG A;  3TW7 A;  4A6E A;  2FXA A;  2LY9 A;  4XRS A;  4WF2 A;  1IG7 A;  5F0H A;  3AG4 H;  4A12 A;  5IT9 K;  2VQC A;  3CC7 I;  1DP3 A;  2TDX A;  3A01 B;  1OKR A;  2HKX A;  4HLY A;  3RIR A;  3AL0 C;  3J7Y J;  1Z77 A;  1K4T A;  4L0Y B;  4NHJ A;  3FXR A;  3HRT A;  1VQ9 I;  3GFL A;  2P0W A;  4PGG A;  3L09 A;  1KQ0 A;  1AKH A;  3TMO A;  3SYT A;  3F22 A;  4A3K J;  2BHZ A;  2DT5 A;  2WA0 A;  2VON A;  2NNN A;  2EJR A;  4CA0 A;  1OCO H;  3HG9 A;  3C1D A;  2E5Z A;  5K7Z A;  2EB7 A;  3E5X A;  5ED4 A;  4L5I A;  2ZME B;  4W1U A;  2DPU A;  1DUX C;  1J9I A;  1IN7 A;  2JJ7 A;  1Z3Y A;  3DKW A;  2F4O B;  4F55 A;  1F5T A;  1K7A A;  4XBF A;  1X58 A;  1SC7 A;  3OYM A;  2R93 J;  2H09 A;  4IVN A;  4II2 A;  1HW5 A;  3A02 A;  1CF7 B;  1B59 A;  4S05 A;  1QHH D;  3SJM A;  1L0O C;  4I02 A;  1PUE E;  4XKV A;  2Y9Z A;  1YI2 I;  3S1R J;  1GVD A;  2EIM H;  1GV2 A;  2XB0 X;  4BQQ A;  4ENJ A;  3HIF A;  1GXQ A;  1PVE A;  4WK8 F;  1JGS A;  1IUY A;  3I5U A;  3KEY A;  4KIS A;  3CJT B;  1HST A;  2BBY A;  3CTA A;  4GRI A;  5IPA A;  4MGR A;  2RNJ A;  2DMQ A;  4IF4 A;  1U3E M;  1ZQ3 P;  3TOB A;  4RM2 A;  2L9N A;  2Z5U A;  2XGC A;  1YJW I;  4HLX A;  2LD5 A;  1B6A A;  2MLG A;  2M8E A;  1QA6 A;  4KIC A;  1QBJ A;  4UV8 A;  3GZ6 A;  2Z16 A;  1AKH B;  2ESH A;  5D8K B;  2WC2 A;  3A2K A;  4E7H A;  3E7L A;  5B5E C;  4WX9 A;  3E97 A;  2V6C A;  2F5D A;  4NB5 A;  1QU3 A;  2HVS A;  3ZQQ A;  2M34 A;  3BPV A;  2CUE A;  4Q47 A;  2XPV A;  3SZP A;  3LFK A;  1DQU A;  3K4L A;  5J40 A;  1QNT A;  4XRS G;  1MSF C;  4FHT A;  5IYD J;  1O3S A;  3IRQ A;  3OYH A;  5D8L B;  1IN5 A;  4LG3 A;  5CKT A;  2VKE A;  2K7L A;  1WJB A;  5F27 A;  1DGW Y;  4ENM A;  1HXD A;  1U5T B;  2ZME C;  3EDP A;  4UUS A;  2DK8 A;  2M0M A;  4A3F J;  3NAR A;  4OMZ A;  4L0Z B;  2NS0 A;  1LNW A;  4AVP A;  2JN6 A;  5FFZ A;  2OA4 A;  2Y9Y A;  5L3G A;  5E20 A;  4M6X A;  2FNA A;  3F3X A;  1W0T A;  2HI3 A;  4UXN A;  4ASN A;  3CF2 A;  2DJN A;  3QOE A;  1H89 C;  1TWH J;  1IN6 A;  3PIO F;  1SFK A;  3ECH A;  1P7I A;  4S04 A;  4FCY A;  3H9G A;  2LSO A;  1ZH5 A;  2DTR A;  5ICC A;  3GX4 X;  4U7B A;  3BG3 A;  4NC7 A;  2FQ4 A;  2NVQ J;  2VKD A;  4DZJ A;  2IGM A;  1S72 I;  5DS9 A;  1YJ9 I;  1ON1 A;  2L4A A;  5ICF A;  2ZB9 A;  3KFW X;  1ZG1 A;  4UB6 C;  3LSR A;  1K78 B;  4GYI A;  1LE8 A;  2YX4 A;  3HL2 A;  1J09 A;  1PDN C;  1TNS A;  1FOX A;  4ENN A;  2CFO A;  2R7F A;  2VIX A;  2QLZ A;  2Y30 A;  3ABL H;  5J1U A;  1LB2 A;  2R5Y B;  4PFO A;  1AU7 A;  1YRN B;  5AIP A;  3FXJ A;  1DGR M;  3CES A;  3MVP A;  3K0L A;  4RGS A;  3VYR B;  1FYM A;  2X51 A;  3S2D J;  5IY5 H;  1Z21 A;  2PMZ A;  2R7U A;  4CYC B;  3F21 A;  2OQR A;  3MEX A;  4ITV A;  2MH9 A;  1UHW A;  2A6H F;  4BHB A;  2DO7 A;  1ON2 A;  1R22 A;  3HOW J;  3H92 A;  4O6J A;  1B72 A;  3K9T A;  4I0B A;  1RIO H;  4A3D J;  1J75 A;  1SAX A;  2PMZ N;  4M74 A;  3CO7 C;  3J80 K;  1V5F A;  1SAN A;  3DEU A;  4B48 A;  3F8M A;  2DOA A;  4F3Q A;  3TKY A;  2ZSI B;  3L2V A;  2H94 A;  4CGZ A;  3AL0 B;  4P5O A;  4D1Q A;  3T8R A;  2W84 A;  2W48 A;  3W6K B;  1UHM A;  2XAQ A;  2VN2 A;  3CUQ C;  3K1P A;  1L3L A;  4C2U A;  4MHG A;  4GYG A;  1BI1 A;  2RN7 A;  1AA7 A;  2HYF A;  3HOZ J;  3WTY C;  1ZN2 A;  2DDB A;  4P55 A;  2LR8 A;  4HNT A;  2R5Y A;  4BQN A;  3IH3 A;  3V8J A;  5ICE A;  2JUC A;  3EUH A;  4EQQ A;  5M3M J;  5DCF A;  5E3N A;  3M1E A;  1TL8 A;  4MNU A;  5CQG A;  3WG9 A;  1ZKG A;  4EJV A;  1NHA A;  3FIW A;  2YS9 A;  2QQB A;  4NC8 A;  2COB A;  3JRC A;  3OYB A;  4PCQ A;  1T0F A;  3HZJ A;  5F0C A;  2HOE A;  3PQJ A;  1KGS A;  2EBI A;  1BI0 A;  1N78 A;  1BW5 A;  3Q0V A;  5LGU A;  2BY0 A;  2W7N A;  1K4S A;  1T2K A;  4A3C J;  3DXJ F;  2H6C A;  1D8K A;  3S3M A;  4D5F A;  3LA3 A;  1IJW C;  2HVR A;  1R00 A;  1IF1 A;  3VYU B;  1LKX A;  2Q1Z B;  1WJE A;  1LE8 B;  3E1S A;  2HPM A;  5GP9 A;  4BEH B;  1VQO I;  1S29 A;  5KK1 A;  1U9N A;  1VF9 A;  3OYL A;  3LA7 A;  1G4D A;  1MNM C;  3PM1 A;  1QHG A;  3LMM A;  3ZQC A;  3K4K A;  2XGE A;  4RGX A;  3COA C;  3OR2 C;  1TNT A;  1SMY F;  1Z05 A;  4A3G J;  2HVQ A;  2VPL A;  1ZGJ A;  3HBL A;  4BS9 A;  5E3M A;  1D1C A;  3H9J A;  3BQY A;  5J1Y A;  3LQQ A;  4HV6 A;  3PFY A;  2Y75 A;  5B3S H;  1B72 B;  2CV0 A;  4BGD A;  1R6R A;  2W25 A;  2H1K A;  2N8G A;  3J80 Z;  2ZJ2 A;  5LHI A;  3S1N J;  2DA5 A;  5FKO A;  2NRA C;  3W6J B;  4LB5 A;  2ZXW H;  1P9Q C;  1H9G A;  3GFI A;  2IGN A;  2HQN A;  5E79 C;  2JPB A;  2FRH A;  4HX4 A;  1SFE A;  5B1A H;  3CCL I;  2OUM A;  4C9Y A;  3DKY A;  2V1N A;  1JKP C;  3RSN A;  2E2J J;  1LFU P;  3IUO A;  3OSG A;  3QQA A;  4BEH A;  4WXH A;  2BW3 A;  3HHG A;  1R23 A;  2HQR A;  3K4C A;  4L9J A;  1MJA A;  3TDZ C;  1WI9 A;  4LLG F;  2MFZ A;  2KIU A;  3LAJ A;  2F4I A;  4XL9 A;  2VPR A;  3D0S A;  1OCZ H;  1T38 A;  2Y31 A;  2XPU A;  3SZG A;  4M3G A;  1WJA A;  1XDS A;  3I59 A;  3S2W A;  2VKH A;  5ILS A;  4XQF A;  2QA4 I;  3HRU A;  4EMS A;  4BJ5 C;  5F1R A;  4JQF A;  1OCR H;  5J8F A;  5J6X A;  3Q5F A;  4OOI A;  3PIP F;  3ZXS A;  1T98 A;  3F9K A;  5EG0 A;  5HLT A;  1FIA A;  3MCZ A;  2OQG A;  4KNY A;  5F6F A;  2E7X A;  1R49 A;  1WH7 A;  1G3T A;  2XIG A;  2EA4 A;  3BQZ A;  4YEJ A;  2HTJ A;  2PMU A;  4BYY A;  3F6O A;  4RB0 A;  2VI6 A;  5D5W B;  2OCE A;  1BM9 A;  3TO9 A;  4HBL A;  1O7L A;  2A61 A;  1RKT A;  2OAZ A;  3E3V A;  1TWA J;  3AKZ A;  1MMS A; 
#chains in the Genus database with same CATH homology
 5TRD A;  5K5Q A;  3BPX A;  1MGT A;  1RZ4 A;  5K1Y A;  5HOO A;  3EYY A;  4UHT A;  1XGO A;  1FBS A;  3U9G A;  5FD6 A;  5FGM A;  3WGI A;  1O3T A;  4KFC A;  2HKO A;  1FPQ A;  3RI4 A;  1I5Z A;  1U5T C;  3CUO A;  2AS5 F;  2J5O A;  4B09 A;  2NYX A;  3FZV A;  3V8L A;  1K79 A;  5DD4 A;  1W5S A;  1TQM A;  4IHS A;  4AIK A;  3E6D A;  1FYK A;  4XRF A;  3FWE A;  4IJA A;  2JZY A;  2XUB A;  3HRS A;  3OOP A;  1J2X A;  2D45 A;  4R79 A;  2VBZ A;  4AD9 A;  1HBX G;  3DV8 A;  2G7H A;  1ZG3 A;  2P7V B;  1YS6 A;  3WU1 B;  3V8K A;  2VC0 A;  4UVA A;  3E5Q A;  3F6V A;  3K1M A;  2CG4 A;  4EJW A;  4I7H A;  2O6G E;  1RI7 A;  2VE8 A;  1PP7 U;  1XSV A;  2DAO A;  3R61 A;  5KVR A;  3ZN0 A;  4G7H F;  3JTH A;  2WTE A;  1KU3 A;  2EFO A;  2P6T A;  4P9F A;  1FSE A;  3VEP A;  5BPD A;  5CVI A;  3WTT C;  4GO1 A;  3NEU A;  1TQI A;  3GO5 A;  2D2W A;  2DLL A;  3LQR A;  3SQN A;  2GXB A;  2ACJ A;  3KP4 A;  2ISZ A;  3B02 A;  3ZQ7 A;  1WKM A;  2XVC A;  3WTW C;  1TLH B;  5BS6 A;  3ML6 A;  1XB4 A;  4KIG A;  2DQR A;  5E18 F;  5L3D A;  2K4J A;  4ZYG A;  3V7S A;  4DQ2 A;  3CO6 C;  2D1V A;  1YFH A;  5DCM A;  1FT9 A;  1FP2 A;  2O3F A;  4OIN F;  5AIQ A;  5HDG A;  4WCG A;  5LBQ A;  4BNC A;  5H6R A;  3DP7 A;  3GW2 A;  3GFM A;  2GAU A;  2QBY B;  3QP6 A;  2DU9 A;  4KMF A;  1ZAR A;  4U0W A;  5ICG A;  2XV4 S;  1UCR A;  1ZGA A;  3HSR A;  1FBQ A;  1BOA A;  4QWQ A;  3L9F A;  3BY6 A;  3HTS B;  3C3W A;  2JPC A;  2P5L C;  4KIB A;  1W7P D;  4MEX F;  4DNC A;  3G73 A;  1OYW A;  1RNL A;  2PEX A;  4K2E A;  2V1X A;  2H6B A;  2BYV E;  3JW4 A;  3I58 A;  4EGZ A;  2YSR A;  3JAM Z;  3ZP5 A;  4YFN F;  1FY7 A;  2HTS A;  3DPL C;  3IWZ A;  2FEZ A;  5L3E A;  5H20 A;  1Z7U A;  2GA1 A;  5FLX Z;  2V1U A;  5DD8 A;  1KYW A;  1FLI A;  3P9C A;  1SFU A;  4LMY A;  1ZRD A;  3BWG A;  1ZRC A;  3R6S A;  2HR3 A;  1ZHF A;  1IN4 A;  2JSC A;  1A04 A;  3H3Z A;  2RDP A;  1ZAO A;  5BQT A;  1IW7 F;  1XGS A;  3KLN A;  4YG2 F;  4LK1 F;  3L2C A;  2QM3 A;  4Y15 A;  4F7Z A;  4R8H A;  4RB2 C;  1XCB A;  4LLN A;  2EFW A;  5E8G A;  3ZMZ A;  3EET A;  5LHG A;  1E2X A;  3V7C A;  2GA2 A;  1GVJ A;  3L7W A;  4L9T A;  2FU4 A;  3RYP A;  3BJ6 A;  1X3U A;  6PAX A;  3GXO A;  1LVA A;  1G3Y A;  3KEO A;  2EK5 A;  2FBI A;  1SD6 A;  2DK5 A;  5D6F A;  1B9N A;  4LD5 A;  1Z6T A;  3GFJ A;  2OU2 A;  4EJO A;  3I53 A;  4MEY F;  1H9T A;  4HA8 A;  1KU7 A;  4I2O A;  5K5R A;  2JTV A;  1FOK A;  3Q9V A;  5HS9 A;  2K86 A;  4PGH A;  3MZY A;  3KCC A;  3WE3 A;  4ZYD A;  3TO6 A;  3P9K A;  3DQV C;  3N4M A;  3JSO A;  2QZ8 A;  3V4G A;  2ZNY A;  4KN7 X;  3MZH A;  4WXD A;  1HKT A;  2QWW A;  4OIR F;  4M72 A;  4RGU A;  4GCV A;  3FM3 A;  2ZBK A;  2JT1 A;  5A2Q Z;  4OIO F;  1GHC A;  2LDU A;  3QPT A;  2A5Y B;  1H0M A;  4ZYH A;  1J7K A;  2PLY A;  4ENK A;  1R7J A;  2OBP A;  2FNP A;  3M7G A;  1S7O A;  3F8C A;  1HW2 A;  3CUQ A;  1UST A;  1Y0U A;  4KT5 C;  1IRG A;  3LST A;  4CO8 A;  4HOB A;  2XRN A;  1AOY A;  3QU3 A;  1I6X A;  1T39 A;  3R0J A;  5TJJ A;  1T6S A;  3PQK A;  1YS7 A;  5LLQ A;  2PMH A;  4OU0 A;  1G3S A;  3J81 K;  4WWC A;  4RAZ A;  1EV7 A;  3WTV C;  3U1D A;  3IL2 A;  1R36 A;  1XD7 A;  2EV5 A;  2UXN A;  1PP8 F;  2FOK A;  5A2Q K;  2EFP A;  3HTU A;  3I54 A;  4A0Z A;  4M9X A;  3RDI A;  2MC3 A;  5CVJ A;  1P4W A;  4RB3 C;  1QGP A;  5EEH A;  3BJO A;  3RYR A;  2EV6 A;  2VBW A;  2W57 A;  4N0B A;  1F9N A;  1MZB A;  2CSO A;  3FMQ A;  3E6B A;  1DPR A;  1EH7 A;  2ZKZ A;  4XLN F;  1YYV A;  3RTR A;  2XKO A;  2FQ3 A;  1FP1 D;  3SFZ A;  2R7D A;  2VT2 A;  1QZY A;  1FX7 A;  2BE5 F;  2NNY A;  3ZMS A;  1SD4 A;  4A0X A;  1IZ1 A;  5LEK A;  2G9W A;  4H0E A;  1Z1D A;  3WOD F;  1BC7 C;  4HDV A;  2D1H A;  1BJA A;  2RKH A;  3BRO A;  4HF1 A;  4YII A;  1Z91 A;  4EM1 A;  3D5L A;  4MTD A;  1JHH A;  3I71 A;  3FMR A;  3O2P E;  3O6B B;  2YX7 A;  2KIF A;  3HRM A;  2XAG A;  3RKX A;  5J8C A;  5DV5 A;  3M9A A;  4B8X A;  1I1G A;  3IKT A;  1BI2 A;  2ADU A;  2MLK A;  1Z9C A;  1FNN A;  4OMY A;  4NQW A;  1F4K A;  2O8X A;  1DDN A;  1CGP A;  3GWZ A;  2PBI A;  2MBF A;  5E1Z B;  5F64 A;  3HOS A;  4ESJ A;  4KN4 X;  4KYW A;  4N9I A;  2FF4 A;  5E1X A;  5L3F A;  2LNB A;  3M8F A;  4U7D A;  2W24 A;  3ZMD A;  4Q5S F;  2FMY A;  2K4B A;  3T1B A;  4IXA A;  2ZO4 A;  3NQO A;  5FLX K;  1R58 A;  2WWY A;  2IA1 A;  3I64 A;  2UZK A;  3TO7 A;  5FB2 A;  5DYM A;  3ZMU A;  2ETH A;  1HKS A;  2F5F A;  3B73 A;  3LAP A;  4KDP A;  4BAY A;  2Q2E A;  3O3K A;  2V1D A;  2ZFW A;  2M87 A;  4G6Q A;  4M71 A;  3VOD A;  3J7A O;  3ZPL A;  4BXU A;  3HSF A;  2CWE A;  2Y0M A;  2L3D A;  1O57 A;  3KP6 A;  1CF7 A;  1TW2 A;  1XGN A;  2Z9O A;  2KJC A;  4AWX B;  2IA0 A;  5CJ9 A;  2QEN A;  3BZ6 A;  1EH6 A;  2KIM A;  5BOX A;  3K1N A;  2QVO A;  4LG0 B;  4HV5 A;  4EM2 A;  2IJL A;  1SMT A;  3G3Z A;  2K27 A;  2QUF A;  5HLH A;  2OZU A;  2UXX A;  3EQL F;  2PN6 A;  1J59 A;  2YU3 A;  3C18 A;  2GZW A;  3QPH A;  3VFZ A;  1OR7 A;  1YLF A;  1LEB A;  4A5N A;  3GF2 A;  3PFI A;  2VOO A;  4CDG A;  4I98 B;  2VE9 A;  3P9I A;  4JBA A;  2FA5 A;  3V7R A;  2VT3 A;  4UNO A;  4ESB A;  3KP3 A;  3CJN A;  2QQA A;  4UVB A;  1UFM A;  1MDM A;  1XGM A;  4D0P A;  2HGC A;  1I1S A;  5LGN A;  2IRF G;  2XAH A;  4HQE A;  1WRJ A;  1O7F A;  2ESN A;  3LA2 A;  1S6L A;  4MTE A;  5DUI A;  1MJB A;  1V3F A;  1S8N A;  1REP C;  3IHU A;  4XSZ F;  2PJP A;  2Z99 A;  4PZJ A;  4ZZD A;  4G7O F;  1BIA A;  2FSW A;  3N97 A;  5IT9 Z;  3T5X A;  2CYY A;  1U5T A;  5FD5 A;  5ILV A;  1K78 A;  5L3B A;  2VC1 A;  2PFB A;  1ZLJ A;  5CVR A;  1ONV A;  2EA2 A;  4JK1 X;  3E6M A;  1R5G A;  4G8X A;  3FHZ A;  4EGY A;  5JFR A;  3R60 A;  1ZG5 A;  3EYI A;  3HYI A;  5JI6 A;  1R1V A;  2R3S A;  1VTN C;  4AIJ A;  2BV6 A;  1W7P A;  2EWN A;  2P5V A;  2WV0 A;  5K5O A;  2KKO A;  2KRF A;  3QOP A;  5CYV A;  4CYD A;  2KJB A;  4XSX F;  2PG4 A;  4A2U A;  4IRH A;  1SD7 A;  2PQ8 A;  3MAJ A;  2L4M A;  4PDK A;  1AWC A;  5HLG A;  1TBX A;  1TTY A;  1XMA A;  2HFH A;  3MQ0 A;  1YW9 A;  3FX3 A;  5D6E A;  3WU0 A;  1F1Z A;  1YW8 A;  2K02 A;  3KLO A;  3VB2 A;  4G94 A;  1QZZ A;  3F23 A;  1LDJ A;  2VBY A;  1U2W A;  2F5C A;  4HF0 A;  1RUO A;  5LRR A;  4IHT A;  3ZN1 A;  3GLX A;  2CFX A;  5HDN A;  1USS A;  5FO5 A;  4AIH A;  1J0R A;  2XRO A;  2GXG A;  4GXO A;  4GGG A;  2COM A;  3AAF A;  3RKW A;  2CQK A;  3NRV A;  1ZRE A;  1YIO A;  3KP7 A;  5HS7 A;  3IRR A;  2M1B A;  4ZZL A;  3T8T A;  5D4R A;  4FT8 A;  3CDH A;  4Z2Y A;  3ELK A;  3WGG A;  3Q9S A;  4BH9 A;  5BMZ A;  2O0Y A;  4M9Z A;  5HVQ C;  3ULQ B;  5DUK A;  1IN8 A;  2XHK A;  1O3Q A;  2UWM A;  1MKM A;  1OMI A;  1W5T A;  3WGH A;  2GQQ A;  4LB6 B;  2RQP A;  1OYI A;  1WWX A;  4YFK F;  4HF2 A;  1YQA A;  4EVI A;  1MD0 A;  3WTU C;  3F8F A;  5BPI A;  2GWR A;  5LRS A;  2XAJ A;  2XKP A;  2P7C B;  4BQA A;  2XAS A;  1IXR C;  5CVU A;  4UVC A;  5CLS A;  2RGV A;  2MH2 A;  2PI0 A;  5FFX A;  3KEQ A;  4FX0 A;  3C7J A;  1XDU A;  4WXC A;  2FML A;  3M8E A;  1KYZ A;  2JRT A;  2YPR A;  1Q1H A;  1IXS B;  3WTZ A;  3ECO A;  1E17 A;  2E7W A;  3QAH A;  2O03 A;  2A3S A;  1YTY A;  5DCM B;  1MJ9 A;  2W85 A;  5H6Q A;  2X4H A;  2CGP A;  1LDK B;  1JE8 A;  1LQ1 A;  1LDD A;  5HDK A;  4U0Y A;  4Y13 A;  4KIF A;  4LLL A;  2QBY A;  2XAF A;  4KMU X;  3RKY A;  5AON A;  1FSH A;  2VXZ A;  5HS8 A;  3KET A;  2STW A;  3RPQ A;  4LG0 A;  4ON0 A;  1HKQ A;  3CLO A;  1O3R A;  1SFX A;  2Z33 A;  2Q0O A;  1HQC A;  3ZMT A;  3OV8 A;  5HLI A;  5D5V B;  2DW4 A;  4CZZ A;  1QPM A;  5D5X B;  1G3W A;  3JSP A;  4RAY A;  3IWF A;  2P5K A;  5ERI A;  4MQV A;  5ILU A;  1S7A A;  2C6Y A;  2RVC A;  3E5U A;  1U8R A;  2M30 A;  5D4S A;  2RV8 A;  3KP5 A;  2B0L A;  1GXP A;  1QO0 D;  3GVA A;  1STZ A;  4CXF A;  1P2F A;  1U6G A;  1P92 A;  3TQN A;  2HWV A;  4EV0 A;  2EFQ A;  4TV7 A;  4A6D A;  1QQI A;  1XSX A;  4LK0 F;  4Q4Z F;  1R5H A;  1XSD A;  4G9Y A;  3MWM A;  4UV9 A;  1UB9 A;  2MD5 A;  4EJU A;  1BI3 A;  4RB1 A;  1MDM B;  4M73 A;  3BJA A;  2DPD A;  1B1B A;  4ETS A;  2IVM A;  1LJ9 A;  1S3J A;  2O61 A;  2CO5 A;  1KA8 A;  2EFN A;  3VOE A;  4OIP F;  3R4K A;  2Q8K A;  5LEJ A;  5DDG A;  3GZ5 A;  3MFK A;  2BGC A;  2ZXJ A;  2G7U A;  4P9U A;  5L3C A;  2IPQ X;  3J81 Z;  3GUD A;  3TOA A;  3DPT A;  2STT A;  1Z6R A;  3KZZ A;  4E70 A;  1OYY A;  1K6O A;  4G7Z F;  3F8N A;  2ISY A;  2LKP A;  3ABT A;  4HQM A;  4P96 A;  2GIV A;  3BP8 A;  3FXQ A;  1XN7 A;  4L9V A;  4HX7 A;  1C0W A;  1W7P B;  3IKV A;  2V79 A;  4O5V A;  2CW0 F;  5E8I A;  4I01 A;  4LGW A;  1FZP B;  4FX4 A;  4ESF A;  1P6R A;  4M9S A;  3GYH X;  1ZLK A;  4CIC A;  3HOT A;  4R1H A;  3RJP A;  1RUN A;  3FMS A;  2P4W A;  2P6S A;  4ZH4 F;  1JHF A;  1FBU A;  5D5U B;  2V9V A;  1XMK A;  3R0A A;  3QRF F;  3KE2 A;  2M45 A;  3K69 A;  3IC7 A;  3REO A;  1FWZ A;  4Q48 A;  3I0T A;  3FM5 A;  3U2R A;  5E1W A;  1HSJ A;  2DQL A;  2IT0 A;  1JXS A;  4HDU A;  3ZMV A;  4UUV A;  2DBB A;  3ROU A;  3GEZ A;  5JR3 A;  1W4M A;  1BC8 C;  5CVV A;  3ERE D;  4ZYE A;  3F72 A;  3FXU A;  5E17 F;  2OD5 A;  5IT3 A;  3WTX C;  2Z3Y A;  2HDC A;  1ZYR F;  4LJZ F;  1J5Y A;  4G6D A;  2J5P A;  2LF8 A;  1IAW A;  3RPU A;  4N9H A;  3KZY A;  4HAM A;  4BHC A;  3DFG A;  4KA4 A;  2L02 A;  2RC4 A;  1B9M A;  3SHF A;  1D3Y A;  1G6N A;  2HS5 A;  2VOP A;  4BHP A;  1BIB A;  4MQ9 F;  2NAZ A;  3I59 B;  3CUQ B;  2DFI A;  4O3M A;  4HX8 A;  4A0Y A;  3JAM K;  1R1T A;  3HUG A;  3QP5 A;  4I09 A;  4Y17 A;  1EH8 A;  2H27 A;  1KU9 A;  3DF8 A;  3E6C C;  1WSU A;  3JTG A;  2MA3 A;  4OIQ F;  4HW0 A;  4LFU A;  1YW7 A;  2HEO A;  1YG2 A;  1D8J A;  1R1U A;  3K2Z A;  3WTS C;  1D5V A;  2FBH A;  4EJT A;  1KU2 A;  1TW3 A;  1FYL A;  1U78 A;  3LWF A;  3HSE A;  2ZNZ A;  1LEA A;  4L5J A;  4CHU A;  4KUM A;  2FBK A;  2M5W A;  1KQ9 A;  1B4A A;  3H3U A;  1DPU A;  1P4X A;  3ABU A;  4M6Y A;  3TGN A;  4A5M A;  2P8T A;  1SD5 A;  4YIF A;  2DI3 A;  2VOD A;  4U0V A;  1BN5 A;  2XGX A;  1YO5 C;  4U88 A;  5EEG A;  3SZT A;  3KP2 A;  1KQ8 A;  2VBX A;  3I4P A;  2Y48 A;  2HZT A;  4L18 B;  1V4R A;  4RGR A;  4EM0 B;  4HZF A;  3BDD A;  1HW1 A;  1FC3 A;  1TQP A;  4IPA A;  5JVT A;  2BEO A;  4L9N A;  1P4A A;  2AXL A;  2YR2 A;  3L00 A;  2EV0 A;  2LF7 A;  2X0L A;  4HYE A;  1BBY A;  2ELH A;  1XCV A;  2HYG D;  3P7N A;  1ULY A;  3FF5 A;  2OZ6 A;  1OPC A;  4I0A A;  2ZME A;  2ZCW A;  3ISP A;  2IW5 A;  1DP7 P;  2E1N A;  2QYO A;  5DEQ A;  4QLC U;  2IP2 A;  2L54 A;  3SXY A;  5LGT A;  2F5E A;  2QQ9 A;  4YFX F;  2IA2 A;  5LHH A;  4IRI A;  2E1C A;  3WE2 A;  2F2E A;  2FE3 A;  3T0Y A;  2A68 F;  2L01 A;  1IXC A;  3HHH A;  4XLP F;  3TDU C;  1ODD A;  2A07 F;  2A6E F;  5JHU A;  3QU6 A;  3BOQ A;  3F8B A;  2A69 F;  4RS8 A;  1IRF A;  1WQ2 A;  1I27 A;  1ZRF A;  4IRG A;  4A6E A;  2FXA A;  4WF2 A;  4A12 A;  5IT9 K;  2TDX A;  1OKR A;  2HKX A;  4HLY A;  3RIR A;  4L0Y B;  4NHJ A;  3FXR A;  3HRT A;  3GFL A;  4PGG A;  3L09 A;  1KQ0 A;  3F22 A;  2VON A;  2DT5 A;  2NNN A;  2EJR A;  3C1D A;  2EB7 A;  3E5X A;  5ED4 A;  4L5I A;  2ZME B;  2DPU A;  1DUX C;  1J9I A;  1IN7 A;  3DKW A;  1F5T A;  1K7A A;  4XBF A;  2H09 A;  4IVN A;  1HW5 A;  1CF7 B;  1B59 A;  4S05 A;  1L0O C;  4I02 A;  1PUE E;  4ENJ A;  3HIF A;  1GXQ A;  4WK8 F;  1JGS A;  1IUY A;  3I5U A;  1HST A;  2BBY A;  3CTA A;  4MGR A;  2RNJ A;  4IF4 A;  1U3E M;  3TOB A;  2Z5U A;  4HLX A;  1B6A A;  2MLG A;  2M8E A;  4KIC A;  1QBJ A;  4UV8 A;  3GZ6 A;  2ESH A;  5D8K B;  2WC2 A;  4WX9 A;  3E97 A;  2V6C A;  2F5D A;  4NB5 A;  3BPV A;  4Q47 A;  3SZP A;  3LFK A;  1QNT A;  4FHT A;  1O3S A;  3IRQ A;  5D8L B;  1IN5 A;  2K7L A;  4ENM A;  1HXD A;  1U5T B;  3EDP A;  2DK8 A;  4OMZ A;  4L0Z B;  2NS0 A;  1LNW A;  4AVP A;  5FFZ A;  2OA4 A;  5L3G A;  5E20 A;  4M6X A;  2FNA A;  3F3X A;  4UXN A;  4ASN A;  1IN6 A;  3ECH A;  4S04 A;  2LSO A;  1ZH5 A;  2DTR A;  5ICC A;  3GX4 X;  4U7B A;  1ON1 A;  2L4A A;  5ICF A;  3KFW X;  1ZG1 A;  1K78 B;  4GYI A;  2YX4 A;  1PDN C;  1TNS A;  4ENN A;  2R7F A;  2QLZ A;  1LB2 A;  5AIP A;  4RGS A;  3K0L A;  1FYM A;  3F21 A;  2OQR A;  3MEX A;  1UHW A;  2A6H F;  2MH9 A;  4BHB A;  2DO7 A;  1ON2 A;  1R22 A;  3H92 A;  4O6J A;  3K9T A;  4I0B A;  1RIO H;  1J75 A;  1SAX A;  4M74 A;  3CO7 C;  3J80 K;  3DEU A;  3F8M A;  3TKY A;  2H94 A;  4CGZ A;  4P5O A;  3T8R A;  2W84 A;  3W6K B;  1UHM A;  2XAQ A;  2VN2 A;  3CUQ C;  3K1P A;  1L3L A;  4MHG A;  4GYG A;  1BI1 A;  2RN7 A;  2HYF A;  3WTY C;  1ZN2 A;  4P55 A;  3V8J A;  5ICE A;  3EUH A;  4EQQ A;  5DCF A;  3M1E A;  4MNU A;  3WG9 A;  4EJV A;  1NHA A;  2QQB A;  4PCQ A;  1T0F A;  2HOE A;  3PQJ A;  1KGS A;  1BI0 A;  5LGU A;  1T2K A;  3DXJ F;  2H6C A;  1D8K A;  3LA3 A;  1R00 A;  1IF1 A;  1S29 A;  5KK1 A;  3LA7 A;  1G4D A;  4RGX A;  3COA C;  1TNT A;  1SMY F;  1Z05 A;  1ZGJ A;  3LQQ A;  4HV6 A;  2Y75 A;  2W25 A;  3J80 Z;  2ZJ2 A;  5LHI A;  2NRA C;  3W6J B;  4LB5 A;  1H9G A;  3GFI A;  2HQN A;  2JPB A;  2FRH A;  4HX4 A;  1SFE A;  4WXH A;  3HHG A;  1R23 A;  2HQR A;  4L9J A;  1MJA A;  3TDZ C;  1WI9 A;  4LLG F;  2KIU A;  3LAJ A;  3D0S A;  1T38 A;  1XDS A;  3I59 A;  3S2W A;  5ILS A;  3HRU A;  4EMS A;  5J8F A;  5F1R A;  4JQF A;  5J6X A;  3Q5F A;  4OOI A;  1T98 A;  3MCZ A;  2OQG A;  4KNY A;  5F6F A;  2E7X A;  1G3T A;  2XIG A;  2EA4 A;  2HTJ A;  2PMU A;  4BYY A;  3F6O A;  4RB0 A;  5D5W B;  1BM9 A;  3TO9 A;  4HBL A;  1O7L A;  2A61 A;  2OAZ A;  3E3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...