2X4HA

Crystal structure of the hypothetical protein sso2273 from sulfolobus solfataricus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
129
Chain Sequence
LSRREFSYLLTIKRYNDSGEGAKINRIAKDLKIAPSSVFEEVSHLEEKGLVKKKEDGVWITNNGTRSINYLIKAHRVIEILLVNIGIDKQTACEYSKQFDYLIPEEIIDKLYNYLGKPSYCPHGLEIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN SSO2273
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transcription
total genus 47
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2x4hA00
3LQRA 2ISZA 2D1HA 5BMZA 4HZFA 5E20A 4LLLA 4KDPA 3JW4A 5F1RA 3Q5FA 3MFKA 2R3SA 1DPRA 2X4HA 1RUOA 1FBUA 1XGNA 2FF4A 2FA5A 2FSWA 3O2PE 1CF7A 1GHCA 3WTYC 2DTRA 4U88A 2XVCA 5H20A 1U3EM 1SD6A 1F5TA 3P9CA 3LAJA 2H6CA 2MH9A 1HXDA 2QLZA 1OYYA 4BYYA 4RGSA 2MBFA 3K2ZA 2XAQA 2ACJA 3ZMVA 1IN7A 2NYXA 3DPTA 2VODA 4KN7X 3ROUA 1LDJA 3GLXA 5BS6A 4A6DA 2IRFG 5ILUA 3FXUA 3TOAA 4CXFA 2OU2A 3AAFA 1XGMA 1H9GA 2A68F 2UXXA 2J5OA 4G7OF 5HS8A 2COMA 2L4AA 3CO7C 3VEPA 3HUGA 3WTTC 2A3SA 3TDZC 4ENKA 1DDNA 5HDNA 5DV5A 2B0LA 4L0YB 5HLGA 1YLFA 1SMTA 3KP3A 4YFXF 4KMUX 1J5YA 4G7HF 4MTEA 3M8EA 2X0LA 2MLKA 4P55A 2EFOA 2QENA 5DD8A 2GQQA 1IXRC 3I58A 2IA0A 3ZMUA 4YIIA 5FLXZ 2ESNA 1I27A 1SAXA 3DFGA 3KP2A 3KZYA 2EJRA 1STZA 2KJBA 3BY6A 4LGWA 1B1BA 2ZBKA 3RKWA 1VTNC 1E17A 1FPQA 1ZG5A 3F8FA 2JT1A 2IP2A 3IWFA 1R1VA 4KIFA 1IUYA 2DO7A 4MEYF 4KA4A 4NQWA 3D0SA 4OMZA 5E1WA 3IKVA 1YW9A 2PI0A 3OOPA 3SZTA 2F5CA 1PUEE 5HLIA 3GYHX 2D1VA 2H6BA 2A69F 4GXOA 3I64A 2YPRA 4WWCA 3I5UA 4I02A 3T8RA 1MKMA 4ZYDA 4BAYA 3F8BA 1GVJA 4Q5SF 2ZJ2A 4MGRA 2HTJA 5LEKA 3G73A 3CO6C 4Q4ZF 3N4MA 5BPIA 3CUQA 3HIFA 4HA8A 4G6QA 4EM1A 4CGZA 1HKSA 2A6EF 5D6FA 2QYOA 1P4XA 2ESHA 3JTGA 3KP7A 1P4AA 4ZYGA 5BPDA 1WRJA 2W24A 3BZ6A 2HQNA 5JI6A 2PG4A 3V7RA 1O3QA 2HOEA 3KP4A 3R6SA 4TV7A 4RB2C 4ASNA 3P7NA 1YS7A 4KUMA 2CSOA 2P7CB 4AIKA 2H09A 2D45A 2DLLA 3ZMSA 1XSXA 2EV5A 1FP2A 4JQFA 2ETHA 5E8IA 1G4DA 4OMYA 3DF8A 2QVOA 2WTEA 2PBIA 2QUFA 3RKXA 2HYGD 3GEZA 1BI0A 1XMKA 2V6CA 4EMSA 3QP5A 2XAGA 1G3SA 5L3BA 1J7KA 4Q48A 5JHUA 1FWZA 2MA3A 4PGGA 1AWCA 5CYVA 3EYYA 5DCMB 4AIHA 1USSA 5DDGA 3V7CA 2O0YA 2DK5A 4LJZF 3CJNA 2P7VB 1QQIA 3I0TA 2Y0MA 2DBBA 1ONVA 3J80Z 1W5TA 1FT9A 1W5SA 2FBIA 1LB2A 5D8KB 2GWRA 5LEJA 4A5NA 1P4WA 1K78A 1U6GA 2CWEA 3IWZA 2VXZA 1RUNA 1ZHFA 3MQ0A 1FYMA 1ZRDA 3BROA 3L00A 3CLOA 1S3JA 5A2QK 4A6EA 5IT9Z 2G7HA 4HYEA 1SFUA 5LGTA 1QGPA 2ZMEA 4M74A 3QP6A 3VFZA 2WWYA 1R7JA 1WQ2A 2XIGA 5HLHA 2XRNA 3E6BA 3BOQA 4WXCA 1I1SA 4N9IA 1R00A 4RB1A 1IZ1A 3EETA 3W6KB 1U78A 1UCRA 3V8LA 1XB4A 4K2EA 3SHFA 3K9TA 3R61A 2RC4A 2F5DA 1T2KA 2VBXA 4ESBA 2XAJA 4PCQA 4S04A 3FMQA 1OYIA 2DK8A 4R1HA 2Z33A 2QBYB 3HRTA 1YW8A 4BHCA 4IXAA 2HTSA 4ETSA 5D5UB 3B02A 1MJ9A 2G7UA 1XCBA 3HYIA 1V4RA 1LVAA 2ZNZA 4A5MA 4OINF 3E5UA 3GW2A 4MEXF 4RS8A 2MC3A 5HVQC 1QPMA 1DUXC 2RDPA 3E6DA 3JSOA 2EV0A 2RKHA 3I59A 5LHGA 4BHBA 1I1GA 1BI1A 4EJTA 3HTUA 5ICGA 5CVUA 2D2WA 3W6JB 2BBYA 1PP7U 2XAFA 2K7LA 1TLHB 3R60A 2QWWA 4L18B 3ULQB 4B09A 1Z6TA 3ZQ7A 4NHJA 2UZKA 1T39A 3WTVC 1ZLJA 4BHPA 2ZKZA 5DUIA 4U7DA 1SFEA 5H6RA 4JBAA 1H0MA 1NHAA 4EJVA 1O3RA 1B9NA 5D5WB 5L3FA 1J75A 2HDCA 1EH6A 2VBYA 2CG4A 2EFNA 1KU2A 1RI7A 1YIOA 1BI2A 2GIVA 3RPQA 2OD5A 1S7OA 5CVJA 5K5RA 4A2UA 4QWQA 1MDMA 5IT3A 2HEOA 2EFWA 3J7AO 4ON0A 4HF2A 3TDUC 4HDUA 2CFXA 3ELKA 4XBFA 1QZYA 3I54A 1FBSA 1MGTA 2FMLA 3GZ5A 3F6VA 3H3UA 2NS0A 2KIUA 2ZFWA 3DKWA 2V79A 2DFIA 4ESJA 2GXGA 2P5KA 2J5PA 3ECHA 3B73A 1TNSA 3HRSA 2Z5UA 1SD5A 4R8HA 1FP1D 3TOBA 2F5FA 2Z3YA 1LEAA 5DCFA 1FOKA 2NRAC 2W85A 1ZAOA 2UWMA 5FLXK 4RGUA 2O8XA 3WG9A 2OQGA 4EGZA 4IPAA 2Z99A 4MHGA 4P5OA 2CGPA 2EWNA 3SZPA 1USTA 2W57A 5KVRA 3BJAA 4HX8A 2STTA 4HF1A 4AVPA 5LBQA 1W7PD 2EFQA 1X3UA 1IAWA 1HW1A 5HS9A 2VC0A 4M71A 5L3GA 5ED4A 1YFHA 2M87A 4P9UA 4IRHA 4EQQA 1GXQA 1FBQA 1FNNA 4LG0A 2L3DA 2JTVA 4KIBA 5BQTA 1IF1A 5AIQA 5CLSA 5F64A 3LA3A 2P5VA 4GYIA 3ISPA 3ABUA 4RAYA 3WTSC 1YO5C 1MD0A 3DEUA 3BJ6A 2CW0F 5K5QA 2IA2A 2HFHA 3WU0A 1REPC 4KFCA 2P6SA 2O61A 3V4GA 3LA2A 4FHTA 5E1ZB 1K79A 1IN8A 2DI3A 2BYVE 3F6OA 3HRUA 5D5VB 1DPUA 1YG2A 4EJUA 2NNNA 4HOBA 3HRMA 4B8XA 4I2OA 3GF2A 2QQ9A 4F7ZA 2V1DA 1W7PA 1JE8A 1XD7A 3J80K 2G9WA 2XASA 1D3YA 3GZ6A 3F8CA 2HR3A 2P8TA 3GUDA 3ZP5A 2NAZA 4M9XA 4R79A 4MTDA 2WV0A 2A5YB 4N0BA 4JK1X 2VOOA 1UHMA 1S7AA 4LB6B 5IT9K 5ICEA 3ZMDA 2FNPA 3BPXA 3L9FA 3M1EA 2DPUA 1IW7F 3KEOA 1G6NA 1KYZA 1ZG1A 3ZMZA 1IN4A 4IHSA 1ZGJA 1I5ZA 2P5LC 2M5WA 1SD4A 5TRDA 3V8JA 4G6DA 4I98B 1J59A 2L4MA 4IVNA 4RGRA 3N97A 3BJOA 2L02A 3HTSB 2O03A 3GFJA 3BP8A 4IHTA 1G3WA 1SMYF 1ZYRF 3ZMTA 2JPCA 1ZARA 3RIRA 2EFPA 4HLYA 1FX7A 5HDKA 1IRGA 3JAMZ 3WU1B 5D8LB 1R1UA 3K1PA 1HW2A 1ZREA 3P9KA 2FEZA 3U1DA 1YQAA 2VT3A 2Q0OA 3FMSA 3IRRA 3GFIA 2HKOA 4IJAA 3GXOA 4AD9A 1S8NA 2QQAA 4WCGA 4L0ZB 4G8XA 4BH9A 3DQVC 4I7HA 4UVAA 1G3TA 1XGOA 3EDPA 3C18A 1Y0UA 5JR3A 2GXBA 3EUHA 4ESFA 3KLNA 6PAXA 3KLOA 3FZVA 4OOIA 3HHHA 3ZPLA 3SQNA 2IVMA 1P6RA 3HSFA 3ML6A 2YR2A 2QZ8A 1TQIA 1XSVA 2MLGA 1TW3A 4UVBA 1GXPA 2YX7A 3F8MA 4U7BA 1FSEA 4ENMA 2WC2A 1SD7A 2ISYA 2K4JA 3L7WA 1HBXG 3ECOA 5JVTA 3RKYA 4UNOA 4YIFA 3QPTA 1CF7B 5FO5A 3VODA 1WWXA 4OIRF 3E5XA 4O5VA 3IRQA 2DU9A 2KKOA 3LSTA 1ZLKA 3KP5A 2FMYA 3REOA 3KCCA 5DD4A 4EGYA 1LDDA 1QO0D 1IRFA 3GVAA 2K02A 3QU3A 1WI9A 2ZNYA 1MJBA 1MZBA 2RGVA 1KQ0A 4IRGA 3K0LA 2JRTA 3CTAA 4ZZDA 1KQ9A 3TKYA 3V8KA 1HKQA 4LB5A 3DP7A 1LDKB 4GO1A 2KJCA 1DP7P 1ON2A 1P2FA 4GYGA 2AXLA 2TDXA 3JTHA 3SXYA 5FB2A 3R0JA 3EQLF 1OMIA 3FWEA 4I0BA 5K5OA 1Z9CA 5K1YA 3NEUA 1YS6A 2F2EA 2PLYA 1T0FA 3MCZA 4M6YA 3RYRA 3BPVA 2E7XA 1F4KA 1LNWA 4P9FA 4HV6A 3TO6A 3ZN1A 2DAOA 1FLIA 5LGNA 1TQPA 3PQJA 4XLNF 1HW5A 1V3FA 1T38A 1OKRA 3F22A 5FGMA 3ABTA 4HLXA 4YG2F 2FQ3A 4EV0A 1OPCA 4CYDA 3ZN0A 4EVIA 2OZ6A 5ERIA 4EJWA 5D6EA 1XDUA 2LKPA 4U0VA 1ZH5A 3PQKA 3FXQA 1B4AA 3CUQB 3IL2A 3F72A 3RI4A 1MJAA 2HKXA 1ZGAA 3T5XA 2XKPA 3HSRA 1BC7C 3IHUA 5D4RA 3U9GA 1IN6A 1U5TB 1YTYA 2F5EA 5FD6A 2K86A 2PQ8A 2XV4S 3I53A 2LF8A 1LJ9A 3WE3A 4LMYA 3M9AA 5CVIA 5E8GA 5E18F 3C7JA 1O57A 4L9JA 1H9TA 3FHZA 1R5HA 4FX4A 1ODDA 5FFZA 2C6YA 4PZJA 2W25A 2EV6A 1TQMA 2IT0A 4YFKF 4DQ2A 2LDUA 1CGPA 2P4WA 2ADUA 5L3EA 5EEGA 3GFMA 1R1TA 2VE9A 2IW5A 1O3TA 1C0WA 1BJAA 5BOXA 3H92A 1S29A 3E3VA 4MQVA 1TW2A 4P96A 1BM9A 2GA1A 1YW7A 1K78B 2RNJA 3O3KA 4G9YA 4EJOA 1U5TC 3FF5A 1T6SA 4HV5A 4M9ZA 1KYWA 2FNAA 4CO8A 2RV8A 1O7FA 2ZMEB 4EM2A 1FZPB 1L3LA 2E1NA 4OU0A 1XDSA 5AIPA 3Q9SA 4IRIA 2VONA 4LLGF 3P9IA 2LNBA 4UXNA 1BC8C 1Z6RA 2DT5A 2XGXA 1T98A 1IXCA 1TBXA 3GO5A 4HDVA 3PFIA 3JAMK 3RYPA 1Z05A 3QOPA 1ZN2A 2Z9OA 1F9NA 1ON1A 3V7SA 1XMAA 4M73A 2H94A 3WODF 1KU7A 3WTZA 1S6LA 3T8TA 2PEXA 3IC7A 1Z91A 2MD5A 4KICA 2PN6A 2VBZA 2KRFA 3C3WA 2DQRA 5LHHA 4A0YA 4I0AA 3IKTA 1YYVA 2HYFA 2M1BA 4ZH4F 3FM5A 4RB0A 2PMHA 4NB5A 2P6TA 5DUKA 4D0PA 1JHFA 4HW0A 4LK0F 1XN7A 2M45A 2EK5A 1D5VA 1OR7A 3RTRA 3K1NA 3KP6A 3I59B 3FX3A 3OV8A 4E70A 3LA7A 3I4PA 2V9VA 2GA2A 5DCMA 2FBHA 2DQLA 4HAMA 3WTUC 1J0RA 4G94A 5LLQA 4EM0B 2XHKA 3RDIA 3HSEA 5TJJA 4HX7A 3EYIA 3U2RA 3J81Z 2M30A 4MQ9F 4FX0A 4KN4X 3RJPA 2FE3A 2OBPA 4LLNA 2KIFA 1AOYA 1A04A 2A61A 1KGSA 1KU3A 2Q2EA 2R7FA 3MZYA 2STWA 5HS7A 1E2XA 4CDGA 2QQBA 2HQRA 3SFZA 2EA2A 3TO7A 4UUVA 4L9NA 1LEBA 5L3CA 5DEQA 3KETA 1MDMB 2VOPA 2CQKA 3MZHA 2JPBA 5D4SA 5LRSA 5LGUA 3LFKA 2K4BA 5L3DA 3F23A 1R23A 3COAC 3F21A 4XRFA 2ZCWA 1B59A 3QU6A 4N9HA 2V1XA 1EH8A 1I6XA 5D5XB 4PGHA 3L09A 3WE2A 4OIQF 2XUBA 2E7WA 4BQAA 1JXSA 3BDDA 4KT5C 4KMFA 4Z2YA 4S05A 3LWFA 2HS5A 3T1BA 4OIOF 4DNCA 4ENJA 2QBYA 1W4MA 2A07F 3L2CA 4UV8A 4ENNA 3M8FA 1BIBA 3I71A 2Y75A 3E97A 3O6BB 4PDKA 4UVCA 2FXAA 4YFNF 2R7DA 4L9VA 3VOEA 2VT2A 1BN5A 1IN5A 4A0XA 4GCVA 2LSOA 4KYWA 3QRFF 4GGGA 3DPLC 4O3MA 3MEXA 4RB3C 3RPUA 5FFXA 2Y48A 3WTXC 2RQPA 5E1XA 4XLPF 1Z7UA 5CVVA 1HSJA 1R36A 1D8KA 4HF0A 2DW4A 3C1DA 2DPDA 4A12A 4RGXA 3GWZA 3Q9VA 4LG0B 3E6CC 2GZWA 1HKTA 2A6HF 1RNLA 1B6AA 5ILVA 3R0AA 5E17F 1U5TA 1JHHA 4CZZA 1XCVA 1PDNC 5CJ9A 2EB7A 3WGIA 5H6QA 1R58A 4G7ZF 3FMRA 1B9MA 4LD5A 1L0OC 2HZTA 2L01A 1QBJA 2OA4A 3LQQA 1RIOH 2W84A 2QM3A 2L54A 3K1MA 4H0EA 3GFLA 2ELHA 1UFMA 1TNTA 4ZYHA 1BBYA 5FD5A 4O6JA 1WSUA 2BV6A 4WXHA 2RN7A 1TTYA 3QAHA 1U2WA 5CVRA 2O6GE 2E1CA 5HDGA 3CUOA 1WKMA 5J6XA 2CO5A 2EA4A 3F3XA 1OYWA 3LAPA 2OZUA 1IXSB 1W7PB 1ULYA 1D8JA 1K7AA 2H27A 4UV9A 2BE5F 3BWGA 5HOOA 1HSTA 4RAZA 3NRVA 2YX4A 3JSPA 4L5IA 4Y15A 2PFBA 2K27A 1FSHA 3VB2A 2M8EA 3WGGA 3GX4X 2MH2A 3FM3A 2JZYA 4UHTA 3ERED 4HQEA 4HQMA 1BOAA 2NNYA 3TO9A 3G3ZA 3NQOA 2ZO4A 2IJLA 1FYLA 1UHWA 3MAJA 2VN2A 1Q1HA 2HGCA 4I01A 1PP8F 3KE2A 2VBWA 4CHUA 1G3YA 5F6FA 3KZZA 2UXNA 4HX4A 2FBKA 1ZRCA 1R5GA 2AS5F 4LK1F 3M7GA 2XROA 3K69A 3WTWC 1J2XA 3FXRA 1J9IA 2JSCA 5LRRA 1QNTA 4FT8A 1FC3A 3E5QA 5J8CA 1FYKA 2VE8A 4L5JA 4QLCU 1O7LA 2V1UA 4BXUA 2OAZA 1KQ8A 2OQRA 1XSDA 3WGHA 2PMUA 1XGSA 5LHIA 2RVCA 5EEHA 3E6MA 3CDHA 4OIPF 5ICCA 5AONA 3HHGA 4M72A 1K6OA 5J8FA 2FRHA 4ZYEA 1Z1DA 1RZ4A 3DV8A 3HOSA 4HBLA 2Q8KA 1KU9A 3J81K 1QZZA 4WF2A 2IPQX 4AWXB 4AIJA 2YU3A 3CUQC 3R4KA 3HOTA 1HQCA 1F1ZA 2HWVA 3KFWX 5ICFA 3TQNA 4A0ZA 4XSZF 4WX9A 4BNCA 3D5LA 5KK1A 4ZZLA 2IA1A 2YSRA 1BI3A 2ZXJA 4U0YA 2CYYA 5A2QZ 3TGNA 2LF7A 2XAHA 1FY7A 1P92A 5DYMA 4KNYA 4U0WA 1EH7A 1U8RA 1SFXA 3QPHA 4M9SA 1O3SA 1BIAA 2FU4A 3DXJF 4L9TA 3MWMA 3H3ZA 4Y13A 4Y17A 2O3FA 4IF4A 1ZG3A 2BEOA 2GAUA 2FOKA 4KIGA 1JGSA 3S2WA 5JFRA 4CICA 4LFUA 1LQ1A 2XKOA 3KEQA 4M6XA 1EV7A 1KA8A 2PJPA 4XSXF 5ILSA 2VC1A 4I09A 1ZRFA 4Q47A 2BGCA 3F8NA 4WK8F 3T0YA 1R22A 1UB9A 4WXDA 2KIMA 4MNUA
chains in the Genus database with same CATH superfamily
3LQRA 2ISZA 2D1HA 1HF0A 5GAEJ 4BEHA 5BMZA 3KYDB 2A6TA 3S1MJ 4HZFA 5E20A 4LLLA 2IS4A 1YRNB 4KDPA 3JW4A 1X58A 5F1RA 3CCUI 3Q5FA 3MFKA 2R3SA 1DPRA 3A03A 2VPRA 1UELB 2CQNA 2E19A 2X4HA 4IOCF 1RUOA 2DMQA 5J3LA 1FBUA 1XGNA 2FF4A 2FA5A 2X1EA 3OS1A 2FSWA 3O2PE 1CF7A 1WH7A 2BHYA 1GHCA 3WTYC 2DTRA 2CUEA 2XGDA 4U88A 3VWBA 4CCLA 4E7IA 3DTIA 1XC5A 2XVCA 5H20A 1U3EM 1SD6A 1HDPA 3VSKA 4XLHA 2WB1N 1F5TA 3P9CA 2XDVA 2R5YB 1YX3A 3LAJA 3IH4A 2H6CA 2DA2A 2MH9A 4II2A 3HOWJ 1HXDA 4E7SA 2QLZA 3TP0A 2OTLI 1TC3C 2NXNB 1SAUA 1T0FC 3AL0C 1OYYA 1Y1VJ 3MMYB 2DODA 1LFPA 3BG6A 2QSGX 4M3GA 2NVXJ 4BYYA 3TEDA 1P7IA 4RGSA 2MBFA 2IXSA 3K2ZA 2DFFA 3OYAA 2XAQA 2ACJA 3WHCA 2H1LA 3ONQA 5J1RA 2IS2A 3ZMVA 3GLLA 1IN7A 2NYXA 3G1MA 1HLVA 3DPTA 1WJBA 4M3DA 2VODA 4KN7X 3ROUA 3ZR8X 1LDJA 3GLXA 5BS6A 4KITB 4A6DA 2IRFG 5ILUA 2KP6A 3FXUA 3TOAA 2KHMA 3CMAI 1XG1A 4CXFA 3X2QH 2OU2A 3AAFA 1XGMA 1H9GA 2A68F 2UXXA 1X1PA 2J5OA 3WHBA 4G7OF 2ZXIA 5HS8A 2ZJPF 4B4CA 2COMA 2JN6A 3GCMA 4U87A 2L4AA 3DTKA 1T08B 3L1PA 3CO7C 5FKMA 3VEPA 3HUGA 3WTTC 1POGA 3W2VA 3Q0VA 4F91B 2A3SA 5FKLA 3TDZC 1W1WE 4ENKA 1DDNA 1F36A 5HDNA 5DV5A 2B0LA 1VQNI 2HPIA 4L0YB 3S1RJ 3CF5F 3AKZA 4FE7A 5HLGA 1YLFA 2ICWG 3BZCA 2K9QA 1SMTA 4JX6A 1RKWA 2CFOA 3IAM2 3KP3A 2VASA 4YFXF 4KMUX 5K7FA 1HC8A 1J5YA 4G7HF 5KCMA 4MTEA 3M8EA 1G8XA 3HXLA 2X0LA 2OTJI 2MLKA 4P55A 2EFOA 3LFUA 2AO9A 2QEXI 2DDAA 2QENA 2KDZA 5DD8A 2EQRA 1D0XA 2GQQA 1IXRC 2LY2A 3I58A 2IA0A 5TISC 4D5FA 2LMDA 3ZMUA 5DM6F 3CCMI 3HPGA 4YIIA 5FLXZ 2EIMH 2ESNA 1R4NB 2COBA 3NARA 2GBYA 1I27A 1SAXA 3DFGA 5E79C 3HC7A 3KP2A 3N05A 3KZYA 2EJRA 1STZA 2KJBA 3BY6A 4LGWA 1B1BA 1P7JA 2RNGA 2ZBKA 3RKWA 1VTNC 1ETQA 1E17A 5IOYA 1FPQA 1WCMJ 3DLAA 4LOCA 1ZG5A 3F8FA 2JT1A 2IP2A 3IWFA 1R1VA 4KIFA 1IUYA 3TL4X 2DO7A 4MEYF 4ZYAA 3IV5A 2L9RA 4KA4A 4NQWA 3D0SA 4OMZA 5E1WA 3IKVA 5FKKA 1VQMI 2KZVA 3FIWA 3ZXSA 1YW9A 2PI0A 3OOPA 3SZTA 4FTHA 1TP4A 2F5CA 1PUEE 5HLIA 3GYHX 4J00A 2D1VA 2H6BA 2A69F 3UKGA 3S1NJ 1MNDA 4GXOA 3I64A 2YPRA 4WWCA 4PSWA 2DOFA 2IBDA 3I5UA 1DGRM 4I02A 1HDDC 3T8RA 1MKMA 4F52A 4ZYDA 1PVEA 4BAYA 3RZOJ 3F8BA 1A6QA 3F0CA 1GVJA 4Q5SF 2ZJ2A 4MGRA 1WVRA 2HTJA 3HB9A 3VDXA 1Y8RB 5LEKA 2DMNA 5GAGJ 2L9SA 3G73A 3HDDA 3CO6C 4Q4ZF 3OSGA 3N4MA 5BPIA 3CUQA 5M5YJ 3HIFA 2VUMJ 4HA8A 2H8RA 1S7EA 1JJ8C 4G6QA 5EDNA 2R7UA 4EM1A 4CGZA 1HKSA 1B8IA 3OYIA 2A6EF 2DFHA 5D6FA 4BJ6C 2QYOA 1ACIA 1P4XA 4IHXA 2ESHA 3JTGA 3KP7A 1P4AA 4ZYGA 5BPDA 1WRJA 4AUXA 1MMGA 2E2HJ 2W24A 1VQLI 3BZ6A 5CQEA 1Z77A 4LIUA 2HQNA 3SJMA 5JI6A 2PG4A 3V7RA 4F92B 1O3QA 2HOEA 3KP4A 3G71I 3R6SA 4LG3A 3H1CA 4TV7A 3DWLE 4RB2C 4ASNA 2E60A 4RDUA 3P7NA 2DA5A 1YS7A 1LE8B 4KUMA 2CSOA 2P7CB 4D5CA 1IRZA 4AIKA 2JUGA 3DCFA 1IDYA 2H09A 2VJ4A 2DLLA 1KZHA 3ZMSA 1XSXA 2EV5A 3QYFA 3DLLF 2D45A 1FP2A 4II3A 4JQFA 3M8JA 4BBRJ 3OYBA 2ETHA 1N78A 2B7EA 4XOTA 5E8IA 3IAS2 1G4DA 4OMYA 3DF8A 2QSHX 2P0WA 2QVOA 2WTEA 2GIZA 2PBIA 3UR3C 2QUFA 2PMZA 3DBHB 3RKXA 2HYGD 3ZQGA 3GEZA 3MZ8A 1BI0A 1XMKA 3OYJA 2V6CA 4EMSA 3QP5A 3SFIA 2XAGA 1OCTC 1G3SA 4XICA 3DBRB 2HOTA 1ZR4A 2JUCA 5F0FA 3C2HA 2L0KA 5L3BA 2ZJQF 3ESWB 1J7KA 2XSJC 4Q48A 3I4MJ 5JHUA 1FWZA 2MA3A 4PGGA 1AWCA 5FLVA 3BR6A 4DYQA 5CYVA 3EYYA 5DCMB 4AIHA 1USSA 5DM7F 3TW7A 2NVQJ 5DDGA 1LPQA 3V7CA 3NAUA 2O0YA 2DK5A 4LJZF 1BOBA 3CJNA 2P7VB 3M4OJ 1TWAJ 1QQIA 3I0TA 3LSKA 3CD6I 3BTCA 5C4JJ 2Y0MA 3CJRB 3OOUA 2ZSIB 3K4NA 2DBBA 1MBHA 4ITVA 1ONVA 3S3OA 3J80Z 1S5LC 1W5TA 4DW6A 3JRDA 1FT9A 1W5SA 2FBIA 1LB2A 5D8KB 2L9VA 2GWRA 2M34A 5LEJA 1Y8QB 4A5NA 1P4WA 1K78A 4BBSJ 1U6GA 2CWEA 5M3MJ 3I9V2 3IWZA 2VXZA 1RUNA 2E1OA 2XB0X 1ZHFA 3I3LA 1FTZA 1SVLA 3MQ0A 1MMSA 1FYMA 1ZRDA 4IKFA 2HZDA 2W1OA 3BROA 3M07A 4L5EA 3L00A 3DEEA 1S3JA 2L5QA 2Q2EB 3CLOA 4A6EA 5A2QK 3U21A 5IT9Z 2G7HA 4XM3A 3F9KA 4HYEA 4JOMA 4CCJA 1SFUA 5LGTA 1QGPA 2ZSHB 2ZMEA 4BDZA 4M74A 4HNVA 3QP6A 3VFZA 2CW8A 2WWYA 4MIMA 2XF6A 1UG0A 2OC6A 3ZGKA 4IQJA 1R7JA 1WQ2A 2XIGA 5HLHA 1W0TA 4A3DJ 2HOAA 2XRNA 2I10A 1PUFA 3E6BA 3BOQA 4WXCA 1I1SA 2BY2A 4N9IA 1ZGWA 3BTIA 1R00A 4RB1A 1IZ1A 2VI6A 4XN0A 4Y4RA 3EETA 1WH5A 3W6KB 1U78A 1OJLA 3OYEA 4CZCA 4Y7NJ 3KYLA 1VF9A 1UCRA 4D7MA 3Q0UA 5EEAA 3K4KA 4XNFA 5F04A 3V8LA 1XB4A 3DBLB 1A6IA 4K2EA 3SHFA 2OV7A 3K9TA 3R61A 3CESA 1IJWC 2L2OA 2LBFA 3EPZA 2QQ8A 2RC4A 2F5DA 4YIRX 1T2KA 2VBXA 3CCLI 4ESBA 2XAJA 4PCQA 5HLTA 2EZHA 5FKNA 4S04A 3FMQA 1OYIA 2DK8A 3ZQQA 2FD5A 2BY3A 4R1HA 2Z33A 2QBYB 3S2HJ 5K7HA 3FKIJ 3GMEA 4HRIA 1VQPI 3HRTA 1YW8A 5EGOA 4BHCA 2Y69H 4CSWA 1D1CA 4IXAA 5EZHA 1ZQ3P 2BW3B 2HTSA 2KFDA 4ETSA 3B02A 5D5UB 4DBQA 1NK2P 1MJ9A 2G7UA 2KT0A 1A31A 1IV6A 1XCBA 3HYIA 1V4RA 3A01B 2M0MA 2X48A 1LVAA 2ZNZA 5FKOA 4A5MA 4OINF 4A3IJ 3E5UA 5C3EJ 3GW2A 1OCPA 2OF7A 4MEXF 1ETKA 1XS9A 4RS8A 2MC3A 5HVQC 2Y31A 4XIDA 5EG0B 1QPMA 1X1BA 2L7KA 2RDPA 1DUXC 3E6DA 3JSOA 2EV0A 2RKHA 3I59A 5LHGA 1YJWI 5LD2C 4BHBA 1I1GA 1JT0A 3K7AJ 3FK7A 1BI1A 2MGQA 4IHYA 4EJTA 1X1AA 3HTUA 4W97A 3FISA 5ICGA 1BW6A 2OJED 3CMYA 3PUBA 1QHHD 4KT6A 1R4MB 5CVUA 2D2WA 3W6JB 5IYCJ 3ABLH 2K40A 3CJTB 2BBYA 1PP7U 2F5VA 2XAFA 2Y2ZA 2K7LA 3VPRA 1TLHB 3R60A 3CCEI 5C44J 3PIOF 3RZDJ 2QWWA 2XPWA 2HPMA 4L18B 3ULQB 2IGMA 3ABKH 4B09A 5IP7J 4RMNA 1Z6TA 3ZQ7A 5JLWA 4LIVA 4XLFA 4NHJA 2UZKA 2R93J 1NTCA 1T39A 3CC7I 2EINH 2CRGA 1ETXA 5BNGA 3WTVC 1ZLJA 2V7FA 4BHPA 2ZKZA 1XPXA 5DUIA 4U7DA 2EZKA 4BACA 1SFEA 2FJ1A 5H6RA 1GVDA 3CCJI 4E7KA 4X0GA 4JBAA 1H0MA 1NHAA 4EJVA 1O3RA 1B9NA 5D5WB 5L3FA 1J75A 4E7ZA 3RQ4A 1JGGA 2HDCA 1EH6A 2LY9A 3D5SC 2VBYA 2CG4A 2EFNA 2LG4A 1KU2A 1RI7A 5CPRB 1B72A 1YIOA 1BI2A 2GIVA 3RPQA 2OD5A 1S7OA 5CVJA 1YJ9I 5K5RA 4A2UA 4ZDPA 4CA0A 4QWQA 1I6HJ 2JK3A 1MDMA 5IT3A 2HEOA 4PUSA 2MSYA 2GOMA 4YEJA 2EFWA 3J7AO 4ON0A 4HF2A 3DKYA 3TDUC 3BQYA 4HDUA 3QQAA 3EUHC 2CFXA 3ELKA 3KEYA 4DZJA 3HOXJ 4XBFA 1A36A 1WFXA 1QZYA 4D7NA 1TWHJ 4XLAA 3I54A 1E3PA 1FBSA 1RPWA 4BJTA 1IG7A 3KZIC 1MGTA 2FMLA 3HKZN 3KIOA 3GZ5A 2LKXA 1JKOC 3H0DA 3F6VA 3H3UA 2NS0A 2KIUA 3HEFA 2ZFWA 9ANTA 4NC6A 2EBIA 3HKZA 2PJRA 1RKTA 3DKWA 2VXDA 5GTHC 2V79A 2DFIA 3HOYJ 1BL0A 4ESJA 2GXGA 2P5KA 1OCOH 2J5PA 3ECHA 3B73A 2BZTA 1TNSA 2LREA 1V55H 2Z5UA 3HRSA 1SD5A 2Z1DA 4R8HA 1FP1D 2VQCA 2F5FA 2Z3YA 1LEAA 3TOBA 2JMWA 5GAHJ 5LFAA 5DCFA 1FOKA 4AYBN 2NRAC 2BVMA 4FASD 3FK6A 5B1AH 2W85A 4OAYA 1ZAOA 2UWMA 5FLXK 1W36C 4RGUA 4AYBA 1MBFA 2O8XA 3FBIB 3WG9A 2OQGA 2R5ZB 4EGZA 1EKEA 2QA4I 4IPAA 3CCRI 2Z99A 3G1OA 1XMXA 2XPUA 4MHGA 5IYDJ 3LOCA 4P5OA 2CGPA 2EWNA 3SZGA 4C2TA 2CUZA 3SZPA 1AHDP 2KISA 1USTA 2W57A 5KVRA 4A3MJ 1MMNA 3BJAA 3E7LA 4HX8A 2STTA 2JVHA 3G4SI 4HF1A 2VKDA 4AVPA 5LBQA 3D1NI 5B3SH 3FDYA 1SC7A 1W7PD 5DS9A 3K2AA 3BZKA 1ORKA 2EFQA 1S72I 1X3UA 4CCKA 1IAWA 1HW1A 2IGKA 5HS9A 2IEKA 2VC0A 4V2FA 3NWSA 4M71A 5L3GA 4HSRA 3K70D 4IHWA 5ED4A 3BR5A 2CQXA 1YFHA 2M87A 2V9KA 2VIXA 4P9UA 2R7QA 4IRHA 4Y33A 4EQQA 4PFPA 1GXQA 3CCVI 1R71A 1FBQA 2X6XA 3C2GA 2Q1ZB 4UUSB 1FNNA 4LG0A 2L3DA 1JJ6C 1IC8A 2JTVA 2XGEA 3JCUC 4XONA 3K10A 4KIBA 5BQTA 1IF1A 3AFHA 2EILH 1SEUA 2HVQA 3OIQA 1X3WB 1BR4A 1X4OA 5FRMA 3MKZA 5AIQA 5CLSA 4E4HA 4F93B 3BG5A 2P81A 5F64A 3LA3A 2P5VA 4GYIA 1GDTA 3LSPA 4PJNA 2ZXHA 4N4OB 3ISPA 3ABUA 4RAYA 3WTSC 1YO5C 3U1KA 1MD0A 1K61A 1NK3P 3DEUA 2WB1A 3CLQA 3K4BA 3BJ6A 2CW0F 5K5QA 2IA2A 2HFHA 5E3LA 3WU0A 1REPC 2QCOA 4KFCA 4I76A 1AKHA 2FUG2 4CYCA 3HM5A 4PJMA 2HVSA 2P6SA 2O61A 3M3YJ 3V4GA 3LA2A 4FHTA 2K9NA 5E1ZB 1K79A 1IN8A 2DI3A 2BYVE 1RESA 4RLQA 2AQFA 3RQIA 3F6OA 3HRUA 1YIJI 3W6VA 5D5VB 3BLYA 1DPUA 3A02A 2XF5A 1YG2A 3AG3H 3S8PA 3GTMJ 1H88C 4EJUA 2E71A 2NNNA 4HOBA 3HRMA 1WHUA 4B8XA 3HZJA 3LSGA 1EJ9A 4I2OA 2M3AA 3GF2A 1IV8A 2QQ9A 3W2AA 4F7ZA 2CQ7A 3LSIA 4ZC3A 2V1DA 1W7PA 1JE8A 1XD7A 3J80K 2G9WA 2XASA 1D3YA 3HOZJ 3GZ6A 1QA6A 3F8CA 3FBNB 1FOXA 2R7ZJ 2HR3A 2P8TA 1X3ZB 3GUDA 3ZP5A 2FOWA 2NAZA 1YOVB 4M9XA 2M4GA 3OMYA 4R79A 4MTDA 3GBGA 2WV0A 2A5YB 3OR2C 4IHVA 4N0BA 4JK1X 3OS0A 2IS6A 3A1YA 2VOOA 3OYHA 1UHMA 1S7AA 2DXIA 1U9OA 4LB6B 5IT9K 5ICEA 2O8KA 3ZMDA 2DA6A 2FNPA 3BPXA 3L9FA 3NWTA 4Y52J 3V42A 4C2MJ 3BR0A 3M1EA 2DPUA 1VQ8I 1IW7F 1S9HA 4RM2A 3OYMA 3KEOA 1G6NA 1KYZA 1MBGA 1ZG1A 4DZPA 2M0CA 4XLEA 1M1EB 2WAEA 1R5ID 4FISA 4PJ0C 3ZMZA 3DU5A 1IN4A 2L7ZA 3IP4B 4IHSA 1VQOI 1ZGJA 2EZLA 3O8HA 1DP3A 1I5ZA 2H8WA 2P5LC 2B63J 5IYBJ 2M5WA 1W36D 3OL3A 1SD4A 2HNHA 2JQ7A 5TRDA 2DJIA 3V8JA 4G6DA 4I98B 1J59A 2L4MA 3QPSA 4IVNA 4RGRA 2TCTA 2DMUA 3DPUA 3N97A 4HEA2 3BQZA 3BJOA 1O4XA 2L02A 4A93J 3HTSB 2O03A 3GFJA 5EJCA 4PFOA 1QVTA 3BP8A 4IHTA 1G3WA 1SMYF 1ZYRF 2WY8Q 5E3NA 3ZMTA 1APLC 1IRXA 2JPCA 1P9QC 4M3BA 1ZARA 2F6CA 4N4NB 3RIRA 2EFPA 3QODA 4HLYA 1FX7A 1ETVA 3JRHA 5HDKA 1E3OC 1IRGA 2KPMA 3JAMZ 3WU1B 5F27A 1YX5A 5D8LB 4M3FA 1R1UA 3K1PA 2NS8A 3A0HC 2JVGA 1HW2A 3GTQJ 4XOPA 2L7MP 2F48A 2FEZA 2MYSA 3P9KA 4NC7A 3U1DA 1ZREA 2BW3A 2E1MB 1D0ZA 1YQAA 2VT3A 4A3GJ 2Q0OA 3FMSA 3A01A 2K9SA 3IRRA 3GFIA 2HKOA 4IJAA 5KHDA 3B6CA 3GXOA 2YS9A 4AD9A 1S8NA 2QQAA 4WCGA 1OCCH 5IY5H 1JI8A 1ERDA 4L0ZB 4G8XA 1R6RA 1I39A 3DQVC 4I7HA 3S32A 2OPTA 4BH9A 4UVAA 1G3TA 2XSDC 1XGOA 1H8AC 2DYSH 5F0CA 4AU7A 2VLAA 2W82A 3EDPA 3C18A 1Y0UA 5JR3A 2MD0A 2GXBA 3EUHA 1V5FA 2MABA 4ESFA 4W1UA 3KLNA 6PAXA 3KLOA 3FZVA 3Q3SA 2XF7A 2W48A 4OOIA 3H5RA 2BY1A 3HHHA 4XKBA 4ZDOA 1PYVA 2PX9A 3ZPLA 3GZNB 2NVUB 3D5RC 4BEHB 3SQNA 2IVMA 1P6RA 1Z0XA 3HSFA 4KISA 3ML6A 2YR2A 2VKVA 2QZ8A 5JLXA 1TQIA 1XSVA 2MLGA 1TW3A 3ASNH 2Y30A 4UVBA 5HNHA 1GXPA 4XKVA 2YX7A 3F8MA 1NG7A 1R49A 4U7BA 1FSEA 4ENMA 2WC2A 1SD7A 2ISYA 4E7HA 2K4JA 2A05A 5GP9A 3L7WA 4J19A 2LRDA 1HBXG 3ECOA 1MBEA 1MBKA 4QPOA 2RQQA 4C2UA 3FKJA 2FX0A 5JVTA 2XC7A 1MSFC 2K9MA 3RKYA 5KAFC 4UNOA 5J1YA 4YIFA 3QPTA 1CF7B 5FO5A 3VODA 1WWXA 1BR2A 2DDBA 1WJFA 3S93A 3CCSI 2DA4A 1GV2A 2ID6A 2VKEA 4OIRF 3E5XA 2KRHA 4O5VA 4MO7A 3OYDA 3IRQA 2DU9A 1G2HA 2KKOA 2NOJB 3LSTA 3A2KA 3CC2I 2WAQN 1ZLKA 4IO9F 3KP5A 2FMYA 3REOA 2V1NA 1WI3A 2E5NA 3KCCA 5DD4A 2WAQA 4EGYA 1LDDA 4BJ5C 3JRIA 4XKWA 1QO0D 4AIDA 2R7XA 1IRFA 3GVAA 4HSTA 2K02A 4BQQA 3QU3A 2JA2A 2R7SA 1WI9A 2NVTJ 3TW6A 1OISA 3G6EI 2ZNYA 4XORA 2EZIA 1MJBA 1MZBA 2LK2A 2RGVA 1KQ0A 4OWRB 1UMQA 2AXTC 1D1AA 3LSRA 3K0LA 4IRGA 3RKQA 2JRTA 3CTAA 4ZZDA 1KQ9A 3TKYA 1RETA 3V8KA 3MKLA 4HPQA 1HKQA 4LB5A 4BQNA 3DP7A 5M3FJ 1LDKB 4BE1A 4H4KC 4GFBA 1N75A 3S3NA 2NS7A 1ENHA 4GO1A 3W3CA 1U8BA 1SVOA 1JUSA 2R92J 5C4XJ 1ZK8A 2KJCA 1SANA 1DP7P 1DGWY 1ON2A 1P2FA 4GYGA 2WA0A 4B44A 2AXLA 3BTJA 2TDXA 3JTHA 3SXYA 5FB2A 1VQKI 3ZQCA 3HUGB 5GTIC 1OR7C 3VYSB 4ZTJA 2W4SA 5IPAA 3R0JA 1VI0A 3EQLF 2IAIA 1OMIA 1AU7A 3I55I 3FWEA 4I0BA 4YELA 5K5OA 1E0EA 1Z9CA 1UAAA 5K1YA 5E3OA 2JA5J 3NEUA 4XN3A 3HOVJ 2JSPA 4XRSA 1YS6A 2Y0SN 1I3QJ 1TZLA 1YI2I 2MFZA 3OR1C 4QTRA 2F2EA 2PLYA 3UNGC 2RREA 1T0FA 4X6AJ 1HCRA 3MCZA 4M6YA 1LFUP 4UB8C 3RYRA 3OYKA 3BPVA 2E7XA 2KZGA 5J47A 1V54H 1F4KA 1PJRA 4DYCA 4M6VA 4E7LA 1LNWA 1W5CC 4P9FA 4HV6A 2E2IJ 3TO6A 3ZN1A 3BTLA 5J1UA 4CCNA 3PL8A 2DAOA 1X2NA 1FLIA 4G6TB 1TQPA 3BCBA 5LGNA 1ZTRA 3H3VK 3PQJA 2M4KA 4Y3OA 4XLNF 1HW5A 1V3FA 1YRNA 1T38A 1OKRA 1TL8A 4UUTA 4UUSA 3F22A 5FGMA 2M7AA 3H9QA 2HDWA 2DT7B 4V19K 2R7OA 4NQWB 3ABTA 2VJ5A 4HLXA 1J09A 4YG2F 2FQ3A 3MKWB 4EV0A 1OPCA 3PNVA 4CYDA 3ZN0A 4EVIA 2OZ6A 2LVSA 5ERIA 1ETYA 4EJWA 5D6EA 3QWLA 1VZ0A 1XDUA 2LKPA 2K3PA 4U0VA 3S3MA 1YITI 1ZH5A 1QZEA 3DEWA 4LITA 2IGNA 2BXYA 3PSIA 3PUFA 3PQKA 2BHZA 4AVZA 1WJ5A 3FXQA 3MD2A 1Y0NA 1B4AA 3CUQB 5FROA 2R5YA 3HOUJ 3IL2A 2JA6J 2DCEA 2E36A 5J40A 4D1QA 2O7OA 2GM4A 3F72A 3RI4A 1B8IB 1MJAA 3OYGA 1IGNA 4B48A 1QHGA 2HKXA 3B6AA 1ZGAA 3T5XA 2XKPA 3HSRA 4FETA 4BKXA 1ITYA 3OYFA 1BC7C 3L2RA 3IHUA 3K6GA 5D4RA 3U9GA 4Z6YA 2LFBA 3TMOA 2O9LA 1IN6A 4CH7A 1MIJA 4A3FJ 2X1DA 4I6ZA 4ZJZA 1U5TB 1YTYA 2DFEA 2JA7J 1LKXA 2F5EA 5FD6A 2CS3A 4XLCA 2K86A 4QPQA 2LD5A 2PQ8A 3KYCB 2XV4S 3I53A 5F1JA 1RR7A 2LF8A 1LJ9A 3WE3A 1JKPC 4IEJA 1Y56A 4LMYA 3M9AA 5CVIA 5E8GA 2DOAA 4HNTA 5E18F 3C7JA 1O57A 4L9JA 1H9TA 3FHZA 1R5HA 4FX4A 1ODDA 5FFZA 2C6YA 1LFBA 2V4JC 1BR1A 4PZJA 1JTXA 4B3AA 5IOZA 4FQGA 2W25A 5EYRA 2EV6A 1TQMA 2IT0A 3G1LA 3DTEA 4YFKF 3QYBA 5M5XJ 4DQ2A 2LDUA 2HQAA 1CGPA 3QOEA 4XK4A 2P4WA 2K9LA 3Q0WA 2ADUA 1U9NA 4JP0A 4ABZA 1T56A 5L3EA 1EA3A 2K85A 5EEGA 4C9YA 2GXAA 3GFMA 3JREA 2D5VA 1ETWA 1R1TA 1ZKGA 2VE9A 2KDOA 2E5ZA 2IW5A 1O3TA 1C0WA 1BJAA 5BOXA 3H92A 1S29A 3E3VA 4MQVA 1TW2A 3RCOA 4P96A 1BM9A 1BW5A 2GA1A 4PSXA 1YW7A 1K78B 2RNJA 3O3KA 2V6EA 3OWTA 1WJCA 4G9YA 4DOZA 4EJOA 1U5TC 3FF5A 1UJ8A 2HXOA 2BVLA 2JA8J 1T6SA 4RM3A 4M3EA 5E3MA 1FOWA 1OLTA 3CQZJ 4HV5A 1FMVA 4M9ZA 1KYWA 2DA1A 4D9JA 1DQUA 1VNDA 2FNAA 4CO8A 2RV8A 4CUGA 2R7RA 2LLKA 1O7FA 3H36A 3K4MA 1FJLA 2ZMEB 1WJAA 4EM2A 2XB5A 2M7BA 2ZFUA 1FZPB 4NC8A 5F0HA 1L3LA 2E1NA 4OU0A 1XDSA 5AIPA 1A35A 3Q9SA 4IRIA 1G59A 2VONA 4LLGF 3P9IA 2LNBA 4UXNA 4E6KG 1BC8C 4AM3A 1Z6RA 2DT5A 3BG3A 2XGXA 1T98A 1PUFB 2R7VA 1IXCA 1TBXA 2F4OB 2VJIA 3GO5A 3LSJA 4HDVA 4UB6C 2F4MB 3PFIA 3AG1H 3RYPA 3JAMK 3H9GA 1Z05A 5FRNA 4FE4A 2HVRA 3QOPA 3HGGA 3CC4I 3ERMA 1ZN2A 1GUUA 3SDGA 4AC0A 2Z9OA 5HNFA 1F9NA 1WPKA 1QPIA 2VB6A 1ON1A 3V7SA 1XMAA 2XPVA 4M73A 2H94A 3WODF 1KU7A 3WTZA 1S6LA 1Y39A 3T8TA 2VL8A 2PEXA 2HI3A 3IC7A 1Z91A 2N8GA 4BDYA 2LBFB 4BUPA 2MD5A 4KICA 4RAGA 1FOYA 4V2GA 2PN6A 2ME6A 1JT6A 3VSLA 2R7TA 2VBZA 2KRFA 4XQFA 3C3WA 2E2JJ 3QPLA 3PO3J 2DYRH 2DQRA 3BC8A 5LHHA 2ECBA 4A0YA 2H1KA 1K4TA 4I0AA 1LE8A 3IKTA 1YYVA 3JRAA 2HYFA 2M1BA 4ZH4F 3FM5A 1Z3XA 1HA8A 2OCCH 4RB0A 2HDDA 2RAEA 5EGOB 2ZMEC 3HGYA 1D5YA 2PMHA 1WJEA 4NB5A 2HXIA 4NDLA 2P6TA 5DUKA 4D0PA 1JHFA 1TWGJ 4HW0A 3CCYA 4LK0F 1XN7A 2OUMA 4BY7J 2M45A 3TBIA 2EK5A 3J7YJ 1QVUA 2F4IA 3OYLA 1D5VA 4B47A 3PO2J 1OR7A 3RTRA 3K1NA 3GTLJ 2L9NA 2X6OA 3KP6A 3LSHA 3I59B 3FX3A 1T33A 3OV8A 4E70A 5B5EC 5EZGA 3LA7A 3I4PA 4IOAF 1SFOJ 3JRFA 1ZR2A 1YE9A 2V9VA 1JUPA 2GA2A 5DCMA 2FBHA 4J01A 2VPLA 2DQLA 3BG7A 4HAMA 3WTUC 1J0RA 4G94A 4DBRA 2I8DA 2WADA 1N25A 3S1QJ 3S17J 3W2WA 5LLQA 4EM0B 4XMYA 3SEQA 3OS2A 2XHKA 3RDIA 3HSEA 2QF7A 2M8GX 5TJJA 4HX7A 3EYIA 3GTGJ 3OYCA 2QKMB 3U2RA 1RR8C 5IP9J 3J81Z 2M30A 2WY7Q 1RC9A 4MQ9F 4RLFA 4RBOA 1A5JA 2O5RA 4FX0A 4KN4X 3RJPA 1W0UA 2FE3A 2OBPA 1VQ4I 1E3HA 4LLNA 2KIFA 2XRLA 2IS1A 1QRYA 4NNJA 1AOYA 3KPHA 1A04A 3RPUD 3SEZA 2A61A 1KGSA 1KU3A 2Q2EA 2R7FA 3MZYA 2STWA 3GTPJ 3BR1A 4DJAA 1KONA 5CQGA 5HS7A 1E2XA 2WV1A 4CDGA 2QQBA 2HQRA 3SFZA 4DYRA 2EA2A 3TO7A 4UUVA 1FIAA 1B72B 4L9NA 4UY8I 1LEBA 3L2QA 3HJEA 2GOXB 5L3CA 4NUBA 2M9HA 5DEQA 1OCRH 3KETA 2M2EA 3H9JA 1MDMB 4ZTFA 1RRJA 5KNLA 1N77A 2VOPA 4A69C 2DA7A 4B3XA 2E34A 2CQKA 3MZHA 5EF6A 2JPBA 5D4SA 5LRSA 1YJNI 5LGUA 2MC4A 3CCQI 5FJ8J 3K4JA 2R4GA 3LFKA 2K4BA 5L3DA 3F23A 3CDLA 3CF2A 1R23A 3ZQIA 3COAC 3F21A 2DT6A 4XRFA 2ZCWA 1B59A 3QU6A 4N9HA 3FHNA 5H2FC 5JVGF 2V1XA 2DOEA 3FXOA 1EH8A 1I6XA 5D5XB 4IQ4A 4PGHA 3CJQB 2PJRB 3L09A 3WE2A 4C30A 4B43A 3LSMA 4A3KJ 4B1RA 4OIQF 2XUBA 2E7WA 4BQAA 1JXSA 5KAIC 3BDDA 3FXKA 2IGOA 4KT5C 3SDBA 4HNUA 2ZC2A 4BY1J 4KMFA 4Z2YA 4S05A 3LWFA 2HS5A 3T1BA 2BXZA 2GLOA 2HOSA 3S14J 3E1SA 4OIOF 1NH3A 3GTOJ 4DNCA 4ENJA 1XX5A 2QBYA 1WJDA 4DIQA 2YUSA 1W4MA 1TWFJ 2A07F 5GADJ 5HODA 3L2CA 3L2UA 2LKSA 4UV8A 2LTPA 4ENNA 3M8FA 2CUFA 2ECCA 3VYUB 3CMMA 1BIBA 3I71A 2Y75A 3E97A 3H5NA 1Z67A 3O6BB 4PDKA 4UVCA 2FXAA 3RSNA 4YFNF 2CJJA 2R7DA 4L9VA 3VOEA 5GPAA 2VT2A 1BN5A 1IN5A 4A0XA 1JKQC 4GCVA 1MH4A 3K4LA 2LSOA 4BE0A 1MSEC 4BL0B 5EG0A 4KYWA 3QRFF 2KIQA 1VQ6I 2HYJA 4GGGA 3DPLC 3BR3A 3PIPF 4O3MA 2OCEA 1I3AA 4JYKA 2Y9YA 3MEXA 4RB3C 2CW7A 3AG4H 2L7FP 3RPUA 2ME0A 3QYEA 5FFXA 2AQEA 2DJNA 2Y48A 4F3QA 3WTXC 3ZQLA 2RQPA 5E1XA 4XLPF 1IUFA 1Z7UA 4C3HJ 3TP3A 1TT5B 2DMPA 5CVVA 2X85A 1HSJA 1R36A 1D8KA 2W7NA 4XRMA 5F08A 3MN2A 2DW4A 4HF0A 3JRCA 3HPHA 1YHQI 5DTDA 3C1DA 4C3JJ 2DPDA 4A12A 4ZDLA 3WU2C 4RGXA 3GWZA 3Q9VA 4LG0B 3E6CC 2GZWA 4RAFA 2HQ5A 1HKTA 2A6HF 1RNLA 3FXMA 1B6AA 3J7ZI 2LYCA 1Z3YA 5ILVA 1BJZA 3R0AA 5E17F 3ZQHA 1V5EA 1U5TA 1X2MA 1IO2A 1JHHA 2V9PA 2E1MC 4CZZA 1XCVA 2VQHA 1PDNC 5CJ9A 2EB7A 4HG2A 2PMZN 1MH3A 4MLOA 3WGIA 4XL9A 5H6QA 1R58A 2UUZA 4A3EJ 4G7ZF 3FMRA 1B9MA 4LD5A 3OYNA 3E0JB 5M5WJ 1L0OC 3JRBA 2HZTA 2L01A 4YRVA 2QGUA 1QBJA 1MBJA 4BE2A 2OA4A 3LQQA 4BQOA 1RIOH 2X1CA 2W84A 2QM3A 2LC2A 4BXFA 2L54A 3DU6A 3K1MA 4H0EA 3GFLA 1AKHB 2ELHA 4CYCB 3S16J 1T8IA 1UFMA 3PJRA 3ASOH 4RA2A 2XGCA 3JR9A 1TNTA 4ZYHA 1BBYA 5FD5A 4O6JA 4BGDA 1WSUA 2BV6A 2EIJH 4WXHA 1DU6A 3BCAA 2VKHA 2RN7A 1TTYA 1JUMA 3JRGA 3QAHA 1U2WA 4A3JJ 5CVRA 1VFCA 2O6GE 2E1CA 4IL6C 5HDGA 3H35A 4QIWN 3OY9A 3KX2A 3GTKJ 2R7WA 3CUOA 1WKMA 1Q1VA 3G2BA 2KQRA 5J6XA 1DU0A 2E35A 2CO5A 2EA4A 3F3XA 2V26A 1OYWA 3PSFA 3LAPA 1VQ5I 3A0BC 4XRSG 2OZUA 1MMDA 1SVMA 2DA3A 2DN0A 2LR8A 3CP8A 3A4CA 4I99C 1IXSB 2CH0A 2WBMA 4DGWB 1W7PB 1UG2A 1ULYA 1Z7LA 3S2DJ 1GLNA 1D8JA 4QSHA 1K7AA 2X9DA 3ABMH 2H27A 1X19A 4UV9A 1K83J 2EH3A 2FQ4A 2BE5F 3BWGA 5HOOA 1HSTA 4RAZA 4F55A 1U0JA 3NRVA 3L2WA 2B9SA 2YX4A 3JSPA 2R5ZA 4L5IA 2QKLB 4Y15A 2PFBA 1EF4A 3ZQFA 3MVPA 1R9TJ 2JJ7A 2K27A 1FEXA 1FSHA 3VB2A 2M8EA 3WGGA 1MNMC 4FCYA 3PNTA 3GX4X 2MH2A 3FM3A 4P1WA 2JZYA 4UHTA 2X6WA 3ERED 2EPFA 3SYTA 4XKCA 4HQEA 2KLOA 2Y0SA 4HQMA 1BOAA 2NNYA 3TO9A 2ELKA 1LVKA 1JTYA 1F43A 3G3ZA 3NQOA 1Y6IA 3CMEI 3BR2A 2CV2A 5B1BH 2ZO4A 2IJLA 1FYLA 3J7AY 1UHWA 4IX7A 2QSFX 5B66C 4NBQA 3MAJA 4MFEA 2KRCA 5CKTA 1XTAA 2VN2A 1Q1HA 2HGCA 3C2BA 4I01A 3IH3A 1PP8F 3KE2A 2I5UA 2CMPA 2VBWA 4CHUA 1G3YA 1Y1WJ 5F6FA 2DMTA 2UV1A 1OFCX 3KZZA 2UXNA 4HX4A 4KJZA 1X1DA 2VJJA 2WAFA 2FBKA 1ZRCA 2R0QC 1R5GA 2AS5F 1UZCA 4LK1F 5J4VA 3M7GA 4XR6A 3K70C 1QU3A 3M1CA 5FLMJ 2XROA 3K69A 3OIPA 5JHFA 3FXJA 3WTWC 2X6YA 3HG9A 1JKRC 1J2XA 3ZCOA 3FXRA 1K4SA 2A5WA 1J9IA 2JSCA 5LRRA 1QNTA 4FT8A 1FC3A 3E5QA 2KL4A 1GV5A 2CU7A 1AA7A 2ZXWH 5J8CA 3BT9A 1FYKA 1MMAA 4CCMA 1FMWA 2VE8A 4L5JA 4QLCU 1O7LA 2V1UA 3LNQA 1T95A 4BXUA 1VQ7I 4GRIA 1HOMA 4PJJA 2OAZA 4EATA 1GT0C 4BS9A 1KQ8A 3AG2H 1OCZH 2OQRA 2YU9J 3EUAA 3GTJJ 4MFDA 1XSDA 2K3FA 3WGHA 2PMUA 1XGSA 2LY1A 4EEFG 3K4CA 2LH9A 1MNEA 5LHIA 3H0GJ 2RVCA 5EEHA 3E6MA 3EUKL 3CDHA 1CQTA 4OIPF 5ICCA 4IZZA 3IUOA 5AONA 1TWCJ 3P5JA 1IDZA 3LMMA 3HHGA 2LP0A 3ZOBA 2DTZA 4M72A 1K6OA 1I50J 5J8FA 2FRHA 2XAUA 4ZYEA 1Z1DA 2JRMA 1X1CA 3S15J 4ANJA 1RZ4A 3DV8A 3WG7H 1V5GA 2ZB9A 2CQQA 3HOSA 4HBLA 2Q8KA 2HU9A 1KU9A 3J81K 1QZZA 3OIOA 4WF2A 2VQGA 2IPQX 1D1BA 2JWTA 4AWXB 2CUJA 4AIJA 2CV1A 2YU3A 3CUQC 3R4KA 4A3LJ 1LUJB 2TRTA 3HOTA 3PM1A 4X1EA 2K5CA 1OQYA 4S0HB 1HQCA 1TT0A 1F1ZA 2HWVA 4JX5A 3KFWX 2NOGA 5ICFA 3TQNA 4A0ZA 4XSZF 4WX9A 3H5AA 4BNCA 3D5LA 5KK1A 4ZZLA 4BU2A 3L2VA 2IA1A 3PFYA 3CDIA 2YSRA 1MW7A 1BI3A 3HBLA 2ELJA 2KMUA 1K6YA 1FIPA 3VYTB 4CCOA 2ZXJA 3PNYA 4U0YA 2Y9ZA 2CYYA 3DKXA 5A2QZ 3TGNA 2LF7A 1D0YA 2XAHA 1FY7A 1P92A 4G12A 5DYMA 2BY0A 4U0WA 4KNYA 2MW8A 2Z16A 4BXXJ 1EH7A 1U8RA 1UHSA 1ETOA 3CZ6A 1SFXA 3QPHA 4M9SA 1VQ9I 1SFKA 4PJLA 1WGXA 5TGTA 1O3SA 1BIAA 1NG6A 2FU4A 3DXJF 4L9TA 2Z2SB 3MWMA 3IH2A 1X4PA 4A3CJ 3H3ZA 5GPCA 2VQLA 4Y13A 4E7JA 1WZ2A 5K7ZA 4Y17A 2LOOA 2O3FA 3OSFA 4IF4A 1ZG3A 4GDFA 3O8GA 1BA5A 2BEOA 3CP2A 2GAUA 2FOKA 4KIGA 1ZELA 4JX4A 1JGSA 2X51A 3S2WA 3HL2A 3OL4A 5JFRA 1H89C 3LL7A 3VYRB 4CICA 4LFUA 4PK4A 1LQ1A 2XKOA 3KEQA 2BOLA 2EIKH 2NVYJ 1EV7A 1Z21A 4M6XA 1KA8A 2PJPA 4XSXF 2W00A 3I4NJ 2ZJRF 5ILSA 4A3BJ 2VC1A 4I09A 1FTTA 1ZRFA 3BG9A 4Q47A 3ZRGA 3I56I 2BGCA 5J4YA 4C3IJ 3F8NA 4WK8F 2CV0A 3AL0B 3T0YA 5IP6A 1R22A 1UB9A 3MKYB 4OAZA 2ID3A 2AHQA 2G0EA 4WXDA 3FXLA 2MG4A 2KIMA 4MNUA
chains in the Genus database with same CATH topology
3LQRA 2ISZA 2D1HA 5BMZA 4HZFA 5E20A 4LLLA 4KDPA 3JW4A 5F1RA 3Q5FA 3MFKA 2R3SA 1DPRA 2X4HA 1RUOA 1FBUA 1XGNA 2FF4A 2FA5A 2FSWA 3O2PE 1CF7A 1GHCA 3WTYC 2DTRA 4U88A 2XVCA 5H20A 1U3EM 1SD6A 1F5TA 3P9CA 3LAJA 2H6CA 2MH9A 1HXDA 2QLZA 1OYYA 4BYYA 4RGSA 2MBFA 3K2ZA 2XAQA 2ACJA 3ZMVA 1IN7A 2NYXA 3DPTA 2VODA 4KN7X 3ROUA 1LDJA 3GLXA 5BS6A 4A6DA 2IRFG 5ILUA 3FXUA 3TOAA 4CXFA 2OU2A 3AAFA 1XGMA 1H9GA 2A68F 2UXXA 2J5OA 4G7OF 5HS8A 2COMA 2L4AA 3CO7C 3VEPA 3HUGA 3WTTC 2A3SA 3TDZC 4ENKA 1DDNA 5HDNA 5DV5A 2B0LA 4L0YB 5HLGA 1YLFA 1SMTA 3KP3A 4YFXF 4KMUX 1J5YA 4G7HF 4MTEA 3M8EA 2X0LA 2MLKA 4P55A 2EFOA 2QENA 5DD8A 2GQQA 1IXRC 3I58A 2IA0A 3ZMUA 4YIIA 5FLXZ 2ESNA 1I27A 1SAXA 3DFGA 3KP2A 3KZYA 2EJRA 1STZA 2KJBA 3BY6A 4LGWA 1B1BA 2ZBKA 3RKWA 1VTNC 1E17A 1FPQA 1ZG5A 3F8FA 2JT1A 2IP2A 3IWFA 1R1VA 4KIFA 1IUYA 2DO7A 4MEYF 4KA4A 4NQWA 3D0SA 4OMZA 5E1WA 3IKVA 1YW9A 2PI0A 3OOPA 3SZTA 2F5CA 1PUEE 5HLIA 3GYHX 2D1VA 2H6BA 2A69F 4GXOA 3I64A 2YPRA 4WWCA 3I5UA 4I02A 3T8RA 1MKMA 4ZYDA 4BAYA 3F8BA 1GVJA 4Q5SF 2ZJ2A 4MGRA 2HTJA 5LEKA 3G73A 3CO6C 4Q4ZF 3N4MA 5BPIA 3CUQA 3HIFA 4HA8A 4G6QA 4EM1A 4CGZA 1HKSA 2A6EF 5D6FA 2QYOA 1P4XA 2ESHA 3JTGA 3KP7A 1P4AA 4ZYGA 5BPDA 1WRJA 2W24A 3BZ6A 2HQNA 5JI6A 2PG4A 3V7RA 1O3QA 2HOEA 3KP4A 3R6SA 4TV7A 4RB2C 4ASNA 3P7NA 1YS7A 4KUMA 2CSOA 2P7CB 4AIKA 2H09A 2D45A 2DLLA 3ZMSA 1XSXA 2EV5A 1FP2A 4JQFA 2ETHA 5E8IA 1G4DA 4OMYA 3DF8A 2QVOA 2WTEA 2PBIA 2QUFA 3RKXA 2HYGD 3GEZA 1BI0A 1XMKA 2V6CA 4EMSA 3QP5A 2XAGA 1G3SA 5L3BA 1J7KA 4Q48A 5JHUA 1FWZA 2MA3A 4PGGA 1AWCA 5CYVA 3EYYA 5DCMB 4AIHA 1USSA 5DDGA 3V7CA 2O0YA 2DK5A 4LJZF 3CJNA 2P7VB 1QQIA 3I0TA 2Y0MA 2DBBA 1ONVA 3J80Z 1W5TA 1FT9A 1W5SA 2FBIA 1LB2A 5D8KB 2GWRA 5LEJA 4A5NA 1P4WA 1K78A 1U6GA 2CWEA 3IWZA 2VXZA 1RUNA 1ZHFA 3MQ0A 1FYMA 1ZRDA 3BROA 3L00A 3CLOA 1S3JA 5A2QK 4A6EA 5IT9Z 2G7HA 4HYEA 1SFUA 5LGTA 1QGPA 2ZMEA 4M74A 3QP6A 3VFZA 2WWYA 1R7JA 1WQ2A 2XIGA 5HLHA 2XRNA 3E6BA 3BOQA 4WXCA 1I1SA 4N9IA 1R00A 4RB1A 1IZ1A 3EETA 3W6KB 1U78A 1UCRA 3V8LA 1XB4A 4K2EA 3SHFA 3K9TA 3R61A 2RC4A 2F5DA 1T2KA 2VBXA 4ESBA 2XAJA 4PCQA 4S04A 3FMQA 1OYIA 2DK8A 4R1HA 2Z33A 2QBYB 3HRTA 1YW8A 4BHCA 4IXAA 2HTSA 4ETSA 5D5UB 3B02A 1MJ9A 2G7UA 1XCBA 3HYIA 1V4RA 1LVAA 2ZNZA 4A5MA 4OINF 3E5UA 3GW2A 4MEXF 4RS8A 2MC3A 5HVQC 1QPMA 1DUXC 2RDPA 3E6DA 3JSOA 2EV0A 2RKHA 3I59A 5LHGA 4BHBA 1I1GA 1BI1A 4EJTA 3HTUA 5ICGA 5CVUA 2D2WA 3W6JB 2BBYA 1PP7U 2XAFA 2K7LA 1TLHB 3R60A 2QWWA 4L18B 3ULQB 4B09A 1Z6TA 3ZQ7A 4NHJA 2UZKA 1T39A 3WTVC 1ZLJA 4BHPA 2ZKZA 5DUIA 4U7DA 1SFEA 5H6RA 4JBAA 1H0MA 1NHAA 4EJVA 1O3RA 1B9NA 5D5WB 5L3FA 1J75A 2HDCA 1EH6A 2VBYA 2CG4A 2EFNA 1KU2A 1RI7A 1YIOA 1BI2A 2GIVA 3RPQA 2OD5A 1S7OA 5CVJA 5K5RA 4A2UA 4QWQA 1MDMA 5IT3A 2HEOA 2EFWA 3J7AO 4ON0A 4HF2A 3TDUC 4HDUA 2CFXA 3ELKA 4XBFA 1QZYA 3I54A 1FBSA 1MGTA 2FMLA 3GZ5A 3F6VA 3H3UA 2NS0A 2KIUA 2ZFWA 3DKWA 2V79A 2DFIA 4ESJA 2GXGA 2P5KA 2J5PA 3ECHA 3B73A 1TNSA 3HRSA 2Z5UA 1SD5A 4R8HA 1FP1D 3TOBA 2F5FA 2Z3YA 1LEAA 5DCFA 1FOKA 2NRAC 2W85A 1ZAOA 2UWMA 5FLXK 4RGUA 2O8XA 3WG9A 2OQGA 4EGZA 4IPAA 2Z99A 4MHGA 4P5OA 2CGPA 2EWNA 3SZPA 1USTA 2W57A 5KVRA 3BJAA 4HX8A 2STTA 4HF1A 4AVPA 5LBQA 1W7PD 2EFQA 1X3UA 1IAWA 1HW1A 5HS9A 2VC0A 4M71A 5L3GA 5ED4A 1YFHA 2M87A 4P9UA 4IRHA 4EQQA 1GXQA 1FBQA 1FNNA 4LG0A 2L3DA 2JTVA 4KIBA 5BQTA 1IF1A 5AIQA 5CLSA 5F64A 3LA3A 2P5VA 4GYIA 3ISPA 3ABUA 4RAYA 3WTSC 1YO5C 1MD0A 3DEUA 3BJ6A 2CW0F 5K5QA 2IA2A 2HFHA 3WU0A 1REPC 4KFCA 2P6SA 2O61A 3V4GA 3LA2A 4FHTA 5E1ZB 1K79A 1IN8A 2DI3A 2BYVE 3F6OA 3HRUA 5D5VB 1DPUA 1YG2A 4EJUA 2NNNA 4HOBA 3HRMA 4B8XA 4I2OA 3GF2A 2QQ9A 4F7ZA 2V1DA 1W7PA 1JE8A 1XD7A 3J80K 2G9WA 2XASA 1D3YA 3GZ6A 3F8CA 2HR3A 2P8TA 3GUDA 3ZP5A 2NAZA 4M9XA 4R79A 4MTDA 2WV0A 2A5YB 4N0BA 4JK1X 2VOOA 1UHMA 1S7AA 4LB6B 5IT9K 5ICEA 3ZMDA 2FNPA 3BPXA 3L9FA 3M1EA 2DPUA 1IW7F 3KEOA 1G6NA 1KYZA 1ZG1A 3ZMZA 1IN4A 4IHSA 1ZGJA 1I5ZA 2P5LC 2M5WA 1SD4A 5TRDA 3V8JA 4G6DA 4I98B 1J59A 2L4MA 4IVNA 4RGRA 3N97A 3BJOA 2L02A 3HTSB 2O03A 3GFJA 3BP8A 4IHTA 1G3WA 1SMYF 1ZYRF 3ZMTA 2JPCA 1ZARA 3RIRA 2EFPA 4HLYA 1FX7A 5HDKA 1IRGA 3JAMZ 3WU1B 5D8LB 1R1UA 3K1PA 1HW2A 1ZREA 3P9KA 2FEZA 3U1DA 1YQAA 2VT3A 2Q0OA 3FMSA 3IRRA 3GFIA 2HKOA 4IJAA 3GXOA 4AD9A 1S8NA 2QQAA 4WCGA 4L0ZB 4G8XA 4BH9A 3DQVC 4I7HA 4UVAA 1G3TA 1XGOA 3EDPA 3C18A 1Y0UA 5JR3A 2GXBA 3EUHA 4ESFA 3KLNA 6PAXA 3KLOA 3FZVA 4OOIA 3HHHA 3ZPLA 3SQNA 2IVMA 1P6RA 3HSFA 3ML6A 2YR2A 2QZ8A 1TQIA 1XSVA 2MLGA 1TW3A 4UVBA 1GXPA 2YX7A 3F8MA 4U7BA 1FSEA 4ENMA 2WC2A 1SD7A 2ISYA 2K4JA 3L7WA 1HBXG 3ECOA 5JVTA 3RKYA 4UNOA 4YIFA 3QPTA 1CF7B 5FO5A 3VODA 1WWXA 4OIRF 3E5XA 4O5VA 3IRQA 2DU9A 2KKOA 3LSTA 1ZLKA 3KP5A 2FMYA 3REOA 3KCCA 5DD4A 4EGYA 1LDDA 1QO0D 1IRFA 3GVAA 2K02A 3QU3A 1WI9A 2ZNYA 1MJBA 1MZBA 2RGVA 1KQ0A 4IRGA 3K0LA 2JRTA 3CTAA 4ZZDA 1KQ9A 3TKYA 3V8KA 1HKQA 4LB5A 3DP7A 1LDKB 4GO1A 2KJCA 1DP7P 1ON2A 1P2FA 4GYGA 2AXLA 2TDXA 3JTHA 3SXYA 5FB2A 3R0JA 3EQLF 1OMIA 3FWEA 4I0BA 5K5OA 1Z9CA 5K1YA 3NEUA 1YS6A 2F2EA 2PLYA 1T0FA 3MCZA 4M6YA 3RYRA 3BPVA 2E7XA 1F4KA 1LNWA 4P9FA 4HV6A 3TO6A 3ZN1A 2DAOA 1FLIA 5LGNA 1TQPA 3PQJA 4XLNF 1HW5A 1V3FA 1T38A 1OKRA 3F22A 5FGMA 3ABTA 4HLXA 4YG2F 2FQ3A 4EV0A 1OPCA 4CYDA 3ZN0A 4EVIA 2OZ6A 5ERIA 4EJWA 5D6EA 1XDUA 2LKPA 4U0VA 1ZH5A 3PQKA 3FXQA 1B4AA 3CUQB 3IL2A 3F72A 3RI4A 1MJAA 2HKXA 1ZGAA 3T5XA 2XKPA 3HSRA 1BC7C 3IHUA 5D4RA 3U9GA 1IN6A 1U5TB 1YTYA 2F5EA 5FD6A 2K86A 2PQ8A 2XV4S 3I53A 2LF8A 1LJ9A 3WE3A 4LMYA 3M9AA 5CVIA 5E8GA 5E18F 3C7JA 1O57A 4L9JA 1H9TA 3FHZA 1R5HA 4FX4A 1ODDA 5FFZA 2C6YA 4PZJA 2W25A 2EV6A 1TQMA 2IT0A 4YFKF 4DQ2A 2LDUA 1CGPA 2P4WA 2ADUA 5L3EA 5EEGA 3GFMA 1R1TA 2VE9A 2IW5A 1O3TA 1C0WA 1BJAA 5BOXA 3H92A 1S29A 3E3VA 4MQVA 1TW2A 4P96A 1BM9A 2GA1A 1YW7A 1K78B 2RNJA 3O3KA 4G9YA 4EJOA 1U5TC 3FF5A 1T6SA 4HV5A 4M9ZA 1KYWA 2FNAA 4CO8A 2RV8A 1O7FA 2ZMEB 4EM2A 1FZPB 1L3LA 2E1NA 4OU0A 1XDSA 5AIPA 3Q9SA 4IRIA 2VONA 4LLGF 3P9IA 2LNBA 4UXNA 1BC8C 1Z6RA 2DT5A 2XGXA 1T98A 1IXCA 1TBXA 3GO5A 4HDVA 3PFIA 3JAMK 3RYPA 1Z05A 3QOPA 1ZN2A 2Z9OA 1F9NA 1ON1A 3V7SA 1XMAA 4M73A 2H94A 3WODF 1KU7A 3WTZA 1S6LA 3T8TA 2PEXA 3IC7A 1Z91A 2MD5A 4KICA 2PN6A 2VBZA 2KRFA 3C3WA 2DQRA 5LHHA 4A0YA 4I0AA 3IKTA 1YYVA 2HYFA 2M1BA 4ZH4F 3FM5A 4RB0A 2PMHA 4NB5A 2P6TA 5DUKA 4D0PA 1JHFA 4HW0A 4LK0F 1XN7A 2M45A 2EK5A 1D5VA 1OR7A 3RTRA 3K1NA 3KP6A 3I59B 3FX3A 3OV8A 4E70A 3LA7A 3I4PA 2V9VA 2GA2A 5DCMA 2FBHA 2DQLA 4HAMA 3WTUC 1J0RA 4G94A 5LLQA 4EM0B 2XHKA 3RDIA 3HSEA 5TJJA 4HX7A 3EYIA 3U2RA 3J81Z 2M30A 4MQ9F 4FX0A 4KN4X 3RJPA 2FE3A 2OBPA 4LLNA 2KIFA 1AOYA 1A04A 2A61A 1KGSA 1KU3A 2Q2EA 2R7FA 3MZYA 2STWA 5HS7A 1E2XA 4CDGA 2QQBA 2HQRA 3SFZA 2EA2A 3TO7A 4UUVA 4L9NA 1LEBA 5L3CA 5DEQA 3KETA 1MDMB 2VOPA 2CQKA 3MZHA 2JPBA 5D4SA 5LRSA 5LGUA 3LFKA 2K4BA 5L3DA 3F23A 1R23A 3COAC 3F21A 4XRFA 2ZCWA 1B59A 3QU6A 4N9HA 2V1XA 1EH8A 1I6XA 5D5XB 4PGHA 3L09A 3WE2A 4OIQF 2XUBA 2E7WA 4BQAA 1JXSA 3BDDA 4KT5C 4KMFA 4Z2YA 4S05A 3LWFA 2HS5A 3T1BA 4OIOF 4DNCA 4ENJA 2QBYA 1W4MA 2A07F 3L2CA 4UV8A 4ENNA 3M8FA 1BIBA 3I71A 2Y75A 3E97A 3O6BB 4PDKA 4UVCA 2FXAA 4YFNF 2R7DA 4L9VA 3VOEA 2VT2A 1BN5A 1IN5A 4A0XA 4GCVA 2LSOA 4KYWA 3QRFF 4GGGA 3DPLC 4O3MA 3MEXA 4RB3C 3RPUA 5FFXA 2Y48A 3WTXC 2RQPA 5E1XA 4XLPF 1Z7UA 5CVVA 1HSJA 1R36A 1D8KA 4HF0A 2DW4A 3C1DA 2DPDA 4A12A 4RGXA 3GWZA 3Q9VA 4LG0B 3E6CC 2GZWA 1HKTA 2A6HF 1RNLA 1B6AA 5ILVA 3R0AA 5E17F 1U5TA 1JHHA 4CZZA 1XCVA 1PDNC 5CJ9A 2EB7A 3WGIA 5H6QA 1R58A 4G7ZF 3FMRA 1B9MA 4LD5A 1L0OC 2HZTA 2L01A 1QBJA 2OA4A 3LQQA 1RIOH 2W84A 2QM3A 2L54A 3K1MA 4H0EA 3GFLA 2ELHA 1UFMA 1TNTA 4ZYHA 1BBYA 5FD5A 4O6JA 1WSUA 2BV6A 4WXHA 2RN7A 1TTYA 3QAHA 1U2WA 5CVRA 2O6GE 2E1CA 5HDGA 3CUOA 1WKMA 5J6XA 2CO5A 2EA4A 3F3XA 1OYWA 3LAPA 2OZUA 1IXSB 1W7PB 1ULYA 1D8JA 1K7AA 2H27A 4UV9A 2BE5F 3BWGA 5HOOA 1HSTA 4RAZA 3NRVA 2YX4A 3JSPA 4L5IA 4Y15A 2PFBA 2K27A 1FSHA 3VB2A 2M8EA 3WGGA 3GX4X 2MH2A 3FM3A 2JZYA 4UHTA 3ERED 4HQEA 4HQMA 1BOAA 2NNYA 3TO9A 3G3ZA 3NQOA 2ZO4A 2IJLA 1FYLA 1UHWA 3MAJA 2VN2A 1Q1HA 2HGCA 4I01A 1PP8F 3KE2A 2VBWA 4CHUA 1G3YA 5F6FA 3KZZA 2UXNA 4HX4A 2FBKA 1ZRCA 1R5GA 2AS5F 4LK1F 3M7GA 2XROA 3K69A 3WTWC 1J2XA 3FXRA 1J9IA 2JSCA 5LRRA 1QNTA 4FT8A 1FC3A 3E5QA 5J8CA 1FYKA 2VE8A 4L5JA 4QLCU 1O7LA 2V1UA 4BXUA 2OAZA 1KQ8A 2OQRA 1XSDA 3WGHA 2PMUA 1XGSA 5LHIA 2RVCA 5EEHA 3E6MA 3CDHA 4OIPF 5ICCA 5AONA 3HHGA 4M72A 1K6OA 5J8FA 2FRHA 4ZYEA 1Z1DA 1RZ4A 3DV8A 3HOSA 4HBLA 2Q8KA 1KU9A 3J81K 1QZZA 4WF2A 2IPQX 4AWXB 4AIJA 2YU3A 3CUQC 3R4KA 3HOTA 1HQCA 1F1ZA 2HWVA 3KFWX 5ICFA 3TQNA 4A0ZA 4XSZF 4WX9A 4BNCA 3D5LA 5KK1A 4ZZLA 2IA1A 2YSRA 1BI3A 2ZXJA 4U0YA 2CYYA 5A2QZ 3TGNA 2LF7A 2XAHA 1FY7A 1P92A 5DYMA 4KNYA 4U0WA 1EH7A 1U8RA 1SFXA 3QPHA 4M9SA 1O3SA 1BIAA 2FU4A 3DXJF 4L9TA 3MWMA 3H3ZA 4Y13A 4Y17A 2O3FA 4IF4A 1ZG3A 2BEOA 2GAUA 2FOKA 4KIGA 1JGSA 3S2WA 5JFRA 4CICA 4LFUA 1LQ1A 2XKOA 3KEQA 4M6XA 1EV7A 1KA8A 2PJPA 4XSXF 5ILSA 2VC1A 4I09A 1ZRFA 4Q47A 2BGCA 3F8NA 4WK8F 3T0YA 1R22A 1UB9A 4WXDA 2KIMA 4MNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQR A;  2ISZ A;  2D1H A;  5BMZ A;  4HZF A;  5E20 A;  4LLL A;  4KDP A;  3JW4 A;  5F1R A;  3Q5F A;  3MFK A;  2R3S A;  1DPR A;  2X4H A;  1RUO A;  1FBU A;  1XGN A;  2FF4 A;  2FA5 A;  2FSW A;  3O2P E;  1CF7 A;  1GHC A;  3WTY C;  2DTR A;  4U88 A;  2XVC A;  5H20 A;  1U3E M;  1SD6 A;  1F5T A;  3P9C A;  3LAJ A;  2H6C A;  2MH9 A;  1HXD A;  2QLZ A;  1OYY A;  4BYY A;  4RGS A;  2MBF A;  3K2Z A;  2XAQ A;  2ACJ A;  3ZMV A;  1IN7 A;  2NYX A;  3DPT A;  2VOD A;  4KN7 X;  3ROU A;  1LDJ A;  3GLX A;  5BS6 A;  4A6D A;  2IRF G;  5ILU A;  3FXU A;  3TOA A;  4CXF A;  2OU2 A;  3AAF A;  1XGM A;  1H9G A;  2A68 F;  2UXX A;  2J5O A;  4G7O F;  5HS8 A;  2COM A;  2L4A A;  3CO7 C;  3VEP A;  3HUG A;  3WTT C;  2A3S A;  3TDZ C;  4ENK A;  1DDN A;  5HDN A;  5DV5 A;  2B0L A;  4L0Y B;  5HLG A;  1YLF A;  1SMT A;  3KP3 A;  4YFX F;  4KMU X;  1J5Y A;  4G7H F;  4MTE A;  3M8E A;  2X0L A;  2MLK A;  4P55 A;  2EFO A;  2QEN A;  5DD8 A;  2GQQ A;  1IXR C;  3I58 A;  2IA0 A;  3ZMU A;  4YII A;  5FLX Z;  2ESN A;  1I27 A;  1SAX A;  3DFG A;  3KP2 A;  3KZY A;  2EJR A;  1STZ A;  2KJB A;  3BY6 A;  4LGW A;  1B1B A;  2ZBK A;  3RKW A;  1VTN C;  1E17 A;  1FPQ A;  1ZG5 A;  3F8F A;  2JT1 A;  2IP2 A;  3IWF A;  1R1V A;  4KIF A;  1IUY A;  2DO7 A;  4MEY F;  4KA4 A;  4NQW A;  3D0S A;  4OMZ A;  5E1W A;  3IKV A;  1YW9 A;  2PI0 A;  3OOP A;  3SZT A;  2F5C A;  1PUE E;  5HLI A;  3GYH X;  2D1V A;  2H6B A;  2A69 F;  4GXO A;  3I64 A;  2YPR A;  4WWC A;  3I5U A;  4I02 A;  3T8R A;  1MKM A;  4ZYD A;  4BAY A;  3F8B A;  1GVJ A;  4Q5S F;  2ZJ2 A;  4MGR A;  2HTJ A;  5LEK A;  3G73 A;  3CO6 C;  4Q4Z F;  3N4M A;  5BPI A;  3CUQ A;  3HIF A;  4HA8 A;  4G6Q A;  4EM1 A;  4CGZ A;  1HKS A;  2A6E F;  5D6F A;  2QYO A;  1P4X A;  2ESH A;  3JTG A;  3KP7 A;  1P4A A;  4ZYG A;  5BPD A;  1WRJ A;  2W24 A;  3BZ6 A;  2HQN A;  5JI6 A;  2PG4 A;  3V7R A;  1O3Q A;  2HOE A;  3KP4 A;  3R6S A;  4TV7 A;  4RB2 C;  4ASN A;  3P7N A;  1YS7 A;  4KUM A;  2CSO A;  2P7C B;  4AIK A;  2H09 A;  2D45 A;  2DLL A;  3ZMS A;  1XSX A;  2EV5 A;  1FP2 A;  4JQF A;  2ETH A;  5E8I A;  1G4D A;  4OMY A;  3DF8 A;  2QVO A;  2WTE A;  2PBI A;  2QUF A;  3RKX A;  2HYG D;  3GEZ A;  1BI0 A;  1XMK A;  2V6C A;  4EMS A;  3QP5 A;  2XAG A;  1G3S A;  5L3B A;  1J7K A;  4Q48 A;  5JHU A;  1FWZ A;  2MA3 A;  4PGG A;  1AWC A;  5CYV A;  3EYY A;  5DCM B;  4AIH A;  1USS A;  5DDG A;  3V7C A;  2O0Y A;  2DK5 A;  4LJZ F;  3CJN A;  2P7V B;  1QQI A;  3I0T A;  2Y0M A;  2DBB A;  1ONV A;  3J80 Z;  1W5T A;  1FT9 A;  1W5S A;  2FBI A;  1LB2 A;  5D8K B;  2GWR A;  5LEJ A;  4A5N A;  1P4W A;  1K78 A;  1U6G A;  2CWE A;  3IWZ A;  2VXZ A;  1RUN A;  1ZHF A;  3MQ0 A;  1FYM A;  1ZRD A;  3BRO A;  3L00 A;  3CLO A;  1S3J A;  5A2Q K;  4A6E A;  5IT9 Z;  2G7H A;  4HYE A;  1SFU A;  5LGT A;  1QGP A;  2ZME A;  4M74 A;  3QP6 A;  3VFZ A;  2WWY A;  1R7J A;  1WQ2 A;  2XIG A;  5HLH A;  2XRN A;  3E6B A;  3BOQ A;  4WXC A;  1I1S A;  4N9I A;  1R00 A;  4RB1 A;  1IZ1 A;  3EET A;  3W6K B;  1U78 A;  1UCR A;  3V8L A;  1XB4 A;  4K2E A;  3SHF A;  3K9T A;  3R61 A;  2RC4 A;  2F5D A;  1T2K A;  2VBX A;  4ESB A;  2XAJ A;  4PCQ A;  4S04 A;  3FMQ A;  1OYI A;  2DK8 A;  4R1H A;  2Z33 A;  2QBY B;  3HRT A;  1YW8 A;  4BHC A;  4IXA A;  2HTS A;  4ETS A;  5D5U B;  3B02 A;  1MJ9 A;  2G7U A;  1XCB A;  3HYI A;  1V4R A;  1LVA A;  2ZNZ A;  4A5M A;  4OIN F;  3E5U A;  3GW2 A;  4MEX F;  4RS8 A;  2MC3 A;  5HVQ C;  1QPM A;  1DUX C;  2RDP A;  3E6D A;  3JSO A;  2EV0 A;  2RKH A;  3I59 A;  5LHG A;  4BHB A;  1I1G A;  1BI1 A;  4EJT A;  3HTU A;  5ICG A;  5CVU A;  2D2W A;  3W6J B;  2BBY A;  1PP7 U;  2XAF A;  2K7L A;  1TLH B;  3R60 A;  2QWW A;  4L18 B;  3ULQ B;  4B09 A;  1Z6T A;  3ZQ7 A;  4NHJ A;  2UZK A;  1T39 A;  3WTV C;  1ZLJ A;  4BHP A;  2ZKZ A;  5DUI A;  4U7D A;  1SFE A;  5H6R A;  4JBA A;  1H0M A;  1NHA A;  4EJV A;  1O3R A;  1B9N A;  5D5W B;  5L3F A;  1J75 A;  2HDC A;  1EH6 A;  2VBY A;  2CG4 A;  2EFN A;  1KU2 A;  1RI7 A;  1YIO A;  1BI2 A;  2GIV A;  3RPQ A;  2OD5 A;  1S7O A;  5CVJ A;  5K5R A;  4A2U A;  4QWQ A;  1MDM A;  5IT3 A;  2HEO A;  2EFW A;  3J7A O;  4ON0 A;  4HF2 A;  3TDU C;  4HDU A;  2CFX A;  3ELK A;  4XBF A;  1QZY A;  3I54 A;  1FBS A;  1MGT A;  2FML A;  3GZ5 A;  3F6V A;  3H3U A;  2NS0 A;  2KIU A;  2ZFW A;  3DKW A;  2V79 A;  2DFI A;  4ESJ A;  2GXG A;  2P5K A;  2J5P A;  3ECH A;  3B73 A;  1TNS A;  3HRS A;  2Z5U A;  1SD5 A;  4R8H A;  1FP1 D;  3TOB A;  2F5F A;  2Z3Y A;  1LEA A;  5DCF A;  1FOK A;  2NRA C;  2W85 A;  1ZAO A;  2UWM A;  5FLX K;  4RGU A;  2O8X A;  3WG9 A;  2OQG A;  4EGZ A;  4IPA A;  2Z99 A;  4MHG A;  4P5O A;  2CGP A;  2EWN A;  3SZP A;  1UST A;  2W57 A;  5KVR A;  3BJA A;  4HX8 A;  2STT A;  4HF1 A;  4AVP A;  5LBQ A;  1W7P D;  2EFQ A;  1X3U A;  1IAW A;  1HW1 A;  5HS9 A;  2VC0 A;  4M71 A;  5L3G A;  5ED4 A;  1YFH A;  2M87 A;  4P9U A;  4IRH A;  4EQQ A;  1GXQ A;  1FBQ A;  1FNN A;  4LG0 A;  2L3D A;  2JTV A;  4KIB A;  5BQT A;  1IF1 A;  5AIQ A;  5CLS A;  5F64 A;  3LA3 A;  2P5V A;  4GYI A;  3ISP A;  3ABU A;  4RAY A;  3WTS C;  1YO5 C;  1MD0 A;  3DEU A;  3BJ6 A;  2CW0 F;  5K5Q A;  2IA2 A;  2HFH A;  3WU0 A;  1REP C;  4KFC A;  2P6S A;  2O61 A;  3V4G A;  3LA2 A;  4FHT A;  5E1Z B;  1K79 A;  1IN8 A;  2DI3 A;  2BYV E;  3F6O A;  3HRU A;  5D5V B;  1DPU A;  1YG2 A;  4EJU A;  2NNN A;  4HOB A;  3HRM A;  4B8X A;  4I2O A;  3GF2 A;  2QQ9 A;  4F7Z A;  2V1D A;  1W7P A;  1JE8 A;  1XD7 A;  3J80 K;  2G9W A;  2XAS A;  1D3Y A;  3GZ6 A;  3F8C A;  2HR3 A;  2P8T A;  3GUD A;  3ZP5 A;  2NAZ A;  4M9X A;  4R79 A;  4MTD A;  2WV0 A;  2A5Y B;  4N0B A;  4JK1 X;  2VOO A;  1UHM A;  1S7A A;  4LB6 B;  5IT9 K;  5ICE A;  3ZMD A;  2FNP A;  3BPX A;  3L9F A;  3M1E A;  2DPU A;  1IW7 F;  3KEO A;  1G6N A;  1KYZ A;  1ZG1 A;  3ZMZ A;  1IN4 A;  4IHS A;  1ZGJ A;  1I5Z A;  2P5L C;  2M5W A;  1SD4 A;  5TRD A;  3V8J A;  4G6D A;  4I98 B;  1J59 A;  2L4M A;  4IVN A;  4RGR A;  3N97 A;  3BJO A;  2L02 A;  3HTS B;  2O03 A;  3GFJ A;  3BP8 A;  4IHT A;  1G3W A;  1SMY F;  1ZYR F;  3ZMT A;  2JPC A;  1ZAR A;  3RIR A;  2EFP A;  4HLY A;  1FX7 A;  5HDK A;  1IRG A;  3JAM Z;  3WU1 B;  5D8L B;  1R1U A;  3K1P A;  1HW2 A;  1ZRE A;  3P9K A;  2FEZ A;  3U1D A;  1YQA A;  2VT3 A;  2Q0O A;  3FMS A;  3IRR A;  3GFI A;  2HKO A;  4IJA A;  3GXO A;  4AD9 A;  1S8N A;  2QQA A;  4WCG A;  4L0Z B;  4G8X A;  4BH9 A;  3DQV C;  4I7H A;  4UVA A;  1G3T A;  1XGO A;  3EDP A;  3C18 A;  1Y0U A;  5JR3 A;  2GXB A;  3EUH A;  4ESF A;  3KLN A;  6PAX A;  3KLO A;  3FZV A;  4OOI A;  3HHH A;  3ZPL A;  3SQN A;  2IVM A;  1P6R A;  3HSF A;  3ML6 A;  2YR2 A;  2QZ8 A;  1TQI A;  1XSV A;  2MLG A;  1TW3 A;  4UVB A;  1GXP A;  2YX7 A;  3F8M A;  4U7B A;  1FSE A;  4ENM A;  2WC2 A;  1SD7 A;  2ISY A;  2K4J A;  3L7W A;  1HBX G;  3ECO A;  5JVT A;  3RKY A;  4UNO A;  4YIF A;  3QPT A;  1CF7 B;  5FO5 A;  3VOD A;  1WWX A;  4OIR F;  3E5X A;  4O5V A;  3IRQ A;  2DU9 A;  2KKO A;  3LST A;  1ZLK A;  3KP5 A;  2FMY A;  3REO A;  3KCC A;  5DD4 A;  4EGY A;  1LDD A;  1QO0 D;  1IRF A;  3GVA A;  2K02 A;  3QU3 A;  1WI9 A;  2ZNY A;  1MJB A;  1MZB A;  2RGV A;  1KQ0 A;  4IRG A;  3K0L A;  2JRT A;  3CTA A;  4ZZD A;  1KQ9 A;  3TKY A;  3V8K A;  1HKQ A;  4LB5 A;  3DP7 A;  1LDK B;  4GO1 A;  2KJC A;  1DP7 P;  1ON2 A;  1P2F A;  4GYG A;  2AXL A;  2TDX A;  3JTH A;  3SXY A;  5FB2 A;  3R0J A;  3EQL F;  1OMI A;  3FWE A;  4I0B A;  5K5O A;  1Z9C A;  5K1Y A;  3NEU A;  1YS6 A;  2F2E A;  2PLY A;  1T0F A;  3MCZ A;  4M6Y A;  3RYR A;  3BPV A;  2E7X A;  1F4K A;  1LNW A;  4P9F A;  4HV6 A;  3TO6 A;  3ZN1 A;  2DAO A;  1FLI A;  5LGN A;  1TQP A;  3PQJ A;  4XLN F;  1HW5 A;  1V3F A;  1T38 A;  1OKR A;  3F22 A;  5FGM A;  3ABT A;  4HLX A;  4YG2 F;  2FQ3 A;  4EV0 A;  1OPC A;  4CYD A;  3ZN0 A;  4EVI A;  2OZ6 A;  5ERI A;  4EJW A;  5D6E A;  1XDU A;  2LKP A;  4U0V A;  1ZH5 A;  3PQK A;  3FXQ A;  1B4A A;  3CUQ B;  3IL2 A;  3F72 A;  3RI4 A;  1MJA A;  2HKX A;  1ZGA A;  3T5X A;  2XKP A;  3HSR A;  1BC7 C;  3IHU A;  5D4R A;  3U9G A;  1IN6 A;  1U5T B;  1YTY A;  2F5E A;  5FD6 A;  2K86 A;  2PQ8 A;  2XV4 S;  3I53 A;  2LF8 A;  1LJ9 A;  3WE3 A;  4LMY A;  3M9A A;  5CVI A;  5E8G A;  5E18 F;  3C7J A;  1O57 A;  4L9J A;  1H9T A;  3FHZ A;  1R5H A;  4FX4 A;  1ODD A;  5FFZ A;  2C6Y A;  4PZJ A;  2W25 A;  2EV6 A;  1TQM A;  2IT0 A;  4YFK F;  4DQ2 A;  2LDU A;  1CGP A;  2P4W A;  2ADU A;  5L3E A;  5EEG A;  3GFM A;  1R1T A;  2VE9 A;  2IW5 A;  1O3T A;  1C0W A;  1BJA A;  5BOX A;  3H92 A;  1S29 A;  3E3V A;  4MQV A;  1TW2 A;  4P96 A;  1BM9 A;  2GA1 A;  1YW7 A;  1K78 B;  2RNJ A;  3O3K A;  4G9Y A;  4EJO A;  1U5T C;  3FF5 A;  1T6S A;  4HV5 A;  4M9Z A;  1KYW A;  2FNA A;  4CO8 A;  2RV8 A;  1O7F A;  2ZME B;  4EM2 A;  1FZP B;  1L3L A;  2E1N A;  4OU0 A;  1XDS A;  5AIP A;  3Q9S A;  4IRI A;  2VON A;  4LLG F;  3P9I A;  2LNB A;  4UXN A;  1BC8 C;  1Z6R A;  2DT5 A;  2XGX A;  1T98 A;  1IXC A;  1TBX A;  3GO5 A;  4HDV A;  3PFI A;  3JAM K;  3RYP A;  1Z05 A;  3QOP A;  1ZN2 A;  2Z9O A;  1F9N A;  1ON1 A;  3V7S A;  1XMA A;  4M73 A;  2H94 A;  3WOD F;  1KU7 A;  3WTZ A;  1S6L A;  3T8T A;  2PEX A;  3IC7 A;  1Z91 A;  2MD5 A;  4KIC A;  2PN6 A;  2VBZ A;  2KRF A;  3C3W A;  2DQR A;  5LHH A;  4A0Y A;  4I0A A;  3IKT A;  1YYV A;  2HYF A;  2M1B A;  4ZH4 F;  3FM5 A;  4RB0 A;  2PMH A;  4NB5 A;  2P6T A;  5DUK A;  4D0P A;  1JHF A;  4HW0 A;  4LK0 F;  1XN7 A;  2M45 A;  2EK5 A;  1D5V A;  1OR7 A;  3RTR A;  3K1N A;  3KP6 A;  3I59 B;  3FX3 A;  3OV8 A;  4E70 A;  3LA7 A;  3I4P A;  2V9V A;  2GA2 A;  5DCM A;  2FBH A;  2DQL A;  4HAM A;  3WTU C;  1J0R A;  4G94 A;  5LLQ A;  4EM0 B;  2XHK A;  3RDI A;  3HSE A;  5TJJ A;  4HX7 A;  3EYI A;  3U2R A;  3J81 Z;  2M30 A;  4MQ9 F;  4FX0 A;  4KN4 X;  3RJP A;  2FE3 A;  2OBP A;  4LLN A;  2KIF A;  1AOY A;  1A04 A;  2A61 A;  1KGS A;  1KU3 A;  2Q2E A;  2R7F A;  3MZY A;  2STW A;  5HS7 A;  1E2X A;  4CDG A;  2QQB A;  2HQR A;  3SFZ A;  2EA2 A;  3TO7 A;  4UUV A;  4L9N A;  1LEB A;  5L3C A;  5DEQ A;  3KET A;  1MDM B;  2VOP A;  2CQK A;  3MZH A;  2JPB A;  5D4S A;  5LRS A;  5LGU A;  3LFK A;  2K4B A;  5L3D A;  3F23 A;  1R23 A;  3COA C;  3F21 A;  4XRF A;  2ZCW A;  1B59 A;  3QU6 A;  4N9H A;  2V1X A;  1EH8 A;  1I6X A;  5D5X B;  4PGH A;  3L09 A;  3WE2 A;  4OIQ F;  2XUB A;  2E7W A;  4BQA A;  1JXS A;  3BDD A;  4KT5 C;  4KMF A;  4Z2Y A;  4S05 A;  3LWF A;  2HS5 A;  3T1B A;  4OIO F;  4DNC A;  4ENJ A;  2QBY A;  1W4M A;  2A07 F;  3L2C A;  4UV8 A;  4ENN A;  3M8F A;  1BIB A;  3I71 A;  2Y75 A;  3E97 A;  3O6B B;  4PDK A;  4UVC A;  2FXA A;  4YFN F;  2R7D A;  4L9V A;  3VOE A;  2VT2 A;  1BN5 A;  1IN5 A;  4A0X A;  4GCV A;  2LSO A;  4KYW A;  3QRF F;  4GGG A;  3DPL C;  4O3M A;  3MEX A;  4RB3 C;  3RPU A;  5FFX A;  2Y48 A;  3WTX C;  2RQP A;  5E1X A;  4XLP F;  1Z7U A;  5CVV A;  1HSJ A;  1R36 A;  1D8K A;  4HF0 A;  2DW4 A;  3C1D A;  2DPD A;  4A12 A;  4RGX A;  3GWZ A;  3Q9V A;  4LG0 B;  3E6C C;  2GZW A;  1HKT A;  2A6H F;  1RNL A;  1B6A A;  5ILV A;  3R0A A;  5E17 F;  1U5T A;  1JHH A;  4CZZ A;  1XCV A;  1PDN C;  5CJ9 A;  2EB7 A;  3WGI A;  5H6Q A;  1R58 A;  4G7Z F;  3FMR A;  1B9M A;  4LD5 A;  1L0O C;  2HZT A;  2L01 A;  1QBJ A;  2OA4 A;  3LQQ A;  1RIO H;  2W84 A;  2QM3 A;  2L54 A;  3K1M A;  4H0E A;  3GFL A;  2ELH A;  1UFM A;  1TNT A;  4ZYH A;  1BBY A;  5FD5 A;  4O6J A;  1WSU A;  2BV6 A;  4WXH A;  2RN7 A;  1TTY A;  3QAH A;  1U2W A;  5CVR A;  2O6G E;  2E1C A;  5HDG A;  3CUO A;  1WKM A;  5J6X A;  2CO5 A;  2EA4 A;  3F3X A;  1OYW A;  3LAP A;  2OZU A;  1IXS B;  1W7P B;  1ULY A;  1D8J A;  1K7A A;  2H27 A;  4UV9 A;  2BE5 F;  3BWG A;  5HOO A;  1HST A;  4RAZ A;  3NRV A;  2YX4 A;  3JSP A;  4L5I A;  4Y15 A;  2PFB A;  2K27 A;  1FSH A;  3VB2 A;  2M8E A;  3WGG A;  3GX4 X;  2MH2 A;  3FM3 A;  2JZY A;  4UHT A;  3ERE D;  4HQE A;  4HQM A;  1BOA A;  2NNY A;  3TO9 A;  3G3Z A;  3NQO A;  2ZO4 A;  2IJL A;  1FYL A;  1UHW A;  3MAJ A;  2VN2 A;  1Q1H A;  2HGC A;  4I01 A;  1PP8 F;  3KE2 A;  2VBW A;  4CHU A;  1G3Y A;  5F6F A;  3KZZ A;  2UXN A;  4HX4 A;  2FBK A;  1ZRC A;  1R5G A;  2AS5 F;  4LK1 F;  3M7G A;  2XRO A;  3K69 A;  3WTW C;  1J2X A;  3FXR A;  1J9I A;  2JSC A;  5LRR A;  1QNT A;  4FT8 A;  1FC3 A;  3E5Q A;  5J8C A;  1FYK A;  2VE8 A;  4L5J A;  4QLC U;  1O7L A;  2V1U A;  4BXU A;  2OAZ A;  1KQ8 A;  2OQR A;  1XSD A;  3WGH A;  2PMU A;  1XGS A;  5LHI A;  2RVC A;  5EEH A;  3E6M A;  3CDH A;  4OIP F;  5ICC A;  5AON A;  3HHG A;  4M72 A;  1K6O A;  5J8F A;  2FRH A;  4ZYE A;  1Z1D A;  1RZ4 A;  3DV8 A;  3HOS A;  4HBL A;  2Q8K A;  1KU9 A;  3J81 K;  1QZZ A;  4WF2 A;  2IPQ X;  4AWX B;  4AIJ A;  2YU3 A;  3CUQ C;  3R4K A;  3HOT A;  1HQC A;  1F1Z A;  2HWV A;  3KFW X;  5ICF A;  3TQN A;  4A0Z A;  4XSZ F;  4WX9 A;  4BNC A;  3D5L A;  5KK1 A;  4ZZL A;  2IA1 A;  2YSR A;  1BI3 A;  2ZXJ A;  4U0Y A;  2CYY A;  5A2Q Z;  3TGN A;  2LF7 A;  2XAH A;  1FY7 A;  1P92 A;  5DYM A;  4KNY A;  4U0W A;  1EH7 A;  1U8R A;  1SFX A;  3QPH A;  4M9S A;  1O3S A;  1BIA A;  2FU4 A;  3DXJ F;  4L9T A;  3MWM A;  3H3Z A;  4Y13 A;  4Y17 A;  2O3F A;  4IF4 A;  1ZG3 A;  2BEO A;  2GAU A;  2FOK A;  4KIG A;  1JGS A;  3S2W A;  5JFR A;  4CIC A;  4LFU A;  1LQ1 A;  2XKO A;  3KEQ A;  4M6X A;  1EV7 A;  1KA8 A;  2PJP A;  4XSX F;  5ILS A;  2VC1 A;  4I09 A;  1ZRF A;  4Q47 A;  2BGC A;  3F8N A;  4WK8 F;  3T0Y A;  1R22 A;  1UB9 A;  4WXD A;  2KIM A;  4MNU A; 
#chains in the Genus database with same CATH topology
 3LQR A;  2ISZ A;  2D1H A;  1HF0 A;  5GAE J;  4BEH A;  5BMZ A;  3KYD B;  2A6T A;  3S1M J;  4HZF A;  5E20 A;  4LLL A;  2IS4 A;  1YRN B;  4KDP A;  3JW4 A;  1X58 A;  5F1R A;  3CCU I;  3Q5F A;  3MFK A;  2R3S A;  1DPR A;  3A03 A;  2VPR A;  1UEL B;  2CQN A;  2E19 A;  2X4H A;  4IOC F;  1RUO A;  2DMQ A;  5J3L A;  1FBU A;  1XGN A;  2FF4 A;  2FA5 A;  2X1E A;  3OS1 A;  2FSW A;  3O2P E;  1CF7 A;  1WH7 A;  2BHY A;  1GHC A;  3WTY C;  2DTR A;  2CUE A;  2XGD A;  4U88 A;  3VWB A;  4CCL A;  4E7I A;  3DTI A;  1XC5 A;  2XVC A;  5H20 A;  1U3E M;  1SD6 A;  1HDP A;  3VSK A;  4XLH A;  2WB1 N;  1F5T A;  3P9C A;  2XDV A;  2R5Y B;  1YX3 A;  3LAJ A;  3IH4 A;  2H6C A;  2DA2 A;  2MH9 A;  4II2 A;  3HOW J;  1HXD A;  4E7S A;  2QLZ A;  3TP0 A;  2OTL I;  1TC3 C;  2NXN B;  1SAU A;  1T0F C;  3AL0 C;  1OYY A;  1Y1V J;  3MMY B;  2DOD A;  1LFP A;  3BG6 A;  2QSG X;  4M3G A;  2NVX J;  4BYY A;  3TED A;  1P7I A;  4RGS A;  2MBF A;  2IXS A;  3K2Z A;  2DFF A;  3OYA A;  2XAQ A;  2ACJ A;  3WHC A;  2H1L A;  3ONQ A;  5J1R A;  2IS2 A;  3ZMV A;  3GLL A;  1IN7 A;  2NYX A;  3G1M A;  1HLV A;  3DPT A;  1WJB A;  4M3D A;  2VOD A;  4KN7 X;  3ROU A;  3ZR8 X;  1LDJ A;  3GLX A;  5BS6 A;  4KIT B;  4A6D A;  2IRF G;  5ILU A;  2KP6 A;  3FXU A;  3TOA A;  2KHM A;  3CMA I;  1XG1 A;  4CXF A;  3X2Q H;  2OU2 A;  3AAF A;  1XGM A;  1H9G A;  2A68 F;  2UXX A;  1X1P A;  2J5O A;  3WHB A;  4G7O F;  2ZXI A;  5HS8 A;  2ZJP F;  4B4C A;  2COM A;  2JN6 A;  3GCM A;  4U87 A;  2L4A A;  3DTK A;  1T08 B;  3L1P A;  3CO7 C;  5FKM A;  3VEP A;  3HUG A;  3WTT C;  1POG A;  3W2V A;  3Q0V A;  4F91 B;  2A3S A;  5FKL A;  3TDZ C;  1W1W E;  4ENK A;  1DDN A;  1F36 A;  5HDN A;  5DV5 A;  2B0L A;  1VQN I;  2HPI A;  4L0Y B;  3S1R J;  3CF5 F;  3AKZ A;  4FE7 A;  5HLG A;  1YLF A;  2ICW G;  3BZC A;  2K9Q A;  1SMT A;  4JX6 A;  1RKW A;  2CFO A;  3IAM 2;  3KP3 A;  2VAS A;  4YFX F;  4KMU X;  5K7F A;  1HC8 A;  1J5Y A;  4G7H F;  5KCM A;  4MTE A;  3M8E A;  1G8X A;  3HXL A;  2X0L A;  2OTJ I;  2MLK A;  4P55 A;  2EFO A;  3LFU A;  2AO9 A;  2QEX I;  2DDA A;  2QEN A;  2KDZ A;  5DD8 A;  2EQR A;  1D0X A;  2GQQ A;  1IXR C;  2LY2 A;  3I58 A;  2IA0 A;  5TIS C;  4D5F A;  2LMD A;  3ZMU A;  5DM6 F;  3CCM I;  3HPG A;  4YII A;  5FLX Z;  2EIM H;  2ESN A;  1R4N B;  2COB A;  3NAR A;  2GBY A;  1I27 A;  1SAX A;  3DFG A;  5E79 C;  3HC7 A;  3KP2 A;  3N05 A;  3KZY A;  2EJR A;  1STZ A;  2KJB A;  3BY6 A;  4LGW A;  1B1B A;  1P7J A;  2RNG A;  2ZBK A;  3RKW A;  1VTN C;  1ETQ A;  1E17 A;  5IOY A;  1FPQ A;  1WCM J;  3DLA A;  4LOC A;  1ZG5 A;  3F8F A;  2JT1 A;  2IP2 A;  3IWF A;  1R1V A;  4KIF A;  1IUY A;  3TL4 X;  2DO7 A;  4MEY F;  4ZYA A;  3IV5 A;  2L9R A;  4KA4 A;  4NQW A;  3D0S A;  4OMZ A;  5E1W A;  3IKV A;  5FKK A;  1VQM I;  2KZV A;  3FIW A;  3ZXS A;  1YW9 A;  2PI0 A;  3OOP A;  3SZT A;  4FTH A;  1TP4 A;  2F5C A;  1PUE E;  5HLI A;  3GYH X;  4J00 A;  2D1V A;  2H6B A;  2A69 F;  3UKG A;  3S1N J;  1MND A;  4GXO A;  3I64 A;  2YPR A;  4WWC A;  4PSW A;  2DOF A;  2IBD A;  3I5U A;  1DGR M;  4I02 A;  1HDD C;  3T8R A;  1MKM A;  4F52 A;  4ZYD A;  1PVE A;  4BAY A;  3RZO J;  3F8B A;  1A6Q A;  3F0C A;  1GVJ A;  4Q5S F;  2ZJ2 A;  4MGR A;  1WVR A;  2HTJ A;  3HB9 A;  3VDX A;  1Y8R B;  5LEK A;  2DMN A;  5GAG J;  2L9S A;  3G73 A;  3HDD A;  3CO6 C;  4Q4Z F;  3OSG A;  3N4M A;  5BPI A;  3CUQ A;  5M5Y J;  3HIF A;  2VUM J;  4HA8 A;  2H8R A;  1S7E A;  1JJ8 C;  4G6Q A;  5EDN A;  2R7U A;  4EM1 A;  4CGZ A;  1HKS A;  1B8I A;  3OYI A;  2A6E F;  2DFH A;  5D6F A;  4BJ6 C;  2QYO A;  1ACI A;  1P4X A;  4IHX A;  2ESH A;  3JTG A;  3KP7 A;  1P4A A;  4ZYG A;  5BPD A;  1WRJ A;  4AUX A;  1MMG A;  2E2H J;  2W24 A;  1VQL I;  3BZ6 A;  5CQE A;  1Z77 A;  4LIU A;  2HQN A;  3SJM A;  5JI6 A;  2PG4 A;  3V7R A;  4F92 B;  1O3Q A;  2HOE A;  3KP4 A;  3G71 I;  3R6S A;  4LG3 A;  3H1C A;  4TV7 A;  3DWL E;  4RB2 C;  4ASN A;  2E60 A;  4RDU A;  3P7N A;  2DA5 A;  1YS7 A;  1LE8 B;  4KUM A;  2CSO A;  2P7C B;  4D5C A;  1IRZ A;  4AIK A;  2JUG A;  3DCF A;  1IDY A;  2H09 A;  2VJ4 A;  2DLL A;  1KZH A;  3ZMS A;  1XSX A;  2EV5 A;  3QYF A;  3DLL F;  2D45 A;  1FP2 A;  4II3 A;  4JQF A;  3M8J A;  4BBR J;  3OYB A;  2ETH A;  1N78 A;  2B7E A;  4XOT A;  5E8I A;  3IAS 2;  1G4D A;  4OMY A;  3DF8 A;  2QSH X;  2P0W A;  2QVO A;  2WTE A;  2GIZ A;  2PBI A;  3UR3 C;  2QUF A;  2PMZ A;  3DBH B;  3RKX A;  2HYG D;  3ZQG A;  3GEZ A;  3MZ8 A;  1BI0 A;  1XMK A;  3OYJ A;  2V6C A;  4EMS A;  3QP5 A;  3SFI A;  2XAG A;  1OCT C;  1G3S A;  4XIC A;  3DBR B;  2HOT A;  1ZR4 A;  2JUC A;  5F0F A;  3C2H A;  2L0K A;  5L3B A;  2ZJQ F;  3ESW B;  1J7K A;  2XSJ C;  4Q48 A;  3I4M J;  5JHU A;  1FWZ A;  2MA3 A;  4PGG A;  1AWC A;  5FLV A;  3BR6 A;  4DYQ A;  5CYV A;  3EYY A;  5DCM B;  4AIH A;  1USS A;  5DM7 F;  3TW7 A;  2NVQ J;  5DDG A;  1LPQ A;  3V7C A;  3NAU A;  2O0Y A;  2DK5 A;  4LJZ F;  1BOB A;  3CJN A;  2P7V B;  3M4O J;  1TWA J;  1QQI A;  3I0T A;  3LSK A;  3CD6 I;  3BTC A;  5C4J J;  2Y0M A;  3CJR B;  3OOU A;  2ZSI B;  3K4N A;  2DBB A;  1MBH A;  4ITV A;  1ONV A;  3S3O A;  3J80 Z;  1S5L C;  1W5T A;  4DW6 A;  3JRD A;  1FT9 A;  1W5S A;  2FBI A;  1LB2 A;  5D8K B;  2L9V A;  2GWR A;  2M34 A;  5LEJ A;  1Y8Q B;  4A5N A;  1P4W A;  1K78 A;  4BBS J;  1U6G A;  2CWE A;  5M3M J;  3I9V 2;  3IWZ A;  2VXZ A;  1RUN A;  2E1O A;  2XB0 X;  1ZHF A;  3I3L A;  1FTZ A;  1SVL A;  3MQ0 A;  1MMS A;  1FYM A;  1ZRD A;  4IKF A;  2HZD A;  2W1O A;  3BRO A;  3M07 A;  4L5E A;  3L00 A;  3DEE A;  1S3J A;  2L5Q A;  2Q2E B;  3CLO A;  4A6E A;  5A2Q K;  3U21 A;  5IT9 Z;  2G7H A;  4XM3 A;  3F9K A;  4HYE A;  4JOM A;  4CCJ A;  1SFU A;  5LGT A;  1QGP A;  2ZSH B;  2ZME A;  4BDZ A;  4M74 A;  4HNV A;  3QP6 A;  3VFZ A;  2CW8 A;  2WWY A;  4MIM A;  2XF6 A;  1UG0 A;  2OC6 A;  3ZGK A;  4IQJ A;  1R7J A;  1WQ2 A;  2XIG A;  5HLH A;  1W0T A;  4A3D J;  2HOA A;  2XRN A;  2I10 A;  1PUF A;  3E6B A;  3BOQ A;  4WXC A;  1I1S A;  2BY2 A;  4N9I A;  1ZGW A;  3BTI A;  1R00 A;  4RB1 A;  1IZ1 A;  2VI6 A;  4XN0 A;  4Y4R A;  3EET A;  1WH5 A;  3W6K B;  1U78 A;  1OJL A;  3OYE A;  4CZC A;  4Y7N J;  3KYL A;  1VF9 A;  1UCR A;  4D7M A;  3Q0U A;  5EEA A;  3K4K A;  4XNF A;  5F04 A;  3V8L A;  1XB4 A;  3DBL B;  1A6I A;  4K2E A;  3SHF A;  2OV7 A;  3K9T A;  3R61 A;  3CES A;  1IJW C;  2L2O A;  2LBF A;  3EPZ A;  2QQ8 A;  2RC4 A;  2F5D A;  4YIR X;  1T2K A;  2VBX A;  3CCL I;  4ESB A;  2XAJ A;  4PCQ A;  5HLT A;  2EZH A;  5FKN A;  4S04 A;  3FMQ A;  1OYI A;  2DK8 A;  3ZQQ A;  2FD5 A;  2BY3 A;  4R1H A;  2Z33 A;  2QBY B;  3S2H J;  5K7H A;  3FKI J;  3GME A;  4HRI A;  1VQP I;  3HRT A;  1YW8 A;  5EGO A;  4BHC A;  2Y69 H;  4CSW A;  1D1C A;  4IXA A;  5EZH A;  1ZQ3 P;  2BW3 B;  2HTS A;  2KFD A;  4ETS A;  3B02 A;  5D5U B;  4DBQ A;  1NK2 P;  1MJ9 A;  2G7U A;  2KT0 A;  1A31 A;  1IV6 A;  1XCB A;  3HYI A;  1V4R A;  3A01 B;  2M0M A;  2X48 A;  1LVA A;  2ZNZ A;  5FKO A;  4A5M A;  4OIN F;  4A3I J;  3E5U A;  5C3E J;  3GW2 A;  1OCP A;  2OF7 A;  4MEX F;  1ETK A;  1XS9 A;  4RS8 A;  2MC3 A;  5HVQ C;  2Y31 A;  4XID A;  5EG0 B;  1QPM A;  1X1B A;  2L7K A;  2RDP A;  1DUX C;  3E6D A;  3JSO A;  2EV0 A;  2RKH A;  3I59 A;  5LHG A;  1YJW I;  5LD2 C;  4BHB A;  1I1G A;  1JT0 A;  3K7A J;  3FK7 A;  1BI1 A;  2MGQ A;  4IHY A;  4EJT A;  1X1A A;  3HTU A;  4W97 A;  3FIS A;  5ICG A;  1BW6 A;  2OJE D;  3CMY A;  3PUB A;  1QHH D;  4KT6 A;  1R4M B;  5CVU A;  2D2W A;  3W6J B;  5IYC J;  3ABL H;  2K40 A;  3CJT B;  2BBY A;  1PP7 U;  2F5V A;  2XAF A;  2Y2Z A;  2K7L A;  3VPR A;  1TLH B;  3R60 A;  3CCE I;  5C44 J;  3PIO F;  3RZD J;  2QWW A;  2XPW A;  2HPM A;  4L18 B;  3ULQ B;  2IGM A;  3ABK H;  4B09 A;  5IP7 J;  4RMN A;  1Z6T A;  3ZQ7 A;  5JLW A;  4LIV A;  4XLF A;  4NHJ A;  2UZK A;  2R93 J;  1NTC A;  1T39 A;  3CC7 I;  2EIN H;  2CRG A;  1ETX A;  5BNG A;  3WTV C;  1ZLJ A;  2V7F A;  4BHP A;  2ZKZ A;  1XPX A;  5DUI A;  4U7D A;  2EZK A;  4BAC A;  1SFE A;  2FJ1 A;  5H6R A;  1GVD A;  3CCJ I;  4E7K A;  4X0G A;  4JBA A;  1H0M A;  1NHA A;  4EJV A;  1O3R A;  1B9N A;  5D5W B;  5L3F A;  1J75 A;  4E7Z A;  3RQ4 A;  1JGG A;  2HDC A;  1EH6 A;  2LY9 A;  3D5S C;  2VBY A;  2CG4 A;  2EFN A;  2LG4 A;  1KU2 A;  1RI7 A;  5CPR B;  1B72 A;  1YIO A;  1BI2 A;  2GIV A;  3RPQ A;  2OD5 A;  1S7O A;  5CVJ A;  1YJ9 I;  5K5R A;  4A2U A;  4ZDP A;  4CA0 A;  4QWQ A;  1I6H J;  2JK3 A;  1MDM A;  5IT3 A;  2HEO A;  4PUS A;  2MSY A;  2GOM A;  4YEJ A;  2EFW A;  3J7A O;  4ON0 A;  4HF2 A;  3DKY A;  3TDU C;  3BQY A;  4HDU A;  3QQA A;  3EUH C;  2CFX A;  3ELK A;  3KEY A;  4DZJ A;  3HOX J;  4XBF A;  1A36 A;  1WFX A;  1QZY A;  4D7N A;  1TWH J;  4XLA A;  3I54 A;  1E3P A;  1FBS A;  1RPW A;  4BJT A;  1IG7 A;  3KZI C;  1MGT A;  2FML A;  3HKZ N;  3KIO A;  3GZ5 A;  2LKX A;  1JKO C;  3H0D A;  3F6V A;  3H3U A;  2NS0 A;  2KIU A;  3HEF A;  2ZFW A;  9ANT A;  4NC6 A;  2EBI A;  3HKZ A;  2PJR A;  1RKT A;  3DKW A;  2VXD A;  5GTH C;  2V79 A;  2DFI A;  3HOY J;  1BL0 A;  4ESJ A;  2GXG A;  2P5K A;  1OCO H;  2J5P A;  3ECH A;  3B73 A;  2BZT A;  1TNS A;  2LRE A;  1V55 H;  2Z5U A;  3HRS A;  1SD5 A;  2Z1D A;  4R8H A;  1FP1 D;  2VQC A;  2F5F A;  2Z3Y A;  1LEA A;  3TOB A;  2JMW A;  5GAH J;  5LFA A;  5DCF A;  1FOK A;  4AYB N;  2NRA C;  2BVM A;  4FAS D;  3FK6 A;  5B1A H;  2W85 A;  4OAY A;  1ZAO A;  2UWM A;  5FLX K;  1W36 C;  4RGU A;  4AYB A;  1MBF A;  2O8X A;  3FBI B;  3WG9 A;  2OQG A;  2R5Z B;  4EGZ A;  1EKE A;  2QA4 I;  4IPA A;  3CCR I;  2Z99 A;  3G1O A;  1XMX A;  2XPU A;  4MHG A;  5IYD J;  3LOC A;  4P5O A;  2CGP A;  2EWN A;  3SZG A;  4C2T A;  2CUZ A;  3SZP A;  1AHD P;  2KIS A;  1UST A;  2W57 A;  5KVR A;  4A3M J;  1MMN A;  3BJA A;  3E7L A;  4HX8 A;  2STT A;  2JVH A;  3G4S I;  4HF1 A;  2VKD A;  4AVP A;  5LBQ A;  3D1N I;  5B3S H;  3FDY A;  1SC7 A;  1W7P D;  5DS9 A;  3K2A A;  3BZK A;  1ORK A;  2EFQ A;  1S72 I;  1X3U A;  4CCK A;  1IAW A;  1HW1 A;  2IGK A;  5HS9 A;  2IEK A;  2VC0 A;  4V2F A;  3NWS A;  4M71 A;  5L3G A;  4HSR A;  3K70 D;  4IHW A;  5ED4 A;  3BR5 A;  2CQX A;  1YFH A;  2M87 A;  2V9K A;  2VIX A;  4P9U A;  2R7Q A;  4IRH A;  4Y33 A;  4EQQ A;  4PFP A;  1GXQ A;  3CCV I;  1R71 A;  1FBQ A;  2X6X A;  3C2G A;  2Q1Z B;  4UUS B;  1FNN A;  4LG0 A;  2L3D A;  1JJ6 C;  1IC8 A;  2JTV A;  2XGE A;  3JCU C;  4XON A;  3K10 A;  4KIB A;  5BQT A;  1IF1 A;  3AFH A;  2EIL H;  1SEU A;  2HVQ A;  3OIQ A;  1X3W B;  1BR4 A;  1X4O A;  5FRM A;  3MKZ A;  5AIQ A;  5CLS A;  4E4H A;  4F93 B;  3BG5 A;  2P81 A;  5F64 A;  3LA3 A;  2P5V A;  4GYI A;  1GDT A;  3LSP A;  4PJN A;  2ZXH A;  4N4O B;  3ISP A;  3ABU A;  4RAY A;  3WTS C;  1YO5 C;  3U1K A;  1MD0 A;  1K61 A;  1NK3 P;  3DEU A;  2WB1 A;  3CLQ A;  3K4B A;  3BJ6 A;  2CW0 F;  5K5Q A;  2IA2 A;  2HFH A;  5E3L A;  3WU0 A;  1REP C;  2QCO A;  4KFC A;  4I76 A;  1AKH A;  2FUG 2;  4CYC A;  3HM5 A;  4PJM A;  2HVS A;  2P6S A;  2O61 A;  3M3Y J;  3V4G A;  3LA2 A;  4FHT A;  2K9N A;  5E1Z B;  1K79 A;  1IN8 A;  2DI3 A;  2BYV E;  1RES A;  4RLQ A;  2AQF A;  3RQI A;  3F6O A;  3HRU A;  1YIJ I;  3W6V A;  5D5V B;  3BLY A;  1DPU A;  3A02 A;  2XF5 A;  1YG2 A;  3AG3 H;  3S8P A;  3GTM J;  1H88 C;  4EJU A;  2E71 A;  2NNN A;  4HOB A;  3HRM A;  1WHU A;  4B8X A;  3HZJ A;  3LSG A;  1EJ9 A;  4I2O A;  2M3A A;  3GF2 A;  1IV8 A;  2QQ9 A;  3W2A A;  4F7Z A;  2CQ7 A;  3LSI A;  4ZC3 A;  2V1D A;  1W7P A;  1JE8 A;  1XD7 A;  3J80 K;  2G9W A;  2XAS A;  1D3Y A;  3HOZ J;  3GZ6 A;  1QA6 A;  3F8C A;  3FBN B;  1FOX A;  2R7Z J;  2HR3 A;  2P8T A;  1X3Z B;  3GUD A;  3ZP5 A;  2FOW A;  2NAZ A;  1YOV B;  4M9X A;  2M4G A;  3OMY A;  4R79 A;  4MTD A;  3GBG A;  2WV0 A;  2A5Y B;  3OR2 C;  4IHV A;  4N0B A;  4JK1 X;  3OS0 A;  2IS6 A;  3A1Y A;  2VOO A;  3OYH A;  1UHM A;  1S7A A;  2DXI A;  1U9O A;  4LB6 B;  5IT9 K;  5ICE A;  2O8K A;  3ZMD A;  2DA6 A;  2FNP A;  3BPX A;  3L9F A;  3NWT A;  4Y52 J;  3V42 A;  4C2M J;  3BR0 A;  3M1E A;  2DPU A;  1VQ8 I;  1IW7 F;  1S9H A;  4RM2 A;  3OYM A;  3KEO A;  1G6N A;  1KYZ A;  1MBG A;  1ZG1 A;  4DZP A;  2M0C A;  4XLE A;  1M1E B;  2WAE A;  1R5I D;  4FIS A;  4PJ0 C;  3ZMZ A;  3DU5 A;  1IN4 A;  2L7Z A;  3IP4 B;  4IHS A;  1VQO I;  1ZGJ A;  2EZL A;  3O8H A;  1DP3 A;  1I5Z A;  2H8W A;  2P5L C;  2B63 J;  5IYB J;  2M5W A;  1W36 D;  3OL3 A;  1SD4 A;  2HNH A;  2JQ7 A;  5TRD A;  2DJI A;  3V8J A;  4G6D A;  4I98 B;  1J59 A;  2L4M A;  3QPS A;  4IVN A;  4RGR A;  2TCT A;  2DMU A;  3DPU A;  3N97 A;  4HEA 2;  3BQZ A;  3BJO A;  1O4X A;  2L02 A;  4A93 J;  3HTS B;  2O03 A;  3GFJ A;  5EJC A;  4PFO A;  1QVT A;  3BP8 A;  4IHT A;  1G3W A;  1SMY F;  1ZYR F;  2WY8 Q;  5E3N A;  3ZMT A;  1APL C;  1IRX A;  2JPC A;  1P9Q C;  4M3B A;  1ZAR A;  2F6C A;  4N4N B;  3RIR A;  2EFP A;  3QOD A;  4HLY A;  1FX7 A;  1ETV A;  3JRH A;  5HDK A;  1E3O C;  1IRG A;  2KPM A;  3JAM Z;  3WU1 B;  5F27 A;  1YX5 A;  5D8L B;  4M3F A;  1R1U A;  3K1P A;  2NS8 A;  3A0H C;  2JVG A;  1HW2 A;  3GTQ J;  4XOP A;  2L7M P;  2F48 A;  2FEZ A;  2MYS A;  3P9K A;  4NC7 A;  3U1D A;  1ZRE A;  2BW3 A;  2E1M B;  1D0Z A;  1YQA A;  2VT3 A;  4A3G J;  2Q0O A;  3FMS A;  3A01 A;  2K9S A;  3IRR A;  3GFI A;  2HKO A;  4IJA A;  5KHD A;  3B6C A;  3GXO A;  2YS9 A;  4AD9 A;  1S8N A;  2QQA A;  4WCG A;  1OCC H;  5IY5 H;  1JI8 A;  1ERD A;  4L0Z B;  4G8X A;  1R6R A;  1I39 A;  3DQV C;  4I7H A;  3S32 A;  2OPT A;  4BH9 A;  4UVA A;  1G3T A;  2XSD C;  1XGO A;  1H8A C;  2DYS H;  5F0C A;  4AU7 A;  2VLA A;  2W82 A;  3EDP A;  3C18 A;  1Y0U A;  5JR3 A;  2MD0 A;  2GXB A;  3EUH A;  1V5F A;  2MAB A;  4ESF A;  4W1U A;  3KLN A;  6PAX A;  3KLO A;  3FZV A;  3Q3S A;  2XF7 A;  2W48 A;  4OOI A;  3H5R A;  2BY1 A;  3HHH A;  4XKB A;  4ZDO A;  1PYV A;  2PX9 A;  3ZPL A;  3GZN B;  2NVU B;  3D5R C;  4BEH B;  3SQN A;  2IVM A;  1P6R A;  1Z0X A;  3HSF A;  4KIS A;  3ML6 A;  2YR2 A;  2VKV A;  2QZ8 A;  5JLX A;  1TQI A;  1XSV A;  2MLG A;  1TW3 A;  3ASN H;  2Y30 A;  4UVB A;  5HNH A;  1GXP A;  4XKV A;  2YX7 A;  3F8M A;  1NG7 A;  1R49 A;  4U7B A;  1FSE A;  4ENM A;  2WC2 A;  1SD7 A;  2ISY A;  4E7H A;  2K4J A;  2A05 A;  5GP9 A;  3L7W A;  4J19 A;  2LRD A;  1HBX G;  3ECO A;  1MBE A;  1MBK A;  4QPO A;  2RQQ A;  4C2U A;  3FKJ A;  2FX0 A;  5JVT A;  2XC7 A;  1MSF C;  2K9M A;  3RKY A;  5KAF C;  4UNO A;  5J1Y A;  4YIF A;  3QPT A;  1CF7 B;  5FO5 A;  3VOD A;  1WWX A;  1BR2 A;  2DDB A;  1WJF A;  3S93 A;  3CCS I;  2DA4 A;  1GV2 A;  2ID6 A;  2VKE A;  4OIR F;  3E5X A;  2KRH A;  4O5V A;  4MO7 A;  3OYD A;  3IRQ A;  2DU9 A;  1G2H A;  2KKO A;  2NOJ B;  3LST A;  3A2K A;  3CC2 I;  2WAQ N;  1ZLK A;  4IO9 F;  3KP5 A;  2FMY A;  3REO A;  2V1N A;  1WI3 A;  2E5N A;  3KCC A;  5DD4 A;  2WAQ A;  4EGY A;  1LDD A;  4BJ5 C;  3JRI A;  4XKW A;  1QO0 D;  4AID A;  2R7X A;  1IRF A;  3GVA A;  4HST A;  2K02 A;  4BQQ A;  3QU3 A;  2JA2 A;  2R7S A;  1WI9 A;  2NVT J;  3TW6 A;  1OIS A;  3G6E I;  2ZNY A;  4XOR A;  2EZI A;  1MJB A;  1MZB A;  2LK2 A;  2RGV A;  1KQ0 A;  4OWR B;  1UMQ A;  2AXT C;  1D1A A;  3LSR A;  3K0L A;  4IRG A;  3RKQ A;  2JRT A;  3CTA A;  4ZZD A;  1KQ9 A;  3TKY A;  1RET A;  3V8K A;  3MKL A;  4HPQ A;  1HKQ A;  4LB5 A;  4BQN A;  3DP7 A;  5M3F J;  1LDK B;  4BE1 A;  4H4K C;  4GFB A;  1N75 A;  3S3N A;  2NS7 A;  1ENH A;  4GO1 A;  3W3C A;  1U8B A;  1SVO A;  1JUS A;  2R92 J;  5C4X J;  1ZK8 A;  2KJC A;  1SAN A;  1DP7 P;  1DGW Y;  1ON2 A;  1P2F A;  4GYG A;  2WA0 A;  4B44 A;  2AXL A;  3BTJ A;  2TDX A;  3JTH A;  3SXY A;  5FB2 A;  1VQK I;  3ZQC A;  3HUG B;  5GTI C;  1OR7 C;  3VYS B;  4ZTJ A;  2W4S A;  5IPA A;  3R0J A;  1VI0 A;  3EQL F;  2IAI A;  1OMI A;  1AU7 A;  3I55 I;  3FWE A;  4I0B A;  4YEL A;  5K5O A;  1E0E A;  1Z9C A;  1UAA A;  5K1Y A;  5E3O A;  2JA5 J;  3NEU A;  4XN3 A;  3HOV J;  2JSP A;  4XRS A;  1YS6 A;  2Y0S N;  1I3Q J;  1TZL A;  1YI2 I;  2MFZ A;  3OR1 C;  4QTR A;  2F2E A;  2PLY A;  3UNG C;  2RRE A;  1T0F A;  4X6A J;  1HCR A;  3MCZ A;  4M6Y A;  1LFU P;  4UB8 C;  3RYR A;  3OYK A;  3BPV A;  2E7X A;  2KZG A;  5J47 A;  1V54 H;  1F4K A;  1PJR A;  4DYC A;  4M6V A;  4E7L A;  1LNW A;  1W5C C;  4P9F A;  4HV6 A;  2E2I J;  3TO6 A;  3ZN1 A;  3BTL A;  5J1U A;  4CCN A;  3PL8 A;  2DAO A;  1X2N A;  1FLI A;  4G6T B;  1TQP A;  3BCB A;  5LGN A;  1ZTR A;  3H3V K;  3PQJ A;  2M4K A;  4Y3O A;  4XLN F;  1HW5 A;  1V3F A;  1YRN A;  1T38 A;  1OKR A;  1TL8 A;  4UUT A;  4UUS A;  3F22 A;  5FGM A;  2M7A A;  3H9Q A;  2HDW A;  2DT7 B;  4V19 K;  2R7O A;  4NQW B;  3ABT A;  2VJ5 A;  4HLX A;  1J09 A;  4YG2 F;  2FQ3 A;  3MKW B;  4EV0 A;  1OPC A;  3PNV A;  4CYD A;  3ZN0 A;  4EVI A;  2OZ6 A;  2LVS A;  5ERI A;  1ETY A;  4EJW A;  5D6E A;  3QWL A;  1VZ0 A;  1XDU A;  2LKP A;  2K3P A;  4U0V A;  3S3M A;  1YIT I;  1ZH5 A;  1QZE A;  3DEW A;  4LIT A;  2IGN A;  2BXY A;  3PSI A;  3PUF A;  3PQK A;  2BHZ A;  4AVZ A;  1WJ5 A;  3FXQ A;  3MD2 A;  1Y0N A;  1B4A A;  3CUQ B;  5FRO A;  2R5Y A;  3HOU J;  3IL2 A;  2JA6 J;  2DCE A;  2E36 A;  5J40 A;  4D1Q A;  2O7O A;  2GM4 A;  3F72 A;  3RI4 A;  1B8I B;  1MJA A;  3OYG A;  1IGN A;  4B48 A;  1QHG A;  2HKX A;  3B6A A;  1ZGA A;  3T5X A;  2XKP A;  3HSR A;  4FET A;  4BKX A;  1ITY A;  3OYF A;  1BC7 C;  3L2R A;  3IHU A;  3K6G A;  5D4R A;  3U9G A;  4Z6Y A;  2LFB A;  3TMO A;  2O9L A;  1IN6 A;  4CH7 A;  1MIJ A;  4A3F J;  2X1D A;  4I6Z A;  4ZJZ A;  1U5T B;  1YTY A;  2DFE A;  2JA7 J;  1LKX A;  2F5E A;  5FD6 A;  2CS3 A;  4XLC A;  2K86 A;  4QPQ A;  2LD5 A;  2PQ8 A;  3KYC B;  2XV4 S;  3I53 A;  5F1J A;  1RR7 A;  2LF8 A;  1LJ9 A;  3WE3 A;  1JKP C;  4IEJ A;  1Y56 A;  4LMY A;  3M9A A;  5CVI A;  5E8G A;  2DOA A;  4HNT A;  5E18 F;  3C7J A;  1O57 A;  4L9J A;  1H9T A;  3FHZ A;  1R5H A;  4FX4 A;  1ODD A;  5FFZ A;  2C6Y A;  1LFB A;  2V4J C;  1BR1 A;  4PZJ A;  1JTX A;  4B3A A;  5IOZ A;  4FQG A;  2W25 A;  5EYR A;  2EV6 A;  1TQM A;  2IT0 A;  3G1L A;  3DTE A;  4YFK F;  3QYB A;  5M5X J;  4DQ2 A;  2LDU A;  2HQA A;  1CGP A;  3QOE A;  4XK4 A;  2P4W A;  2K9L A;  3Q0W A;  2ADU A;  1U9N A;  4JP0 A;  4ABZ A;  1T56 A;  5L3E A;  1EA3 A;  2K85 A;  5EEG A;  4C9Y A;  2GXA A;  3GFM A;  3JRE A;  2D5V A;  1ETW A;  1R1T A;  1ZKG A;  2VE9 A;  2KDO A;  2E5Z A;  2IW5 A;  1O3T A;  1C0W A;  1BJA A;  5BOX A;  3H92 A;  1S29 A;  3E3V A;  4MQV A;  1TW2 A;  3RCO A;  4P96 A;  1BM9 A;  1BW5 A;  2GA1 A;  4PSX A;  1YW7 A;  1K78 B;  2RNJ A;  3O3K A;  2V6E A;  3OWT A;  1WJC A;  4G9Y A;  4DOZ A;  4EJO A;  1U5T C;  3FF5 A;  1UJ8 A;  2HXO A;  2BVL A;  2JA8 J;  1T6S A;  4RM3 A;  4M3E A;  5E3M A;  1FOW A;  1OLT A;  3CQZ J;  4HV5 A;  1FMV A;  4M9Z A;  1KYW A;  2DA1 A;  4D9J A;  1DQU A;  1VND A;  2FNA A;  4CO8 A;  2RV8 A;  4CUG A;  2R7R A;  2LLK A;  1O7F A;  3H36 A;  3K4M A;  1FJL A;  2ZME B;  1WJA A;  4EM2 A;  2XB5 A;  2M7B A;  2ZFU A;  1FZP B;  4NC8 A;  5F0H A;  1L3L A;  2E1N A;  4OU0 A;  1XDS A;  5AIP A;  1A35 A;  3Q9S A;  4IRI A;  1G59 A;  2VON A;  4LLG F;  3P9I A;  2LNB A;  4UXN A;  4E6K G;  1BC8 C;  4AM3 A;  1Z6R A;  2DT5 A;  3BG3 A;  2XGX A;  1T98 A;  1PUF B;  2R7V A;  1IXC A;  1TBX A;  2F4O B;  2VJI A;  3GO5 A;  3LSJ A;  4HDV A;  4UB6 C;  2F4M B;  3PFI A;  3AG1 H;  3RYP A;  3JAM K;  3H9G A;  1Z05 A;  5FRN A;  4FE4 A;  2HVR A;  3QOP A;  3HGG A;  3CC4 I;  3ERM A;  1ZN2 A;  1GUU A;  3SDG A;  4AC0 A;  2Z9O A;  5HNF A;  1F9N A;  1WPK A;  1QPI A;  2VB6 A;  1ON1 A;  3V7S A;  1XMA A;  2XPV A;  4M73 A;  2H94 A;  3WOD F;  1KU7 A;  3WTZ A;  1S6L A;  1Y39 A;  3T8T A;  2VL8 A;  2PEX A;  2HI3 A;  3IC7 A;  1Z91 A;  2N8G A;  4BDY A;  2LBF B;  4BUP A;  2MD5 A;  4KIC A;  4RAG A;  1FOY A;  4V2G A;  2PN6 A;  2ME6 A;  1JT6 A;  3VSL A;  2R7T A;  2VBZ A;  2KRF A;  4XQF A;  3C3W A;  2E2J J;  3QPL A;  3PO3 J;  2DYR H;  2DQR A;  3BC8 A;  5LHH A;  2ECB A;  4A0Y A;  2H1K A;  1K4T A;  4I0A A;  1LE8 A;  3IKT A;  1YYV A;  3JRA A;  2HYF A;  2M1B A;  4ZH4 F;  3FM5 A;  1Z3X A;  1HA8 A;  2OCC H;  4RB0 A;  2HDD A;  2RAE A;  5EGO B;  2ZME C;  3HGY A;  1D5Y A;  2PMH A;  1WJE A;  4NB5 A;  2HXI A;  4NDL A;  2P6T A;  5DUK A;  4D0P A;  1JHF A;  1TWG J;  4HW0 A;  3CCY A;  4LK0 F;  1XN7 A;  2OUM A;  4BY7 J;  2M45 A;  3TBI A;  2EK5 A;  3J7Y J;  1QVU A;  2F4I A;  3OYL A;  1D5V A;  4B47 A;  3PO2 J;  1OR7 A;  3RTR A;  3K1N A;  3GTL J;  2L9N A;  2X6O A;  3KP6 A;  3LSH A;  3I59 B;  3FX3 A;  1T33 A;  3OV8 A;  4E70 A;  5B5E C;  5EZG A;  3LA7 A;  3I4P A;  4IOA F;  1SFO J;  3JRF A;  1ZR2 A;  1YE9 A;  2V9V A;  1JUP A;  2GA2 A;  5DCM A;  2FBH A;  4J01 A;  2VPL A;  2DQL A;  3BG7 A;  4HAM A;  3WTU C;  1J0R A;  4G94 A;  4DBR A;  2I8D A;  2WAD A;  1N25 A;  3S1Q J;  3S17 J;  3W2W A;  5LLQ A;  4EM0 B;  4XMY A;  3SEQ A;  3OS2 A;  2XHK A;  3RDI A;  3HSE A;  2QF7 A;  2M8G X;  5TJJ A;  4HX7 A;  3EYI A;  3GTG J;  3OYC A;  2QKM B;  3U2R A;  1RR8 C;  5IP9 J;  3J81 Z;  2M30 A;  2WY7 Q;  1RC9 A;  4MQ9 F;  4RLF A;  4RBO A;  1A5J A;  2O5R A;  4FX0 A;  4KN4 X;  3RJP A;  1W0U A;  2FE3 A;  2OBP A;  1VQ4 I;  1E3H A;  4LLN A;  2KIF A;  2XRL A;  2IS1 A;  1QRY A;  4NNJ A;  1AOY A;  3KPH A;  1A04 A;  3RPU D;  3SEZ A;  2A61 A;  1KGS A;  1KU3 A;  2Q2E A;  2R7F A;  3MZY A;  2STW A;  3GTP J;  3BR1 A;  4DJA A;  1KON A;  5CQG A;  5HS7 A;  1E2X A;  2WV1 A;  4CDG A;  2QQB A;  2HQR A;  3SFZ A;  4DYR A;  2EA2 A;  3TO7 A;  4UUV A;  1FIA A;  1B72 B;  4L9N A;  4UY8 I;  1LEB A;  3L2Q A;  3HJE A;  2GOX B;  5L3C A;  4NUB A;  2M9H A;  5DEQ A;  1OCR H;  3KET A;  2M2E A;  3H9J A;  1MDM B;  4ZTF A;  1RRJ A;  5KNL A;  1N77 A;  2VOP A;  4A69 C;  2DA7 A;  4B3X A;  2E34 A;  2CQK A;  3MZH A;  5EF6 A;  2JPB A;  5D4S A;  5LRS A;  1YJN I;  5LGU A;  2MC4 A;  3CCQ I;  5FJ8 J;  3K4J A;  2R4G A;  3LFK A;  2K4B A;  5L3D A;  3F23 A;  3CDL A;  3CF2 A;  1R23 A;  3ZQI A;  3COA C;  3F21 A;  2DT6 A;  4XRF A;  2ZCW A;  1B59 A;  3QU6 A;  4N9H A;  3FHN A;  5H2F C;  5JVG F;  2V1X A;  2DOE A;  3FXO A;  1EH8 A;  1I6X A;  5D5X B;  4IQ4 A;  4PGH A;  3CJQ B;  2PJR B;  3L09 A;  3WE2 A;  4C30 A;  4B43 A;  3LSM A;  4A3K J;  4B1R A;  4OIQ F;  2XUB A;  2E7W A;  4BQA A;  1JXS A;  5KAI C;  3BDD A;  3FXK A;  2IGO A;  4KT5 C;  3SDB A;  4HNU A;  2ZC2 A;  4BY1 J;  4KMF A;  4Z2Y A;  4S05 A;  3LWF A;  2HS5 A;  3T1B A;  2BXZ A;  2GLO A;  2HOS A;  3S14 J;  3E1S A;  4OIO F;  1NH3 A;  3GTO J;  4DNC A;  4ENJ A;  1XX5 A;  2QBY A;  1WJD A;  4DIQ A;  2YUS A;  1W4M A;  1TWF J;  2A07 F;  5GAD J;  5HOD A;  3L2C A;  3L2U A;  2LKS A;  4UV8 A;  2LTP A;  4ENN A;  3M8F A;  2CUF A;  2ECC A;  3VYU B;  3CMM A;  1BIB A;  3I71 A;  2Y75 A;  3E97 A;  3H5N A;  1Z67 A;  3O6B B;  4PDK A;  4UVC A;  2FXA A;  3RSN A;  4YFN F;  2CJJ A;  2R7D A;  4L9V A;  3VOE A;  5GPA A;  2VT2 A;  1BN5 A;  1IN5 A;  4A0X A;  1JKQ C;  4GCV A;  1MH4 A;  3K4L A;  2LSO A;  4BE0 A;  1MSE C;  4BL0 B;  5EG0 A;  4KYW A;  3QRF F;  2KIQ A;  1VQ6 I;  2HYJ A;  4GGG A;  3DPL C;  3BR3 A;  3PIP F;  4O3M A;  2OCE A;  1I3A A;  4JYK A;  2Y9Y A;  3MEX A;  4RB3 C;  2CW7 A;  3AG4 H;  2L7F P;  3RPU A;  2ME0 A;  3QYE A;  5FFX A;  2AQE A;  2DJN A;  2Y48 A;  4F3Q A;  3WTX C;  3ZQL A;  2RQP A;  5E1X A;  4XLP F;  1IUF A;  1Z7U A;  4C3H J;  3TP3 A;  1TT5 B;  2DMP A;  5CVV A;  2X85 A;  1HSJ A;  1R36 A;  1D8K A;  2W7N A;  4XRM A;  5F08 A;  3MN2 A;  2DW4 A;  4HF0 A;  3JRC A;  3HPH A;  1YHQ I;  5DTD A;  3C1D A;  4C3J J;  2DPD A;  4A12 A;  4ZDL A;  3WU2 C;  4RGX A;  3GWZ A;  3Q9V A;  4LG0 B;  3E6C C;  2GZW A;  4RAF A;  2HQ5 A;  1HKT A;  2A6H F;  1RNL A;  3FXM A;  1B6A A;  3J7Z I;  2LYC A;  1Z3Y A;  5ILV A;  1BJZ A;  3R0A A;  5E17 F;  3ZQH A;  1V5E A;  1U5T A;  1X2M A;  1IO2 A;  1JHH A;  2V9P A;  2E1M C;  4CZZ A;  1XCV A;  2VQH A;  1PDN C;  5CJ9 A;  2EB7 A;  4HG2 A;  2PMZ N;  1MH3 A;  4MLO A;  3WGI A;  4XL9 A;  5H6Q A;  1R58 A;  2UUZ A;  4A3E J;  4G7Z F;  3FMR A;  1B9M A;  4LD5 A;  3OYN A;  3E0J B;  5M5W J;  1L0O C;  3JRB A;  2HZT A;  2L01 A;  4YRV A;  2QGU A;  1QBJ A;  1MBJ A;  4BE2 A;  2OA4 A;  3LQQ A;  4BQO A;  1RIO H;  2X1C A;  2W84 A;  2QM3 A;  2LC2 A;  4BXF A;  2L54 A;  3DU6 A;  3K1M A;  4H0E A;  3GFL A;  1AKH B;  2ELH A;  4CYC B;  3S16 J;  1T8I A;  1UFM A;  3PJR A;  3ASO H;  4RA2 A;  2XGC A;  3JR9 A;  1TNT A;  4ZYH A;  1BBY A;  5FD5 A;  4O6J A;  4BGD A;  1WSU A;  2BV6 A;  2EIJ H;  4WXH A;  1DU6 A;  3BCA A;  2VKH A;  2RN7 A;  1TTY A;  1JUM A;  3JRG A;  3QAH A;  1U2W A;  4A3J J;  5CVR A;  1VFC A;  2O6G E;  2E1C A;  4IL6 C;  5HDG A;  3H35 A;  4QIW N;  3OY9 A;  3KX2 A;  3GTK J;  2R7W A;  3CUO A;  1WKM A;  1Q1V A;  3G2B A;  2KQR A;  5J6X A;  1DU0 A;  2E35 A;  2CO5 A;  2EA4 A;  3F3X A;  2V26 A;  1OYW A;  3PSF A;  3LAP A;  1VQ5 I;  3A0B C;  4XRS G;  2OZU A;  1MMD A;  1SVM A;  2DA3 A;  2DN0 A;  2LR8 A;  3CP8 A;  3A4C A;  4I99 C;  1IXS B;  2CH0 A;  2WBM A;  4DGW B;  1W7P B;  1UG2 A;  1ULY A;  1Z7L A;  3S2D J;  1GLN A;  1D8J A;  4QSH A;  1K7A A;  2X9D A;  3ABM H;  2H27 A;  1X19 A;  4UV9 A;  1K83 J;  2EH3 A;  2FQ4 A;  2BE5 F;  3BWG A;  5HOO A;  1HST A;  4RAZ A;  4F55 A;  1U0J A;  3NRV A;  3L2W A;  2B9S A;  2YX4 A;  3JSP A;  2R5Z A;  4L5I A;  2QKL B;  4Y15 A;  2PFB A;  1EF4 A;  3ZQF A;  3MVP A;  1R9T J;  2JJ7 A;  2K27 A;  1FEX A;  1FSH A;  3VB2 A;  2M8E A;  3WGG A;  1MNM C;  4FCY A;  3PNT A;  3GX4 X;  2MH2 A;  3FM3 A;  4P1W A;  2JZY A;  4UHT A;  2X6W A;  3ERE D;  2EPF A;  3SYT A;  4XKC A;  4HQE A;  2KLO A;  2Y0S A;  4HQM A;  1BOA A;  2NNY A;  3TO9 A;  2ELK A;  1LVK A;  1JTY A;  1F43 A;  3G3Z A;  3NQO A;  1Y6I A;  3CME I;  3BR2 A;  2CV2 A;  5B1B H;  2ZO4 A;  2IJL A;  1FYL A;  3J7A Y;  1UHW A;  4IX7 A;  2QSF X;  5B66 C;  4NBQ A;  3MAJ A;  4MFE A;  2KRC A;  5CKT A;  1XTA A;  2VN2 A;  1Q1H A;  2HGC A;  3C2B A;  4I01 A;  3IH3 A;  1PP8 F;  3KE2 A;  2I5U A;  2CMP A;  2VBW A;  4CHU A;  1G3Y A;  1Y1W J;  5F6F A;  2DMT A;  2UV1 A;  1OFC X;  3KZZ A;  2UXN A;  4HX4 A;  4KJZ A;  1X1D A;  2VJJ A;  2WAF A;  2FBK A;  1ZRC A;  2R0Q C;  1R5G A;  2AS5 F;  1UZC A;  4LK1 F;  5J4V A;  3M7G A;  4XR6 A;  3K70 C;  1QU3 A;  3M1C A;  5FLM J;  2XRO A;  3K69 A;  3OIP A;  5JHF A;  3FXJ A;  3WTW C;  2X6Y A;  3HG9 A;  1JKR C;  1J2X A;  3ZCO A;  3FXR A;  1K4S A;  2A5W A;  1J9I A;  2JSC A;  5LRR A;  1QNT A;  4FT8 A;  1FC3 A;  3E5Q A;  2KL4 A;  1GV5 A;  2CU7 A;  1AA7 A;  2ZXW H;  5J8C A;  3BT9 A;  1FYK A;  1MMA A;  4CCM A;  1FMW A;  2VE8 A;  4L5J A;  4QLC U;  1O7L A;  2V1U A;  3LNQ A;  1T95 A;  4BXU A;  1VQ7 I;  4GRI A;  1HOM A;  4PJJ A;  2OAZ A;  4EAT A;  1GT0 C;  4BS9 A;  1KQ8 A;  3AG2 H;  1OCZ H;  2OQR A;  2YU9 J;  3EUA A;  3GTJ J;  4MFD A;  1XSD A;  2K3F A;  3WGH A;  2PMU A;  1XGS A;  2LY1 A;  4EEF G;  3K4C A;  2LH9 A;  1MNE A;  5LHI A;  3H0G J;  2RVC A;  5EEH A;  3E6M A;  3EUK L;  3CDH A;  1CQT A;  4OIP F;  5ICC A;  4IZZ A;  3IUO A;  5AON A;  1TWC J;  3P5J A;  1IDZ A;  3LMM A;  3HHG A;  2LP0 A;  3ZOB A;  2DTZ A;  4M72 A;  1K6O A;  1I50 J;  5J8F A;  2FRH A;  2XAU A;  4ZYE A;  1Z1D A;  2JRM A;  1X1C A;  3S15 J;  4ANJ A;  1RZ4 A;  3DV8 A;  3WG7 H;  1V5G A;  2ZB9 A;  2CQQ A;  3HOS A;  4HBL A;  2Q8K A;  2HU9 A;  1KU9 A;  3J81 K;  1QZZ A;  3OIO A;  4WF2 A;  2VQG A;  2IPQ X;  1D1B A;  2JWT A;  4AWX B;  2CUJ A;  4AIJ A;  2CV1 A;  2YU3 A;  3CUQ C;  3R4K A;  4A3L J;  1LUJ B;  2TRT A;  3HOT A;  3PM1 A;  4X1E A;  2K5C A;  1OQY A;  4S0H B;  1HQC A;  1TT0 A;  1F1Z A;  2HWV A;  4JX5 A;  3KFW X;  2NOG A;  5ICF A;  3TQN A;  4A0Z A;  4XSZ F;  4WX9 A;  3H5A A;  4BNC A;  3D5L A;  5KK1 A;  4ZZL A;  4BU2 A;  3L2V A;  2IA1 A;  3PFY A;  3CDI A;  2YSR A;  1MW7 A;  1BI3 A;  3HBL A;  2ELJ A;  2KMU A;  1K6Y A;  1FIP A;  3VYT B;  4CCO A;  2ZXJ A;  3PNY A;  4U0Y A;  2Y9Z A;  2CYY A;  3DKX A;  5A2Q Z;  3TGN A;  2LF7 A;  1D0Y A;  2XAH A;  1FY7 A;  1P92 A;  4G12 A;  5DYM A;  2BY0 A;  4U0W A;  4KNY A;  2MW8 A;  2Z16 A;  4BXX J;  1EH7 A;  1U8R A;  1UHS A;  1ETO A;  3CZ6 A;  1SFX A;  3QPH A;  4M9S A;  1VQ9 I;  1SFK A;  4PJL A;  1WGX A;  5TGT A;  1O3S A;  1BIA A;  1NG6 A;  2FU4 A;  3DXJ F;  4L9T A;  2Z2S B;  3MWM A;  3IH2 A;  1X4P A;  4A3C J;  3H3Z A;  5GPC A;  2VQL A;  4Y13 A;  4E7J A;  1WZ2 A;  5K7Z A;  4Y17 A;  2LOO A;  2O3F A;  3OSF A;  4IF4 A;  1ZG3 A;  4GDF A;  3O8G A;  1BA5 A;  2BEO A;  3CP2 A;  2GAU A;  2FOK A;  4KIG A;  1ZEL A;  4JX4 A;  1JGS A;  2X51 A;  3S2W A;  3HL2 A;  3OL4 A;  5JFR A;  1H89 C;  3LL7 A;  3VYR B;  4CIC A;  4LFU A;  4PK4 A;  1LQ1 A;  2XKO A;  3KEQ A;  2BOL A;  2EIK H;  2NVY J;  1EV7 A;  1Z21 A;  4M6X A;  1KA8 A;  2PJP A;  4XSX F;  2W00 A;  3I4N J;  2ZJR F;  5ILS A;  4A3B J;  2VC1 A;  4I09 A;  1FTT A;  1ZRF A;  3BG9 A;  4Q47 A;  3ZRG A;  3I56 I;  2BGC A;  5J4Y A;  4C3I J;  3F8N A;  4WK8 F;  2CV0 A;  3AL0 B;  3T0Y A;  5IP6 A;  1R22 A;  1UB9 A;  3MKY B;  4OAZ A;  2ID3 A;  2AHQ A;  2G0E A;  4WXD A;  3FXL A;  2MG4 A;  2KIM A;  4MNU A; 
#chains in the Genus database with same CATH homology
 3LQR A;  2ISZ A;  2D1H A;  5BMZ A;  4HZF A;  5E20 A;  4LLL A;  4KDP A;  3JW4 A;  5F1R A;  3Q5F A;  3MFK A;  2R3S A;  1DPR A;  2X4H A;  1RUO A;  1FBU A;  1XGN A;  2FF4 A;  2FA5 A;  2FSW A;  3O2P E;  1CF7 A;  1GHC A;  3WTY C;  2DTR A;  4U88 A;  2XVC A;  5H20 A;  1U3E M;  1SD6 A;  1F5T A;  3P9C A;  3LAJ A;  2H6C A;  2MH9 A;  1HXD A;  2QLZ A;  1OYY A;  4BYY A;  4RGS A;  2MBF A;  3K2Z A;  2XAQ A;  2ACJ A;  3ZMV A;  1IN7 A;  2NYX A;  3DPT A;  2VOD A;  4KN7 X;  3ROU A;  1LDJ A;  3GLX A;  5BS6 A;  4A6D A;  2IRF G;  5ILU A;  3FXU A;  3TOA A;  4CXF A;  2OU2 A;  3AAF A;  1XGM A;  1H9G A;  2A68 F;  2UXX A;  2J5O A;  4G7O F;  5HS8 A;  2COM A;  2L4A A;  3CO7 C;  3VEP A;  3HUG A;  3WTT C;  2A3S A;  3TDZ C;  4ENK A;  1DDN A;  5HDN A;  5DV5 A;  2B0L A;  4L0Y B;  5HLG A;  1YLF A;  1SMT A;  3KP3 A;  4YFX F;  4KMU X;  1J5Y A;  4G7H F;  4MTE A;  3M8E A;  2X0L A;  2MLK A;  4P55 A;  2EFO A;  2QEN A;  5DD8 A;  2GQQ A;  1IXR C;  3I58 A;  2IA0 A;  3ZMU A;  4YII A;  5FLX Z;  2ESN A;  1I27 A;  1SAX A;  3DFG A;  3KP2 A;  3KZY A;  2EJR A;  1STZ A;  2KJB A;  3BY6 A;  4LGW A;  1B1B A;  2ZBK A;  3RKW A;  1VTN C;  1E17 A;  1FPQ A;  1ZG5 A;  3F8F A;  2JT1 A;  2IP2 A;  3IWF A;  1R1V A;  4KIF A;  1IUY A;  2DO7 A;  4MEY F;  4KA4 A;  4NQW A;  3D0S A;  4OMZ A;  5E1W A;  3IKV A;  1YW9 A;  2PI0 A;  3OOP A;  3SZT A;  2F5C A;  1PUE E;  5HLI A;  3GYH X;  2D1V A;  2H6B A;  2A69 F;  4GXO A;  3I64 A;  2YPR A;  4WWC A;  3I5U A;  4I02 A;  3T8R A;  1MKM A;  4ZYD A;  4BAY A;  3F8B A;  1GVJ A;  4Q5S F;  2ZJ2 A;  4MGR A;  2HTJ A;  5LEK A;  3G73 A;  3CO6 C;  4Q4Z F;  3N4M A;  5BPI A;  3CUQ A;  3HIF A;  4HA8 A;  4G6Q A;  4EM1 A;  4CGZ A;  1HKS A;  2A6E F;  5D6F A;  2QYO A;  1P4X A;  2ESH A;  3JTG A;  3KP7 A;  1P4A A;  4ZYG A;  5BPD A;  1WRJ A;  2W24 A;  3BZ6 A;  2HQN A;  5JI6 A;  2PG4 A;  3V7R A;  1O3Q A;  2HOE A;  3KP4 A;  3R6S A;  4TV7 A;  4RB2 C;  4ASN A;  3P7N A;  1YS7 A;  4KUM A;  2CSO A;  2P7C B;  4AIK A;  2H09 A;  2D45 A;  2DLL A;  3ZMS A;  1XSX A;  2EV5 A;  1FP2 A;  4JQF A;  2ETH A;  5E8I A;  1G4D A;  4OMY A;  3DF8 A;  2QVO A;  2WTE A;  2PBI A;  2QUF A;  3RKX A;  2HYG D;  3GEZ A;  1BI0 A;  1XMK A;  2V6C A;  4EMS A;  3QP5 A;  2XAG A;  1G3S A;  5L3B A;  1J7K A;  4Q48 A;  5JHU A;  1FWZ A;  2MA3 A;  4PGG A;  1AWC A;  5CYV A;  3EYY A;  5DCM B;  4AIH A;  1USS A;  5DDG A;  3V7C A;  2O0Y A;  2DK5 A;  4LJZ F;  3CJN A;  2P7V B;  1QQI A;  3I0T A;  2Y0M A;  2DBB A;  1ONV A;  3J80 Z;  1W5T A;  1FT9 A;  1W5S A;  2FBI A;  1LB2 A;  5D8K B;  2GWR A;  5LEJ A;  4A5N A;  1P4W A;  1K78 A;  1U6G A;  2CWE A;  3IWZ A;  2VXZ A;  1RUN A;  1ZHF A;  3MQ0 A;  1FYM A;  1ZRD A;  3BRO A;  3L00 A;  3CLO A;  1S3J A;  5A2Q K;  4A6E A;  5IT9 Z;  2G7H A;  4HYE A;  1SFU A;  5LGT A;  1QGP A;  2ZME A;  4M74 A;  3QP6 A;  3VFZ A;  2WWY A;  1R7J A;  1WQ2 A;  2XIG A;  5HLH A;  2XRN A;  3E6B A;  3BOQ A;  4WXC A;  1I1S A;  4N9I A;  1R00 A;  4RB1 A;  1IZ1 A;  3EET A;  3W6K B;  1U78 A;  1UCR A;  3V8L A;  1XB4 A;  4K2E A;  3SHF A;  3K9T A;  3R61 A;  2RC4 A;  2F5D A;  1T2K A;  2VBX A;  4ESB A;  2XAJ A;  4PCQ A;  4S04 A;  3FMQ A;  1OYI A;  2DK8 A;  4R1H A;  2Z33 A;  2QBY B;  3HRT A;  1YW8 A;  4BHC A;  4IXA A;  2HTS A;  4ETS A;  5D5U B;  3B02 A;  1MJ9 A;  2G7U A;  1XCB A;  3HYI A;  1V4R A;  1LVA A;  2ZNZ A;  4A5M A;  4OIN F;  3E5U A;  3GW2 A;  4MEX F;  4RS8 A;  2MC3 A;  5HVQ C;  1QPM A;  1DUX C;  2RDP A;  3E6D A;  3JSO A;  2EV0 A;  2RKH A;  3I59 A;  5LHG A;  4BHB A;  1I1G A;  1BI1 A;  4EJT A;  3HTU A;  5ICG A;  5CVU A;  2D2W A;  3W6J B;  2BBY A;  1PP7 U;  2XAF A;  2K7L A;  1TLH B;  3R60 A;  2QWW A;  4L18 B;  3ULQ B;  4B09 A;  1Z6T A;  3ZQ7 A;  4NHJ A;  2UZK A;  1T39 A;  3WTV C;  1ZLJ A;  4BHP A;  2ZKZ A;  5DUI A;  4U7D A;  1SFE A;  5H6R A;  4JBA A;  1H0M A;  1NHA A;  4EJV A;  1O3R A;  1B9N A;  5D5W B;  5L3F A;  1J75 A;  2HDC A;  1EH6 A;  2VBY A;  2CG4 A;  2EFN A;  1KU2 A;  1RI7 A;  1YIO A;  1BI2 A;  2GIV A;  3RPQ A;  2OD5 A;  1S7O A;  5CVJ A;  5K5R A;  4A2U A;  4QWQ A;  1MDM A;  5IT3 A;  2HEO A;  2EFW A;  3J7A O;  4ON0 A;  4HF2 A;  3TDU C;  4HDU A;  2CFX A;  3ELK A;  4XBF A;  1QZY A;  3I54 A;  1FBS A;  1MGT A;  2FML A;  3GZ5 A;  3F6V A;  3H3U A;  2NS0 A;  2KIU A;  2ZFW A;  3DKW A;  2V79 A;  2DFI A;  4ESJ A;  2GXG A;  2P5K A;  2J5P A;  3ECH A;  3B73 A;  1TNS A;  3HRS A;  2Z5U A;  1SD5 A;  4R8H A;  1FP1 D;  3TOB A;  2F5F A;  2Z3Y A;  1LEA A;  5DCF A;  1FOK A;  2NRA C;  2W85 A;  1ZAO A;  2UWM A;  5FLX K;  4RGU A;  2O8X A;  3WG9 A;  2OQG A;  4EGZ A;  4IPA A;  2Z99 A;  4MHG A;  4P5O A;  2CGP A;  2EWN A;  3SZP A;  1UST A;  2W57 A;  5KVR A;  3BJA A;  4HX8 A;  2STT A;  4HF1 A;  4AVP A;  5LBQ A;  1W7P D;  2EFQ A;  1X3U A;  1IAW A;  1HW1 A;  5HS9 A;  2VC0 A;  4M71 A;  5L3G A;  5ED4 A;  1YFH A;  2M87 A;  4P9U A;  4IRH A;  4EQQ A;  1GXQ A;  1FBQ A;  1FNN A;  4LG0 A;  2L3D A;  2JTV A;  4KIB A;  5BQT A;  1IF1 A;  5AIQ A;  5CLS A;  5F64 A;  3LA3 A;  2P5V A;  4GYI A;  3ISP A;  3ABU A;  4RAY A;  3WTS C;  1YO5 C;  1MD0 A;  3DEU A;  3BJ6 A;  2CW0 F;  5K5Q A;  2IA2 A;  2HFH A;  3WU0 A;  1REP C;  4KFC A;  2P6S A;  2O61 A;  3V4G A;  3LA2 A;  4FHT A;  5E1Z B;  1K79 A;  1IN8 A;  2DI3 A;  2BYV E;  3F6O A;  3HRU A;  5D5V B;  1DPU A;  1YG2 A;  4EJU A;  2NNN A;  4HOB A;  3HRM A;  4B8X A;  4I2O A;  3GF2 A;  2QQ9 A;  4F7Z A;  2V1D A;  1W7P A;  1JE8 A;  1XD7 A;  3J80 K;  2G9W A;  2XAS A;  1D3Y A;  3GZ6 A;  3F8C A;  2HR3 A;  2P8T A;  3GUD A;  3ZP5 A;  2NAZ A;  4M9X A;  4R79 A;  4MTD A;  2WV0 A;  2A5Y B;  4N0B A;  4JK1 X;  2VOO A;  1UHM A;  1S7A A;  4LB6 B;  5IT9 K;  5ICE A;  3ZMD A;  2FNP A;  3BPX A;  3L9F A;  3M1E A;  2DPU A;  1IW7 F;  3KEO A;  1G6N A;  1KYZ A;  1ZG1 A;  3ZMZ A;  1IN4 A;  4IHS A;  1ZGJ A;  1I5Z A;  2P5L C;  2M5W A;  1SD4 A;  5TRD A;  3V8J A;  4G6D A;  4I98 B;  1J59 A;  2L4M A;  4IVN A;  4RGR A;  3N97 A;  3BJO A;  2L02 A;  3HTS B;  2O03 A;  3GFJ A;  3BP8 A;  4IHT A;  1G3W A;  1SMY F;  1ZYR F;  3ZMT A;  2JPC A;  1ZAR A;  3RIR A;  2EFP A;  4HLY A;  1FX7 A;  5HDK A;  1IRG A;  3JAM Z;  3WU1 B;  5D8L B;  1R1U A;  3K1P A;  1HW2 A;  1ZRE A;  3P9K A;  2FEZ A;  3U1D A;  1YQA A;  2VT3 A;  2Q0O A;  3FMS A;  3IRR A;  3GFI A;  2HKO A;  4IJA A;  3GXO A;  4AD9 A;  1S8N A;  2QQA A;  4WCG A;  4L0Z B;  4G8X A;  4BH9 A;  3DQV C;  4I7H A;  4UVA A;  1G3T A;  1XGO A;  3EDP A;  3C18 A;  1Y0U A;  5JR3 A;  2GXB A;  3EUH A;  4ESF A;  3KLN A;  6PAX A;  3KLO A;  3FZV A;  4OOI A;  3HHH A;  3ZPL A;  3SQN A;  2IVM A;  1P6R A;  3HSF A;  3ML6 A;  2YR2 A;  2QZ8 A;  1TQI A;  1XSV A;  2MLG A;  1TW3 A;  4UVB A;  1GXP A;  2YX7 A;  3F8M A;  4U7B A;  1FSE A;  4ENM A;  2WC2 A;  1SD7 A;  2ISY A;  2K4J A;  3L7W A;  1HBX G;  3ECO A;  5JVT A;  3RKY A;  4UNO A;  4YIF A;  3QPT A;  1CF7 B;  5FO5 A;  3VOD A;  1WWX A;  4OIR F;  3E5X A;  4O5V A;  3IRQ A;  2DU9 A;  2KKO A;  3LST A;  1ZLK A;  3KP5 A;  2FMY A;  3REO A;  3KCC A;  5DD4 A;  4EGY A;  1LDD A;  1QO0 D;  1IRF A;  3GVA A;  2K02 A;  3QU3 A;  1WI9 A;  2ZNY A;  1MJB A;  1MZB A;  2RGV A;  1KQ0 A;  4IRG A;  3K0L A;  2JRT A;  3CTA A;  4ZZD A;  1KQ9 A;  3TKY A;  3V8K A;  1HKQ A;  4LB5 A;  3DP7 A;  1LDK B;  4GO1 A;  2KJC A;  1DP7 P;  1ON2 A;  1P2F A;  4GYG A;  2AXL A;  2TDX A;  3JTH A;  3SXY A;  5FB2 A;  3R0J A;  3EQL F;  1OMI A;  3FWE A;  4I0B A;  5K5O A;  1Z9C A;  5K1Y A;  3NEU A;  1YS6 A;  2F2E A;  2PLY A;  1T0F A;  3MCZ A;  4M6Y A;  3RYR A;  3BPV A;  2E7X A;  1F4K A;  1LNW A;  4P9F A;  4HV6 A;  3TO6 A;  3ZN1 A;  2DAO A;  1FLI A;  5LGN A;  1TQP A;  3PQJ A;  4XLN F;  1HW5 A;  1V3F A;  1T38 A;  1OKR A;  3F22 A;  5FGM A;  3ABT A;  4HLX A;  4YG2 F;  2FQ3 A;  4EV0 A;  1OPC A;  4CYD A;  3ZN0 A;  4EVI A;  2OZ6 A;  5ERI A;  4EJW A;  5D6E A;  1XDU A;  2LKP A;  4U0V A;  1ZH5 A;  3PQK A;  3FXQ A;  1B4A A;  3CUQ B;  3IL2 A;  3F72 A;  3RI4 A;  1MJA A;  2HKX A;  1ZGA A;  3T5X A;  2XKP A;  3HSR A;  1BC7 C;  3IHU A;  5D4R A;  3U9G A;  1IN6 A;  1U5T B;  1YTY A;  2F5E A;  5FD6 A;  2K86 A;  2PQ8 A;  2XV4 S;  3I53 A;  2LF8 A;  1LJ9 A;  3WE3 A;  4LMY A;  3M9A A;  5CVI A;  5E8G A;  5E18 F;  3C7J A;  1O57 A;  4L9J A;  1H9T A;  3FHZ A;  1R5H A;  4FX4 A;  1ODD A;  5FFZ A;  2C6Y A;  4PZJ A;  2W25 A;  2EV6 A;  1TQM A;  2IT0 A;  4YFK F;  4DQ2 A;  2LDU A;  1CGP A;  2P4W A;  2ADU A;  5L3E A;  5EEG A;  3GFM A;  1R1T A;  2VE9 A;  2IW5 A;  1O3T A;  1C0W A;  1BJA A;  5BOX A;  3H92 A;  1S29 A;  3E3V A;  4MQV A;  1TW2 A;  4P96 A;  1BM9 A;  2GA1 A;  1YW7 A;  1K78 B;  2RNJ A;  3O3K A;  4G9Y A;  4EJO A;  1U5T C;  3FF5 A;  1T6S A;  4HV5 A;  4M9Z A;  1KYW A;  2FNA A;  4CO8 A;  2RV8 A;  1O7F A;  2ZME B;  4EM2 A;  1FZP B;  1L3L A;  2E1N A;  4OU0 A;  1XDS A;  5AIP A;  3Q9S A;  4IRI A;  2VON A;  4LLG F;  3P9I A;  2LNB A;  4UXN A;  1BC8 C;  1Z6R A;  2DT5 A;  2XGX A;  1T98 A;  1IXC A;  1TBX A;  3GO5 A;  4HDV A;  3PFI A;  3JAM K;  3RYP A;  1Z05 A;  3QOP A;  1ZN2 A;  2Z9O A;  1F9N A;  1ON1 A;  3V7S A;  1XMA A;  4M73 A;  2H94 A;  3WOD F;  1KU7 A;  3WTZ A;  1S6L A;  3T8T A;  2PEX A;  3IC7 A;  1Z91 A;  2MD5 A;  4KIC A;  2PN6 A;  2VBZ A;  2KRF A;  3C3W A;  2DQR A;  5LHH A;  4A0Y A;  4I0A A;  3IKT A;  1YYV A;  2HYF A;  2M1B A;  4ZH4 F;  3FM5 A;  4RB0 A;  2PMH A;  4NB5 A;  2P6T A;  5DUK A;  4D0P A;  1JHF A;  4HW0 A;  4LK0 F;  1XN7 A;  2M45 A;  2EK5 A;  1D5V A;  1OR7 A;  3RTR A;  3K1N A;  3KP6 A;  3I59 B;  3FX3 A;  3OV8 A;  4E70 A;  3LA7 A;  3I4P A;  2V9V A;  2GA2 A;  5DCM A;  2FBH A;  2DQL A;  4HAM A;  3WTU C;  1J0R A;  4G94 A;  5LLQ A;  4EM0 B;  2XHK A;  3RDI A;  3HSE A;  5TJJ A;  4HX7 A;  3EYI A;  3U2R A;  3J81 Z;  2M30 A;  4MQ9 F;  4FX0 A;  4KN4 X;  3RJP A;  2FE3 A;  2OBP A;  4LLN A;  2KIF A;  1AOY A;  1A04 A;  2A61 A;  1KGS A;  1KU3 A;  2Q2E A;  2R7F A;  3MZY A;  2STW A;  5HS7 A;  1E2X A;  4CDG A;  2QQB A;  2HQR A;  3SFZ A;  2EA2 A;  3TO7 A;  4UUV A;  4L9N A;  1LEB A;  5L3C A;  5DEQ A;  3KET A;  1MDM B;  2VOP A;  2CQK A;  3MZH A;  2JPB A;  5D4S A;  5LRS A;  5LGU A;  3LFK A;  2K4B A;  5L3D A;  3F23 A;  1R23 A;  3COA C;  3F21 A;  4XRF A;  2ZCW A;  1B59 A;  3QU6 A;  4N9H A;  2V1X A;  1EH8 A;  1I6X A;  5D5X B;  4PGH A;  3L09 A;  3WE2 A;  4OIQ F;  2XUB A;  2E7W A;  4BQA A;  1JXS A;  3BDD A;  4KT5 C;  4KMF A;  4Z2Y A;  4S05 A;  3LWF A;  2HS5 A;  3T1B A;  4OIO F;  4DNC A;  4ENJ A;  2QBY A;  1W4M A;  2A07 F;  3L2C A;  4UV8 A;  4ENN A;  3M8F A;  1BIB A;  3I71 A;  2Y75 A;  3E97 A;  3O6B B;  4PDK A;  4UVC A;  2FXA A;  4YFN F;  2R7D A;  4L9V A;  3VOE A;  2VT2 A;  1BN5 A;  1IN5 A;  4A0X A;  4GCV A;  2LSO A;  4KYW A;  3QRF F;  4GGG A;  3DPL C;  4O3M A;  3MEX A;  4RB3 C;  3RPU A;  5FFX A;  2Y48 A;  3WTX C;  2RQP A;  5E1X A;  4XLP F;  1Z7U A;  5CVV A;  1HSJ A;  1R36 A;  1D8K A;  4HF0 A;  2DW4 A;  3C1D A;  2DPD A;  4A12 A;  4RGX A;  3GWZ A;  3Q9V A;  4LG0 B;  3E6C C;  2GZW A;  1HKT A;  2A6H F;  1RNL A;  1B6A A;  5ILV A;  3R0A A;  5E17 F;  1U5T A;  1JHH A;  4CZZ A;  1XCV A;  1PDN C;  5CJ9 A;  2EB7 A;  3WGI A;  5H6Q A;  1R58 A;  4G7Z F;  3FMR A;  1B9M A;  4LD5 A;  1L0O C;  2HZT A;  2L01 A;  1QBJ A;  2OA4 A;  3LQQ A;  1RIO H;  2W84 A;  2QM3 A;  2L54 A;  3K1M A;  4H0E A;  3GFL A;  2ELH A;  1UFM A;  1TNT A;  4ZYH A;  1BBY A;  5FD5 A;  4O6J A;  1WSU A;  2BV6 A;  4WXH A;  2RN7 A;  1TTY A;  3QAH A;  1U2W A;  5CVR A;  2O6G E;  2E1C A;  5HDG A;  3CUO A;  1WKM A;  5J6X A;  2CO5 A;  2EA4 A;  3F3X A;  1OYW A;  3LAP A;  2OZU A;  1IXS B;  1W7P B;  1ULY A;  1D8J A;  1K7A A;  2H27 A;  4UV9 A;  2BE5 F;  3BWG A;  5HOO A;  1HST A;  4RAZ A;  3NRV A;  2YX4 A;  3JSP A;  4L5I A;  4Y15 A;  2PFB A;  2K27 A;  1FSH A;  3VB2 A;  2M8E A;  3WGG A;  3GX4 X;  2MH2 A;  3FM3 A;  2JZY A;  4UHT A;  3ERE D;  4HQE A;  4HQM A;  1BOA A;  2NNY A;  3TO9 A;  3G3Z A;  3NQO A;  2ZO4 A;  2IJL A;  1FYL A;  1UHW A;  3MAJ A;  2VN2 A;  1Q1H A;  2HGC A;  4I01 A;  1PP8 F;  3KE2 A;  2VBW A;  4CHU A;  1G3Y A;  5F6F A;  3KZZ A;  2UXN A;  4HX4 A;  2FBK A;  1ZRC A;  1R5G A;  2AS5 F;  4LK1 F;  3M7G A;  2XRO A;  3K69 A;  3WTW C;  1J2X A;  3FXR A;  1J9I A;  2JSC A;  5LRR A;  1QNT A;  4FT8 A;  1FC3 A;  3E5Q A;  5J8C A;  1FYK A;  2VE8 A;  4L5J A;  4QLC U;  1O7L A;  2V1U A;  4BXU A;  2OAZ A;  1KQ8 A;  2OQR A;  1XSD A;  3WGH A;  2PMU A;  1XGS A;  5LHI A;  2RVC A;  5EEH A;  3E6M A;  3CDH A;  4OIP F;  5ICC A;  5AON A;  3HHG A;  4M72 A;  1K6O A;  5J8F A;  2FRH A;  4ZYE A;  1Z1D A;  1RZ4 A;  3DV8 A;  3HOS A;  4HBL A;  2Q8K A;  1KU9 A;  3J81 K;  1QZZ A;  4WF2 A;  2IPQ X;  4AWX B;  4AIJ A;  2YU3 A;  3CUQ C;  3R4K A;  3HOT A;  1HQC A;  1F1Z A;  2HWV A;  3KFW X;  5ICF A;  3TQN A;  4A0Z A;  4XSZ F;  4WX9 A;  4BNC A;  3D5L A;  5KK1 A;  4ZZL A;  2IA1 A;  2YSR A;  1BI3 A;  2ZXJ A;  4U0Y A;  2CYY A;  5A2Q Z;  3TGN A;  2LF7 A;  2XAH A;  1FY7 A;  1P92 A;  5DYM A;  4KNY A;  4U0W A;  1EH7 A;  1U8R A;  1SFX A;  3QPH A;  4M9S A;  1O3S A;  1BIA A;  2FU4 A;  3DXJ F;  4L9T A;  3MWM A;  3H3Z A;  4Y13 A;  4Y17 A;  2O3F A;  4IF4 A;  1ZG3 A;  2BEO A;  2GAU A;  2FOK A;  4KIG A;  1JGS A;  3S2W A;  5JFR A;  4CIC A;  4LFU A;  1LQ1 A;  2XKO A;  3KEQ A;  4M6X A;  1EV7 A;  1KA8 A;  2PJP A;  4XSX F;  5ILS A;  2VC1 A;  4I09 A;  1ZRF A;  4Q47 A;  2BGC A;  3F8N A;  4WK8 F;  3T0Y A;  1R22 A;  1UB9 A;  4WXD A;  2KIM A;  4MNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...