2X4IA

Orf 114a from sulfolobus islandicus rudivirus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
112
structure length
105
Chain Sequence
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGHDSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISILTLEEILKLYESGKVQFFEIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus islandicus rudivirus 1 variant xx
molecule tags Unknown function
molecule keywords UNCHARACTERIZED PROTEIN 114
total genus 25
structure length 105
sequence length 112
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08960 DUF1874 Domain of unknown function (DUF1874)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x4iA00
2J6BA 2J85A 2J6CA 2X4IA
chains in the Genus database with same CATH superfamily
1JXQA 4YDRA 3WGYA 2GYYA 4ZAWA 4BYMA 2I2BA 2ZT5A 4FT4A 1KK0A 1CR0A 1M2OB 1YZQA 2G07A 1NULA 2X19A 3VX3A 1Z13A 1TYZA 3ESZA 4HLNA 4LRTB 3WMGA 5HIJA 4N8DA 2DWPA 2DBRA 3QY9A 1TEZA 2VXCA 3QQ5A 3IVRA 4E7PA 4DBLE 4E07A 2PUBA 4ADSG 1DWOA 1RD4A 2MTBA 5A5VA 1W7AA 4IDNA 2C9DA 2QTVB 3IAXA 3QBVA 2O5RA 3KT0A 2HV8A 1P1KA 3LX5A 2R1VA 4H7HA 2QN1A 2VBGA 3E1KA 3QLUC 1UPUA 4IIBA 5J5AA 3KSBC 4NBSA 4F1KA 2YV3A 1CUUA 5U1PA 1JDJA 2XE7A 2Q3BA 6REQA 3MUOA 4NV0A 1FDWA 5GM2A 1X0VA 2DZDA 1KY4A 1RIIA 1R0BA 2CW5A 1C9MA 2IYZA 2WRZA 2Z5GA 3GRZA 4Y9SA 4AMUA 2WUEA 4B3FX 3HO1A 1AK9A 1Y4SA 1V8PA 1UDBA 3BSYA 5DYIA 3EGOA 1U8ZA 4DKJA 3UATA 2FPWA 4H27A 5TVGA 4M1EA 3H0KA 4M0CA 2LKCA 3IQEA 4EVIA 1W36D 1X7YA 4P83A 1PTJC 5B4VA 3ZCTA 2FZCA 5K7SA 3V8PA 2IBSA 4URWR 4F45A 4OK5A 4U39A 2H92A 4O8CA 4XUCA 3MN1A 3SHWA 4JJ4A 3EDYA 2OMKA 2B1JA 2Q3MA 3DTVA 3MMPA 3QOXA 4LWPA 4LXXA 2WJ6A 3E61A 5DHFA 1YCGA 4EI9A 3BXGA 4YAGA 4XRRA 4HQFA 3BHJA 4NBKA 5IANA 4G1CA 3PEYA 1WXFA 4ACAA 1QHXA 1SEVA 1ZM2A 3VI4B 3UB3A 3DOIA 1Q6YA 3HJUA 2WWVD 2QR2A 3ILYA 3LCCA 5C3UA 4YXWD 1XTBA 2R8PA 3CLVA 2GM9A 2G3YA 1OASA 2BR5A 2BBOA 1C0LA 3ZWOA 3Q9LA 1MRNA 3H5IA 4MYRA 3VSBA 1QJCA 2QHXA 3L8HA 4P0QB 1T4CB 3U16A 3RC1A 1RI3A 1GZ3A 1NUAA 3E48A 3O91A 3V7NA 1O97C 2VBCA 4YB8A 4C0JA 4FE4A 1WULS 1Q11A 4NJEB 5E4FA 3SEFA 4EJMA 5L3QB 5LMNB 1KYXA 2XMPA 2VEOA 3NORA 4HMQA 1RKXA 3M1IA 4GHWA 5A2GA 2AXNA 4I4TA 3QX7A 1A8HA 1J1IA 4HDCA 1NN3A 4MI3A 5H3LA 5B6IA 2QG9A 4LDPA 2JAWA 4HUJA 1POXA 3OC0A 1M8FA 4NH4A 1D6MA 1UZNA 1ZGJA 3AGQA 3BXPA 3LPAA 2GXQA 4JLDA 2IS4A 2AI3A 1AGYA 2ECFA 4FDAA 1EP3B 2WUDA 3ZC3A 4B9EA 2FGJA 3E4CA 1I3LA 5L40A 1WS6A 3AI3A 1LK5A 1COWA 3WIDA 3IO3A 2FWAA 4EEKA 2IH5A 2QMZA 1SOUA 2PCLA 4TZ6A 3E70C 5KSZA 1KSJA 2OV2A 2BDTA 2XE4A 3QVVA 1BIFA 4KXNA 5A4FS 5LZ5A 3N0RA 5JD3A 1GQFA 1CE8B 1NJ2A 4KL8S 3ME5A 1KEWA 2RHOA 4AJ2A 1ISRA 1YJAA 4N5LA 1PEAA 2X8BA 4QYMA 4ZCLA 4E11A 2YHIA 1IVSA 1U63A 2IC5A 3ABRB 3PIRA 4LZOA 4MVJE 2HWYA 1ENZA 2Q6OA 3HPQA 4HYEA 4EHAA 3OQNA 4JI2B 1W1WA 3FE2A 4EUFA 4IUCS 1NZDA 3OSUA 3ZU4A 4M22A 4BTVA 5DBGA 2BJHA 2V45A 1FXSA 5IPFA 4B7AA 3MCVA 4OKSA 5FA5A 5BN4B 3ZJTA 1C4XA 2NU6A 2C83A 1HTWA 3TKLA 2IHNA 2IU6A 3RWMB 3W4KA 2HJ9A 2I4IA 1Y5RA 1QCCA 3RROA 1MDBA 2RHWA 3G2LA 3TLJA 3UKOA 4PO3X 3A32A 2HXYA 2FRXA 5EKXA 3L92A 1RI2A 2HM7A 521PA 2QVBA 4B4OA 2H1HA 4LFAB 2WJ4A 4LMRA 3UTDA 1H2WA 1ORTA 1DXHA 4G5FA 3ROQA 5C7YA 2WPNA 4BQQA 2JGMA 3GNTA 1AU9A 2FWBA 4JLNA 5J4VA 5HJ2A 1FYFA 5JFOA 4ESHA 2P2DA 4J0CA 1RP1A 1T2DA 4JUBA 3U3MA 3D8RA 5FDFA 2PSFA 4Z4EA 3ONNA 1ADFA 4C06A 1D2HA 4I9GA 5I9TA 1GA1A 1FXUA 1HSZA 3S1AA 1R0SA 4K46A 5AOAA 2NUAA 3ZS8A 2D0IA 2AKYA 1JG3A 2AEMA 4J07A 1ABEA 2BHRA 5CPFA 1W2WB 2G28A 3MGAA 1O95D 1AA6A 3ZWMA 3RREA 4GOLD 3M6AA 1HORA 1IUKA 2BGJA 1T3ZA 3BMXA 3GMSA 4HAZA 4TVKA 3MT8A 5E2AA 3L6RA 2RBKA 1M74A 4RFSA 3MCAA 4N5IX 3GEGA 3EEQA 4DA0A 1U99A 2P3QA 1G5FA 1UOOA 2W6QA 3D0QA 3S5UA 2AJ8A 4ER0A 3G0OA 3TQSA 4OQ4A 3DZJA 1YZUA 4FCWA 2V4ZA 4JYCA 1X38A 3EZ6A 3AESA 3W2HA 4ZDWA 1OBVA 1NMSA 2H4JA 1T5DX 4DIOA 3Q3CA 1LJUA 1ZUNB 3F6BX 4QDKA 2B8WA 1PJ3A 1GGVA 1QGUA 1UMBB 2P9YA 4CM3A 4RTKA 3KUUA 2HWWA 2IHUA 1FU8A 3RUEA 3ZNPA 3BIFA 3A25A 1QVRA 4IG4A 4HF7A 3T95A 4C0QC 1RS0A 2WA2A 2YZ2A 4KMOA 1Y6FA 4NBVA 3HCCA 1WOMA 1TIPA 2HF7A 2Q4BA 4K9DA 4RVOA 1S4MA 1YQ9A 4O4LF 5IXJA 2BGLA 3IT0A 4QFBA 2WIDA 3HEBA 3AEKA 1NQVA 1U65A 3EXFB 3QXGA 2OXIA 4WVLA 3C3XA 3QPBA 3RTGA 4ZICA 2AZDA 4D81A 2FH5B 1SIWA 2FR8C 5IKXA 3F5SA 2C2YA 2DR2A 5LXTA 1Z39A 1NU6A 3KJFA 1WXDA 2VYFA 4D8TA 4ZGWA 1Y81A 2V7VA 3DBHA 5DX8A 3KZNA 2Z3WA 2FRVA 4P86A 3CJRA 2PZLA 4FNOA 1ZK0A 2I6UA 3DFMA 3AJEA 3GQBB 2O1XA 3EH1A 4GXTA 4MP6A 5DRTA 4A8HA 4AP5A 4ZEMA 3I5AA 3L0DA 3UAZA 2AN5A 4PNHA 1IZ0A 3COZA 1I2MA 4GD3Q 5J59A 4UHEA 1EH5A 1PG5A 3H86A 2ILVA 1JPVA 2A5YB 5I4KA 4TVSA 4LA4A 4Y2VA 4MYUA 4H3HB 2G6TA 4JC0A 1XEXB 4WKOA 1DCKA 4UU7A 3ITKA 2BWJA 3FLBA 3B7PA 4IQFA 2HQSA 4PC6A 3OUZA 1OWMA 2VEDA 5K0FA 3ZGZA 3NOXA 4E14A 5I7UA 2DFVA 2DULA 4YO8A 4NAHA 3QWBA 4KX3A 2YYZA 3ZE1B 5CLHA 5FLXA 3QG1A 3MBIA 2HOQA 4NL4H 1K6IA 3E6AA 3OETA 2E82A 4MV1A 4LY3A 1GGKA 4YP7A 2ROQA 3ZVRA 821PA 1Y1KE 4L0MA 3MCTA 1W76A 1YR2A 2ZB4A 1UCFA 4PG7A 4NI5A 1X2BA 3ES9A 3SQOA 1E0KA 4H6PA 4BVLA 2X86A 5CDFE 1UXIA 4B76A 3LRXA 1Z5VA 5L9AA 3UMCA 4FWTA 1XZIA 1XZQA 2W93A 3U26A 4AF8A 1GKYA 2FSSA 1Z16A 1KKMA 4H3KB 4IKPA 4EAAA 2VI5A 2BSQA 4BNDB 2IE8A 1FVXA 4LOHA 3STVA 4M46A 1E2BA 3UWMA 2DYKA 1SU7A 2XGMA 1X1CA 3GJ3A 3OEED 4FM9A 2VJMA 3LQYA 3ROXA 1JR3A 3WV4A 1QZTA 2I4NA 2QSJA 1WSDA 2V7EA 4H15A 2DC1A 2YQ5A 3IKMB 5HBGA 1U2PA 2VNIA 1HNNA 4Q1VA 5D51S 2VPWA 2FSIA 2GVZC 2XMGA 1V2HE 4J91A 5BY2A 3DB2A 1W35A 1CLUA 4XUEA 1HFEL 3K8ZA 5EKTA 1L9XA 1PWYE 3TTYA 1SC3A 4TTTS 3ZBQA 1E9RA 5B7GA 5BSKA 5JEEA 1TVMA 2FG7C 5LJIA 4R1TA 4NOMA 4HAVA 4P31A 1VKZA 1YUBA 4YUXA 3SQXA 2OL4A 3DMPA 4KQ6A 3TPFA 2F3PA 3HSKA 4PZCA 3BH7A 3C3DA 1G8YA 1TLFA 1QE5A 2BE7A 3P4UA 3EQ2A 2ID8A 4JMLA 4NWIA 4BDSA 3TK1A 3L4BC 3OUUA 3B5JA 1IL0A 3C39A 3OLVA 2CXPA 3JS5A 2B35A 3KV3O 3NV7A 3FMIA 1Y34E 3QLEA 3DGFC 3RNLA 3VPBA 3IVMA 3ETCA 5A4IS 1EXMA 1SHLA 3QBTA 4M21A 1YQTA 2I2CA 1J07A 1EG2A 2O3UA 2PUEA 3KO8A 2XVZA 1E2IA 2A5JA 5F1KA 1RQ7A 2FEMA 4HC4A 1RLIA 2O5VA 1PL8A 2V9ZA 1IVNA 2D2EA 4KBYA 4L57A 4YONB 1R64A 2OQ2A 1ZMTA 1Y7HA 2W42A 4PPGA 5FTNA 1DMRA 1T0HB 4LF7B 1U2EA 2P3OA 2WAOA 3A0UA 2AQ8A 2YWJA 1JU4A 1Y6ZA 3F67A 4L5AA 4MRVA 5HK9A 1Z5GA 4AJEA 4OJMX 2FFHA 3WFZA 4DMUB 5DN6D 3AM1A 3AR3A 3NTOA 4K87A 1NN5A 1QGYA 1WQ4A 2BMWA 2FPKA 3N8HA 4RQTA 1BEUB 5IS2A 4NFHA 3RM3A 5L3SB 5H4HA 4J0HA 2ET6A 3TBFA 3M70A 3SDBA 5IDXA 5JD6A 1NJ5A 5CXUA 3T1YB 2TYSB 4UREA 4HLCA 1TZJA 4KMRA 5ALTA 1D2EA 3ZGYA 4E31A 1XP5A 1U0EA 4JB2A 1GG5A 5H3HA 3AETB 3OIGA 4E51A 3DMNA 1EWKA 3HBAA 4GKBA 4F6CA 2ZRFA 3HR8A 3R9IA 3PI6A 4WPGA 1V8FA 4QXAA 1B74A 1SOVA 2FYTA 3L0CA 3IV6A 5DX0A 4CKBA 3A3KA 3F4LA 2J33A 5E4JA 1CQJA 4TWIA 4XGKA 5A6VA 4UM8B 2Q5FA 2Q62A 1BH2A 4PFSA 3S2SA 5IXYA 1A95A 2IP2A 1QOZA 2JZOA 3DJFA 3HGTA 3LUCA 2P11A 3H5VA 4JQCA 1XQ1A 1LPPA 4NAVA 3ZJVA 4BQNA 2IZ5A 1C7QA 4RD3A 4Y18A 4M87A 5GGXA 1G6Q1 2YJTD 4RXUA 1EM6A 3LA8A 3T9BA 3TH5A 3WWYA 4EUHA 2VZ8A 1FP4B 5EE5B 3WL8A 4MA0A 2R4QA 3LL4A 1FF9A 3EYWA 4UM7A 3BD7A 2SICE 1BD4A 1ZX1A 4RH3A 3A9CA 4K9MA 3H42B 3UW1A 2V7WA 4MVWA 4U7HA 1PR9A 2X4GA 4C7OA 3S4YA 2D7JA 2B2CA 2I76A 3RFCA 1Y6JA 4I99A 5E9AA 1OA1A 2R44A 1P4SA 4OHPA 3VZCA 5K3CA 4EQ6B 1MC4A 2FPLA 3U4CA 3ICEA 5JSFA 4JV5B 2XRMA 2QTMA 4YP1A 3FAKA 1CZUA 4V0QA 3VMMA 5ALHA 1QV7A 2QZSA 3GJ5A 1PR3A 1F2VA 1S2IA 3MEQA 3DB1A 4PX9A 3M5CA 5DHRA 2R1UA 3AJ8A 3RKRA 3GHYA 4KN8A 4Y0VA 4P9NA 4WZAB 2FUKA 1X39A 2QZ9A 3VOTA 1QR6A 1C8KA 4G4IA 3TTTA 2E1RA 3CNBA 4QDOA 3U6BA 5E2BA 2C88A 1GGHA 2INGX 4HDRB 4XOIA 5I7WA 2P30A 3I76A 4WUVA 2BTQA 3LWBA 1B4DA 2QAGB 3C3CA 1PIWA 3GVCA 3O0DA 4PBSA 2OVFA 3FFBA 1KDRA 5IK2A 4BP3A 2O8VA 4NJMB 2Y0DA 1DFIA 4F72A 5TQ2B 4DLYA 1KEKA 1NF9A 3S7ZA 5ITVA 5I48A 5F2NA 2C9CA 4XM1A 3MQ4A 5CDGA 5KX5F 1GG2A 1JTEA 1FB5A 1RZUA 2OG1A 4QUAA 1HDYA 4D82A 4KWIA 1LVGA 1PHPA 2GCGA 3AMVA 2YASA 2AEJA 2BEJA 4MGYR 2UYQA 3HADA 3P2JA 1W46A 1KETA 1RI5A 3QW4B 5JU6A 3AR9A 1DKNA 1SR8A 1WCYA 2WHXA 3HP1A 3AHEA 4BY9E 3SZOA 1NDQA 2W6MA 4PC7A 1SQFA 2WNSA 5F1OA 1QRTA 4Q9KA 5K0LA 1UKEA 1GNRA 3HE3A 1WZNA 2ATXA 1VCIA 1G41A 1U8AA 3PD7A 4PHHA 5LNK1 2JKVA 3WY9A 2GCIA 5IMSA 5JAZA 1UM9A 1SWVA 4QYSA 5IZ4A 2HT1A 1WKVA 4KVGA 4ZTZB 2IRWA 3FX2A 4MV3A 2CZQA 1PJ8A 1W0JD 1Y48E 2ZPAA 2Y0CA 1PQYA 2I4RA 4JFRA 2W6PA 1BKYA 2BYTA 2C54A 2FJPA 2NWQA 3PYMA 4WL0A 5FXMA 4MUGA 2VJQA 4DLSA 5JWHA 2HA4A 2YHSA 1BCRB 4EARA 2F67A 3F6EX 1TM7E 5K6RA 2HHAA 3FJ1A 5B58C 4HDQB 2BGGA 1W4ZA 3JZIA 1T8YA 1XCOA 1M1NA 3QU2A 2JFQA 3E5HA 4HNUA 4NBWA 1L8AA 3LK6A 1DBIA 1OAAA 2MHCA 3DE6X 3HN6A 1E96A 3LVFO 4LUCA 2ZIXA 5J5VA 1J70A 2NSYA 4JP5A 1TM2A 4W5RA 2G9NA 3AOGA 4DBZA 4IEIA 3E15A 2QTNA 3NHAA 3WFIA 4QQFA 4IRUB 4B82A 3BFPA 3L1JA 2I55A 1ZMXA 2EZ4A 1UZUA 4JYAB 4PANA 1JHXA 4LWZA 5BSUA 3FMGA 3A6PC 3DE7X 1I36A 3WMEA 1TT7A 2XBUA 1Y8RA 3C70A 2SCUB 4NBRA 4YRFA 3T5BA 4MR8B 3I64A 4PLPA 4ESOA 1DQZA 1SHJA 5HE8A 1GUYA 5CCDA 4EG3A 1J0DA 5DIFA 5ELXA 4QYWA 5IKPA 3ILSA 1KJ9A 4QUJA 1H0SA 4KJXA 4D5GA 2AMYA 3QIAA 4BMPB 2YKGA 4ZEVA 2JLZA 1YRQA 4CG0A 4ZJZA 2OK8A 4LNUA 3T0GA 1G6KA 1SC4A 1UAAA 1EFDN 2DRIA 3HFGA 1FP6A 2J4DA 4U9UA 3WGMA 3PC8C 3GC6A 2QTZA 2AW5A 2NO4A 1XQVA 2HBYA 3VR0A 2ATIA 4W5NA 4UXJA 5B4TA 2KLHA 4WNIA 1ULZA 3VQTA 4DMHA 4NE7A 1E1RA 1BMFA 3AWIA 4CQMB 1XBTA 1XF1A 3GFPA 4JJFA 4UUBA 1MUUA 2UYYA 5CM9C 1IUOA 5DTEA 2LP4Y 4GPBA 2QQ5A 3IS3A 1DDOA 1FUYB 1BROA 1M0WA 2CZGA 3V7UA 3SP1A 3SFZA 4TS4A 4MLCA 1JDBB 2EZUA 3H11A 4I9FA 1N6KA 1NBMA 1YU6A 4UE3S 1P3JA 5LOVF 4URHA 1VL8A 3AM5A 1EUDA 1H69A 1KY5A 2CFTA 2ZJFA 3KJQA 4J6FA 4AP9A 2IUSA 4DR7B 4NZYA 2XKAA 1RFLA 1R9MA 1L3BA 1X2EA 2PXHA 1Q0HA 3GELA 5FHRA 2B61A 2X2FA 2A7QA 2AXQA 3FWKA 3KKPA 5LQJA 4D44A 2N46A 3H1BA 2A58A 4MEJA 3KTAB 2X0EA 1XGKA 2OQIA 4PZZA 1C3OB 3FOCA 4P93A 3VTZA 5FA8A 2Y0EA 3CX8A 1SCIA 4F9EA 1GGMA 2XZTA 4ETIA 2ZT7A 4N65A 4RTRA 3LPCA 2F59A 3LLUA 1GAEO 1I4TD 1QFMA 4X85A 4R7GA 5FQNA 4DQKA 4PC1A 3UWOA 1TFUA 2CLSA 2IXTA 3KB8A 4ID3A 3U17A 1DC3A 4ID9A 1UBEA 1YONA 2NO9A 3PFFA 4ZHQB 3IILA 3TN7A 1D4ZA 1I7NA 3A4MA 3LIIA 1LD3A 3BWEA 4XCXA 2V8BA 2XE8A 4REQB 3R7FA 5TE9A 4D8XA 1TYBE 2XMZA 3O4GA 5ECDA 1UT6A 1E0JA 4GDMA 4LHVA 1T10A 4KQWA 1EP2B 4P4LA 3WRVA 2QXTA 4Q7QA 5CT9A 2CJYA 3B52X 3HWX1 4IHJF 2ETVA 5FWNA 1JR4A 2WFLB 4CN9A 2AN3A 1XYYA 2CLDX 3K8YA 4KZKA 1OILA 4OJKA 4D56A 4BEVA 4RW0A 5IFLA 4UDYX 4OXRA 3SVZA 2B4AA 4D9HA 1OD6A 2QAJA 3MD9A 1TM4E 1SRQA 1Z2AA 1ECFA 4JCOA 3PJRA 4OIMA 5F35A 1EZ4A 3MAJA 5G4KB 2HX1A 1XDDA 2QLNA 3IPYA 5BNZA 4FNGA 1VMAA 1K6MA 2GX6A 2I87A 3LBNA 1S96A 4C2AA 1ANKA 2GILA 4D3YA 2WYOA 4X95A 2KS6A 1C9YA 4LPKA 1V7ZA 4X8LA 4CMBA 4GX5A 3PNSA 1SZJG 4N8EA 4A03A 4G84A 3EDCA 4OHFA 4PU0A 3VBEA 4YUAA 3HKDB 4E1VA 3B12A 4KGVA 2BELA 1R8JA 3CC8A 1JR2A 2TECE 3CTMA 3OIYA 5BWLA 1XRRA 4U7PB 5CT8A 2JCVA 3EVNA 1Q2UA 4RZ2A 1YK0A 5EIFA 2QY9A 1DEHA 4KXWA 1QH1B 1HZJA 3N6XA 5EZYB 3DZDA 1OYYA 5CGZA 4ZVVA 4GNRA 3O8NA 4TS1A 1GV0A 1GU0A 3H5LA 1JJVA 4MIYA 4GIBA 2WJJA 4YRZA 2O20A 2W2KB 2ZBEA 3WJ2A 2V7TA 4RA6A 2D6FA 3TYXA 4IHAA 4GPZA 1TVKA 3UWKA 1B23P 2Z0MA 1FYDA 2VPTA 1QQBA 4ZQBA 3WMFA 4AZ0B 3HR7A 3KWMA 1L3CA 3Q1KA 2DPYA 2D7CA 2OCKA 1XLTA 2N42A 2ZAYA 1T0BA 4GRDA 5K3BA 3HVJA 2NU9A 1I3NA 5I9IA 4C3OB 1U9YA 5KWJA 3MT7A 1AMNA 3FDIA 3H2HA 1R6TA 1M1YE 4PPNA 2X40A 3MTQA 4QL3A 1IN8A 3ED1A 3OEHD 1CJTC 4X7MA 1E60A 3U31A 4KXMA 3ZXIA 3ZWCA 5HM8A 3OT5A 1X1TA 1XSEA 2XMDA 1N2EA 3I3SR 5HF6A 1NW7A 3T7KA 4C6TA 1G55A 5EEHA 1C30B 1KMHB 1ADYA 5IC6A 3WYGA 1GVHA 4D0LB 1V41E 1F8GA 2PH1A 2UYGA 3CNOA 4X00A 4AG6A 5EHXA 2AJLI 2VTDA 2C95A 5KJFA 2J0SA 2X2PA 1E6EA 2I6SA 3IUJA 1A69A 4ZP1A 2BEKA 2EKDA 3GOHA 2VA8A 2Q29A 1Z0AA 2VO1A 3JWHA 5B2EA 5CEJA 1IN1A 3ZGVA 4D41A 4IOJA 4M3NA 5HPYB 1EGQA 1YS1X 3SJZA 1P8JA 3GEHA 2ZBRA 5A7HA 2Q3FA 3O3OB 1FLDA 1WPGA 4IDCA 5E6UA 1HM5A 3IIKA 1YE8A 2CMDA 4TMTA 3ECAA 3D3JA 1DT5A 1JBKA 5AKEA 2ZE8A 1T3TA 3K9NA 2OC4A 2ZTHA 3ANSA 5EIBD 3RVPA 3BICA 4Q24A 2PUAA 3B6ZA 1G5PA 2DHDA 2DR3A 2IYYA 1PGQA 3A6FA 4EG1A 3UGJA 2ZYAA 1H2BA 4JBIA 4R5HA 3LLSA 2Q4OA 1MW8X 2AMLA 1TT5B 2SKEA 3H6KA 4TKZA 4DLBA 1E2DA 3EVEA 4C3VA 2I7XA 4B09A 4HJRA 1KR2A 5EN4A 5B55A 1GP2A 1BG6A 1LJLA 1RM5A 3D4PA 4WGGA 2A4MA 2AK3A 3DTYA 4XB6B 3OHMA 1CJSA 2H4ZA 2IU0A 4CJXA 1H2XA 1HRDA 2MSLA 3OU6A 5LMZA 4FEAA 2ZSFA 3OMXA 1JG2A 4I6JA 4J1SA 4JLMA 5KJCA 2C00A 3L8YA 3MQ2A 3PIIA 5ILGA 1XV5A 1ZI8A 3FOFC 4YVFA 3H3FA 1NRWA 3WP1B 3SQWA 4QT0A 5HVNA 2IEZA 1RWVA 1JIJA 3KXLA 2BSAA 4WTOA 4JROA 1NJ6A 2PKQO 1G2QA 1OV4A 4M1YA 5LA6F 5HRCA 4RO0A 5JADA 3RHZA 1ZUHA 2XB9A 5KJEA 5BNTA 1LBQA 3A6EA 4WKBA 4AKEA 4B80A 1V5FA 4N5MA 3SMQA 3BMQB 4P4GA 1HY3A 4ZO7A 3UAWA 1ENPA 3B1VA 4BMOB 1T6NA 4RD1A 4YMUA 2Q2VA 4RABA 4AX8A 3MT0A 1PW7A 1AO0A 1UPXA 4MB2A 2ABWA 2IXDA 9LDBA 2WFZA 1ZZEA 3HTXA 1SU4A 4IIJA 2QXYA 3GW8A 3RYFA 1JBQA 1PZFA 1PUXA 4EO9A 4KITB 1A8QA 1OXUA 3K0BA 4UUQA 2VF8A 3NP7A 4EW2A 2OBLA 4J0KA 1QB8A 4EGJA 1UMCB 1KVTA 1W52X 2BZSA 2QSUA 3KDSE 3P9ZA 2Q9UA 5HKLA 1K9VF 4AECA 3DT6A 2C2XA 4PCAA 4Y1EA 4LX0A 3OEHA 2XRZA 1JHZA 2Z4RA 3DHWC 3KALA 1B6TA 4M9XA 1LRKA 3KUDA 4LY0A 4MW0A 2B36A 5JLAA 1EZ1A 1QAQA 3DE3X 4HDMA 4G5RA 4GX2A 5GZ3A 4DSOA 5EZ6B 2A5FA 1XDZA 1U7TA 2B4TO 3IHKA 3MHTA 3WDKA 1LBSA 4QRIA 4MAFA 3DDHA 1HFJA 1KOFA 1BEEA 4HQLA 4Z9FA 9ATCA 3HYCA 2KE5A 4CLOA 4HB4A 4PZ9A 2JA1A 1WB9A 2GJSA 2I7TA 3FBGA 1AMOA 2IYAA 1UKAA 4MV5A 1ZEMA 2ZIFA 4D9MA 2BHSA 3CN9A 1TMGE 3JQBC 4GE3A 4XEUA 4DPKA 4A1OA 1JYEA 1I1OA 3OI7A 4O2RA 1TW2A 3WHLA 4KN9S 2QD1A 1ONPA 4QOFA 2F6RA 4JZYA 1ZNZA 1TLTA 2QN3A 4W1RA 2G70A 4DNQA 8AT1A 3PKIA 1V7CA 2VRNA 4GVXA 2ICAA 4NH0A 2DT5A 4QEDA 3T12A 4CEIA 1XMIA 5KU7A 3UCEA 3W6PA 5DLPA 2E5LB 1NXOA 3GFGA 2WTNA 4IJQA 3RWOA 3EGXB 5AW1A 2ORYA 1A4UA 1JFRA 2HLHA 1DXQA 3NHPA 4P5PA 1DARA 3MINB 3BQ9A 4QECA 3V1YA 4BFZA 2HWKA 1PZGA 3QTTA 3MJVA 1JX6A 3IXLA 4J0QA 4B74A 1E3EA 6LDHA 4TLBA 2V96A 1S3IA 1N3BA 2G1KA 2OV8A 2PAAA 1RQPA 4KXXA 1SU6A 5FOSA 5FUVA 4NAUA 3O1HB 1OHHD 2G76A 1Y4AE 4YHBA 1KWKA 4QJBA 1LNQA 2Y76A 4RJ2A 2WWTA 3C4QA 3FNEA 4PLWA 3VGJA 4QQNA 2OZLB 5K0CA 4MQFB 4KPFC 3KB6A 1G1AA 1Q2XA 2O7QA 1UH5A 2YZGA 1RCTE 1U1FA 4MDHA 3A1CA 1H1DA 3PFHA 2LNDA 1FNSA 5KNBD 3W5BA 4LWOA 3O03A 1VHJA 5J63A 3KUCA 2I99A 2VDLB 5ES3A 1T9DA 1NURA 1E59A 4A2PA 3L1VA 3FPLA 4X5OA 4BZPA 3L49A 1H42A 2NMVA 2FWIA 3UT5B 4DCSA 4A0SA 3WGGA 3RK0A 3EHDA 1PWXA 2IFTA 2EW2A 1IVYA 3OTWA 2W70A 3UCFA 1WE2A 3BREA 4YJFA 4EMTA 4W8GA 2VPYA 1QHNA 1QG2A 3HA2A 4BFVA 3NHJA 1M34A 2JCXA 4G01B 4UUNA 3UXMA 4ZPXA 3LQ2A 2X6TA 2V7UA 1N8NA 2DBYA 2WZDA 4AS3A 1Z4OA 3IQXA 4E2ZA 2GMWA 4YPVA 5GONF 3K6RA 4BNWA 2ONZA 1E69A 1UC5B 5C7IO 5JQGA 4TV9F 1YI8A 4G4SP 4EGQA 1R5BA 3OQ6A 1LK7A 3SS8A 4LRYA 4RH0A 2WP8J 1EDOA 2QVYX 3HY4A 1N3YA 2CJXA 4GWGA 4KXQA 4U63A 2AJBA 2CL5A 3BA6A 1CY4A 4H17A 3TQFA 3TM4A 2V0GA 1UZLA 2C4KA 1MIOA 2H16A 2K2WA 2BCGY 2PA0A 4LQCA 4MUNA 2JIZD 5JYBA 2A5DA 2LCIA 1NV8A 3NWEA 2P2ZA 4M0MA 1GARA 4KQIA 2C5LA 1PSDA 3FTCA 1UP6A 2HFKA 3HEAA 1MA3A 4GLOA 5LQKA 1W87A 3H2IA 1PJRA 4FFBB 4JT2A 4D97A 3FUVA 3W6OA 1J49A 4YRBA 4F7WA 5JZOA 4NMLA 3E2PA 4PPYA 1U9CA 1EWTA 3W8EA 4EYSA 2YWFA 1Z75A 2JI7A 4M9CA 4B6OA 3AOEA 3U40A 3NIDB 1ZAYA 2N3ZA 1BZYA 4C7MA 2EL9A 1WTCA 2H9AA 2X14A 4XCQA 3LBYA 5LWHA 3C7KA 3GUUA 1ZEJA 3N2ZB 5H70A 3M9LA 2RHBA 3OZ7A 4AY4A 1GN8A 5E3IA 2HHHB 1K92A 3EDOA 3X1DA 4ASUA 1HYHA 2CGEA 1KDZA 1JHUA 1AK1A 2DKOA 5KYWB 3F3MA 4HDKA 1ZGBA 3CW8X 1LK0A 2YY6A 1NLZA 1DKPA 1L5HB 3NAQA 4WHMA 1MQ9A 4KU4A 2F9FA 4JUFA 3V8EA 4URVR 3ZIAD 4RMJA 4W4TA 3NHWA 3UBTA 3IDSA 4RBNA 1Y7IA 2VLIA 3U3RA 1JHAA 4J3NA 2O8DB 5ALXA 4S24A 2Q27A 3G6KA 3QHQA 1D4FA 4EB3A 3SXUB 2RHCA 1GPLA 1E3LA 3LIPA 1ZIOA 4L8WB 3UPDA 1VBKA 2F1HA 2QUIA 3EDMA 3D4BA 4P3PA 3I6IA 5T6MA 4UEJA 5EJ7A 4C14A 4FLFA 1NRXA 5JS6A 3R7SA 1E64A 4WCVA 4KQXA 3Q2IA 1N2CE 2B1IA 2EEZA 5G3YA 2JLAA 3DL0A 1CHDA 1RYYA 2CKDA 3K7EA 3WXBA 3ZE9A 4LVUA 5JH7F 5KTNA 5AMXA 1G5RA 2YFQA 4HB2A 1XJ0A 3ND7A 3NH9A 4OAOA 3ZXYA 4HLDA 5B53A 1EXVA 2V65A 1CR6A 2W71A 4NONA 2PT9A 4QBFA 1CTQA 4R84A 2P9JA 4IILA 3I09A 1LDGA 2GM5A 4G5XA 3L8ZA 5TVKA 3RRYA 2J85A 5HQTA 1Z5PA 2FE1A 1W6UA 2I6FA 1E9DA 1MN6A 2HK7A 2HTFA 2XCQA 2B92A 7GPBA 4JEUA 1YRWA 3M89A 3BSWA 1E6LA 2JGDA 4DTIA 2I8CA 5A1JA 2FEKA 1UDWA 5C34B 2PLNA 2OBBA 4PSAA 3O1IC 4UNIA 4WINA 3NANA 4R2KA 4MW6A 3KX2A 1J21A 1YIDA 3M6MD 1M8KA 3MJHA 5BUSA 3C6XA 1Y1LA 5JNRA 2AE2A 1V8OA 1O96B 2A0YA 3GMTA 2EJBA 5EP2A 2ZRIA 2CFOA 2O2ZA 3WO1A 1UINA 1II8B 2I2FA 2PPLA 3H4TA 2ZI9A 4MWGA 2VH5R 3I2HA 4HLUA 3B7GA 2OFOA 3QPDA 1X42A 1YJ5A 1K9SA 4R0VA 4DQUA 1P4GA 1ZESA 1IJKA 2LVBA 2CNWA 1EUCA 4H9GA 4R51A 4O1MA 3RUDA 1C1DB 3O93A 1R74A 3AEXA 1BRMA 5ESRA 4B8ZA 3IQFA 1E66A 3P52A 3QFRA 4G9EA 1KARA 1SVIA 3NT4A 1FJ2A 3KB2A 5ABPA 1QB7A 4OGGA 2WOOA 3DBVO 3L05A 2Q7XA 4TM8A 5D1HA 4KSBA 3CVUA 4FR0A 4BPBA 1EESA 5I7HA 1CKEA 4MGIR 4FFMA 3DA8A 3AHDA 2WSLA 4O2BF 1ZONA 5K8UA 1QRAA 2Q3DA 1RZVA 3KYDA 3M33A 4MYCA 4CNBA 4RDCA 3ZXXA 1V11A 2F64A 4BNZA 5GMOA 3TTUA 2DG2A 1JKJB 1P72A 1BC5A 3AH8A 4XWKA 4IIYA 1QK5A 1YWGO 2C3UA 4ENVA 3VDNB 3BVPA 2PUHA 1QH8B 1FQOA 4EWLA 1NE7A 1NR7A 4QJIA 4YRKA 2HI0A 4NZ9A 2ACVA 3G0CA 3IALA 3KOZA 4R6WA 5KCMA 3Q3EA 4HADA 5KYYA 5JH7B 2ODAA 3I23A 3S2UA 1Z36A 3KQKA 2F1OA 2XCUA 1T6ZA 3SY8A 4RLQA 2IZ7A 2P1DA 3A4IA 3AIKA 2P27A 1PS8A 5SY4A 2P0YA 3ENQA 4R8KA 4D0SA 4FCCA 4RXMA 1OB5A 1GOTA 3HNRA 3KD3A 5EIAA 1HNZB 2V6JA 3EIXA 4EPRA 2XODA 5K2OA 4EW3A 3REOA 4DR6B 3FCCA 2WSMA 3GT3A 2B9EA 1E79D 2CXNA 3BWYA 2JCYA 3N8NA 5EJFA 1GNSA 1QHHB 1VPLA 1KO1A 2OBYA 5B1IA 1QRUA 4O4HF 1K66A 3BH6A 3D8TA 2WD7A 5T41A 2VJPA 1NVUQ 5T64A 3WYNA 1NR1A 3GXOA 1E62A 5BYBA 2PGLA 1PR5A 3BWVA 5COAA 3AZOA 1CYEA 4ZZ3A 1K68A 5B3KA 1OFHA 1FTNA 4YQEA 5D01A 1V26A 3GNLA 5C52B 1HOTA 4YCSA 1FDSA 4RZUA 3LQ1A 4GP9A 5FUQA 1XNHA 3KSZO 1E94E 2P5TB 3K5PA 3TLBA 3LXMA 4HPXB 2Q5OA 1VSBA 4MGHA 3KHUA 1ZXLA 5IARA 1J8FA 4CV0A 1T9GR 2BOVA 2IYQA 5BP7A 2P0EA 4DHWA 1YIAA 1XQ9A 2A9KA 2GN9A 3R0ZA 5DHAA 2R6HA 2G9UA 5MFPA 2RH8A 4NJMA 5LOVA 2FWJA 3SYKA 2PLAA 3VFDA 2P75A 1P9LA 1MAWA 3ZTYA 2BY4A 2PGOA 4AUEA 2GN1A 3MWLA 3E4DA 4F5DA 4H6XA 3AF2A 5BW8A 3ZQJA 4ZGGA 3B89A 4KFSA 1QVZA 3HLYA 1ZVMA 1N6IA 3TR6A 4BE4A 4E4TA 3QVJA 3OG9A 3KUXA 3ELYA 4LDRA 1JPNA 4L0DA 2VP3A 2WB4A 1I7QB 2A14A 4HNHA 4F86A 1IHYA 1NQWA 4ASUD 1SFRA 4L5BA 3IL2A 4FDVA 2X0RA 3K9WA 2Q1SA 4G0XA 3RI3A 3EVFA 5D3MB 1K5HA 2EQ5A 3JQ8A 2YNMD 3EUWA 4J9VA 1IEQA 1SBHA 1V71A 2WIKA 2FSPA 3BGOS 1CQIB 2ZXEA 3K6JA 5C31A 3SSAA 5ERGB 1GTJ1 2JB9A 4MV6A 2EAUA 3LY5A 2IYLD 2BMVA 5C1DA 1ZCFA 3P9CA 4WLEA 4G0MA 2GAIA 4X9XA 5EZYF 3BMNA 4MVYA 4CQLB 1P9RA 4Q4HA 4XD2A 2B7BA 3ECCA 3H5RA 4Q37A 1MH1A 4TT3D 3ZEAA 5ECGC 1YQGA 3LGAA 5KYVA 1T35A 3AUXA 4BBAA 3GGOA 4BO5A 2JK1A 1MJGM 3K4HA 4XASA 5KTPA 5CFOA 4QUBA 2P3LA 1ABFA 3JTEA 3PHHA 1L4EA 4NCXA 1EP9A 2M6LA 1EE9A 3JVIA 3PUKA 5IU6A 5MGBA 1T4MA 3TAXA 4BJ3A 2PBLA 4IKEA 4AJLA 2XNKA 3BJRA 2B4RO 4BQPA 3CSSA 1VJ0A 1RXWA 1RYHA 5CD1A 1NUHA 3OCXA 1MABA 2O19A 1T2VA 2ZIWB 4DCOA 1L7MA 2RIRA 3ZD9A 1XALA 5FADA 1NYTA 4JJ6A 3EPRA 4OKIA 5EKDA 4ZVNA 4UM9B 2B82A 4LJ5A 2WUWE 5JXGA 2H6EA 2GT1A 2W11A 5AKZA 3EVAA 4X7BA 2O7NA 3CCCA 1OY1A 3RANA 1GQRA 1IE3A 2Q0QA 3EW7A 3JAKB 3I45A 1DPFA 1QHEA 2QXUA 3HVIA 4JVLA 4MYTA 4FC7A 3IIIA 2I3DA 4GEKA 4ZDKA 1U1GA 4WJLA 1I24A 3HP4A 3EGWA 2PX2A 3AVTA 1ZJYA 2G17A 5KDLA 3CRW1 1YBAA 2QYSA 4D7AA 1P7YA 1UK6A 1V8ZA 1E9FA 1Z12A 3QYAA 2GCEA 4P54A 5K01A 3AEQB 2X7JA 2YWCA 4RGYA 1UWCA 4J49A 1A97A 4S12A 3VR2A 1EIWA 2NXJA 4Y2PA 2AG1A 3E0XA 2Y1DA 2Y9MB 3LY7A 3KOXA 2JGAA 5AW5A 1XAIA 3T7JA 1IRXA 2WINI 4I36A 3HA5A 3ETDA 4KKXB 3LOUA 4TYNA 4J0GA 1L2TA 1EXWA 2N75A 4P38A 1UQTA 1E3TA 1Y3BE 1Y4ZA 1T25A 5TGTA 2IH4A 2WDZA 5KVCA 4K6FA 1DO8A 4E33A 4XSHA 1PFKA 4RVNA 1NBME 5DYGA 4BXOB 4WCFC 5C8XA 2R6ZA 4KPUA 4NCHA 4RGBA 8ADHA 2FPSA 3AI7A 3DLBA 3HC7A 3TM5A 3HUUA 1NQAO 1XCLA 1GL9B 2ZYIA 3GLHE 3HRIA 4GNKA 3KPJA 4PG8A 1A50B 1JHPA 3L7LA 3UMGA 5K0EA 2FW0A 4ZAYA 1DEAA 3GIWA 1HE5A 1K3TA 1J1UA 3HN2A 3C8MA 4AURA 2W6JD 3UK1A 3JARB 5DGXA 1JEOA 3FHJA 4KQJA 4QLBA 4KH1A 2WU3A 3LOQA 1UMKA 2V0CA 2YQZA 5CEFA 1O4VA 1F2TA 4WOCA 3RVKA 2CXTA 4O59O 2EFCB 2CVHA 4WFJA 1F0KA 4OHZA 3K4PA 4XLZA 3RS2A 2QIOA 4I46A 2JK0A 2OZEA 3B2EA 5BWMA 4NDAA 1KOLA 4IIUA 5EKUA 1NBMD 1WVMA 3CU5A 4PPQA 4ZYWA 4JT4A 2UVQA 3V1TC 3RS0A 3I34X 4C07A 2R8ZA 1XELA 3QI7A 5F78A 1T36A 3OQVA 3PDCA 3ZDCA 2PT5A 4XQEA 4KR9A 5I7EA 1U0FA 3OSZA 1IBLB 3OY2A 3VNVA 1AQUA 2VHCA 2Y66A 2C9BA 3HVUA 3GBSA 3L82B 4RIGA 4M49A 2WZQA 5CAEA 2HC9A 4O4JB 4ZVOA 4DVGA 3D59A 2VAVA 4E4YA 1OE0A 2WFLA 3S8MA 4CL0A 2Z1MA 2IDJA 3TL6A 1JVBA 2CUKA 2L0XA 3UJCA 2C4UA 4W6QA 1VB5A 1A9SA 1ULUA 3W3AD 1Z4JA 1ODFA 1PS0A 2NZVG 1BS2A 4M0KA 1VBFA 4EMSA 3O1JC 3BHNA 5C53B 3H1TA 1JJ7A 1SY7A 4TL6A 1HDOA 3AX6A 1A82A 3NVMB 1E1QD 1VL5A 1I2DA 3GH3A 4V0OA 4Q4JA 4HAIA 1L5RA 4JLPA 4CKCB 1HDZA 2PS1A 3DLAA 4OHXA 1N5MA 3GX1A 3QVMA 2B4YA 1RMTA 1WCXA 3KKQA 4D80A 1U7ZA 4TVBA 4INOA 4XVCA 3OLQA 4I5GA 1BHJA 2AOXA 3OIWA 3Q3VA 3W2IA 4E88A 2WIFA 4MSUA 6PFKA 3CT4A 1V2GA 1I7LA 5JAIA 2J30A 1F2UA 3RC8A 5FFFA 4ZT5A 1PGPA 1KORA 2PH3A 1WABA 3IAS1 4YMWA 5ENDA 4ESEA 5IJ0A 5JSQA 3PYXA 2PRSA 1K97A 1M6YA 1XRNA 4UNQA 3K6SB 1TCCA 1YB2A 3H2JA 1GPWB 2EVWX 4Q05A 4HZGA 1BVHA 4PGAA 1BMTA 1VYUA 3BXHA 1X1RA 3P20A 3Q7PA 4R54A 1M5RA 4CE6A 3HYRA 1I5EA 1G21E 1SG6A 3CUKA 4GSLA 4A2CA 3G79A 2YMLA 1DAFA 3BORA 4KO2S 5LMUB 4FHGA 1GPH1 3BMOB 3F4KA 2A9VA 2MINA 1KP2A 1G3MA 3IT2A 4J8PA 3PICA 1EFVB 3EMDA 4EX7A 4CIWA 4JS0A 2NO1A 1KRHA 5FUBA 5CCXA 5LBTA 3UAVA 4EYGA 4LY6A 1NBOA 2YDYA 1X8LA 3DAPA 3IC5A 5D7NA 2J3JA 3KZOA 3QM1A 1TAUA 5DTRA 4W5OA 2DY1A 1APBA 1N6NA 2GK4A 2RFLA 1UXGA 3RYIB 1G42A 1MGPA 5K8LA 4MICA 1QMPA 2Q7OE 2WQ7A 1E1CB 1SZPA 1ZU4A 2PJUA 1IMJA 2XQJA 1T4DA 4IICA 3AEUB 4UBKA 1BOOA 5ELMA 3SM3A 3ZLUA 4J4TA 2YDXA 2FDCA 1QCZA 3OOJA 1OKKD 2H5LA 2OCDA 2QTGA 2VQDA 3PEFA 3Q11A 2IX3A 3KEFA 4LDQA 4NF2A 4AJ1A 2FQYA 1V43A 1ODSA 4BLQA 1O87A 1XMJA 5THKA 3RT1A 3U0BA 3BMCB 1R8YA 2Z2KA 3D0OA 4V0LA 5BQ5A 1U7XA 3M3HA 3PL1A 4QNMA 5F5LA 3RLIA 3WGIA 2UVPB 3EF0A 3R3VA 4A8JB 3ZZ1A 3VDMA 2HQOA 4TQAA 5EWLA 5JSYA 4CMKA 1AQNA 3FSRA 3O8QB 5M04A 3MAAC 2QRKA 5IUNC 4ND8A 1JI0A 1HSOA 1T1RA 2EXXA 5ITSA 4Z86A 1W25A 5KSOA 1CDEA 2WKWA 1M2GA 4BVHA 4EHNA 3D6JA 3SS9X 1QQAA 2WG0A 3VO2A 3E1GA 3LFUA 2XDAA 4QJ5A 1ORVA 5CCBA 5BN3B 4B4UA 4DGQA 2NM0A 2D0DA 1Z8DA 3DLPX 3II6X 5FV7A 5KTSA 5C2JB 3TQRA 1T1SA 3OZSA 3WWZA 5BV2P 4PYJA 4DLLA 1TM1E 2DFDA 2VRCA 4ALNA 3AW9A 4P1ZA 4JJZA 3V46A 4NYIR 2C97A 2Q4DA 2NZXA 2R7KA 3B9RA 3G2IA 4I6GA 4KUEA 4JI4B 1BAPA 4UBJA 3EFOA 1W85B 4FOTA 1RMYA 4TMYA 2DUJA 1UBHS 5AXCA 1UF9A 2DFLA 2GUWA 4RHYA 2C98A 4CEJB 5G1OA 4N5NA 2YH2A 1KDTA 1TD1A 1HG0A 1D2CA 3H1FA 3CF2A 2RAUA 1SUPA 4EY7A 1COWD 1XCBA 3A1SA 2M9MA 1DS6A 2M1XA 3B7WA 5FBWB 1CY8A 1EEHA 1QP0A 5IBRA 4U7JA 5LYJA 1NVAA 1LNZA 2XXBA 3R7WB 3U7HB 5A06A 2OD2A 1E77A 1A4IA 2D7DA 5DTJA 1BXKA 2R5WA 1LLDA 3MWEB 2XUDA 2GZ1A 3IAEA 2UXBB 3I01A 4BGVA 1IBSA 4PYMA 4EELA 4P53A 3TE7A 3I2IA 1M2KA 3HJRA 3UUFA 2YNMA 3FF4A 3QHPA 2SKCA 3E7WA 4MI6A 3M6IA 3IJRA 2VSQA 2G04A 2ADOA 1JLLB 1EVIA 2BBSA 5AIAA 1PNQA 3N3BC 3ZQKA 1ZR4A 2FZWA 2A6PA 1YIOA 1SBQA 2VDWA 2JAUA 2ZAGA 3G5MA 3UH0A 3WG9A 4BLSA 4DIBA 5KKNB 1AHPA 4Y0AA 1RAHA 2WYWA 3NC1C 3IJPA 2H52A 5K4AA 5DBEX 3VKVA 5K03A 3IMFA 3K05A 5M7EA 5EWJA 1ORDA 5IBPA 2QROA 1UADA 3B1WA 2L82A 2GDJA 5AKHA 2L69A 2ZW9A 2GEJA 1H85A 3UENA 3U3JA 5P21A 2HYIC 1UBJS 1WCWA 2PKRA 3GJ0A 1C7RA 5FTMA 3LDFA 4UVHA 5TF0A 1P62B 1O5IA 4OL0A 3GQBA 4UATA 3C5WP 2DH5A 2OM2A 2WWRA 1TM3E 1Y89A 4N9QA 2ATVA 2X0KA 1RXVA 3MTGA 3NKLA 3DWIA 5JCOC 3QX3A 1PLKA 1V9CA 1QVAA 2WA1A 3K72B 3LQFA 1PGOA 4UTOA 3NDPA 3RUAA 1JUDA 1W5EA 2HA3A 4FWIB 3PX2A 4MPTA 1PFYA 4IQ4A 3K8OE 1LLUA 1SXIA 1JHVA 1ZW6A 2LCFA 3LAWA 1UKVY 3C6BA 3OUTA 3PZRA 3DKVA 1U3CA 1ZK3A 1YACA 2H1LA 5ALDA 2A9OA 1T2FA 1WXGA 1T6YA 4RDHA 1KO7A 3QPWA 3UJPA 1DG3A 3IXQA 2X9GA 1MV5A 4KQGA 1EX6A 4G0NA 4LRQA 2NTJA 3BJZA 3IA7A 1JZQA 3KJEA 2NO7A 5E3JA 5H16A 1MA0A 1G6OA 4J1QA 4O2AB 4ZOLB 3U7QA 4BU0A 4AF7A 2DWUA 3MINA 4H08A 1SO8A 2Z30A 1YZTA 3CLSD 3T5MA 3LUDA 4PHTA 4WWHA 3TSOA 4CM5A 4Z7JA 3NEAA 1W49A 2C4VA 2ZIGA 3BDVA 3QOWA 5E3HA 5DTIA 5DW0A 3JQ9A 1RNLA 1M33A 1FNNA 3H2SA 3MPUA 1M7GA 4FDTA 2XVXA 3P0RA 4OHOA 4QQ8A 1DOZA 3TZCA 5BXQC 2NQ8A 3P94A 2B78A 2B3TA 3NBMA 1TD9A 4A36A 1OLOA 5FH9A 1QO9A 3V00A 2JFBA 2AK2A 5ES4B 3NDBB 3EIEA 4K81B 3NKFA 1YDGA 1GIAA 4E46A 3JASB 1FFCA 3E81A 1JKMA 3Q40A 3MYRA 3WB2A 2Q9BA 1WV0A 5BNWA 3UCXA 3PX7A 5I01A 1FRFS 4X1YA 3RGGA 1Z08A 1CC1S 5EGSA 3N70A 2H2DA 2OZKA 2OG2A 4C08A 2GPTA 2V7GA 1R37A 1RKQA 4M1TA 2WICA 4YWJA 4UNSA 1MT3A 2GZRA 5FEMA 5CURA 4WKPA 1SD5A 2XUGA 3C3AA 3PNOA 5I7AA 1ZRSA 5IK2D 1L7OA 3KTOA 4DLUA 1CUJA 1V9SA 3ELWA 3R40A 4QQKA 4ARZA 3GLFE 3GY0A 1V48A 2BW0A 1HC7A 2WDPA 3T3PB 3HWRA 4CI0B 1AE1A 3ER9A 1Q83A 2HF2A 4X1IB 1DFGA 1QG6A 5DXAA 2VUUA 2NQ2C 4KPGA 4MUJA 1FP1D 3QVOA 3RS4A 1N3LA 4LOKA 4X71A 1S6YA 1YOVB 2VTVA 5AK4A 3IBSA 2OD7A 4L4UA 1KR5A 4PLFA 3BQNB 4UARA 4W7HA 1DC6A 5KNCA 2HDHA 5AW9A 4N3BA 1FMJA 3AV3A 1MOZA 3KAQA 3DO8A 1L5WA 2X4DA 3WK6A 2BFNA 4YWHA 1AKQA 1JJAA 3JZAA 3ZCQA 4CDMA 5H59A 5BQOA 4W5HA 5CB4F 3C6MA 3HABA 2RGRA 1SUEA 1RTKA 2AW3A 1CUBA 1SELA 3NTUA 4M6WA 4U2BA 4BLRA 1NBHA 1F5NA 1L4FA 1J2EA 2CXSA 5BOSA 1AKTA 1PFGA 1R4NB 1CNMA 3BAFA 3G8DA 2LGJA 1Z0DA 3KEMA 3G17A 4POAA 4DNPA 1Q57A 1F3LA 1GT6A 2YWBA 2RD2A 3SHVA 1NPTO 3C4JA 2A84A 2D74A 1Y3IA 3CG0A 4ZPJA 2BI4A 4BFWA 3IELA 4OXQA 3JR7A 1HI9A 2VSNA 3NUGA 3FETA 1X1QA 1I0ZA 2GOYA 3T94A 2C4NA 1CEEA 1T0PA 3L7IA 3LPMA 3X1MA 4KLCA 5BYKA 3CZPA 5LM3A 4KLRA 4NYJQ 4G0YA 1I1QB 1BU8A 3DQQA 3MMNA 2VCEA 2OQVA 1E4VA 1EJBA 2REQB 3EZLA 1QANA 1FFAA 5DNCA 4P82A 1CFJA 2X42A 2D00A 2ZCVA 3JYHA 2L2QA 1B73A 3GYBA 4FJ2A 4UNPA 2ZYHA 2AFVA 4L73A 5IM4F 1W9MA 1IBKB 2OMEA 1AUXA 2C4MA 2WTXA 4EFDA 3A28A 5AW0A 3CLRC 4YJGA 4LNAA 2VHXA 5F9MA 3PQ5A 3PXEA 3DPIA 4X54A 1USIA 1G0NA 4KLZA 4U7GA 4LBWA 1GD1O 1HOXA 1E8DA 4BZQA 5ADVA 2W5UA 3FSGA 3VH4A 5EY5B 1RKUA 3SJCA 3FYSA 3UWDA 3PWKA 5JALA 1U2GA 1Q7TA 2WHPB 1AKUA 1NBEA 1EDDA 3Q3JB 4A0QA 3OCZA 4BL5A 3ZJUA 4DMKA 1NIPA 2BMAA 1OXVA 2HD4A 1V5IA 1WHTB 1XZGA 3QVTA 5EA2A 3T5TA 3W5AA 3DZHA 3TGWA 1YL5A 1CS0A 2BM8A 2JHPA 1YHZA 3AF0A 5EJIA 3USZA 3ZE8A 3PPYA 2DUWA 4XR9A 1JF8A 4DLZA 2WAYA 2V74B 5D3QA 3ZDEA 2PD3A 1DTWA 5BSVA 1FNBA 3DTTA 4FWBA 4C4ZA 2QMYA 1WM1A 3BWBA 3PEVA 5IVDA 2YV1A 3QLJA 4UEWA 2F3SA 3K73O 5H0IA 1O6BA 1WMDA 1RYNA 4ANFA 3RFVA 1AV6A 3D7SA 3ZU6A 1N2GA 3OPQA 3OZCA 1ELOA 1F60A 4KAXA 1P1CA 4DS3A 2LDBA 2HQ1A 2QBYB 4WOPA 3HB1A 4RQBA 5E1MA 3NBZC 1AUVA 2H4WA 4W8HA 3UJ8A 3AY3A 5AQ1A 1RSZA 2JLUA 4C0XA 1G64A 1SUBA 2QU7A 3EF1A 3O8CA 4JLJA 3THYB 1ST2A 2B6HA 2X1LA 3CJQA 3KKEA 4HYTA 1SUSA 1Q21A 2IYNA 4TLCA 3KL2A 2E3JA 5LC1A 3PRHA 3HUFA 1H5NA 1ULSA 1XB2A 5CFNA 3U37A 4BNDA 1OKKA 1AF4A 2YOGA 3DNFA 1G8MA 3L0PA 2RAVA 3O3NB 4Z2YA 4MW5A 1RWPA 2B6NA 3TOVA 5JCJD 3CUEF 3Q9UA 5D5PA 1FE8A 3V2IA 5IZCC 1D7OA 4PTYA 2P1ZA 5ARBA 4J3FA 4LYYA 4RPHA 2IY8A 4CXMA 2VRCD 4BMVA 1RC8A 3ZNNA 3N0XA 2CXHA 3LT1A 4L07A 2C2ZA 2UAGA 3QELA 1Z4IA 4H60A 1GTVA 3F4BA 2ZB3A 3VV2A 3H84A 1CZLA 4FX5A 4CKZA 3KTDA 5GONB 2HRZA 4B35A 1IULA 4FDMA 1Z0IA 2QA5A 3WFJA 4CW7A 1N4DA 3FPFA 2ZIAA 1D0SA 1PFUA 4HK4A 1QX3A 2JIQA 2OGWA 2Y1FA 4PW0A 4WXYB 1E9CA 2DQSA 2NV0A 4IJMA 1AT1A 3SC4A 2ZYGA 4BBJA 4NFSA 5DLDA 1XNGA 3HV2A 3IEXA 5BWBA 2QM0A 4JH0A 3V9PA 4AZVA 3RSHA 3LTEA 1UJNA 2JRCA 2XYRA 2P6MA 3IDOA 1HKHA 2M6SA 4HNTA 2FOIA 4FN4A 5L4SA 4QM6A 5D86A 1H23A 3K0SA 2QAIA 3D1LA 5HIMA 3EDRA 3S29A 3AF1A 4BPRA 4CETA 2XTAA 2AC2A 3W79A 1I6LA 2C84A 4ZDIA 5TV2A 2ACKA 1L4LA 1NQOA 1U9ZA 2H3HA 2XUPA 4MVJA 3ZKAA 4GBJA 4NV3A 4PIMA 5A9RA 4JCCA 1NLUA 3Q7TA 5DHSA 4R1NA 1QF9A 1X7ZA 3O4JA 3U81A 3ILVA 1GNQA 1G16A 2ECOA 3WDSA 3QXJA 2IUTA 3ADKA 5ALLA 3GDGA 4YFVA 1SQGA 1E58A 4PFQA 3KYJB 4UOEA 2FCAA 1JEYB 3NTVA 3R0JA 5IAAA 2GJ8A 2ODWA 3HBFA 3PGMA 3H99A 3KELA 4KQHA 5AI0A 5KOJB 1R3DA 4G4GA 3H04A 1IB6A 5FPTA 3R4VA 3ZI4A 1JKFA 1KA9H 2CMKA 3GR6A 5LOVB 1KAOA 2XE6A 4ZVKA 2PT7A 3NLLA 5B3AA 2HU5A 3K0FA 1ZL0A 1A5AB 3DO6A 3NM4A 1J8QA 3QKIA 2IGTA 5CTAA 3VC2A 2B83A 1JIUA 4UHDA 1DGQA 2ADMA 4LHSA 3VI3B 4LNUB 3EY4A 4YRSA 1LI7A 2X9NA 3COYA 3JSXA 4DLWA 1TZKA 3RVRA 2FZEA 4JFAA 3UIEA 5TC4A 3ZEIA 4EW1A 3DDUA 4JEMA 2QX9A 4OB6A 3HSYA 2QF7A 5AJYA 3SMVA 4I8XA 5DH9A 4EKNB 1A1SA 3NJ8A 3SD7A 4AQ7A 1Z0UA 2A35A 4M8NE 2BP7A 3B82A 4NYJR 1QTNA 4WCDA 3R7NA 3UXYA 5AVZA 3ZD7A 1K7EB 3DVAB 5CH8A 1XTSA 2AEEA 3DMYA 1Q0QA 4W9NA 2NUPA 3PCRB 2GN6A 4AD8A 1CQJB 4AROA 3U44A 1JG6A 2IUYA 1W5TA 1TF7A 1PX0A 2R8XA 2RMKA 4JU9A 1PGJA 4RF3A 1Z63A 4I55A 3I2GA 5C8YF 3ZY6A 2F4NA 3I58A 1I7PA 2GI4A 1QQ6A 3IUYA 3C7AA 1JEJA 2WAAA 3I5XA 4FMPA 4MQLA 1V9LA 4XSGA 2BIFA 1EFPA 4FFOA 4YK7A 5EZSA 3AKZA 1O0CA 4G0PA 1BCSB 2DPLA 2SNIE 1SCAA 4V3BA 1HL7A 3BF8A 4YDSA 4AY6A 3VR2D 3H6GA 4IVRA 4MO2A 1ODCA 1HDXA 1Q6ZA 2KMLA 3CZQA 3L0ZA 3M2TA 3PV0A 2BMJA 5ALOA 4D9JA 4DMGA 3GEDA 1JG1A 2IY9A 2Q5JA 3HL4A 1QIKA 4Z0HO 3WGZA 3ITNA 1N2JA 1N7IA 1FL9A 2RK3A 3FIJA 3KPVA 3T7AA 5G0TA 1GITA 3TLGB 4F6LA 3BWDD 2EEPA 3QWHA 3VSEA 1SB8A 2C5SA 1RQNA 1M6NA 1UXOA 2E4AA 1NQTA 3PNBA 1O08A 4JY7A 1FMLA 5FPSA 1E1DA 1P4RA 3W9YA 4B46A 1EHYA 2DCMA 4M7OA 2I9PA 3D3WB 3FHOA 2J67A 3FB4A 4X3CA 3Q8XB 3RS8A 3VR6D 4XYLA 4WBSA 4UTVA 5I8PA 3Q0TA 1JAZA 4MA5A 5J43A 1C9EA 4IEFB 4YJ3A 4CTKA 1T3GA 4BN5A 2YOFA 3PDWA 4R8SA 3TIFA 1EFAA 1OZFA 3ZWVA 1NKTA 3JVEA 4GSYA 4HNAB 4TTIA 3ZLVA 1BN6A 3LC2O 3WISA 4WXEA 4IX9A 3G0DA 3WBKA 4PNEA 4ZIRB 4BLOA 4O2BB 5BSFA 2CBZA 3QA9A 1IQRA 2AYZA 2JLWA 4DLAA 4CT5A 3KYCA 2OXFA 4GSKA 1C0PA 4WZAE 2MCFA 2BH2A 2A5LA 2YRFA 1R00A 4LAFA 5DGHA 1ZRNA 2I3GA 4WLUA 4DRZA 4E7OA 3L04A 3O38A 3K96A 3WLLA 1HTBA 1JMYA 1N1DA 4Z9AA 1DWQA 3NH6A 3HCDA 4K8RB 2FK7A 1EK0A 3CXRA 3I6MA 4QHTA 4ZVRA 3BD8A 4EPVA 3JWGA 3CZMA 3UJAA 4IJ6A 5DYNA 3ZZTA 4QLAA 4H1VA 3I32A 2BZGA 5C8YB 5K3EA 4U02A 1IAQA 3KT8A 2PUGA 3K9LA 3O0TA 3INNA 4OHYA 1RYFA 2IKSA 1X7WB 2JLXA 5IDVA 2YUTA 5KC8A 3ORRA 3SIRA 4EY4A 3F2VA 1XJWA 1JDBC 2MDTA 3TTWA 1A5TA 3B3JA 1M2OA 2R8EA 3INGA 5BN5A 1F6WA 3R44A 1AA9A 1BNCA 4AK9A 1T3SA 1YA4A 3I0NA 4JITA 2Q8NA 2FRDA 3W8NA 4JVSB 5KI6A 2HREA 3TR5A 4BMYA 1E3IA 5G02A 5KKAA 4RA6B 1ISHA 1OT5A 1QRDA 3TOCA 5K0SA 2AF4C 4QPZA 3FTNA 4UDXX 4OQMA 4DV2B 1KC3A 4X6UA 2FMTA 2EARA 4URXR 2FDXA 3TZEA 3VTFA 4IIDA 3WGOA 3QY0A 4B6GA 2BGNA 4X64B 3GEBA 1TECE 1LPOA 1P4AA 2IY7A 3JYQA 4EITA 3H1AA 2GZSA 2IQIA 3MTJA 4ZN6A 1G21B 3W1WA 4EFKA 1U7UA 4QFDA 3LFTA 2F43A 2BKVA 1QV9A 3HL0A 5JBQA 5JRDS 4ENSA 5I7RA 5EJ6A 5AR1A 1QIMA 4KWCA 5EKSA 2DVMA 4AKTA 1EVLA 4JXJA 4B31A 1TF2A 5C18A 3LUPA 3UPUA 3C8UA 4Y6PA 3URMA 1ZGAA 4O8ZA 5BO5A 1YKFA 4PXSA 3TQOA 2YMMA 3RAFC 5EXEA 1UPCA 3D4OA 4NSNA 4PAMA 3T3DA 3IJEB 5CAEB 5CXQA 1XWIA 2OY0A 3LF1A 5EL0A 1A88A 4OGWA 1L7PA 3ZR4B 4U0JA 2Y2VA 3F7TA 1F48A 4O25A 1YZLA 4NY1A 3TG2A 1TPZA 3O9VA 1P9NA 1Z0FA 1SXJD 4XIYA 3A6GA 3QE3A 2P9ZA 3QENA 2HV9A 3I05A 3JQQA 4UCWA 3VNRA 3DDWA 3IEUA 4C0WA 2BR4A 3FSGD 4WZBB 1XZPA 2FWRA 1TVCA 2Q2QA 2Y71A 2CLIB 3OKPA 4BCBA 5TIIA 3QPVA 1P2TA 2PJDA 2W6CX 4BKQA 1RPZA 4E2WA 4FI3F 3WL6A 3VR3A 2ERCA 4DM3A 3GZJA 2WV7A 4G5HA 1JQDA 2J9FA 5COQA 1LI5A 4RULA 4B47A 4ZI7F 4Q3DA 2WJVA 4L5IA 4NMMA 1ZYUA 4B2LA 4BAUA 1HF3A 2VFAA 5JASA 1UDAA 3MVEA 1F4LA 2C0QA 4UBLA 3NV9A 3RC3A 3ZIDA 5JISA 4D0GA 2I2AA 3A6JA 1R6VA 1ZOPA 4QEKA 5HCUA 1BEZA 1NVWQ 1OMOA 4DDKA 5A1TA 2VK2A 4LYFA 2GF0A 2GPNA 2QJWA 2Q1WA 1J23A 1SXJE 3O8OA 1Q19A 2ZI6A 4NEQA 4RJIA 4HZUB 3GP3A 3MOIA 3UMSA 2MMCA 3BFXA 3VDQA 5EUCA 2W2VA 2F1JA 4LKOA 4RYLA 3T1OA 1ZN9A 1U0RA 5JRZA 4LE1A 3E27A 2HHJA 2OHVA 1ZBDA 2EBUA 1EMDA 4Z2AA 5IJ9B 3E1SA 3BRCA 3N76A 5K3AA 2VSFA 1EDBA 4L28A 2GARA 2WJHA 1PT5A 1U1IA 2R8RA 2VWQA 3H17A 4I1PA 4LECA 4M37A 4WOKA 1AJEA 1PJZA 4QPPA 3FCUB 4WERA 2ATEA 3GH1A 4QUHA 4AZ3B 3CZCA 3IOBA 2YVLA 4JDPA 1SHTX 4OMDA 1SB9A 4F9TA 5JBNA 4X92A 5D87A 3G8AA 3H65A 5JPIA 3T38A 4KQ9A 3RIYA 1E3SA 2BFAA 4ZCSA 3I01M 3A6ZA 4BJ5A 3KVOA 4L4YA 1T43A 1GL3A 5E6RA 1HNWB 3H16A 2VPZA 5DM4A 5FPHA 1UBRS 1Y5LA 1MJNA 3ZTWA 4G24A 1GLVA 4KXYA 1LW6E 3AUJB 1I2BA 3MILA 3LE8A 4I8DA 5SZKB 2ZM5A 1YFLA 3QP9A 1X9IA 1U31A 2YOHA 3UTCA 3WIEA 3PFNA 2B1QA 1K7FB 1H5UA 3NONA 5ELLA 5LQUA 4AY3A 2HXSA 2JFHA 2R6JA 3QU7A 1OWNA 4FGWA 2FR0A 4LYEA 5FO1A 1BQEA 1RPJA 4G4JA 1P2SA 1USKA 2KM1A 1ZD2P 2HW8A 1R5OA 4MARA 1NP6A 4US0R 2KSQA 1LPAB 2O06A 1DZIA 3PKZA 4M9RA 3ND6A 4HAUA 3BM5A 4NENB 1NJFA 2FEAA 1PS9A 4D46A 2BLLA 2PMDA 4R01A 3RU7A 4GGOA 1THTA 3Q72A 1KTIA 4MVXA 1EA5A 4EHHA 3UOGA 1NXPA 3CNLA 2BBWA 4W1PA 3E3NA 2W0SA 1XEWX 4MW4A 4X24A 1GDTA 1VP9A 1Y33E 4ZQCB 4H18A 3NO4A 1PVOA 3VKGA 2PWAA 1QH1A 5ICEA 3LYHA 4KK4A 3HFSA 2DFTA 2R68A 4TMXA 2BKLA 2PUWA 4EA6A 1CJCA 4QWMA 3GJTA 4ZVMA 5IAJA 2QSZA 3E9MA 4TMVA 2KBEA 1U5BA 3AFHA 2IL1A 2J7KA 2IXFA 2W8BB 4BZZA 3N8KA 2PMFA 1YQDA 2ZLBA 3SF8A 3ZVNA 1JEAA 3DVQX 3RAPR 3SNKA 1U3FA 2RHMA 3UG7A 3LHSA 4UFNA 5IDQA 1CX9B 8MHTA 4RTSA 2CVQA 1KY3A 2HAEA 5GP1A 1IZYA 1MX3A 3IGFA 2FUCA 3DVSX 3ZXSA 1XCMA 3RVSA 4BWYA 5DHPA 3RK4A 2G4VA 2GCOB 1ULAA 6CHYA 1GN9A 1I4LD 4RMNA 5KNLA 3GD7A 2O0HA 3GFSA 4NTZA 2WC1A 3K53A 1S3GA 1KEEB 3FVRA 2GK7A 3ZHUA 3DO5A 4QGAA 4OI0A 4ZZ2A 2HH9A 3KR9A 3DCNA 3L0IB 3I9JA 1X94A 1MO6A 1ZBQA 3I6BA 4QQRA 4JJKA 3EXFA 3ZWKA 4PN3A 4KQ2A 5JANA 5CM2Z 3ZN2A 1DHTA 2C57A 4MWOA 1XX6A 1JLLA 4WY5A 5F5NA 3IIJA 2JFXA 4A16A 5HKKA 3ABZA 2PIAA 3D6HA 4TXJA 4X6YA 2A88A 4P92A 1FSSA 1MJHA 3KK0A 2R0QC 4MVJF 3A2MA 4MV9A 4TTAA 3ZH9B 3CCFA 2VTKA 3D31A 1JHDA 1XC7A 4E09A 1CEXA 2Z8XA 2OGZA 4QICA 2J9YB 1TDJA 4ZI7A 1XRQA 2P6UA 3DR5A 1HQYE 3KQTA 2JZCA 5F3RA 4BX9A 4CKXA 4JGBA 4CMHA 9LDTA 4F93B 3VSDA 4OFWA 2O2DA 1XHLA 2WW8A 3H5TA 1E4YA 3LP5A 4XGIA 4NPHA 4EX6A 4M53A 4DMRA 4QM7A 1XYGA 2E4WA 1XEWY 3P9SA 5L6LB 1YB7A 4COOA 4F6RB 1WETA 2C1ZA 3QE0A 4Z6KA 3DFZA 3L7BA 3M1YA 3DMFA 2BFDA 2C2WA 1XKLA 2OQRA 1PR0A 1E9SA 4QYIA 1DAPA 4IL5A 4RIFA 5DKFA 5DNVA 2H7YA 4S1VA 3B48A 2QL6A 4B83A 5HWSA 2XMRA 2Q8QA 1MIOB 1CJVC 4JIGA 4O5AA 4RTPA 1PYDA 2YN4A 4K9PA 4EB8A 5I7OA 4B7XA 2C07A 1G8FA 3B1XA 2G5TA 4WASA 5EYPA 3KHKA 1JFSA 2Z1NA 4KR3A 4OMCA 1DO0A 1D6JA 4E5NA 1TUGA 5EESA 3PITA 2PX3A 2Q99A 4JEHA 3NYQA 2WKPA 1HQKA 3D1JA 2YYAA 4NRDA 4Q9NA 3WAKA 4KE9A 1R0LA 3PHLA 1BH6A 1THZA 4Q9LA 3T1NA 5FP0A 3VUFA 3WZMA 3GLUA 4BMZA 3N3AC 4Z51A 1KE2A 3T3HA 4M0FA 1KYWA 1PFVA 2XUOA 2ZJ7A 4KKVA 5HIIA 3EEYA 2IDMA 4C3UA 3BXZA 5T4FA 4ER6A 2WZCA 4A5OA 4HNGA 1T13A 1XFAA 4G2TA 3ZU5A 4UBMA 5ALWA 3QFCA 5IM5A 4II2A 3W6UA 1TK3A 1XTKA 1E2GA 1RXYA 1KAHA 3ZDZB 4PNZA 4A8JC 4PVDA 3RHTA 1E2JA 2C2OA 2PIDA 1QQTA 3JASA 3QWFA 4LXHA 3TEJA 3W7VA 3R24A 3VYRB 2NUBA 3CLUC 4U6SA 2WJAA 3WLFA 4D9GA 4FEEA 1ACLA 3HNOA 3UN1A 5B57C 4HN2A 1E7MA 3ZZNA 1YA6A 4C87A 2BUBA 2D2FA 1OPXA 4G26A 3C48A 5KYUA 1C1HA 2NTVA 4GEGA 4K26A 4F06A 2DKNA 3AHCA 1O8BA 5IRCD 1N5RA 4MKIA 1OAOC 4HPWA 5DTMA 4ILKA 5BNFA 5CNJA 1BMFD 4EG5A 4JBNA 4MWZA 3R9XB 1KAMA 3C3BA 3VU1A 1T91A 1GG8A 3LGSA 4EI7A 5LIRA 1MMFB 5LXTB 2QNBA 1QOPB 4YV2A 3M9XA 5KNDD 3BOSA 4MPDA 3AR2A 3W5JA 4EY8A 4BNJA 3FDZB 3SIWA 4X8OA 5F12A 3ZU2A 4L4ZA 4QNNA 4XYEA 3V4SA 1R8SA 1U7HA 2YZNA 2X1MA 3UW3A 3WMXA 1ZAKA 2BHLA 4OO3A 4TL7A 3LBAA 3UFBA 4AKIA 4KODA 4Z0PA 1ISGA 3E23A 1MEOA 1ZFNA 1DBWA 2PH5A 1ZK1A 1TQDA 2BGMA 4U6QA 4WEQA 3WB1A 1R10A 4RJTA 1VRCA 1UFKA 5B3JA 5CCEA 1W94A 3OIUA 3SS7X 4PXAA 2Z2YA 5E0OA 2ACEA 3TW8B 5CH3A 4NZZA 4HP8A 3ZK8A 1R1DA 1Z3IX 2ESRA 2FOXA 2PGJA 3EG5A 5F1PA 3T6KA 3ZKWB 4DCMA 3KQLA 1C8VB 2OCPA 3C3JA 4H3VA 4IO1A 3AM4A 4XEHA 1U1EA 2XAAA 2VHJA 4LJKA 3P0EA 5AI8A 3PA6A 5IH3A 3L5KA 3MWGA 2XUQA 1P17A 1P6UA 4J7CA 1IZ8A 3RUIA 4B9AA 2PZ8A 1RABA 1J2RA 1R8XA 2O6LA 1QGDA 3B1ZA 2YWGA 4AZSA 4C20A 2GFIA 5AW8A 3QEAZ 1AS2A 2BL4A 3IHWA 5JZVA 1I1HA 4GT1A 3VC1A 4F5WA 4OJQA 4P6VF 1JHMA 1SBYA 4HGQA 4B3IA 1UJBA 1NVEA 1JZTA 1XVTA 1XL1A 3F98A 2W00A 3PRYA 4K6OA 1YS2X 1O94D 1Q3TA 1R9JA 5JV5A 5DZSA 3KYDB 5HGXA 2LIVA 5TMDA 5JQWA 4OLBA 3N5CA 4ISBA 4KJZA 4IG9A 3RPEA 3AVQA 1KI3A 3DOFA 4BO8A 1D2MA 3U60B 2FZ5A 4G36A 1YR3A 1AS3A 1YRBA 4L5YA 3R3YA 3WLAA 3TDMA 3IDQA 4MRAA 3RASA 2GD2A 1NNUA 5HHTA 8ATCA 4I1RA 1J2JA 3NVAA 4CLRB 1KI7A 3GCDA 2BFWA 4G63A 1W2HA 3HQ4O 3KXIA 4YO7A 2CV1A 3F71A 1LI4A 2D62A 2MSCB 3Q5DA 1GHTA 4Q9AA 5ETJA 3GRPA 1YCDA 3PK0A 1J06A 1W4BA 2WLTA 2JZNA 4C4XA 1YA8A 4K8OA 3SC3A 2J4FA 4J03A 1RE1A 1BX0A 3LKBA 2W7TA 4MWSA 4S0ZA 2IOHA 3VSCA 2H1IA 2IYPA 3ONWA 4QBGB 2GPBA 4H7IA 4AQYB 3TF5A 3CWZA 1ZD5A 3E9EA 3THXB 1SHUX 4URUR 5BOVA 2VIIA 1H1TA 2QGZA 4LXYA 3RQIA 2HU2A 1ZHOA 4LF6B 2R00A 3NTQA 2ID9A 5FTWA 2ZWOA 1G3QA 1MOQA 2O8FB 2WK1A 1H65A 4GBGA 1CZOA 1WX1A 4GBMA 2Z43A 4MDYA 1AGNA 1ZM3A 3G1TA 3FOAA 3GDWA 3ZW9A 4DVJA 3PZBA 2B5OA 3DV0B 1CW2B 1W8DA 2KX7A 3IOCA 2HSDA 3PFBA 5BV7A 3A1UA 2ZDQA 3BRSA 1KEZA 2QTHA 3R8CA 4K9NA 4A23A 5BMVB 1TRKA 1KFJB 2RH4A 3JYNA 3KLOA 3PYLA 1X7HA 1HO3A 1TZMA 4BC0A 2OLEA 2Y3IA 4Q12A 3E8MA 2HEGA 4BV2A 3I61A 1P73A 2CNLA 4TKUB 3ZGXA 4ALMA 3BULA 3ET4A 3KJHA 1DV2A 4QG7A 2YC4C 2ZRHA 3KOOA 4U7FA 1W73A 2ENWA 1LNSA 2CVZA 2WWWA 3E84A 3HDQA 4NPAA 1YB6A 1C7JA 4XLTA 4BNXA 1NYRA 2CFCA 2RC6A 1PJSA 4LJAA 1BXGB 5BVGA 1ZJWA 4ESVA 4G4SO 4CLHA 3BE8A 2R96A 3O8LA 5B1DA 1UJ5A 3LC1O 1GVNB 3FOZA 1NTRA 1SG0A 1XCPA 1ZVQA 3KVRA 1L5HA 1OB2A 1YZHA 3M4YA 1ZH4A 4MV7A 3R9KA 4BQIA 3PPIA 3WZ2A 2A92A 4LHEA 1EGMB 1TTHA 3HDGA 1V1JA 5T57A 5IXSA 3LHKA 5AUOB 5LIPA 1R66A 1DQYA 4KDRA 3PEUA 3RJMA 3W9BA 4Q93A 3NEJA 4R05A 1TQ4A 4D3ZA 1CFZA 5KJ6A 1M2VA 1ODLA 1XTRA 3AY0A 3F6SA 1Y8CA 3OY7A 1TJ4A 3PEEA 2ZUDA 3BCRA 2YJ3A 5ICSA 3L6CA 2YFKA 3K9QO 4FMDB 3HVRA 4KPYA 1P5FA 4PHGA 1DP4A 4DV6B 3SHFA 2JEOA 5IVPA 2YV2A 4BDTA 5C46F 2FMKA 3R2JA 3ZI0A 1QZZA 3KYBA 3Q6NA 3O83A 4B6RA 3FDXA 1P7ZA 1E98A 3EZGA 4BNLA 1IATA 4W63A 4X3PA 2NUTB 3Q3HA 1ATZA 1K4YA 3N05A 4DJTA 4IP0A 1ZJ6A 1MENA 1C1YA 2JASA 2R85A 2XBLA 2PUTA 2EERA 3BXOA 2FPPA 1P29A 4UHFA 3V9AA 2CNBA 5E2IA 1FFSA 3KKZA 1PWHA 4GUDA 3OFKA 3TX6A 4CU5A 1M0EA 4YRDA 1NNLA 5IW8A 4KN6A 3C3KA 4DG8A 1NVKA 4QDXA 1DKOA 4MP8A 2O2HA 4ZJPA 4G0QA 4ZU1X 2PXCA 3IP7A 2XHZA 2H57A 2QS9A 1FX0B 3A3YA 4N54A 4MR8A 4RENA 1VJCA 5LA6A 3J81k 4O3MA 1Z6GA 1DEKA 4YNBA 5IKOA 4CM4B 1BKSB 4A9AA 3DHEA 1XTUA 4Q6BA 1KFKB 2ECPA 2QN6A 4GLFA 5LP6A 2BV3A 3HU5A 4YTEA 4RD2A 1G2OA 3VDXA 1GXSB 4FS3A 1XI2A 5J4YA 3WBFA 3UAYA 5BSEA 4PS0A 4C1BA 2CLFB 3KJZA 3CEMA 1GSIA 2H3EA 2PD6A 2WR8A 3RF7A 4WOBA 4BN0A 3OQMA 2AJDA 4JGIA 3SKYA 4KE8A 3ROGA 3ZTTA 1FRZA 1T9AA 4TUYA 4AJOA 3IE0A 4AIIA 3WC4A 1EQAA 5EQFA 1OLUA 1GILA 1H4TA 5GVRA 3VDRA 4AUKA 2Z6AA 2H1OA 1LDBA 4Y2HA 3EWIA 1J5PA 1MHPA 1T0IA 5B36A 2FB9A 3FPGA 3G7NA 4X1KB 1KSFX 3GRRA 4I50B 3G2OA 3M82A 3CS3A 4GQBA 4XX0B 3MS7A 4XFDA 4D9BA 4EZIA 2Z1DA 1OLXB 3QMWA 1T5IA 4JQZA 4RM2A 2PA3A 5FR1A 2CVFA 2OV3A 4PNPA 3CZ5A 4EATA 3CVYA 4EHIA 2R6R1 2Y77A 3BZBA 2N47A 1P2VA 4N7BA 1E63A 1X1DA 1VLMA 1Q1GA 5ENVA 3R74A 2HRQA 3RS7A 1THMA 4EFNA 4X6LA 3RC7A 4BRZA 1LV7A 4NECA 5A03A 5HOQA 4FLEA 4LGYA 2VTEA 3SJBA 4GVLA 4H7FA 4ZAVA 2YJ5A 1IY0A 3G49A 5I8WA 4IDBA 1NNEA 1B93A 3UT0A 4DJJA 5ALEA 3CF0A 5CDFA 4ENTA 5C1OA 1FQWA 4MDEA 3YASA 4FVTA 2YMPA 3C8ZA 4HX9A 4Q3LA 3LC7O 5ALNA 1U11A 4MI9A 4Z9YA 3EEIA 1GPYA 3HV0A 1QVWA 4L9SA 2ZRMA 3NUQA 3BJIC 1T1EA 4MVJP 2RHHA 1ZGGA 1S1MA 3G8YA 4J0JA 1OI2A 4MR7B 1RCFA 2X4LA 1U6IA 1SM4A 2XUHA 4L78A 4JXZA 2TSYB 5CVTA 2VBIA 1ECGA 1MTZA 3HNPA 3HO6A 5FX2A 1Z4KA 2JEZA 3OTOB 3DYBA 3GOQA 2D5IA 4UOZA 3FCAA 5ALQA 2IUUA 1GZ7A 5IT9A 4BAGA 3ORYA 4BRSA 1SKBA 1JAXA 4C3ZA 3TWOA 4RQUA 1XA3A 4NXMB 3ZCPA 3V80A 4C43A 3HB5X 3QV1A 4B6SA 1OTHA 1Z56C 3AW8A 4E21A 1IQ0A 4F4UA 1JIKA 3PDJA 2Q9AA 3ZJ4A 2OXCA 4HTFB 2IPLA 3VHQA 3E7PA 5F4BA 3L8EA 2Z3ZA 1CB7A 4M89A 1LBTA 5IAGA 1BA2A 3KG2A 4EHBA 1N77A 2CSXA 1QKJA 2HRRA 2AOVA 3DOEA 3HKEB 2QK4A 1KFEB 4GQAA 4Q39A 2EDAA 4RCVA 3UMVA 3RV3A 3R0XA 1PQPA 1F8YA 3OBBA 3JD0A 1LSUA 4LI0A 4OL9A 2ZSUA 4OK6A 4JI1B 1FC0A 1SUWA 4RC9A 1GGNA 3GEPA 2D13A 3CMCO 4GOXA 1XNRB 5FOTA 1JHRA 2O2IA 4GO1A 5I9BA 3UWPA 2H8KA 1YZYA 2VWPA 4L6AA 3IJ5A 4BIIA 2VP2A 1GDDA 2Q0XA 3ND5A 3D1VA 1S02A 3FB1A 5CUQA 3UV7A 2OZVA 4CKCA 4AB1A 2FZKA 1MAUA 1PR4A 1GAWA 1QKIA 1RQXA 2I8LA 2XMBA 4P32A 5J1TB 4CQMA 3D4IA 2FJ0A 3CB2A 4WZBE 4LVNA 5AM4A 5AO9A 4PIPA 1NOJA 3CR8A 3LG2A 1KYTA 1ORHA 2WSSD 3RS3A 3V6LA 3CE6A 3U3ZA 3L4JA 3UK2A 3PUJA 1HL3A 3CURA 3CISA 3IT3A 2VUIB 1U2GC 3FVQA 1FS6A 1QZXA 3BC1A 2ZSHA 3CEJA 4JSYA 1EK6A 1EVKA 2QD3A 3IQZA 1GZHB 3AQIA 3HI4A 3R3HA 4NHEA 4GMFA 2XWQA 3AEZA 4G3XA 4PGFA 5DHUA 1IHDA 4HGOA 5EXSA 2EZ8A 4OQZA 3V42A 3G1UA 4ILEA 3MTIA 4A82A 1MQ8B 4EENA 2V3VA 3UHOA 4Z99A 3K1YA 3FMFA 4DNOA 1P61B 2RI1A 2G1PA 3L18A 4DDHA 4UOQA 3N2GA 3UUEA 1TLLA 3VYWA 4ZCIA 2GASA 2AHRA 1RWBA 3OPYA 1SK8A 1L1EA 3RU2A 4B3GA 1IK4A 1TUBA 1DIOB 3IQHX 4XFKA 1A7UA 2EDCA 4B3DA 3HU2A 3B3QA 4UAJA 3ZU3A 4BNMA 2E2WA 3E3MA 3A9SA 3PQ2A 1SVKA 4PLGA 4YAIA 621PA 1D3AA 3PQ4A 4NNPA 1M8GA 3NHFA 5FNZA 1RM0A 1IY9A 2DFNA 3DHNA 3KFXA 4L2IB 3SJUA 3ZIUA 4E3WA 2D0PB 4L4XA 5AM3A 4G6ZA 3NWOA 1A98A 3PXAA 3ITEA 4MKXA 4D4LA 3EGDB 1CU1A 2H59A 3GB9A 3FW1A 5HUHA 4GI1A 4UVDA 5DGCA 3OCWA 3JQAD 3GFTA 5ADHA 3AG6A 1G20E 2EBWA 2Z6VA 4F2HA 4JELA 3OPNA 3PCXA 2BFBB 3Q88A 3CNEA 3R7BA 5AVUA 5CLIA 5CT5A 1I33A 1VJ1A 3EXEA 3K1AB 2O57A 4KFCA 3QVGB 1UBSB 4DSUA 1WCIB 1D04A 2XIQA 2NU6B 3E7FA 5TS2A 5JS1A 4R3NA 2FQWA 3ASYA 1XKXA 3K0KA 2Z8YA 3TJMA 4CF3A 2FWPA 3DM5A 4UNNA 1NKVA 1SA0A 4HGRA 5DI3A 2V9CA 4C22A 1ETHA 2DEUA 5HJ7A 1W4AA 2CN1A 1NXQA 1XVAA 1B0AA 1LZKA 1GZSA 3OQJA 4ZODA 5TB5A 3RNOA 4BEWA 2V4MA 5TQ0A 3B78A 1DC4A 2C2GA 2QRVB 3NS7A 3TRKA 4AWAA 5K20A