2X4HA

Crystal structure of the hypothetical protein sso2273 from sulfolobus solfataricus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
129
Chain Sequence
LSRREFSYLLTIKRYNDSGEGAKINRIAKDLKIAPSSVFEEVSHLEEKGLVKKKEDGVWITNNGTRSINYLIKAHRVIEILLVNIGIDKQTACEYSKQFDYLIPEEIIDKLYNYLGKPSYCPHGLEIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transcription
molecule keywords HYPOTHETICAL PROTEIN SSO2273
total genus 47
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2x4hA00
2DT5A 2VT3A 2F5FA 3KP4A 4L9TA 4EM2A 2LF8A 4FHTA 1ZG5A 5K5OA 4O3MA 2XVCA 5E1WA 2QLZA 4I02A 4G8XA 2GXBA 2RVCA 2HR3A 1XGMA 2STWA 3NRVA 2LDUA 4AIHA 4ZZLA 2HKXA 2MA3A 1TLHB 2EK5A 3L09A 4WXHA 2P6TA 1AOYA 2EV0A 2STTA 5DV5A 1BN5A 3HRTA 4G7HF 1BC7C 4KN7X 2DPUA 3HRMA 2QQ9A 4BNCA 3R60A 1P2FA 2Z9OA 3GXOA 3W6KB 2EV6A 4RS8A 3HOSA 2F2EA 5CYVA 1YW7A 5HS7A 2IT0A 3I53A 4LLGF 1JHHA 3QPHA 4Z2YA 3L7WA 3IC7A 1OYYA 3WU0A 4YG2F 2O03A 1G3WA 5JVTA 4NHJA 2HYFA 1XD7A 2QQAA 1O3RA 4QLCU 3RTRA 1TQPA 4B09A 1WKMA 4HBLA 1T98A 2HFHA 2MBFA 1R5HA 5HLIA 4EGYA 2BYVE 4OU0A 5IT9K 1RNLA 3FZVA 3I58A 1S7AA 5D4SA 3MQ0A 3B02A 3HHHA 2XAGA 1O57A 2QVOA 1FT9A 2M87A 4HYEA 2D1HA 4NQWA 1XN7A 2UWMA 2V1XA 3RKYA 1OR7A 4I0BA 1XGNA 3F22A 4RGXA 1XCVA 4LMYA 4WWCA 3F21A 4BAYA 1I1GA 1UHWA 1HXDA 2HQRA 4JBAA 1QBJA 1UB9A 3IWZA 5LLQA 4HLYA 5CJ9A 4L5IA 2R3SA 2UXNA 1IXCA 4ESJA 2XROA 2DLLA 4L9JA 2NRAC 1KU7A 4EJOA 2IA2A 4WCGA 1IRGA 3P9CA 3ZMDA 3WTZA 1L0OC 5BQTA 1Q1HA 1R58A 4A12A 2P5VA 3EDPA 3WG9A 4AWXB 3GF2A 2XV4S 5DUIA 1F5TA 2FEZA 3RYRA 2XUBA 1R7JA 3DXJF 1YYVA 2DAOA 4HF1A 2V1UA 4PDKA 1MGTA 3HRUA 1K79A 3QAHA 2XHKA 1YG2A 2ADUA 2KRFA 2YX4A 1FYKA 5L3DA 1FP2A 3WTTC 3WU1B 4OIOF 4QWQA 3FM5A 4I98B 2K7LA 2FBHA 4IF4A 1U5TC 1KYWA 3R0JA 2OZ6A 4KT5C 3HOTA 2ELHA 5HDGA 2P7CB 3KZZA 1K6OA 3GW2A 2DO7A 1TQMA 2OU2A 4RAZA 3ZMUA 3ZQ7A 2PN6A 1HW5A 4BHCA 4ENMA 2NS0A 2P5LC 2KJCA 1R36A 3R4KA 5D5XB 4MQVA 2PBIA 5E1XA 4Y13A 1ZLJA 1RI7A 4HF2A 4YIFA 3CUOA 3RIRA 5DUKA 3TGNA 2ACJA 5L3FA 1HW2A 4RGSA 3CUQC 1MKMA 1SFXA 2OQGA 2XRNA 2W25A 5HS8A 1FPQA 2VBXA 5ICCA 2O0YA 4BXUA 3K1NA 4UV8A 3K9TA 4ENJA 2JRTA 1YTYA 3LA3A 2W84A 2FXAA 3HSRA 3KLOA 2Y48A 3KEOA 2L4MA 3REOA 2M8EA 1IW7F 2IJLA 4JK1X 2O61A 1GXPA 1XSXA 2HWVA 2H09A 3V8KA 3ABUA 2M45A 1FYLA 1FWZA 3G3ZA 2GXGA 5E8GA 1S3JA 5DDGA 5DD4A 3TQNA 1E2XA 3J80Z 4EM0B 3O6BB 2UXXA 1YW9A 1J9IA 1O7LA 5HOOA 2A3SA 1HKSA 4Q47A 2OD5A 2XIGA 4HF0A 3ZMTA 5LBQA 1YS6A 3RPUA 3GO5A 1D5VA 4WXCA 1R1UA 1ZRDA 2HGCA 2FBKA 3V8LA 1E17A 5AIPA 3ZP5A 1H9TA 3DKWA 1G3TA 1FSEA 2JT1A 1MDMA 2Z5UA 1IUYA 3WGHA 2HS5A 2PQ8A 2C6YA 3QOPA 3PQKA 5J8FA 4RB3C 3RKWA 4N9HA 2D45A 1H0MA 2RV8A 1LVAA 4XRFA 2RKHA 4AIJA 4IRHA 3QP5A 5CVVA 2HDCA 2MLKA 4A0ZA 5BMZA 1GXQA 4UXNA 3GVAA 3EQLF 5H6RA 3DPLC 3KLNA 3I54A 1K78A 3RDIA 3ELKA 5AONA 5LHIA 3T8RA 1YFHA 3N97A 4HQEA 3F8FA 1YLFA 4G7ZF 2HQNA 5E20A 1UHMA 4G6DA 3C3WA 3WGGA 3Q5FA 1JE8A 4KIGA 3FMQA 3FM3A 1ZYRF 4A6EA 4A5MA 5CVUA 2W85A 3KP5A 4ESBA 2GQQA 3E6BA 1QPMA 5JR3A 2A69F 2W24A 3BPVA 1HKQA 2IPQX 5HLHA 3V7SA 3J80K 4GXOA 3LQQA 5K1YA 1TW2A 5LEJA 3EUHA 2O8XA 5TJJA 4KIBA 1R1VA 1W4MA 1T2KA 4XLNF 2DU9A 1F1ZA 1FNNA 4LK0F 1GHCA 4LFUA 2CYYA 5LGTA 1ULYA 1ZN2A 3FX3A 1FY7A 3GFIA 2H27A 3U9GA 2HKOA 4KDPA 4ZYEA 1BM9A 3WGIA 2OAZA 2O6GE 3VB2A 4GO1A 4RB0A 2CWEA 2IW5A 3HTSB 2EFWA 5HS9A 2ZJ2A 4AIKA 1XB4A 1KU3A 3ZMZA 2NYXA 4BQAA 2ZKZA 1U3EM 2KIMA 3TOBA 1QO0D 1U8RA 3L2CA 5DCMA 3E6DA 1ZG3A 4GYIA 4UUVA 3COAC 3RPQA 1IZ1A 2VC1A 4ZZDA 1O7FA 1XGSA 3CLOA 3I0TA 2ZNZA 3C7JA 2UZKA 1J75A 1EH6A 3CUQA 4PGHA 2A61A 2EFNA 2MH2A 2EB7A 4CYDA 2NNYA 4LD5A 1IN5A 4L5JA 1WQ2A 3GX4X 2L02A 1HQCA 4HV6A 3T0YA 1ON2A 1QNTA 4EM1A 2A6EF 5DCFA 2DQRA 2K86A 1ZHFA 2HEOA 1R23A 2Z99A 1TBXA 5LHHA 4HV5A 5BPDA 4M74A 3ZPLA 2KJBA 2Z33A 5DD8A 1FBSA 5E17F 3WTYC 4IRGA 2ZXJA 4NB5A 3MAJA 1IN4A 3KP3A 1ZGAA 2IA1A 3GWZA 3JSOA 3ROUA 2K02A 1C0WA 2XAJA 3NEUA 1U78A 1TW3A 2IRFG 2V1DA 4CXFA 4ESFA 2Y75A 3B73A 3J7AO 1W7PA 3MWMA 4RB1A 1PP8F 2RC4A 1U2WA 2IVMA 3RYPA 1ONVA 5LRRA 1D8KA 1HSJA 4CHUA 4CO8A 2PG4A 4MQ9F 2XASA 4M9SA 2XAQA 2CGPA 1KA8A 5FLXZ 2HTSA 1IRFA 3CO7C 4N0BA 3M1EA 3MEXA 5E1ZB 1RIOH 4BHBA 4HLXA 2IP2A 1BC8C 1WI9A 3K69A 1G4DA 1UFMA 4A0XA 4KFCA 1FC3A 4XBFA 3LAPA 4XSZF 4P9FA 3OOPA 4OMZA 4HX4A 2HZTA 3RI4A 3WTWC 1GVJA 5BS6A 2ZFWA 4L9VA 1MDMB 1P6RA 5L3EA 1QGPA 3D5LA 5ICEA 4N9IA 3DQVC 2VOOA 3LQRA 2QUFA 1K7AA 2PFBA 5FGMA 4OINF 2W57A 1Z6TA 2CW0F 3HUGA 4MEYF 1T38A 1W7PD 3BDDA 3FXRA 2KIFA 3VEPA 4CGZA 1YS7A 2F5CA 4OMYA 3P7NA 2ZCWA 2L3DA 3DEUA 4DQ2A 1RZ4A 1WRJA 5TRDA 2M30A 2XKOA 1TNTA 4ENKA 2G7HA 3I5UA 2VONA 3SFZA 4HDVA 1DDNA 3LSTA 1UCRA 2K27A 1XDUA 1J7KA 3JTHA 4M6YA 3RJPA 1FBUA 1TNSA 2MD5A 2YSRA 1G3YA 2FMLA 4KMUX 4H0EA 3O2PE 5ED4A 1W5SA 2XKPA 4M6XA 4UVCA 1W7PB 2CO5A 5J6XA 4Q48A 5K5QA 5HDKA 4FX4A 4CICA 3SHFA 2O3FA 3F6VA 1BBYA 2PJPA 4EJTA 4PGGA 3F72A 4FT8A 5FB2A 4EVIA 2VBWA 4IRIA 1YO5C 2B0LA 2MC3A 3BPXA 1OKRA 2VOPA 1LDKB 2EFOA 1B9MA 5K5RA 4KA4A 4A2UA 3OV8A 1SFEA 3QPTA 1MJBA 3GYHX 4CDGA 2WTEA 3E5UA 1J0RA 2FMYA 3TKYA 3T1BA 3EYIA 1W5TA 2VODA 1FYMA 1B59A 1DPRA 3V7RA 3QP6A 2QBYB 1KQ9A 3VODA 1SFUA 2QWWA 1BIAA 5EEHA 1FLIA 4M9ZA 4YFNF 4BHPA 5D8KB 4G6QA 4Q5SF 2EWNA 3M8FA 2BE5F 3I64A 1HBXG 2FQ3A 2CG4A 3LA2A 1K78B 3DPTA 3F6OA 2IA0A 4LB6B 4P9UA 3E3VA 3F8NA 2A6HF 1MJ9A 3T5XA 1A04A 3CTAA 3F23A 2YU3A 4AD9A 3KP7A 2YX7A 5KK1A 3VOEA 1LDJA 2DW4A 3KEQA 3U2RA 1ZRFA 2PMHA 3H3ZA 3QU6A 5D5WB 1EV7A 2ISYA 5FD5A 4P55A 1YIOA 4PZJA 3WTSC 2COMA 3GZ5A 1L3LA 2VBYA 2D1VA 3E5QA 1KYZA 2D2WA 2FSWA 1XCBA 4I0AA 2EV5A 5E8IA 4U0VA 4I01A 4HOBA 1G3SA 2VE8A 1SD4A 4O6JA 3WODF 1IXRC 3FMRA 3AAFA 2MLGA 3F8CA 3LFKA 4ON0A 4KMFA 4LLNA 4IVNA 5LGUA 1B4AA 4RAYA 5KVRA 2GWRA 5HDNA 1YQAA 1ZG1A 3M8EA 1D3YA 4RB2C 3MZHA 3W6JB 2VE9A 5BOXA 1SMYF 2Y0MA 4WK8F 1ZREA 2E1CA 2H6CA 3V7CA 1PDNC 1P4AA 2BEOA 5F1RA 3ULQB 1HSTA 2DTRA 3LAJA 4L9NA 3DF8A 1J59A 3GLXA 3FMSA 1PUEE 3CJNA 3V4GA 4I7HA 2Q2EA 2GAUA 4R8HA 1ON1A 4MTEA 2VT2A 3SZTA 1S8NA 3HTUA 1F9NA 1MZBA 3IHUA 2JPCA 1HKTA 1O3TA 3V8JA 2Z3YA 1IXSB 4Y15A 4YFKF 4DNCA 2FOKA 4M9XA 2EA2A 2BGCA 1I5ZA 3I4PA 4IJAA 1S29A 2XAHA 2RN7A 5D5VB 3P9KA 1BI2A 4LG0A 4I2OA 4CZZA 3BY6A 2AXLA 1Z7UA 2M5WA 3LA7A 3DP7A 1TQIA 1Z05A 4OIPF 2DBBA 2EA4A 3QU3A 1ZH5A 3KE2A 4KICA 2LF7A 2FE3A 3H92A 4EV0A 4KUMA 1ZGJA 2E1NA 3JAMZ 3M9AA 3JSPA 1USTA 4MTDA 3H3UA 3C18A 2H94A 2ISZA 5J8CA 3R61A 2DFIA 4UVBA 5FLXK 3KCCA 5CVRA 1F4KA 4R1HA 5LHGA 3WTUC 5F6FA 3I71A 2RQPA 1RUOA 1U5TA 3LWFA 4HDUA 5ILSA 3HSFA 3ECHA 1FSHA 5LEKA 2M1BA 2L54A 2WC2A 2DK5A 1Z1DA 1BI0A 2KIUA 4ASNA 3RKXA 1SAXA 1BOAA 4Y17A 4ENNA 3U1DA 3WTXC 2GA2A 5L3GA 1XDSA 2F5EA 3HRSA 3BROA 2DPDA 1REPC 2WWYA 2K4BA 4P5OA 1EH7A 2K4JA 1P4WA 3BWGA 4FX0A 4ZYGA 4U7DA 5JHUA 1B6AA 2VBZA 2AS5F 1SD5A 1S7OA 1OYWA 3K0LA 4LJZF 2JTVA 4I09A 5F64A 2BV6A 2RDPA 5DYMA 2YR2A 4KN4X 5ICFA 4KYWA 5H6QA 1J2XA 4MEXF 2EFPA 2ESNA 3IKVA 1SD7A 2DK8A 1IN8A 3BOQA 3TDZC 2ZMEB 2CSOA 2Q8KA 1FX7A 2GIVA 1STZA 2WV0A 1FOKA 4EJUA 1CF7B 2XGXA 4HZFA 4XSXF 3JAMK 2VXZA 1VTNC 4U0WA 2V6CA 4F7ZA 2FRHA 1IF1A 1ZRCA 3PQJA 4EGZA 1CGPA 2X0LA 1BJAA 1I6XA 3JW4A 5ILVA 5FD6A 3TOAA 1MJAA 1R1TA 3ERED 3FF5A 4O5VA 2EFQA 3ML6A 4EMSA 1BI3A 2FF4A 4P96A 4WXDA 1ZAOA 3N4MA 1SD6A 4WF2A 2NNNA 3EETA 3GEZA 3ECOA 3TDUC 2L01A 3DFGA 5E18F 1JXSA 1FZPB 2FA5A 5H20A 1WWXA 1RUNA 4U7BA 2F5DA 3IWFA 3NQOA 4L0YB 3T8TA 4GYGA 2FU4A 1S6LA 2CFXA 4UV9A 3WE3A 5L3CA 3EYYA 3ABTA 3IL2A 1IAWA 4GCVA 2JPBA 1T0FA 1H9GA 2OA4A 3CDHA 4LK1F 3F8BA 2R7FA 2ZMEA 5D6FA 3VFZA 1LDDA 3IKTA 2QZ8A 2HTJA 1KQ8A 1I27A 1LEBA 2JSCA 1OMIA 2QM3A 1B9NA 1R22A 1MD0A 4A0YA 4JQFA 3Q9VA 1QQIA 1V4RA 1Z9CA 2TDXA 1ZARA 3S2WA 4M71A 4U0YA 3ZN1A 1AWCA 1O3SA 4LG0B 2JZYA 5A2QZ 3QRFF 2A07F 3DV8A 3FWEA 2HYGD 3J81Z 3ZMVA 5HVQC 1YW8A 3HHGA 2HOEA 3CUQB 4D0PA 2X4HA 3HYIA 1R00A 3PFIA 2ZNYA 5FO5A 3IRQA 3KP2A 3K2ZA 1B1BA 2QENA 5L3BA 5CLSA 5DCMB 3GFLA 1O3QA 2ZBKA 3M7GA 4K2EA 4OIQF 2YPRA 3ISPA 1R5GA 4HA8A 5AIQA 1CF7A 2FNAA 5D4RA 3R0AA 4OIRF 4LLLA 4L18B 2PMUA 4UNOA 1KU9A 2P7VB 5ILUA 3MCZA 3GZ6A 2OZUA 5FFZA 4LGWA 3JTGA 2EJRA 4R79A 1QZYA 3E5XA 1NHAA 3D0SA 3F8MA 1XMAA 1EH8A 3GFMA 2PI0A 1T39A 3GUDA 3MZYA 1ODDA 4G7OF 1HW1A 5HLGA 4RGRA 5CVJA 3FXQA 3E6MA 2RGVA 1I1SA 4RGUA 2QQBA 4ZYHA 5D5UB 2BBYA 4WX9A 3BJOA 3K1PA 5EEGA 2OBPA 2ESHA 4HX7A 4IXAA 5LRSA 3TO6A 4PCQA 1P92A 4M73A 4S04A 4IHSA 4A6DA 3G73A 5A2QK 5JI6A 1KQ0A 1Y0UA 2DQLA 4ETSA 1JHFA 3L00A 3FHZA 3ZMSA 1U6GA 2G7UA 1KU2A 2KKOA 2P6SA 3P9IA 5FFXA 2A68F 2PLYA 3E6CC 4EQQA 2R7DA 4ZH4F 3SQNA 3HSEA 4AVPA 4S05A 1FBQA 2L4AA 1XSDA 5IT3A 3TO9A 2GA1A 2P5KA 4BYYA 2V9VA 1WSUA 4KIFA 2H6BA 1XSVA 3C1DA 3IRRA 4YFXF 4LB5A 2A5YB 1IN7A 1FP1D 2FNPA 1XMKA 2ZO4A 4HQMA 1SMTA 5D6EA 5ICGA 3KETA 3GFJA 2PEXA 2LNBA 2GZWA 1TTYA 3FXUA 2J5PA 4TV7A 1BIBA 1BI1A 4Q4ZF 3L9FA 4UVAA 2E7XA 4IHTA 3CO6C 4A5NA 2QYOA 3SXYA 1D8JA 4ZYDA 5BPIA 1Z91A 1DP7P 1DUXC 5LGNA 1LNWA 4MNUA 3O3KA 1X3UA 2E7WA 4XLPF 1PP7U 2XAFA 2VN2A 4B8XA 3BJAA 3KFWX 1LQ1A 1DPUA 4GGGA 4L0ZB 2FBIA 1G6NA 5DEQA 3BP8A 1J5YA 3BZ6A 1V3FA 3F3XA 3E97A 3KP6A 2J5OA 3J81K 4U88A 3TO7A 3MFKA 4EJVA 4IPAA 1T6SA 3I59A 3HIFA 1ZLKA 1QZZA 1Z6RA 2LKPA 1JGSA 1U5TB 3WTVC 3I59B 2Q0OA 1XGOA 3SZPA 5JFRA 5ERIA 1USSA 4E70A 2G9WA 1LJ9A 4BH9A 4M72A 4EJWA 2P8TA 4YIIA 2LSOA 2ETHA 2RNJA 3KZYA 4KNYA 3ZN0A 2CQKA 1IN6A 2VC0A 3K1MA 4MGRA 4MHGA 4HX8A 1OYIA 3BJ6A 2P4WA 3WE2A 5IT9Z 2MH9A 5CVIA 5D8LB 2V79A 2NAZA 2QBYA 1OPCA 1P4XA 4HW0A 4G9YA 2OQRA 1LB2A 3R6SA 6PAXA 1KGSA 2DI3A 3Q9SA 4OOIA 4HAMA 4UHTA 1LEAA 4G94A
chains in the Genus database with same CATH superfamily
2DT5A 2VLAA 3CCJI 1YRNA 2VJ4A 2VT3A 2F5FA 1VQNI 3S8PA 3KP4A 4LITA 5FROA 4L9TA 2WAQA 4EM2A 2LF8A 4FHTA 2TCTA 1ZG5A 5K5OA 4O3MA 2XVCA 4HSRA 3BCAA 5E1WA 2QLZA 3MD2A 4I02A 4G8XA 2GXBA 1VNDA 2L9NA 2RVCA 2HR3A 4DZPA 1XGMA 2STWA 3NRVA 2LDUA 2NOJB 2ZSIB 1H89C 2BY3A 3BR3A 4AIHA 4ZZLA 3U1KA 2VQCA 4HNTA 2HKXA 2MA3A 1I3QJ 1TLHB 2EK5A 3IH4A 3L09A 4WXHA 3FKIJ 2BZTA 4E7SA 2P6TA 1AOYA 2EV0A 2STTA 2LP0A 5DV5A 1A31A 1BN5A 3HRTA 3KIOA 3QYFA 4XKVA 3RZOJ 4XONA 2VJJA 4G7HF 2E36A 1BC7C 4KN7X 4Y33A 3K4KA 4II2A 2DPUA 1G59A 3HRMA 2KZVA 3FK7A 4DBQA 4UB6C 2RNGA 2QQ9A 4BNCA 2FJ1A 3BQZA 2JA2A 3R60A 1Y1WJ 3RSNA 1P2FA 2Z9OA 3GXOA 4E7JA 1UAAA 3W6KB 3H5NA 1F36A 2EV6A 4RS8A 3HOSA 2F2EA 5CYVA 1LFPA 4BQQA 1YW7A 5HS7A 2MABA 2IT0A 3I53A 1B8IB 1GUUA 2XPUA 4LLGF 1JHHA 3A4CA 3QPHA 4Z2YA 4UY8I 4ZJZA 3L7WA 5F0HA 3IC7A 1VQLI 2DCEA 4X1EA 1OYYA 3WU0A 4YG2F 3VYRB 2O03A 3BT9A 2M8GX 1G3WA 2LY1A 2QSHX 2HOAA 1W1WE 5JVTA 4NHJA 1MBFA 1NG6A 3ZXSA 2XF6A 3ZR8X 2M0CA 4XICA 2HYFA 1XD7A 3IH2A 2QQAA 1O3RA 4QLCU 2R92J 3RTRA 3H0GJ 1TQPA 4B09A 1TT5B 1MMAA 2DMUA 2IEKA 1WKMA 4HBLA 2AQEA 1MBHA 1T98A 2HFHA 2XGEA 2MBFA 1R5HA 5HLIA 5FRMA 1FOYA 2BYVE 4EGYA 4CCMA 4OU0A 4XNFA 2IS2A 1RNLA 5IT9K 5J1YA 3FZVA 3DEEA 2LRDA 3I58A 2IXSA 1S7AA 5D4SA 2KZGA 3MQ0A 3HUGB 4UUSA 1OCOH 3B02A 3VYUB 4IEJA 3TBIA 4ANJA 3HHHA 2XAGA 1O57A 2QVOA 1MSFC 2IS6A 1FT9A 3NARA 4A3CJ 2M87A 4HYEA 1BA5A 3OS2A 2D1HA 4NQWA 2EIKH 4BL0B 3FIWA 1CQTA 2VJIA 3JRDA 1XN7A 3JRIA 2UWMA 1TZLA 2V1XA 3G4SI 2R7TA 3RKYA 1SEUA 1MSEC 3DU6A 1OR7A 4IX7A 1RR8C 4I0BA 4D1QA 3IH3A 1XGNA 3F22A 1X1CA 4RGXA 1XCVA 2E1OA 4QPOA 1X1PA 2ZMEC 4LMYA 5M3FJ 4WWCA 3F21A 2L9RA 4DYRA 3CF2A 4BAYA 1I1GA 1UHWA 1HXDA 2HQRA 4XIDA 4JBAA 1AKHB 3GTQJ 2H8WA 1SFOJ 1QBJA 1UB9A 3IWZA 3L1PA 1OCTC 1FMWA 2W00A 4A3EJ 2VXDA 5LLQA 4HLYA 1OCCH 5CJ9A 2R7WA 4DW6A 1VQ4I 5F1JA 5EEAA 4L5IA 2R3SA 2UXNA 2M7AA 3FBNB 3HGGA 3W2VA 1IXCA 2MGQA 3SDBA 2HQ5A 3HG9A 4ESJA 2XROA 2DLLA 2DYSH 4L9JA 2NRAC 3OL4A 3CF5F 1KU7A 4EJOA 2IA2A 4WCGA 1VQ7I 2QSFX 4X6AJ 4PJLA 3P9CA 4E7LA 1IRGA 3U21A 3VSLA 3ZMDA 3WTZA 2DXIA 1L0OC 1WJBA 5BQTA 1Q1HA 1R58A 4A12A 1I3AA 2P5VA 3M3YJ 3S2DJ 3EDPA 2CW8A 3WG9A 2ZJRF 4RLQA 4AWXB 3GF2A 2XV4S 5DUIA 2LD5A 2FEZA 1F5TA 4HNUA 3RYRA 4PFOA 2XUBA 1R7JA 1Z67A 2BHYA 3DXJF 4DYCA 2L7KA 1YYVA 2DAOA 4HF1A 2V1UA 4PDKA 5M5WJ 2V9PA 1MGTA 3HRUA 5HLTA 1K79A 2BVLA 3QAHA 1ERDA 4XMYA 1X1DA 2XHKA 1YG2A 2ADUA 2KRFA 3IUOA 3EUAA 2YX4A 3OIOA 1FYKA 4E4HA 5C4JJ 5L3DA 1FP2A 3WTTC 4LG3A 5K7FA 3WU1B 2VASA 1IRZA 2QGUA 1M1EB 2R93J 2L5QA 4QWQA 4OIOF 2K9MA 3FM5A 4I98B 2K7LA 2FBHA 4IF4A 1U5TC 1KYWA 3R0JA 2OZ6A 4KT5C 4RAFA 3HOTA 2ELHA 5HDGA 2P7CB 3KZZA 1K6OA 3GW2A 5TISC 2DO7A 2W48A 1TQMA 2OU2A 1IDZA 4RAZA 3S3MA 1JUSA 3ZMUA 4P1WA 3ZQ7A 5JVGF 2PN6A 1HW5A 4BHCA 4ENMA 2OTLI 3K4JA 2NS0A 2P5LC 2KJCA 1R36A 3R4KA 3TP0A 3N05A 1A5JA 5D5XB 5FKMA 4MQVA 3VSKA 2PBIA 3VYSB 5E1XA 4Y13A 1ZLJA 4BXXJ 1RI7A 3P5JA 1K6YA 1MBJA 3PNTA 3PL8A 1LPQA 4HF2A 4YIFA 2M9HA 3CUOA 3RIRA 5DUKA 2OJED 3TGNA 4IHXA 1DU6A 2ACJA 5L3FA 1HW2A 4RGSA 5HNHA 2DOEA 3CUQC 1MKMA 1SFXA 4A3IJ 2OQGA 2XRNA 2WADA 5GTIC 2W25A 4CCJA 5HS8A 1NH3A 1FPQA 1WCMJ 1MBGA 4KITB 2VBXA 2KFDA 5ICCA 1Y8RB 4AC0A 3JRCA 2O0YA 4BXUA 1NK3P 3K1NA 4FETA 4UV8A 3TL4X 2ZXIA 4GRIA 3K9TA 1MMNA 4ENJA 2JRTA 4L5EA 1YTYA 3LA3A 1H88C 3J7ZI 2W84A 2HOSA 2LYCA 1YI2I 2FXAA 3HSRA 3KLOA 2Y48A 3L2VA 3VWBA 4C3HJ 3KEOA 2L4MA 3REOA 2M8EA 1GV2A 2GOXB 3HGYA 4UUSB 1BOBA 1IW7F 2IJLA 2R7OA 4JK1X 3BZCA 2O61A 1GXPA 1XSXA 4A3FJ 1AU7A 2R7QA 2HWVA 2H09A 3V8KA 3CCQI 3ABUA 2M45A 1FYLA 2YU9J 1FWZA 2BY0A 3G3ZA 2GXGA 5E8GA 1S3JA 5DDGA 3JCUC 5DD4A 3TQNA 1E2XA 3J80Z 4EM0B 3O6BB 1G2HA 1R6RA 1JT6A 2NVYJ 1MH3A 1QVTA 1VQMI 2UXXA 1YW9A 1J9IA 1RC9A 1A36A 1O7LA 5HOOA 2ID6A 2A3SA 3AG2H 3ZGKA 1HKSA 2R7UA 3KPHA 4Q47A 2OD5A 4FE7A 2Q2EB 2XIGA 4HF0A 3ZMTA 5LBQA 3LSIA 1YS6A 3RPUA 4JX5A 3GO5A 1D5VA 4WXCA 1R1UA 1SC7A 4IHVA 1Y39A 2VQLA 2AQFA 1ZRDA 2E2IJ 2HGCA 2FBKA 3V8LA 1E17A 1B72A 4CCLA 5AIPA 3ZP5A 1H9TA 2X6OA 5K7ZA 4JYKA 3TP3A 3DKWA 1G3TA 1FSEA 3K4MA 1JTYA 2JT1A 1YJ9I 1MDMA 2Z5UA 1IUYA 3WGHA 2HS5A 2PQ8A 2C6YA 3QOPA 4PK4A 3PQKA 5J8FA 4RB3C 4XL9A 4UUTA 3ZQFA 2RQQA 3RKWA 4DYQA 4Y7NJ 4N9HA 2D45A 1H0MA 2RV8A 2VKDA 2R0QC 1LVAA 4XRFA 5JLXA 2RKHA 3GCMA 2I10A 4AIJA 4IRHA 1T8IA 3CCSI 2NVUB 2JA6J 3QP5A 3L2UA 1E3PA 2IGKA 4OAZA 5CVVA 2HDCA 2MLKA 4A0ZA 5BMZA 1PUFB 1GXQA 4YELA 4UXNA 1VF9A 3GVAA 3EQLF 5H6RA 4HPQA 3DPLC 4GFBA 2LREA 3KLNA 3I54A 1JT0A 1K78A 2PJRB 3M1CA 3RQIA 3PO3J 1T95A 1VI0A 2LVSA 3B6CA 4EEFG 3RDIA 3ELKA 2R7SA 5AONA 5EG0B 1SVLA 5LHIA 3T8RA 1YFHA 3N97A 3HOXJ 1J09A 4HQEA 3F9KA 2GXAA 3F8FA 1YLFA 4G7ZF 4A93J 2HQNA 3HOUJ 5E20A 1UHMA 3QWLA 1BL0A 4G6DA 3C3WA 3WGGA 1D1AA 3PIOF 3Q5FA 1JE8A 3FMQA 4KIGA 3FM3A 1ZYRF 4A6EA 4A5MA 3V42A 2E2HJ 5CVUA 2LY2A 4N4OB 2M34A 2XDVA 2RREA 4ZTFA 1XMXA 2W85A 2JUGA 3KP5A 4C9YA 4ITVA 1XC5A 4ESBA 3LSRA 4BE2A 2GQQA 3E6BA 3DEWA 2E1MC 3MN2A 4CCOA 2FUG2 3HPHA 1QPMA 2XF7A 5JR3A 5GADJ 5EGOB 1B8IA 2A69F 2W24A 3TW6A 3BPVA 1AA7A 1HKQA 5DM6F 4XR6A 2IPQX 3HB9A 2O9LA 2JRMA 5HLHA 1A35A 3V7SA 3J80K 4GXOA 3LQQA 1WGXA 5K1YA 1TW2A 5HNFA 3JRAA 2ID3A 5LEJA 3HEFA 3OY9A 4F52A 3EUHA 3KEYA 2DMQA 2NXNB 2O8XA 5TJJA 4KIBA 1R1VA 1XG1A 1W4MA 3K7AJ 1T2KA 4XLNF 2MD0A 1W0UA 1LE8A 2DU9A 1F1ZA 1FNNA 3EPZA 2EZLA 2VPLA 4LK0F 1UHSA 4HNVA 4HG2A 4LFUA 4BJ5C 1XX5A 1GHCA 1SVOA 2CYYA 2HVRA 5LGTA 1ULYA 1SVMA 2E5ZA 4XKBA 1ZN2A 3FX3A 5GAHJ 2E60A 3GTLJ 3H3VK 1FY7A 3GFIA 2H27A 3U9GA 3IAS2 4BJTA 2KHMA 4G6TB 1YE9A 2HKOA 2JVHA 4KDPA 4XLAA 2EIMH 4ZYEA 1BM9A 3WGIA 2KDOA 2W7NA 2X6WA 2OAZA 2CJJA 2O6GE 3PSIA 3VB2A 3OR1C 4GO1A 2CUJA 2HPMA 4RB0A 2CWEA 2IW5A 2DT6A 3HTSB 2CUFA 2EFWA 3ONQA 4LIUA 1JTXA 4NBQA 5HS9A 2ZJ2A 4B47A 4AIKA 1XB4A 3GTPJ 1KU3A 3ZMZA 2NYXA 4BQAA 2DOFA 1U8BA 2ZKZA 2P81A 1U3EM 2KIMA 3LMMA 1R9TJ 3TOBA 1QO0D 1U8RA 1YHQI 3K4NA 3L2CA 5DCMA 3E6DA 3OYEA 1ZG3A 4GYIA 3C2HA 3BG5A 4UUVA 3COAC 3RPQA 2LMDA 3PNVA 2RAEA 5IP7J 3ZCOA 1Y1VJ 2WBMA 1BJZA 2R5YA 3PFYA 1IZ1A 2Y0SN 2V9KA 5EDNA 2VC1A 2Y9ZA 2EBIA 2CU7A 5IPAA 4ZZDA 1TL8A 2E2JJ 1O7FA 2DA5A 2XGCA 1XGSA 4Y3OA 1T33A 3CLOA 2UUZA 3I0TA 2JA5J 2ZNZA 2XAUA 3FDYA 1JI8A 3C7JA 2UZKA 1J75A 1EH6A 3CUQA 2KLOA 4PSWA 2JWTA 4PGHA 3PM1A 3VYTB 2A61A 2EFNA 1OR7C 2VKEA 2MH2A 2BXYA 1GVDA 2EB7A 1MBEA 4CYDA 2NNYA 4LD5A 2KL4A 1IN5A 4IQJA 2Y9YA 4L5JA 4XOPA 2O8KA 1WQ2A 3H0DA 4B48A 3GX4X 2EZIA 2L02A 1HQCA 4HV6A 3T0YA 4NQWB 4AM3A 2E1MB 1VZ0A 2X1DA 2Y30A 1ON2A 3CCMI 1QNTA 4EM1A 2A6EF 1TWHJ 5DCFA 3HOYJ 2OCEA 2DQRA 1X3WB 2K86A 1ZHFA 2HEOA 1R23A 2Z99A 1TBXA 5LHHA 4HV5A 2WAEA 3DU5A 5CQEA 5BPDA 2M4GA 3I4NJ 4M74A 3ZPLA 2KJBA 2LH9A 3GZNB 4RAGA 2IGMA 2I5UA 2Z33A 5DD8A 1ETWA 1FBSA 5E17F 4CSWA 1JJ8C 3WTYC 2FOWA 1W36D 4IRGA 2ZC2A 3FISA 3BG7A 2ZXJA 4NB5A 2CH0A 2R5ZB 4MFDA 1IGNA 3MAJA 3SFIA 1IN4A 2X9DA 2GOMA 3KP3A 1ZGAA 2IA1A 4BGDA 3G2BA 4XKWA 3GWZA 4RBOA 4IHWA 3FXOA 3JSOA 3ROUA 2K02A 3A0HC 1C0WA 2XAJA 3CMEI 2V26A 3O8GA 3NEUA 4YRVA 1TW3A 3OYNA 4BACA 4XOTA 3QYEA 2V1DA 1U78A 2IRFG 2NVXJ 4CXFA 2M7BA 4I76A 4ESFA 2Y75A 2DJIA 3B73A 3J7AO 1W7PA 3MWMA 2EH3A 4II3A 4RB1A 2LFBA 1PP8F 2RC4A 1U2WA 1LUJB 2IVMA 1X1BA 3RYPA 3MKZA 1ONVA 1JKOC 5LRRA 4XRMA 1D8KA 2L7MP 1HSJA 4CHUA 5KCMA 4S0HB 4CO8A 2Y2ZA 2PG4A 4MQ9F 2XASA 4YIRX 4M9SA 2XAQA 3GLLA 3GTGJ 2L7FP 2CGPA 1KA8A 2WAFA 5FLXZ 3OYAA 2HTSA 1IRFA 1S5LC 5M5XJ 3CO7C 4N0BA 3G71I 5GPAA 2ME0A 3M1EA 2IBDA 3MEXA 5E1ZB 1RIOH 4BHBA 4HLXA 2IP2A 1BC8C 1WI9A 3K69A 1G4DA 1UFMA 3ABKH 3GTKJ 4A0XA 4KFCA 1FC3A 1QZEA 4XBFA 3LAPA 2QKMB 4XSZF 3L2WA 3CDLA 4P9FA 3OOPA 1N25A 4OMZA 1AHDP 4BJ6C 2DFFA 4HX4A 2HZTA 4F93B 1B72B 3RI4A 4BBRJ 2CFOA 3HKZN 1D0XA 2DYRH 3WTWC 1ZR2A 1GVJA 5BS6A 2ZFWA 4L9VA 1MDMB 1P6RA 4A69C 5L3EA 1QGPA 3D5LA 4F92B 5ICEA 5IY5H 2X6XA 4N9IA 3DQVC 3HZJA 2VOOA 1S72I 5GPCA 3JREA 2MSYA 3LQRA 3LL7A 2QUFA 1K7AA 2F4IA 3FXKA 4PJ0C 3PSFA 3OSFA 2HDWA 3ZQQA 1JGGA 2PFBA 3RKQA 5EYRA 5FGMA 5B1BH 4OINF 1HLVA 2W57A 1ETQA 1IDYA 5HODA 1EJ9A 1Z6TA 2CW0F 1VQ5I 5F0CA 3L2RA 5IP6A 3RCOA 3HUGA 1Y8QB 4MEYF 1T38A 1W7PD 3BDDA 3FXRA 4D5FA 2KIFA 3VEPA 3WHCA 1TP4A 4CGZA 3OYKA 1YS7A 2Y69H 2KDZA 2XGDA 3PJRA 2ICWG 2CQQA 2F5CA 2R5ZA 4OMYA 2MW8A 3P7NA 2ZCWA 2L3DA 1YJNI 4W97A 1FMVA 3DEUA 4DQ2A 4UB8C 1RZ4A 1BR4A 1WRJA 2JN6A 3VPRA 1RETA 5TRDA 2M30A 2XKOA 2HPIA 4CA0A 1TNTA 1V55H 4ENKA 4A3JJ 2HVSA 4BY1J 2G7HA 3I5UA 4QSHA 3K70C 2CRGA 4Z6YA 3ASOH 4NNJA 3ZRGA 1YIJI 2VONA 3EUHC 2KRCA 1T56A 3G1MA 2VIXA 3SFZA 4RMNA 4LIVA 1GLNA 2QEXI 4HDVA 1W36C 1DDNA 4XLHA 3LSTA 1QA6A 1UCRA 2K27A 1XDUA 2JQ7A 1DGWY 1J7KA 3JTHA 4XN0A 4M6YA 3RJPA 1FBUA 1TNSA 2MD5A 2V6EA 2YSRA 1G3YA 1E3OC 2FMLA 5IOZA 1I6HJ 1U9OA 4KMUX 4A3BJ 4H0EA 2Z1DA 3LOCA 2A5WA 3HJEA 5EF6A 3O2PE 1OCZH 2CQXA 5ED4A 2DMTA 4XN3A 1W5SA 3E0JB 5EG0A 2XKPA 1SAUA 3UR3C 2A05A 4M6XA 3JR9A 3GMEA 3WHBA 2PMZA 2HDDA 1APLC 4UVCA 1W7PB 2CO5A 5J6XA 3CCYA 1FOWA 2LKXA 4Q48A 5K5QA 5HDKA 4FX4A 4CICA 3FXMA 3SHFA 2K9NA 2O3FA 3PO2J 3F6VA 1BBYA 5E79C 2XF5A 5FKOA 2HQAA 1F43A 3ERMA 4B43A 2PJPA 3CMMA 5FLMJ 2H8RA 4EJTA 4PGGA 2K3PA 3F72A 3LSKA 4FT8A 3MKLA 5FB2A 1ETVA 3GTMJ 4EVIA 3BG3A 1Z3YA 2VBWA 4IRIA 4J00A 1N78A 1YO5C 2B0LA 4IHYA 2MC3A 3G1OA 2AO9A 2FX0A 4MO7A 3OYHA 3A03A 1MH4A 1OKRA 2KQRA 3BPXA 4A3DJ 2VOPA 4C2MJ 3IAM2 1LDKB 1TWGJ 3QPLA 2EFOA 5FKKA 3CCVI 2QKLB 1B9MA 4BQNA 3JRGA 5K5RA 4KA4A 1WJFA 3Q0UA 4M3FA 1TWFJ 3OV8A 4A2UA 1SFEA 3QPTA 1MJBA 2A6TA 4ZDPA 4AUXA 4CDGA 3GYHX 2IGNA 2WTEA 2HXOA 3E5UA 3K4BA 1XPXA 2V4JC 1J0RA 3C2GA 2FMYA 3TKYA 3T1BA 3EYIA 1W5TA 2VODA 1FYMA 2WY7Q 1B59A 1DPRA 3TMOA 5EZHA 2R7VA 2KISA 3S93A 1Z3XA 3LNQA 3V7RA 4RA2A 5J4YA 3QP6A 2QBYB 4M3GA 1V5FA 1LKXA 1KQ9A 2GIZA 3VODA 1SFUA 5C3EJ 2QWWA 1BIAA 2W4SA 2Z16A 5EEHA 2O7OA 3HOZJ 1FLIA 4M9ZA 4YFNF 4BHPA 4PJJA 5D8KB 2DMNA 4G6QA 2JA8J 4Q5SF 2EWNA 3FXLA 1Q1VA 3M8FA 3OYCA 3SEQA 3PUBA 1D1BA 3I4MJ 2BOLA 5H2FC 2EPFA 4CYCA 4V19K 1MNEA 2BE5F 3BCBA 2B9SA 3I64A 2MFZA 3AG3H 1HBXG 2ZB9A 4E6KG 2FQ3A 2CG4A 2CQ7A 3LA2A 1K78B 1HA8A 3DPTA 5IYCJ 3E1SA 3ZQCA 4BE1A 4XKCA 3F6OA 2IA0A 4LB6B 4P9UA 5F27A 3E3VA 2F48A 3F8NA 3BC8A 2A6HF 4C3IJ 1FIAA 1MJ9A 3T5XA 1A04A 3CTAA 3S32A 3F23A 1I50J 2YU3A 4AD9A 2M2EA 1X58A 4FE4A 2JMWA 5K7HA 3KP7A 2YX7A 5KK1A 3DTIA 1WPKA 3VOEA 1LDJA 5FRNA 2R7XA 1YOVB 2DW4A 3CCLI 4E7IA 4ABZA 1OCRH 2E71A 3KEQA 2L9SA 3U2RA 1ZRFA 1JUPA 2PMHA 3H3ZA 3QU6A 5D5WB 1QRYA 1EV7A 2LBFB 3W2WA 1GV5A 1X2NA 2ISYA 5EGOA 4XLCA 3PUFA 5FD5A 2ZJQF 2O5RA 1UG2A 1MMSA 2K9LA 4P55A 1JKQC 1YIOA 2K40A 1R71A 3I55I 4XK4A 1RKWA 4CCNA 4PZJA 1AKHA 3WTSC 2COMA 3GZ5A 1L3LA 2P0WA 3PNYA 1IG7A 1WVRA 2LBFA 1HF0A 3EUKL 2VBYA 2D1VA 3OIQA 3E5QA 3K2AA 2MG4A 1KYZA 2BW3A 2D2WA 2FSWA 1S7EA 2BHZA 1XCBA 4I0AA 3A02A 1X2MA 2EV5A 5E8IA 2COBA 3ZQGA 3UNGC 4U0VA 4I01A 4HOBA 1ETOA 4BKXA 1G3SA 4IO9F 3BR6A 2VE8A 1SD4A 3BTIA 2VQGA 3FHNA 3JRHA 1PJRA 1JUMA 2VJ5A 3KYCB 3LFUA 4O6JA 3WODF 1V5GA 1IXRC 2XRLA 3FMRA 3ZOBA 3KX2A 5IOYA 3F0CA 3SJMA 1SFKA 2EIJH 4KISA 2BW3B 2MLGA 3AAFA 3HC7A 3F8CA 3LFKA 3G1LA 4ON0A 3L2QA 3D1NI 3GTJJ 3H9QA 4KMFA 1IV8A 4ZDOA 4LLNA 1YX5A 4IVNA 5LGUA 1B4AA 4OWRB 3CJTB 4RAYA 1ZR4A 5KVRA 3OR2C 2GWRA 5HDNA 4ZC3A 4CYCB 3FK6A 4XLEA 2CV2A 1YQAA 5E3LA 5B5EC 1ZG1A 3LSHA 4DJAA 1QPIA 2ECCA 2E5NA 3HM5A 1IUFA 3M8EA 1D3YA 2DFEA 4NC6A 3A0BC 4RB2C 2IS1A 4DBRA 3MZHA 4AU7A 3W6JB 2N8GA 2VE9A 1FTZA 1MBKA 5BOXA 1SMYF 2Y0MA 1FOXA 4WK8F 1ZREA 5E3OA 4RDUA 2E1CA 2H6CA 3BR2A 3V7CA 2HYJA 4AIDA 5GAEJ 1P4AA 2BEOA 5F1RA 3S1RJ 2X1EA 1PDNC 1LFBA 1HSTA 3ULQB 4B1RA 1HDDC 1QU3A 2DTRA 3IV5A 2EZHA 4XORA 3LAJA 4L9NA 5J47A 3DF8A 1J59A 3GLXA 5GTHC 1MIJA 3FMSA 2DDAA 5J1UA 3SYTA 1DU0A 3CJNA 3V4GA 3OYMA 1PUEE 4I7HA 4FQGA 2Q2EA 2GAUA 4R8HA 2F6CA 4F91B 4CCKA 3GTOJ 1ON1A 4MTEA 4EATA 2VT2A 3RPUD 4OAYA 5EJCA 4BDZA 4E7KA 3SZGA 1ZTRA 3J7AY 3SZTA 1S8NA 2CS3A 3HTUA 1F9NA 2EILH 5B3SH 1MZBA 1X1AA 2I8DA 3IHUA 2JPCA 1HKTA 3X2QH 1O3TA 3DKXA 3DTKA 3V8JA 4PFPA 5F08A 2Z3YA 2LKSA 1IXSB 4Y15A 4YFKF 4DNCA 1Z21A 4C3JJ 2FOKA 3OYBA 4J01A 3KZIC 3AL0C 4M9XA 5FKNA 4HRIA 3I3LA 2VKHA 2EA2A 1EA3A 2BGCA 1I5ZA 3I4PA 4IJAA 1SANA 4F3QA 1ZQ3P 1S29A 3J7YJ 2X1CA 2XAHA 2RN7A 3S14J 5D5VB 2K9SA 1XS9A 1D0YA 2GBYA 2DTZA 3DBLB 2LOOA 3P9KA 1BI2A 4LG0A 1Z7LA 4I2OA 4E7ZA 3D5RC 4CZZA 2NS7A 4BQOA 1MNDA 2LK2A 1PYVA 3BY6A 2AXLA 1YRNB 5J3LA 1Z7UA 2M5WA 1GT0C 2XSDC 3LA7A 3DP7A 1TQIA 1Z05A 3Q3SA 3H5AA 2DFHA 3CJRB 2HZDA 4D9JA 4OIPF 2DBBA 2EA4A 1FEXA 2E19A 3QU3A 2QF7A 1ZH5A 5F0FA 3KE2A 5J4VA 1QHHD 3BR1A 4XRSG 1DGRM 4KICA 2LF7A 2LR8A 2FE3A 3H92A 4EV0A 3W2AA 2CQNA 4KUMA 2K85A 4PJNA 1ZGJA 2E1NA 3JAMZ 3TEDA 3M9AA 3JSPA 1USTA 4NC8A 2MC4A 4MTDA 3CMAI 3H3UA 4X0GA 3CZ6A 2OV7A 3C18A 2F5VA 4D7NA 2H94A 4D5CA 2EINH 2ISZA 5J8CA 3R61A 3UKGA 2DFIA 4UVBA 5FLXK 3KCCA 2H1KA 5CVRA 4IOCF 4BXFA 1F4KA 4IOAF 4R1HA 2UV1A 1V5EA 1Z0XA 3CP8A 5LHGA 5M3MJ 3OSGA 3WTUC 5F6FA 2OCCH 3I71A 2RQPA 2ELKA 2IGOA 1RUOA 1U5TA 2JJ7A 3LWFA 3SDGA 3NWTA 4HDUA 3S16J 1MNMC 4V2GA 1UJ8A 3G6EI 2WB1N 5ILSA 3HSFA 3Q0VA 3DBHB 3ECHA 5IYBJ 1FSHA 5LEKA 2LTPA 1K83J 2M1BA 2L54A 2WC2A 5KAFC 1BR2A 2DK5A 1Z1DA 3ZQIA 4A3KJ 2NVQJ 2VQHA 1BI0A 3CC2I 2KIUA 4ASNA 4LOCA 1IV6A 3W6VA 4U87A 3RKXA 1SAXA 1BOAA 3DTEA 4Y17A 4ENNA 3U1DA 3OYLA 3WTXC 2GA2A 3MZ8A 5L3GA 4XRSA 1XDSA 2F5EA 5DS9A 4CUGA 1VQ8I 3HRSA 1UELB 4DIQA 3D5SC 1U9NA 3LSPA 1MMGA 1E0EA 3BROA 2DPDA 1REPC 2WWYA 1VQOI 2K4BA 1VQ6I 4NUBA 4P5OA 2PJRA 1EH7A 2K4JA 1P4WA 3ASNH 2LC2A 3BWGA 5KNLA 2X85A 4FX0A 1K4SA 3C2BA 2Z2SB 4ZYGA 4U7DA 2XB0X 1RESA 5JHUA 3S3OA 3FXJA 1B6AA 2VBZA 3GBGA 3MVPA 2AS5F 1A6QA 5CKTA 1SD5A 1S7OA 3M07A 1OYWA 3E7LA 3K0LA 2F4OB 4LJZF 4MFEA 4JX4A 2JTVA 4I09A 1IJWC 1ENHA 1I39A 5DM7F 3S15J 5F64A 4DZJA 2KT0A 1WJ5A 2BV6A 2RDPA 5DYMA 1TC3C 2YR2A 3H1CA 4KN4X 1VQPI 3HKZA 1KONA 5ICFA 4Y4RA 4KYWA 5H6QA 2DA1A 1J2XA 3TW7A 4MEXF 3Q0WA 1WJCA 3BG9A 4JOMA 2WV1A 4MIMA 3I9V2 4QPQA 2EFPA 2ESNA 2OF7A 1E3HA 3IKVA 1A6IA 1SD7A 5B66C 3LSMA 5BNGA 2DK8A 1IN8A 3BOQA 3BR5A 3TDZC 1WH7A 2VPRA 2ZMEB 2CSOA 2Q8KA 4FTHA 1FX7A 2GIVA 1STZA 2WV0A 1FOKA 2VKVA 4M3BA 4EJUA 1CF7B 2XGXA 4HZFA 5GAGJ 2AHQA 3QQAA 3M4OJ 4XLFA 4XSXF 3JAMK 5J40A 2VXZA 1VTNC 4JX6A 2V6CA 2JVGA 2WB1A 2FRHA 4U0WA 2EQRA 4F7ZA 2HI3A 1IF1A 3K4LA 3S1MJ 1ZRCA 2NS8A 2D5VA 3PQJA 3DBRB 2HNHA 4EGZA 3HOWJ 1CGPA 3NWSA 3OWTA 4E7HA 3S1NJ 2X0LA 1BJAA 2L2OA 1I6XA 1G8XA 3JW4A 5ILVA 5FD6A 3TOAA 4M6VA 2K9QA 3BTLA 3CP2A 5TGTA 1ZK8A 1MJAA 2B63J 1R1TA 3ERED 2LY9A 3FF5A 4O5VA 4YEJA 2EFQA 3ML6A 1Y0NA 2DA6A 2DA7A 1TWAJ 1U0JA 4EMSA 1BI3A 4KT6A 2XC7A 2DA3A 2FF4A 1RR7A 1D5YA 9ANTA 3OYDA 3K70D 4P96A 4WXDA 1ZAOA 3N4MA 1W5CC 3PIPF 4C2TA 1SD6A 2X51A 4WF2A 5GP9A 2NNNA 3EETA 2X6YA 3GEZA 3HBLA 1WJAA 3ECOA 3TDUC 4BEHA 2L01A 3DFGA 5E18F 3H35A 1R4MB 3AFHA 1JXSA 1ETKA 1FZPB 2FA5A 1ETYA 2G0EA 5H20A 1WWXA 1PVEA 1X4PA 4HSTA 1RUNA 4ZDLA 2XPWA 4U7BA 1T0FC 1BW5A 2R7RA 2L0KA 2F5DA 4QTRA 1PUFA 3BG6A 1P9QC 3H5RA 3IWFA 3NQOA 4C2UA 4L0YB 3T8TA 4GYGA 2FU4A 3OS1A 2WY8Q 1X19A 3AG4H 5JHFA 1S6LA 2QQ8A 2CFXA 2DA2A 1D0ZA 4UV9A 3WE3A 1K61A 1LVKA 3A01A 5J1RA 5L3CA 3EYYA 3DWLE 4ZTJA 1K4TA 5IYDJ 3ABTA 3IL2A 3CJQB 1IAWA 4GCVA 1D1CA 2ZSHB 2JUCA 3OYJA 2JPBA 1T0FA 1BW6A 1H9GA 2OA4A 3BR0A 2E34A 2M0MA 3CDHA 4LK1F 3F8BA 2R7FA 2ZMEA 3KYDB 5FKLA 3HPGA 3HOVJ 5D6FA 4F55A 2DT7B 3VFZA 4AYBN 1LDDA 5LFAA 2QZ8A 3IKTA 2HTJA 5IP9J 2CV1A 1S9HA 1I27A 1KQ8A 4I99C 3BQYA 1LEBA 2JSCA 2KRHA 4BU2A 2QCOA 3CDIA 3ABMH 2HU9A 2CW7A 1OMIA 2QM3A 1B9NA 3S3NA 1VQ9I 1N77A 1R22A 2GLOA 1MD0A 1QHGA 3WG7H 4A0YA 3CCUI 4JQFA 3Q9VA 2L7ZA 2CMPA 1QQIA 1V4RA 1Z9CA 2M4KA 4NDLA 1ITYA 2DN0A 2TDXA 2YUSA 3DPUA 1FJLA 1ZARA 3S2WA 4M71A 3AL0B 4U0YA 3ZN1A 1AWCA 1O3SA 2QA4I 1MW7A 4LG0B 2JZYA 5A2QZ 3H9JA 3DKYA 3QRFF 2A07F 2NVTJ 3DV8A 3FWEA 2HYGD 3J81Z 1X4OA 2FQ4A 3ZMVA 5HVQC 1OFCX 3HL2A 1YW8A 3HHGA 1HCRA 2Y31A 2HOEA 2JSPA 3CUQB 4D0PA 2X4HA 5M5YJ 3HYIA 2GM4A 1R00A 3PFIA 2ZNYA 3CLQA 5FO5A 3DLLF 3IRQA 2IS4A 2VI6A 2ZXHA 1H8AC 3KP2A 2BY1A 3BZKA 3K2ZA 3FBIB 4RLFA 3AKZA 1B1BA 1Y6IA 4PSXA 4M3EA 2QENA 5L3BA 5CLSA 5DCMB 3NAUA 1NG7A 3GFLA 2M3AA 1O3QA 3CESA 2VB6A 1XTAA 2ZBKA 3M7GA 1TT0A 2R4GA 4DGWB 4K2EA 3CMYA 4OIQF 2EZKA 2YPRA 4HEA2 3ISPA 1R5GA 4HA8A 4BDYA 5AIQA 1IO2A 1CF7A 1TWCJ 2FNAA 1IRXA 5D4RA 3R0AA 1ZELA 4W1UA 1RPWA 2ZJPF 4OIRF 4LLLA 1O4XA 4IKFA 2L9VA 4L18B 5E3NA 2PMUA 2ZXWH 3W3CA 4UNOA 4BY7J 1KU9A 5B1AH 2P7VB 5ILUA 3MCZA 1NK2P 3OYIA 3GZ6A 4BBSJ 3DCFA 1ZGWA 1R5ID 2HVQA 2OZUA 5FFZA 4LGWA 2ELJA 3JTGA 4Y52J 2EJRA 4R79A 1QZYA 2YS9A 3E5XA 1QVUA 1OCPA 3KYLA 3DLAA 1NHAA 2HXIA 3OL3A 3D0SA 1FIPA 3F8MA 3CC7I 3BTJA 1XMAA 2W82A 3S1QJ 1EH8A 3LSJA 3GFMA 5FLVA 2PI0A 3QOEA 1P7JA 4PUSA 1T39A 3GUDA 3MZYA 1WHUA 1ODDA 4G7OF 1HW1A 4JP0A 4DOZA 1HC8A 2PX9A 5HLGA 4IQ4A 4CH7A 4XM3A 2B7EA 1NTCA 4RGRA 5CVJA 1OQYA 3CC4I 3H9GA 4BUPA 3FXQA 3E6MA 2RGVA 1OLTA 1I1SA 1VFCA 4RGUA 2QQBA 4ZYHA 2X48A 5D5UB 2BBYA 4A3MJ 1WZ2A 1WJEA 2OPTA 1MMDA 1YX3A 4WX9A 1ACIA 3BJOA 1RRJA 3K1PA 5EEGA 2OBPA 2MYSA 2ESHA 4HX7A 5C4XJ 2Y0SA 4IXAA 2OC6A 4NC7A 5EZGA 3A01B 4BEHB 4FCYA 5LRSA 3TO6A 4PCQA 1P92A 4M73A 4RM3A 3JRFA 4S04A 4IHSA 2OUMA 2V7FA 4A6DA 4ZYAA 2H1LA 4G12A 5A2QK 3G73A 4A3LJ 5JI6A 2CUEA 1KQ0A 1Y0UA 2DQLA 1RKTA 1JHFA 4ETSA 3L00A 1R49A 2V1NA 2WAQN 3B6AA 5CQGA 3FHZA 3CCEI 3ZMSA 1U6GA 3SEZA 1Y56A 2G7UA 4B3AA 1KU2A 1WJDA 2KKOA 5KHDA 2P6SA 3P9IA 5FFXA 2A68F 2PLYA 5F04A 3E6CC 4EQQA 2R7DA 4N4NB 1POGA 4M3DA 3K6GA 3CQZJ 2IAIA 3OOUA 3OYGA 2KIQA 4ZH4F 3SQNA 3HSEA 4AVPA 2E35A 3RQ4A 4S05A 1FBQA 1ETXA 1UZCA 2L4AA 1XSDA 3LSGA 2WA0A 5IT3A 1UG0A 3TO9A 2GA1A 2P5KA 4BYYA 1UMQA 2V9VA 2LLKA 5CPRB 1WSUA 4CZCA 4KIFA 2H6BA 1XSVA 1EKEA 4XQFA 3C1DA 3IRRA 4YFXF 4LB5A 3S17J 3QYBA 2A5YB 1IN7A 1DQUA 1FP1D 1WFXA 2R7ZJ 4IZZA 2FNPA 1XMKA 2ZO4A 4HQMA 1SMTA 5D6EA 5ICGA 3KETA 2XPVA 3GFJA 2ZFUA 3A2KA 3IP4B 3ZQLA 2PEXA 3CD6I 2LNBA 2TRTA 1N75A 1BR1A 1OJLA 4KJZA 2DODA 5E3MA 2GZWA 1TTYA 3FXUA 3I56I 4MLOA 2J5PA 2BVMA 1BIBA 1BI1A 4TV7A 2PMZN 3WU2C 1X3ZB 4Q4ZF 2DMPA 3L9FA 4UVAA 2NOGA 3ABLH 2E7XA 3OYFA 4IHTA 2VUMJ 2CV0A 3CO6C 4A5NA 2QYOA 3BTCA 3A1YA 1LFUP 1ORKA 4AYBA 3SXYA 1D8JA 4ZYDA 5BPIA 1WI3A 2QSGX 1Z91A 2ME6A 4AVZA 1DP7P 1DUXC 5LGNA 2JA7J 2DA4A 2BXZA 1LNWA 3FKJA 4MNUA 3O3KA 2BY2A 1X3UA 2E7WA 4XLPF 1PP7U 2XAFA 3JRBA 2VN2A 3MKWB 4B8XA 3BJAA 2R5YB 3KFWX 1LQ1A 1R4NB 1HDPA 1DPUA 3ESWB 4GGGA 2FBIA 4L0ZB 4V2FA 1G6NA 5DEQA 2ECBA 1LE8B 1EF4A 3BP8A 2AXTC 5LD2C 1J5YA 3BZ6A 3S2HJ 3K4CA 2JK3A 2LG4A 5FJ8J 4B44A 1V3FA 4C30A 4GDFA 3MMYB 1WH5A 1P7IA 3F3XA 3E97A 3KP6A 2J5OA 1JKPC 2CUZA 2DDBA 1IC8A 1DP3A 3J81K 4U88A 3TO7A 2DJNA 1V54H 3MFKA 1GDTA 4EJVA 2K5CA 4IPAA 1T6SA 3I59A 3RZDJ 5KAIC 3HIFA 3AG1H 1ZLKA 4RM2A 3M8JA 1QZZA 3HDDA 1Z6RA 4BE0A 2LKPA 1JGSA 5DTDA 1U5TB 3WTVC 3I59B 2Q0OA 1XGOA 3MKYB 3SZPA 5JFRA 2FD5A 1YITI 1JJ6C 1FTTA 1Z77A 2DOAA 5ERIA 4IL6C 1USSA 2KMUA 2F4MB 2K3FA 4E70A 3BLYA 3OS0A 4B3XA 2XB5A 2G9WA 4A3GJ 1LJ9A 4FASD 1HOMA 2W1OA 4BH9A 1W0TA 4M72A 4EJWA 3CCRI 2VL8A 2P8TA 2Q1ZB 4YIIA 1YJWI 5C44J 4PJMA 2LSOA 2ETHA 2KP6A 2RNJA 2OTJI 3ZQHA 3KZYA 3K10A 3H36A 4J19A 3OMYA 2HOTA 3O8HA 4QIWN 4KNYA 3ZN0A 2KPMA 4D7MA 2CQKA 3VDXA 1IN6A 2VC0A 3K1MA 4MGRA 2XSJC 4MHGA 4HX8A 1OYIA 3BJ6A 1T08B 4BS9A 2P4WA 1KZHA 3HXLA 3WE2A 5IT9Z 2MH9A 1ZKGA 5CVIA 5D8LB 2V79A 2NAZA 2QBYA 1OPCA 1P4XA 4HW0A 4G9YA 4I6ZA 2OQRA 4FISA 3QODA 3OIPA 5JLWA 1LB2A 3R6SA 6PAXA 1KGSA 4B4CA 2DI3A 3Q9SA 1JKRC 4OOIA 4HAMA 1OISA 1VQKI 4UHTA 1LEAA 3QPSA 4H4KC 4G94A
chains in the Genus database with same CATH topology
2DT5A 2VT3A 2F5FA 3KP4A 4L9TA 4EM2A 2LF8A 4FHTA 1ZG5A 5K5OA 4O3MA 2XVCA 5E1WA 2QLZA 4I02A 4G8XA 2GXBA 2RVCA 2HR3A 1XGMA 2STWA 3NRVA 2LDUA 4AIHA 4ZZLA 2HKXA 2MA3A 1TLHB 2EK5A 3L09A 4WXHA 2P6TA 1AOYA 2EV0A 2STTA 5DV5A 1BN5A 3HRTA 4G7HF 1BC7C 4KN7X 2DPUA 3HRMA 2QQ9A 4BNCA 3R60A 1P2FA 2Z9OA 3GXOA 3W6KB 2EV6A 4RS8A 3HOSA 2F2EA 5CYVA 1YW7A 5HS7A 2IT0A 3I53A 4LLGF 1JHHA 3QPHA 4Z2YA 3L7WA 3IC7A 1OYYA 3WU0A 4YG2F 2O03A 1G3WA 5JVTA 4NHJA 2HYFA 1XD7A 2QQAA 1O3RA 4QLCU 3RTRA 1TQPA 4B09A 1WKMA 4HBLA 1T98A 2HFHA 2MBFA 1R5HA 5HLIA 4EGYA 2BYVE 4OU0A 5IT9K 1RNLA 3FZVA 3I58A 1S7AA 5D4SA 3MQ0A 3B02A 3HHHA 2XAGA 1O57A 2QVOA 1FT9A 2M87A 4HYEA 2D1HA 4NQWA 1XN7A 2UWMA 2V1XA 3RKYA 1OR7A 4I0BA 1XGNA 3F22A 4RGXA 1XCVA 4LMYA 4WWCA 3F21A 4BAYA 1I1GA 1UHWA 1HXDA 2HQRA 4JBAA 1QBJA 1UB9A 3IWZA 5LLQA 4HLYA 5CJ9A 4L5IA 2R3SA 2UXNA 1IXCA 4ESJA 2XROA 2DLLA 4L9JA 2NRAC 1KU7A 4EJOA 2IA2A 4WCGA 1IRGA 3P9CA 3ZMDA 3WTZA 1L0OC 5BQTA 1Q1HA 1R58A 4A12A 2P5VA 3EDPA 3WG9A 4AWXB 3GF2A 2XV4S 5DUIA 1F5TA 2FEZA 3RYRA 2XUBA 1R7JA 3DXJF 1YYVA 2DAOA 4HF1A 2V1UA 4PDKA 1MGTA 3HRUA 1K79A 3QAHA 2XHKA 1YG2A 2ADUA 2KRFA 2YX4A 1FYKA 5L3DA 1FP2A 3WTTC 3WU1B 4OIOF 4QWQA 3FM5A 4I98B 2K7LA 2FBHA 4IF4A 1U5TC 1KYWA 3R0JA 2OZ6A 4KT5C 3HOTA 2ELHA 5HDGA 2P7CB 3KZZA 1K6OA 3GW2A 2DO7A 1TQMA 2OU2A 4RAZA 3ZMUA 3ZQ7A 2PN6A 1HW5A 4BHCA 4ENMA 2NS0A 2P5LC 2KJCA 1R36A 3R4KA 5D5XB 4MQVA 2PBIA 5E1XA 4Y13A 1ZLJA 1RI7A 4HF2A 4YIFA 3CUOA 3RIRA 5DUKA 3TGNA 2ACJA 5L3FA 1HW2A 4RGSA 3CUQC 1MKMA 1SFXA 2OQGA 2XRNA 2W25A 5HS8A 1FPQA 2VBXA 5ICCA 2O0YA 4BXUA 3K1NA 4UV8A 3K9TA 4ENJA 2JRTA 1YTYA 3LA3A 2W84A 2FXAA 3HSRA 3KLOA 2Y48A 3KEOA 2L4MA 3REOA 2M8EA 1IW7F 2IJLA 4JK1X 2O61A 1GXPA 1XSXA 2HWVA 2H09A 3V8KA 3ABUA 2M45A 1FYLA 1FWZA 3G3ZA 2GXGA 5E8GA 1S3JA 5DDGA 5DD4A 3TQNA 1E2XA 3J80Z 4EM0B 3O6BB 2UXXA 1YW9A 1J9IA 1O7LA 5HOOA 2A3SA 1HKSA 4Q47A 2OD5A 2XIGA 4HF0A 3ZMTA 5LBQA 1YS6A 3RPUA 3GO5A 1D5VA 4WXCA 1R1UA 1ZRDA 2HGCA 2FBKA 3V8LA 1E17A 5AIPA 3ZP5A 1H9TA 3DKWA 1G3TA 1FSEA 2JT1A 1MDMA 2Z5UA 1IUYA 3WGHA 2HS5A 2PQ8A 2C6YA 3QOPA 3PQKA 5J8FA 4RB3C 3RKWA 4N9HA 2D45A 1H0MA 2RV8A 1LVAA 4XRFA 2RKHA 4AIJA 4IRHA 3QP5A 5CVVA 2HDCA 2MLKA 4A0ZA 5BMZA 1GXQA 4UXNA 3GVAA 3EQLF 5H6RA 3DPLC 3KLNA 3I54A 1K78A 3RDIA 3ELKA 5AONA 5LHIA 3T8RA 1YFHA 3N97A 4HQEA 3F8FA 1YLFA 4G7ZF 2HQNA 5E20A 1UHMA 4G6DA 3C3WA 3WGGA 3Q5FA 1JE8A 4KIGA 3FMQA 3FM3A 1ZYRF 4A6EA 4A5MA 5CVUA 2W85A 3KP5A 4ESBA 2GQQA 3E6BA 1QPMA 5JR3A 2A69F 2W24A 3BPVA 1HKQA 2IPQX 5HLHA 3V7SA 3J80K 4GXOA 3LQQA 5K1YA 1TW2A 5LEJA 3EUHA 2O8XA 5TJJA 4KIBA 1R1VA 1W4MA 1T2KA 4XLNF 2DU9A 1F1ZA 1FNNA 4LK0F 1GHCA 4LFUA 2CYYA 5LGTA 1ULYA 1ZN2A 3FX3A 1FY7A 3GFIA 2H27A 3U9GA 2HKOA 4KDPA 4ZYEA 1BM9A 3WGIA 2OAZA 2O6GE 3VB2A 4GO1A 4RB0A 2CWEA 2IW5A 3HTSB 2EFWA 5HS9A 2ZJ2A 4AIKA 1XB4A 1KU3A 3ZMZA 2NYXA 4BQAA 2ZKZA 1U3EM 2KIMA 3TOBA 1QO0D 1U8RA 3L2CA 5DCMA 3E6DA 1ZG3A 4GYIA 4UUVA 3COAC 3RPQA 1IZ1A 2VC1A 4ZZDA 1O7FA 1XGSA 3CLOA 3I0TA 2ZNZA 3C7JA 2UZKA 1J75A 1EH6A 3CUQA 4PGHA 2A61A 2EFNA 2MH2A 2EB7A 4CYDA 2NNYA 4LD5A 1IN5A 4L5JA 1WQ2A 3GX4X 2L02A 1HQCA 4HV6A 3T0YA 1ON2A 1QNTA 4EM1A 2A6EF 5DCFA 2DQRA 2K86A 1ZHFA 2HEOA 1R23A 2Z99A 1TBXA 5LHHA 4HV5A 5BPDA 4M74A 3ZPLA 2KJBA 2Z33A 5DD8A 1FBSA 5E17F 3WTYC 4IRGA 2ZXJA 4NB5A 3MAJA 1IN4A 3KP3A 1ZGAA 2IA1A 3GWZA 3JSOA 3ROUA 2K02A 1C0WA 2XAJA 3NEUA 1U78A 1TW3A 2IRFG 2V1DA 4CXFA 4ESFA 2Y75A 3B73A 3J7AO 1W7PA 3MWMA 4RB1A 1PP8F 2RC4A 1U2WA 2IVMA 3RYPA 1ONVA 5LRRA 1D8KA 1HSJA 4CHUA 4CO8A 2PG4A 4MQ9F 2XASA 4M9SA 2XAQA 2CGPA 1KA8A 5FLXZ 2HTSA 1IRFA 3CO7C 4N0BA 3M1EA 3MEXA 5E1ZB 1RIOH 4BHBA 4HLXA 2IP2A 1BC8C 1WI9A 3K69A 1G4DA 1UFMA 4A0XA 4KFCA 1FC3A 4XBFA 3LAPA 4XSZF 4P9FA 3OOPA 4OMZA 4HX4A 2HZTA 3RI4A 3WTWC 1GVJA 5BS6A 2ZFWA 4L9VA 1MDMB 1P6RA 5L3EA 1QGPA 3D5LA 5ICEA 4N9IA 3DQVC 2VOOA 3LQRA 2QUFA 1K7AA 2PFBA 5FGMA 4OINF 2W57A 1Z6TA 2CW0F 3HUGA 4MEYF 1T38A 1W7PD 3BDDA 3FXRA 2KIFA 3VEPA 4CGZA 1YS7A 2F5CA 4OMYA 3P7NA 2ZCWA 2L3DA 3DEUA 4DQ2A 1RZ4A 1WRJA 5TRDA 2M30A 2XKOA 1TNTA 4ENKA 2G7HA 3I5UA 2VONA 3SFZA 4HDVA 1DDNA 3LSTA 1UCRA 2K27A 1XDUA 1J7KA 3JTHA 4M6YA 3RJPA 1FBUA 1TNSA 2MD5A 2YSRA 1G3YA 2FMLA 4KMUX 4H0EA 3O2PE 5ED4A 1W5SA 2XKPA 4M6XA 4UVCA 1W7PB 2CO5A 5J6XA 4Q48A 5K5QA 5HDKA 4FX4A 4CICA 3SHFA 2O3FA 3F6VA 1BBYA 2PJPA 4EJTA 4PGGA 3F72A 4FT8A 5FB2A 4EVIA 2VBWA 4IRIA 1YO5C 2B0LA 2MC3A 3BPXA 1OKRA 2VOPA 1LDKB 2EFOA 1B9MA 5K5RA 4KA4A 4A2UA 3OV8A 1SFEA 3QPTA 1MJBA 3GYHX 4CDGA 2WTEA 3E5UA 1J0RA 2FMYA 3TKYA 3T1BA 3EYIA 1W5TA 2VODA 1FYMA 1B59A 1DPRA 3V7RA 3QP6A 2QBYB 1KQ9A 3VODA 1SFUA 2QWWA 1BIAA 5EEHA 1FLIA 4M9ZA 4YFNF 4BHPA 5D8KB 4G6QA 4Q5SF 2EWNA 3M8FA 2BE5F 3I64A 1HBXG 2FQ3A 2CG4A 3LA2A 1K78B 3DPTA 3F6OA 2IA0A 4LB6B 4P9UA 3E3VA 3F8NA 2A6HF 1MJ9A 3T5XA 1A04A 3CTAA 3F23A 2YU3A 4AD9A 3KP7A 2YX7A 5KK1A 3VOEA 1LDJA 2DW4A 3KEQA 3U2RA 1ZRFA 2PMHA 3H3ZA 3QU6A 5D5WB 1EV7A 2ISYA 5FD5A 4P55A 1YIOA 4PZJA 3WTSC 2COMA 3GZ5A 1L3LA 2VBYA 2D1VA 3E5QA 1KYZA 2D2WA 2FSWA 1XCBA 4I0AA 2EV5A 5E8IA 4U0VA 4I01A 4HOBA 1G3SA 2VE8A 1SD4A 4O6JA 3WODF 1IXRC 3FMRA 3AAFA 2MLGA 3F8CA 3LFKA 4ON0A 4KMFA 4LLNA 4IVNA 5LGUA 1B4AA 4RAYA 5KVRA 2GWRA 5HDNA 1YQAA 1ZG1A 3M8EA 1D3YA 4RB2C 3MZHA 3W6JB 2VE9A 5BOXA 1SMYF 2Y0MA 4WK8F 1ZREA 2E1CA 2H6CA 3V7CA 1PDNC 1P4AA 2BEOA 5F1RA 3ULQB 1HSTA 2DTRA 3LAJA 4L9NA 3DF8A 1J59A 3GLXA 3FMSA 1PUEE 3CJNA 3V4GA 4I7HA 2Q2EA 2GAUA 4R8HA 1ON1A 4MTEA 2VT2A 3SZTA 1S8NA 3HTUA 1F9NA 1MZBA 3IHUA 2JPCA 1HKTA 1O3TA 3V8JA 2Z3YA 1IXSB 4Y15A 4YFKF 4DNCA 2FOKA 4M9XA 2EA2A 2BGCA 1I5ZA 3I4PA 4IJAA 1S29A 2XAHA 2RN7A 5D5VB 3P9KA 1BI2A 4LG0A 4I2OA 4CZZA 3BY6A 2AXLA 1Z7UA 2M5WA 3LA7A 3DP7A 1TQIA 1Z05A 4OIPF 2DBBA 2EA4A 3QU3A 1ZH5A 3KE2A 4KICA 2LF7A 2FE3A 3H92A 4EV0A 4KUMA 1ZGJA 2E1NA 3JAMZ 3M9AA 3JSPA 1USTA 4MTDA 3H3UA 3C18A 2H94A 2ISZA 5J8CA 3R61A 2DFIA 4UVBA 5FLXK 3KCCA 5CVRA 1F4KA 4R1HA 5LHGA 3WTUC 5F6FA 3I71A 2RQPA 1RUOA 1U5TA 3LWFA 4HDUA 5ILSA 3HSFA 3ECHA 1FSHA 5LEKA 2M1BA 2L54A 2WC2A 2DK5A 1Z1DA 1BI0A 2KIUA 4ASNA 3RKXA 1SAXA 1BOAA 4Y17A 4ENNA 3U1DA 3WTXC 2GA2A 5L3GA 1XDSA 2F5EA 3HRSA 3BROA 2DPDA 1REPC 2WWYA 2K4BA 4P5OA 1EH7A 2K4JA 1P4WA 3BWGA 4FX0A 4ZYGA 4U7DA 5JHUA 1B6AA 2VBZA 2AS5F 1SD5A 1S7OA 1OYWA 3K0LA 4LJZF 2JTVA 4I09A 5F64A 2BV6A 2RDPA 5DYMA 2YR2A 4KN4X 5ICFA 4KYWA 5H6QA 1J2XA 4MEXF 2EFPA 2ESNA 3IKVA 1SD7A 2DK8A 1IN8A 3BOQA 3TDZC 2ZMEB 2CSOA 2Q8KA 1FX7A 2GIVA 1STZA 2WV0A 1FOKA 4EJUA 1CF7B 2XGXA 4HZFA 4XSXF 3JAMK 2VXZA 1VTNC 4U0WA 2V6CA 4F7ZA 2FRHA 1IF1A 1ZRCA 3PQJA 4EGZA 1CGPA 2X0LA 1BJAA 1I6XA 3JW4A 5ILVA 5FD6A 3TOAA 1MJAA 1R1TA 3ERED 3FF5A 4O5VA 2EFQA 3ML6A 4EMSA 1BI3A 2FF4A 4P96A 4WXDA 1ZAOA 3N4MA 1SD6A 4WF2A 2NNNA 3EETA 3GEZA 3ECOA 3TDUC 2L01A 3DFGA 5E18F 1JXSA 1FZPB 2FA5A 5H20A 1WWXA 1RUNA 4U7BA 2F5DA 3IWFA 3NQOA 4L0YB 3T8TA 4GYGA 2FU4A 1S6LA 2CFXA 4UV9A 3WE3A 5L3CA 3EYYA 3ABTA 3IL2A 1IAWA 4GCVA 2JPBA 1T0FA 1H9GA 2OA4A 3CDHA 4LK1F 3F8BA 2R7FA 2ZMEA 5D6FA 3VFZA 1LDDA 3IKTA 2QZ8A 2HTJA 1KQ8A 1I27A 1LEBA 2JSCA 1OMIA 2QM3A 1B9NA 1R22A 1MD0A 4A0YA 4JQFA 3Q9VA 1QQIA 1V4RA 1Z9CA 2TDXA 1ZARA 3S2WA 4M71A 4U0YA 3ZN1A 1AWCA 1O3SA 4LG0B 2JZYA 5A2QZ 3QRFF 2A07F 3DV8A 3FWEA 2HYGD 3J81Z 3ZMVA 5HVQC 1YW8A 3HHGA 2HOEA 3CUQB 4D0PA 2X4HA 3HYIA 1R00A 3PFIA 2ZNYA 5FO5A 3IRQA 3KP2A 3K2ZA 1B1BA 2QENA 5L3BA 5CLSA 5DCMB 3GFLA 1O3QA 2ZBKA 3M7GA 4K2EA 4OIQF 2YPRA 3ISPA 1R5GA 4HA8A 5AIQA 1CF7A 2FNAA 5D4RA 3R0AA 4OIRF 4LLLA 4L18B 2PMUA 4UNOA 1KU9A 2P7VB 5ILUA 3MCZA 3GZ6A 2OZUA 5FFZA 4LGWA 3JTGA 2EJRA 4R79A 1QZYA 3E5XA 1NHAA 3D0SA 3F8MA 1XMAA 1EH8A 3GFMA 2PI0A 1T39A 3GUDA 3MZYA 1ODDA 4G7OF 1HW1A 5HLGA 4RGRA 5CVJA 3FXQA 3E6MA 2RGVA 1I1SA 4RGUA 2QQBA 4ZYHA 5D5UB 2BBYA 4WX9A 3BJOA 3K1PA 5EEGA 2OBPA 2ESHA 4HX7A 4IXAA 5LRSA 3TO6A 4PCQA 1P92A 4M73A 4S04A 4IHSA 4A6DA 3G73A 5A2QK 5JI6A 1KQ0A 1Y0UA 2DQLA 4ETSA 1JHFA 3L00A 3FHZA 3ZMSA 1U6GA 2G7UA 1KU2A 2KKOA 2P6SA 3P9IA 5FFXA 2A68F 2PLYA 3E6CC 4EQQA 2R7DA 4ZH4F 3SQNA 3HSEA 4AVPA 4S05A 1FBQA 2L4AA 1XSDA 5IT3A 3TO9A 2GA1A 2P5KA 4BYYA 2V9VA 1WSUA 4KIFA 2H6BA 1XSVA 3C1DA 3IRRA 4YFXF 4LB5A 2A5YB 1IN7A 1FP1D 2FNPA 1XMKA 2ZO4A 4HQMA 1SMTA 5D6EA 5ICGA 3KETA 3GFJA 2PEXA 2LNBA 2GZWA 1TTYA 3FXUA 2J5PA 4TV7A 1BIBA 1BI1A 4Q4ZF 3L9FA 4UVAA 2E7XA 4IHTA 3CO6C 4A5NA 2QYOA 3SXYA 1D8JA 4ZYDA 5BPIA 1Z91A 1DP7P 1DUXC 5LGNA 1LNWA 4MNUA 3O3KA 1X3UA 2E7WA 4XLPF 1PP7U 2XAFA 2VN2A 4B8XA 3BJAA 3KFWX 1LQ1A 1DPUA 4GGGA 4L0ZB 2FBIA 1G6NA 5DEQA 3BP8A 1J5YA 3BZ6A 1V3FA 3F3XA 3E97A 3KP6A 2J5OA 3J81K 4U88A 3TO7A 3MFKA 4EJVA 4IPAA 1T6SA 3I59A 3HIFA 1ZLKA 1QZZA 1Z6RA 2LKPA 1JGSA 1U5TB 3WTVC 3I59B 2Q0OA 1XGOA 3SZPA 5JFRA 5ERIA 1USSA 4E70A 2G9WA 1LJ9A 4BH9A 4M72A 4EJWA 2P8TA 4YIIA 2LSOA 2ETHA 2RNJA 3KZYA 4KNYA 3ZN0A 2CQKA 1IN6A 2VC0A 3K1MA 4MGRA 4MHGA 4HX8A 1OYIA 3BJ6A 2P4WA 3WE2A 5IT9Z 2MH9A 5CVIA 5D8LB 2V79A 2NAZA 2QBYA 1OPCA 1P4XA 4HW0A 4G9YA 2OQRA 1LB2A 3R6SA 6PAXA 1KGSA 2DI3A 3Q9SA 4OOIA 4HAMA 4UHTA 1LEAA 4G94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT5 A;  2VT3 A;  2F5F A;  3KP4 A;  4L9T A;  4EM2 A;  2LF8 A;  4FHT A;  1ZG5 A;  5K5O A;  4O3M A;  2XVC A;  5E1W A;  2QLZ A;  4I02 A;  4G8X A;  2GXB A;  2RVC A;  2HR3 A;  1XGM A;  2STW A;  3NRV A;  2LDU A;  4AIH A;  4ZZL A;  2HKX A;  2MA3 A;  1TLH B;  2EK5 A;  3L09 A;  4WXH A;  2P6T A;  1AOY A;  2EV0 A;  2STT A;  5DV5 A;  1BN5 A;  3HRT A;  4G7H F;  1BC7 C;  4KN7 X;  2DPU A;  3HRM A;  2QQ9 A;  4BNC A;  3R60 A;  1P2F A;  2Z9O A;  3GXO A;  3W6K B;  2EV6 A;  4RS8 A;  3HOS A;  2F2E A;  5CYV A;  1YW7 A;  5HS7 A;  2IT0 A;  3I53 A;  4LLG F;  1JHH A;  3QPH A;  4Z2Y A;  3L7W A;  3IC7 A;  1OYY A;  3WU0 A;  4YG2 F;  2O03 A;  1G3W A;  5JVT A;  4NHJ A;  2HYF A;  1XD7 A;  2QQA A;  1O3R A;  4QLC U;  3RTR A;  1TQP A;  4B09 A;  1WKM A;  4HBL A;  1T98 A;  2HFH A;  2MBF A;  1R5H A;  5HLI A;  4EGY A;  2BYV E;  4OU0 A;  5IT9 K;  1RNL A;  3FZV A;  3I58 A;  1S7A A;  5D4S A;  3MQ0 A;  3B02 A;  3HHH A;  2XAG A;  1O57 A;  2QVO A;  1FT9 A;  2M87 A;  4HYE A;  2D1H A;  4NQW A;  1XN7 A;  2UWM A;  2V1X A;  3RKY A;  1OR7 A;  4I0B A;  1XGN A;  3F22 A;  4RGX A;  1XCV A;  4LMY A;  4WWC A;  3F21 A;  4BAY A;  1I1G A;  1UHW A;  1HXD A;  2HQR A;  4JBA A;  1QBJ A;  1UB9 A;  3IWZ A;  5LLQ A;  4HLY A;  5CJ9 A;  4L5I A;  2R3S A;  2UXN A;  1IXC A;  4ESJ A;  2XRO A;  2DLL A;  4L9J A;  2NRA C;  1KU7 A;  4EJO A;  2IA2 A;  4WCG A;  1IRG A;  3P9C A;  3ZMD A;  3WTZ A;  1L0O C;  5BQT A;  1Q1H A;  1R58 A;  4A12 A;  2P5V A;  3EDP A;  3WG9 A;  4AWX B;  3GF2 A;  2XV4 S;  5DUI A;  1F5T A;  2FEZ A;  3RYR A;  2XUB A;  1R7J A;  3DXJ F;  1YYV A;  2DAO A;  4HF1 A;  2V1U A;  4PDK A;  1MGT A;  3HRU A;  1K79 A;  3QAH A;  2XHK A;  1YG2 A;  2ADU A;  2KRF A;  2YX4 A;  1FYK A;  5L3D A;  1FP2 A;  3WTT C;  3WU1 B;  4OIO F;  4QWQ A;  3FM5 A;  4I98 B;  2K7L A;  2FBH A;  4IF4 A;  1U5T C;  1KYW A;  3R0J A;  2OZ6 A;  4KT5 C;  3HOT A;  2ELH A;  5HDG A;  2P7C B;  3KZZ A;  1K6O A;  3GW2 A;  2DO7 A;  1TQM A;  2OU2 A;  4RAZ A;  3ZMU A;  3ZQ7 A;  2PN6 A;  1HW5 A;  4BHC A;  4ENM A;  2NS0 A;  2P5L C;  2KJC A;  1R36 A;  3R4K A;  5D5X B;  4MQV A;  2PBI A;  5E1X A;  4Y13 A;  1ZLJ A;  1RI7 A;  4HF2 A;  4YIF A;  3CUO A;  3RIR A;  5DUK A;  3TGN A;  2ACJ A;  5L3F A;  1HW2 A;  4RGS A;  3CUQ C;  1MKM A;  1SFX A;  2OQG A;  2XRN A;  2W25 A;  5HS8 A;  1FPQ A;  2VBX A;  5ICC A;  2O0Y A;  4BXU A;  3K1N A;  4UV8 A;  3K9T A;  4ENJ A;  2JRT A;  1YTY A;  3LA3 A;  2W84 A;  2FXA A;  3HSR A;  3KLO A;  2Y48 A;  3KEO A;  2L4M A;  3REO A;  2M8E A;  1IW7 F;  2IJL A;  4JK1 X;  2O61 A;  1GXP A;  1XSX A;  2HWV A;  2H09 A;  3V8K A;  3ABU A;  2M45 A;  1FYL A;  1FWZ A;  3G3Z A;  2GXG A;  5E8G A;  1S3J A;  5DDG A;  5DD4 A;  3TQN A;  1E2X A;  3J80 Z;  4EM0 B;  3O6B B;  2UXX A;  1YW9 A;  1J9I A;  1O7L A;  5HOO A;  2A3S A;  1HKS A;  4Q47 A;  2OD5 A;  2XIG A;  4HF0 A;  3ZMT A;  5LBQ A;  1YS6 A;  3RPU A;  3GO5 A;  1D5V A;  4WXC A;  1R1U A;  1ZRD A;  2HGC A;  2FBK A;  3V8L A;  1E17 A;  5AIP A;  3ZP5 A;  1H9T A;  3DKW A;  1G3T A;  1FSE A;  2JT1 A;  1MDM A;  2Z5U A;  1IUY A;  3WGH A;  2HS5 A;  2PQ8 A;  2C6Y A;  3QOP A;  3PQK A;  5J8F A;  4RB3 C;  3RKW A;  4N9H A;  2D45 A;  1H0M A;  2RV8 A;  1LVA A;  4XRF A;  2RKH A;  4AIJ A;  4IRH A;  3QP5 A;  5CVV A;  2HDC A;  2MLK A;  4A0Z A;  5BMZ A;  1GXQ A;  4UXN A;  3GVA A;  3EQL F;  5H6R A;  3DPL C;  3KLN A;  3I54 A;  1K78 A;  3RDI A;  3ELK A;  5AON A;  5LHI A;  3T8R A;  1YFH A;  3N97 A;  4HQE A;  3F8F A;  1YLF A;  4G7Z F;  2HQN A;  5E20 A;  1UHM A;  4G6D A;  3C3W A;  3WGG A;  3Q5F A;  1JE8 A;  4KIG A;  3FMQ A;  3FM3 A;  1ZYR F;  4A6E A;  4A5M A;  5CVU A;  2W85 A;  3KP5 A;  4ESB A;  2GQQ A;  3E6B A;  1QPM A;  5JR3 A;  2A69 F;  2W24 A;  3BPV A;  1HKQ A;  2IPQ X;  5HLH A;  3V7S A;  3J80 K;  4GXO A;  3LQQ A;  5K1Y A;  1TW2 A;  5LEJ A;  3EUH A;  2O8X A;  5TJJ A;  4KIB A;  1R1V A;  1W4M A;  1T2K A;  4XLN F;  2DU9 A;  1F1Z A;  1FNN A;  4LK0 F;  1GHC A;  4LFU A;  2CYY A;  5LGT A;  1ULY A;  1ZN2 A;  3FX3 A;  1FY7 A;  3GFI A;  2H27 A;  3U9G A;  2HKO A;  4KDP A;  4ZYE A;  1BM9 A;  3WGI A;  2OAZ A;  2O6G E;  3VB2 A;  4GO1 A;  4RB0 A;  2CWE A;  2IW5 A;  3HTS B;  2EFW A;  5HS9 A;  2ZJ2 A;  4AIK A;  1XB4 A;  1KU3 A;  3ZMZ A;  2NYX A;  4BQA A;  2ZKZ A;  1U3E M;  2KIM A;  3TOB A;  1QO0 D;  1U8R A;  3L2C A;  5DCM A;  3E6D A;  1ZG3 A;  4GYI A;  4UUV A;  3COA C;  3RPQ A;  1IZ1 A;  2VC1 A;  4ZZD A;  1O7F A;  1XGS A;  3CLO A;  3I0T A;  2ZNZ A;  3C7J A;  2UZK A;  1J75 A;  1EH6 A;  3CUQ A;  4PGH A;  2A61 A;  2EFN A;  2MH2 A;  2EB7 A;  4CYD A;  2NNY A;  4LD5 A;  1IN5 A;  4L5J A;  1WQ2 A;  3GX4 X;  2L02 A;  1HQC A;  4HV6 A;  3T0Y A;  1ON2 A;  1QNT A;  4EM1 A;  2A6E F;  5DCF A;  2DQR A;  2K86 A;  1ZHF A;  2HEO A;  1R23 A;  2Z99 A;  1TBX A;  5LHH A;  4HV5 A;  5BPD A;  4M74 A;  3ZPL A;  2KJB A;  2Z33 A;  5DD8 A;  1FBS A;  5E17 F;  3WTY C;  4IRG A;  2ZXJ A;  4NB5 A;  3MAJ A;  1IN4 A;  3KP3 A;  1ZGA A;  2IA1 A;  3GWZ A;  3JSO A;  3ROU A;  2K02 A;  1C0W A;  2XAJ A;  3NEU A;  1U78 A;  1TW3 A;  2IRF G;  2V1D A;  4CXF A;  4ESF A;  2Y75 A;  3B73 A;  3J7A O;  1W7P A;  3MWM A;  4RB1 A;  1PP8 F;  2RC4 A;  1U2W A;  2IVM A;  3RYP A;  1ONV A;  5LRR A;  1D8K A;  1HSJ A;  4CHU A;  4CO8 A;  2PG4 A;  4MQ9 F;  2XAS A;  4M9S A;  2XAQ A;  2CGP A;  1KA8 A;  5FLX Z;  2HTS A;  1IRF A;  3CO7 C;  4N0B A;  3M1E A;  3MEX A;  5E1Z B;  1RIO H;  4BHB A;  4HLX A;  2IP2 A;  1BC8 C;  1WI9 A;  3K69 A;  1G4D A;  1UFM A;  4A0X A;  4KFC A;  1FC3 A;  4XBF A;  3LAP A;  4XSZ F;  4P9F A;  3OOP A;  4OMZ A;  4HX4 A;  2HZT A;  3RI4 A;  3WTW C;  1GVJ A;  5BS6 A;  2ZFW A;  4L9V A;  1MDM B;  1P6R A;  5L3E A;  1QGP A;  3D5L A;  5ICE A;  4N9I A;  3DQV C;  2VOO A;  3LQR A;  2QUF A;  1K7A A;  2PFB A;  5FGM A;  4OIN F;  2W57 A;  1Z6T A;  2CW0 F;  3HUG A;  4MEY F;  1T38 A;  1W7P D;  3BDD A;  3FXR A;  2KIF A;  3VEP A;  4CGZ A;  1YS7 A;  2F5C A;  4OMY A;  3P7N A;  2ZCW A;  2L3D A;  3DEU A;  4DQ2 A;  1RZ4 A;  1WRJ A;  5TRD A;  2M30 A;  2XKO A;  1TNT A;  4ENK A;  2G7H A;  3I5U A;  2VON A;  3SFZ A;  4HDV A;  1DDN A;  3LST A;  1UCR A;  2K27 A;  1XDU A;  1J7K A;  3JTH A;  4M6Y A;  3RJP A;  1FBU A;  1TNS A;  2MD5 A;  2YSR A;  1G3Y A;  2FML A;  4KMU X;  4H0E A;  3O2P E;  5ED4 A;  1W5S A;  2XKP A;  4M6X A;  4UVC A;  1W7P B;  2CO5 A;  5J6X A;  4Q48 A;  5K5Q A;  5HDK A;  4FX4 A;  4CIC A;  3SHF A;  2O3F A;  3F6V A;  1BBY A;  2PJP A;  4EJT A;  4PGG A;  3F72 A;  4FT8 A;  5FB2 A;  4EVI A;  2VBW A;  4IRI A;  1YO5 C;  2B0L A;  2MC3 A;  3BPX A;  1OKR A;  2VOP A;  1LDK B;  2EFO A;  1B9M A;  5K5R A;  4KA4 A;  4A2U A;  3OV8 A;  1SFE A;  3QPT A;  1MJB A;  3GYH X;  4CDG A;  2WTE A;  3E5U A;  1J0R A;  2FMY A;  3TKY A;  3T1B A;  3EYI A;  1W5T A;  2VOD A;  1FYM A;  1B59 A;  1DPR A;  3V7R A;  3QP6 A;  2QBY B;  1KQ9 A;  3VOD A;  1SFU A;  2QWW A;  1BIA A;  5EEH A;  1FLI A;  4M9Z A;  4YFN F;  4BHP A;  5D8K B;  4G6Q A;  4Q5S F;  2EWN A;  3M8F A;  2BE5 F;  3I64 A;  1HBX G;  2FQ3 A;  2CG4 A;  3LA2 A;  1K78 B;  3DPT A;  3F6O A;  2IA0 A;  4LB6 B;  4P9U A;  3E3V A;  3F8N A;  2A6H F;  1MJ9 A;  3T5X A;  1A04 A;  3CTA A;  3F23 A;  2YU3 A;  4AD9 A;  3KP7 A;  2YX7 A;  5KK1 A;  3VOE A;  1LDJ A;  2DW4 A;  3KEQ A;  3U2R A;  1ZRF A;  2PMH A;  3H3Z A;  3QU6 A;  5D5W B;  1EV7 A;  2ISY A;  5FD5 A;  4P55 A;  1YIO A;  4PZJ A;  3WTS C;  2COM A;  3GZ5 A;  1L3L A;  2VBY A;  2D1V A;  3E5Q A;  1KYZ A;  2D2W A;  2FSW A;  1XCB A;  4I0A A;  2EV5 A;  5E8I A;  4U0V A;  4I01 A;  4HOB A;  1G3S A;  2VE8 A;  1SD4 A;  4O6J A;  3WOD F;  1IXR C;  3FMR A;  3AAF A;  2MLG A;  3F8C A;  3LFK A;  4ON0 A;  4KMF A;  4LLN A;  4IVN A;  5LGU A;  1B4A A;  4RAY A;  5KVR A;  2GWR A;  5HDN A;  1YQA A;  1ZG1 A;  3M8E A;  1D3Y A;  4RB2 C;  3MZH A;  3W6J B;  2VE9 A;  5BOX A;  1SMY F;  2Y0M A;  4WK8 F;  1ZRE A;  2E1C A;  2H6C A;  3V7C A;  1PDN C;  1P4A A;  2BEO A;  5F1R A;  3ULQ B;  1HST A;  2DTR A;  3LAJ A;  4L9N A;  3DF8 A;  1J59 A;  3GLX A;  3FMS A;  1PUE E;  3CJN A;  3V4G A;  4I7H A;  2Q2E A;  2GAU A;  4R8H A;  1ON1 A;  4MTE A;  2VT2 A;  3SZT A;  1S8N A;  3HTU A;  1F9N A;  1MZB A;  3IHU A;  2JPC A;  1HKT A;  1O3T A;  3V8J A;  2Z3Y A;  1IXS B;  4Y15 A;  4YFK F;  4DNC A;  2FOK A;  4M9X A;  2EA2 A;  2BGC A;  1I5Z A;  3I4P A;  4IJA A;  1S29 A;  2XAH A;  2RN7 A;  5D5V B;  3P9K A;  1BI2 A;  4LG0 A;  4I2O A;  4CZZ A;  3BY6 A;  2AXL A;  1Z7U A;  2M5W A;  3LA7 A;  3DP7 A;  1TQI A;  1Z05 A;  4OIP F;  2DBB A;  2EA4 A;  3QU3 A;  1ZH5 A;  3KE2 A;  4KIC A;  2LF7 A;  2FE3 A;  3H92 A;  4EV0 A;  4KUM A;  1ZGJ A;  2E1N A;  3JAM Z;  3M9A A;  3JSP A;  1UST A;  4MTD A;  3H3U A;  3C18 A;  2H94 A;  2ISZ A;  5J8C A;  3R61 A;  2DFI A;  4UVB A;  5FLX K;  3KCC A;  5CVR A;  1F4K A;  4R1H A;  5LHG A;  3WTU C;  5F6F A;  3I71 A;  2RQP A;  1RUO A;  1U5T A;  3LWF A;  4HDU A;  5ILS A;  3HSF A;  3ECH A;  1FSH A;  5LEK A;  2M1B A;  2L54 A;  2WC2 A;  2DK5 A;  1Z1D A;  1BI0 A;  2KIU A;  4ASN A;  3RKX A;  1SAX A;  1BOA A;  4Y17 A;  4ENN A;  3U1D A;  3WTX C;  2GA2 A;  5L3G A;  1XDS A;  2F5E A;  3HRS A;  3BRO A;  2DPD A;  1REP C;  2WWY A;  2K4B A;  4P5O A;  1EH7 A;  2K4J A;  1P4W A;  3BWG A;  4FX0 A;  4ZYG A;  4U7D A;  5JHU A;  1B6A A;  2VBZ A;  2AS5 F;  1SD5 A;  1S7O A;  1OYW A;  3K0L A;  4LJZ F;  2JTV A;  4I09 A;  5F64 A;  2BV6 A;  2RDP A;  5DYM A;  2YR2 A;  4KN4 X;  5ICF A;  4KYW A;  5H6Q A;  1J2X A;  4MEX F;  2EFP A;  2ESN A;  3IKV A;  1SD7 A;  2DK8 A;  1IN8 A;  3BOQ A;  3TDZ C;  2ZME B;  2CSO A;  2Q8K A;  1FX7 A;  2GIV A;  1STZ A;  2WV0 A;  1FOK A;  4EJU A;  1CF7 B;  2XGX A;  4HZF A;  4XSX F;  3JAM K;  2VXZ A;  1VTN C;  4U0W A;  2V6C A;  4F7Z A;  2FRH A;  1IF1 A;  1ZRC A;  3PQJ A;  4EGZ A;  1CGP A;  2X0L A;  1BJA A;  1I6X A;  3JW4 A;  5ILV A;  5FD6 A;  3TOA A;  1MJA A;  1R1T A;  3ERE D;  3FF5 A;  4O5V A;  2EFQ A;  3ML6 A;  4EMS A;  1BI3 A;  2FF4 A;  4P96 A;  4WXD A;  1ZAO A;  3N4M A;  1SD6 A;  4WF2 A;  2NNN A;  3EET A;  3GEZ A;  3ECO A;  3TDU C;  2L01 A;  3DFG A;  5E18 F;  1JXS A;  1FZP B;  2FA5 A;  5H20 A;  1WWX A;  1RUN A;  4U7B A;  2F5D A;  3IWF A;  3NQO A;  4L0Y B;  3T8T A;  4GYG A;  2FU4 A;  1S6L A;  2CFX A;  4UV9 A;  3WE3 A;  5L3C A;  3EYY A;  3ABT A;  3IL2 A;  1IAW A;  4GCV A;  2JPB A;  1T0F A;  1H9G A;  2OA4 A;  3CDH A;  4LK1 F;  3F8B A;  2R7F A;  2ZME A;  5D6F A;  3VFZ A;  1LDD A;  3IKT A;  2QZ8 A;  2HTJ A;  1KQ8 A;  1I27 A;  1LEB A;  2JSC A;  1OMI A;  2QM3 A;  1B9N A;  1R22 A;  1MD0 A;  4A0Y A;  4JQF A;  3Q9V A;  1QQI A;  1V4R A;  1Z9C A;  2TDX A;  1ZAR A;  3S2W A;  4M71 A;  4U0Y A;  3ZN1 A;  1AWC A;  1O3S A;  4LG0 B;  2JZY A;  5A2Q Z;  3QRF F;  2A07 F;  3DV8 A;  3FWE A;  2HYG D;  3J81 Z;  3ZMV A;  5HVQ C;  1YW8 A;  3HHG A;  2HOE A;  3CUQ B;  4D0P A;  2X4H A;  3HYI A;  1R00 A;  3PFI A;  2ZNY A;  5FO5 A;  3IRQ A;  3KP2 A;  3K2Z A;  1B1B A;  2QEN A;  5L3B A;  5CLS A;  5DCM B;  3GFL A;  1O3Q A;  2ZBK A;  3M7G A;  4K2E A;  4OIQ F;  2YPR A;  3ISP A;  1R5G A;  4HA8 A;  5AIQ A;  1CF7 A;  2FNA A;  5D4R A;  3R0A A;  4OIR F;  4LLL A;  4L18 B;  2PMU A;  4UNO A;  1KU9 A;  2P7V B;  5ILU A;  3MCZ A;  3GZ6 A;  2OZU A;  5FFZ A;  4LGW A;  3JTG A;  2EJR A;  4R79 A;  1QZY A;  3E5X A;  1NHA A;  3D0S A;  3F8M A;  1XMA A;  1EH8 A;  3GFM A;  2PI0 A;  1T39 A;  3GUD A;  3MZY A;  1ODD A;  4G7O F;  1HW1 A;  5HLG A;  4RGR A;  5CVJ A;  3FXQ A;  3E6M A;  2RGV A;  1I1S A;  4RGU A;  2QQB A;  4ZYH A;  5D5U B;  2BBY A;  4WX9 A;  3BJO A;  3K1P A;  5EEG A;  2OBP A;  2ESH A;  4HX7 A;  4IXA A;  5LRS A;  3TO6 A;  4PCQ A;  1P92 A;  4M73 A;  4S04 A;  4IHS A;  4A6D A;  3G73 A;  5A2Q K;  5JI6 A;  1KQ0 A;  1Y0U A;  2DQL A;  4ETS A;  1JHF A;  3L00 A;  3FHZ A;  3ZMS A;  1U6G A;  2G7U A;  1KU2 A;  2KKO A;  2P6S A;  3P9I A;  5FFX A;  2A68 F;  2PLY A;  3E6C C;  4EQQ A;  2R7D A;  4ZH4 F;  3SQN A;  3HSE A;  4AVP A;  4S05 A;  1FBQ A;  2L4A A;  1XSD A;  5IT3 A;  3TO9 A;  2GA1 A;  2P5K A;  4BYY A;  2V9V A;  1WSU A;  4KIF A;  2H6B A;  1XSV A;  3C1D A;  3IRR A;  4YFX F;  4LB5 A;  2A5Y B;  1IN7 A;  1FP1 D;  2FNP A;  1XMK A;  2ZO4 A;  4HQM A;  1SMT A;  5D6E A;  5ICG A;  3KET A;  3GFJ A;  2PEX A;  2LNB A;  2GZW A;  1TTY A;  3FXU A;  2J5P A;  4TV7 A;  1BIB A;  1BI1 A;  4Q4Z F;  3L9F A;  4UVA A;  2E7X A;  4IHT A;  3CO6 C;  4A5N A;  2QYO A;  3SXY A;  1D8J A;  4ZYD A;  5BPI A;  1Z91 A;  1DP7 P;  1DUX C;  5LGN A;  1LNW A;  4MNU A;  3O3K A;  1X3U A;  2E7W A;  4XLP F;  1PP7 U;  2XAF A;  2VN2 A;  4B8X A;  3BJA A;  3KFW X;  1LQ1 A;  1DPU A;  4GGG A;  4L0Z B;  2FBI A;  1G6N A;  5DEQ A;  3BP8 A;  1J5Y A;  3BZ6 A;  1V3F A;  3F3X A;  3E97 A;  3KP6 A;  2J5O A;  3J81 K;  4U88 A;  3TO7 A;  3MFK A;  4EJV A;  4IPA A;  1T6S A;  3I59 A;  3HIF A;  1ZLK A;  1QZZ A;  1Z6R A;  2LKP A;  1JGS A;  1U5T B;  3WTV C;  3I59 B;  2Q0O A;  1XGO A;  3SZP A;  5JFR A;  5ERI A;  1USS A;  4E70 A;  2G9W A;  1LJ9 A;  4BH9 A;  4M72 A;  4EJW A;  2P8T A;  4YII A;  2LSO A;  2ETH A;  2RNJ A;  3KZY A;  4KNY A;  3ZN0 A;  2CQK A;  1IN6 A;  2VC0 A;  3K1M A;  4MGR A;  4MHG A;  4HX8 A;  1OYI A;  3BJ6 A;  2P4W A;  3WE2 A;  5IT9 Z;  2MH9 A;  5CVI A;  5D8L B;  2V79 A;  2NAZ A;  2QBY A;  1OPC A;  1P4X A;  4HW0 A;  4G9Y A;  2OQR A;  1LB2 A;  3R6S A;  6PAX A;  1KGS A;  2DI3 A;  3Q9S A;  4OOI A;  4HAM A;  4UHT A;  1LEA A;  4G94 A; 
#chains in the Genus database with same CATH topology
 2DT5 A;  2VLA A;  3CCJ I;  1YRN A;  2VJ4 A;  2VT3 A;  2F5F A;  1VQN I;  3S8P A;  3KP4 A;  4LIT A;  5FRO A;  4L9T A;  2WAQ A;  4EM2 A;  2LF8 A;  4FHT A;  2TCT A;  1ZG5 A;  5K5O A;  4O3M A;  2XVC A;  4HSR A;  3BCA A;  5E1W A;  2QLZ A;  3MD2 A;  4I02 A;  4G8X A;  2GXB A;  1VND A;  2L9N A;  2RVC A;  2HR3 A;  4DZP A;  1XGM A;  2STW A;  3NRV A;  2LDU A;  2NOJ B;  2ZSI B;  1H89 C;  2BY3 A;  3BR3 A;  4AIH A;  4ZZL A;  3U1K A;  2VQC A;  4HNT A;  2HKX A;  2MA3 A;  1I3Q J;  1TLH B;  2EK5 A;  3IH4 A;  3L09 A;  4WXH A;  3FKI J;  2BZT A;  4E7S A;  2P6T A;  1AOY A;  2EV0 A;  2STT A;  2LP0 A;  5DV5 A;  1A31 A;  1BN5 A;  3HRT A;  3KIO A;  3QYF A;  4XKV A;  3RZO J;  4XON A;  2VJJ A;  4G7H F;  2E36 A;  1BC7 C;  4KN7 X;  4Y33 A;  3K4K A;  4II2 A;  2DPU A;  1G59 A;  3HRM A;  2KZV A;  3FK7 A;  4DBQ A;  4UB6 C;  2RNG A;  2QQ9 A;  4BNC A;  2FJ1 A;  3BQZ A;  2JA2 A;  3R60 A;  1Y1W J;  3RSN A;  1P2F A;  2Z9O A;  3GXO A;  4E7J A;  1UAA A;  3W6K B;  3H5N A;  1F36 A;  2EV6 A;  4RS8 A;  3HOS A;  2F2E A;  5CYV A;  1LFP A;  4BQQ A;  1YW7 A;  5HS7 A;  2MAB A;  2IT0 A;  3I53 A;  1B8I B;  1GUU A;  2XPU A;  4LLG F;  1JHH A;  3A4C A;  3QPH A;  4Z2Y A;  4UY8 I;  4ZJZ A;  3L7W A;  5F0H A;  3IC7 A;  1VQL I;  2DCE A;  4X1E A;  1OYY A;  3WU0 A;  4YG2 F;  3VYR B;  2O03 A;  3BT9 A;  2M8G X;  1G3W A;  2LY1 A;  2QSH X;  2HOA A;  1W1W E;  5JVT A;  4NHJ A;  1MBF A;  1NG6 A;  3ZXS A;  2XF6 A;  3ZR8 X;  2M0C A;  4XIC A;  2HYF A;  1XD7 A;  3IH2 A;  2QQA A;  1O3R A;  4QLC U;  2R92 J;  3RTR A;  3H0G J;  1TQP A;  4B09 A;  1TT5 B;  1MMA A;  2DMU A;  2IEK A;  1WKM A;  4HBL A;  2AQE A;  1MBH A;  1T98 A;  2HFH A;  2XGE A;  2MBF A;  1R5H A;  5HLI A;  5FRM A;  1FOY A;  2BYV E;  4EGY A;  4CCM A;  4OU0 A;  4XNF A;  2IS2 A;  1RNL A;  5IT9 K;  5J1Y A;  3FZV A;  3DEE A;  2LRD A;  3I58 A;  2IXS A;  1S7A A;  5D4S A;  2KZG A;  3MQ0 A;  3HUG B;  4UUS A;  1OCO H;  3B02 A;  3VYU B;  4IEJ A;  3TBI A;  4ANJ A;  3HHH A;  2XAG A;  1O57 A;  2QVO A;  1MSF C;  2IS6 A;  1FT9 A;  3NAR A;  4A3C J;  2M87 A;  4HYE A;  1BA5 A;  3OS2 A;  2D1H A;  4NQW A;  2EIK H;  4BL0 B;  3FIW A;  1CQT A;  2VJI A;  3JRD A;  1XN7 A;  3JRI A;  2UWM A;  1TZL A;  2V1X A;  3G4S I;  2R7T A;  3RKY A;  1SEU A;  1MSE C;  3DU6 A;  1OR7 A;  4IX7 A;  1RR8 C;  4I0B A;  4D1Q A;  3IH3 A;  1XGN A;  3F22 A;  1X1C A;  4RGX A;  1XCV A;  2E1O A;  4QPO A;  1X1P A;  2ZME C;  4LMY A;  5M3F J;  4WWC A;  3F21 A;  2L9R A;  4DYR A;  3CF2 A;  4BAY A;  1I1G A;  1UHW A;  1HXD A;  2HQR A;  4XID A;  4JBA A;  1AKH B;  3GTQ J;  2H8W A;  1SFO J;  1QBJ A;  1UB9 A;  3IWZ A;  3L1P A;  1OCT C;  1FMW A;  2W00 A;  4A3E J;  2VXD A;  5LLQ A;  4HLY A;  1OCC H;  5CJ9 A;  2R7W A;  4DW6 A;  1VQ4 I;  5F1J A;  5EEA A;  4L5I A;  2R3S A;  2UXN A;  2M7A A;  3FBN B;  3HGG A;  3W2V A;  1IXC A;  2MGQ A;  3SDB A;  2HQ5 A;  3HG9 A;  4ESJ A;  2XRO A;  2DLL A;  2DYS H;  4L9J A;  2NRA C;  3OL4 A;  3CF5 F;  1KU7 A;  4EJO A;  2IA2 A;  4WCG A;  1VQ7 I;  2QSF X;  4X6A J;  4PJL A;  3P9C A;  4E7L A;  1IRG A;  3U21 A;  3VSL A;  3ZMD A;  3WTZ A;  2DXI A;  1L0O C;  1WJB A;  5BQT A;  1Q1H A;  1R58 A;  4A12 A;  1I3A A;  2P5V A;  3M3Y J;  3S2D J;  3EDP A;  2CW8 A;  3WG9 A;  2ZJR F;  4RLQ A;  4AWX B;  3GF2 A;  2XV4 S;  5DUI A;  2LD5 A;  2FEZ A;  1F5T A;  4HNU A;  3RYR A;  4PFO A;  2XUB A;  1R7J A;  1Z67 A;  2BHY A;  3DXJ F;  4DYC A;  2L7K A;  1YYV A;  2DAO A;  4HF1 A;  2V1U A;  4PDK A;  5M5W J;  2V9P A;  1MGT A;  3HRU A;  5HLT A;  1K79 A;  2BVL A;  3QAH A;  1ERD A;  4XMY A;  1X1D A;  2XHK A;  1YG2 A;  2ADU A;  2KRF A;  3IUO A;  3EUA A;  2YX4 A;  3OIO A;  1FYK A;  4E4H A;  5C4J J;  5L3D A;  1FP2 A;  3WTT C;  4LG3 A;  5K7F A;  3WU1 B;  2VAS A;  1IRZ A;  2QGU A;  1M1E B;  2R93 J;  2L5Q A;  4QWQ A;  4OIO F;  2K9M A;  3FM5 A;  4I98 B;  2K7L A;  2FBH A;  4IF4 A;  1U5T C;  1KYW A;  3R0J A;  2OZ6 A;  4KT5 C;  4RAF A;  3HOT A;  2ELH A;  5HDG A;  2P7C B;  3KZZ A;  1K6O A;  3GW2 A;  5TIS C;  2DO7 A;  2W48 A;  1TQM A;  2OU2 A;  1IDZ A;  4RAZ A;  3S3M A;  1JUS A;  3ZMU A;  4P1W A;  3ZQ7 A;  5JVG F;  2PN6 A;  1HW5 A;  4BHC A;  4ENM A;  2OTL I;  3K4J A;  2NS0 A;  2P5L C;  2KJC A;  1R36 A;  3R4K A;  3TP0 A;  3N05 A;  1A5J A;  5D5X B;  5FKM A;  4MQV A;  3VSK A;  2PBI A;  3VYS B;  5E1X A;  4Y13 A;  1ZLJ A;  4BXX J;  1RI7 A;  3P5J A;  1K6Y A;  1MBJ A;  3PNT A;  3PL8 A;  1LPQ A;  4HF2 A;  4YIF A;  2M9H A;  3CUO A;  3RIR A;  5DUK A;  2OJE D;  3TGN A;  4IHX A;  1DU6 A;  2ACJ A;  5L3F A;  1HW2 A;  4RGS A;  5HNH A;  2DOE A;  3CUQ C;  1MKM A;  1SFX A;  4A3I J;  2OQG A;  2XRN A;  2WAD A;  5GTI C;  2W25 A;  4CCJ A;  5HS8 A;  1NH3 A;  1FPQ A;  1WCM J;  1MBG A;  4KIT B;  2VBX A;  2KFD A;  5ICC A;  1Y8R B;  4AC0 A;  3JRC A;  2O0Y A;  4BXU A;  1NK3 P;  3K1N A;  4FET A;  4UV8 A;  3TL4 X;  2ZXI A;  4GRI A;  3K9T A;  1MMN A;  4ENJ A;  2JRT A;  4L5E A;  1YTY A;  3LA3 A;  1H88 C;  3J7Z I;  2W84 A;  2HOS A;  2LYC A;  1YI2 I;  2FXA A;  3HSR A;  3KLO A;  2Y48 A;  3L2V A;  3VWB A;  4C3H J;  3KEO A;  2L4M A;  3REO A;  2M8E A;  1GV2 A;  2GOX B;  3HGY A;  4UUS B;  1BOB A;  1IW7 F;  2IJL A;  2R7O A;  4JK1 X;  3BZC A;  2O61 A;  1GXP A;  1XSX A;  4A3F J;  1AU7 A;  2R7Q A;  2HWV A;  2H09 A;  3V8K A;  3CCQ I;  3ABU A;  2M45 A;  1FYL A;  2YU9 J;  1FWZ A;  2BY0 A;  3G3Z A;  2GXG A;  5E8G A;  1S3J A;  5DDG A;  3JCU C;  5DD4 A;  3TQN A;  1E2X A;  3J80 Z;  4EM0 B;  3O6B B;  1G2H A;  1R6R A;  1JT6 A;  2NVY J;  1MH3 A;  1QVT A;  1VQM I;  2UXX A;  1YW9 A;  1J9I A;  1RC9 A;  1A36 A;  1O7L A;  5HOO A;  2ID6 A;  2A3S A;  3AG2 H;  3ZGK A;  1HKS A;  2R7U A;  3KPH A;  4Q47 A;  2OD5 A;  4FE7 A;  2Q2E B;  2XIG A;  4HF0 A;  3ZMT A;  5LBQ A;  3LSI A;  1YS6 A;  3RPU A;  4JX5 A;  3GO5 A;  1D5V A;  4WXC A;  1R1U A;  1SC7 A;  4IHV A;  1Y39 A;  2VQL A;  2AQF A;  1ZRD A;  2E2I J;  2HGC A;  2FBK A;  3V8L A;  1E17 A;  1B72 A;  4CCL A;  5AIP A;  3ZP5 A;  1H9T A;  2X6O A;  5K7Z A;  4JYK A;  3TP3 A;  3DKW A;  1G3T A;  1FSE A;  3K4M A;  1JTY A;  2JT1 A;  1YJ9 I;  1MDM A;  2Z5U A;  1IUY A;  3WGH A;  2HS5 A;  2PQ8 A;  2C6Y A;  3QOP A;  4PK4 A;  3PQK A;  5J8F A;  4RB3 C;  4XL9 A;  4UUT A;  3ZQF A;  2RQQ A;  3RKW A;  4DYQ A;  4Y7N J;  4N9H A;  2D45 A;  1H0M A;  2RV8 A;  2VKD A;  2R0Q C;  1LVA A;  4XRF A;  5JLX A;  2RKH A;  3GCM A;  2I10 A;  4AIJ A;  4IRH A;  1T8I A;  3CCS I;  2NVU B;  2JA6 J;  3QP5 A;  3L2U A;  1E3P A;  2IGK A;  4OAZ A;  5CVV A;  2HDC A;  2MLK A;  4A0Z A;  5BMZ A;  1PUF B;  1GXQ A;  4YEL A;  4UXN A;  1VF9 A;  3GVA A;  3EQL F;  5H6R A;  4HPQ A;  3DPL C;  4GFB A;  2LRE A;  3KLN A;  3I54 A;  1JT0 A;  1K78 A;  2PJR B;  3M1C A;  3RQI A;  3PO3 J;  1T95 A;  1VI0 A;  2LVS A;  3B6C A;  4EEF G;  3RDI A;  3ELK A;  2R7S A;  5AON A;  5EG0 B;  1SVL A;  5LHI A;  3T8R A;  1YFH A;  3N97 A;  3HOX J;  1J09 A;  4HQE A;  3F9K A;  2GXA A;  3F8F A;  1YLF A;  4G7Z F;  4A93 J;  2HQN A;  3HOU J;  5E20 A;  1UHM A;  3QWL A;  1BL0 A;  4G6D A;  3C3W A;  3WGG A;  1D1A A;  3PIO F;  3Q5F A;  1JE8 A;  3FMQ A;  4KIG A;  3FM3 A;  1ZYR F;  4A6E A;  4A5M A;  3V42 A;  2E2H J;  5CVU A;  2LY2 A;  4N4O B;  2M34 A;  2XDV A;  2RRE A;  4ZTF A;  1XMX A;  2W85 A;  2JUG A;  3KP5 A;  4C9Y A;  4ITV A;  1XC5 A;  4ESB A;  3LSR A;  4BE2 A;  2GQQ A;  3E6B A;  3DEW A;  2E1M C;  3MN2 A;  4CCO A;  2FUG 2;  3HPH A;  1QPM A;  2XF7 A;  5JR3 A;  5GAD J;  5EGO B;  1B8I A;  2A69 F;  2W24 A;  3TW6 A;  3BPV A;  1AA7 A;  1HKQ A;  5DM6 F;  4XR6 A;  2IPQ X;  3HB9 A;  2O9L A;  2JRM A;  5HLH A;  1A35 A;  3V7S A;  3J80 K;  4GXO A;  3LQQ A;  1WGX A;  5K1Y A;  1TW2 A;  5HNF A;  3JRA A;  2ID3 A;  5LEJ A;  3HEF A;  3OY9 A;  4F52 A;  3EUH A;  3KEY A;  2DMQ A;  2NXN B;  2O8X A;  5TJJ A;  4KIB A;  1R1V A;  1XG1 A;  1W4M A;  3K7A J;  1T2K A;  4XLN F;  2MD0 A;  1W0U A;  1LE8 A;  2DU9 A;  1F1Z A;  1FNN A;  3EPZ A;  2EZL A;  2VPL A;  4LK0 F;  1UHS A;  4HNV A;  4HG2 A;  4LFU A;  4BJ5 C;  1XX5 A;  1GHC A;  1SVO A;  2CYY A;  2HVR A;  5LGT A;  1ULY A;  1SVM A;  2E5Z A;  4XKB A;  1ZN2 A;  3FX3 A;  5GAH J;  2E60 A;  3GTL J;  3H3V K;  1FY7 A;  3GFI A;  2H27 A;  3U9G A;  3IAS 2;  4BJT A;  2KHM A;  4G6T B;  1YE9 A;  2HKO A;  2JVH A;  4KDP A;  4XLA A;  2EIM H;  4ZYE A;  1BM9 A;  3WGI A;  2KDO A;  2W7N A;  2X6W A;  2OAZ A;  2CJJ A;  2O6G E;  3PSI A;  3VB2 A;  3OR1 C;  4GO1 A;  2CUJ A;  2HPM A;  4RB0 A;  2CWE A;  2IW5 A;  2DT6 A;  3HTS B;  2CUF A;  2EFW A;  3ONQ A;  4LIU A;  1JTX A;  4NBQ A;  5HS9 A;  2ZJ2 A;  4B47 A;  4AIK A;  1XB4 A;  3GTP J;  1KU3 A;  3ZMZ A;  2NYX A;  4BQA A;  2DOF A;  1U8B A;  2ZKZ A;  2P81 A;  1U3E M;  2KIM A;  3LMM A;  1R9T J;  3TOB A;  1QO0 D;  1U8R A;  1YHQ I;  3K4N A;  3L2C A;  5DCM A;  3E6D A;  3OYE A;  1ZG3 A;  4GYI A;  3C2H A;  3BG5 A;  4UUV A;  3COA C;  3RPQ A;  2LMD A;  3PNV A;  2RAE A;  5IP7 J;  3ZCO A;  1Y1V J;  2WBM A;  1BJZ A;  2R5Y A;  3PFY A;  1IZ1 A;  2Y0S N;  2V9K A;  5EDN A;  2VC1 A;  2Y9Z A;  2EBI A;  2CU7 A;  5IPA A;  4ZZD A;  1TL8 A;  2E2J J;  1O7F A;  2DA5 A;  2XGC A;  1XGS A;  4Y3O A;  1T33 A;  3CLO A;  2UUZ A;  3I0T A;  2JA5 J;  2ZNZ A;  2XAU A;  3FDY A;  1JI8 A;  3C7J A;  2UZK A;  1J75 A;  1EH6 A;  3CUQ A;  2KLO A;  4PSW A;  2JWT A;  4PGH A;  3PM1 A;  3VYT B;  2A61 A;  2EFN A;  1OR7 C;  2VKE A;  2MH2 A;  2BXY A;  1GVD A;  2EB7 A;  1MBE A;  4CYD A;  2NNY A;  4LD5 A;  2KL4 A;  1IN5 A;  4IQJ A;  2Y9Y A;  4L5J A;  4XOP A;  2O8K A;  1WQ2 A;  3H0D A;  4B48 A;  3GX4 X;  2EZI A;  2L02 A;  1HQC A;  4HV6 A;  3T0Y A;  4NQW B;  4AM3 A;  2E1M B;  1VZ0 A;  2X1D A;  2Y30 A;  1ON2 A;  3CCM I;  1QNT A;  4EM1 A;  2A6E F;  1TWH J;  5DCF A;  3HOY J;  2OCE A;  2DQR A;  1X3W B;  2K86 A;  1ZHF A;  2HEO A;  1R23 A;  2Z99 A;  1TBX A;  5LHH A;  4HV5 A;  2WAE A;  3DU5 A;  5CQE A;  5BPD A;  2M4G A;  3I4N J;  4M74 A;  3ZPL A;  2KJB A;  2LH9 A;  3GZN B;  4RAG A;  2IGM A;  2I5U A;  2Z33 A;  5DD8 A;  1ETW A;  1FBS A;  5E17 F;  4CSW A;  1JJ8 C;  3WTY C;  2FOW A;  1W36 D;  4IRG A;  2ZC2 A;  3FIS A;  3BG7 A;  2ZXJ A;  4NB5 A;  2CH0 A;  2R5Z B;  4MFD A;  1IGN A;  3MAJ A;  3SFI A;  1IN4 A;  2X9D A;  2GOM A;  3KP3 A;  1ZGA A;  2IA1 A;  4BGD A;  3G2B A;  4XKW A;  3GWZ A;  4RBO A;  4IHW A;  3FXO A;  3JSO A;  3ROU A;  2K02 A;  3A0H C;  1C0W A;  2XAJ A;  3CME I;  2V26 A;  3O8G A;  3NEU A;  4YRV A;  1TW3 A;  3OYN A;  4BAC A;  4XOT A;  3QYE A;  2V1D A;  1U78 A;  2IRF G;  2NVX J;  4CXF A;  2M7B A;  4I76 A;  4ESF A;  2Y75 A;  2DJI A;  3B73 A;  3J7A O;  1W7P A;  3MWM A;  2EH3 A;  4II3 A;  4RB1 A;  2LFB A;  1PP8 F;  2RC4 A;  1U2W A;  1LUJ B;  2IVM A;  1X1B A;  3RYP A;  3MKZ A;  1ONV A;  1JKO C;  5LRR A;  4XRM A;  1D8K A;  2L7M P;  1HSJ A;  4CHU A;  5KCM A;  4S0H B;  4CO8 A;  2Y2Z A;  2PG4 A;  4MQ9 F;  2XAS A;  4YIR X;  4M9S A;  2XAQ A;  3GLL A;  3GTG J;  2L7F P;  2CGP A;  1KA8 A;  2WAF A;  5FLX Z;  3OYA A;  2HTS A;  1IRF A;  1S5L C;  5M5X J;  3CO7 C;  4N0B A;  3G71 I;  5GPA A;  2ME0 A;  3M1E A;  2IBD A;  3MEX A;  5E1Z B;  1RIO H;  4BHB A;  4HLX A;  2IP2 A;  1BC8 C;  1WI9 A;  3K69 A;  1G4D A;  1UFM A;  3ABK H;  3GTK J;  4A0X A;  4KFC A;  1FC3 A;  1QZE A;  4XBF A;  3LAP A;  2QKM B;  4XSZ F;  3L2W A;  3CDL A;  4P9F A;  3OOP A;  1N25 A;  4OMZ A;  1AHD P;  4BJ6 C;  2DFF A;  4HX4 A;  2HZT A;  4F93 B;  1B72 B;  3RI4 A;  4BBR J;  2CFO A;  3HKZ N;  1D0X A;  2DYR H;  3WTW C;  1ZR2 A;  1GVJ A;  5BS6 A;  2ZFW A;  4L9V A;  1MDM B;  1P6R A;  4A69 C;  5L3E A;  1QGP A;  3D5L A;  4F92 B;  5ICE A;  5IY5 H;  2X6X A;  4N9I A;  3DQV C;  3HZJ A;  2VOO A;  1S72 I;  5GPC A;  3JRE A;  2MSY A;  3LQR A;  3LL7 A;  2QUF A;  1K7A A;  2F4I A;  3FXK A;  4PJ0 C;  3PSF A;  3OSF A;  2HDW A;  3ZQQ A;  1JGG A;  2PFB A;  3RKQ A;  5EYR A;  5FGM A;  5B1B H;  4OIN F;  1HLV A;  2W57 A;  1ETQ A;  1IDY A;  5HOD A;  1EJ9 A;  1Z6T A;  2CW0 F;  1VQ5 I;  5F0C A;  3L2R A;  5IP6 A;  3RCO A;  3HUG A;  1Y8Q B;  4MEY F;  1T38 A;  1W7P D;  3BDD A;  3FXR A;  4D5F A;  2KIF A;  3VEP A;  3WHC A;  1TP4 A;  4CGZ A;  3OYK A;  1YS7 A;  2Y69 H;  2KDZ A;  2XGD A;  3PJR A;  2ICW G;  2CQQ A;  2F5C A;  2R5Z A;  4OMY A;  2MW8 A;  3P7N A;  2ZCW A;  2L3D A;  1YJN I;  4W97 A;  1FMV A;  3DEU A;  4DQ2 A;  4UB8 C;  1RZ4 A;  1BR4 A;  1WRJ A;  2JN6 A;  3VPR A;  1RET A;  5TRD A;  2M30 A;  2XKO A;  2HPI A;  4CA0 A;  1TNT A;  1V55 H;  4ENK A;  4A3J J;  2HVS A;  4BY1 J;  2G7H A;  3I5U A;  4QSH A;  3K70 C;  2CRG A;  4Z6Y A;  3ASO H;  4NNJ A;  3ZRG A;  1YIJ I;  2VON A;  3EUH C;  2KRC A;  1T56 A;  3G1M A;  2VIX A;  3SFZ A;  4RMN A;  4LIV A;  1GLN A;  2QEX I;  4HDV A;  1W36 C;  1DDN A;  4XLH A;  3LST A;  1QA6 A;  1UCR A;  2K27 A;  1XDU A;  2JQ7 A;  1DGW Y;  1J7K A;  3JTH A;  4XN0 A;  4M6Y A;  3RJP A;  1FBU A;  1TNS A;  2MD5 A;  2V6E A;  2YSR A;  1G3Y A;  1E3O C;  2FML A;  5IOZ A;  1I6H J;  1U9O A;  4KMU X;  4A3B J;  4H0E A;  2Z1D A;  3LOC A;  2A5W A;  3HJE A;  5EF6 A;  3O2P E;  1OCZ H;  2CQX A;  5ED4 A;  2DMT A;  4XN3 A;  1W5S A;  3E0J B;  5EG0 A;  2XKP A;  1SAU A;  3UR3 C;  2A05 A;  4M6X A;  3JR9 A;  3GME A;  3WHB A;  2PMZ A;  2HDD A;  1APL C;  4UVC A;  1W7P B;  2CO5 A;  5J6X A;  3CCY A;  1FOW A;  2LKX A;  4Q48 A;  5K5Q A;  5HDK A;  4FX4 A;  4CIC A;  3FXM A;  3SHF A;  2K9N A;  2O3F A;  3PO2 J;  3F6V A;  1BBY A;  5E79 C;  2XF5 A;  5FKO A;  2HQA A;  1F43 A;  3ERM A;  4B43 A;  2PJP A;  3CMM A;  5FLM J;  2H8R A;  4EJT A;  4PGG A;  2K3P A;  3F72 A;  3LSK A;  4FT8 A;  3MKL A;  5FB2 A;  1ETV A;  3GTM J;  4EVI A;  3BG3 A;  1Z3Y A;  2VBW A;  4IRI A;  4J00 A;  1N78 A;  1YO5 C;  2B0L A;  4IHY A;  2MC3 A;  3G1O A;  2AO9 A;  2FX0 A;  4MO7 A;  3OYH A;  3A03 A;  1MH4 A;  1OKR A;  2KQR A;  3BPX A;  4A3D J;  2VOP A;  4C2M J;  3IAM 2;  1LDK B;  1TWG J;  3QPL A;  2EFO A;  5FKK A;  3CCV I;  2QKL B;  1B9M A;  4BQN A;  3JRG A;  5K5R A;  4KA4 A;  1WJF A;  3Q0U A;  4M3F A;  1TWF J;  3OV8 A;  4A2U A;  1SFE A;  3QPT A;  1MJB A;  2A6T A;  4ZDP A;  4AUX A;  4CDG A;  3GYH X;  2IGN A;  2WTE A;  2HXO A;  3E5U A;  3K4B A;  1XPX A;  2V4J C;  1J0R A;  3C2G A;  2FMY A;  3TKY A;  3T1B A;  3EYI A;  1W5T A;  2VOD A;  1FYM A;  2WY7 Q;  1B59 A;  1DPR A;  3TMO A;  5EZH A;  2R7V A;  2KIS A;  3S93 A;  1Z3X A;  3LNQ A;  3V7R A;  4RA2 A;  5J4Y A;  3QP6 A;  2QBY B;  4M3G A;  1V5F A;  1LKX A;  1KQ9 A;  2GIZ A;  3VOD A;  1SFU A;  5C3E J;  2QWW A;  1BIA A;  2W4S A;  2Z16 A;  5EEH A;  2O7O A;  3HOZ J;  1FLI A;  4M9Z A;  4YFN F;  4BHP A;  4PJJ A;  5D8K B;  2DMN A;  4G6Q A;  2JA8 J;  4Q5S F;  2EWN A;  3FXL A;  1Q1V A;  3M8F A;  3OYC A;  3SEQ A;  3PUB A;  1D1B A;  3I4M J;  2BOL A;  5H2F C;  2EPF A;  4CYC A;  4V19 K;  1MNE A;  2BE5 F;  3BCB A;  2B9S A;  3I64 A;  2MFZ A;  3AG3 H;  1HBX G;  2ZB9 A;  4E6K G;  2FQ3 A;  2CG4 A;  2CQ7 A;  3LA2 A;  1K78 B;  1HA8 A;  3DPT A;  5IYC J;  3E1S A;  3ZQC A;  4BE1 A;  4XKC A;  3F6O A;  2IA0 A;  4LB6 B;  4P9U A;  5F27 A;  3E3V A;  2F48 A;  3F8N A;  3BC8 A;  2A6H F;  4C3I J;  1FIA A;  1MJ9 A;  3T5X A;  1A04 A;  3CTA A;  3S32 A;  3F23 A;  1I50 J;  2YU3 A;  4AD9 A;  2M2E A;  1X58 A;  4FE4 A;  2JMW A;  5K7H A;  3KP7 A;  2YX7 A;  5KK1 A;  3DTI A;  1WPK A;  3VOE A;  1LDJ A;  5FRN A;  2R7X A;  1YOV B;  2DW4 A;  3CCL I;  4E7I A;  4ABZ A;  1OCR H;  2E71 A;  3KEQ A;  2L9S A;  3U2R A;  1ZRF A;  1JUP A;  2PMH A;  3H3Z A;  3QU6 A;  5D5W B;  1QRY A;  1EV7 A;  2LBF B;  3W2W A;  1GV5 A;  1X2N A;  2ISY A;  5EGO A;  4XLC A;  3PUF A;  5FD5 A;  2ZJQ F;  2O5R A;  1UG2 A;  1MMS A;  2K9L A;  4P55 A;  1JKQ C;  1YIO A;  2K40 A;  1R71 A;  3I55 I;  4XK4 A;  1RKW A;  4CCN A;  4PZJ A;  1AKH A;  3WTS C;  2COM A;  3GZ5 A;  1L3L A;  2P0W A;  3PNY A;  1IG7 A;  1WVR A;  2LBF A;  1HF0 A;  3EUK L;  2VBY A;  2D1V A;  3OIQ A;  3E5Q A;  3K2A A;  2MG4 A;  1KYZ A;  2BW3 A;  2D2W A;  2FSW A;  1S7E A;  2BHZ A;  1XCB A;  4I0A A;  3A02 A;  1X2M A;  2EV5 A;  5E8I A;  2COB A;  3ZQG A;  3UNG C;  4U0V A;  4I01 A;  4HOB A;  1ETO A;  4BKX A;  1G3S A;  4IO9 F;  3BR6 A;  2VE8 A;  1SD4 A;  3BTI A;  2VQG A;  3FHN A;  3JRH A;  1PJR A;  1JUM A;  2VJ5 A;  3KYC B;  3LFU A;  4O6J A;  3WOD F;  1V5G A;  1IXR C;  2XRL A;  3FMR A;  3ZOB A;  3KX2 A;  5IOY A;  3F0C A;  3SJM A;  1SFK A;  2EIJ H;  4KIS A;  2BW3 B;  2MLG A;  3AAF A;  3HC7 A;  3F8C A;  3LFK A;  3G1L A;  4ON0 A;  3L2Q A;  3D1N I;  3GTJ J;  3H9Q A;  4KMF A;  1IV8 A;  4ZDO A;  4LLN A;  1YX5 A;  4IVN A;  5LGU A;  1B4A A;  4OWR B;  3CJT B;  4RAY A;  1ZR4 A;  5KVR A;  3OR2 C;  2GWR A;  5HDN A;  4ZC3 A;  4CYC B;  3FK6 A;  4XLE A;  2CV2 A;  1YQA A;  5E3L A;  5B5E C;  1ZG1 A;  3LSH A;  4DJA A;  1QPI A;  2ECC A;  2E5N A;  3HM5 A;  1IUF A;  3M8E A;  1D3Y A;  2DFE A;  4NC6 A;  3A0B C;  4RB2 C;  2IS1 A;  4DBR A;  3MZH A;  4AU7 A;  3W6J B;  2N8G A;  2VE9 A;  1FTZ A;  1MBK A;  5BOX A;  1SMY F;  2Y0M A;  1FOX A;  4WK8 F;  1ZRE A;  5E3O A;  4RDU A;  2E1C A;  2H6C A;  3BR2 A;  3V7C A;  2HYJ A;  4AID A;  5GAE J;  1P4A A;  2BEO A;  5F1R A;  3S1R J;  2X1E A;  1PDN C;  1LFB A;  1HST A;  3ULQ B;  4B1R A;  1HDD C;  1QU3 A;  2DTR A;  3IV5 A;  2EZH A;  4XOR A;  3LAJ A;  4L9N A;  5J47 A;  3DF8 A;  1J59 A;  3GLX A;  5GTH C;  1MIJ A;  3FMS A;  2DDA A;  5J1U A;  3SYT A;  1DU0 A;  3CJN A;  3V4G A;  3OYM A;  1PUE E;  4I7H A;  4FQG A;  2Q2E A;  2GAU A;  4R8H A;  2F6C A;  4F91 B;  4CCK A;  3GTO J;  1ON1 A;  4MTE A;  4EAT A;  2VT2 A;  3RPU D;  4OAY A;  5EJC A;  4BDZ A;  4E7K A;  3SZG A;  1ZTR A;  3J7A Y;  3SZT A;  1S8N A;  2CS3 A;  3HTU A;  1F9N A;  2EIL H;  5B3S H;  1MZB A;  1X1A A;  2I8D A;  3IHU A;  2JPC A;  1HKT A;  3X2Q H;  1O3T A;  3DKX A;  3DTK A;  3V8J A;  4PFP A;  5F08 A;  2Z3Y A;  2LKS A;  1IXS B;  4Y15 A;  4YFK F;  4DNC A;  1Z21 A;  4C3J J;  2FOK A;  3OYB A;  4J01 A;  3KZI C;  3AL0 C;  4M9X A;  5FKN A;  4HRI A;  3I3L A;  2VKH A;  2EA2 A;  1EA3 A;  2BGC A;  1I5Z A;  3I4P A;  4IJA A;  1SAN A;  4F3Q A;  1ZQ3 P;  1S29 A;  3J7Y J;  2X1C A;  2XAH A;  2RN7 A;  3S14 J;  5D5V B;  2K9S A;  1XS9 A;  1D0Y A;  2GBY A;  2DTZ A;  3DBL B;  2LOO A;  3P9K A;  1BI2 A;  4LG0 A;  1Z7L A;  4I2O A;  4E7Z A;  3D5R C;  4CZZ A;  2NS7 A;  4BQO A;  1MND A;  2LK2 A;  1PYV A;  3BY6 A;  2AXL A;  1YRN B;  5J3L A;  1Z7U A;  2M5W A;  1GT0 C;  2XSD C;  3LA7 A;  3DP7 A;  1TQI A;  1Z05 A;  3Q3S A;  3H5A A;  2DFH A;  3CJR B;  2HZD A;  4D9J A;  4OIP F;  2DBB A;  2EA4 A;  1FEX A;  2E19 A;  3QU3 A;  2QF7 A;  1ZH5 A;  5F0F A;  3KE2 A;  5J4V A;  1QHH D;  3BR1 A;  4XRS G;  1DGR M;  4KIC A;  2LF7 A;  2LR8 A;  2FE3 A;  3H92 A;  4EV0 A;  3W2A A;  2CQN A;  4KUM A;  2K85 A;  4PJN A;  1ZGJ A;  2E1N A;  3JAM Z;  3TED A;  3M9A A;  3JSP A;  1UST A;  4NC8 A;  2MC4 A;  4MTD A;  3CMA I;  3H3U A;  4X0G A;  3CZ6 A;  2OV7 A;  3C18 A;  2F5V A;  4D7N A;  2H94 A;  4D5C A;  2EIN H;  2ISZ A;  5J8C A;  3R61 A;  3UKG A;  2DFI A;  4UVB A;  5FLX K;  3KCC A;  2H1K A;  5CVR A;  4IOC F;  4BXF A;  1F4K A;  4IOA F;  4R1H A;  2UV1 A;  1V5E A;  1Z0X A;  3CP8 A;  5LHG A;  5M3M J;  3OSG A;  3WTU C;  5F6F A;  2OCC H;  3I71 A;  2RQP A;  2ELK A;  2IGO A;  1RUO A;  1U5T A;  2JJ7 A;  3LWF A;  3SDG A;  3NWT A;  4HDU A;  3S16 J;  1MNM C;  4V2G A;  1UJ8 A;  3G6E I;  2WB1 N;  5ILS A;  3HSF A;  3Q0V A;  3DBH B;  3ECH A;  5IYB J;  1FSH A;  5LEK A;  2LTP A;  1K83 J;  2M1B A;  2L54 A;  2WC2 A;  5KAF C;  1BR2 A;  2DK5 A;  1Z1D A;  3ZQI A;  4A3K J;  2NVQ J;  2VQH A;  1BI0 A;  3CC2 I;  2KIU A;  4ASN A;  4LOC A;  1IV6 A;  3W6V A;  4U87 A;  3RKX A;  1SAX A;  1BOA A;  3DTE A;  4Y17 A;  4ENN A;  3U1D A;  3OYL A;  3WTX C;  2GA2 A;  3MZ8 A;  5L3G A;  4XRS A;  1XDS A;  2F5E A;  5DS9 A;  4CUG A;  1VQ8 I;  3HRS A;  1UEL B;  4DIQ A;  3D5S C;  1U9N A;  3LSP A;  1MMG A;  1E0E A;  3BRO A;  2DPD A;  1REP C;  2WWY A;  1VQO I;  2K4B A;  1VQ6 I;  4NUB A;  4P5O A;  2PJR A;  1EH7 A;  2K4J A;  1P4W A;  3ASN H;  2LC2 A;  3BWG A;  5KNL A;  2X85 A;  4FX0 A;  1K4S A;  3C2B A;  2Z2S B;  4ZYG A;  4U7D A;  2XB0 X;  1RES A;  5JHU A;  3S3O A;  3FXJ A;  1B6A A;  2VBZ A;  3GBG A;  3MVP A;  2AS5 F;  1A6Q A;  5CKT A;  1SD5 A;  1S7O A;  3M07 A;  1OYW A;  3E7L A;  3K0L A;  2F4O B;  4LJZ F;  4MFE A;  4JX4 A;  2JTV A;  4I09 A;  1IJW C;  1ENH A;  1I39 A;  5DM7 F;  3S15 J;  5F64 A;  4DZJ A;  2KT0 A;  1WJ5 A;  2BV6 A;  2RDP A;  5DYM A;  1TC3 C;  2YR2 A;  3H1C A;  4KN4 X;  1VQP I;  3HKZ A;  1KON A;  5ICF A;  4Y4R A;  4KYW A;  5H6Q A;  2DA1 A;  1J2X A;  3TW7 A;  4MEX F;  3Q0W A;  1WJC A;  3BG9 A;  4JOM A;  2WV1 A;  4MIM A;  3I9V 2;  4QPQ A;  2EFP A;  2ESN A;  2OF7 A;  1E3H A;  3IKV A;  1A6I A;  1SD7 A;  5B66 C;  3LSM A;  5BNG A;  2DK8 A;  1IN8 A;  3BOQ A;  3BR5 A;  3TDZ C;  1WH7 A;  2VPR A;  2ZME B;  2CSO A;  2Q8K A;  4FTH A;  1FX7 A;  2GIV A;  1STZ A;  2WV0 A;  1FOK A;  2VKV A;  4M3B A;  4EJU A;  1CF7 B;  2XGX A;  4HZF A;  5GAG J;  2AHQ A;  3QQA A;  3M4O J;  4XLF A;  4XSX F;  3JAM K;  5J40 A;  2VXZ A;  1VTN C;  4JX6 A;  2V6C A;  2JVG A;  2WB1 A;  2FRH A;  4U0W A;  2EQR A;  4F7Z A;  2HI3 A;  1IF1 A;  3K4L A;  3S1M J;  1ZRC A;  2NS8 A;  2D5V A;  3PQJ A;  3DBR B;  2HNH A;  4EGZ A;  3HOW J;  1CGP A;  3NWS A;  3OWT A;  4E7H A;  3S1N J;  2X0L A;  1BJA A;  2L2O A;  1I6X A;  1G8X A;  3JW4 A;  5ILV A;  5FD6 A;  3TOA A;  4M6V A;  2K9Q A;  3BTL A;  3CP2 A;  5TGT A;  1ZK8 A;  1MJA A;  2B63 J;  1R1T A;  3ERE D;  2LY9 A;  3FF5 A;  4O5V A;  4YEJ A;  2EFQ A;  3ML6 A;  1Y0N A;  2DA6 A;  2DA7 A;  1TWA J;  1U0J A;  4EMS A;  1BI3 A;  4KT6 A;  2XC7 A;  2DA3 A;  2FF4 A;  1RR7 A;  1D5Y A;  9ANT A;  3OYD A;  3K70 D;  4P96 A;  4WXD A;  1ZAO A;  3N4M A;  1W5C C;  3PIP F;  4C2T A;  1SD6 A;  2X51 A;  4WF2 A;  5GP9 A;  2NNN A;  3EET A;  2X6Y A;  3GEZ A;  3HBL A;  1WJA A;  3ECO A;  3TDU C;  4BEH A;  2L01 A;  3DFG A;  5E18 F;  3H35 A;  1R4M B;  3AFH A;  1JXS A;  1ETK A;  1FZP B;  2FA5 A;  1ETY A;  2G0E A;  5H20 A;  1WWX A;  1PVE A;  1X4P A;  4HST A;  1RUN A;  4ZDL A;  2XPW A;  4U7B A;  1T0F C;  1BW5 A;  2R7R A;  2L0K A;  2F5D A;  4QTR A;  1PUF A;  3BG6 A;  1P9Q C;  3H5R A;  3IWF A;  3NQO A;  4C2U A;  4L0Y B;  3T8T A;  4GYG A;  2FU4 A;  3OS1 A;  2WY8 Q;  1X19 A;  3AG4 H;  5JHF A;  1S6L A;  2QQ8 A;  2CFX A;  2DA2 A;  1D0Z A;  4UV9 A;  3WE3 A;  1K61 A;  1LVK A;  3A01 A;  5J1R A;  5L3C A;  3EYY A;  3DWL E;  4ZTJ A;  1K4T A;  5IYD J;  3ABT A;  3IL2 A;  3CJQ B;  1IAW A;  4GCV A;  1D1C A;  2ZSH B;  2JUC A;  3OYJ A;  2JPB A;  1T0F A;  1BW6 A;  1H9G A;  2OA4 A;  3BR0 A;  2E34 A;  2M0M A;  3CDH A;  4LK1 F;  3F8B A;  2R7F A;  2ZME A;  3KYD B;  5FKL A;  3HPG A;  3HOV J;  5D6F A;  4F55 A;  2DT7 B;  3VFZ A;  4AYB N;  1LDD A;  5LFA A;  2QZ8 A;  3IKT A;  2HTJ A;  5IP9 J;  2CV1 A;  1S9H A;  1I27 A;  1KQ8 A;  4I99 C;  3BQY A;  1LEB A;  2JSC A;  2KRH A;  4BU2 A;  2QCO A;  3CDI A;  3ABM H;  2HU9 A;  2CW7 A;  1OMI A;  2QM3 A;  1B9N A;  3S3N A;  1VQ9 I;  1N77 A;  1R22 A;  2GLO A;  1MD0 A;  1QHG A;  3WG7 H;  4A0Y A;  3CCU I;  4JQF A;  3Q9V A;  2L7Z A;  2CMP A;  1QQI A;  1V4R A;  1Z9C A;  2M4K A;  4NDL A;  1ITY A;  2DN0 A;  2TDX A;  2YUS A;  3DPU A;  1FJL A;  1ZAR A;  3S2W A;  4M71 A;  3AL0 B;  4U0Y A;  3ZN1 A;  1AWC A;  1O3S A;  2QA4 I;  1MW7 A;  4LG0 B;  2JZY A;  5A2Q Z;  3H9J A;  3DKY A;  3QRF F;  2A07 F;  2NVT J;  3DV8 A;  3FWE A;  2HYG D;  3J81 Z;  1X4O A;  2FQ4 A;  3ZMV A;  5HVQ C;  1OFC X;  3HL2 A;  1YW8 A;  3HHG A;  1HCR A;  2Y31 A;  2HOE A;  2JSP A;  3CUQ B;  4D0P A;  2X4H A;  5M5Y J;  3HYI A;  2GM4 A;  1R00 A;  3PFI A;  2ZNY A;  3CLQ A;  5FO5 A;  3DLL F;  3IRQ A;  2IS4 A;  2VI6 A;  2ZXH A;  1H8A C;  3KP2 A;  2BY1 A;  3BZK A;  3K2Z A;  3FBI B;  4RLF A;  3AKZ A;  1B1B A;  1Y6I A;  4PSX A;  4M3E A;  2QEN A;  5L3B A;  5CLS A;  5DCM B;  3NAU A;  1NG7 A;  3GFL A;  2M3A A;  1O3Q A;  3CES A;  2VB6 A;  1XTA A;  2ZBK A;  3M7G A;  1TT0 A;  2R4G A;  4DGW B;  4K2E A;  3CMY A;  4OIQ F;  2EZK A;  2YPR A;  4HEA 2;  3ISP A;  1R5G A;  4HA8 A;  4BDY A;  5AIQ A;  1IO2 A;  1CF7 A;  1TWC J;  2FNA A;  1IRX A;  5D4R A;  3R0A A;  1ZEL A;  4W1U A;  1RPW A;  2ZJP F;  4OIR F;  4LLL A;  1O4X A;  4IKF A;  2L9V A;  4L18 B;  5E3N A;  2PMU A;  2ZXW H;  3W3C A;  4UNO A;  4BY7 J;  1KU9 A;  5B1A H;  2P7V B;  5ILU A;  3MCZ A;  1NK2 P;  3OYI A;  3GZ6 A;  4BBS J;  3DCF A;  1ZGW A;  1R5I D;  2HVQ A;  2OZU A;  5FFZ A;  4LGW A;  2ELJ A;  3JTG A;  4Y52 J;  2EJR A;  4R79 A;  1QZY A;  2YS9 A;  3E5X A;  1QVU A;  1OCP A;  3KYL A;  3DLA A;  1NHA A;  2HXI A;  3OL3 A;  3D0S A;  1FIP A;  3F8M A;  3CC7 I;  3BTJ A;  1XMA A;  2W82 A;  3S1Q J;  1EH8 A;  3LSJ A;  3GFM A;  5FLV A;  2PI0 A;  3QOE A;  1P7J A;  4PUS A;  1T39 A;  3GUD A;  3MZY A;  1WHU A;  1ODD A;  4G7O F;  1HW1 A;  4JP0 A;  4DOZ A;  1HC8 A;  2PX9 A;  5HLG A;  4IQ4 A;  4CH7 A;  4XM3 A;  2B7E A;  1NTC A;  4RGR A;  5CVJ A;  1OQY A;  3CC4 I;  3H9G A;  4BUP A;  3FXQ A;  3E6M A;  2RGV A;  1OLT A;  1I1S A;  1VFC A;  4RGU A;  2QQB A;  4ZYH A;  2X48 A;  5D5U B;  2BBY A;  4A3M J;  1WZ2 A;  1WJE A;  2OPT A;  1MMD A;  1YX3 A;  4WX9 A;  1ACI A;  3BJO A;  1RRJ A;  3K1P A;  5EEG A;  2OBP A;  2MYS A;  2ESH A;  4HX7 A;  5C4X J;  2Y0S A;  4IXA A;  2OC6 A;  4NC7 A;  5EZG A;  3A01 B;  4BEH B;  4FCY A;  5LRS A;  3TO6 A;  4PCQ A;  1P92 A;  4M73 A;  4RM3 A;  3JRF A;  4S04 A;  4IHS A;  2OUM A;  2V7F A;  4A6D A;  4ZYA A;  2H1L A;  4G12 A;  5A2Q K;  3G73 A;  4A3L J;  5JI6 A;  2CUE A;  1KQ0 A;  1Y0U A;  2DQL A;  1RKT A;  1JHF A;  4ETS A;  3L00 A;  1R49 A;  2V1N A;  2WAQ N;  3B6A A;  5CQG A;  3FHZ A;  3CCE I;  3ZMS A;  1U6G A;  3SEZ A;  1Y56 A;  2G7U A;  4B3A A;  1KU2 A;  1WJD A;  2KKO A;  5KHD A;  2P6S A;  3P9I A;  5FFX A;  2A68 F;  2PLY A;  5F04 A;  3E6C C;  4EQQ A;  2R7D A;  4N4N B;  1POG A;  4M3D A;  3K6G A;  3CQZ J;  2IAI A;  3OOU A;  3OYG A;  2KIQ A;  4ZH4 F;  3SQN A;  3HSE A;  4AVP A;  2E35 A;  3RQ4 A;  4S05 A;  1FBQ A;  1ETX A;  1UZC A;  2L4A A;  1XSD A;  3LSG A;  2WA0 A;  5IT3 A;  1UG0 A;  3TO9 A;  2GA1 A;  2P5K A;  4BYY A;  1UMQ A;  2V9V A;  2LLK A;  5CPR B;  1WSU A;  4CZC A;  4KIF A;  2H6B A;  1XSV A;  1EKE A;  4XQF A;  3C1D A;  3IRR A;  4YFX F;  4LB5 A;  3S17 J;  3QYB A;  2A5Y B;  1IN7 A;  1DQU A;  1FP1 D;  1WFX A;  2R7Z J;  4IZZ A;  2FNP A;  1XMK A;  2ZO4 A;  4HQM A;  1SMT A;  5D6E A;  5ICG A;  3KET A;  2XPV A;  3GFJ A;  2ZFU A;  3A2K A;  3IP4 B;  3ZQL A;  2PEX A;  3CD6 I;  2LNB A;  2TRT A;  1N75 A;  1BR1 A;  1OJL A;  4KJZ A;  2DOD A;  5E3M A;  2GZW A;  1TTY A;  3FXU A;  3I56 I;  4MLO A;  2J5P A;  2BVM A;  1BIB A;  1BI1 A;  4TV7 A;  2PMZ N;  3WU2 C;  1X3Z B;  4Q4Z F;  2DMP A;  3L9F A;  4UVA A;  2NOG A;  3ABL H;  2E7X A;  3OYF A;  4IHT A;  2VUM J;  2CV0 A;  3CO6 C;  4A5N A;  2QYO A;  3BTC A;  3A1Y A;  1LFU P;  1ORK A;  4AYB A;  3SXY A;  1D8J A;  4ZYD A;  5BPI A;  1WI3 A;  2QSG X;  1Z91 A;  2ME6 A;  4AVZ A;  1DP7 P;  1DUX C;  5LGN A;  2JA7 J;  2DA4 A;  2BXZ A;  1LNW A;  3FKJ A;  4MNU A;  3O3K A;  2BY2 A;  1X3U A;  2E7W A;  4XLP F;  1PP7 U;  2XAF A;  3JRB A;  2VN2 A;  3MKW B;  4B8X A;  3BJA A;  2R5Y B;  3KFW X;  1LQ1 A;  1R4N B;  1HDP A;  1DPU A;  3ESW B;  4GGG A;  2FBI A;  4L0Z B;  4V2F A;  1G6N A;  5DEQ A;  2ECB A;  1LE8 B;  1EF4 A;  3BP8 A;  2AXT C;  5LD2 C;  1J5Y A;  3BZ6 A;  3S2H J;  3K4C A;  2JK3 A;  2LG4 A;  5FJ8 J;  4B44 A;  1V3F A;  4C30 A;  4GDF A;  3MMY B;  1WH5 A;  1P7I A;  3F3X A;  3E97 A;  3KP6 A;  2J5O A;  1JKP C;  2CUZ A;  2DDB A;  1IC8 A;  1DP3 A;  3J81 K;  4U88 A;  3TO7 A;  2DJN A;  1V54 H;  3MFK A;  1GDT A;  4EJV A;  2K5C A;  4IPA A;  1T6S A;  3I59 A;  3RZD J;  5KAI C;  3HIF A;  3AG1 H;  1ZLK A;  4RM2 A;  3M8J A;  1QZZ A;  3HDD A;  1Z6R A;  4BE0 A;  2LKP A;  1JGS A;  5DTD A;  1U5T B;  3WTV C;  3I59 B;  2Q0O A;  1XGO A;  3MKY B;  3SZP A;  5JFR A;  2FD5 A;  1YIT I;  1JJ6 C;  1FTT A;  1Z77 A;  2DOA A;  5ERI A;  4IL6 C;  1USS A;  2KMU A;  2F4M B;  2K3F A;  4E70 A;  3BLY A;  3OS0 A;  4B3X A;  2XB5 A;  2G9W A;  4A3G J;  1LJ9 A;  4FAS D;  1HOM A;  2W1O A;  4BH9 A;  1W0T A;  4M72 A;  4EJW A;  3CCR I;  2VL8 A;  2P8T A;  2Q1Z B;  4YII A;  1YJW I;  5C44 J;  4PJM A;  2LSO A;  2ETH A;  2KP6 A;  2RNJ A;  2OTJ I;  3ZQH A;  3KZY A;  3K10 A;  3H36 A;  4J19 A;  3OMY A;  2HOT A;  3O8H A;  4QIW N;  4KNY A;  3ZN0 A;  2KPM A;  4D7M A;  2CQK A;  3VDX A;  1IN6 A;  2VC0 A;  3K1M A;  4MGR A;  2XSJ C;  4MHG A;  4HX8 A;  1OYI A;  3BJ6 A;  1T08 B;  4BS9 A;  2P4W A;  1KZH A;  3HXL A;  3WE2 A;  5IT9 Z;  2MH9 A;  1ZKG A;  5CVI A;  5D8L B;  2V79 A;  2NAZ A;  2QBY A;  1OPC A;  1P4X A;  4HW0 A;  4G9Y A;  4I6Z A;  2OQR A;  4FIS A;  3QOD A;  3OIP A;  5JLW A;  1LB2 A;  3R6S A;  6PAX A;  1KGS A;  4B4C A;  2DI3 A;  3Q9S A;  1JKR C;  4OOI A;  4HAM A;  1OIS A;  1VQK I;  4UHT A;  1LEA A;  3QPS A;  4H4K C;  4G94 A; 
#chains in the Genus database with same CATH homology
 2DT5 A;  2VT3 A;  2F5F A;  3KP4 A;  4L9T A;  4EM2 A;  2LF8 A;  4FHT A;  1ZG5 A;  5K5O A;  4O3M A;  2XVC A;  5E1W A;  2QLZ A;  4I02 A;  4G8X A;  2GXB A;  2RVC A;  2HR3 A;  1XGM A;  2STW A;  3NRV A;  2LDU A;  4AIH A;  4ZZL A;  2HKX A;  2MA3 A;  1TLH B;  2EK5 A;  3L09 A;  4WXH A;  2P6T A;  1AOY A;  2EV0 A;  2STT A;  5DV5 A;  1BN5 A;  3HRT A;  4G7H F;  1BC7 C;  4KN7 X;  2DPU A;  3HRM A;  2QQ9 A;  4BNC A;  3R60 A;  1P2F A;  2Z9O A;  3GXO A;  3W6K B;  2EV6 A;  4RS8 A;  3HOS A;  2F2E A;  5CYV A;  1YW7 A;  5HS7 A;  2IT0 A;  3I53 A;  4LLG F;  1JHH A;  3QPH A;  4Z2Y A;  3L7W A;  3IC7 A;  1OYY A;  3WU0 A;  4YG2 F;  2O03 A;  1G3W A;  5JVT A;  4NHJ A;  2HYF A;  1XD7 A;  2QQA A;  1O3R A;  4QLC U;  3RTR A;  1TQP A;  4B09 A;  1WKM A;  4HBL A;  1T98 A;  2HFH A;  2MBF A;  1R5H A;  5HLI A;  4EGY A;  2BYV E;  4OU0 A;  5IT9 K;  1RNL A;  3FZV A;  3I58 A;  1S7A A;  5D4S A;  3MQ0 A;  3B02 A;  3HHH A;  2XAG A;  1O57 A;  2QVO A;  1FT9 A;  2M87 A;  4HYE A;  2D1H A;  4NQW A;  1XN7 A;  2UWM A;  2V1X A;  3RKY A;  1OR7 A;  4I0B A;  1XGN A;  3F22 A;  4RGX A;  1XCV A;  4LMY A;  4WWC A;  3F21 A;  4BAY A;  1I1G A;  1UHW A;  1HXD A;  2HQR A;  4JBA A;  1QBJ A;  1UB9 A;  3IWZ A;  5LLQ A;  4HLY A;  5CJ9 A;  4L5I A;  2R3S A;  2UXN A;  1IXC A;  4ESJ A;  2XRO A;  2DLL A;  4L9J A;  2NRA C;  1KU7 A;  4EJO A;  2IA2 A;  4WCG A;  1IRG A;  3P9C A;  3ZMD A;  3WTZ A;  1L0O C;  5BQT A;  1Q1H A;  1R58 A;  4A12 A;  2P5V A;  3EDP A;  3WG9 A;  4AWX B;  3GF2 A;  2XV4 S;  5DUI A;  1F5T A;  2FEZ A;  3RYR A;  2XUB A;  1R7J A;  3DXJ F;  1YYV A;  2DAO A;  4HF1 A;  2V1U A;  4PDK A;  1MGT A;  3HRU A;  1K79 A;  3QAH A;  2XHK A;  1YG2 A;  2ADU A;  2KRF A;  2YX4 A;  1FYK A;  5L3D A;  1FP2 A;  3WTT C;  3WU1 B;  4OIO F;  4QWQ A;  3FM5 A;  4I98 B;  2K7L A;  2FBH A;  4IF4 A;  1U5T C;  1KYW A;  3R0J A;  2OZ6 A;  4KT5 C;  3HOT A;  2ELH A;  5HDG A;  2P7C B;  3KZZ A;  1K6O A;  3GW2 A;  2DO7 A;  1TQM A;  2OU2 A;  4RAZ A;  3ZMU A;  3ZQ7 A;  2PN6 A;  1HW5 A;  4BHC A;  4ENM A;  2NS0 A;  2P5L C;  2KJC A;  1R36 A;  3R4K A;  5D5X B;  4MQV A;  2PBI A;  5E1X A;  4Y13 A;  1ZLJ A;  1RI7 A;  4HF2 A;  4YIF A;  3CUO A;  3RIR A;  5DUK A;  3TGN A;  2ACJ A;  5L3F A;  1HW2 A;  4RGS A;  3CUQ C;  1MKM A;  1SFX A;  2OQG A;  2XRN A;  2W25 A;  5HS8 A;  1FPQ A;  2VBX A;  5ICC A;  2O0Y A;  4BXU A;  3K1N A;  4UV8 A;  3K9T A;  4ENJ A;  2JRT A;  1YTY A;  3LA3 A;  2W84 A;  2FXA A;  3HSR A;  3KLO A;  2Y48 A;  3KEO A;  2L4M A;  3REO A;  2M8E A;  1IW7 F;  2IJL A;  4JK1 X;  2O61 A;  1GXP A;  1XSX A;  2HWV A;  2H09 A;  3V8K A;  3ABU A;  2M45 A;  1FYL A;  1FWZ A;  3G3Z A;  2GXG A;  5E8G A;  1S3J A;  5DDG A;  5DD4 A;  3TQN A;  1E2X A;  3J80 Z;  4EM0 B;  3O6B B;  2UXX A;  1YW9 A;  1J9I A;  1O7L A;  5HOO A;  2A3S A;  1HKS A;  4Q47 A;  2OD5 A;  2XIG A;  4HF0 A;  3ZMT A;  5LBQ A;  1YS6 A;  3RPU A;  3GO5 A;  1D5V A;  4WXC A;  1R1U A;  1ZRD A;  2HGC A;  2FBK A;  3V8L A;  1E17 A;  5AIP A;  3ZP5 A;  1H9T A;  3DKW A;  1G3T A;  1FSE A;  2JT1 A;  1MDM A;  2Z5U A;  1IUY A;  3WGH A;  2HS5 A;  2PQ8 A;  2C6Y A;  3QOP A;  3PQK A;  5J8F A;  4RB3 C;  3RKW A;  4N9H A;  2D45 A;  1H0M A;  2RV8 A;  1LVA A;  4XRF A;  2RKH A;  4AIJ A;  4IRH A;  3QP5 A;  5CVV A;  2HDC A;  2MLK A;  4A0Z A;  5BMZ A;  1GXQ A;  4UXN A;  3GVA A;  3EQL F;  5H6R A;  3DPL C;  3KLN A;  3I54 A;  1K78 A;  3RDI A;  3ELK A;  5AON A;  5LHI A;  3T8R A;  1YFH A;  3N97 A;  4HQE A;  3F8F A;  1YLF A;  4G7Z F;  2HQN A;  5E20 A;  1UHM A;  4G6D A;  3C3W A;  3WGG A;  3Q5F A;  1JE8 A;  4KIG A;  3FMQ A;  3FM3 A;  1ZYR F;  4A6E A;  4A5M A;  5CVU A;  2W85 A;  3KP5 A;  4ESB A;  2GQQ A;  3E6B A;  1QPM A;  5JR3 A;  2A69 F;  2W24 A;  3BPV A;  1HKQ A;  2IPQ X;  5HLH A;  3V7S A;  3J80 K;  4GXO A;  3LQQ A;  5K1Y A;  1TW2 A;  5LEJ A;  3EUH A;  2O8X A;  5TJJ A;  4KIB A;  1R1V A;  1W4M A;  1T2K A;  4XLN F;  2DU9 A;  1F1Z A;  1FNN A;  4LK0 F;  1GHC A;  4LFU A;  2CYY A;  5LGT A;  1ULY A;  1ZN2 A;  3FX3 A;  1FY7 A;  3GFI A;  2H27 A;  3U9G A;  2HKO A;  4KDP A;  4ZYE A;  1BM9 A;  3WGI A;  2OAZ A;  2O6G E;  3VB2 A;  4GO1 A;  4RB0 A;  2CWE A;  2IW5 A;  3HTS B;  2EFW A;  5HS9 A;  2ZJ2 A;  4AIK A;  1XB4 A;  1KU3 A;  3ZMZ A;  2NYX A;  4BQA A;  2ZKZ A;  1U3E M;  2KIM A;  3TOB A;  1QO0 D;  1U8R A;  3L2C A;  5DCM A;  3E6D A;  1ZG3 A;  4GYI A;  4UUV A;  3COA C;  3RPQ A;  1IZ1 A;  2VC1 A;  4ZZD A;  1O7F A;  1XGS A;  3CLO A;  3I0T A;  2ZNZ A;  3C7J A;  2UZK A;  1J75 A;  1EH6 A;  3CUQ A;  4PGH A;  2A61 A;  2EFN A;  2MH2 A;  2EB7 A;  4CYD A;  2NNY A;  4LD5 A;  1IN5 A;  4L5J A;  1WQ2 A;  3GX4 X;  2L02 A;  1HQC A;  4HV6 A;  3T0Y A;  1ON2 A;  1QNT A;  4EM1 A;  2A6E F;  5DCF A;  2DQR A;  2K86 A;  1ZHF A;  2HEO A;  1R23 A;  2Z99 A;  1TBX A;  5LHH A;  4HV5 A;  5BPD A;  4M74 A;  3ZPL A;  2KJB A;  2Z33 A;  5DD8 A;  1FBS A;  5E17 F;  3WTY C;  4IRG A;  2ZXJ A;  4NB5 A;  3MAJ A;  1IN4 A;  3KP3 A;  1ZGA A;  2IA1 A;  3GWZ A;  3JSO A;  3ROU A;  2K02 A;  1C0W A;  2XAJ A;  3NEU A;  1U78 A;  1TW3 A;  2IRF G;  2V1D A;  4CXF A;  4ESF A;  2Y75 A;  3B73 A;  3J7A O;  1W7P A;  3MWM A;  4RB1 A;  1PP8 F;  2RC4 A;  1U2W A;  2IVM A;  3RYP A;  1ONV A;  5LRR A;  1D8K A;  1HSJ A;  4CHU A;  4CO8 A;  2PG4 A;  4MQ9 F;  2XAS A;  4M9S A;  2XAQ A;  2CGP A;  1KA8 A;  5FLX Z;  2HTS A;  1IRF A;  3CO7 C;  4N0B A;  3M1E A;  3MEX A;  5E1Z B;  1RIO H;  4BHB A;  4HLX A;  2IP2 A;  1BC8 C;  1WI9 A;  3K69 A;  1G4D A;  1UFM A;  4A0X A;  4KFC A;  1FC3 A;  4XBF A;  3LAP A;  4XSZ F;  4P9F A;  3OOP A;  4OMZ A;  4HX4 A;  2HZT A;  3RI4 A;  3WTW C;  1GVJ A;  5BS6 A;  2ZFW A;  4L9V A;  1MDM B;  1P6R A;  5L3E A;  1QGP A;  3D5L A;  5ICE A;  4N9I A;  3DQV C;  2VOO A;  3LQR A;  2QUF A;  1K7A A;  2PFB A;  5FGM A;  4OIN F;  2W57 A;  1Z6T A;  2CW0 F;  3HUG A;  4MEY F;  1T38 A;  1W7P D;  3BDD A;  3FXR A;  2KIF A;  3VEP A;  4CGZ A;  1YS7 A;  2F5C A;  4OMY A;  3P7N A;  2ZCW A;  2L3D A;  3DEU A;  4DQ2 A;  1RZ4 A;  1WRJ A;  5TRD A;  2M30 A;  2XKO A;  1TNT A;  4ENK A;  2G7H A;  3I5U A;  2VON A;  3SFZ A;  4HDV A;  1DDN A;  3LST A;  1UCR A;  2K27 A;  1XDU A;  1J7K A;  3JTH A;  4M6Y A;  3RJP A;  1FBU A;  1TNS A;  2MD5 A;  2YSR A;  1G3Y A;  2FML A;  4KMU X;  4H0E A;  3O2P E;  5ED4 A;  1W5S A;  2XKP A;  4M6X A;  4UVC A;  1W7P B;  2CO5 A;  5J6X A;  4Q48 A;  5K5Q A;  5HDK A;  4FX4 A;  4CIC A;  3SHF A;  2O3F A;  3F6V A;  1BBY A;  2PJP A;  4EJT A;  4PGG A;  3F72 A;  4FT8 A;  5FB2 A;  4EVI A;  2VBW A;  4IRI A;  1YO5 C;  2B0L A;  2MC3 A;  3BPX A;  1OKR A;  2VOP A;  1LDK B;  2EFO A;  1B9M A;  5K5R A;  4KA4 A;  4A2U A;  3OV8 A;  1SFE A;  3QPT A;  1MJB A;  3GYH X;  4CDG A;  2WTE A;  3E5U A;  1J0R A;  2FMY A;  3TKY A;  3T1B A;  3EYI A;  1W5T A;  2VOD A;  1FYM A;  1B59 A;  1DPR A;  3V7R A;  3QP6 A;  2QBY B;  1KQ9 A;  3VOD A;  1SFU A;  2QWW A;  1BIA A;  5EEH A;  1FLI A;  4M9Z A;  4YFN F;  4BHP A;  5D8K B;  4G6Q A;  4Q5S F;  2EWN A;  3M8F A;  2BE5 F;  3I64 A;  1HBX G;  2FQ3 A;  2CG4 A;  3LA2 A;  1K78 B;  3DPT A;  3F6O A;  2IA0 A;  4LB6 B;  4P9U A;  3E3V A;  3F8N A;  2A6H F;  1MJ9 A;  3T5X A;  1A04 A;  3CTA A;  3F23 A;  2YU3 A;  4AD9 A;  3KP7 A;  2YX7 A;  5KK1 A;  3VOE A;  1LDJ A;  2DW4 A;  3KEQ A;  3U2R A;  1ZRF A;  2PMH A;  3H3Z A;  3QU6 A;  5D5W B;  1EV7 A;  2ISY A;  5FD5 A;  4P55 A;  1YIO A;  4PZJ A;  3WTS C;  2COM A;  3GZ5 A;  1L3L A;  2VBY A;  2D1V A;  3E5Q A;  1KYZ A;  2D2W A;  2FSW A;  1XCB A;  4I0A A;  2EV5 A;  5E8I A;  4U0V A;  4I01 A;  4HOB A;  1G3S A;  2VE8 A;  1SD4 A;  4O6J A;  3WOD F;  1IXR C;  3FMR A;  3AAF A;  2MLG A;  3F8C A;  3LFK A;  4ON0 A;  4KMF A;  4LLN A;  4IVN A;  5LGU A;  1B4A A;  4RAY A;  5KVR A;  2GWR A;  5HDN A;  1YQA A;  1ZG1 A;  3M8E A;  1D3Y A;  4RB2 C;  3MZH A;  3W6J B;  2VE9 A;  5BOX A;  1SMY F;  2Y0M A;  4WK8 F;  1ZRE A;  2E1C A;  2H6C A;  3V7C A;  1PDN C;  1P4A A;  2BEO A;  5F1R A;  3ULQ B;  1HST A;  2DTR A;  3LAJ A;  4L9N A;  3DF8 A;  1J59 A;  3GLX A;  3FMS A;  1PUE E;  3CJN A;  3V4G A;  4I7H A;  2Q2E A;  2GAU A;  4R8H A;  1ON1 A;  4MTE A;  2VT2 A;  3SZT A;  1S8N A;  3HTU A;  1F9N A;  1MZB A;  3IHU A;  2JPC A;  1HKT A;  1O3T A;  3V8J A;  2Z3Y A;  1IXS B;  4Y15 A;  4YFK F;  4DNC A;  2FOK A;  4M9X A;  2EA2 A;  2BGC A;  1I5Z A;  3I4P A;  4IJA A;  1S29 A;  2XAH A;  2RN7 A;  5D5V B;  3P9K A;  1BI2 A;  4LG0 A;  4I2O A;  4CZZ A;  3BY6 A;  2AXL A;  1Z7U A;  2M5W A;  3LA7 A;  3DP7 A;  1TQI A;  1Z05 A;  4OIP F;  2DBB A;  2EA4 A;  3QU3 A;  1ZH5 A;  3KE2 A;  4KIC A;  2LF7 A;  2FE3 A;  3H92 A;  4EV0 A;  4KUM A;  1ZGJ A;  2E1N A;  3JAM Z;  3M9A A;  3JSP A;  1UST A;  4MTD A;  3H3U A;  3C18 A;  2H94 A;  2ISZ A;  5J8C A;  3R61 A;  2DFI A;  4UVB A;  5FLX K;  3KCC A;  5CVR A;  1F4K A;  4R1H A;  5LHG A;  3WTU C;  5F6F A;  3I71 A;  2RQP A;  1RUO A;  1U5T A;  3LWF A;  4HDU A;  5ILS A;  3HSF A;  3ECH A;  1FSH A;  5LEK A;  2M1B A;  2L54 A;  2WC2 A;  2DK5 A;  1Z1D A;  1BI0 A;  2KIU A;  4ASN A;  3RKX A;  1SAX A;  1BOA A;  4Y17 A;  4ENN A;  3U1D A;  3WTX C;  2GA2 A;  5L3G A;  1XDS A;  2F5E A;  3HRS A;  3BRO A;  2DPD A;  1REP C;  2WWY A;  2K4B A;  4P5O A;  1EH7 A;  2K4J A;  1P4W A;  3BWG A;  4FX0 A;  4ZYG A;  4U7D A;  5JHU A;  1B6A A;  2VBZ A;  2AS5 F;  1SD5 A;  1S7O A;  1OYW A;  3K0L A;  4LJZ F;  2JTV A;  4I09 A;  5F64 A;  2BV6 A;  2RDP A;  5DYM A;  2YR2 A;  4KN4 X;  5ICF A;  4KYW A;  5H6Q A;  1J2X A;  4MEX F;  2EFP A;  2ESN A;  3IKV A;  1SD7 A;  2DK8 A;  1IN8 A;  3BOQ A;  3TDZ C;  2ZME B;  2CSO A;  2Q8K A;  1FX7 A;  2GIV A;  1STZ A;  2WV0 A;  1FOK A;  4EJU A;  1CF7 B;  2XGX A;  4HZF A;  4XSX F;  3JAM K;  2VXZ A;  1VTN C;  4U0W A;  2V6C A;  4F7Z A;  2FRH A;  1IF1 A;  1ZRC A;  3PQJ A;  4EGZ A;  1CGP A;  2X0L A;  1BJA A;  1I6X A;  3JW4 A;  5ILV A;  5FD6 A;  3TOA A;  1MJA A;  1R1T A;  3ERE D;  3FF5 A;  4O5V A;  2EFQ A;  3ML6 A;  4EMS A;  1BI3 A;  2FF4 A;  4P96 A;  4WXD A;  1ZAO A;  3N4M A;  1SD6 A;  4WF2 A;  2NNN A;  3EET A;  3GEZ A;  3ECO A;  3TDU C;  2L01 A;  3DFG A;  5E18 F;  1JXS A;  1FZP B;  2FA5 A;  5H20 A;  1WWX A;  1RUN A;  4U7B A;  2F5D A;  3IWF A;  3NQO A;  4L0Y B;  3T8T A;  4GYG A;  2FU4 A;  1S6L A;  2CFX A;  4UV9 A;  3WE3 A;  5L3C A;  3EYY A;  3ABT A;  3IL2 A;  1IAW A;  4GCV A;  2JPB A;  1T0F A;  1H9G A;  2OA4 A;  3CDH A;  4LK1 F;  3F8B A;  2R7F A;  2ZME A;  5D6F A;  3VFZ A;  1LDD A;  3IKT A;  2QZ8 A;  2HTJ A;  1KQ8 A;  1I27 A;  1LEB A;  2JSC A;  1OMI A;  2QM3 A;  1B9N A;  1R22 A;  1MD0 A;  4A0Y A;  4JQF A;  3Q9V A;  1QQI A;  1V4R A;  1Z9C A;  2TDX A;  1ZAR A;  3S2W A;  4M71 A;  4U0Y A;  3ZN1 A;  1AWC A;  1O3S A;  4LG0 B;  2JZY A;  5A2Q Z;  3QRF F;  2A07 F;  3DV8 A;  3FWE A;  2HYG D;  3J81 Z;  3ZMV A;  5HVQ C;  1YW8 A;  3HHG A;  2HOE A;  3CUQ B;  4D0P A;  2X4H A;  3HYI A;  1R00 A;  3PFI A;  2ZNY A;  5FO5 A;  3IRQ A;  3KP2 A;  3K2Z A;  1B1B A;  2QEN A;  5L3B A;  5CLS A;  5DCM B;  3GFL A;  1O3Q A;  2ZBK A;  3M7G A;  4K2E A;  4OIQ F;  2YPR A;  3ISP A;  1R5G A;  4HA8 A;  5AIQ A;  1CF7 A;  2FNA A;  5D4R A;  3R0A A;  4OIR F;  4LLL A;  4L18 B;  2PMU A;  4UNO A;  1KU9 A;  2P7V B;  5ILU A;  3MCZ A;  3GZ6 A;  2OZU A;  5FFZ A;  4LGW A;  3JTG A;  2EJR A;  4R79 A;  1QZY A;  3E5X A;  1NHA A;  3D0S A;  3F8M A;  1XMA A;  1EH8 A;  3GFM A;  2PI0 A;  1T39 A;  3GUD A;  3MZY A;  1ODD A;  4G7O F;  1HW1 A;  5HLG A;  4RGR A;  5CVJ A;  3FXQ A;  3E6M A;  2RGV A;  1I1S A;  4RGU A;  2QQB A;  4ZYH A;  5D5U B;  2BBY A;  4WX9 A;  3BJO A;  3K1P A;  5EEG A;  2OBP A;  2ESH A;  4HX7 A;  4IXA A;  5LRS A;  3TO6 A;  4PCQ A;  1P92 A;  4M73 A;  4S04 A;  4IHS A;  4A6D A;  3G73 A;  5A2Q K;  5JI6 A;  1KQ0 A;  1Y0U A;  2DQL A;  4ETS A;  1JHF A;  3L00 A;  3FHZ A;  3ZMS A;  1U6G A;  2G7U A;  1KU2 A;  2KKO A;  2P6S A;  3P9I A;  5FFX A;  2A68 F;  2PLY A;  3E6C C;  4EQQ A;  2R7D A;  4ZH4 F;  3SQN A;  3HSE A;  4AVP A;  4S05 A;  1FBQ A;  2L4A A;  1XSD A;  5IT3 A;  3TO9 A;  2GA1 A;  2P5K A;  4BYY A;  2V9V A;  1WSU A;  4KIF A;  2H6B A;  1XSV A;  3C1D A;  3IRR A;  4YFX F;  4LB5 A;  2A5Y B;  1IN7 A;  1FP1 D;  2FNP A;  1XMK A;  2ZO4 A;  4HQM A;  1SMT A;  5D6E A;  5ICG A;  3KET A;  3GFJ A;  2PEX A;  2LNB A;  2GZW A;  1TTY A;  3FXU A;  2J5P A;  4TV7 A;  1BIB A;  1BI1 A;  4Q4Z F;  3L9F A;  4UVA A;  2E7X A;  4IHT A;  3CO6 C;  4A5N A;  2QYO A;  3SXY A;  1D8J A;  4ZYD A;  5BPI A;  1Z91 A;  1DP7 P;  1DUX C;  5LGN A;  1LNW A;  4MNU A;  3O3K A;  1X3U A;  2E7W A;  4XLP F;  1PP7 U;  2XAF A;  2VN2 A;  4B8X A;  3BJA A;  3KFW X;  1LQ1 A;  1DPU A;  4GGG A;  4L0Z B;  2FBI A;  1G6N A;  5DEQ A;  3BP8 A;  1J5Y A;  3BZ6 A;  1V3F A;  3F3X A;  3E97 A;  3KP6 A;  2J5O A;  3J81 K;  4U88 A;  3TO7 A;  3MFK A;  4EJV A;  4IPA A;  1T6S A;  3I59 A;  3HIF A;  1ZLK A;  1QZZ A;  1Z6R A;  2LKP A;  1JGS A;  1U5T B;  3WTV C;  3I59 B;  2Q0O A;  1XGO A;  3SZP A;  5JFR A;  5ERI A;  1USS A;  4E70 A;  2G9W A;  1LJ9 A;  4BH9 A;  4M72 A;  4EJW A;  2P8T A;  4YII A;  2LSO A;  2ETH A;  2RNJ A;  3KZY A;  4KNY A;  3ZN0 A;  2CQK A;  1IN6 A;  2VC0 A;  3K1M A;  4MGR A;  4MHG A;  4HX8 A;  1OYI A;  3BJ6 A;  2P4W A;  3WE2 A;  5IT9 Z;  2MH9 A;  5CVI A;  5D8L B;  2V79 A;  2NAZ A;  2QBY A;  1OPC A;  1P4X A;  4HW0 A;  4G9Y A;  2OQR A;  1LB2 A;  3R6S A;  6PAX A;  1KGS A;  2DI3 A;  3Q9S A;  4OOI A;  4HAM A;  4UHT A;  1LEA A;  4G94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...