2X4HA

Crystal structure of the hypothetical protein sso2273 from sulfolobus solfataricus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
129
Chain Sequence
b'LSRREFSYLLTIKRYNDSGEGAKINRIAKDLKIAPSSVFEEVSHLEEKGLVKKKEDGVWITNNGTRSINYLIKAHRVIEILLVNIGIDKQTACEYSKQFDYLIPEEIIDKLYNYLGKPSYCPHGLEIPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN SSO2273
molecule tags Transcription
source organism Sulfolobus solfataricus
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
total genus 47
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2x4hA00
5J6XA 3ISPA 2E7WA 1OKRA 1W5SA 2RDPA 3I71A 1TBXA 4U0YA 3J80K 2KKOA 1OYIA 3LAPA 5E8GA 5LHHA 5FD5A 3E5UA 4WK8F 2O8XA 3ZP5A 2HDCA 3TQNA 1BI3A 5DDGA 2QQBA 5HDNA 3WU0A 5H20A 3H3UA 5H6RA 2ACJA 2OAZA 1IZ1A 3CO7C 3B02A 1J59A 3SXYA 3T1BA 3WTVC 5FLXK 3GFLA 2B0LA 3SQNA 3AAFA 1R36A 5ED4A 1MZBA 3HSFA 4CYDA 1IRFA 5ICEA 1WQ2A 1XCVA 4D0PA 4LJZF 2K4JA 5LRRA 4MTDA 4LG0A 1OR7A 1A04A 3KP3A 3HSEA 3L9FA 2G7UA 1TW3A 4ZYDA 1FBSA 3JAMK 1ZAOA 3DV8A 5HS7A 4YFNF 3ZMVA 5FFXA 1BM9A 2QYOA 4ESFA 4KA4A 1MDMB 4KUMA 2HWVA 2ZKZA 5CVRA 2XV4S 2PFBA 5IT3A 4YIFA 1R5HA 3TKYA 3P9CA 4OMZA 5K1YA 5BOXA 1HKTA 1R00A 3GZ6A 2CYYA 3C1DA 2PQ8A 5HVQC 5D8LB 3V7CA 1FYMA 4QWQA 3HOSA 5H6QA 2HYFA 3BJAA 3H3ZA 3K69A 2BV6A 2L01A 2WV0A 1QZYA 4BH9A 5E8IA 1FOKA 1H0MA 2IA1A 4M9ZA 3R61A 3RI4A 4HQEA 3DF8A 3S2WA 1V4RA 2LKPA 4RGSA 3M9AA 3FWEA 5ILVA 2L54A 4HV5A 2C6YA 1SAXA 4RGRA 4AIJA 1RUNA 4OINF 4IVNA 3QP6A 4B8XA 1QPMA 2HOEA 1R1TA 3RPQA 3KE2A 2Q8KA 2DK5A 4XBFA 4G7HF 5D5WB 4KIFA 5LHIA 1DPUA 5ICCA 2AXLA 4ZYEA 5BPDA 4IRGA 2JSCA 1E17A 3CUQC 4MNUA 1K79A 1QBJA 3JTHA 2HEOA 1K78A 4XSXF 4G6DA 4ASNA 1HW2A 1U2WA 3K1NA 3IRQA 2VN2A 1UHWA 3F22A 5L3GA 1R5GA 1U5TB 1J2XA 4H0EA 1CF7B 1GHCA 1T39A 2MLGA 3O3KA 2ELHA 2L4AA 2M87A 3ZMUA 1HSTA 4EJOA 1U78A 4JK1X 5D6FA 1W4MA 2VOOA 1I1GA 1FP1D 3IHUA 1B6AA 3DXJF 2W57A 2XASA 3BJOA 1LVAA 4S04A 4UVAA 5DUIA 3FM3A 4PZJA 5L3CA 1XSDA 2A61A 1ZG1A 1GXPA 4HLXA 4HX4A 4OIQF 5A2QZ 3EDPA 5FD6A 1RI7A 4LFUA 3JAMZ 2CW0F 1MGTA 3HHHA 4U7DA 3T8RA 1EH7A 1ON1A 3NQOA 1Q1HA 3MAJA 1W7PB 2Y48A 2RN7A 3QP5A 1KA8A 3WTYC 1TQMA 1LB2A 3U2RA 3PFIA 3MEXA 5F64A 2ZMEB 3E6MA 3N4MA 5LLQA 5HLHA 1SFEA 4NQWA 3MWMA 3I59A 4L9JA 3WU1B 1O3SA 1ZLKA 5HS9A 3NRVA 3ECOA 4ZYHA 3KEQA 1BC8C 5DYMA 3L2CA 1PDNC 2P8TA 2QZ8A 3CJNA 4E70A 3GO5A 3F23A 2ISZA 2PN6A 1UHMA 4GXOA 2QM3A 1GVJA 1HKSA 4L5JA 3ZMDA 2XKPA 3DPLC 3ZMZA 1IXRC 1IN4A 1ZRFA 2DLLA 2O61A 2EFOA 2ESHA 2OZ6A 1FSEA 5D8KB 2R7FA 2UWMA 4LG0B 2XVCA 2MA3A 1ZARA 2JZYA 4L5IA 4I0AA 3KP4A 4OIRF 4ESBA 2MH2A 4QLCU 4EJUA 3FF5A 2IA0A 3J80Z 2P6TA 2UXNA 2DPDA 4A5NA 4KIGA 3TOBA 1UFMA 1SD5A 3DEUA 3ELKA 3NEUA 4GO1A 4U0WA 2RVCA 3ZN1A 1TNSA 3V4GA 2GXBA 1FX7A 1S7OA 3BY6A 3IKTA 1OPCA 3F3XA 3I0TA 4IRIA 3ERED 2QBYB 3JW4A 2VC1A 2DW4A 2R3SA 2WWYA 3EYYA 4LK1F 1XB4A 3RTRA 1ZGAA 5FO5A 4M6YA 2OU2A 5E1WA 2XHKA 4DNCA 5DD4A 2F5FA 3DFGA 5HOOA 1G3SA 3GFJA 2VT2A 2A07F 1KGSA 2M5WA 1CF7A 2PI0A 2FNPA 4R8HA 1USTA 1YG2A 2NS0A 2CFXA 1R22A 5HS8A 4EJTA 1AWCA 2XUBA 1PP8F 1D8JA 1HQCA 4BHBA 1F4KA 4XRFA 2VONA 3ZN0A 1FC3A 3CO6C 2A5YB 2HTSA 2K7LA 5E18F 2OBPA 5ICFA 2H27A 2IA2A 1ODDA 3HUGA 2LF8A 1WKMA 2A68F 3V8LA 1ZHFA 1WSUA 1O3QA 4RB2C 2O6GE 3FXRA 1XGSA 3J81K 3BPVA 1K7AA 5L3EA 2HFHA 4F7ZA 1SD7A 3ML6A 2NNYA 2BGCA 4FT8A 1ON2A 2PJPA 1I6XA 2YPRA 3WGHA 3LAJA 1BOAA 3V7SA 1R1UA 1I1SA 3DKWA 1Z05A 3DQVC 4IXAA 2BEOA 2VBZA 2G7HA 3SHFA 4P9UA 4HLYA 4CHUA 1G3TA 1QZZA 2H6BA 3CUOA 1RIOH 2PEXA 2GWRA 3RIRA 4M74A 3F8BA 4EJWA 4XLPF 4EJVA 5TJJA 2EV5A 3KLNA 1S8NA 2GA1A 3WG9A 3DP7A 2HS5A 2WC2A 5L3DA 4L9VA 4N9IA 4LK0F 5LRSA 1IUYA 3CUQA 1V3FA 3C7JA 1WWXA 1IN6A 2L4MA 4MGRA 4LB6B 2EV6A 2STTA 4CICA 3WTUC 4ESJA 1RZ4A 3IWZA 2EJRA 2HKOA 3E5QA 2ETHA 2ISYA 3LSTA 4LLNA 3V8JA 2DU9A 2H09A 4Y13A 3I54A 2VBXA 4ETSA 1F9NA 4Q4ZF 4OOIA 1G3YA 3ZPLA 2JRTA 1T2KA 5BPIA 3IC7A 2EWNA 1HW1A 1G4DA 4UV9A 4RS8A 2QUFA 2JTVA 2R7DA 3HSRA 1UB9A 2QBYA 4L18B 1FT9A 5D5UB 2IRFG 4Y17A 2FBKA 3PQKA 3EETA 2PMHA 2QENA 2F2EA 3IWFA 2D45A 4WWCA 1O57A 3T8TA 2XAGA 1GXQA 3CTAA 2VE9A 4MEYF 1ZLJA 2HQNA 1DDNA 2Z9OA 4R1HA 3WGGA 5FGMA 1S29A 3VOEA 5HLGA 1MKMA 3CLOA 1XDUA 1XSVA 4GYIA 4N9HA 1Z9CA 1FBUA 4A5MA 4P9FA 2AS5F 3GVAA 1XGMA 4IF4A 1KYWA 3G3ZA 4KIBA 4KT5C 1P4AA 2FRHA 5JHUA 3B73A 3D5LA 2K02A 1T0FA 1LEAA 2XIGA 1KU9A 1BC7C 4PGHA 5LBQA 4WXDA 3RYRA 2YX7A 3Q9SA 1B1BA 2XAHA 1P4XA 1FY7A 1IN7A 1XSXA 4RGXA 4UHTA 3W6JB 4JBAA 4HQMA 5J8CA 3WE3A 2FE3A 4KMFA 2KIMA 1LDJA 3MQ0A 3TDUC 4EGYA 5JR3A 4WF2A 3FXQA 1SFUA 1ZG5A 2KRFA 1JXSA 2J5PA 4I98B 4MEXF 2IT0A 2Z5UA 1YQAA 2A3SA 3KETA 2VC0A 1BI2A 3OOPA 1STZA 4A12A 2CSOA 2GQQA 3FMSA 4CO8A 3E6CC 1EH8A 2FSWA 4G94A 2JPCA 2O3FA 2M1BA 2Q0OA 3IKVA 3LA2A 4BNCA 3PQJA 3M8FA 3U1DA 4HBLA 1JHHA 3RJPA 2V1DA 1P4WA 1FBQA 1FYLA 4DQ2A 4AWXB 3BPXA 5AIPA 3TO9A 4HDUA 1FZPB 4RAYA 3WGIA 1KQ0A 4UV8A 2GZWA 1U5TC 3RKYA 4HF2A 1LJ9A 3WTSC 3HOTA 4EM0B 1JHFA 3J81Z 3TO7A 4BAYA 3HRUA 1D8KA 1BJAA 1F5TA 1G6NA 1SMTA 4S05A 3HTSB 4U7BA 2O0YA 2OQGA 1BN5A 5KVRA 1ZH5A 2W85A 5CLSA 5L3FA 5CYVA 1YTYA 3P7NA 3TOAA 3KP5A 1R23A 5FLXZ 4MHGA 4EM1A 2A69F 2ZMEA 2DQRA 4GGGA 2VODA 1SMYF 3K1MA 2P5VA 3JSPA 2FEZA 4Q5SF 3BZ6A 4O3MA 3I59B 1MJ9A 2EA2A 3VODA 4AIKA 2GAUA 1B9MA 2GA2A 3ABUA 4AD9A 2F5EA 2MBFA 4IRHA 1B59A 3F8NA 5DCMA 1H9GA 3E6DA 2P7CB 3L00A 3TO6A 4UVCA 2ZNYA 1QNTA 1YW7A 4ZZDA 4RGUA 2MH9A 4NB5A 1O7FA 3FX3A 1XMKA 2ZXJA 1J5YA 4O6JA 4KFCA 2RC4A 3FMRA 4TV7A 4XLNF 4OIPF 4YG2F 5LGUA 4YFKF 2V6CA 2VXZA 5HLIA 4UXNA 2E1NA 2BBYA 1LNWA 2EB7A 2FMYA 3TDZC 4EGZA 3U9GA 3K1PA 1SD6A 1P6RA 4EMSA 3ZMSA 1TTYA 1ZREA 1FWZA 5IT9Z 3EQLF 3KP6A 5BQTA 1PP7U 2V9VA 4RB3C 3P9KA 4YIIA 2HTJA 3BWGA 1KU7A 5JVTA 3DPTA 3ROUA 3FXUA 1J75A 1W5TA 3GWZA 3J7AO 2NNNA 2FU4A 2QQAA 4CXFA 4P55A 4BHCA 5EEGA 1F1ZA 3HRSA 1BIAA 3JTGA 3FZVA 3HTUA 3GFIA 4B09A 2ESNA 2DPUA 1HBXG 2P5KA 3K0LA 4G6QA 2IVMA 2X0LA 3F21A 4L9NA 4M73A 3GX4X 2M45A 3IRRA 4GCVA 4KN7X 2QWWA 2MD5A 5J8FA 2V79A 4HV6A 1TNTA 4K2EA 1FSHA 4ENJA 2L3DA 3LA3A 4CZZA 1LDKB 1TW2A 2L02A 2M30A 5BS6A 3EUHA 2K86A 3G73A 1PUEE 3QRFF 4IPAA 1MJBA 2OZUA 2Q2EA 3HRMA 3SFZA 4WXHA 4AVPA 4A6EA 4Q47A 5FFZA 1VTNC 2QQ9A 3N97A 1D3YA 4CDGA 3HIFA 4UUVA 5DV5A 3WODF 4WX9A 3ECHA 1J9IA 3WTTC 1XD7A 1U6GA 2NAZA 4FX0A 3HRTA 4G7ZF 2IPQX 1YS6A 1O3TA 2YU3A 4M9SA 1ZRDA 2D1VA 3RPUA 2XRNA 2YX4A 3T0YA 4EV0A 1T6SA 3M7GA 1L0OC 5DCMB 3LQRA 4EVIA 2FBIA 3F8CA 2DT5A 2Y0MA 2HYGD 3M8EA 5ILUA 2TDXA 2FMLA 3COAC 2HGCA 5D4SA 4RB1A 2F5DA 1ONVA 2HZTA 3KFWX 3LWFA 3QU3A 2IJLA 3HHGA 4HDVA 1HXDA 5LGTA 2CO5A 1IRGA 5DCFA 4IHTA 3C3WA 4PGGA 2J5OA 5LEKA 1RUOA 3D0SA 3QOPA 1IW7F 1NHAA 1BBYA 5EEHA 2DAOA 2DK8A 3EYIA 3BOQA 5E1ZB 1J7KA 4A0XA 1TQPA 2JPBA 3P9IA 1I27A 1YLFA 4LGWA 3E6BA 1OMIA 5AIQA 4FHTA 4BYYA 1ZRCA 4ZYGA 1H9TA 2RQPA 1Z7UA 2FA5A 4P5OA 2H94A 2E7XA 1FYKA 3L7WA 3ABTA 4WCGA 1ZN2A 2FOKA 2UZKA 2EV0A 5CVUA 1P2FA 3JSOA 5AONA 2RNJA 4CGZA 2VE8A 4UNOA 1S7AA 2UXXA 1B4AA 1DPRA 4N0BA 4M9XA 3HYIA 1P92A 2H6CA 2W24A 4G7OF 1E2XA 3QPTA 5F1RA 1MDMA 4Y15A 1BI1A 5DUKA 1O7LA 1HW5A 2LDUA 4L0YB 2LNBA 3GEZA 3V7RA 4XSZF 2STWA 2IP2A 2F5CA 5D4RA 2EK5A 1JE8A 4HA8A 2A6EF 4P96A 2JT1A 1DUXC 1YYVA 2FNAA 1BI0A 4O5VA 2P5LC 2RGVA 3CDHA 4HX8A 3GF2A 3RKWA 4ZZLA 1YW8A 3O2PE 4MTEA 3WTZA 5DD8A 4KMUX 1EV7A 2DBBA 4M71A 3QAHA 2RKHA 1O3RA 3KLOA 3F6OA 1J0RA 2DI3A 2K4BA 2XGXA 1YO5C 4LD5A 4LMYA 1YS7A 3I64A 2HR3A 4EQQA 1LQ1A 1YW9A 3RDIA 3QPHA 5K5OA 2XKOA 4HZFA 1UCRA 3VEPA 4IHSA 3H92A 1R58A 2EFNA 3BP8A 4OU0A 1KQ8A 2A6HF 4RAZA 4LLGF 2EFPA 4G8XA 1KU2A 3GYHX 1B9NA 4A6DA 3LQQA 5LGNA 1U3EM 4UVBA 5TRDA 2YSRA 2NRAC 4HF1A 3RKXA 1FPQA 1ZG3A 4U88A 2HKXA 1IAWA 1XGOA 3I53A 3C18A 1MJAA 4YFXF 3GFMA 2KJBA 1XDSA 1JGSA 2RV8A 4ZH4F 2GIVA 3LFKA 4EM2A 4I0BA 3F6VA 3ZQ7A 1OYWA 5FB2A 2OA4A 3LA7A 2LF7A 2QVOA 1WI9A 3GW2A 4I09A 3FM5A 3R60A 1ZYRF 3WTWC 4U0VA 1KU3A 4IJAA 3BDDA 4I2OA 1SD4A 2VBYA 2ZCWA 4AIHA 5A2QK 5D6EA 2Z3YA 3V8KA 3GZ5A 4BHPA 1U5TA 3R4KA 2CG4A 2GXGA 4HYEA 3FHZA 1LDDA 5ERIA 1QGPA 2P6SA 3FMQA 2EFWA 1IN5A 4I01A 2W25A 5D5XB 1YFHA 1W7PA 4OIOF 3ULQB 2MC3A 3GLXA 3KP2A 5BMZA 2KIUA 1TLHB 1T98A 2COMA 4LB5A 3MFKA 4FX4A 2X4HA 3E3VA 2VOPA 4KDPA 1K6OA 4L0ZB 2ZBKA 4HOBA 2CQKA 4ENMA 3TGNA 2CGPA 3KEOA 1U8RA 1WRJA 1CGPA 1DP7P 3R0AA 2VBWA 2ZO4A 3T5XA 5K5RA 3WTXC 2FQ3A 4ON0A 5DEQA 4R79A 1BIBA 5CVJA 1XMAA 2CWEA 1USSA 1T38A 1SFXA 2E1CA 2Y75A 1QO0D 2V1XA 2VT3A 1IXCA 5L3BA 2FXAA 2P4WA 3SZPA 2BYVE 2PMUA 2KIFA 3QU6A 4NHJA 3OV8A 4JQFA 1R7JA 1XN7A 4ENKA 4BQAA 4MQ9F 5CJ9A 1Z6TA 4HX7A 2P7VB 2W84A 1ZGJA 1EH6A 2ADUA 4BXUA 4RB0A 4I7HA 5ILSA 3K2ZA 5K5QA 1L3LA 1IN8A 3Q9VA 3R0JA 2MLKA 3I4PA 3I58A 5LHGA 2NYXA 1I5ZA 4Z2YA 3GUDA 4A2UA 4HW0A 4PDKA 2Z33A 3REOA 4KN4X 2KJCA 3ZMTA 1X3UA 2EA4A 2YR2A 2XROA 2DFIA 2OQRA 3L09A 1IF1A 2D1HA 5KK1A 3I5UA 1G3WA 2XAFA 3WE2A 1XGNA 3K9TA 2PLYA 1Y0UA 1YIOA 5HDGA 3KZZA 2ZJ2A 1HKQA 1REPC 3Q5FA 5E17F 2WTEA 2PBIA 3KCCA 3MZHA 5HDKA 3O6BB 3MZYA 3BROA 3KP7A 2Z99A 4M6XA 1C0WA 1D5VA 1KQ9A 1R1VA 2DO7A 4HF0A 3W6KB 3GXOA 2XAJA 2FF4A 2ZFWA 1LEBA 3IL2A 3CUQB 1KYZA 3SZTA 1HSJA 2HQRA 4I02A 1ULYA 4A0ZA 1S6LA 4KYWA 4PCQA 2DTRA 4A0YA 5CVVA 3F72A 4Q48A 1AOYA 1FNNA 3MCZA 4HAMA 2FBHA 3E5XA 2O03A 2QLZA 1K78B 4MQVA 4LLLA 1XCBA 2PG4A 2D2WA 1OYYA 4GYGA 1RNLA 2LSOA 4M72A 5CVIA 1Z1DA 1W7PD 3E97A 3RYPA 5E1XA 5JFRA 5JI6A 2OD5A 1Z91A 3BJ6A 4KICA 2IW5A 4WXCA 2V1UA 1TQIA 1MD0A 2XAQA 5F6FA 3VB2A 5D5VB 6PAXA 1FP2A 3F8FA 4ENNA 3M1EA 3KZYA 5E20A 3F8MA 1QQIA 2DQLA 4G9YA 3VFZA 2K27A 2ZNZA 1Z6RA 2G9WA 1S3JA 5IT9K 1FLIA 2BE5F 5LEJA 4KNYA 3R6SA 5ICGA 2M8EA 4OMYA 4L9TA 2EFQA 1IXSB
chains in the Genus database with same CATH superfamily
5J6XA 4A3FJ 3VYRB 3ISPA 2K3FA 5EZHA 2E7WA 3K10A 3H3VK 1GDTA 3W2AA 1OKRA 1W5SA 1U9OA 2ELKA 4Y4RA 1ZR2A 1ZKGA 1Q1VA 2RDPA 1R4MB 3I71A 2X85A 3ZR8X 1TBXA 2DDBA 4U0YA 2VQLA 3CMMA 2AQFA 3J80K 2KKOA 1OYIA 3LAPA 2NOGA 5E8GA 5LHHA 5FD5A 3E5UA 4WK8F 2O8XA 2LG4A 3ZP5A 4XLHA 3TQNA 2HDCA 1BI3A 1PYVA 5DDGA 2QQBA 2GOXB 2QCOA 1FMVA 3WU0A 3BR2A 5HDNA 3EUHC 2LTPA 4FCYA 5H20A 4CSWA 3H3UA 3JRCA 5H6RA 2ACJA 3G71I 2OAZA 2WAFA 3QYFA 1IZ1A 3CO7C 3B02A 1J59A 3SXYA 3T1BA 4QIWN 3WTVC 2MGQA 3GFLA 2B0LA 3SQNA 2R0QC 5FLXK 3AAFA 1R36A 5ED4A 1MZBA 3HSFA 4CYDA 5JLWA 2X1EA 3GZNB 1IRFA 5ICEA 1WQ2A 5GAHJ 1XCVA 1TZLA 1MSEC 4D0PA 4MFEA 1NTCA 4LJZF 4LG3A 2K4JA 5B1AH 5FROA 1Y1WJ 3HJEA 2WAQN 3BR0A 5LRRA 4MTDA 4A3BJ 4LG0A 1OR7A 1A04A 3KP3A 3BCAA 3HSEA 4BS9A 3L9FA 1V5FA 2G7UA 1TW3A 4ZYDA 1FBSA 2JQ7A 3JAMK 1ZAOA 1AKHA 4C2UA 3DV8A 2DT7B 5HS7A 4YFNF 4W97A 1IG7A 3OIOA 3Q0VA 3ZMVA 5FFXA 1UZCA 1BM9A 1RESA 1HDDC 2QYOA 4ESFA 4KA4A 1MDMB 2AO9A 4KUMA 1TWHJ 2HWVA 3CC2I 2ZKZA 1IDYA 5J47A 5F0CA 5CVRA 2E60A 2XV4S 4NQWB 2PFBA 5IT3A 1N77A 3KX2A 1VQOI 4YIFA 1TT5B 1R5HA 2CQNA 2JA5J 1B8IB 3HG9A 2GBYA 2JA7J 4PJ0C 3RZDJ 3TKYA 5IYBJ 2LLKA 2OTLI 3P9CA 2DYSH 4OMZA 3DLLF 5K1YA 5BOXA 1HA8A 1SEUA 2ZJPF 2R5ZA 4BEHA 1HKTA 1R00A 1FIPA 3GZ6A 3TBIA 2Z1DA 2CYYA 3C1DA 2PQ8A 5HVQC 5D8LB 2R7TA 3V7CA 3OYMA 1FYMA 2PJRA 1EA3A 4QWQA 1DQUA 3HOSA 5H6QA 2HYFA 3MMYB 3BJAA 3H3ZA 2L7FP 3K69A 2BV6A 2L01A 3P5JA 3SFIA 2WV0A 1QZYA 4BH9A 2BY3A 5E8IA 1MNDA 3PO2J 4ZDOA 2XF6A 4IX7A 1FOKA 2M3AA 3H5AA 4Y52J 4ZTJA 3O8HA 2IA1A 1Y8RB 4M9ZA 4D5CA 3R61A 2BZTA 3RI4A 1TL8A 4HQEA 3DF8A 3PNVA 1JGGA 3S2WA 1V4RA 2LKPA 3A0HC 4RGSA 2XGCA 4ZC3A 3M9AA 3FWEA 4C30A 2PX9A 2IXSA 3GCMA 2ZSHB 5KAIC 1VZ0A 3PNTA 1F36A 2IBDA 5ILVA 2R7WA 2L54A 3ZCOA 3IAM2 5GAEJ 4HV5A 2C6YA 1SAXA 4RGRA 4AIJA 1RUNA 4OINF 4QPOA 2EZKA 2CW7A 1X2MA 1WJCA 4GFBA 4IVNA 1X4PA 3QP6A 4B8XA 1QPMA 1TT0A 2HOEA 1R1TA 3RPQA 3KE2A 2Q8KA 4P1WA 2DK5A 3K2AA 4XBFA 1RRJA 2JVHA 4G7HF 2DDAA 5D5WB 3QPLA 4KIFA 3A4CA 2K85A 5LHIA 1DPUA 4ANJA 1W36C 1VQKI 2ME0A 3Q3SA 5ICCA 4CCOA 2AXLA 4PFPA 3OYKA 4ZYEA 5BPDA 4IRGA 2VPLA 2JSCA 2O8KA 5LD2C 1E17A 3CUQC 1FOXA 2E5ZA 4MNUA 4CCNA 1K79A 1QBJA 3JTHA 1RKWA 5C44J 2HEOA 1K78A 1P7JA 3S1QJ 4XSXF 4G6DA 4ASNA 1HW2A 1U2WA 1IRZA 2ZJRF 3K1NA 1BJZA 3IRQA 4RM3A 2VN2A 1UHWA 3F22A 5L3GA 1R5GA 3HBLA 4B3XA 1QPIA 1U5TB 1J2XA 3BTIA 4CCKA 4H0EA 1MMSA 1CF7B 4F92B 1GHCA 1T39A 1UJ8A 2MLGA 3O3KA 5GADJ 2ELHA 2L4AA 2M87A 1F43A 2VJ5A 3ZMUA 3MN2A 2EZHA 2NS7A 3FXMA 4LOCA 5BNGA 1HSTA 1YJ9I 2XPVA 1K83J 4JK1X 5D6FA 1W4MA 4EJOA 2R5YB 1VFCA 1U78A 2VOOA 1V5GA 5B3SH 1I1GA 4UB8C 1FP1D 1Z21A 1B6AA 2G0EA 3IHUA 3DXJF 1FJLA 2CV2A 2W57A 2XASA 3BJOA 2ZB9A 3KYDB 1LVAA 2KHMA 4GRIA 4XOTA 3HKZA 4S04A 1H89C 1YI2I 4UVAA 3BQZA 4F52A 5DUIA 2MSYA 3FM3A 4PZJA 5FRMA 5L3CA 2R7VA 5F27A 4BE0A 1XSDA 1ETQA 2A61A 5GTHC 1ZG1A 1MBFA 2RAEA 1W0TA 1GXPA 2F5VA 2XSDC 4HLXA 4HX4A 1XG1A 2JA2A 1XS9A 3BR6A 1TWAJ 4D5FA 4OIQF 5A2QZ 3EDPA 1VF9A 4BDZA 5FD6A 2HZDA 3HUGB 2DYRH 1AU7A 3DKYA 1RI7A 2OCCH 4LFUA 2CW0F 3JAMZ 4E7JA 3BR3A 4DOZA 1MGTA 3HHHA 3M07A 1A31A 2E2IJ 4U7DA 2V9PA 3H0DA 3T8RA 4E4HA 1EH7A 1H0MA 1ON1A 3NQOA 2IS2A 1Q1HA 3MAJA 2FD5A 5M5WJ 2ECCA 1W7PB 2LY2A 5IOZA 1VQ8I 2Y48A 2RN7A 4AIDA 2IS1A 3BTLA 4F3QA 3QP5A 2XDVA 1EF4A 2AQEA 3HKZN 1KA8A 3WTYC 1TQMA 1LB2A 3TW6A 3U2RA 3PFIA 3MEXA 2LOOA 3FHNA 3HOYJ 5F64A 1OISA 2X51A 2ZMEB 1A6QA 3QOEA 1VQPI 1X1AA 5C4JJ 1LVKA 2W7NA 3E6MA 3OL3A 3N4MA 2OC6A 5LLQA 1DU0A 1NG7A 3D5RC 5HLHA 1SFEA 4BQQA 4HNVA 2K40A 4NQWA 3MWMA 1H8AC 4PJJA 2O9LA 5F08A 3ZRGA 3I59A 1X1DA 2H8RA 1D0YA 3H35A 4L9JA 3WU1B 1O3SA 1ZLKA 5HS9A 3NRVA 3ECOA 1NG6A 4ZYHA 3KEQA 1BC8C 2LKSA 1A36A 4AU7A 5DYMA 3NAUA 1OCCH 3L2CA 1PDNC 2HVSA 2P8TA 2QZ8A 4BE1A 3CJNA 4E70A 3OSFA 4FE4A 3GO5A 3F23A 2ISZA 4RLFA 2L9NA 2PN6A 1IO2A 3SEZA 1UHMA 4GXOA 2QM3A 5DM7F 1GVJA 1HKSA 4L5JA 4II2A 3ZMDA 4D9JA 2XKPA 4RM2A 2X6XA 3DPLC 3ZMZA 3J7AY 3HEFA 3AG1H 1IXRC 2V4JC 1IN4A 1ZRFA 2DLLA 2PMZA 2O61A 2EFOA 2ESHA 4XR6A 2OZ6A 1FSEA 1BL0A 5D8KB 2NOJB 2DA3A 2BW3A 2HU9A 2NVYJ 4X6AJ 1LFPA 2R7FA 4BJ5C 2UWMA 4LG0B 4U87A 2V6EA 2XVCA 3GTKJ 2MA3A 3BLYA 3M3YJ 1ZARA 2JZYA 4L5IA 4I0AA 3W3CA 3KP4A 5HODA 4OIRF 4ESBA 2R5ZB 2ZMEC 3AL0B 2MH2A 3PFYA 3ZXSA 4CCJA 3AKZA 4QLCU 4EJUA 3FF5A 1JUSA 2BVLA 2IA0A 3J80Z 3S3NA 4IHVA 2P6TA 2XRLA 2UXNA 2DPDA 4A5NA 4KIGA 3TOBA 3HPGA 3N05A 3DU5A 1UFMA 1SD5A 2CRGA 3DEUA 3ELKA 2M9HA 3NEUA 4GO1A 2VKHA 3M4OJ 4U0WA 2RVCA 2OTJI 4BUPA 1JKRC 1BA5A 1WHUA 2CUZA 4XORA 2V26A 1TNSA 3ZN1A 3JRAA 3V4GA 3L2UA 1FX7A 1HCRA 2GXBA 3F0CA 1M1EB 1S7OA 2V7FA 3BY6A 2K5CA 4DW6A 3IKTA 1OPCA 4ITVA 3F3XA 1K4TA 3I0TA 5FLMJ 3DTIA 4IRIA 4BEHB 3FKJA 3ERED 1NK2P 2QBYB 3G1OA 3JW4A 2VC1A 2DW4A 1T95A 2R3SA 1AHDP 3G1MA 2WWYA 3EYYA 4LK1F 3SJMA 1XB4A 2HQ5A 3RTRA 1ZGAA 5FO5A 4B3AA 1D5YA 4M6YA 2OU2A 2NXNB 4JX6A 2K3PA 1YHQI 3L2RA 2TRTA 1UG0A 5E1WA 5B5EC 2XHKA 3AL0C 3DKXA 4DNCA 4E7KA 3ZQFA 5E3OA 2Y9YA 5DD4A 2F5FA 3C2BA 3DFGA 4IHYA 2HI3A 5HOOA 1G3SA 4LITA 3BG7A 2KDZA 2FQ4A 3GFJA 2VT2A 2WV1A 4J01A 2A07F 1X58A 3LSHA 1KGSA 2M5WA 3OYEA 1MH3A 1CF7A 3L2WA 2XSJC 2PI0A 4UB6C 5EGOB 2FNPA 4R8HA 1USTA 1FMWA 1U0JA 1YG2A 2CW8A 2CFXA 2L7ZA 2NS0A 4IHWA 1R22A 5HS8A 4EJTA 1AWCA 2XUBA 1PP8F 1D8JA 1HQCA 2X6WA 4BHBA 1F4KA 1WGXA 4RA2A 4XRFA 2VONA 1OLTA 3ZN0A 4F93B 1FC3A 2WAQA 5F1JA 3CO6C 3S14J 2A5YB 2HTSA 2K7LA 2LR8A 5E18F 2OBPA 2XF5A 5ICFA 4J19A 2H27A 2IA2A 1VQMI 4A3KJ 2WAEA 2E71A 1ODDA 3HUGA 2LF8A 1WKMA 2A68F 4KJZA 2WB1A 3V8LA 1ZHFA 4DZJA 2E36A 3FIWA 4OWRB 1WSUA 3BTCA 3HOXJ 1O3QA 1VQ5I 4RB2C 4XK4A 2O6GE 2LY1A 3FXRA 1XGSA 2DOEA 1PUFA 1IV6A 3HOVJ 3C2GA 1E3HA 3J81K 1W1WE 3BPVA 3HOZJ 1K7AA 1P7IA 1MMNA 1UG2A 2F4OB 5L3EA 2HFHA 4F7ZA 5FLVA 4MFDA 1DU6A 1SD7A 2O5RA 2WA0A 1OCRH 3PIPF 3ML6A 2NNYA 2BGCA 1YX3A 4FT8A 5K7ZA 1ON2A 2PJPA 1I6XA 2YPRA 2M7AA 3WGHA 3LAJA 3M8JA 1BOAA 3V7SA 3AFHA 1R1UA 1I1SA 4PSXA 3OIPA 3DKWA 1Z05A 3DQVC 4IXAA 3TMOA 2BEOA 2R5YA 2VBZA 4RLQA 2G7HA 3SHFA 4P9UA 4HLYA 4CHUA 3S1NJ 2W48A 2M2EA 5M3MJ 2KZGA 1G3TA 1QZZA 2H6BA 3CUOA 2JN6A 1RIOH 4A3CJ 2PEXA 2DN0A 3IH2A 2GWRA 2Y0SN 3RIRA 3FXOA 2ZXWH 4M74A 3F8BA 4EJWA 2QA4I 1IV8A 3SZGA 4XLPF 4EJVA 5TJJA 2FUG2 3QYEA 3CP2A 3AG4H 4NNJA 1SVLA 4EEFG 2MG4A 2EV5A 3K4LA 3KLNA 5JLXA 1A6IA 2R7UA 1S8NA 3BZKA 2GA1A 3WG9A 3DP7A 2HS5A 2WC2A 1A5JA 2HVQA 5L3DA 4L9VA 4N9IA 4LK0F 2Z2SB 5LRSA 2KISA 1IUYA 3CUQA 1V3FA 4HSRA 3C7JA 1WWXA 5B66C 1D0XA 1B72A 1XC5A 1IN6A 2L4MA 3ZQGA 4MGRA 1QZEA 2ZXIA 4LB6B 2EV6A 2X48A 2STTA 3VPRA 4I6ZA 1GLNA 4CICA 3H5NA 5EG0A 3CDLA 3WTUC 4ESJA 1RZ4A 1QHGA 2R7OA 4BKXA 3IWZA 3Q0UA 3CLQA 2EJRA 2VKEA 1SFOJ 1LKXA 3WU2C 2HKOA 1QHHD 3E5QA 2ETHA 2ISYA 1X3ZB 3LSTA 3L2VA 3ZOBA 4LLNA 3RPUD 3V8JA 3MKWB 2K9SA 2DU9A 3VYUB 1VI0A 2H09A 1WVRA 4Y13A 3CCEI 3I54A 2VBXA 3HPHA 4ETSA 3CJRB 1F9NA 2OCEA 4Q4ZF 3JRIA 2QSFX 2YUSA 1G3YA 4OOIA 1ZQ3P 1VNDA 3RQ4A 3ZPLA 2JRTA 1T2KA 2P0WA 4IOAF 1FOWA 3BT9A 5BPIA 4A3DJ 3IC7A 2EWNA 5M5YJ 4IHXA 4XLAA 1HW1A 2KFDA 1G4DA 3CCJI 4UV9A 4RS8A 2X9DA 3LNQA 2QUFA 3HGGA 1YOVB 4XLEA 2JTVA 4NC6A 1ZR4A 2R7DA 3HSRA 1UB9A 4KISA 2COBA 2DCEA 4PJNA 4IZZA 2QBYA 4L18B 4HG2A 4G6TB 3WHCA 1FT9A 3BZCA 5D5UB 2IRFG 4UUSA 4Y17A 2FBKA 4F91B 2VKVA 2EINH 3PQKA 3EETA 2PMHA 1YITI 2RREA 1Y39A 4YELA 5CQGA 2HPMA 2AXTC 2LBFA 1O4XA 2QENA 3OS1A 2LH9A 2F2EA 3IWFA 3LSPA 2LD5A 2D45A 3CCQI 4WWCA 1O57A 3T8TA 2LREA 2XAGA 4M3GA 5E79C 1GXQA 3CTAA 5DTDA 2VE9A 1MMAA 4AYBN 5M3FJ 2QSGX 2DA4A 3OYAA 2R4GA 4DBRA 4MEYF 5C3EJ 1XX5A 1ZLJA 2HQNA 4N4OB 1DDNA 1JTYA 5E3NA 2X6OA 1ZK8A 2BXYA 4PK4A 2Z9OA 4R1HA 3WGGA 5FGMA 1S29A 3VOEA 2M4KA 1RETA 5HLGA 1WJ5A 3S2HJ 1MKMA 3CLOA 2KZVA 1XDUA 2H1LA 1XSVA 4GYIA 4N9HA 1Z9CA 1FBUA 2VXDA 2M0CA 4XKCA 4A5MA 4BBRJ 4P9FA 5IP7J 2DFFA 2VUMJ 2AS5F 3GVAA 3OYIA 1XGMA 2LFBA 1HC8A 4RMNA 4IF4A 1GVDA 5EJCA 3E1SA 1KYWA 3G3ZA 4KIBA 2DODA 4KT5C 1HOMA 4S0HB 4BJ6C 1P4AA 2FRHA 5JHUA 3B73A 2DA6A 3D5LA 2K02A 1T0FA 1LEAA 1W0UA 2XIGA 4A3GJ 1G8XA 1KU9A 1BC7C 4PGHA 3J7YJ 2MC4A 5LBQA 3DTKA 3L1PA 5EZGA 5J1UA 4WXDA 3RYRA 3OYLA 2YX7A 2MABA 4ZJZA 3Q9SA 4MIMA 5IOYA 1B1BA 2XAHA 2EIJH 4PFOA 1P4XA 3IUOA 1FY7A 1IN7A 2BY0A 1IRXA 5E3MA 3KZIC 1WH5A 1D0ZA 1XSXA 1MBGA 4RGXA 4UHTA 4JBAA 3W6JB 4HQMA 5K7FA 1NK3P 3GTPJ 5J8CA 4M3DA 2E1OA 3OYJA 3WE3A 2FE3A 3TP3A 4DYQA 4KMFA 1APLC 1DGWY 2KIMA 3A1YA 2E34A 5H2FC 2DMTA 1LDJA 3K4JA 1AKHB 1J09A 3DLAA 3MQ0A 3TDUC 4EGYA 5JR3A 4WF2A 3W6VA 3TL4X 3FXQA 3OYHA 1LFUP 3EUAA 1SFUA 1ZG5A 2KRFA 3RCOA 1JXSA 1ETYA 2J5PA 4F55A 3BG3A 2YU9J 5IPAA 3LOCA 4I98B 3VSKA 4MEXF 2IT0A 2Z5UA 3CD6I 1YQAA 2WADA 2A3SA 2NVXJ 3KETA 1G59A 2JRMA 2L7KA 1SANA 2VC0A 1BI2A 5M5XJ 2DTZA 4BXFA 5FKLA 2JWTA 4HEA2 3BC8A 3OS0A 3OOPA 3CMEI 2DMNA 1OCTC 1V54H 1STZA 4JX4A 4A12A 2CSOA 2GQQA 3FMSA 4CO8A 2YS9A 1BR1A 3OYFA 3BG6A 2EQRA 4D7NA 3E6CC 4E7HA 1EH8A 1RR8C 2FSWA 3ASOH 3E7LA 4NC7A 3S32A 4G94A 2JPCA 2O3FA 2M1BA 2JSPA 2Q0OA 3IKVA 3GTLJ 3LA2A 3O8GA 2R92J 5J3LA 1SC7A 4AVZA 3HC7A 3LMMA 1TP4A 4JYKA 4A3LJ 4BNCA 3PQJA 4XQFA 3M8FA 3U1DA 2DFHA 3L2QA 3ABLH 4HBLA 3S1MJ 4NC8A 1IDZA 1P9QC 1JHHA 3RJPA 2V1DA 1P4WA 3OY9A 2LMDA 1FBQA 1FYLA 5HLTA 2XAUA 3S1RJ 4DQ2A 2HDWA 4AWXB 3BPXA 5AIPA 3ONQA 1MBKA 2XPUA 2M34A 3KYCB 3TO9A 2QSHX 1POGA 1K4SA 4HDUA 1FZPB 2DA5A 2ZXHA 2GM4A 2EZLA 2IGMA 5GP9A 4RAYA 3WGIA 5EF6A 1KQ0A 4UV8A 2GZWA 1U5TC 3RKYA 4XIDA 3JRBA 2CUEA 2X1CA 4HF2A 1LJ9A 4XLCA 3WTSC 3HOTA 4EM0B 1JHFA 3J81Z 4IEJA 3TO7A 3OSGA 4MO7A 3DEEA 4BAYA 1S5LC 3K70D 3HRUA 1D8KA 1BJAA 1MNMC 3G6EI 1F5TA 4XN3A 1G6NA 1SMTA 4S05A 3HTSB 4U7BA 2O0YA 2OQGA 1BN5A 1XMXA 5KVRA 1ZH5A 2NVQJ 2W85A 5CLSA 5B1BH 5L3FA 5CYVA 3OYDA 1YTYA 3P7NA 1XPXA 3NWSA 3TOAA 3QQAA 3CJQB 2R7QA 1TWFJ 3K4CA 1R23A 3KP5A 2HNHA 4KT6A 5FLXZ 4MHGA 1CQTA 3K4MA 4EM1A 2A69F 2ZMEA 1UELB 3NARA 2DQRA 4GGGA 2VODA 2R7SA 1SMYF 2EBIA 4FE7A 3OL4A 3K1MA 4I76A 1FTTA 1MBEA 2P5VA 3JSPA 2FEZA 4Q5SF 1QVTA 3BZ6A 4O3MA 2M8GX 3I59B 1Y56A 1Y0NA 1MJ9A 2HOAA 4XKVA 2EA2A 3K6GA 3PO3J 5F0HA 1HDPA 3OWTA 3GMEA 3UNGC 3VODA 5J1YA 3K4BA 4YIRX 2CUJA 4AIKA 2GAUA 2JUGA 1ETVA 1B9MA 2GA2A 3ABUA 4AD9A 2F5EA 2VIXA 4BACA 1A35A 2MBFA 4IRHA 1AA7A 1B59A 2I10A 3F8NA 5DCMA 1JTXA 1H9GA 1N75A 3E6DA 2P7CB 3L00A 3TO6A 4UVCA 2CV0A 2ZNYA 5HNFA 1QNTA 1YW7A 2LKXA 1MNEA 2HYJA 3H9JA 4ZZDA 4RGUA 2MH9A 3EPZA 4NB5A 1HLVA 1O7FA 3LL7A 5EYRA 2OJED 2WY7Q 3FX3A 4V2GA 1XMKA 3MKLA 2ZXJA 1VQ7I 1I50J 5C4XJ 1D1AA 3OMYA 1J5YA 2CMPA 4O6JA 4KFCA 1ITYA 2K9LA 2RC4A 2HVRA 3FMRA 4TV7A 3A01B 3HGYA 4XLNF 4E7LA 4OIPF 4YG2F 5IP9J 5LGUA 2OPTA 3SDGA 2CH0A 4A69C 2BHYA 4YFKF 2V6CA 3SDBA 2VXZA 5HLIA 4FQGA 4UXNA 1FEXA 2LP0A 3FXKA 4N4NB 2E1NA 2BBYA 4KITB 1LNWA 2EB7A 2FMYA 3TDZC 4EGZA 4DYCA 4A93J 3OIQA 3U9GA 3K1PA 1SD6A 1P6RA 2QQ8A 4EMSA 3H9GA 3FK6A 4E7IA 3ZMSA 3CDIA 1IJWC 1TTYA 1ZREA 1FWZA 1G2HA 5IT9Z 1LUJB 3EQLF 3KP6A 5DM6F 3QODA 5BQTA 1PP7U 1GT0C 2RNGA 2JK3A 2QKMB 2V9VA 1YRNA 4IQJA 4RB3C 2QKLB 5FKOA 3P9KA 2JA6J 1ZELA 2JA8J 4YIIA 2HTJA 3BWGA 1KU7A 2Y2ZA 2KP6A 3PJRA 5JVTA 2K9NA 1Z3YA 3HDDA 3GTQJ 2F4MB 4D7MA 4E7SA 3DPTA 2XPWA 3ROUA 3FXUA 1ETWA 1J75A 1W5TA 3S3OA 1ACIA 2A6TA 3GWZA 2DJIA 3J7AO 2NNNA 3FBNB 2FU4A 2QQAA 4CXFA 4P55A 4BHCA 4B43A 5EEGA 1F1ZA 1YJNI 3CJTB 4ZYAA 3HRSA 1BIAA 4XN0A 3JTGA 3FZVA 1IC8A 3HTUA 1R5ID 1JJ6C 1T33A 2DA2A 1WH7A 2ICWG 3GFIA 4Y7NJ 4PJLA 4B09A 1HF0A 4BBSJ 2ESNA 4CCLA 3QPSA 2DPUA 1HBXG 2P5KA 3B6AA 3K0LA 4G6QA 3I4NJ 2IVMA 2X0LA 3F21A 2BW3B 2L9VA 1JKPC 4L9NA 3ZQQA 3F9KA 4M73A 2E1MB 1YE9A 1ZTRA 3GX4X 1GV2A 2M45A 2ZSIB 2BVMA 3RSNA 3IRRA 1BOBA 4GCVA 4KN7X 3SEQA 3GLLA 3FDYA 4HNUA 3CMYA 2QWWA 2DMPA 2MD5A 1PJRA 1WZ2A 5J8FA 1QVUA 3CC7I 3GBGA 1Z3XA 2CS3A 2V79A 4HV6A 1IUFA 4HPQA 1TNTA 4K2EA 1FSHA 1X3WB 2I8DA 3M1CA 4ENJA 1FIAA 2L3DA 4DIQA 3LA3A 2N8GA 4CZZA 1S72I 2WB1N 1JI8A 1LDKB 1TW2A 1Y1VJ 3PIOF 4XRSG 2L02A 2M30A 3H5RA 5BS6A 3EUHA 1Y8QB 4XNFA 2K86A 2ME6A 2X1DA 3G73A 1QU3A 3B6CA 1PUEE 2WY8Q 3QRFF 1W5CC 4IPAA 1MJBA 1DP3A 2DFEA 2OZUA 3JREA 2FX0A 2Q2EA 2LC2A 3W2VA 3HRMA 2R7XA 3SFZA 4WXHA 4AVPA 5IYCJ 4A6EA 4Q47A 5FFZA 1VTNC 2QQ9A 4M3FA 2BHZA 3J7ZI 3N97A 1D3YA 4L5EA 4CDGA 1KZHA 4X1EA 1LE8B 1OCOH 1RKTA 3HIFA 4CH7A 2XB0X 2H1KA 4UUVA 3K4NA 3W2WA 5DV5A 3WODF 3U1KA 4QSHA 4CCMA 1JJ8C 4B47A 2LK2A 2M0MA 1MH4A 3ECHA 4WX9A 3OYNA 4RAGA 3OR1C 1J9IA 3WTTC 3OS2A 4BJTA 1XD7A 1U6GA 2NAZA 4FX0A 4BL0B 3H36A 2WBMA 3HRTA 4G7ZF 2IPQX 2Y9ZA 1YS6A 3E0JB 4Y33A 4EATA 2B9SA 2ELJA 3ESWB 1O3TA 1X1PA 2YU3A 2L2OA 1T0FC 2PJRB 4M9SA 1ZRDA 2D1VA 3RPUA 2VQGA 4D1QA 2XRNA 3MKYB 2JMWA 4UY8I 4CYCB 4IO9F 2YX4A 3ZQLA 3FK7A 1ZGWA 3T0YA 4EV0A 1GUUA 1T6SA 3M7GA 1L0OC 5DCMB 4A3IJ 3LQRA 2NVUB 4EVIA 3RKQA 2FBIA 3F8CA 2DT5A 2VQCA 2Y0MA 2HYGD 2XF7A 1BR2A 3M8EA 3I3LA 5ILUA 2TDXA 5J4VA 2FMLA 4CZCA 3COAC 2AHQA 1RC9A 3TEDA 2HGCA 4ZDLA 5D4SA 4RB1A 4B44A 1WPKA 2F5DA 1ONVA 2HZTA 2KRHA 3KFWX 3LWFA 3QU3A 2IJLA 3HHGA 2ZFUA 2VASA 1XTAA 3JCUC 4HDVA 1HXDA 5LGTA 2CQQA 2CO5A 1IRGA 2Q1ZB 1OFCX 5DCFA 4IHTA 3C3WA 4PGGA 2J5OA 1Z77A 4BQNA 1D1BA 5LEKA 1NH3A 1TC3C 1RUOA 3D0SA 1OQYA 5E3LA 2BY1A 3QOPA 1IW7F 3BR5A 1NHAA 3MZ8A 1BW5A 1BBYA 5EEHA 4C2MJ 1B8IA 2DAOA 3LSMA 3A02A 1JKOC 2OV7A 4JP0A 4XM3A 2DK8A 2VB6A 2E5NA 1WI3A 2EIMH 3EYIA 2D5VA 2DA7A 2F4IA 3BOQA 4OAZA 1WCMJ 5E1ZB 1ERDA 1J7KA 3CCUI 4A0XA 1TQPA 2JPBA 3OR2C 3P9IA 1I27A 1YLFA 4LGWA 9ANTA 3E6BA 1OMIA 3IH4A 4NDLA 5AIQA 2W1OA 1UAAA 4FHTA 4BYYA 3KEYA 4I99C 4CUGA 1RR7A 4ZYGA 1H9TA 1ZRCA 1MBJA 2RQPA 1Z7UA 3ZQHA 2I5UA 1H88C 3TP0A 2FA5A 3VWBA 4P5OA 2HOTA 3VSLA 2H94A 3MD2A 4QPQA 3IV5A 1YRNB 1MSFC 1FOYA 2E7XA 1FYKA 3L7WA 3ABTA 4WCGA 1ZN2A 2FOKA 5KAFC 2EV0A 2UZKA 5CVUA 3A01A 3CCLI 2KT0A 4V2FA 1P2FA 2F6CA 3JSOA 1V55H 5CPRB 5AONA 2RNJA 4CGZA 2KRCA 2VE8A 3K70C 2VPRA 3JRFA 3GTOJ 4UNOA 2MW8A 4XL9A 1S7AA 2UXXA 5F0FA 3UKGA 1B4AA 1DPRA 5EG0B 3KYLA 2R7RA 3EUKL 4N0BA 2DXIA 4M9XA 3HYIA 5EEAA 1P92A 2H6CA 3IP4B 2W24A 4XLFA 2ID3A 1ORKA 4G7OF 2L0KA 1E2XA 4W1UA 3LSGA 2ZJQF 3PUFA 3QPTA 3PSFA 5F1RA 1MDMA 2E35A 4G12A 1OJLA 4Y15A 2Y0SA 3LSJA 1BI1A 5DUKA 3K4KA 1O7LA 1HW5A 2LDUA 3S8PA 4L0YB 2LNBA 3GEZA 3V7RA 4XSZF 2STWA 2IP2A 2F5CA 5D4RA 2EK5A 1WJAA 1JE8A 4HA8A 2A6EF 4P96A 2KMUA 2JT1A 1DUXC 4FASD 1WJEA 1YYVA 1E3OC 2JVGA 2FNAA 5JHFA 3BTJA 1QRYA 1BI0A 4O5VA 2P5LC 2RGVA 3CDHA 5TISC 1U9NA 3WG7H 4IKFA 4HX8A 5GPAA 3GF2A 3RKWA 3S3MA 4ZZLA 5F04A 1YW8A 3O2PE 2DJNA 1LPQA 3CC4I 4MTEA 3WTZA 2IGKA 2LBFB 5DD8A 4KMUX 1EV7A 3PNYA 2DBBA 1ETKA 4M71A 1R49A 3DPUA 3QAHA 2RKHA 4DBQA 3HOUJ 4GDFA 2KL4A 3S15J 1VQNI 3RQIA 2X6YA 4XKBA 4XRSA 5K7HA 1O3RA 3KLOA 5JVGF 1OCPA 3F6OA 1R6RA 1J0RA 2DI3A 2K4BA 2XGXA 2HXIA 4HNTA 1YO5C 2Q2EB 4LD5A 4LMYA 1YS7A 2B7EA 3I64A 2HR3A 4EQQA 2Y30A 3CCVI 2DMQA 4HRIA 1LQ1A 1YW9A 1OCZH 1V5EA 5HNHA 3RDIA 3QPHA 2IGOA 4QTRA 5K5OA 1R4NB 2E1MC 2XKOA 5CKTA 4HZFA 4XKWA 1UCRA 2KLOA 3VEPA 1LE8A 4IHSA 3H92A 2DOFA 1R58A 2EFNA 4E7ZA 2EZIA 3BP8A 3ZGKA 3DBLB 3K7AJ 4OU0A 1KQ8A 2HXOA 2A6HF 4RAZA 3ASNH 4LLGF 3JRHA 2EFPA 3S2DJ 4G8XA 1KU2A 3SYTA 3GYHX 2MYSA 1B9NA 4A6DA 3LQQA 4BY1J 5LGNA 1U3EM 5IYDJ 4UVBA 3CCMI 2OUMA 5TRDA 1Z67A 2YSRA 2NRAC 4HF1A 3HB9A 3KIOA 2HPIA 1MBHA 4FETA 3RKXA 1S7EA 1FPQA 1ZG3A 4U88A 2CFOA 2HKXA 3WHBA 1IAWA 5TGTA 4ZDPA 1XGOA 3I53A 2QEXI 1TWCJ 1X1CA 5CQEA 3C18A 1D1CA 1Y6IA 2L7MP 3GTJJ 1SVMA 1JT0A 3G1LA 1MJAA 4YFXF 3GFMA 1YX5A 2KJBA 1WJBA 1XDSA 3BQYA 1JGSA 2W82A 1K61A 2RV8A 5FKNA 4ZH4F 3NWTA 2GIVA 3JRGA 1MMDA 2Y31A 3LFKA 1T8IA 4XOPA 2H8WA 4PUSA 3CCYA 4I0BA 4EM2A 3F6VA 3BR1A 2UV1A 2W4SA 3ZQ7A 1OYWA 1BR4A 3X2QH 5FB2A 2V9KA 2OA4A 1VQ4I 3VYSB 3LA7A 2LF7A 2QVOA 3H9QA 1WI9A 3GW2A 1N25A 4I09A 2A5WA 2QF7A 2VJIA 3FM5A 4BQOA 3DEWA 3R60A 1ZYRF 3CQZJ 3WTWC 2XC7A 4JX5A 4U0VA 2ZC2A 1IGNA 2HOSA 2W00A 4CYCA 3S17J 4RBOA 1RPWA 1KU3A 4IJAA 3FBIB 3MKZA 3BDDA 4I2OA 1SD4A 3HM5A 2VBYA 2ZCWA 4AIHA 5A2QK 5D6EA 1WFXA 2Z3YA 1VQLI 3V8KA 4A3JJ 3GZ5A 4BHPA 3UR3C 2BOLA 1U5TA 1YIJI 3R4KA 2CG4A 2GXGA 4HYEA 5IP6A 2R7ZJ 3FHZA 1ETOA 1LDDA 1JUMA 2E2HJ 5ERIA 1QGPA 1SAUA 2P6SA 3FMQA 3ZQIA 4IL6C 2IS6A 3A2KA 3JR9A 2EFWA 2B63J 1IN5A 2IGNA 1R9TJ 1W36D 4I01A 3AG3H 3ZQCA 3CCSI 2W25A 5D5XB 1YFHA 1YJWI 1W7PA 2FOWA 4OIOF 3ULQB 1TWGJ 2MC3A 3LSIA 3GLXA 1X19A 3KP2A 2PMZN 4IQ4A 3ERMA 5J40A 5BMZA 2K9MA 3HOWJ 2XGEA 1LFBA 4DYRA 4Z6YA 2KIUA 2LYCA 2EPFA 1TLHB 4DJAA 2VJJA 1T98A 2COMA 4PJMA 1I3QJ 4LB5A 2E2JJ 3MFKA 2CU7A 3A03A 4FX4A 2X4HA 3E3VA 2VOPA 4KDPA 1K6OA 4L0ZB 2EIKH 3QYBA 2NVTJ 3FISA 2ZBKA 2CQXA 4HOBA 2CQKA 3DU6A 4ENMA 3TGNA 1K6YA 1SFKA 1T08B 2CGPA 4A3EJ 3KEOA 5KHDA 3D1NI 1U8RA 1WRJA 2VKDA 1X4OA 3FXJA 1CGPA 1DP7P 2LRDA 5GPCA 2EH3A 3R0AA 4OAYA 3CF2A 2VBWA 3PM1A 2ZO4A 4JOMA 1MMGA 3T5XA 5J1RA 5KNLA 5FKMA 1SVOA 5K5RA 3WTXC 2FQ3A 4ON0A 1EJ9A 5DEQA 3IH3A 4C3JJ 4R79A 1BIBA 5CVJA 1XMAA 3BG9A 3S93A 4E6KG 4XMYA 2CWEA 2ECBA 2OF7A 1USSA 1T38A 1ENHA 4M3BA 1R71A 4B48A 1SFXA 2E1CA 2ID6A 2Y75A 3D5SC 1QO0D 2KQRA 2V1XA 2VT3A 4YEJA 3I56I 2RQQA 1IXCA 5L3BA 2FXAA 2VI6A 2P4WA 5FKKA 3SZPA 1E0EA 5EGOA 4X0GA 2BYVE 2PMUA 2KIFA 3QU6A 3PL8A 4DGWB 2L5QA 2VLAA 4NHJA 3G4SI 2TCTA 3OV8A 2E19A 4JQFA 1R7JA 4LIVA 1XN7A 4M3EA 4ENKA 4BQAA 4MQ9F 4M6VA 4C2TA 5CJ9A 2DT6A 3PUBA 1Z6TA 2KDOA 4HX7A 2P7VB 4NUBA 3DTEA 1BW6A 2W84A 1ZGJA 3CP8A 1EH6A 2QGUA 2CUFA 1X1BA 2ADUA 2VJ4A 5EDNA 3OYCA 4BXUA 3PSIA 4RB0A 4I7HA 5ILSA 1QA6A 3K2ZA 4MLOA 4B4CA 2IAIA 3HZJA 2DA1A 2CV1A 5K5QA 1X2NA 3IAS2 3G2BA 1L3LA 1IN8A 2LY9A 1ETXA 1S9HA 3Q9VA 5DS9A 3R0JA 1EKEA 4C9YA 3HXLA 2MLKA 5FJ8J 3I4PA 4BXXJ 3I58A 4H4KC 5LHGA 2NYXA 1I5ZA 4A3MJ 4Z2YA 3GUDA 4BE2A 2JJ7A 4NBQA 3RZOJ 4A2UA 4HW0A 5J4YA 1VQ9I 4PDKA 2Z33A 4B1RA 1JT6A 3REOA 4J00A 3QWLA 3ABMH 3H0GJ 3Q0WA 2EILH 3KPHA 2HDDA 4KN4X 2KJCA 3ZMTA 4ABZA 1X3UA 2EA4A 2IEKA 2YR2A 2XROA 2DFIA 3CMAI 4RDUA 3LSKA 2OQRA 3L09A 4V19K 1IF1A 2D1HA 2HQAA 5KK1A 4AM3A 1WJFA 4ZTFA 3I5UA 1MIJA 2BXZA 4XRMA 1PVEA 4C3HJ 1G3WA 2A05A 2XAFA 3OYGA 3WE2A 5GAGJ 2GOMA 2MFZA 1GV5A 4BY7J 3TW7A 1XGNA 3K9TA 2PLYA 1Y0UA 1YIOA 3I4MJ 3DCFA 2VL8A 4II3A 1JUPA 3GTGJ 1T56A 1DGRM 5HDGA 3KZZA 3LSRA 3JRDA 2ZJ2A 1HKQA 1REPC 3Q5FA 5E17F 2WTEA 2PBIA 3KCCA 3MZHA 3DBHB 2DOAA 1Z7LA 5HDKA 2LVSA 3CZ6A 3O6BB 2FJ1A 5FRNA 3MZYA 3BROA 3KP7A 3S16J 2M7BA 2Z99A 4M6XA 1C0WA 2K9QA 3I55I 2Z16A 1D5VA 1JKQC 1KQ9A 1R1VA 2DO7A 4HF0A 3W6KB 3GXOA 3V42A 2XAJA 2FF4A 2ZFWA 2V1NA 2JUCA 1LEBA 1UMQA 1I39A 4LIUA 3IL2A 3CUQB 1KYZA 3SZTA 2F48A 1HSJA 2CJJA 1B72B 2HQRA 4I02A 1ULYA 4A0ZA 1S6LA 4KYWA 2XB5A 1WJDA 4BGDA 3I9V2 4PCQA 4Y3OA 2DTRA 1KONA 2UUZA 4A0YA 2R93J 5CVVA 2KIQA 4AUXA 1OR7C 3F72A 4Q48A 4IOCF 1AOYA 1FNNA 3MCZA 4HAMA 1FTZA 1PUFB 2FBHA 3OOUA 4UUTA 3E5XA 3VDXA 2O03A 2QLZA 2GLOA 1K78B 4MQVA 3GTMJ 2IS4A 3AG2H 2VQHA 4LLLA 5KCMA 1XCBA 3CESA 3HL2A 4AC0A 2PG4A 2D2WA 1OYYA 4GYGA 4YRVA 1VQ6I 1Z0XA 1RNLA 2LSOA 4M72A 5CVIA 4AYBA 1Z1DA 2O7OA 2M4GA 4DZPA 3H1CA 1W7PD 3E97A 5GTIC 3RYPA 1I6HJ 5E1XA 1N78A 2BY2A 3FXLA 1U8BA 3DWLE 5JFRA 2NS8A 2L9SA 2GIZA 1I3AA 4BDYA 5JI6A 3FKIJ 2OD5A 1Z91A 2Y69H 3BJ6A 4KICA 4FTHA 2IW5A 4BU2A 4WXCA 3A0BC 4UUSB 4FISA 1TQIA 2V1UA 5LFAA 4XONA 2L9RA 1MD0A 2XAQA 3C2HA 4PSWA 3BCBA 5F6FA 3VB2A 5D5VB 4HSTA 6PAXA 4RAFA 1FP2A 3F8FA 4ENNA 3M1EA 3KZYA 5E20A 4C3IJ 3F8MA 1QQIA 2DQLA 4G9YA 1UHSA 2CQ7A 2K27A 2ZNZA 3VFZA 1Z6RA 2KPMA 2G9WA 1S3JA 4CA0A 5IT9K 1FLIA 3DBRB 2GXAA 5IY5H 2BE5F 1E3PA 3ABKH 5LEJA 2P81A 3CF5F 4KNYA 3MVPA 3LFUA 3OYBA 1MW7A 3R6SA 5ICGA 3BG5A 2M8EA 3U21A 4OMYA 3CCRI 2DMUA 2XGDA 3VYTB 2MD0A 4L9TA 2EFQA 1IXSB 4XICA
chains in the Genus database with same CATH topology
5J6XA 3ISPA 2E7WA 1OKRA 1W5SA 2RDPA 3I71A 1TBXA 4U0YA 3J80K 2KKOA 1OYIA 3LAPA 5E8GA 5LHHA 5FD5A 3E5UA 4WK8F 2O8XA 3ZP5A 2HDCA 3TQNA 1BI3A 5DDGA 2QQBA 5HDNA 3WU0A 5H20A 3H3UA 5H6RA 2ACJA 2OAZA 1IZ1A 3CO7C 3B02A 1J59A 3SXYA 3T1BA 3WTVC 5FLXK 3GFLA 2B0LA 3SQNA 3AAFA 1R36A 5ED4A 1MZBA 3HSFA 4CYDA 1IRFA 5ICEA 1WQ2A 1XCVA 4D0PA 4LJZF 2K4JA 5LRRA 4MTDA 4LG0A 1OR7A 1A04A 3KP3A 3HSEA 3L9FA 2G7UA 1TW3A 4ZYDA 1FBSA 3JAMK 1ZAOA 3DV8A 5HS7A 4YFNF 3ZMVA 5FFXA 1BM9A 2QYOA 4ESFA 4KA4A 1MDMB 4KUMA 2HWVA 2ZKZA 5CVRA 2XV4S 2PFBA 5IT3A 4YIFA 1R5HA 3TKYA 3P9CA 4OMZA 5K1YA 5BOXA 1HKTA 1R00A 3GZ6A 2CYYA 3C1DA 2PQ8A 5HVQC 5D8LB 3V7CA 1FYMA 4QWQA 3HOSA 5H6QA 2HYFA 3BJAA 3H3ZA 3K69A 2BV6A 2L01A 2WV0A 1QZYA 4BH9A 5E8IA 1FOKA 1H0MA 2IA1A 4M9ZA 3R61A 3RI4A 4HQEA 3DF8A 3S2WA 1V4RA 2LKPA 4RGSA 3M9AA 3FWEA 5ILVA 2L54A 4HV5A 2C6YA 1SAXA 4RGRA 4AIJA 1RUNA 4OINF 4IVNA 3QP6A 4B8XA 1QPMA 2HOEA 1R1TA 3RPQA 3KE2A 2Q8KA 2DK5A 4XBFA 4G7HF 5D5WB 4KIFA 5LHIA 1DPUA 5ICCA 2AXLA 4ZYEA 5BPDA 4IRGA 2JSCA 1E17A 3CUQC 4MNUA 1K79A 1QBJA 3JTHA 2HEOA 1K78A 4XSXF 4G6DA 4ASNA 1HW2A 1U2WA 3K1NA 3IRQA 2VN2A 1UHWA 3F22A 5L3GA 1R5GA 1U5TB 1J2XA 4H0EA 1CF7B 1GHCA 1T39A 2MLGA 3O3KA 2ELHA 2L4AA 2M87A 3ZMUA 1HSTA 4EJOA 1U78A 4JK1X 5D6FA 1W4MA 2VOOA 1I1GA 1FP1D 3IHUA 1B6AA 3DXJF 2W57A 2XASA 3BJOA 1LVAA 4S04A 4UVAA 5DUIA 3FM3A 4PZJA 5L3CA 1XSDA 2A61A 1ZG1A 1GXPA 4HLXA 4HX4A 4OIQF 5A2QZ 3EDPA 5FD6A 1RI7A 4LFUA 3JAMZ 2CW0F 1MGTA 3HHHA 4U7DA 3T8RA 1EH7A 1ON1A 3NQOA 1Q1HA 3MAJA 1W7PB 2Y48A 2RN7A 3QP5A 1KA8A 3WTYC 1TQMA 1LB2A 3U2RA 3PFIA 3MEXA 5F64A 2ZMEB 3E6MA 3N4MA 5LLQA 5HLHA 1SFEA 4NQWA 3MWMA 3I59A 4L9JA 3WU1B 1O3SA 1ZLKA 5HS9A 3NRVA 3ECOA 4ZYHA 3KEQA 1BC8C 5DYMA 3L2CA 1PDNC 2P8TA 2QZ8A 3CJNA 4E70A 3GO5A 3F23A 2ISZA 2PN6A 1UHMA 4GXOA 2QM3A 1GVJA 1HKSA 4L5JA 3ZMDA 2XKPA 3DPLC 3ZMZA 1IXRC 1IN4A 1ZRFA 2DLLA 2O61A 2EFOA 2ESHA 2OZ6A 1FSEA 5D8KB 2R7FA 2UWMA 4LG0B 2XVCA 2MA3A 1ZARA 2JZYA 4L5IA 4I0AA 3KP4A 4OIRF 4ESBA 2MH2A 4QLCU 4EJUA 3FF5A 2IA0A 3J80Z 2P6TA 2UXNA 2DPDA 4A5NA 4KIGA 3TOBA 1UFMA 1SD5A 3DEUA 3ELKA 3NEUA 4GO1A 4U0WA 2RVCA 3ZN1A 1TNSA 3V4GA 2GXBA 1FX7A 1S7OA 3BY6A 3IKTA 1OPCA 3F3XA 3I0TA 4IRIA 3ERED 2QBYB 3JW4A 2VC1A 2DW4A 2R3SA 2WWYA 3EYYA 4LK1F 1XB4A 3RTRA 1ZGAA 5FO5A 4M6YA 2OU2A 5E1WA 2XHKA 4DNCA 5DD4A 2F5FA 3DFGA 5HOOA 1G3SA 3GFJA 2VT2A 2A07F 1KGSA 2M5WA 1CF7A 2PI0A 2FNPA 4R8HA 1USTA 1YG2A 2NS0A 2CFXA 1R22A 5HS8A 4EJTA 1AWCA 2XUBA 1PP8F 1D8JA 1HQCA 4BHBA 1F4KA 4XRFA 2VONA 3ZN0A 1FC3A 3CO6C 2A5YB 2HTSA 2K7LA 5E18F 2OBPA 5ICFA 2H27A 2IA2A 1ODDA 3HUGA 2LF8A 1WKMA 2A68F 3V8LA 1ZHFA 1WSUA 1O3QA 4RB2C 2O6GE 3FXRA 1XGSA 3J81K 3BPVA 1K7AA 5L3EA 2HFHA 4F7ZA 1SD7A 3ML6A 2NNYA 2BGCA 4FT8A 1ON2A 2PJPA 1I6XA 2YPRA 3WGHA 3LAJA 1BOAA 3V7SA 1R1UA 1I1SA 3DKWA 1Z05A 3DQVC 4IXAA 2BEOA 2VBZA 2G7HA 3SHFA 4P9UA 4HLYA 4CHUA 1G3TA 1QZZA 2H6BA 3CUOA 1RIOH 2PEXA 2GWRA 3RIRA 4M74A 3F8BA 4EJWA 4XLPF 4EJVA 5TJJA 2EV5A 3KLNA 1S8NA 2GA1A 3WG9A 3DP7A 2HS5A 2WC2A 5L3DA 4L9VA 4N9IA 4LK0F 5LRSA 1IUYA 3CUQA 1V3FA 3C7JA 1WWXA 1IN6A 2L4MA 4MGRA 4LB6B 2EV6A 2STTA 4CICA 3WTUC 4ESJA 1RZ4A 3IWZA 2EJRA 2HKOA 3E5QA 2ETHA 2ISYA 3LSTA 4LLNA 3V8JA 2DU9A 2H09A 4Y13A 3I54A 2VBXA 4ETSA 1F9NA 4Q4ZF 4OOIA 1G3YA 3ZPLA 2JRTA 1T2KA 5BPIA 3IC7A 2EWNA 1HW1A 1G4DA 4UV9A 4RS8A 2QUFA 2JTVA 2R7DA 3HSRA 1UB9A 2QBYA 4L18B 1FT9A 5D5UB 2IRFG 4Y17A 2FBKA 3PQKA 3EETA 2PMHA 2QENA 2F2EA 3IWFA 2D45A 4WWCA 1O57A 3T8TA 2XAGA 1GXQA 3CTAA 2VE9A 4MEYF 1ZLJA 2HQNA 1DDNA 2Z9OA 4R1HA 3WGGA 5FGMA 1S29A 3VOEA 5HLGA 1MKMA 3CLOA 1XDUA 1XSVA 4GYIA 4N9HA 1Z9CA 1FBUA 4A5MA 4P9FA 2AS5F 3GVAA 1XGMA 4IF4A 1KYWA 3G3ZA 4KIBA 4KT5C 1P4AA 2FRHA 5JHUA 3B73A 3D5LA 2K02A 1T0FA 1LEAA 2XIGA 1KU9A 1BC7C 4PGHA 5LBQA 4WXDA 3RYRA 2YX7A 3Q9SA 1B1BA 2XAHA 1P4XA 1FY7A 1IN7A 1XSXA 4RGXA 4UHTA 3W6JB 4JBAA 4HQMA 5J8CA 3WE3A 2FE3A 4KMFA 2KIMA 1LDJA 3MQ0A 3TDUC 4EGYA 5JR3A 4WF2A 3FXQA 1SFUA 1ZG5A 2KRFA 1JXSA 2J5PA 4I98B 4MEXF 2IT0A 2Z5UA 1YQAA 2A3SA 3KETA 2VC0A 1BI2A 3OOPA 1STZA 4A12A 2CSOA 2GQQA 3FMSA 4CO8A 3E6CC 1EH8A 2FSWA 4G94A 2JPCA 2O3FA 2M1BA 2Q0OA 3IKVA 3LA2A 4BNCA 3PQJA 3M8FA 3U1DA 4HBLA 1JHHA 3RJPA 2V1DA 1P4WA 1FBQA 1FYLA 4DQ2A 4AWXB 3BPXA 5AIPA 3TO9A 4HDUA 1FZPB 4RAYA 3WGIA 1KQ0A 4UV8A 2GZWA 1U5TC 3RKYA 4HF2A 1LJ9A 3WTSC 3HOTA 4EM0B 1JHFA 3J81Z 3TO7A 4BAYA 3HRUA 1D8KA 1BJAA 1F5TA 1G6NA 1SMTA 4S05A 3HTSB 4U7BA 2O0YA 2OQGA 1BN5A 5KVRA 1ZH5A 2W85A 5CLSA 5L3FA 5CYVA 1YTYA 3P7NA 3TOAA 3KP5A 1R23A 5FLXZ 4MHGA 4EM1A 2A69F 2ZMEA 2DQRA 4GGGA 2VODA 1SMYF 3K1MA 2P5VA 3JSPA 2FEZA 4Q5SF 3BZ6A 4O3MA 3I59B 1MJ9A 2EA2A 3VODA 4AIKA 2GAUA 1B9MA 2GA2A 3ABUA 4AD9A 2F5EA 2MBFA 4IRHA 1B59A 3F8NA 5DCMA 1H9GA 3E6DA 2P7CB 3L00A 3TO6A 4UVCA 2ZNYA 1QNTA 1YW7A 4ZZDA 4RGUA 2MH9A 4NB5A 1O7FA 3FX3A 1XMKA 2ZXJA 1J5YA 4O6JA 4KFCA 2RC4A 3FMRA 4TV7A 4XLNF 4OIPF 4YG2F 5LGUA 4YFKF 2V6CA 2VXZA 5HLIA 4UXNA 2E1NA 2BBYA 1LNWA 2EB7A 2FMYA 3TDZC 4EGZA 3U9GA 3K1PA 1SD6A 1P6RA 4EMSA 3ZMSA 1TTYA 1ZREA 1FWZA 5IT9Z 3EQLF 3KP6A 5BQTA 1PP7U 2V9VA 4RB3C 3P9KA 4YIIA 2HTJA 3BWGA 1KU7A 5JVTA 3DPTA 3ROUA 3FXUA 1J75A 1W5TA 3GWZA 3J7AO 2NNNA 2FU4A 2QQAA 4CXFA 4P55A 4BHCA 5EEGA 1F1ZA 3HRSA 1BIAA 3JTGA 3FZVA 3HTUA 3GFIA 4B09A 2ESNA 2DPUA 1HBXG 2P5KA 3K0LA 4G6QA 2IVMA 2X0LA 3F21A 4L9NA 4M73A 3GX4X 2M45A 3IRRA 4GCVA 4KN7X 2QWWA 2MD5A 5J8FA 2V79A 4HV6A 1TNTA 4K2EA 1FSHA 4ENJA 2L3DA 3LA3A 4CZZA 1LDKB 1TW2A 2L02A 2M30A 5BS6A 3EUHA 2K86A 3G73A 1PUEE 3QRFF 4IPAA 1MJBA 2OZUA 2Q2EA 3HRMA 3SFZA 4WXHA 4AVPA 4A6EA 4Q47A 5FFZA 1VTNC 2QQ9A 3N97A 1D3YA 4CDGA 3HIFA 4UUVA 5DV5A 3WODF 4WX9A 3ECHA 1J9IA 3WTTC 1XD7A 1U6GA 2NAZA 4FX0A 3HRTA 4G7ZF 2IPQX 1YS6A 1O3TA 2YU3A 4M9SA 1ZRDA 2D1VA 3RPUA 2XRNA 2YX4A 3T0YA 4EV0A 1T6SA 3M7GA 1L0OC 5DCMB 3LQRA 4EVIA 2FBIA 3F8CA 2DT5A 2Y0MA 2HYGD 3M8EA 5ILUA 2TDXA 2FMLA 3COAC 2HGCA 5D4SA 4RB1A 2F5DA 1ONVA 2HZTA 3KFWX 3LWFA 3QU3A 2IJLA 3HHGA 4HDVA 1HXDA 5LGTA 2CO5A 1IRGA 5DCFA 4IHTA 3C3WA 4PGGA 2J5OA 5LEKA 1RUOA 3D0SA 3QOPA 1IW7F 1NHAA 1BBYA 5EEHA 2DAOA 2DK8A 3EYIA 3BOQA 5E1ZB 1J7KA 4A0XA 1TQPA 2JPBA 3P9IA 1I27A 1YLFA 4LGWA 3E6BA 1OMIA 5AIQA 4FHTA 4BYYA 1ZRCA 4ZYGA 1H9TA 2RQPA 1Z7UA 2FA5A 4P5OA 2H94A 2E7XA 1FYKA 3L7WA 3ABTA 4WCGA 1ZN2A 2FOKA 2UZKA 2EV0A 5CVUA 1P2FA 3JSOA 5AONA 2RNJA 4CGZA 2VE8A 4UNOA 1S7AA 2UXXA 1B4AA 1DPRA 4N0BA 4M9XA 3HYIA 1P92A 2H6CA 2W24A 4G7OF 1E2XA 3QPTA 5F1RA 1MDMA 4Y15A 1BI1A 5DUKA 1O7LA 1HW5A 2LDUA 4L0YB 2LNBA 3GEZA 3V7RA 4XSZF 2STWA 2IP2A 2F5CA 5D4RA 2EK5A 1JE8A 4HA8A 2A6EF 4P96A 2JT1A 1DUXC 1YYVA 2FNAA 1BI0A 4O5VA 2P5LC 2RGVA 3CDHA 4HX8A 3GF2A 3RKWA 4ZZLA 1YW8A 3O2PE 4MTEA 3WTZA 5DD8A 4KMUX 1EV7A 2DBBA 4M71A 3QAHA 2RKHA 1O3RA 3KLOA 3F6OA 1J0RA 2DI3A 2K4BA 2XGXA 1YO5C 4LD5A 4LMYA 1YS7A 3I64A 2HR3A 4EQQA 1LQ1A 1YW9A 3RDIA 3QPHA 5K5OA 2XKOA 4HZFA 1UCRA 3VEPA 4IHSA 3H92A 1R58A 2EFNA 3BP8A 4OU0A 1KQ8A 2A6HF 4RAZA 4LLGF 2EFPA 4G8XA 1KU2A 3GYHX 1B9NA 4A6DA 3LQQA 5LGNA 1U3EM 4UVBA 5TRDA 2YSRA 2NRAC 4HF1A 3RKXA 1FPQA 1ZG3A 4U88A 2HKXA 1IAWA 1XGOA 3I53A 3C18A 1MJAA 4YFXF 3GFMA 2KJBA 1XDSA 1JGSA 2RV8A 4ZH4F 2GIVA 3LFKA 4EM2A 4I0BA 3F6VA 3ZQ7A 1OYWA 5FB2A 2OA4A 3LA7A 2LF7A 2QVOA 1WI9A 3GW2A 4I09A 3FM5A 3R60A 1ZYRF 3WTWC 4U0VA 1KU3A 4IJAA 3BDDA 4I2OA 1SD4A 2VBYA 2ZCWA 4AIHA 5A2QK 5D6EA 2Z3YA 3V8KA 3GZ5A 4BHPA 1U5TA 3R4KA 2CG4A 2GXGA 4HYEA 3FHZA 1LDDA 5ERIA 1QGPA 2P6SA 3FMQA 2EFWA 1IN5A 4I01A 2W25A 5D5XB 1YFHA 1W7PA 4OIOF 3ULQB 2MC3A 3GLXA 3KP2A 5BMZA 2KIUA 1TLHB 1T98A 2COMA 4LB5A 3MFKA 4FX4A 2X4HA 3E3VA 2VOPA 4KDPA 1K6OA 4L0ZB 2ZBKA 4HOBA 2CQKA 4ENMA 3TGNA 2CGPA 3KEOA 1U8RA 1WRJA 1CGPA 1DP7P 3R0AA 2VBWA 2ZO4A 3T5XA 5K5RA 3WTXC 2FQ3A 4ON0A 5DEQA 4R79A 1BIBA 5CVJA 1XMAA 2CWEA 1USSA 1T38A 1SFXA 2E1CA 2Y75A 1QO0D 2V1XA 2VT3A 1IXCA 5L3BA 2FXAA 2P4WA 3SZPA 2BYVE 2PMUA 2KIFA 3QU6A 4NHJA 3OV8A 4JQFA 1R7JA 1XN7A 4ENKA 4BQAA 4MQ9F 5CJ9A 1Z6TA 4HX7A 2P7VB 2W84A 1ZGJA 1EH6A 2ADUA 4BXUA 4RB0A 4I7HA 5ILSA 3K2ZA 5K5QA 1L3LA 1IN8A 3Q9VA 3R0JA 2MLKA 3I4PA 3I58A 5LHGA 2NYXA 1I5ZA 4Z2YA 3GUDA 4A2UA 4HW0A 4PDKA 2Z33A 3REOA 4KN4X 2KJCA 3ZMTA 1X3UA 2EA4A 2YR2A 2XROA 2DFIA 2OQRA 3L09A 1IF1A 2D1HA 5KK1A 3I5UA 1G3WA 2XAFA 3WE2A 1XGNA 3K9TA 2PLYA 1Y0UA 1YIOA 5HDGA 3KZZA 2ZJ2A 1HKQA 1REPC 3Q5FA 5E17F 2WTEA 2PBIA 3KCCA 3MZHA 5HDKA 3O6BB 3MZYA 3BROA 3KP7A 2Z99A 4M6XA 1C0WA 1D5VA 1KQ9A 1R1VA 2DO7A 4HF0A 3W6KB 3GXOA 2XAJA 2FF4A 2ZFWA 1LEBA 3IL2A 3CUQB 1KYZA 3SZTA 1HSJA 2HQRA 4I02A 1ULYA 4A0ZA 1S6LA 4KYWA 4PCQA 2DTRA 4A0YA 5CVVA 3F72A 4Q48A 1AOYA 1FNNA 3MCZA 4HAMA 2FBHA 3E5XA 2O03A 2QLZA 1K78B 4MQVA 4LLLA 1XCBA 2PG4A 2D2WA 1OYYA 4GYGA 1RNLA 2LSOA 4M72A 5CVIA 1Z1DA 1W7PD 3E97A 3RYPA 5E1XA 5JFRA 5JI6A 2OD5A 1Z91A 3BJ6A 4KICA 2IW5A 4WXCA 2V1UA 1TQIA 1MD0A 2XAQA 5F6FA 3VB2A 5D5VB 6PAXA 1FP2A 3F8FA 4ENNA 3M1EA 3KZYA 5E20A 3F8MA 1QQIA 2DQLA 4G9YA 3VFZA 2K27A 2ZNZA 1Z6RA 2G9WA 1S3JA 5IT9K 1FLIA 2BE5F 5LEJA 4KNYA 3R6SA 5ICGA 2M8EA 4OMYA 4L9TA 2EFQA 1IXSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J6X A;  3ISP A;  2E7W A;  1OKR A;  1W5S A;  2RDP A;  3I71 A;  1TBX A;  4U0Y A;  3J80 K;  2KKO A;  1OYI A;  3LAP A;  5E8G A;  5LHH A;  5FD5 A;  3E5U A;  4WK8 F;  2O8X A;  3ZP5 A;  2HDC A;  3TQN A;  1BI3 A;  5DDG A;  2QQB A;  5HDN A;  3WU0 A;  5H20 A;  3H3U A;  5H6R A;  2ACJ A;  2OAZ A;  1IZ1 A;  3CO7 C;  3B02 A;  1J59 A;  3SXY A;  3T1B A;  3WTV C;  5FLX K;  3GFL A;  2B0L A;  3SQN A;  3AAF A;  1R36 A;  5ED4 A;  1MZB A;  3HSF A;  4CYD A;  1IRF A;  5ICE A;  1WQ2 A;  1XCV A;  4D0P A;  4LJZ F;  2K4J A;  5LRR A;  4MTD A;  4LG0 A;  1OR7 A;  1A04 A;  3KP3 A;  3HSE A;  3L9F A;  2G7U A;  1TW3 A;  4ZYD A;  1FBS A;  3JAM K;  1ZAO A;  3DV8 A;  5HS7 A;  4YFN F;  3ZMV A;  5FFX A;  1BM9 A;  2QYO A;  4ESF A;  4KA4 A;  1MDM B;  4KUM A;  2HWV A;  2ZKZ A;  5CVR A;  2XV4 S;  2PFB A;  5IT3 A;  4YIF A;  1R5H A;  3TKY A;  3P9C A;  4OMZ A;  5K1Y A;  5BOX A;  1HKT A;  1R00 A;  3GZ6 A;  2CYY A;  3C1D A;  2PQ8 A;  5HVQ C;  5D8L B;  3V7C A;  1FYM A;  4QWQ A;  3HOS A;  5H6Q A;  2HYF A;  3BJA A;  3H3Z A;  3K69 A;  2BV6 A;  2L01 A;  2WV0 A;  1QZY A;  4BH9 A;  5E8I A;  1FOK A;  1H0M A;  2IA1 A;  4M9Z A;  3R61 A;  3RI4 A;  4HQE A;  3DF8 A;  3S2W A;  1V4R A;  2LKP A;  4RGS A;  3M9A A;  3FWE A;  5ILV A;  2L54 A;  4HV5 A;  2C6Y A;  1SAX A;  4RGR A;  4AIJ A;  1RUN A;  4OIN F;  4IVN A;  3QP6 A;  4B8X A;  1QPM A;  2HOE A;  1R1T A;  3RPQ A;  3KE2 A;  2Q8K A;  2DK5 A;  4XBF A;  4G7H F;  5D5W B;  4KIF A;  5LHI A;  1DPU A;  5ICC A;  2AXL A;  4ZYE A;  5BPD A;  4IRG A;  2JSC A;  1E17 A;  3CUQ C;  4MNU A;  1K79 A;  1QBJ A;  3JTH A;  2HEO A;  1K78 A;  4XSX F;  4G6D A;  4ASN A;  1HW2 A;  1U2W A;  3K1N A;  3IRQ A;  2VN2 A;  1UHW A;  3F22 A;  5L3G A;  1R5G A;  1U5T B;  1J2X A;  4H0E A;  1CF7 B;  1GHC A;  1T39 A;  2MLG A;  3O3K A;  2ELH A;  2L4A A;  2M87 A;  3ZMU A;  1HST A;  4EJO A;  1U78 A;  4JK1 X;  5D6F A;  1W4M A;  2VOO A;  1I1G A;  1FP1 D;  3IHU A;  1B6A A;  3DXJ F;  2W57 A;  2XAS A;  3BJO A;  1LVA A;  4S04 A;  4UVA A;  5DUI A;  3FM3 A;  4PZJ A;  5L3C A;  1XSD A;  2A61 A;  1ZG1 A;  1GXP A;  4HLX A;  4HX4 A;  4OIQ F;  5A2Q Z;  3EDP A;  5FD6 A;  1RI7 A;  4LFU A;  3JAM Z;  2CW0 F;  1MGT A;  3HHH A;  4U7D A;  3T8R A;  1EH7 A;  1ON1 A;  3NQO A;  1Q1H A;  3MAJ A;  1W7P B;  2Y48 A;  2RN7 A;  3QP5 A;  1KA8 A;  3WTY C;  1TQM A;  1LB2 A;  3U2R A;  3PFI A;  3MEX A;  5F64 A;  2ZME B;  3E6M A;  3N4M A;  5LLQ A;  5HLH A;  1SFE A;  4NQW A;  3MWM A;  3I59 A;  4L9J A;  3WU1 B;  1O3S A;  1ZLK A;  5HS9 A;  3NRV A;  3ECO A;  4ZYH A;  3KEQ A;  1BC8 C;  5DYM A;  3L2C A;  1PDN C;  2P8T A;  2QZ8 A;  3CJN A;  4E70 A;  3GO5 A;  3F23 A;  2ISZ A;  2PN6 A;  1UHM A;  4GXO A;  2QM3 A;  1GVJ A;  1HKS A;  4L5J A;  3ZMD A;  2XKP A;  3DPL C;  3ZMZ A;  1IXR C;  1IN4 A;  1ZRF A;  2DLL A;  2O61 A;  2EFO A;  2ESH A;  2OZ6 A;  1FSE A;  5D8K B;  2R7F A;  2UWM A;  4LG0 B;  2XVC A;  2MA3 A;  1ZAR A;  2JZY A;  4L5I A;  4I0A A;  3KP4 A;  4OIR F;  4ESB A;  2MH2 A;  4QLC U;  4EJU A;  3FF5 A;  2IA0 A;  3J80 Z;  2P6T A;  2UXN A;  2DPD A;  4A5N A;  4KIG A;  3TOB A;  1UFM A;  1SD5 A;  3DEU A;  3ELK A;  3NEU A;  4GO1 A;  4U0W A;  2RVC A;  3ZN1 A;  1TNS A;  3V4G A;  2GXB A;  1FX7 A;  1S7O A;  3BY6 A;  3IKT A;  1OPC A;  3F3X A;  3I0T A;  4IRI A;  3ERE D;  2QBY B;  3JW4 A;  2VC1 A;  2DW4 A;  2R3S A;  2WWY A;  3EYY A;  4LK1 F;  1XB4 A;  3RTR A;  1ZGA A;  5FO5 A;  4M6Y A;  2OU2 A;  5E1W A;  2XHK A;  4DNC A;  5DD4 A;  2F5F A;  3DFG A;  5HOO A;  1G3S A;  3GFJ A;  2VT2 A;  2A07 F;  1KGS A;  2M5W A;  1CF7 A;  2PI0 A;  2FNP A;  4R8H A;  1UST A;  1YG2 A;  2NS0 A;  2CFX A;  1R22 A;  5HS8 A;  4EJT A;  1AWC A;  2XUB A;  1PP8 F;  1D8J A;  1HQC A;  4BHB A;  1F4K A;  4XRF A;  2VON A;  3ZN0 A;  1FC3 A;  3CO6 C;  2A5Y B;  2HTS A;  2K7L A;  5E18 F;  2OBP A;  5ICF A;  2H27 A;  2IA2 A;  1ODD A;  3HUG A;  2LF8 A;  1WKM A;  2A68 F;  3V8L A;  1ZHF A;  1WSU A;  1O3Q A;  4RB2 C;  2O6G E;  3FXR A;  1XGS A;  3J81 K;  3BPV A;  1K7A A;  5L3E A;  2HFH A;  4F7Z A;  1SD7 A;  3ML6 A;  2NNY A;  2BGC A;  4FT8 A;  1ON2 A;  2PJP A;  1I6X A;  2YPR A;  3WGH A;  3LAJ A;  1BOA A;  3V7S A;  1R1U A;  1I1S A;  3DKW A;  1Z05 A;  3DQV C;  4IXA A;  2BEO A;  2VBZ A;  2G7H A;  3SHF A;  4P9U A;  4HLY A;  4CHU A;  1G3T A;  1QZZ A;  2H6B A;  3CUO A;  1RIO H;  2PEX A;  2GWR A;  3RIR A;  4M74 A;  3F8B A;  4EJW A;  4XLP F;  4EJV A;  5TJJ A;  2EV5 A;  3KLN A;  1S8N A;  2GA1 A;  3WG9 A;  3DP7 A;  2HS5 A;  2WC2 A;  5L3D A;  4L9V A;  4N9I A;  4LK0 F;  5LRS A;  1IUY A;  3CUQ A;  1V3F A;  3C7J A;  1WWX A;  1IN6 A;  2L4M A;  4MGR A;  4LB6 B;  2EV6 A;  2STT A;  4CIC A;  3WTU C;  4ESJ A;  1RZ4 A;  3IWZ A;  2EJR A;  2HKO A;  3E5Q A;  2ETH A;  2ISY A;  3LST A;  4LLN A;  3V8J A;  2DU9 A;  2H09 A;  4Y13 A;  3I54 A;  2VBX A;  4ETS A;  1F9N A;  4Q4Z F;  4OOI A;  1G3Y A;  3ZPL A;  2JRT A;  1T2K A;  5BPI A;  3IC7 A;  2EWN A;  1HW1 A;  1G4D A;  4UV9 A;  4RS8 A;  2QUF A;  2JTV A;  2R7D A;  3HSR A;  1UB9 A;  2QBY A;  4L18 B;  1FT9 A;  5D5U B;  2IRF G;  4Y17 A;  2FBK A;  3PQK A;  3EET A;  2PMH A;  2QEN A;  2F2E A;  3IWF A;  2D45 A;  4WWC A;  1O57 A;  3T8T A;  2XAG A;  1GXQ A;  3CTA A;  2VE9 A;  4MEY F;  1ZLJ A;  2HQN A;  1DDN A;  2Z9O A;  4R1H A;  3WGG A;  5FGM A;  1S29 A;  3VOE A;  5HLG A;  1MKM A;  3CLO A;  1XDU A;  1XSV A;  4GYI A;  4N9H A;  1Z9C A;  1FBU A;  4A5M A;  4P9F A;  2AS5 F;  3GVA A;  1XGM A;  4IF4 A;  1KYW A;  3G3Z A;  4KIB A;  4KT5 C;  1P4A A;  2FRH A;  5JHU A;  3B73 A;  3D5L A;  2K02 A;  1T0F A;  1LEA A;  2XIG A;  1KU9 A;  1BC7 C;  4PGH A;  5LBQ A;  4WXD A;  3RYR A;  2YX7 A;  3Q9S A;  1B1B A;  2XAH A;  1P4X A;  1FY7 A;  1IN7 A;  1XSX A;  4RGX A;  4UHT A;  3W6J B;  4JBA A;  4HQM A;  5J8C A;  3WE3 A;  2FE3 A;  4KMF A;  2KIM A;  1LDJ A;  3MQ0 A;  3TDU C;  4EGY A;  5JR3 A;  4WF2 A;  3FXQ A;  1SFU A;  1ZG5 A;  2KRF A;  1JXS A;  2J5P A;  4I98 B;  4MEX F;  2IT0 A;  2Z5U A;  1YQA A;  2A3S A;  3KET A;  2VC0 A;  1BI2 A;  3OOP A;  1STZ A;  4A12 A;  2CSO A;  2GQQ A;  3FMS A;  4CO8 A;  3E6C C;  1EH8 A;  2FSW A;  4G94 A;  2JPC A;  2O3F A;  2M1B A;  2Q0O A;  3IKV A;  3LA2 A;  4BNC A;  3PQJ A;  3M8F A;  3U1D A;  4HBL A;  1JHH A;  3RJP A;  2V1D A;  1P4W A;  1FBQ A;  1FYL A;  4DQ2 A;  4AWX B;  3BPX A;  5AIP A;  3TO9 A;  4HDU A;  1FZP B;  4RAY A;  3WGI A;  1KQ0 A;  4UV8 A;  2GZW A;  1U5T C;  3RKY A;  4HF2 A;  1LJ9 A;  3WTS C;  3HOT A;  4EM0 B;  1JHF A;  3J81 Z;  3TO7 A;  4BAY A;  3HRU A;  1D8K A;  1BJA A;  1F5T A;  1G6N A;  1SMT A;  4S05 A;  3HTS B;  4U7B A;  2O0Y A;  2OQG A;  1BN5 A;  5KVR A;  1ZH5 A;  2W85 A;  5CLS A;  5L3F A;  5CYV A;  1YTY A;  3P7N A;  3TOA A;  3KP5 A;  1R23 A;  5FLX Z;  4MHG A;  4EM1 A;  2A69 F;  2ZME A;  2DQR A;  4GGG A;  2VOD A;  1SMY F;  3K1M A;  2P5V A;  3JSP A;  2FEZ A;  4Q5S F;  3BZ6 A;  4O3M A;  3I59 B;  1MJ9 A;  2EA2 A;  3VOD A;  4AIK A;  2GAU A;  1B9M A;  2GA2 A;  3ABU A;  4AD9 A;  2F5E A;  2MBF A;  4IRH A;  1B59 A;  3F8N A;  5DCM A;  1H9G A;  3E6D A;  2P7C B;  3L00 A;  3TO6 A;  4UVC A;  2ZNY A;  1QNT A;  1YW7 A;  4ZZD A;  4RGU A;  2MH9 A;  4NB5 A;  1O7F A;  3FX3 A;  1XMK A;  2ZXJ A;  1J5Y A;  4O6J A;  4KFC A;  2RC4 A;  3FMR A;  4TV7 A;  4XLN F;  4OIP F;  4YG2 F;  5LGU A;  4YFK F;  2V6C A;  2VXZ A;  5HLI A;  4UXN A;  2E1N A;  2BBY A;  1LNW A;  2EB7 A;  2FMY A;  3TDZ C;  4EGZ A;  3U9G A;  3K1P A;  1SD6 A;  1P6R A;  4EMS A;  3ZMS A;  1TTY A;  1ZRE A;  1FWZ A;  5IT9 Z;  3EQL F;  3KP6 A;  5BQT A;  1PP7 U;  2V9V A;  4RB3 C;  3P9K A;  4YII A;  2HTJ A;  3BWG A;  1KU7 A;  5JVT A;  3DPT A;  3ROU A;  3FXU A;  1J75 A;  1W5T A;  3GWZ A;  3J7A O;  2NNN A;  2FU4 A;  2QQA A;  4CXF A;  4P55 A;  4BHC A;  5EEG A;  1F1Z A;  3HRS A;  1BIA A;  3JTG A;  3FZV A;  3HTU A;  3GFI A;  4B09 A;  2ESN A;  2DPU A;  1HBX G;  2P5K A;  3K0L A;  4G6Q A;  2IVM A;  2X0L A;  3F21 A;  4L9N A;  4M73 A;  3GX4 X;  2M45 A;  3IRR A;  4GCV A;  4KN7 X;  2QWW A;  2MD5 A;  5J8F A;  2V79 A;  4HV6 A;  1TNT A;  4K2E A;  1FSH A;  4ENJ A;  2L3D A;  3LA3 A;  4CZZ A;  1LDK B;  1TW2 A;  2L02 A;  2M30 A;  5BS6 A;  3EUH A;  2K86 A;  3G73 A;  1PUE E;  3QRF F;  4IPA A;  1MJB A;  2OZU A;  2Q2E A;  3HRM A;  3SFZ A;  4WXH A;  4AVP A;  4A6E A;  4Q47 A;  5FFZ A;  1VTN C;  2QQ9 A;  3N97 A;  1D3Y A;  4CDG A;  3HIF A;  4UUV A;  5DV5 A;  3WOD F;  4WX9 A;  3ECH A;  1J9I A;  3WTT C;  1XD7 A;  1U6G A;  2NAZ A;  4FX0 A;  3HRT A;  4G7Z F;  2IPQ X;  1YS6 A;  1O3T A;  2YU3 A;  4M9S A;  1ZRD A;  2D1V A;  3RPU A;  2XRN A;  2YX4 A;  3T0Y A;  4EV0 A;  1T6S A;  3M7G A;  1L0O C;  5DCM B;  3LQR A;  4EVI A;  2FBI A;  3F8C A;  2DT5 A;  2Y0M A;  2HYG D;  3M8E A;  5ILU A;  2TDX A;  2FML A;  3COA C;  2HGC A;  5D4S A;  4RB1 A;  2F5D A;  1ONV A;  2HZT A;  3KFW X;  3LWF A;  3QU3 A;  2IJL A;  3HHG A;  4HDV A;  1HXD A;  5LGT A;  2CO5 A;  1IRG A;  5DCF A;  4IHT A;  3C3W A;  4PGG A;  2J5O A;  5LEK A;  1RUO A;  3D0S A;  3QOP A;  1IW7 F;  1NHA A;  1BBY A;  5EEH A;  2DAO A;  2DK8 A;  3EYI A;  3BOQ A;  5E1Z B;  1J7K A;  4A0X A;  1TQP A;  2JPB A;  3P9I A;  1I27 A;  1YLF A;  4LGW A;  3E6B A;  1OMI A;  5AIQ A;  4FHT A;  4BYY A;  1ZRC A;  4ZYG A;  1H9T A;  2RQP A;  1Z7U A;  2FA5 A;  4P5O A;  2H94 A;  2E7X A;  1FYK A;  3L7W A;  3ABT A;  4WCG A;  1ZN2 A;  2FOK A;  2UZK A;  2EV0 A;  5CVU A;  1P2F A;  3JSO A;  5AON A;  2RNJ A;  4CGZ A;  2VE8 A;  4UNO A;  1S7A A;  2UXX A;  1B4A A;  1DPR A;  4N0B A;  4M9X A;  3HYI A;  1P92 A;  2H6C A;  2W24 A;  4G7O F;  1E2X A;  3QPT A;  5F1R A;  1MDM A;  4Y15 A;  1BI1 A;  5DUK A;  1O7L A;  1HW5 A;  2LDU A;  4L0Y B;  2LNB A;  3GEZ A;  3V7R A;  4XSZ F;  2STW A;  2IP2 A;  2F5C A;  5D4R A;  2EK5 A;  1JE8 A;  4HA8 A;  2A6E F;  4P96 A;  2JT1 A;  1DUX C;  1YYV A;  2FNA A;  1BI0 A;  4O5V A;  2P5L C;  2RGV A;  3CDH A;  4HX8 A;  3GF2 A;  3RKW A;  4ZZL A;  1YW8 A;  3O2P E;  4MTE A;  3WTZ A;  5DD8 A;  4KMU X;  1EV7 A;  2DBB A;  4M71 A;  3QAH A;  2RKH A;  1O3R A;  3KLO A;  3F6O A;  1J0R A;  2DI3 A;  2K4B A;  2XGX A;  1YO5 C;  4LD5 A;  4LMY A;  1YS7 A;  3I64 A;  2HR3 A;  4EQQ A;  1LQ1 A;  1YW9 A;  3RDI A;  3QPH A;  5K5O A;  2XKO A;  4HZF A;  1UCR A;  3VEP A;  4IHS A;  3H92 A;  1R58 A;  2EFN A;  3BP8 A;  4OU0 A;  1KQ8 A;  2A6H F;  4RAZ A;  4LLG F;  2EFP A;  4G8X A;  1KU2 A;  3GYH X;  1B9N A;  4A6D A;  3LQQ A;  5LGN A;  1U3E M;  4UVB A;  5TRD A;  2YSR A;  2NRA C;  4HF1 A;  3RKX A;  1FPQ A;  1ZG3 A;  4U88 A;  2HKX A;  1IAW A;  1XGO A;  3I53 A;  3C18 A;  1MJA A;  4YFX F;  3GFM A;  2KJB A;  1XDS A;  1JGS A;  2RV8 A;  4ZH4 F;  2GIV A;  3LFK A;  4EM2 A;  4I0B A;  3F6V A;  3ZQ7 A;  1OYW A;  5FB2 A;  2OA4 A;  3LA7 A;  2LF7 A;  2QVO A;  1WI9 A;  3GW2 A;  4I09 A;  3FM5 A;  3R60 A;  1ZYR F;  3WTW C;  4U0V A;  1KU3 A;  4IJA A;  3BDD A;  4I2O A;  1SD4 A;  2VBY A;  2ZCW A;  4AIH A;  5A2Q K;  5D6E A;  2Z3Y A;  3V8K A;  3GZ5 A;  4BHP A;  1U5T A;  3R4K A;  2CG4 A;  2GXG A;  4HYE A;  3FHZ A;  1LDD A;  5ERI A;  1QGP A;  2P6S A;  3FMQ A;  2EFW A;  1IN5 A;  4I01 A;  2W25 A;  5D5X B;  1YFH A;  1W7P A;  4OIO F;  3ULQ B;  2MC3 A;  3GLX A;  3KP2 A;  5BMZ A;  2KIU A;  1TLH B;  1T98 A;  2COM A;  4LB5 A;  3MFK A;  4FX4 A;  2X4H A;  3E3V A;  2VOP A;  4KDP A;  1K6O A;  4L0Z B;  2ZBK A;  4HOB A;  2CQK A;  4ENM A;  3TGN A;  2CGP A;  3KEO A;  1U8R A;  1WRJ A;  1CGP A;  1DP7 P;  3R0A A;  2VBW A;  2ZO4 A;  3T5X A;  5K5R A;  3WTX C;  2FQ3 A;  4ON0 A;  5DEQ A;  4R79 A;  1BIB A;  5CVJ A;  1XMA A;  2CWE A;  1USS A;  1T38 A;  1SFX A;  2E1C A;  2Y75 A;  1QO0 D;  2V1X A;  2VT3 A;  1IXC A;  5L3B A;  2FXA A;  2P4W A;  3SZP A;  2BYV E;  2PMU A;  2KIF A;  3QU6 A;  4NHJ A;  3OV8 A;  4JQF A;  1R7J A;  1XN7 A;  4ENK A;  4BQA A;  4MQ9 F;  5CJ9 A;  1Z6T A;  4HX7 A;  2P7V B;  2W84 A;  1ZGJ A;  1EH6 A;  2ADU A;  4BXU A;  4RB0 A;  4I7H A;  5ILS A;  3K2Z A;  5K5Q A;  1L3L A;  1IN8 A;  3Q9V A;  3R0J A;  2MLK A;  3I4P A;  3I58 A;  5LHG A;  2NYX A;  1I5Z A;  4Z2Y A;  3GUD A;  4A2U A;  4HW0 A;  4PDK A;  2Z33 A;  3REO A;  4KN4 X;  2KJC A;  3ZMT A;  1X3U A;  2EA4 A;  2YR2 A;  2XRO A;  2DFI A;  2OQR A;  3L09 A;  1IF1 A;  2D1H A;  5KK1 A;  3I5U A;  1G3W A;  2XAF A;  3WE2 A;  1XGN A;  3K9T A;  2PLY A;  1Y0U A;  1YIO A;  5HDG A;  3KZZ A;  2ZJ2 A;  1HKQ A;  1REP C;  3Q5F A;  5E17 F;  2WTE A;  2PBI A;  3KCC A;  3MZH A;  5HDK A;  3O6B B;  3MZY A;  3BRO A;  3KP7 A;  2Z99 A;  4M6X A;  1C0W A;  1D5V A;  1KQ9 A;  1R1V A;  2DO7 A;  4HF0 A;  3W6K B;  3GXO A;  2XAJ A;  2FF4 A;  2ZFW A;  1LEB A;  3IL2 A;  3CUQ B;  1KYZ A;  3SZT A;  1HSJ A;  2HQR A;  4I02 A;  1ULY A;  4A0Z A;  1S6L A;  4KYW A;  4PCQ A;  2DTR A;  4A0Y A;  5CVV A;  3F72 A;  4Q48 A;  1AOY A;  1FNN A;  3MCZ A;  4HAM A;  2FBH A;  3E5X A;  2O03 A;  2QLZ A;  1K78 B;  4MQV A;  4LLL A;  1XCB A;  2PG4 A;  2D2W A;  1OYY A;  4GYG A;  1RNL A;  2LSO A;  4M72 A;  5CVI A;  1Z1D A;  1W7P D;  3E97 A;  3RYP A;  5E1X A;  5JFR A;  5JI6 A;  2OD5 A;  1Z91 A;  3BJ6 A;  4KIC A;  2IW5 A;  4WXC A;  2V1U A;  1TQI A;  1MD0 A;  2XAQ A;  5F6F A;  3VB2 A;  5D5V B;  6PAX A;  1FP2 A;  3F8F A;  4ENN A;  3M1E A;  3KZY A;  5E20 A;  3F8M A;  1QQI A;  2DQL A;  4G9Y A;  3VFZ A;  2K27 A;  2ZNZ A;  1Z6R A;  2G9W A;  1S3J A;  5IT9 K;  1FLI A;  2BE5 F;  5LEJ A;  4KNY A;  3R6S A;  5ICG A;  2M8E A;  4OMY A;  4L9T A;  2EFQ A;  1IXS B; 
#chains in the Genus database with same CATH topology
 5J6X A;  4A3F J;  3VYR B;  3ISP A;  2K3F A;  5EZH A;  2E7W A;  3K10 A;  3H3V K;  1GDT A;  3W2A A;  1OKR A;  1W5S A;  1U9O A;  2ELK A;  4Y4R A;  1ZR2 A;  1ZKG A;  1Q1V A;  2RDP A;  1R4M B;  3I71 A;  2X85 A;  3ZR8 X;  1TBX A;  2DDB A;  4U0Y A;  2VQL A;  3CMM A;  2AQF A;  3J80 K;  2KKO A;  1OYI A;  3LAP A;  2NOG A;  5E8G A;  5LHH A;  5FD5 A;  3E5U A;  4WK8 F;  2O8X A;  2LG4 A;  3ZP5 A;  4XLH A;  3TQN A;  2HDC A;  1BI3 A;  1PYV A;  5DDG A;  2QQB A;  2GOX B;  2QCO A;  1FMV A;  3WU0 A;  3BR2 A;  5HDN A;  3EUH C;  2LTP A;  4FCY A;  5H20 A;  4CSW A;  3H3U A;  3JRC A;  5H6R A;  2ACJ A;  3G71 I;  2OAZ A;  2WAF A;  3QYF A;  1IZ1 A;  3CO7 C;  3B02 A;  1J59 A;  3SXY A;  3T1B A;  4QIW N;  3WTV C;  2MGQ A;  3GFL A;  2B0L A;  3SQN A;  2R0Q C;  5FLX K;  3AAF A;  1R36 A;  5ED4 A;  1MZB A;  3HSF A;  4CYD A;  5JLW A;  2X1E A;  3GZN B;  1IRF A;  5ICE A;  1WQ2 A;  5GAH J;  1XCV A;  1TZL A;  1MSE C;  4D0P A;  4MFE A;  1NTC A;  4LJZ F;  4LG3 A;  2K4J A;  5B1A H;  5FRO A;  1Y1W J;  3HJE A;  2WAQ N;  3BR0 A;  5LRR A;  4MTD A;  4A3B J;  4LG0 A;  1OR7 A;  1A04 A;  3KP3 A;  3BCA A;  3HSE A;  4BS9 A;  3L9F A;  1V5F A;  2G7U A;  1TW3 A;  4ZYD A;  1FBS A;  2JQ7 A;  3JAM K;  1ZAO A;  1AKH A;  4C2U A;  3DV8 A;  2DT7 B;  5HS7 A;  4YFN F;  4W97 A;  1IG7 A;  3OIO A;  3Q0V A;  3ZMV A;  5FFX A;  1UZC A;  1BM9 A;  1RES A;  1HDD C;  2QYO A;  4ESF A;  4KA4 A;  1MDM B;  2AO9 A;  4KUM A;  1TWH J;  2HWV A;  3CC2 I;  2ZKZ A;  1IDY A;  5J47 A;  5F0C A;  5CVR A;  2E60 A;  2XV4 S;  4NQW B;  2PFB A;  5IT3 A;  1N77 A;  3KX2 A;  1VQO I;  4YIF A;  1TT5 B;  1R5H A;  2CQN A;  2JA5 J;  1B8I B;  3HG9 A;  2GBY A;  2JA7 J;  4PJ0 C;  3RZD J;  3TKY A;  5IYB J;  2LLK A;  2OTL I;  3P9C A;  2DYS H;  4OMZ A;  3DLL F;  5K1Y A;  5BOX A;  1HA8 A;  1SEU A;  2ZJP F;  2R5Z A;  4BEH A;  1HKT A;  1R00 A;  1FIP A;  3GZ6 A;  3TBI A;  2Z1D A;  2CYY A;  3C1D A;  2PQ8 A;  5HVQ C;  5D8L B;  2R7T A;  3V7C A;  3OYM A;  1FYM A;  2PJR A;  1EA3 A;  4QWQ A;  1DQU A;  3HOS A;  5H6Q A;  2HYF A;  3MMY B;  3BJA A;  3H3Z A;  2L7F P;  3K69 A;  2BV6 A;  2L01 A;  3P5J A;  3SFI A;  2WV0 A;  1QZY A;  4BH9 A;  2BY3 A;  5E8I A;  1MND A;  3PO2 J;  4ZDO A;  2XF6 A;  4IX7 A;  1FOK A;  2M3A A;  3H5A A;  4Y52 J;  4ZTJ A;  3O8H A;  2IA1 A;  1Y8R B;  4M9Z A;  4D5C A;  3R61 A;  2BZT A;  3RI4 A;  1TL8 A;  4HQE A;  3DF8 A;  3PNV A;  1JGG A;  3S2W A;  1V4R A;  2LKP A;  3A0H C;  4RGS A;  2XGC A;  4ZC3 A;  3M9A A;  3FWE A;  4C30 A;  2PX9 A;  2IXS A;  3GCM A;  2ZSH B;  5KAI C;  1VZ0 A;  3PNT A;  1F36 A;  2IBD A;  5ILV A;  2R7W A;  2L54 A;  3ZCO A;  3IAM 2;  5GAE J;  4HV5 A;  2C6Y A;  1SAX A;  4RGR A;  4AIJ A;  1RUN A;  4OIN F;  4QPO A;  2EZK A;  2CW7 A;  1X2M A;  1WJC A;  4GFB A;  4IVN A;  1X4P A;  3QP6 A;  4B8X A;  1QPM A;  1TT0 A;  2HOE A;  1R1T A;  3RPQ A;  3KE2 A;  2Q8K A;  4P1W A;  2DK5 A;  3K2A A;  4XBF A;  1RRJ A;  2JVH A;  4G7H F;  2DDA A;  5D5W B;  3QPL A;  4KIF A;  3A4C A;  2K85 A;  5LHI A;  1DPU A;  4ANJ A;  1W36 C;  1VQK I;  2ME0 A;  3Q3S A;  5ICC A;  4CCO A;  2AXL A;  4PFP A;  3OYK A;  4ZYE A;  5BPD A;  4IRG A;  2VPL A;  2JSC A;  2O8K A;  5LD2 C;  1E17 A;  3CUQ C;  1FOX A;  2E5Z A;  4MNU A;  4CCN A;  1K79 A;  1QBJ A;  3JTH A;  1RKW A;  5C44 J;  2HEO A;  1K78 A;  1P7J A;  3S1Q J;  4XSX F;  4G6D A;  4ASN A;  1HW2 A;  1U2W A;  1IRZ A;  2ZJR F;  3K1N A;  1BJZ A;  3IRQ A;  4RM3 A;  2VN2 A;  1UHW A;  3F22 A;  5L3G A;  1R5G A;  3HBL A;  4B3X A;  1QPI A;  1U5T B;  1J2X A;  3BTI A;  4CCK A;  4H0E A;  1MMS A;  1CF7 B;  4F92 B;  1GHC A;  1T39 A;  1UJ8 A;  2MLG A;  3O3K A;  5GAD J;  2ELH A;  2L4A A;  2M87 A;  1F43 A;  2VJ5 A;  3ZMU A;  3MN2 A;  2EZH A;  2NS7 A;  3FXM A;  4LOC A;  5BNG A;  1HST A;  1YJ9 I;  2XPV A;  1K83 J;  4JK1 X;  5D6F A;  1W4M A;  4EJO A;  2R5Y B;  1VFC A;  1U78 A;  2VOO A;  1V5G A;  5B3S H;  1I1G A;  4UB8 C;  1FP1 D;  1Z21 A;  1B6A A;  2G0E A;  3IHU A;  3DXJ F;  1FJL A;  2CV2 A;  2W57 A;  2XAS A;  3BJO A;  2ZB9 A;  3KYD B;  1LVA A;  2KHM A;  4GRI A;  4XOT A;  3HKZ A;  4S04 A;  1H89 C;  1YI2 I;  4UVA A;  3BQZ A;  4F52 A;  5DUI A;  2MSY A;  3FM3 A;  4PZJ A;  5FRM A;  5L3C A;  2R7V A;  5F27 A;  4BE0 A;  1XSD A;  1ETQ A;  2A61 A;  5GTH C;  1ZG1 A;  1MBF A;  2RAE A;  1W0T A;  1GXP A;  2F5V A;  2XSD C;  4HLX A;  4HX4 A;  1XG1 A;  2JA2 A;  1XS9 A;  3BR6 A;  1TWA J;  4D5F A;  4OIQ F;  5A2Q Z;  3EDP A;  1VF9 A;  4BDZ A;  5FD6 A;  2HZD A;  3HUG B;  2DYR H;  1AU7 A;  3DKY A;  1RI7 A;  2OCC H;  4LFU A;  2CW0 F;  3JAM Z;  4E7J A;  3BR3 A;  4DOZ A;  1MGT A;  3HHH A;  3M07 A;  1A31 A;  2E2I J;  4U7D A;  2V9P A;  3H0D A;  3T8R A;  4E4H A;  1EH7 A;  1H0M A;  1ON1 A;  3NQO A;  2IS2 A;  1Q1H A;  3MAJ A;  2FD5 A;  5M5W J;  2ECC A;  1W7P B;  2LY2 A;  5IOZ A;  1VQ8 I;  2Y48 A;  2RN7 A;  4AID A;  2IS1 A;  3BTL A;  4F3Q A;  3QP5 A;  2XDV A;  1EF4 A;  2AQE A;  3HKZ N;  1KA8 A;  3WTY C;  1TQM A;  1LB2 A;  3TW6 A;  3U2R A;  3PFI A;  3MEX A;  2LOO A;  3FHN A;  3HOY J;  5F64 A;  1OIS A;  2X51 A;  2ZME B;  1A6Q A;  3QOE A;  1VQP I;  1X1A A;  5C4J J;  1LVK A;  2W7N A;  3E6M A;  3OL3 A;  3N4M A;  2OC6 A;  5LLQ A;  1DU0 A;  1NG7 A;  3D5R C;  5HLH A;  1SFE A;  4BQQ A;  4HNV A;  2K40 A;  4NQW A;  3MWM A;  1H8A C;  4PJJ A;  2O9L A;  5F08 A;  3ZRG A;  3I59 A;  1X1D A;  2H8R A;  1D0Y A;  3H35 A;  4L9J A;  3WU1 B;  1O3S A;  1ZLK A;  5HS9 A;  3NRV A;  3ECO A;  1NG6 A;  4ZYH A;  3KEQ A;  1BC8 C;  2LKS A;  1A36 A;  4AU7 A;  5DYM A;  3NAU A;  1OCC H;  3L2C A;  1PDN C;  2HVS A;  2P8T A;  2QZ8 A;  4BE1 A;  3CJN A;  4E70 A;  3OSF A;  4FE4 A;  3GO5 A;  3F23 A;  2ISZ A;  4RLF A;  2L9N A;  2PN6 A;  1IO2 A;  3SEZ A;  1UHM A;  4GXO A;  2QM3 A;  5DM7 F;  1GVJ A;  1HKS A;  4L5J A;  4II2 A;  3ZMD A;  4D9J A;  2XKP A;  4RM2 A;  2X6X A;  3DPL C;  3ZMZ A;  3J7A Y;  3HEF A;  3AG1 H;  1IXR C;  2V4J C;  1IN4 A;  1ZRF A;  2DLL A;  2PMZ A;  2O61 A;  2EFO A;  2ESH A;  4XR6 A;  2OZ6 A;  1FSE A;  1BL0 A;  5D8K B;  2NOJ B;  2DA3 A;  2BW3 A;  2HU9 A;  2NVY J;  4X6A J;  1LFP A;  2R7F A;  4BJ5 C;  2UWM A;  4LG0 B;  4U87 A;  2V6E A;  2XVC A;  3GTK J;  2MA3 A;  3BLY A;  3M3Y J;  1ZAR A;  2JZY A;  4L5I A;  4I0A A;  3W3C A;  3KP4 A;  5HOD A;  4OIR F;  4ESB A;  2R5Z B;  2ZME C;  3AL0 B;  2MH2 A;  3PFY A;  3ZXS A;  4CCJ A;  3AKZ A;  4QLC U;  4EJU A;  3FF5 A;  1JUS A;  2BVL A;  2IA0 A;  3J80 Z;  3S3N A;  4IHV A;  2P6T A;  2XRL A;  2UXN A;  2DPD A;  4A5N A;  4KIG A;  3TOB A;  3HPG A;  3N05 A;  3DU5 A;  1UFM A;  1SD5 A;  2CRG A;  3DEU A;  3ELK A;  2M9H A;  3NEU A;  4GO1 A;  2VKH A;  3M4O J;  4U0W A;  2RVC A;  2OTJ I;  4BUP A;  1JKR C;  1BA5 A;  1WHU A;  2CUZ A;  4XOR A;  2V26 A;  1TNS A;  3ZN1 A;  3JRA A;  3V4G A;  3L2U A;  1FX7 A;  1HCR A;  2GXB A;  3F0C A;  1M1E B;  1S7O A;  2V7F A;  3BY6 A;  2K5C A;  4DW6 A;  3IKT A;  1OPC A;  4ITV A;  3F3X A;  1K4T A;  3I0T A;  5FLM J;  3DTI A;  4IRI A;  4BEH B;  3FKJ A;  3ERE D;  1NK2 P;  2QBY B;  3G1O A;  3JW4 A;  2VC1 A;  2DW4 A;  1T95 A;  2R3S A;  1AHD P;  3G1M A;  2WWY A;  3EYY A;  4LK1 F;  3SJM A;  1XB4 A;  2HQ5 A;  3RTR A;  1ZGA A;  5FO5 A;  4B3A A;  1D5Y A;  4M6Y A;  2OU2 A;  2NXN B;  4JX6 A;  2K3P A;  1YHQ I;  3L2R A;  2TRT A;  1UG0 A;  5E1W A;  5B5E C;  2XHK A;  3AL0 C;  3DKX A;  4DNC A;  4E7K A;  3ZQF A;  5E3O A;  2Y9Y A;  5DD4 A;  2F5F A;  3C2B A;  3DFG A;  4IHY A;  2HI3 A;  5HOO A;  1G3S A;  4LIT A;  3BG7 A;  2KDZ A;  2FQ4 A;  3GFJ A;  2VT2 A;  2WV1 A;  4J01 A;  2A07 F;  1X58 A;  3LSH A;  1KGS A;  2M5W A;  3OYE A;  1MH3 A;  1CF7 A;  3L2W A;  2XSJ C;  2PI0 A;  4UB6 C;  5EGO B;  2FNP A;  4R8H A;  1UST A;  1FMW A;  1U0J A;  1YG2 A;  2CW8 A;  2CFX A;  2L7Z A;  2NS0 A;  4IHW A;  1R22 A;  5HS8 A;  4EJT A;  1AWC A;  2XUB A;  1PP8 F;  1D8J A;  1HQC A;  2X6W A;  4BHB A;  1F4K A;  1WGX A;  4RA2 A;  4XRF A;  2VON A;  1OLT A;  3ZN0 A;  4F93 B;  1FC3 A;  2WAQ A;  5F1J A;  3CO6 C;  3S14 J;  2A5Y B;  2HTS A;  2K7L A;  2LR8 A;  5E18 F;  2OBP A;  2XF5 A;  5ICF A;  4J19 A;  2H27 A;  2IA2 A;  1VQM I;  4A3K J;  2WAE A;  2E71 A;  1ODD A;  3HUG A;  2LF8 A;  1WKM A;  2A68 F;  4KJZ A;  2WB1 A;  3V8L A;  1ZHF A;  4DZJ A;  2E36 A;  3FIW A;  4OWR B;  1WSU A;  3BTC A;  3HOX J;  1O3Q A;  1VQ5 I;  4RB2 C;  4XK4 A;  2O6G E;  2LY1 A;  3FXR A;  1XGS A;  2DOE A;  1PUF A;  1IV6 A;  3HOV J;  3C2G A;  1E3H A;  3J81 K;  1W1W E;  3BPV A;  3HOZ J;  1K7A A;  1P7I A;  1MMN A;  1UG2 A;  2F4O B;  5L3E A;  2HFH A;  4F7Z A;  5FLV A;  4MFD A;  1DU6 A;  1SD7 A;  2O5R A;  2WA0 A;  1OCR H;  3PIP F;  3ML6 A;  2NNY A;  2BGC A;  1YX3 A;  4FT8 A;  5K7Z A;  1ON2 A;  2PJP A;  1I6X A;  2YPR A;  2M7A A;  3WGH A;  3LAJ A;  3M8J A;  1BOA A;  3V7S A;  3AFH A;  1R1U A;  1I1S A;  4PSX A;  3OIP A;  3DKW A;  1Z05 A;  3DQV C;  4IXA A;  3TMO A;  2BEO A;  2R5Y A;  2VBZ A;  4RLQ A;  2G7H A;  3SHF A;  4P9U A;  4HLY A;  4CHU A;  3S1N J;  2W48 A;  2M2E A;  5M3M J;  2KZG A;  1G3T A;  1QZZ A;  2H6B A;  3CUO A;  2JN6 A;  1RIO H;  4A3C J;  2PEX A;  2DN0 A;  3IH2 A;  2GWR A;  2Y0S N;  3RIR A;  3FXO A;  2ZXW H;  4M74 A;  3F8B A;  4EJW A;  2QA4 I;  1IV8 A;  3SZG A;  4XLP F;  4EJV A;  5TJJ A;  2FUG 2;  3QYE A;  3CP2 A;  3AG4 H;  4NNJ A;  1SVL A;  4EEF G;  2MG4 A;  2EV5 A;  3K4L A;  3KLN A;  5JLX A;  1A6I A;  2R7U A;  1S8N A;  3BZK A;  2GA1 A;  3WG9 A;  3DP7 A;  2HS5 A;  2WC2 A;  1A5J A;  2HVQ A;  5L3D A;  4L9V A;  4N9I A;  4LK0 F;  2Z2S B;  5LRS A;  2KIS A;  1IUY A;  3CUQ A;  1V3F A;  4HSR A;  3C7J A;  1WWX A;  5B66 C;  1D0X A;  1B72 A;  1XC5 A;  1IN6 A;  2L4M A;  3ZQG A;  4MGR A;  1QZE A;  2ZXI A;  4LB6 B;  2EV6 A;  2X48 A;  2STT A;  3VPR A;  4I6Z A;  1GLN A;  4CIC A;  3H5N A;  5EG0 A;  3CDL A;  3WTU C;  4ESJ A;  1RZ4 A;  1QHG A;  2R7O A;  4BKX A;  3IWZ A;  3Q0U A;  3CLQ A;  2EJR A;  2VKE A;  1SFO J;  1LKX A;  3WU2 C;  2HKO A;  1QHH D;  3E5Q A;  2ETH A;  2ISY A;  1X3Z B;  3LST A;  3L2V A;  3ZOB A;  4LLN A;  3RPU D;  3V8J A;  3MKW B;  2K9S A;  2DU9 A;  3VYU B;  1VI0 A;  2H09 A;  1WVR A;  4Y13 A;  3CCE I;  3I54 A;  2VBX A;  3HPH A;  4ETS A;  3CJR B;  1F9N A;  2OCE A;  4Q4Z F;  3JRI A;  2QSF X;  2YUS A;  1G3Y A;  4OOI A;  1ZQ3 P;  1VND A;  3RQ4 A;  3ZPL A;  2JRT A;  1T2K A;  2P0W A;  4IOA F;  1FOW A;  3BT9 A;  5BPI A;  4A3D J;  3IC7 A;  2EWN A;  5M5Y J;  4IHX A;  4XLA A;  1HW1 A;  2KFD A;  1G4D A;  3CCJ I;  4UV9 A;  4RS8 A;  2X9D A;  3LNQ A;  2QUF A;  3HGG A;  1YOV B;  4XLE A;  2JTV A;  4NC6 A;  1ZR4 A;  2R7D A;  3HSR A;  1UB9 A;  4KIS A;  2COB A;  2DCE A;  4PJN A;  4IZZ A;  2QBY A;  4L18 B;  4HG2 A;  4G6T B;  3WHC A;  1FT9 A;  3BZC A;  5D5U B;  2IRF G;  4UUS A;  4Y17 A;  2FBK A;  4F91 B;  2VKV A;  2EIN H;  3PQK A;  3EET A;  2PMH A;  1YIT I;  2RRE A;  1Y39 A;  4YEL A;  5CQG A;  2HPM A;  2AXT C;  2LBF A;  1O4X A;  2QEN A;  3OS1 A;  2LH9 A;  2F2E A;  3IWF A;  3LSP A;  2LD5 A;  2D45 A;  3CCQ I;  4WWC A;  1O57 A;  3T8T A;  2LRE A;  2XAG A;  4M3G A;  5E79 C;  1GXQ A;  3CTA A;  5DTD A;  2VE9 A;  1MMA A;  4AYB N;  5M3F J;  2QSG X;  2DA4 A;  3OYA A;  2R4G A;  4DBR A;  4MEY F;  5C3E J;  1XX5 A;  1ZLJ A;  2HQN A;  4N4O B;  1DDN A;  1JTY A;  5E3N A;  2X6O A;  1ZK8 A;  2BXY A;  4PK4 A;  2Z9O A;  4R1H A;  3WGG A;  5FGM A;  1S29 A;  3VOE A;  2M4K A;  1RET A;  5HLG A;  1WJ5 A;  3S2H J;  1MKM A;  3CLO A;  2KZV A;  1XDU A;  2H1L A;  1XSV A;  4GYI A;  4N9H A;  1Z9C A;  1FBU A;  2VXD A;  2M0C A;  4XKC A;  4A5M A;  4BBR J;  4P9F A;  5IP7 J;  2DFF A;  2VUM J;  2AS5 F;  3GVA A;  3OYI A;  1XGM A;  2LFB A;  1HC8 A;  4RMN A;  4IF4 A;  1GVD A;  5EJC A;  3E1S A;  1KYW A;  3G3Z A;  4KIB A;  2DOD A;  4KT5 C;  1HOM A;  4S0H B;  4BJ6 C;  1P4A A;  2FRH A;  5JHU A;  3B73 A;  2DA6 A;  3D5L A;  2K02 A;  1T0F A;  1LEA A;  1W0U A;  2XIG A;  4A3G J;  1G8X A;  1KU9 A;  1BC7 C;  4PGH A;  3J7Y J;  2MC4 A;  5LBQ A;  3DTK A;  3L1P A;  5EZG A;  5J1U A;  4WXD A;  3RYR A;  3OYL A;  2YX7 A;  2MAB A;  4ZJZ A;  3Q9S A;  4MIM A;  5IOY A;  1B1B A;  2XAH A;  2EIJ H;  4PFO A;  1P4X A;  3IUO A;  1FY7 A;  1IN7 A;  2BY0 A;  1IRX A;  5E3M A;  3KZI C;  1WH5 A;  1D0Z A;  1XSX A;  1MBG A;  4RGX A;  4UHT A;  4JBA A;  3W6J B;  4HQM A;  5K7F A;  1NK3 P;  3GTP J;  5J8C A;  4M3D A;  2E1O A;  3OYJ A;  3WE3 A;  2FE3 A;  3TP3 A;  4DYQ A;  4KMF A;  1APL C;  1DGW Y;  2KIM A;  3A1Y A;  2E34 A;  5H2F C;  2DMT A;  1LDJ A;  3K4J A;  1AKH B;  1J09 A;  3DLA A;  3MQ0 A;  3TDU C;  4EGY A;  5JR3 A;  4WF2 A;  3W6V A;  3TL4 X;  3FXQ A;  3OYH A;  1LFU P;  3EUA A;  1SFU A;  1ZG5 A;  2KRF A;  3RCO A;  1JXS A;  1ETY A;  2J5P A;  4F55 A;  3BG3 A;  2YU9 J;  5IPA A;  3LOC A;  4I98 B;  3VSK A;  4MEX F;  2IT0 A;  2Z5U A;  3CD6 I;  1YQA A;  2WAD A;  2A3S A;  2NVX J;  3KET A;  1G59 A;  2JRM A;  2L7K A;  1SAN A;  2VC0 A;  1BI2 A;  5M5X J;  2DTZ A;  4BXF A;  5FKL A;  2JWT A;  4HEA 2;  3BC8 A;  3OS0 A;  3OOP A;  3CME I;  2DMN A;  1OCT C;  1V54 H;  1STZ A;  4JX4 A;  4A12 A;  2CSO A;  2GQQ A;  3FMS A;  4CO8 A;  2YS9 A;  1BR1 A;  3OYF A;  3BG6 A;  2EQR A;  4D7N A;  3E6C C;  4E7H A;  1EH8 A;  1RR8 C;  2FSW A;  3ASO H;  3E7L A;  4NC7 A;  3S32 A;  4G94 A;  2JPC A;  2O3F A;  2M1B A;  2JSP A;  2Q0O A;  3IKV A;  3GTL J;  3LA2 A;  3O8G A;  2R92 J;  5J3L A;  1SC7 A;  4AVZ A;  3HC7 A;  3LMM A;  1TP4 A;  4JYK A;  4A3L J;  4BNC A;  3PQJ A;  4XQF A;  3M8F A;  3U1D A;  2DFH A;  3L2Q A;  3ABL H;  4HBL A;  3S1M J;  4NC8 A;  1IDZ A;  1P9Q C;  1JHH A;  3RJP A;  2V1D A;  1P4W A;  3OY9 A;  2LMD A;  1FBQ A;  1FYL A;  5HLT A;  2XAU A;  3S1R J;  4DQ2 A;  2HDW A;  4AWX B;  3BPX A;  5AIP A;  3ONQ A;  1MBK A;  2XPU A;  2M34 A;  3KYC B;  3TO9 A;  2QSH X;  1POG A;  1K4S A;  4HDU A;  1FZP B;  2DA5 A;  2ZXH A;  2GM4 A;  2EZL A;  2IGM A;  5GP9 A;  4RAY A;  3WGI A;  5EF6 A;  1KQ0 A;  4UV8 A;  2GZW A;  1U5T C;  3RKY A;  4XID A;  3JRB A;  2CUE A;  2X1C A;  4HF2 A;  1LJ9 A;  4XLC A;  3WTS C;  3HOT A;  4EM0 B;  1JHF A;  3J81 Z;  4IEJ A;  3TO7 A;  3OSG A;  4MO7 A;  3DEE A;  4BAY A;  1S5L C;  3K70 D;  3HRU A;  1D8K A;  1BJA A;  1MNM C;  3G6E I;  1F5T A;  4XN3 A;  1G6N A;  1SMT A;  4S05 A;  3HTS B;  4U7B A;  2O0Y A;  2OQG A;  1BN5 A;  1XMX A;  5KVR A;  1ZH5 A;  2NVQ J;  2W85 A;  5CLS A;  5B1B H;  5L3F A;  5CYV A;  3OYD A;  1YTY A;  3P7N A;  1XPX A;  3NWS A;  3TOA A;  3QQA A;  3CJQ B;  2R7Q A;  1TWF J;  3K4C A;  1R23 A;  3KP5 A;  2HNH A;  4KT6 A;  5FLX Z;  4MHG A;  1CQT A;  3K4M A;  4EM1 A;  2A69 F;  2ZME A;  1UEL B;  3NAR A;  2DQR A;  4GGG A;  2VOD A;  2R7S A;  1SMY F;  2EBI A;  4FE7 A;  3OL4 A;  3K1M A;  4I76 A;  1FTT A;  1MBE A;  2P5V A;  3JSP A;  2FEZ A;  4Q5S F;  1QVT A;  3BZ6 A;  4O3M A;  2M8G X;  3I59 B;  1Y56 A;  1Y0N A;  1MJ9 A;  2HOA A;  4XKV A;  2EA2 A;  3K6G A;  3PO3 J;  5F0H A;  1HDP A;  3OWT A;  3GME A;  3UNG C;  3VOD A;  5J1Y A;  3K4B A;  4YIR X;  2CUJ A;  4AIK A;  2GAU A;  2JUG A;  1ETV A;  1B9M A;  2GA2 A;  3ABU A;  4AD9 A;  2F5E A;  2VIX A;  4BAC A;  1A35 A;  2MBF A;  4IRH A;  1AA7 A;  1B59 A;  2I10 A;  3F8N A;  5DCM A;  1JTX A;  1H9G A;  1N75 A;  3E6D A;  2P7C B;  3L00 A;  3TO6 A;  4UVC A;  2CV0 A;  2ZNY A;  5HNF A;  1QNT A;  1YW7 A;  2LKX A;  1MNE A;  2HYJ A;  3H9J A;  4ZZD A;  4RGU A;  2MH9 A;  3EPZ A;  4NB5 A;  1HLV A;  1O7F A;  3LL7 A;  5EYR A;  2OJE D;  2WY7 Q;  3FX3 A;  4V2G A;  1XMK A;  3MKL A;  2ZXJ A;  1VQ7 I;  1I50 J;  5C4X J;  1D1A A;  3OMY A;  1J5Y A;  2CMP A;  4O6J A;  4KFC A;  1ITY A;  2K9L A;  2RC4 A;  2HVR A;  3FMR A;  4TV7 A;  3A01 B;  3HGY A;  4XLN F;  4E7L A;  4OIP F;  4YG2 F;  5IP9 J;  5LGU A;  2OPT A;  3SDG A;  2CH0 A;  4A69 C;  2BHY A;  4YFK F;  2V6C A;  3SDB A;  2VXZ A;  5HLI A;  4FQG A;  4UXN A;  1FEX A;  2LP0 A;  3FXK A;  4N4N B;  2E1N A;  2BBY A;  4KIT B;  1LNW A;  2EB7 A;  2FMY A;  3TDZ C;  4EGZ A;  4DYC A;  4A93 J;  3OIQ A;  3U9G A;  3K1P A;  1SD6 A;  1P6R A;  2QQ8 A;  4EMS A;  3H9G A;  3FK6 A;  4E7I A;  3ZMS A;  3CDI A;  1IJW C;  1TTY A;  1ZRE A;  1FWZ A;  1G2H A;  5IT9 Z;  1LUJ B;  3EQL F;  3KP6 A;  5DM6 F;  3QOD A;  5BQT A;  1PP7 U;  1GT0 C;  2RNG A;  2JK3 A;  2QKM B;  2V9V A;  1YRN A;  4IQJ A;  4RB3 C;  2QKL B;  5FKO A;  3P9K A;  2JA6 J;  1ZEL A;  2JA8 J;  4YII A;  2HTJ A;  3BWG A;  1KU7 A;  2Y2Z A;  2KP6 A;  3PJR A;  5JVT A;  2K9N A;  1Z3Y A;  3HDD A;  3GTQ J;  2F4M B;  4D7M A;  4E7S A;  3DPT A;  2XPW A;  3ROU A;  3FXU A;  1ETW A;  1J75 A;  1W5T A;  3S3O A;  1ACI A;  2A6T A;  3GWZ A;  2DJI A;  3J7A O;  2NNN A;  3FBN B;  2FU4 A;  2QQA A;  4CXF A;  4P55 A;  4BHC A;  4B43 A;  5EEG A;  1F1Z A;  1YJN I;  3CJT B;  4ZYA A;  3HRS A;  1BIA A;  4XN0 A;  3JTG A;  3FZV A;  1IC8 A;  3HTU A;  1R5I D;  1JJ6 C;  1T33 A;  2DA2 A;  1WH7 A;  2ICW G;  3GFI A;  4Y7N J;  4PJL A;  4B09 A;  1HF0 A;  4BBS J;  2ESN A;  4CCL A;  3QPS A;  2DPU A;  1HBX G;  2P5K A;  3B6A A;  3K0L A;  4G6Q A;  3I4N J;  2IVM A;  2X0L A;  3F21 A;  2BW3 B;  2L9V A;  1JKP C;  4L9N A;  3ZQQ A;  3F9K A;  4M73 A;  2E1M B;  1YE9 A;  1ZTR A;  3GX4 X;  1GV2 A;  2M45 A;  2ZSI B;  2BVM A;  3RSN A;  3IRR A;  1BOB A;  4GCV A;  4KN7 X;  3SEQ A;  3GLL A;  3FDY A;  4HNU A;  3CMY A;  2QWW A;  2DMP A;  2MD5 A;  1PJR A;  1WZ2 A;  5J8F A;  1QVU A;  3CC7 I;  3GBG A;  1Z3X A;  2CS3 A;  2V79 A;  4HV6 A;  1IUF A;  4HPQ A;  1TNT A;  4K2E A;  1FSH A;  1X3W B;  2I8D A;  3M1C A;  4ENJ A;  1FIA A;  2L3D A;  4DIQ A;  3LA3 A;  2N8G A;  4CZZ A;  1S72 I;  2WB1 N;  1JI8 A;  1LDK B;  1TW2 A;  1Y1V J;  3PIO F;  4XRS G;  2L02 A;  2M30 A;  3H5R A;  5BS6 A;  3EUH A;  1Y8Q B;  4XNF A;  2K86 A;  2ME6 A;  2X1D A;  3G73 A;  1QU3 A;  3B6C A;  1PUE E;  2WY8 Q;  3QRF F;  1W5C C;  4IPA A;  1MJB A;  1DP3 A;  2DFE A;  2OZU A;  3JRE A;  2FX0 A;  2Q2E A;  2LC2 A;  3W2V A;  3HRM A;  2R7X A;  3SFZ A;  4WXH A;  4AVP A;  5IYC J;  4A6E A;  4Q47 A;  5FFZ A;  1VTN C;  2QQ9 A;  4M3F A;  2BHZ A;  3J7Z I;  3N97 A;  1D3Y A;  4L5E A;  4CDG A;  1KZH A;  4X1E A;  1LE8 B;  1OCO H;  1RKT A;  3HIF A;  4CH7 A;  2XB0 X;  2H1K A;  4UUV A;  3K4N A;  3W2W A;  5DV5 A;  3WOD F;  3U1K A;  4QSH A;  4CCM A;  1JJ8 C;  4B47 A;  2LK2 A;  2M0M A;  1MH4 A;  3ECH A;  4WX9 A;  3OYN A;  4RAG A;  3OR1 C;  1J9I A;  3WTT C;  3OS2 A;  4BJT A;  1XD7 A;  1U6G A;  2NAZ A;  4FX0 A;  4BL0 B;  3H36 A;  2WBM A;  3HRT A;  4G7Z F;  2IPQ X;  2Y9Z A;  1YS6 A;  3E0J B;  4Y33 A;  4EAT A;  2B9S A;  2ELJ A;  3ESW B;  1O3T A;  1X1P A;  2YU3 A;  2L2O A;  1T0F C;  2PJR B;  4M9S A;  1ZRD A;  2D1V A;  3RPU A;  2VQG A;  4D1Q A;  2XRN A;  3MKY B;  2JMW A;  4UY8 I;  4CYC B;  4IO9 F;  2YX4 A;  3ZQL A;  3FK7 A;  1ZGW A;  3T0Y A;  4EV0 A;  1GUU A;  1T6S A;  3M7G A;  1L0O C;  5DCM B;  4A3I J;  3LQR A;  2NVU B;  4EVI A;  3RKQ A;  2FBI A;  3F8C A;  2DT5 A;  2VQC A;  2Y0M A;  2HYG D;  2XF7 A;  1BR2 A;  3M8E A;  3I3L A;  5ILU A;  2TDX A;  5J4V A;  2FML A;  4CZC A;  3COA C;  2AHQ A;  1RC9 A;  3TED A;  2HGC A;  4ZDL A;  5D4S A;  4RB1 A;  4B44 A;  1WPK A;  2F5D A;  1ONV A;  2HZT A;  2KRH A;  3KFW X;  3LWF A;  3QU3 A;  2IJL A;  3HHG A;  2ZFU A;  2VAS A;  1XTA A;  3JCU C;  4HDV A;  1HXD A;  5LGT A;  2CQQ A;  2CO5 A;  1IRG A;  2Q1Z B;  1OFC X;  5DCF A;  4IHT A;  3C3W A;  4PGG A;  2J5O A;  1Z77 A;  4BQN A;  1D1B A;  5LEK A;  1NH3 A;  1TC3 C;  1RUO A;  3D0S A;  1OQY A;  5E3L A;  2BY1 A;  3QOP A;  1IW7 F;  3BR5 A;  1NHA A;  3MZ8 A;  1BW5 A;  1BBY A;  5EEH A;  4C2M J;  1B8I A;  2DAO A;  3LSM A;  3A02 A;  1JKO C;  2OV7 A;  4JP0 A;  4XM3 A;  2DK8 A;  2VB6 A;  2E5N A;  1WI3 A;  2EIM H;  3EYI A;  2D5V A;  2DA7 A;  2F4I A;  3BOQ A;  4OAZ A;  1WCM J;  5E1Z B;  1ERD A;  1J7K A;  3CCU I;  4A0X A;  1TQP A;  2JPB A;  3OR2 C;  3P9I A;  1I27 A;  1YLF A;  4LGW A;  9ANT A;  3E6B A;  1OMI A;  3IH4 A;  4NDL A;  5AIQ A;  2W1O A;  1UAA A;  4FHT A;  4BYY A;  3KEY A;  4I99 C;  4CUG A;  1RR7 A;  4ZYG A;  1H9T A;  1ZRC A;  1MBJ A;  2RQP A;  1Z7U A;  3ZQH A;  2I5U A;  1H88 C;  3TP0 A;  2FA5 A;  3VWB A;  4P5O A;  2HOT A;  3VSL A;  2H94 A;  3MD2 A;  4QPQ A;  3IV5 A;  1YRN B;  1MSF C;  1FOY A;  2E7X A;  1FYK A;  3L7W A;  3ABT A;  4WCG A;  1ZN2 A;  2FOK A;  5KAF C;  2EV0 A;  2UZK A;  5CVU A;  3A01 A;  3CCL I;  2KT0 A;  4V2F A;  1P2F A;  2F6C A;  3JSO A;  1V55 H;  5CPR B;  5AON A;  2RNJ A;  4CGZ A;  2KRC A;  2VE8 A;  3K70 C;  2VPR A;  3JRF A;  3GTO J;  4UNO A;  2MW8 A;  4XL9 A;  1S7A A;  2UXX A;  5F0F A;  3UKG A;  1B4A A;  1DPR A;  5EG0 B;  3KYL A;  2R7R A;  3EUK L;  4N0B A;  2DXI A;  4M9X A;  3HYI A;  5EEA A;  1P92 A;  2H6C A;  3IP4 B;  2W24 A;  4XLF A;  2ID3 A;  1ORK A;  4G7O F;  2L0K A;  1E2X A;  4W1U A;  3LSG A;  2ZJQ F;  3PUF A;  3QPT A;  3PSF A;  5F1R A;  1MDM A;  2E35 A;  4G12 A;  1OJL A;  4Y15 A;  2Y0S A;  3LSJ A;  1BI1 A;  5DUK A;  3K4K A;  1O7L A;  1HW5 A;  2LDU A;  3S8P A;  4L0Y B;  2LNB A;  3GEZ A;  3V7R A;  4XSZ F;  2STW A;  2IP2 A;  2F5C A;  5D4R A;  2EK5 A;  1WJA A;  1JE8 A;  4HA8 A;  2A6E F;  4P96 A;  2KMU A;  2JT1 A;  1DUX C;  4FAS D;  1WJE A;  1YYV A;  1E3O C;  2JVG A;  2FNA A;  5JHF A;  3BTJ A;  1QRY A;  1BI0 A;  4O5V A;  2P5L C;  2RGV A;  3CDH A;  5TIS C;  1U9N A;  3WG7 H;  4IKF A;  4HX8 A;  5GPA A;  3GF2 A;  3RKW A;  3S3M A;  4ZZL A;  5F04 A;  1YW8 A;  3O2P E;  2DJN A;  1LPQ A;  3CC4 I;  4MTE A;  3WTZ A;  2IGK A;  2LBF B;  5DD8 A;  4KMU X;  1EV7 A;  3PNY A;  2DBB A;  1ETK A;  4M71 A;  1R49 A;  3DPU A;  3QAH A;  2RKH A;  4DBQ A;  3HOU J;  4GDF A;  2KL4 A;  3S15 J;  1VQN I;  3RQI A;  2X6Y A;  4XKB A;  4XRS A;  5K7H A;  1O3R A;  3KLO A;  5JVG F;  1OCP A;  3F6O A;  1R6R A;  1J0R A;  2DI3 A;  2K4B A;  2XGX A;  2HXI A;  4HNT A;  1YO5 C;  2Q2E B;  4LD5 A;  4LMY A;  1YS7 A;  2B7E A;  3I64 A;  2HR3 A;  4EQQ A;  2Y30 A;  3CCV I;  2DMQ A;  4HRI A;  1LQ1 A;  1YW9 A;  1OCZ H;  1V5E A;  5HNH A;  3RDI A;  3QPH A;  2IGO A;  4QTR A;  5K5O A;  1R4N B;  2E1M C;  2XKO A;  5CKT A;  4HZF A;  4XKW A;  1UCR A;  2KLO A;  3VEP A;  1LE8 A;  4IHS A;  3H92 A;  2DOF A;  1R58 A;  2EFN A;  4E7Z A;  2EZI A;  3BP8 A;  3ZGK A;  3DBL B;  3K7A J;  4OU0 A;  1KQ8 A;  2HXO A;  2A6H F;  4RAZ A;  3ASN H;  4LLG F;  3JRH A;  2EFP A;  3S2D J;  4G8X A;  1KU2 A;  3SYT A;  3GYH X;  2MYS A;  1B9N A;  4A6D A;  3LQQ A;  4BY1 J;  5LGN A;  1U3E M;  5IYD J;  4UVB A;  3CCM I;  2OUM A;  5TRD A;  1Z67 A;  2YSR A;  2NRA C;  4HF1 A;  3HB9 A;  3KIO A;  2HPI A;  1MBH A;  4FET A;  3RKX A;  1S7E A;  1FPQ A;  1ZG3 A;  4U88 A;  2CFO A;  2HKX A;  3WHB A;  1IAW A;  5TGT A;  4ZDP A;  1XGO A;  3I53 A;  2QEX I;  1TWC J;  1X1C A;  5CQE A;  3C18 A;  1D1C A;  1Y6I A;  2L7M P;  3GTJ J;  1SVM A;  1JT0 A;  3G1L A;  1MJA A;  4YFX F;  3GFM A;  1YX5 A;  2KJB A;  1WJB A;  1XDS A;  3BQY A;  1JGS A;  2W82 A;  1K61 A;  2RV8 A;  5FKN A;  4ZH4 F;  3NWT A;  2GIV A;  3JRG A;  1MMD A;  2Y31 A;  3LFK A;  1T8I A;  4XOP A;  2H8W A;  4PUS A;  3CCY A;  4I0B A;  4EM2 A;  3F6V A;  3BR1 A;  2UV1 A;  2W4S A;  3ZQ7 A;  1OYW A;  1BR4 A;  3X2Q H;  5FB2 A;  2V9K A;  2OA4 A;  1VQ4 I;  3VYS B;  3LA7 A;  2LF7 A;  2QVO A;  3H9Q A;  1WI9 A;  3GW2 A;  1N25 A;  4I09 A;  2A5W A;  2QF7 A;  2VJI A;  3FM5 A;  4BQO A;  3DEW A;  3R60 A;  1ZYR F;  3CQZ J;  3WTW C;  2XC7 A;  4JX5 A;  4U0V A;  2ZC2 A;  1IGN A;  2HOS A;  2W00 A;  4CYC A;  3S17 J;  4RBO A;  1RPW A;  1KU3 A;  4IJA A;  3FBI B;  3MKZ A;  3BDD A;  4I2O A;  1SD4 A;  3HM5 A;  2VBY A;  2ZCW A;  4AIH A;  5A2Q K;  5D6E A;  1WFX A;  2Z3Y A;  1VQL I;  3V8K A;  4A3J J;  3GZ5 A;  4BHP A;  3UR3 C;  2BOL A;  1U5T A;  1YIJ I;  3R4K A;  2CG4 A;  2GXG A;  4HYE A;  5IP6 A;  2R7Z J;  3FHZ A;  1ETO A;  1LDD A;  1JUM A;  2E2H J;  5ERI A;  1QGP A;  1SAU A;  2P6S A;  3FMQ A;  3ZQI A;  4IL6 C;  2IS6 A;  3A2K A;  3JR9 A;  2EFW A;  2B63 J;  1IN5 A;  2IGN A;  1R9T J;  1W36 D;  4I01 A;  3AG3 H;  3ZQC A;  3CCS I;  2W25 A;  5D5X B;  1YFH A;  1YJW I;  1W7P A;  2FOW A;  4OIO F;  3ULQ B;  1TWG J;  2MC3 A;  3LSI A;  3GLX A;  1X19 A;  3KP2 A;  2PMZ N;  4IQ4 A;  3ERM A;  5J40 A;  5BMZ A;  2K9M A;  3HOW J;  2XGE A;  1LFB A;  4DYR A;  4Z6Y A;  2KIU A;  2LYC A;  2EPF A;  1TLH B;  4DJA A;  2VJJ A;  1T98 A;  2COM A;  4PJM A;  1I3Q J;  4LB5 A;  2E2J J;  3MFK A;  2CU7 A;  3A03 A;  4FX4 A;  2X4H A;  3E3V A;  2VOP A;  4KDP A;  1K6O A;  4L0Z B;  2EIK H;  3QYB A;  2NVT J;  3FIS A;  2ZBK A;  2CQX A;  4HOB A;  2CQK A;  3DU6 A;  4ENM A;  3TGN A;  1K6Y A;  1SFK A;  1T08 B;  2CGP A;  4A3E J;  3KEO A;  5KHD A;  3D1N I;  1U8R A;  1WRJ A;  2VKD A;  1X4O A;  3FXJ A;  1CGP A;  1DP7 P;  2LRD A;  5GPC A;  2EH3 A;  3R0A A;  4OAY A;  3CF2 A;  2VBW A;  3PM1 A;  2ZO4 A;  4JOM A;  1MMG A;  3T5X A;  5J1R A;  5KNL A;  5FKM A;  1SVO A;  5K5R A;  3WTX C;  2FQ3 A;  4ON0 A;  1EJ9 A;  5DEQ A;  3IH3 A;  4C3J J;  4R79 A;  1BIB A;  5CVJ A;  1XMA A;  3BG9 A;  3S93 A;  4E6K G;  4XMY A;  2CWE A;  2ECB A;  2OF7 A;  1USS A;  1T38 A;  1ENH A;  4M3B A;  1R71 A;  4B48 A;  1SFX A;  2E1C A;  2ID6 A;  2Y75 A;  3D5S C;  1QO0 D;  2KQR A;  2V1X A;  2VT3 A;  4YEJ A;  3I56 I;  2RQQ A;  1IXC A;  5L3B A;  2FXA A;  2VI6 A;  2P4W A;  5FKK A;  3SZP A;  1E0E A;  5EGO A;  4X0G A;  2BYV E;  2PMU A;  2KIF A;  3QU6 A;  3PL8 A;  4DGW B;  2L5Q A;  2VLA A;  4NHJ A;  3G4S I;  2TCT A;  3OV8 A;  2E19 A;  4JQF A;  1R7J A;  4LIV A;  1XN7 A;  4M3E A;  4ENK A;  4BQA A;  4MQ9 F;  4M6V A;  4C2T A;  5CJ9 A;  2DT6 A;  3PUB A;  1Z6T A;  2KDO A;  4HX7 A;  2P7V B;  4NUB A;  3DTE A;  1BW6 A;  2W84 A;  1ZGJ A;  3CP8 A;  1EH6 A;  2QGU A;  2CUF A;  1X1B A;  2ADU A;  2VJ4 A;  5EDN A;  3OYC A;  4BXU A;  3PSI A;  4RB0 A;  4I7H A;  5ILS A;  1QA6 A;  3K2Z A;  4MLO A;  4B4C A;  2IAI A;  3HZJ A;  2DA1 A;  2CV1 A;  5K5Q A;  1X2N A;  3IAS 2;  3G2B A;  1L3L A;  1IN8 A;  2LY9 A;  1ETX A;  1S9H A;  3Q9V A;  5DS9 A;  3R0J A;  1EKE A;  4C9Y A;  3HXL A;  2MLK A;  5FJ8 J;  3I4P A;  4BXX J;  3I58 A;  4H4K C;  5LHG A;  2NYX A;  1I5Z A;  4A3M J;  4Z2Y A;  3GUD A;  4BE2 A;  2JJ7 A;  4NBQ A;  3RZO J;  4A2U A;  4HW0 A;  5J4Y A;  1VQ9 I;  4PDK A;  2Z33 A;  4B1R A;  1JT6 A;  3REO A;  4J00 A;  3QWL A;  3ABM H;  3H0G J;  3Q0W A;  2EIL H;  3KPH A;  2HDD A;  4KN4 X;  2KJC A;  3ZMT A;  4ABZ A;  1X3U A;  2EA4 A;  2IEK A;  2YR2 A;  2XRO A;  2DFI A;  3CMA I;  4RDU A;  3LSK A;  2OQR A;  3L09 A;  4V19 K;  1IF1 A;  2D1H A;  2HQA A;  5KK1 A;  4AM3 A;  1WJF A;  4ZTF A;  3I5U A;  1MIJ A;  2BXZ A;  4XRM A;  1PVE A;  4C3H J;  1G3W A;  2A05 A;  2XAF A;  3OYG A;  3WE2 A;  5GAG J;  2GOM A;  2MFZ A;  1GV5 A;  4BY7 J;  3TW7 A;  1XGN A;  3K9T A;  2PLY A;  1Y0U A;  1YIO A;  3I4M J;  3DCF A;  2VL8 A;  4II3 A;  1JUP A;  3GTG J;  1T56 A;  1DGR M;  5HDG A;  3KZZ A;  3LSR A;  3JRD A;  2ZJ2 A;  1HKQ A;  1REP C;  3Q5F A;  5E17 F;  2WTE A;  2PBI A;  3KCC A;  3MZH A;  3DBH B;  2DOA A;  1Z7L A;  5HDK A;  2LVS A;  3CZ6 A;  3O6B B;  2FJ1 A;  5FRN A;  3MZY A;  3BRO A;  3KP7 A;  3S16 J;  2M7B A;  2Z99 A;  4M6X A;  1C0W A;  2K9Q A;  3I55 I;  2Z16 A;  1D5V A;  1JKQ C;  1KQ9 A;  1R1V A;  2DO7 A;  4HF0 A;  3W6K B;  3GXO A;  3V42 A;  2XAJ A;  2FF4 A;  2ZFW A;  2V1N A;  2JUC A;  1LEB A;  1UMQ A;  1I39 A;  4LIU A;  3IL2 A;  3CUQ B;  1KYZ A;  3SZT A;  2F48 A;  1HSJ A;  2CJJ A;  1B72 B;  2HQR A;  4I02 A;  1ULY A;  4A0Z A;  1S6L A;  4KYW A;  2XB5 A;  1WJD A;  4BGD A;  3I9V 2;  4PCQ A;  4Y3O A;  2DTR A;  1KON A;  2UUZ A;  4A0Y A;  2R93 J;  5CVV A;  2KIQ A;  4AUX A;  1OR7 C;  3F72 A;  4Q48 A;  4IOC F;  1AOY A;  1FNN A;  3MCZ A;  4HAM A;  1FTZ A;  1PUF B;  2FBH A;  3OOU A;  4UUT A;  3E5X A;  3VDX A;  2O03 A;  2QLZ A;  2GLO A;  1K78 B;  4MQV A;  3GTM J;  2IS4 A;  3AG2 H;  2VQH A;  4LLL A;  5KCM A;  1XCB A;  3CES A;  3HL2 A;  4AC0 A;  2PG4 A;  2D2W A;  1OYY A;  4GYG A;  4YRV A;  1VQ6 I;  1Z0X A;  1RNL A;  2LSO A;  4M72 A;  5CVI A;  4AYB A;  1Z1D A;  2O7O A;  2M4G A;  4DZP A;  3H1C A;  1W7P D;  3E97 A;  5GTI C;  3RYP A;  1I6H J;  5E1X A;  1N78 A;  2BY2 A;  3FXL A;  1U8B A;  3DWL E;  5JFR A;  2NS8 A;  2L9S A;  2GIZ A;  1I3A A;  4BDY A;  5JI6 A;  3FKI J;  2OD5 A;  1Z91 A;  2Y69 H;  3BJ6 A;  4KIC A;  4FTH A;  2IW5 A;  4BU2 A;  4WXC A;  3A0B C;  4UUS B;  4FIS A;  1TQI A;  2V1U A;  5LFA A;  4XON A;  2L9R A;  1MD0 A;  2XAQ A;  3C2H A;  4PSW A;  3BCB A;  5F6F A;  3VB2 A;  5D5V B;  4HST A;  6PAX A;  4RAF A;  1FP2 A;  3F8F A;  4ENN A;  3M1E A;  3KZY A;  5E20 A;  4C3I J;  3F8M A;  1QQI A;  2DQL A;  4G9Y A;  1UHS A;  2CQ7 A;  2K27 A;  2ZNZ A;  3VFZ A;  1Z6R A;  2KPM A;  2G9W A;  1S3J A;  4CA0 A;  5IT9 K;  1FLI A;  3DBR B;  2GXA A;  5IY5 H;  2BE5 F;  1E3P A;  3ABK H;  5LEJ A;  2P81 A;  3CF5 F;  4KNY A;  3MVP A;  3LFU A;  3OYB A;  1MW7 A;  3R6S A;  5ICG A;  3BG5 A;  2M8E A;  3U21 A;  4OMY A;  3CCR I;  2DMU A;  2XGD A;  3VYT B;  2MD0 A;  4L9T A;  2EFQ A;  1IXS B;  4XIC A; 
#chains in the Genus database with same CATH homology
 5J6X A;  3ISP A;  2E7W A;  1OKR A;  1W5S A;  2RDP A;  3I71 A;  1TBX A;  4U0Y A;  3J80 K;  2KKO A;  1OYI A;  3LAP A;  5E8G A;  5LHH A;  5FD5 A;  3E5U A;  4WK8 F;  2O8X A;  3ZP5 A;  2HDC A;  3TQN A;  1BI3 A;  5DDG A;  2QQB A;  5HDN A;  3WU0 A;  5H20 A;  3H3U A;  5H6R A;  2ACJ A;  2OAZ A;  1IZ1 A;  3CO7 C;  3B02 A;  1J59 A;  3SXY A;  3T1B A;  3WTV C;  5FLX K;  3GFL A;  2B0L A;  3SQN A;  3AAF A;  1R36 A;  5ED4 A;  1MZB A;  3HSF A;  4CYD A;  1IRF A;  5ICE A;  1WQ2 A;  1XCV A;  4D0P A;  4LJZ F;  2K4J A;  5LRR A;  4MTD A;  4LG0 A;  1OR7 A;  1A04 A;  3KP3 A;  3HSE A;  3L9F A;  2G7U A;  1TW3 A;  4ZYD A;  1FBS A;  3JAM K;  1ZAO A;  3DV8 A;  5HS7 A;  4YFN F;  3ZMV A;  5FFX A;  1BM9 A;  2QYO A;  4ESF A;  4KA4 A;  1MDM B;  4KUM A;  2HWV A;  2ZKZ A;  5CVR A;  2XV4 S;  2PFB A;  5IT3 A;  4YIF A;  1R5H A;  3TKY A;  3P9C A;  4OMZ A;  5K1Y A;  5BOX A;  1HKT A;  1R00 A;  3GZ6 A;  2CYY A;  3C1D A;  2PQ8 A;  5HVQ C;  5D8L B;  3V7C A;  1FYM A;  4QWQ A;  3HOS A;  5H6Q A;  2HYF A;  3BJA A;  3H3Z A;  3K69 A;  2BV6 A;  2L01 A;  2WV0 A;  1QZY A;  4BH9 A;  5E8I A;  1FOK A;  1H0M A;  2IA1 A;  4M9Z A;  3R61 A;  3RI4 A;  4HQE A;  3DF8 A;  3S2W A;  1V4R A;  2LKP A;  4RGS A;  3M9A A;  3FWE A;  5ILV A;  2L54 A;  4HV5 A;  2C6Y A;  1SAX A;  4RGR A;  4AIJ A;  1RUN A;  4OIN F;  4IVN A;  3QP6 A;  4B8X A;  1QPM A;  2HOE A;  1R1T A;  3RPQ A;  3KE2 A;  2Q8K A;  2DK5 A;  4XBF A;  4G7H F;  5D5W B;  4KIF A;  5LHI A;  1DPU A;  5ICC A;  2AXL A;  4ZYE A;  5BPD A;  4IRG A;  2JSC A;  1E17 A;  3CUQ C;  4MNU A;  1K79 A;  1QBJ A;  3JTH A;  2HEO A;  1K78 A;  4XSX F;  4G6D A;  4ASN A;  1HW2 A;  1U2W A;  3K1N A;  3IRQ A;  2VN2 A;  1UHW A;  3F22 A;  5L3G A;  1R5G A;  1U5T B;  1J2X A;  4H0E A;  1CF7 B;  1GHC A;  1T39 A;  2MLG A;  3O3K A;  2ELH A;  2L4A A;  2M87 A;  3ZMU A;  1HST A;  4EJO A;  1U78 A;  4JK1 X;  5D6F A;  1W4M A;  2VOO A;  1I1G A;  1FP1 D;  3IHU A;  1B6A A;  3DXJ F;  2W57 A;  2XAS A;  3BJO A;  1LVA A;  4S04 A;  4UVA A;  5DUI A;  3FM3 A;  4PZJ A;  5L3C A;  1XSD A;  2A61 A;  1ZG1 A;  1GXP A;  4HLX A;  4HX4 A;  4OIQ F;  5A2Q Z;  3EDP A;  5FD6 A;  1RI7 A;  4LFU A;  3JAM Z;  2CW0 F;  1MGT A;  3HHH A;  4U7D A;  3T8R A;  1EH7 A;  1ON1 A;  3NQO A;  1Q1H A;  3MAJ A;  1W7P B;  2Y48 A;  2RN7 A;  3QP5 A;  1KA8 A;  3WTY C;  1TQM A;  1LB2 A;  3U2R A;  3PFI A;  3MEX A;  5F64 A;  2ZME B;  3E6M A;  3N4M A;  5LLQ A;  5HLH A;  1SFE A;  4NQW A;  3MWM A;  3I59 A;  4L9J A;  3WU1 B;  1O3S A;  1ZLK A;  5HS9 A;  3NRV A;  3ECO A;  4ZYH A;  3KEQ A;  1BC8 C;  5DYM A;  3L2C A;  1PDN C;  2P8T A;  2QZ8 A;  3CJN A;  4E70 A;  3GO5 A;  3F23 A;  2ISZ A;  2PN6 A;  1UHM A;  4GXO A;  2QM3 A;  1GVJ A;  1HKS A;  4L5J A;  3ZMD A;  2XKP A;  3DPL C;  3ZMZ A;  1IXR C;  1IN4 A;  1ZRF A;  2DLL A;  2O61 A;  2EFO A;  2ESH A;  2OZ6 A;  1FSE A;  5D8K B;  2R7F A;  2UWM A;  4LG0 B;  2XVC A;  2MA3 A;  1ZAR A;  2JZY A;  4L5I A;  4I0A A;  3KP4 A;  4OIR F;  4ESB A;  2MH2 A;  4QLC U;  4EJU A;  3FF5 A;  2IA0 A;  3J80 Z;  2P6T A;  2UXN A;  2DPD A;  4A5N A;  4KIG A;  3TOB A;  1UFM A;  1SD5 A;  3DEU A;  3ELK A;  3NEU A;  4GO1 A;  4U0W A;  2RVC A;  3ZN1 A;  1TNS A;  3V4G A;  2GXB A;  1FX7 A;  1S7O A;  3BY6 A;  3IKT A;  1OPC A;  3F3X A;  3I0T A;  4IRI A;  3ERE D;  2QBY B;  3JW4 A;  2VC1 A;  2DW4 A;  2R3S A;  2WWY A;  3EYY A;  4LK1 F;  1XB4 A;  3RTR A;  1ZGA A;  5FO5 A;  4M6Y A;  2OU2 A;  5E1W A;  2XHK A;  4DNC A;  5DD4 A;  2F5F A;  3DFG A;  5HOO A;  1G3S A;  3GFJ A;  2VT2 A;  2A07 F;  1KGS A;  2M5W A;  1CF7 A;  2PI0 A;  2FNP A;  4R8H A;  1UST A;  1YG2 A;  2NS0 A;  2CFX A;  1R22 A;  5HS8 A;  4EJT A;  1AWC A;  2XUB A;  1PP8 F;  1D8J A;  1HQC A;  4BHB A;  1F4K A;  4XRF A;  2VON A;  3ZN0 A;  1FC3 A;  3CO6 C;  2A5Y B;  2HTS A;  2K7L A;  5E18 F;  2OBP A;  5ICF A;  2H27 A;  2IA2 A;  1ODD A;  3HUG A;  2LF8 A;  1WKM A;  2A68 F;  3V8L A;  1ZHF A;  1WSU A;  1O3Q A;  4RB2 C;  2O6G E;  3FXR A;  1XGS A;  3J81 K;  3BPV A;  1K7A A;  5L3E A;  2HFH A;  4F7Z A;  1SD7 A;  3ML6 A;  2NNY A;  2BGC A;  4FT8 A;  1ON2 A;  2PJP A;  1I6X A;  2YPR A;  3WGH A;  3LAJ A;  1BOA A;  3V7S A;  1R1U A;  1I1S A;  3DKW A;  1Z05 A;  3DQV C;  4IXA A;  2BEO A;  2VBZ A;  2G7H A;  3SHF A;  4P9U A;  4HLY A;  4CHU A;  1G3T A;  1QZZ A;  2H6B A;  3CUO A;  1RIO H;  2PEX A;  2GWR A;  3RIR A;  4M74 A;  3F8B A;  4EJW A;  4XLP F;  4EJV A;  5TJJ A;  2EV5 A;  3KLN A;  1S8N A;  2GA1 A;  3WG9 A;  3DP7 A;  2HS5 A;  2WC2 A;  5L3D A;  4L9V A;  4N9I A;  4LK0 F;  5LRS A;  1IUY A;  3CUQ A;  1V3F A;  3C7J A;  1WWX A;  1IN6 A;  2L4M A;  4MGR A;  4LB6 B;  2EV6 A;  2STT A;  4CIC A;  3WTU C;  4ESJ A;  1RZ4 A;  3IWZ A;  2EJR A;  2HKO A;  3E5Q A;  2ETH A;  2ISY A;  3LST A;  4LLN A;  3V8J A;  2DU9 A;  2H09 A;  4Y13 A;  3I54 A;  2VBX A;  4ETS A;  1F9N A;  4Q4Z F;  4OOI A;  1G3Y A;  3ZPL A;  2JRT A;  1T2K A;  5BPI A;  3IC7 A;  2EWN A;  1HW1 A;  1G4D A;  4UV9 A;  4RS8 A;  2QUF A;  2JTV A;  2R7D A;  3HSR A;  1UB9 A;  2QBY A;  4L18 B;  1FT9 A;  5D5U B;  2IRF G;  4Y17 A;  2FBK A;  3PQK A;  3EET A;  2PMH A;  2QEN A;  2F2E A;  3IWF A;  2D45 A;  4WWC A;  1O57 A;  3T8T A;  2XAG A;  1GXQ A;  3CTA A;  2VE9 A;  4MEY F;  1ZLJ A;  2HQN A;  1DDN A;  2Z9O A;  4R1H A;  3WGG A;  5FGM A;  1S29 A;  3VOE A;  5HLG A;  1MKM A;  3CLO A;  1XDU A;  1XSV A;  4GYI A;  4N9H A;  1Z9C A;  1FBU A;  4A5M A;  4P9F A;  2AS5 F;  3GVA A;  1XGM A;  4IF4 A;  1KYW A;  3G3Z A;  4KIB A;  4KT5 C;  1P4A A;  2FRH A;  5JHU A;  3B73 A;  3D5L A;  2K02 A;  1T0F A;  1LEA A;  2XIG A;  1KU9 A;  1BC7 C;  4PGH A;  5LBQ A;  4WXD A;  3RYR A;  2YX7 A;  3Q9S A;  1B1B A;  2XAH A;  1P4X A;  1FY7 A;  1IN7 A;  1XSX A;  4RGX A;  4UHT A;  3W6J B;  4JBA A;  4HQM A;  5J8C A;  3WE3 A;  2FE3 A;  4KMF A;  2KIM A;  1LDJ A;  3MQ0 A;  3TDU C;  4EGY A;  5JR3 A;  4WF2 A;  3FXQ A;  1SFU A;  1ZG5 A;  2KRF A;  1JXS A;  2J5P A;  4I98 B;  4MEX F;  2IT0 A;  2Z5U A;  1YQA A;  2A3S A;  3KET A;  2VC0 A;  1BI2 A;  3OOP A;  1STZ A;  4A12 A;  2CSO A;  2GQQ A;  3FMS A;  4CO8 A;  3E6C C;  1EH8 A;  2FSW A;  4G94 A;  2JPC A;  2O3F A;  2M1B A;  2Q0O A;  3IKV A;  3LA2 A;  4BNC A;  3PQJ A;  3M8F A;  3U1D A;  4HBL A;  1JHH A;  3RJP A;  2V1D A;  1P4W A;  1FBQ A;  1FYL A;  4DQ2 A;  4AWX B;  3BPX A;  5AIP A;  3TO9 A;  4HDU A;  1FZP B;  4RAY A;  3WGI A;  1KQ0 A;  4UV8 A;  2GZW A;  1U5T C;  3RKY A;  4HF2 A;  1LJ9 A;  3WTS C;  3HOT A;  4EM0 B;  1JHF A;  3J81 Z;  3TO7 A;  4BAY A;  3HRU A;  1D8K A;  1BJA A;  1F5T A;  1G6N A;  1SMT A;  4S05 A;  3HTS B;  4U7B A;  2O0Y A;  2OQG A;  1BN5 A;  5KVR A;  1ZH5 A;  2W85 A;  5CLS A;  5L3F A;  5CYV A;  1YTY A;  3P7N A;  3TOA A;  3KP5 A;  1R23 A;  5FLX Z;  4MHG A;  4EM1 A;  2A69 F;  2ZME A;  2DQR A;  4GGG A;  2VOD A;  1SMY F;  3K1M A;  2P5V A;  3JSP A;  2FEZ A;  4Q5S F;  3BZ6 A;  4O3M A;  3I59 B;  1MJ9 A;  2EA2 A;  3VOD A;  4AIK A;  2GAU A;  1B9M A;  2GA2 A;  3ABU A;  4AD9 A;  2F5E A;  2MBF A;  4IRH A;  1B59 A;  3F8N A;  5DCM A;  1H9G A;  3E6D A;  2P7C B;  3L00 A;  3TO6 A;  4UVC A;  2ZNY A;  1QNT A;  1YW7 A;  4ZZD A;  4RGU A;  2MH9 A;  4NB5 A;  1O7F A;  3FX3 A;  1XMK A;  2ZXJ A;  1J5Y A;  4O6J A;  4KFC A;  2RC4 A;  3FMR A;  4TV7 A;  4XLN F;  4OIP F;  4YG2 F;  5LGU A;  4YFK F;  2V6C A;  2VXZ A;  5HLI A;  4UXN A;  2E1N A;  2BBY A;  1LNW A;  2EB7 A;  2FMY A;  3TDZ C;  4EGZ A;  3U9G A;  3K1P A;  1SD6 A;  1P6R A;  4EMS A;  3ZMS A;  1TTY A;  1ZRE A;  1FWZ A;  5IT9 Z;  3EQL F;  3KP6 A;  5BQT A;  1PP7 U;  2V9V A;  4RB3 C;  3P9K A;  4YII A;  2HTJ A;  3BWG A;  1KU7 A;  5JVT A;  3DPT A;  3ROU A;  3FXU A;  1J75 A;  1W5T A;  3GWZ A;  3J7A O;  2NNN A;  2FU4 A;  2QQA A;  4CXF A;  4P55 A;  4BHC A;  5EEG A;  1F1Z A;  3HRS A;  1BIA A;  3JTG A;  3FZV A;  3HTU A;  3GFI A;  4B09 A;  2ESN A;  2DPU A;  1HBX G;  2P5K A;  3K0L A;  4G6Q A;  2IVM A;  2X0L A;  3F21 A;  4L9N A;  4M73 A;  3GX4 X;  2M45 A;  3IRR A;  4GCV A;  4KN7 X;  2QWW A;  2MD5 A;  5J8F A;  2V79 A;  4HV6 A;  1TNT A;  4K2E A;  1FSH A;  4ENJ A;  2L3D A;  3LA3 A;  4CZZ A;  1LDK B;  1TW2 A;  2L02 A;  2M30 A;  5BS6 A;  3EUH A;  2K86 A;  3G73 A;  1PUE E;  3QRF F;  4IPA A;  1MJB A;  2OZU A;  2Q2E A;  3HRM A;  3SFZ A;  4WXH A;  4AVP A;  4A6E A;  4Q47 A;  5FFZ A;  1VTN C;  2QQ9 A;  3N97 A;  1D3Y A;  4CDG A;  3HIF A;  4UUV A;  5DV5 A;  3WOD F;  4WX9 A;  3ECH A;  1J9I A;  3WTT C;  1XD7 A;  1U6G A;  2NAZ A;  4FX0 A;  3HRT A;  4G7Z F;  2IPQ X;  1YS6 A;  1O3T A;  2YU3 A;  4M9S A;  1ZRD A;  2D1V A;  3RPU A;  2XRN A;  2YX4 A;  3T0Y A;  4EV0 A;  1T6S A;  3M7G A;  1L0O C;  5DCM B;  3LQR A;  4EVI A;  2FBI A;  3F8C A;  2DT5 A;  2Y0M A;  2HYG D;  3M8E A;  5ILU A;  2TDX A;  2FML A;  3COA C;  2HGC A;  5D4S A;  4RB1 A;  2F5D A;  1ONV A;  2HZT A;  3KFW X;  3LWF A;  3QU3 A;  2IJL A;  3HHG A;  4HDV A;  1HXD A;  5LGT A;  2CO5 A;  1IRG A;  5DCF A;  4IHT A;  3C3W A;  4PGG A;  2J5O A;  5LEK A;  1RUO A;  3D0S A;  3QOP A;  1IW7 F;  1NHA A;  1BBY A;  5EEH A;  2DAO A;  2DK8 A;  3EYI A;  3BOQ A;  5E1Z B;  1J7K A;  4A0X A;  1TQP A;  2JPB A;  3P9I A;  1I27 A;  1YLF A;  4LGW A;  3E6B A;  1OMI A;  5AIQ A;  4FHT A;  4BYY A;  1ZRC A;  4ZYG A;  1H9T A;  2RQP A;  1Z7U A;  2FA5 A;  4P5O A;  2H94 A;  2E7X A;  1FYK A;  3L7W A;  3ABT A;  4WCG A;  1ZN2 A;  2FOK A;  2UZK A;  2EV0 A;  5CVU A;  1P2F A;  3JSO A;  5AON A;  2RNJ A;  4CGZ A;  2VE8 A;  4UNO A;  1S7A A;  2UXX A;  1B4A A;  1DPR A;  4N0B A;  4M9X A;  3HYI A;  1P92 A;  2H6C A;  2W24 A;  4G7O F;  1E2X A;  3QPT A;  5F1R A;  1MDM A;  4Y15 A;  1BI1 A;  5DUK A;  1O7L A;  1HW5 A;  2LDU A;  4L0Y B;  2LNB A;  3GEZ A;  3V7R A;  4XSZ F;  2STW A;  2IP2 A;  2F5C A;  5D4R A;  2EK5 A;  1JE8 A;  4HA8 A;  2A6E F;  4P96 A;  2JT1 A;  1DUX C;  1YYV A;  2FNA A;  1BI0 A;  4O5V A;  2P5L C;  2RGV A;  3CDH A;  4HX8 A;  3GF2 A;  3RKW A;  4ZZL A;  1YW8 A;  3O2P E;  4MTE A;  3WTZ A;  5DD8 A;  4KMU X;  1EV7 A;  2DBB A;  4M71 A;  3QAH A;  2RKH A;  1O3R A;  3KLO A;  3F6O A;  1J0R A;  2DI3 A;  2K4B A;  2XGX A;  1YO5 C;  4LD5 A;  4LMY A;  1YS7 A;  3I64 A;  2HR3 A;  4EQQ A;  1LQ1 A;  1YW9 A;  3RDI A;  3QPH A;  5K5O A;  2XKO A;  4HZF A;  1UCR A;  3VEP A;  4IHS A;  3H92 A;  1R58 A;  2EFN A;  3BP8 A;  4OU0 A;  1KQ8 A;  2A6H F;  4RAZ A;  4LLG F;  2EFP A;  4G8X A;  1KU2 A;  3GYH X;  1B9N A;  4A6D A;  3LQQ A;  5LGN A;  1U3E M;  4UVB A;  5TRD A;  2YSR A;  2NRA C;  4HF1 A;  3RKX A;  1FPQ A;  1ZG3 A;  4U88 A;  2HKX A;  1IAW A;  1XGO A;  3I53 A;  3C18 A;  1MJA A;  4YFX F;  3GFM A;  2KJB A;  1XDS A;  1JGS A;  2RV8 A;  4ZH4 F;  2GIV A;  3LFK A;  4EM2 A;  4I0B A;  3F6V A;  3ZQ7 A;  1OYW A;  5FB2 A;  2OA4 A;  3LA7 A;  2LF7 A;  2QVO A;  1WI9 A;  3GW2 A;  4I09 A;  3FM5 A;  3R60 A;  1ZYR F;  3WTW C;  4U0V A;  1KU3 A;  4IJA A;  3BDD A;  4I2O A;  1SD4 A;  2VBY A;  2ZCW A;  4AIH A;  5A2Q K;  5D6E A;  2Z3Y A;  3V8K A;  3GZ5 A;  4BHP A;  1U5T A;  3R4K A;  2CG4 A;  2GXG A;  4HYE A;  3FHZ A;  1LDD A;  5ERI A;  1QGP A;  2P6S A;  3FMQ A;  2EFW A;  1IN5 A;  4I01 A;  2W25 A;  5D5X B;  1YFH A;  1W7P A;  4OIO F;  3ULQ B;  2MC3 A;  3GLX A;  3KP2 A;  5BMZ A;  2KIU A;  1TLH B;  1T98 A;  2COM A;  4LB5 A;  3MFK A;  4FX4 A;  2X4H A;  3E3V A;  2VOP A;  4KDP A;  1K6O A;  4L0Z B;  2ZBK A;  4HOB A;  2CQK A;  4ENM A;  3TGN A;  2CGP A;  3KEO A;  1U8R A;  1WRJ A;  1CGP A;  1DP7 P;  3R0A A;  2VBW A;  2ZO4 A;  3T5X A;  5K5R A;  3WTX C;  2FQ3 A;  4ON0 A;  5DEQ A;  4R79 A;  1BIB A;  5CVJ A;  1XMA A;  2CWE A;  1USS A;  1T38 A;  1SFX A;  2E1C A;  2Y75 A;  1QO0 D;  2V1X A;  2VT3 A;  1IXC A;  5L3B A;  2FXA A;  2P4W A;  3SZP A;  2BYV E;  2PMU A;  2KIF A;  3QU6 A;  4NHJ A;  3OV8 A;  4JQF A;  1R7J A;  1XN7 A;  4ENK A;  4BQA A;  4MQ9 F;  5CJ9 A;  1Z6T A;  4HX7 A;  2P7V B;  2W84 A;  1ZGJ A;  1EH6 A;  2ADU A;  4BXU A;  4RB0 A;  4I7H A;  5ILS A;  3K2Z A;  5K5Q A;  1L3L A;  1IN8 A;  3Q9V A;  3R0J A;  2MLK A;  3I4P A;  3I58 A;  5LHG A;  2NYX A;  1I5Z A;  4Z2Y A;  3GUD A;  4A2U A;  4HW0 A;  4PDK A;  2Z33 A;  3REO A;  4KN4 X;  2KJC A;  3ZMT A;  1X3U A;  2EA4 A;  2YR2 A;  2XRO A;  2DFI A;  2OQR A;  3L09 A;  1IF1 A;  2D1H A;  5KK1 A;  3I5U A;  1G3W A;  2XAF A;  3WE2 A;  1XGN A;  3K9T A;  2PLY A;  1Y0U A;  1YIO A;  5HDG A;  3KZZ A;  2ZJ2 A;  1HKQ A;  1REP C;  3Q5F A;  5E17 F;  2WTE A;  2PBI A;  3KCC A;  3MZH A;  5HDK A;  3O6B B;  3MZY A;  3BRO A;  3KP7 A;  2Z99 A;  4M6X A;  1C0W A;  1D5V A;  1KQ9 A;  1R1V A;  2DO7 A;  4HF0 A;  3W6K B;  3GXO A;  2XAJ A;  2FF4 A;  2ZFW A;  1LEB A;  3IL2 A;  3CUQ B;  1KYZ A;  3SZT A;  1HSJ A;  2HQR A;  4I02 A;  1ULY A;  4A0Z A;  1S6L A;  4KYW A;  4PCQ A;  2DTR A;  4A0Y A;  5CVV A;  3F72 A;  4Q48 A;  1AOY A;  1FNN A;  3MCZ A;  4HAM A;  2FBH A;  3E5X A;  2O03 A;  2QLZ A;  1K78 B;  4MQV A;  4LLL A;  1XCB A;  2PG4 A;  2D2W A;  1OYY A;  4GYG A;  1RNL A;  2LSO A;  4M72 A;  5CVI A;  1Z1D A;  1W7P D;  3E97 A;  3RYP A;  5E1X A;  5JFR A;  5JI6 A;  2OD5 A;  1Z91 A;  3BJ6 A;  4KIC A;  2IW5 A;  4WXC A;  2V1U A;  1TQI A;  1MD0 A;  2XAQ A;  5F6F A;  3VB2 A;  5D5V B;  6PAX A;  1FP2 A;  3F8F A;  4ENN A;  3M1E A;  3KZY A;  5E20 A;  3F8M A;  1QQI A;  2DQL A;  4G9Y A;  3VFZ A;  2K27 A;  2ZNZ A;  1Z6R A;  2G9W A;  1S3J A;  5IT9 K;  1FLI A;  2BE5 F;  5LEJ A;  4KNY A;  3R6S A;  5ICG A;  2M8E A;  4OMY A;  4L9T A;  2EFQ A;  1IXS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...