2X4IA

Orf 114a from sulfolobus islandicus rudivirus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
112
structure length
105
Chain Sequence
b'NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGHDSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISILTLEEILKLYESGKVQFFEIIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED PROTEIN 114
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus islandicus rudivirus 1 variant xx
molecule tags Unknown function
total genus 25
structure length 105
sequence length 112
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08960 DUF1874 Domain of unknown function (DUF1874)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x4iA00
2J85A 2J6BA 2J6CA 2X4IA
chains in the Genus database with same CATH superfamily
2DBQA 2X8BA 4PC7A 5M3BA 1MQAA 3T4XA 3IESA 9LDTA 2O0MA 1JXQA 4M8IA 3MTQA 4A6EA 4JB0A 2IZ1A 3MJFA 1AOXA 4TZ6A 3W4JA 1GZ4A 1H4TA 2Q2OA 2OZLB 2N42A 3EJWA 1GPMA 3L5OA 2FWAA 2G0TA 3LBFA 2EGGA 4X20A 4B2IA 1DBSA 1YE3A 3NVAA 5AW6A 4X8LA 4LDZA 1NLFA 3M6XA 3C5EA 3V8EA 1S01A 1KR5A 1OBCA 1TMGE 2FH5B 3QPUA 4H0NA 1YZGA 5BWCA 3GZTB 5I9LA 1T5OA 4MB0A 4MPRA 4UM7A 3CNLA 3JWEA 1FZQA 5HF9A 5KJFA 4TXMA 1JR3E 3NOQA 5DYNA 1TZJA 1W6UA 1WLYA 3BVPA 1VLHA 1JJAA 4WZBE 5EIAA 1O0CA 3FZQA 2RHTA 1IPHA 2GCOA 4O5OA 3SYLA 1OZ0A 3DW3X 1KS2A 4Q12A 3X3HA 4D82A 2HADA 2YS7A 2JJ1A 1JTEA 3MJRA 3RFFA 5LKRA 2R65A 3KOUA 1MA0A 4KH0A 3LPLA 1KP9A 2MINA 4P2BA 1R0XA 2X2PA 1A5ZA 1EFRA 4LVOA 3EPRA 1N3LA 3OLZA 4X6UA 5AI0A 3T5PA 4JBXA 1S8NA 2MYTA 4TS1A 4PANA 5ITZA 1JDSA 2IYEA 2O8FB 2VFAA 4HOYA 4TWJA 1M34B 5GPBA 2WD8A 4NDAA 4GIBA 4E5UA 3LQKA 1YU9A 2ZR7A 2HWKA 4Y2HA 2GBCA 1XP5A 4EUEA 2JGJA 2UYYA 1YK1A 1NF3A 5JJCA 1DG1G 2ZJ1A 3G82C 3O7MA 3FZYA 3MXOA 4QBGB 4JJZA 4HEA6 4C04A 4I4TB 3TM4A 1XF9A 1UBJS 2QYHA 5AM3A 4O4LF 3FTNA 1CEYA 3INTA 1LSJA 1GPKA 2WAAA 4LJRA 4LY6A 5DO9A 5JANA 2Q1YA 3P2JA 4E07A 1Z28A 4Z54A 3DCJA 3N5CA 1TCBA 4CEJA 2YJ6A 4LGCA 2GHTA 1YKSA 1YONA 3H9EO 4Q4AB 5AVOA 1U28A 4J7AA 3RBXA 3CF6R 4WKGA 2CVZA 1JAIA 1VFNA 2WZCA 3KHKA 5ESDA 5BUQA 2F3RA 4DUGD 1XTUA 3AKCA 2JJ2D 4PPQA 1MPXA 1LEHA 2O2IA 2ZU0C 3I42A 1IN6A 3LF2A 3G5LA 4FFNA 3ZDRA 4PZYA 1LLQA 1VKJA 4BTLA 1WULS 1RXIA 2NTJA 4DLKA 1RJGA 1ML3A 4MW7A 4DSUA 1RFGE 2JC3A 2V1UA 4Z53A 2CZQA 2Y0CA 1J23A 1RPTA 1SKBA 3NHJA 4JSRA 4A26A 5K6TA 3KV3O 3JCZA 1HDEA 3UF0A 2EHDA 1JI0A 2GEBA 2OO5A 3AW8A 3MT0A 2CXUA 2JI8A 3DXZA 5AIAA 3T95A 1QV9A 1L7PA 4JNCA 3DFMA 4G4GA 4MMXB 4RPJA 5DWQA 5I7SA 2QVXX 5FA5A 1E2IA 1SR8A 1MAAA 1XEWX 3I0ZA 3GH1A 1Z5ZA 3K8YA 4LHZA 1RWWA 4XM0A 3VO1A 5L6LB 3S6JA 1GO2A 1JV2B 5D3ZA 1IXZA 2A57A 1TPZA 2Q49A 4DEYA 4CXMA 3BIJA 1VE1A 2O2EA 1A04A 1UPUA 4Z9YA 4BNFA 4EMBA 1HFKA 2BFFB 2XAUA 3BL8A 1XQ1A 1XTRA 2B5WA 5E1DA 3LBHA 3VH4A 4EX6A 3MZ0A 3A10A 3RSGA 4F3KA 4Z6KA 2NZVG 3W1EA 4A0FA 3TE6A 5K2OA 2G36A 1XRSB 3KC2A 4Y1EA 3FYTA 3QX9A 4DA6A 4E5NA 5J58A 1ORHA 2OUIA 4BJ6A 4F8EA 2IJGX 5HE9A 1EMDA 1DWPA 1MO4A 3I1FA 3OLWA 4WCFA 2Z58A 3B6EA 2EJCA 4JIMA 2WHPB 4QJ4A 4EI8A 3U7IA 3RIYA 3GT3A 3PK0A 3DUWA 1YZKA 3CT4A 4IGKA 2WZDA 3ANYB 3B48A 3BK7A 1ZMTA 3LY5A 6CHYA 2GFIA 3FHOA 3G88A 1L1EA 4FW8A 4WXMA 3LWDA 2CMFA 4DHWA 3ETDA 1UJCA 3KJQA 4BVLA 5K3OA 3EMBA 4W5TA 4FE3A 2PH1A 1QKJA 5F1PA 1XWIA 3MEQA 2HBZA 5DK6A 3UMFA 3RYHA 1J8VA 3FVRA 2EF0A 1ISMA 4EI2A 2ZI6A 2WI8A 4BLOA 3RHTA 1XQ6A 3L7MA 4PW0A 1C81A 4MCHA 1KETA 1L7EA 2IXEA 3O83A 3GL9A 2NSLA 2FE1A 3S55A 1UJMA 4EPXA 2BGWA 4H3VA 3MRVA 2X1HA 1OREA 4AWBA 4KAFA 4CKBB 1CUIA 4OXNA 2BISA 4DJFC 2F43A 2P40A 5IKPA 2JJ1D 1OC4A 2WZBA 5FRDA 3FJ1A 1G5QA 1L4KA 3GPDG 2HF2A 4FHCA 4TPKA 2OR3A 5LFAA 1XF1A 1ZP6A 1EFRD 1RM3A 4G25A 4GO1A 4J1TC 4HGYA 3ZHZA 5JAIA 2Z6QA 5HBRA 2NUAA 3O92A 2VIIA 3WB2A 4IXTA 2IT1A 3L84A 4GD3Q 3RKRA 1XKLA 3K5HA 1GAWA 4NRDA 4AYXA 1REQB 3KM0A 4HQLA 3KTAA 2XUDA 4HGOA 4OIFA 3U17A 4GOXA 5AQ1A 3GJYA 3HXMA 1N78A 4G3XA 4X00A 3I01A 3M4XA 3UK1A 3C3CA 4G65A 3IDAA 3OJWA 2XB2A 2H06A 3J7TA 1KIMA 4I8IA 2ISCA 2MSEB 1HE3A 1NZDA 1B6SA 2TECE 2VHWA 2Z1NA 3CH6A 3CXUA 3EZ6A 1JG7A 3G8AA 4JLNA 4P82A 5DI3B 1Z8HA 2ZXEA 3HA7A 3FDFA 1YDHA 3BGDA 2NADA 1KQGA 3WAJA 2VS1A 1L7BA 3ZWPA 2XOKD 1T4MA 4MGKR 1T2EA 4KE6A 5LXTB 4ESEA 1JDUA 4KIUA 3D02A 5T4BA 2JDIA 3SS8A 5AUNB 2FW7A 5IUKC 1L5ZA 4JP2A 4KXMA 4ZT5A 1SKMA 4BO0A 3DS8A 4QOSA 1JHZA 4UVHA 1NJ5A 2RGDA 4PV7A 4C2TA 2AI1A 4QIHA 4I1VA 2ZSDA 2OCGA 4UMFA 3SOZA 3ZQKA 1SQSA 3DZ8A 1CY7A 1J1ZA 1B1AA 5HK8A 3WK7A 3R5XA 1AJEA 1PP4A 3OPYI 1QE0A 1O94A 5TQ0A 4AKEA 1HSZA 1PGNA 2Q1XA 1UC9A 2G25A 3C8MA 3WWZA 4BNDA 4KQ2A 5ELMA 2UZ4A 1OLXA 1NSTA 4IIJA 5EAIA 2EBHX 1U8YA 4MUNA 1C9NA 2CL5A 1RLIA 2QXUA 3NANA 3HV0A 4WWHA 3ZBTA 1VSVA 5HIMA 1Q44A 1YAHA 3KX2A 1Q74A 2O57A 4FGKA 1CFJA 4D98A 5IJZA 3DLBA 2BFBA 5ABPA 3THOA 2R66A 3I2JA 1YB7A 3L1IA 2HQ1A 2NTVA 2OE2A 2PJUA 4NBRA 3F46A 4RQBA 4ZALA 4B79A 4B48A 3F90A 3IT0A 1PD1A 1ZU4A 4RULA 4EPVA 1LKZA 3H04A 4IEIA 1WZNA 3IULA 4LHEA 3DYBA 2R7NA 3R6TA 2Q29A 3TSZA 4EG7A 1XUOA 2CLHB 1AE1A 3B1KA 1OBOA 2ZE5A 4ZV7A 4ESOA 1YDGA 1KY5A 4I7EA 1T4BA 4XSGA 5ALMA 4F6CA 5MN5A 3SZMA 2IC5A 1ZI6A 2BJHA 3FVQA 1QTQA 2KLHA 1M5UA 3BGIA 4MPTA 4U0KA 4JKOA 1YIAA 1QVAA 4CT4B 1H3EA 2GK3A 2CYCA 3WYAA 1NW3A 4B7UA 2W22A 4HTFB 3NDIA 1LX6A 1F2DA 5FWXB 4DILA 3RUPA 4M1SA 1BW9B 4FKMA 2FW9A 4ICIA 5JSFA 4GT1A 1N0VC 2PTHA 1T5BA 1KFKB 3GK3A 1EFLA 2YRFA 2JZOA 2OHJA 3AFOA 2A3NA 2D1RA 3TZKA 1PX2A 1FC0A 1NRXA 1P4JA 2HY7A 2X1VA 1NRWA 1ZNWA 3NCHA 4WADA 3RJMA 5K3BA 3OI7A 1RIFA 1Z4QA 2HMAA 2QM7A 3R3HA 4YAOA 3UMCA 1KTIA 4PINA 3VOTA 2GM9A 4H6PA 4DSOA 4GYKA 2CXRA 1KRHA 1XP8A 4ENUA 5CBPA 4X6LA 2OYCA 3JALA 3I6MA 2E4UA 3W7BA 1XQYA 1GU7A 1RI2A 3ILXA 1ZVVA 1E1MA 2BHSA 1XZFA 1KAQA 2WE7A 3EHEA 2HA5A 3PPYA 4JGIA 1KDPA 3FYUC 2RAFA 1FTYA 1UBFA 1X94A 4Q6BA 1HY3A 4ZODA 2RK6A 1YZ3A 3ZHVA 4OA8A 1TO2E 4XWGA 1DFHA 1DCMA 3I39X 4YR9A 3PPXA 3EUWA 4EF6A 1KDYA 5HQ3B 1FYWA 1JDZA 1FXUA 3VDXA 4RMGA 1YS1X 5LBTA 1FDSA 4P5PA 3FPSA 3KKMA 2VZLA 1GJRA 4H0CA 2QJOA 3NHBA 2OSBA 2ZBVA 4EK9A 1T9GS 3BB3A 3E2MA 5HF6A 4AO6A 2AW5A 3MS7A 5L6MB 3ZDCA 2EW1A 5JJBA 2R8BA 3LV8A 4CQMA 3THXA 1U5BA 3OPMA 4IHJF 4L27A 4E6PA 3WJ1A 2VF8A 2WZQA 4DY6A 4D0LB 5IT9A 1RP1A 4JQCA 1E3WA 1E5VA 2P1DA 2JDID 3LDFA 4JP3A 3TLKA 1EXWA 1KVQA 1U0EA 2W6NA 3QXGA 2UV8A 2H4WA 3M5CA 1KTVA 4ZREA 4WJLA 5T5QA 5E2IA 1P7VA 3H4TA 1L5WA 4J0FA 4GLJA 3B1WA 3LC0A 1OV4A 3OO1A 4B7CA 1A77A 1PTJA 3GP3A 4WFIA 2HA4A 3FLMA 3T7IA 1XZBA 2GEVA 3VR0A 2R25B 4CV3A 4YRPA 1O94D 4QYWA 3LCVB 4EDHA 1YTLA 2O2HA 3BEDA 1I13A 2X77A 4N0DA 1ACJA 1RLOA 2A9PA 1MB2A 4HVTA 4L76A 1E3SA 1J2JA 1JHUA 4I6EA 5GM2A 3T15A 1ZINA 3HJCA 1ZN8A 4IDHA 1Q16A 2JBWA 5DCWA 1ABFA 1V8PA 2WTAA 3Q0EA 5EKDA 4OJQA 1GRRA 2RKOA 3CLRD 4C2AA 3A0RB 4W8GA 1UXKA 3MCAA 2I1WA 1YS2X 2VUHB 3WNZA 3UYLA 2DR0A 4HD8A 3BXPA 1RWOA 3KSBC 2WEKA 4WESB 4NFLA 1C5KA 5EWLA 1N92A 1YVRA 3JATA 2C4HA 1JJ7A 5LU9A 2AR9A 1WHTA 5HKKA 3LNCA 4G2TA 3HB9A 3NIWA 1IPEA 3LIPA 4NBNA 4QRDA 1RWVA 2J41A 1FS4A 3DZGA 4YI5A 4F21A 2DXIA 3KR2A 3NC0C 5FNVF 1LPPA 1NW6A 1RPJA 1XDUA 2PUWA 2J3DA 4KX5A 2ZPAA 2XNSA 4BZWA 2RK3A 1MZVA 3EPKA 4X7PA 3I6YA 4BE7B 2I76A 1RACA 4OHPA 5GGYA 1IOWA 3C85A 1P5JA 1VMIA 2WHQA 2QAGA 3Q72A 3W4KA 3ZDFA 4LZWA 2I2AA 4UUNA 1P77A 3PFIA 3HUFA 4LVUA 1EDEA 4D0SA 1DEKA 1L4FA 4FUTA 3NW9A 2CBXA 3T7EA 3ENNA 3U31A 4BS9A 5EOVA 1E9EA 1H2XA 1ULUA 3C41J 3FY4A 4MW5A 1JBKA 4OYHA 1O95C 1DU4A 2Q3LA 3JQ8B 4G5FA 2FJ0A 4H4EA 1EB8A 4PZAA 4L6IA 3WLHA 4NONA 4P80A 4MX8A 4BQFA 3HWRA 5DYYA 5JCOC 5DEOA 3KUCA 4EM6A 3IEMA 3CX4A 1JZQA 2F9FA 4LJ9A 3DR3A 1WUYA 3RTDA 3ZWAA 1Z0DA 3A9VA 4YJGB 1K2VN 4MVJE 3TXYA 4OD0A 4AB1A 2PAFA 4AXXA 4Z4GA 1FDIA 1XCMA 3LQ2A 3O03A 2YZNA 4HB3A 2NTEA 1OE0A 2AJTA 2X76A 1Z15A 3AR7A 3N1UA 3EPJA 1JT2A 5IDVA 4MUYA 4LRTB 3GLFA 1CDZA 1HDRA 1OXUA 3BQMB 4XQ0A 1Q1ZA 4K9QA 5H68A 1SA0A 4TWZA 3DWIA 3U3RA 2PL1A 1AZLA 2G5PA 1KDZA 3KQYA 4CKCB 1Y9AA 5DX8A 1ZZGA 1CYDA 2Y1KA 3HO1A 2AJ8A 2RC5A 4JC5A 4B8WA 2HO4A 3S4YA 2EERA 2ABWA 3D6UA 1NW9B 4PWYA 3CZRA 1THGA 2HWWA 3OCJA 4B82A 1ISJA 4C0KA 1OF1A 2PMEA 3RHSA 3RC7A 5AHWA 2C8LA 4OB6A 5JXJA 4MB6A 3AVTA 2A59A 3ZDAA 1US8B 3WI7A 3AFIA 5LQAA 3H19A 3O8QA 3I32A 4HLNA 4UEOA 3C1AA 1JAHA 5BNTA 2P2CA 3W5UA 4CQMD 2QTTA 3S29A 4B4UA 1H85A 2ZLBA 1OGJA 3FCSB 3M6WA 1PF7E 1UBRS 4NCIA 4UNRA 5HJEA 1DZ3A 2PKYX 4RGQA 4XTRA 2GO1A 1EI9A 3U3XA 1G20A 3OF2A 5B58T 4C5CA 3HKCB 3D8SA 2VXOA 1EYZA 4YJ2A 2XDAA 1XKQA 3HTXA 2QGNA 4KLAA 5ANRB 1TYZA 3H6GA 1XG5A 2I66A 2JCYA 3WLTA 5KX5F 2GJ9A 2PMFA 5KJ1A 3KVOA 1VB5A 3MS4A 4EO4A 5IH3A 4JXKA 4DR1B 2W42A 4JCOA 4A7PA 3D3JA 1FRZA 4ZDWA 3SLGA 3DO5A 2ZTLA 4XSHA 4E13A 3EG9B 2E0IA 1G21A 2J45A 3GLRA 4EG1A 2IYLD 1VP9A 1ZZEA 3RIHA 3HC7A 3P2IA 4G4JA 3TZCA 3AB8A 3V32A 1FK8A 4BXOB 5IZCC 5A7HA 1CUFA 4AIIA 3FLBA 2D2XA 1MAUA 3GPBA 3BE5A 3RG2A 1NV9A 4MQLA 2EEZA 4MICA 4BBPA 4FM9A 1YULA 1CERA 4HHEA 3HCWA 3PDJA 2DHQA 4L5YA 4ZVSA 2JF0A 1QHYA 3IX7A 4DE5A 3A9SA 5ALNA 1IMOA 1F12A 2BKEA 3D81A 2OFOA 2AFVA 3G0GA 4KXQA 5FAXA 3R0JA 3ZV3A 5HKKD 1KVTA 4UTRA 2QX6A 3FWPA 5JNVA 4IV0A 4E15A 4QASA 1ZIDA 4RTNA 3GJ7A 1G3MA 4MUKA 4OK6A 3I4LA 1OXTA 3SZGA 3WMGA 1XVAA 2B99A 1F14A 4RETA 2XYHA 4IRXA 1Z4OA 1X7ZB 1T0IA 3ZZTA 1CVIA 1PQPA 4MRPA 1IK4A 3I45A 3H11B 1JMYA 2WMOB 1ZL2A 3NIBA 3DEIA 4NL4H 4AY3A 3I8OA 3JARA 5EJEA 4DF3A 4DN6A 2VHCA 2RHOA 3KQPA 4HNQA 4OP1A 4PFSA 3OZAA 1DQZA 3ACBA 3ESBA 3DC2A 4MI6A 3S8MA 1KYIA 3ETNA 4ZYLA 3EEOA 5ENZA 3EVEA 1KO8A 3EMKA 4JQSA 1D2MA 2IXGA 3WGZA 4BTEA 2O8NA 3CLSD 2PZFA 1J9ZA 3CH7A 4JEHA 3V9AA 4OLJA 4WXEA 3LHDA 3PNPA 1FRFS 1OMOA 2AEMA 3BXFA 3LUHA 4V0MA 4ZO9A 1Z0JA 5SZHB 1CUCA 2W6ID 2WOOA 4E5DA 1LVHA 2PGNA 3LW7A 4GR4A 4Z0PA 2WA1A 2QV0A 4ERXA 3CISA 5CFPA 4LF8B 4KR7A 1YCGA 3O84A 1NONA 3P0FA 1NE2A 3Q8XB 5KSYA 4K2HA 5ALLA 1E1CB 5FI3A 1KSHA 2TSYB 1P31A 3ICWA 2PJZA 3MJHA 4H4DA 1VBKA 4UARA 1JYSA 4XFJA 3UJ7A 4C4YA 4PYJA 3J80A 4ZU6X 3BWBA 4GU5A 3QFHA 5CFMA 1JALA 4X24A 1DBVO 1D2GA 1T9BA 1QTNA 5FWNA 3HLKA 2B1QA 1C0LA 4Y2GA 3WK6A 1JA0A 1AXEA 2JATA 3SHQA 1V11B 1RHKA 1LZKA 5FHQA 2IODA 5K4GA 5KOHA 4MWSA 4FI3F 4BEJA 2LD4A 2ZUWA 1YOVB 2I65A 2RHJA 4ACBA 2FZ4A 2Q7XA 521PA 2GAOA 2WF7A 1TRKA 5ARDA 1N1EA 2ZB3A 1HFEL 3DLIA 1KOFA 2H4YA 4B6JA 4YUVA 4F4DA 5KZMB 3GWGA 2EIXA 4E2YA 4AZWA 3W5BA 5TEVA 4XR9A 1A9YA 3VKFA 1CUBA 2AD5A 2AB0A 6ABPA 3TW4A 1WP9A 3L06A 5AWFC 1RWPA 2CXXA 5L7WA 5C53B 1Q1AA 2A6PA 2NV0A 1GWNA 1ICEA 2PLWA 5EXTA 1NVKA 2WTMA 3JQAA 3NPAA 4RFLA 3AF0A 2UYGA 3FMVA 4CEHA 1GEGA 3TTSA 3CVXA 1BFDA 1TM7E 1U7DA 3EUFA 5DBIA 1KJ8A 5JWHA 2QN9A 3G85A 3RU3A 5F78A 2BIFA 4MS1B 3CVOA 4BO1A 1J5PA 1OTXA 3FHTA 2PY6A 1C7IA 4RHUA 2V6BA 4Y6RA 5IARA 1TTPB 1MB9A 1GU0A 3NBYC 3OZWA 4REQA 4W5NA 2FN9A 2Q3CA 4JC8A 1ISHA 1DAIA 1JA1A 1CRLA 1OYOA 1OVMA 3PXEA 3G9UA 2D0PB 3N2KB 4I9GA 4G1CA 4O4LB 4KR0A 3OWXA 3QNMA 1GZ3A 3E18A 5AOVA 5GONA 4D0GA 2NNLD 1VL5A 1V9CA 4N54A 3AHGA 5BRAA 3UJ6A 1KEPA 4DR4B 4H08A 2AOVA 3BN3A 2RGNC 3M34A 3QX8A 2IBMA 5FFMA 2CFCA 1ONOA 1UBUS 4HZIA 2EZ8A 2O48X 4ERNA 1YC2A 3NHRA 4HDMB 3CM0A 2VR1A 3DF9A 5ADWA 4LA4A 3B6MA 3E2PA 2ON6A 4U7GA 1W36C 4X54A 2QOEA 4XEHA 1TEHA 3MINA 2GHIA 3AESB 2WF6A 3QM1A 3GX1A 1HRDA 4RYDA 1D2NA 2C95A 1LDYA 3DLPX 4D74A 5KYGA 2LNDA 3HVKA 4JLOA 5ERGB 3BMNA 3N39C 5HKOA 5L3QB 1JH9A 1GG5A 2FG5A 3AEXA 1ULAA 4IJKA 3B1FA 3KZVA 1BDJA 4U2DA 4BNUA 2ECPA 3DL0A 3ND8A 3GLSA 3ZJ4A 2NTYC 2VA8A 3EDOA 2EJUA 3N28A 4Q9NA 2OP0A 1KE1A 4AVYA 1JEYB 1ZK2A 3VOBA 4GOND 4L7VA 1H2FA 4G8JA 5KWSA 1N6OA 1B26A 4HP8A 1T0PA 2YVQA 4O4JA 4RU1A 3FHLA 3O9VA 3GB9A 4N49A 3ZGXA 1KGSA 1QCCA 5G53C 2H1CA 1UXOA 3AVQA 3O31A 3EC1A 3P4UA 3RC2A 4AICA 1X2BA 1CB0A 2RHWA 5D1HA 2FX2A 3DEJA 4MVCA 3RS7A 5A4AA 5K0JA 5CR9A 1V1RB 2ZRFA 3DVSX 5IKMA 4WBSA 4MVWA 4S1TA 3RT7A 1TF7A 1KA9H 4KPYA 1KQFA 4YRRA 2QMUA 3UANA 3KJIA 1RRPA 3HJBA 1JMVA 4J4TA 4CG0A 2G9QA 2I3BA 2XCIA 2HRDA 4IXDA 3I73A 3W6OA 5GV8A 4F8JA 3QLUC 2VZ8A 2HMYB 4JH0A 1DSSG 2ACVA 3ZY5A 2NUPB 4EY4A 4Z4IA 2UKDA 1JEQB 1M6VA 3K6JA 3WK9A 4X45A 1Y8RB 2VJQA 1AG9A 1C3LA 1IY1A 1NKSA 1E6LA 4MUFA 1JIVA 1VLMA 2YN2A 1Q15A 5IXSA 2PZKA 1SZJG 2E18A 3O8NA 4M1QA 4TVBA 4UBIA 4NYIQ 5AXCA 5E4YA 3TQTA 4YMIA 1HLFA 4GOJA 4WIAA 3UJAA 4BVHA 3F6YA 3FZEA 1U3DA 2JFGA 3V4RA 4FWTA 3HBFA 5MN6A 1OFUA 1UOOA 4FMCF 3I4FA 5KINB 2V7VA 4ZDIA 4ZI7A 1D6MA 2O5EA 2O8BB 3DVRX 3I9NA 4CF7A 3CX7A 5I9BA 2A0XA 2H2FA 2PQ2A 5LDHA 3ROFA 3WLEA 1O97D 2QIPA 1EQ2A 2WD9A 4ID9A 2P9QA 5JLJA 4C4RA 3M3DA 2EHJA 2QUIA 1V3UA 2CHQA 1GILA 2ZJ2A 1E3EA 1MN6A 2PS1A 3BERA 3Q88A 3OF3A 3DBHB 5A4MS 4PFJA 5JXHA 3OOJA 1YVPA 2YZMA 1ZCAA 2BGMA 1Z5NA 4PYLA 4TS4A 5JDIA 2RGUA 1A2BA 2IYVA 1EVQA 2LE0A 3BWMA 3P9NA 4XJTA 1GGFA 4M6WA 1TT5A 3ZVKA 1X80B 4PQFA 2WFZA 4S24A 1TZBA 1PQWA 1ORWA 1X7GA 2B9VA 1G59A 3UMVA 4CODB 5JO0A 5HHTA 3WBFA 1HZZC 3TMYA 4P98A 4WN9A 1YL7A 2P68A 1XEXA 1DPFA 2V9ZA 3FCYA 2Z43A 4L9SA 5AVWA 2GKGA 4R1PA 2NVOA 2I3ZA 2II6A 2P35A 4MAMA 4WY8A 1C3OA 2Y1XA 3QYFA 3LXXA 4R9NA 4U5QA 3OQJA 4YJ3F 3O8OA 3WAGA 3GG2A 4OSPA 2FK8A 1VA4A 3EFBA 1ILEA 4YRAA 2LGJA 3PGKA 3EXIA 1RKXA 2QNIA 2Y4NA 3HMKA 3SR4A 2ETVA 1B3BA 1AQ6A 3FOWA 3HO6A 3NDPA 1B6GA 1NBWB 3EA0A 4JI7B 3IV6A 3SM3A 2WJ3A 1YGYA 4IDAA 4AURA 3OCVA 3A9UA 3ABRB 2XF8A 5DK4A 5KYTA 4OX9Y 4RTMA 1A3CA 4A6DA 4V0SA 5EC8A 4HGNA 4RKWA 4FNOA 1T2NA 1ND6A 3BOSA 5DNYB 1G98A 1TLFA 2M9MA 5HKBA 5E9AA 5JROA 2JA2A 3EVZA 4TMXA 3AR3A 2DPHA 1YB6A 4KO3S 4RFSB 3ZK9A 1WO8A 5K8IA 3V4OA 2WU4A 3E1SA 4WXPA 2D74A 3TTWA 2B21A 2FOIA 3EBOA 3BEOA 3B9RA 3IIJA 4R2LA 2QD1A 4D56A 1AA6A 1DXHA 1FNBA 3ESRA 1Z5OA 4BGIA 3KEOA 1JLLA 1RXUA 3BB1A 3OHPA 4DSNA 4AQ7A 3HXTA 2XE7A 3IP5A 3OE7A 5ALZA 1UZNA 3C7CB 4RA9A 1Y6RA 2GD0A 3A31A 3ZXUB 1DIBA 3MA0A 4P33A 3BBPA 2NAFA 4UAVA 2QT1A 2XTNA 2RFLA 5GJCA 5EIEA 5FEUA 4Y8VA 4FOSA 3KYBA 4I9HA 1G5IA 1E2LA 2KSQA 4MQ6A 1PQ4A 5IXJA 4AP9A 3V4SA 2RHRA 3NM4A 5FUBA 2OG2A 4Y2UA 2X0FA 1U31A 2ZIEA 5FTWA 2IEIA 4BUJA 1M2VA 3L8EA 4K26A 3QKRA 4BLTA 5CDYA 2QMZA 3QWAA 4RXTA 1UKYA 3GPIA 1IUPA 1R8QA 3NETA 1HE5A 2AFHA 3OUTA 1XIVA 1XC7A 1X1DA 5A02A 1PJCA 2F1IA 4YACA 2HMWA 2EWWA 4JIGA 4FJ0A 3AUJB 2PE5A 3MJ4A 4X8OA 4J4BA 3TD2A 3JQ7A 4R5MA 2O0HA 4KSBA 5G1OA 4O1HA 2AHOA 2BM9A 4H6WA 1N2EA 4CIBA 1YQEA 3DHNA 1SIWA 3CKMA 3R3XA 2WJZB 3AF5A 1GKUB 4UW9A 3TRKA 1M1YE 2NZ8A 3NTRA 1GYQA 2I2FA 4DABA 1F9AA 1PT8A 1Z4IA 1MA3A 3GFSA 4DR7B 1FJGB 3DJFA 2GBLC 3LUPA 2WG1A 2QG9A 5JDCC 1PG5A 2IS4A 2PLNA 2ZYIA 3PV0A 1VJ0A 2FHPA 2GD6A 3CS3A 1ZIXA 4EYSA 1MV8A 1YQUA 3FKSD 5JRJA 5MN4A 1Y48E 5EWMB 1K66A 1NBIA 1N6HA 1TCCA 2QD5A 1RKVA 1VL0A 3OLVA 3HUDA 4RH1A 4JOSA 1XNRB 4NZYA 2WLTA 3H0CA 4YMHA 1V95A 4YP1A 3W1VA 4UFNA 2YZ7A 5C8DA 4Q7MB 4CQLA 5ICEA 5I4BA 1VSBA 1U9JA 2GDZA 2M98A 4IDQA 1J5XA 1RAFA 3TVTA 1E4YA 1DKRA 5I9MA 3UK2A 3AM3A 1X7XB 3TTTA 3C3KA 1OILA 4GX5A 4A4DA 3ZDYB 4INAA 4KIWA 4DNQA 4K3UA 3INYA 3MWDA 3RB8A 4B76A 4ZK2A 3I5AA 4JUBA 1OYYA 5B3JC 3RBZA 1EVJA 3FRHA 1OX4B 4IHJB 1N33B 2VRWA 3QMVA 5AXDA 2B7CA 5ALEA 3MC1A 2GPSA 1E1KA 2HJSA 2P5SA 1ZW1A 2VCYA 2VF2A 3UTCA 3I3OA 1T9GR 1L1QA 3NHKA 3AEUA 3FCAA 3E61A 3CCFA 3OZFA 2JGEA 4YONB 1FEZA 2PXXA 3EXFB 2VJMA 4ZI5A 4JB3A 4MVJH 3VSCA 3JQFA 2OEPA 2WK1A 4OQDA 2CFOA 1QBKC 4JR0A 3T0IA 5BWBA 1ODIA 1W49A 4CM4B 2AVDA 3PJFA 1FRQA 1QHXA 3T1VA 3I2FA 3P0RA 4Q24A 4LJ4A 4P34A 4UNNA 4FGJA 1MPTA 4Q1BA 1N4DA 1FFGA 1JPVA 2YBDA 4DA8A 1NI5A 1WY5A 5JVDF 5CA1A 3H05A 1EP1B 1UMBB 3HFGA 3WYGA 1ZISA 3MW8A 1RI3A 2C2OA 3PUYA 4PC3A 3O0TA 2PQ6A 4TYYA 3ZE2B 2J6BA 4GE3A 6NULA 5AVTA 2ECQA 2QPTA 2OBYA 5C5IA 1IUOA 5T7BA 2OB1A 4JFAA 4R4JA 3PUXA 1WMEA 4TV8A 4AT1A 4B6PA 4DIKA 2PR7A 3OE7D 4OHOA 4QOJA 3EPHA 1R15A 1A9QA 1II9A 3I2HA 3KE8A 3M4JA 1B43A 4GPD1 4OGGA 3VOAA 3AILA 1K5PA 3WHLA 4CN8A 3WYEA 2C61A 1I3CA 3ZIUA 3MCVA 2FVXA 1XD9A 4PG6A 4C4TA 1LPAB 3N70A 1P0MA 3RJ5A 5JZ9A 2E3JA 5ENVA 5FNVB 1ZOLA 1AY0A 2I6UA 4GKKB 2GJ4A 2Y1EA 3I9JA 1YJCA 4EATA 1OH7A 2WLSA 3HQ4O 1IY2A 1TD1A 2XMPA 3QVWA 1HXHA 3G0CA 3MJVA 5KNDH 1TLTA 2FU5C 3KTOA 3MWEB 4NPHA 3FDZB 4MK4A 4ENTA 3UK6A 3WMWA 1C2TA 2YZ2A 1E99A 2WAOA 2R8ZA 3NWOA 3MELA 1H0KA 2QT9A 3MOSA 3ZIDA 1IHYA 1DC5A 1DKMA 2FMHA 4Q39A 3USZA 2VDWA 4KXFB 1K2WA 3S2FA 1E7YA 2HX1A 3OT1A 4Q15A 1NBHA 5J2TA 5TQVA 4UD6A 4U2CA 2CJFA 2FSHA 4OL0A 1TJPB 4H59A 3ZHYA 4BO4A 1NVWQ 1E94E 4L07A 4MRNA 1QHEA 3CEJA 4JLDA 1PZFA 1G3QA 1P7WA 3FVVA 3TX2A 1FFXA 1X87A 1Y8AA 3CLVA 3A7DA 3LOUA 3MYRA 4US1R 5ERYA 1QC5B 2VLIA 3BMQA 3FWNA 3UJDA 4V1CB 3VM6A 4B1FA 3HFSA 1UFVA 3VSBA 1Y3HA 1Y5LA 4LOHA 3SVTA 4R3UC 1R5NA 2WJJA 3Q9UA 4Q3AA 3ZWBA 1JIXA 1YWGO 4HH3C 4LWPA 4UPEA 9ABPA 1QHIA 4MUHA 5M04A 2AL7A 2EP8A 2WU3A 2E1RA 3K09A 2RSLA 3EGDA 2VXYA 1LV8A 1O08A 1QVRA 3ITDA 3O91A 1GR1A 1M67A 3HNPA 1I5RA 2P8SA 1E1RA 3NM5A 3Q9LA 1S3SA 3GEIA 3M83A 3OBIA 4JQOA 4ND8B 5ALPA 5HCNA 2FEXA 4AYWA 2ZK7A 2QRGA 4UDOA 2C82A 2OWDA 5FI1B 3C97A 2AZDA 2FUNB 3ABOB 4HEJA 2UUPA 1E32A 2GXUA 4G0OA 4PZPA 2HPHA 1NR5A 5TE9A 3W04A 1H8EA 5BUZA 2RGRA 4QG7A 1VKOA 2ZYSA 3DNFA 2M6RA 4Y2PA 1F1JA 1RJ9A 2FOLA 3NJRA 1BROA 1R6AA 4DJDC 5C1BA 4E31A 1EHYA 1K97A 3ZHRA 1MQ8B 3C8ZA 3FIJA 2WHRA 4RPHA 3AERA 2BYTA 1P17A 2K87A 1F20A 3BL5A 4UMDA 4WEQA 1BRMA 4LE2A 4IS2A 1UBKS 3I64A 5AP9A 2IGTA 3VU3A 2Q4BA 5T4EA 4UBKA 3FKJA 5D5HA 3AIMA 3EH1A 3KOOA 5KX5B 1RE1A 1A1VA 1ZJ4A 4M1OA 4BGDA 4PYNA 4AFNA 3VMMA 4F9EA 5CLQA 4RTKA 1QORA 2Q5CA 1PHPA 2R6CA 3AI3A 4FWBA 4OLHA 3ILSA 3G9XA 3W9BA 4BB6A 3CNHA 4G23A 1E3QA 2C5HA 3IV7A 4RZIA 3PBKA 2H2DA 1L5QA 1SU7A 2ZRAA 1EBBA 3PUWA 4PC1A 3BREA 2I1VB 4IR7A 3KPUA 3LFHA 2AK3A 1RLJA 2V9CA 4KLRA 3UENA 3TAHA 3O5AA 4IVQA 4U9HS 5I9NA 5J2UA 1PJBA 4AN1A 3OZBA 1P0CA 4A0QA 2R85A 2X6RA 4JEIA 5I5GA 2GH1A 1QZZA 4RD3A 3IV9A 4N76A 3VO2A 2F59A 4Q9JA 4TLAA 5CIWA 4MWGA 1U3UA 1QGUB 1EK5A 1PHRA 1II8A 1OV6A 1K4YA 4NS1A 5EI5A 5F1YA 1LQUA 4UTOA 1MO3A 3WLMA 1NMSA 1SBYA 2WWWA 3AR4A 3NAZA 4Y9UA 4M49A 4KE9A 5IWAB 3OQHA 4O2AA 5A3VA 2FE4A 1CW2B 3CSSA 2GCIA 4UUQA 5IAEA 1P61B 3QVMA 5HK9A 4HSEA 3KB6A 2GM4A 4ND2A 1NP6A 3K5WA 3ILHA 5CFRA 3VNRA 1E6KA 1I4OA 1NXQA 4S1WA 2XTJA 5H3LA 4C0SA 1GPUA 4JYZA 4QPCA 4C7OA 4FFMA 4GC5A 2IEGA 4HFRA 5AM1A 1L5VA 3WLPA 2VVTA 3AZPA 3C24A 3E3AA 5B1HA 1HYEA 3SJCA 1A1SA 5M7EA 2WTXA 2H18A 2WOJA 3BCSA 3CR3C 4BLPA 1JKJA 1A8HA 3UY4A 3WP0A 1DJNA 4GMGA 4OXQA 3LRTA 5JI3E 2BMJA 2JI4A 3HE3A 4RIFA 2DBYA 2G1JA 4A0GA 2J0UA 4U8GA 1SZDA 1IH8A 3QYPA 5IAGA 3GCDA 3FGNA 2XQFA 3FPBA 2EBWA 3ZXSA 1R88A 4Z7QB 5A4JA 1AK1A 3DB1A 1BXRB 1QHHB 2I6SA 3AEQA 3AM1A 1FTWA 3DFZA 1QFSA 4EG6A 3AU8A 1WZ2A 3L0YA 4JJEA 3ZI4A 3Q7TA 3N8KA 3UAWA 3VUEA 1R0ZA 4P7KA 821PA 1A9XA 3PWSA 2PWZA 3WQBA 4XVRA 2K4MA 2PU7A 3QU9A 4EJSC 2QRVA 1XDZA 3TXAA 1MW8X 2GPWA 2ZJAA 4JL6A 4UUAA 1G0OA 5AKIA 4LFAB 2MYUA 1Y82A 2XUZA 3IOCA 1J8YF 2JGDB 2BUCA 4ARVA 4CF3A 1GKKA 2BEUA 4AY5A 3MHTA 1KY4A 3L05A 1E1RD 5KQSA 4MRAA 4RZ3A 5AVQA 3EX7C 2I71A 5E6RA 5DCYA 1SK8A 4ECEA 4KMRA 3B8HA 8MHTA 3TNLA 1OLSA 3BWDD 2C42A 3FPEA 4DV6B 2WIAA 1V3TA 3RODA 1Q0UA 1O6FA 3EODA 3AVWA 1BH2A 1USGA 1X86B 3QBEA 4PBTA 4CKZA 3M33A 4BMYA 1MNQA 2RHHA 3BE4A 2BLNA 3KSMA 2YIVX 4K88A 4JI1B 1W5FA 1MC4A 4R2IA 1MB0A 3H4VA 3HJTA 5DNAA 4DQLA 3L4EA 2JLWA 3KNZA 3R3ZA 3UAZA 1C4WA 1F17A 1O57A 3DBRB 3OMWA 4HS4A 2VP4A 2VKTA 4WLVA 4AO8A 1N5IA 5BQXA 3JTEA 4XB1A 5C7LO 5K7SA 4YJFB 5KJEA 4LE0A 2WWHA 4IH9A 2AFRA 2NV2B 2XRMA 4GMFA 2J3IA 4DJAA 1PGPA 2JCVA 3K05A 2ZRGA 1U6IA 2A5LA 3PX7A 1VFPA 3PI7A 1U81A 2FVYA 4IWXA 1N8KA 1VMEA 4K6KA 2XSZA 3L7DA 4MR9A 4WH0A 2ZI4A 2CNWA 4GVLA 3RFVA 1K92A 4H7EA 4N03A 1SEVA 5KIAA 4M0KA 1YQ9A 5AK6A 4EARA 1UWVA 2XOEA 1DT5A 2P5UA 5A03A 2JBAB 1OAOC 4LV5B 3NDJA 3MNFA 1JMKC 5HKAA 2C9ZA 4IDOA 1Y1RA 1SOMA 1L7XA 1XMPA 2JFPA 5JFOA 1OBFO 4YAEA 2ZREA 1AO3A 2BBWA 6REQA 3O3NB 3SXUB 1KU6A 3BSSA 1FDTA 4G26A 1VBMA 3F6PA 4FHEA 3BE6A 3KTAB 1Y81A 1DIRA 2BHTA 4F96A 1NVMB 3IRUA 3VR4H 2C2BA 4OYLA 3P2OA 4KZKA 1X2EA 4A91A 1JG6A 1I5EA 4BASA 2V54A 4N48A 5FBKA 3IUSA 3R8CA 1PT9A 2YJNA 1SIOA 1I36A 1XQVA 1ZRMA 2REQA 1KK0A 2BTOA 2VSYA 4K1XA 5EJGA 2PS3A 1U63A 4DTIA 1G17A 1TDJA 2NO9A 3EEYA 2EQBA 3Q9NA 4N6GA 2WNIA 3QV1A 5IJAA 3NEJA 1VJRA 1U98A 1EE2A 5JPIA 2R6ZA 1P9OA 1PJRA 3UKJA 1XRJA 5HM6A 2VTVA 3GLGE 3ZDZB 3WL4A 2BEKA 3WE7A 3NDBB 1DBQA 3M6FA 2ZRNA 4IZIA 4OATA 4UTZA 2QSUA 2R1VA 1NAIA 3BM5A 4RAQA 1B6RA 3I58A 4U2KA 4F92B 3NEPX 2L2QA 1S8FA 3UWDA 2IPAB 1XA4A 4KPUA 4EA8A 4B84A 4M83A 3RT1A 2IHZA 5TQ0B 3QLTA 3VZQA 2KI5A 3A2MA 4JDUA 1FSSA 4RJIA 2WSSD 2TMKA 1UPTA 5E7MA 1XBTA 3I61A 1N2CB 1HM5A 1BJKA 4BLSA 1UPCA 3FNEA 1PDVA 3KT6A 1KZ6A 4M3NA 2VG8A 3AVYA 1C7JA 2FWPA 4TS3A 4BO8A 4UXHA 1V43A 1YS9A 2D2EA 2QX7A 2ANCA 4FSDA 4LN1A 4V0RA 5E3IA 5G41A 4DCVA 4KVGA 4E5MA 2X0EA 1ZJZA 5FR2A 1HO3A 2Y1CA 3FUTA 2QPOA 1YU6A 2QTHA 4KCGA 1A8SA 4WCVA 3UC5A 1QK4A 1T4DA 1N3YA 1IEVA 3NR2A 1KE2A 5A1JA 2QLBA 2QTZA 3FZNA 3TIXB 2ZDHA 4JUFA 4CU2A 3M4ZA 3H13A 5HWSA 4IIBA 1PU2A 1YZNA 4F4UA 2I7DA 1MJGA 1GNLA 2V5UA 1E0KA 4UHJA 2PPLA 2GWRA 4FFDA 2JAHA 1L4BA 4MYRA 5D1NA 3USCS 1BN6A 4O08A 4GL4A 4WY5A 2ZVJA 4PN7A 5JZMA 1NQUA 3VHRA 5BYKA 5G40A 3DL2A 5EPOA 2O1WA 3FTQA 1FYVA 4QLAA 1SKYE 2YH2A 4G41A 1T9HA 2ERXA 3GGPA 4ZHQF 3CKLA 2VDLB 3FMPB 2Z2ZA 2YQ5A 3LLSA 1K88A 2J4DA 3CR7A 1JEJA 1NF9A 2P6PA 3KJEA 4UCXA 5K3FA 2VQFB 3BZBA 4ENPA 3RRXA 4FHGA 4FMCB 2I34A 1T3GA 3JD2A 2IV7A 5JQGA 4LC0A 4MQ5A 4EGCB 2G83A 4PRYA 2GQ0A 4KRFA 3IUBA 5JY6A 4NYJQ 1B73A 4RK0A 2PX5A 1T9AA 1QZTA 5A0FA 1E8NA 1KO5A 2D5BA 2XKBA 1QLJA 3D1JA 1U0OC 2GZ2A 1FF9A 2W0SA 2Y9MB 4LV6A 4RZQA 2PL5A 3H0EA 4HQKA 2ZBDA 1AUOA 2C29D 2XSZD 3IQHX 3TFWA 4BFWA 4NENA 3OLYA 4D41A 2CNWD 1ODLA 3W78A 1Q1NA 2YHUA 3HDVA 1DOHA 4RV5A 4A0RA 3NHUA 4UQPA 3RASA 3ZU4A 3OE1A 4B0OA 1HE2A 3HUUA 3IIIA 3WSTA 1QAMA 4W99A 1FQOA 3PDHA 1V5IA 4PAGA 4X8MA 3O8LA 5EP1A 2AFIA 2GCNA 3ZWWA 3Q40A 1FFAA 4C4XA 1BFKA 5KSWB 3C7TA 1RMQA 2ZT8A 2B3TA 3I4CA 3ORFA 4WAUA 3ZWYA 3DDUA 2BMFA 3JYNA 1HYHA 3OOEA 3VMFA 4WLOA 4G97A 4YJ3B 2FSIA 3PT9A 4F6RB 3BWXA 2Q1TA 1HR0B 4PLYA 1A9RA 3LUKA 4NLLA 1QWOA 2NYUA 3VVMA 4E5VA 2WAYA 4GI1A 4LJKA 3WJAA 2WW8A 3S8YA 4ZVTA 3OSUA 3WGUA 1CE8B 2CDAA 1QOPB 3KSRA 5J63A 4U9UA 4PS0A 2GXQA 2EFGA 3STHA 3L9XA 1XKTA 2GEJA 2B4KA 3GJXC 4L73A 4C21A 3QUBA 1P1IA 1A5SB 1TF2A 1SH7A 1P9RA 1NUSA 2NPFA 4FXOA 1SVMA 2H7YA 4RTJA 3DHYA 1Z68A 2G76A 1D8TA 3K1TA 2BFEB 2E4YA 1JEEA 3H5TA 4C0WA 3BJZA 2WWFA 1QKIA 1DKPA 1G41A 5CNMA 3JASA 2FFJA 4OQ4A 3SICE 4HG2A 1U2PA 1E9RA 4O5AA 1IM5A 5DHSA 3W06A 5CB8A 1CIVA 1VSUA 3SKYA 1J70A 4YC7A 1H3NA 2NVWA 3EBPA 4BX2A 3L6DA 4IQ8A 4LW8A 5FUWA 5BQOA 3TYXA 1BU5A 4DR6B 4UXJA 1PR0A 3V1TC 4MGHA 1KHTA 1GLGA 4FWIB 3X1JA 1SXJA 1Q0PA 2GZ1A 1PYOA 1OX6A 2HHAA 2DHEA 3GRPA 5DRTA 1SHZA 3KOXA 5BR1A 4LZOA 3KIPA 3ZGOA 4JI6B 5LMZA 2CXHA 1VI5A 3KXIA 1DADA 5CK4A 3GMTA 1EQAA 1FNCA 2R2AA 3TOXA 3W2TA 1DBPA 2AZTA 1IZ9A 2XDQA 3EC2A 5IN4A 2PYDA 5DNWA 1ZMOA 1A7KA 5IF3A 2Q6KA 4NX2A 3HS3A 1WZEA 3ZDQA 1J56A 1ZPDA 2C4MA 2O2CA 2UYOA 4LMPA 5EXPA 1DBWA 3UOAB 4RGYA 1JFVA 2JIQA 2RKWA 3JATB 4UE3S 3IL2A 2N1BA 2EW8A 1BMDA 1W1WA 1H8HA 1NX9A 2OESA 1KRWA 3VPCA 3F5MA 3IYLW 2A1IA 1J97A 1BOOA 2WSIA 5HUJA 3DBIA 3LS2A 3OOYA 3CVUA 4JBLA 5JJLA 3T4EA 2CLSA 1MH9A 2AW3A 2EOAA 2VWGA 4G9EA 5CLFA 2V6GA 1U1GA 3DT8A 3SFZA 2P9CA 5HFAA 3LY8A 4MS4B 2P0EA 3NAGA 3L4BA 4IUYA 1P2UA 1W1UA 4N0EA 3WKBA 1BS9A 1QP0A 1NFQA 1SVLA 2PX0A 3GJ4A 4LSGA 3N75A 2MSDB 1P8JA 1C80A 1LBEA 2RGXA 3H5NA 4GECA 4N39A 4NXMB 4LY3A 4G1MB 5BVHB 1VHWA 2BFOA 2WD7B 4CLOA 2FUG1 2XCQA 4V3CA 3WZ2A 4M37A 1JQDA 4WVLA 1JLRA 1KJ9A 3P20A 1EGMB 2NVUA 1UXIA 1RXSA 3K1AA 4BBAA 1AMOA 2FX5A 4X60A 3L1UA 3MSXA 3R77A 2OM6A 4BKQA 5HF8A 2YN4A 3U09A 1HYGA 4IEEA 3AP3A 3DGFC 4D97A 1YZUA 3FAZA 2PSHA 2VXBA 4YDSA 3SQDA 4AQYB 3LKVA 3GDWA 4JLKA 4PS1A 3SQNA 3CU5A 4JT2A 5B3AA 2WFLB 4WNAB 3SF0A 2JLVA 1J1UA 4QKQA 1BAPA 1P7PA 1Q0LA 2FQQA 2F8MA 3BAFA 3GR6A 3VVCA 4AJIA 3ZQJA 5CDSA 3NU1A 5LNK6 4MWTA 4HMOA 4I5IA 1SC3A 4MOWA 3PD7A 4ZU3A 1GGVA 2PVCA 5K8CA 4PAQA 1MAWA 3LBAA 4ND1A 1IAQA 2HKIA 2QLMA 2WM2A 3MLAA 2RH4A 4I8DA 4L95C 4QULA 1S7GA 4GLLA 3QG5A 4HY3A 3JW8A 1ACLA 3ZCTA 5FO1A 4G0WA 3BFVA 4UNIA 1YK0A 1Y5RA 3OUZA 4BFXA 8ABPA 2HEIA 3HKEA 3LGXA 3PYLA 3QOFA 4HXFB 1H9CA 3QYJA 5EXXA 4Z7NB 3S2GA 4RVOA 3JZAA 3MUNA 2J5BA 2PA3A 5DWVA 1ZRNA 1CJKC 3GEMA 2Q1UA 4ZEVA 3GF4A 4HNGA 2C3OA 3LUFA 1PUIA 2PSJA 3NTXA 3O8QB 4JT4A 2GA8A 5JSHA 4XH9B 1IJKA 1GGEA 1YE5A 3K9CA 3OLQA 4OUKX 3VO9A 3ITKA 4AKGA 3V7FA 5JVDB 2QLFA 1R8YA 4LY0A 1NVVR 3T5TA 1T4CA 1Y6JA 4LHVA 1CZLA 1Z0FA 1KDVA 2NM0A 3D5EA 4ZARA 1F0YA 1QNLA 1KO1A 3PNYA 2YW9A 4LZNA 4L1KA 4PO9A 2A7QA 3UFXB 3LMKA 4UTPA 1N32B 4C6TB 3OQ6A 4TXHA 2CL0X 3QPDA 2HIMA 1EFPA 5ELXA 1PK9A 2FR8A 5BUCA 1RNLA 1B7GO 1NLMA 1S2DA 3GEBA 2O7NA 4D9JA 2Z83A 4C1NA 2GFQA 1M34E 4KP7A 1SXJD 4HLDA 4YCMA 4P4LA 1H0SA 3ND9A 1I7NA 4GOMD 1G21B 2WPNA 1TL7C 2PBRA 5BSTA 4WOCA 4E3WA 4ZVLA 4AG5A 2YZGA 3NBZC 2ZWPA 4V39A 1G2OA 3URKA 4KQWA 4WE3A 4GX0A 1T8UA 1PJ8A 5AKJA 5BOVA 1ZH2A 3ZDBA 2P6UA 3EPLA 1Q7RA 1QUEA 1VCNA 2XA9A 4X7BA 4YGYA 3FPGA 2V8OA 1IN5A 2AQHA 2HSEA 2O05A 1G63A 3HCBA 5CH8A 1VCIA 2BMWA 4LC9A 2IE0A 2E37A 3IA7A 3MMNA 2A0KA 1S3IA 3EGEA 2CUTA 3G49A 1FXWA 3LWZA 3PNVA 4J4HA 5CP8A 1ZWLA 2PUEA 5CLLA 3KCNA 5AKZA 2AF4C 3FDJA 4BZXA 1UZLA 2FEKA 1FVXA 2ZR8A 3PQDA 2QEQA 3AP1A 4Z51A 1RQLA 1RWKA 4PYRA 3B82A 3FMOB 3WDSA 3KJGA 3OEED 2IELA 2PAAA 3WK8A 4L8YA 1G5RA 3R74A 5JWRA 1R8JA 4S05A 2Q0SA 3ADBA 4X1KA 4Y9SA 4GBED 3IMCA 1BO6A 3DEAA 2GBFA 1U4OA 2FZCA 3KUUA 1O9HA 4MCIA 4PQGA 4AS3A 4YX9A 4ZZ1A 1B1CA 3K6SA 2E82A 3ZQ6A 3CUTA 1EVYA 4LXUA 4HEQA 3TAUA 3U7RA 3WGQA 3NXKA 1VA5A 2JGFA 3KQSA 4QJIA 1UAYA 1VJDA 1I24A 1GL3A 2O0KA 4N3AA 2VYQA 3G5TA 4FSXA 1JYEA 1C4OA 1Z88A 1CZKA 2B82A 3GZ4A 2C1ZA 4UM5A 5DYIA 1P7ZA 1E7SA 1I14A 3ORRA 3D6TB 1RLUA 2BTEA 5AKYA 1CHDA 1E1QA 3GAAA 4MZXA 2CV0A 3WGLA 3KUKA 5IX8A 1FX1A 1T43A 2JLUA 3FWZA 3RRYA 4M60A 2J9FB 1LSUA 1NFRA 4MUEA 4WQMA 1Z2EA 1PSWA 2FWMX 1DEHA 3H2JA 3PXCX 4TM7A 5E0KB 1WF6A 4CCYB 3RUIA 5B4TA 5I8PA 1FFYA 2D7CA 3WHKA 4G8BA 2B4YA 2ATCA 4EB6A 1GKYA 4ZKDA 3AR2A 1QIJA 1XLTC 3AR9A 3VKGA 1Y3DE 2EFYA 4BCBA 1CR4A 3DE0X 1QRDA 2AC2A 3UIEA 4MIOA 4U8HA 4GPAA 3TUIC 1STOA 1DBIA 3VPXA 5JHHB 4LQDA 1WJGA 3CF4G 3GRAA 1ESCA 4INPA 2FPUA 4X44A 1P73A 1QH1A 5A62A 1E6EA 4G5HA 2DETA 2B5VA 3Q15C 3WXBA 1K86A 3V7WA 1W6RA 3VPFA 1E4EA 4B31A 5KOHB 1YVDA 4HDKA 4PQYA 5FLKA 1MHTA 1TJYA 3TW0A 3TEJA 4KDCA 1ISFA 4P22A 4OK3A 2R7KA 4JA0A 5DSXA 1OSNA 4MDFA 2BAGA 1BHSA 3IQEA 1H5NA 1I01A 2C97A 2R1TA 4KXYA 2W6JA 4YJDA 5ER6A 1LW6E 3EXHA 2HUNA 4EMUA 1NMXA 1Z0SA 2XKKA 4RSGA 1MFZA 1HRKA 1YS6A 1RXEA 2HJVA 1EUYA 4YT5A 3E9CA 3GRUA 2Q5JA 4O6VA 4R2JA 3X1MA 1JE0A 4JWTA 1SQ0A 1SUAA 1UC4B 1NVEA 1VG1A 2VP3A 4JHLA 4DLLA 5AW7A 5KQMA 2QU8A 4EW1A 1FOEB 3FGOA 1AKNA 1JIQA 1W8DA 4YFYA 4BO3A 1OD6A 3EBLA 1DC3A 2XCTB 2OILA 1C7RA 1H4QA 4Z4QA 3A9TA 1ATZA 4Y18A 3WV5A 2UXDB 3TK1A 4D96A 3P2KA 3GCWA 1WD5A 3T1OA 1WZCA 1UIMA 2WE8A 1HDCA 5IYZF 4EHFA 2A86A 3FTEA 1QHGA 3QA9A 4Z3KA 1BXGA 1EM8A 1V8BA 1OI3A 2IKQA 4WINA 3U7QA 3ZNQA 2AOTA 5MFZA 5HVNA 1U9IA 3PHJA 2Q3MA 1NRIA 3FSGA 1FSFA 4QGGA 4HTAA 4Q9DA 1GADO 5DM1A 2NQ8A 3STUA 3WK4A 4DBVO 1ZLYA 1VYVA 1XRLA 3I9V1 3ZLVA 4B4OA 3OP4A 2Q5EA 4E1VA 1AZSC 3CF4A 2PZGA 5IKEA 4O4HF 3REFA 1A71A 1H2AS 4MTCA 4M87A 4Y6QA 2RHBA 5HTKA 3SR0A 4C03A 2F4VB 3CPJB 3MQFA 4EQZA 5DOVA 4BZPA 2CE7A 4NU6A 5J4HA 4GDFA 4NNPA 3QBJA 1FU7A 3A1WA 2DUUA 1DC6A 2OD2A 3IVRA 2X8JA 4FCTA 4GBGA 2ZWOA 5ALSA 5D7BA 4QAJA 5JTUA 2LDXA 3S99A 4LK2A 1SCIA 2HHHB 1QR6A 2MYNA 3TLAA 3BCHA 3C45A 1B2LA 1TE2A 4GBMA 3BMCB 5FBLB 4HAUA 2J30A 3BWCA 3W5HA 4R68A 1FB5A 1GL7A 3BGOS 3AFHA 4OSOA 5FBHA 2PANA 2YHSA 3AKDA 4PCUA 5KWVA 3UQYS 4G1FA 4I1OA 5JPDA 5KYXB 1NSYA 3EIXA 1AQNA 1RYBA 2WJHA 5JECA 1OU0A 2GYYA 1ADYA 3C0KA 4OI4A 1MJ5A 3KT3A 2ZUSA 3G2NA 4P92A 4N7RA 4TTQA 3L8MA 3EISA 4O8ZA 2PNJA 1VL2A 1TUBB 2OKGA 4KHPB 1GUBA 5BN4A 2F55A 2JIPA 1JKIA 2XF2A 3DEHA 2P69A 3EUEA 3WQRA 4LDJA 1B76A 4RIIA 4FR2A 2IHNA 3AIIA 3ELYA 1CRWG 3IR6A 4I1RA 1OKKD 2BFAA 1ZN9A 1TKCA 2TRSB 1CUHA 1O5OA 3SF8B 1E1QD 1BVYF 1VSTA 2W83A 4QYMA 1FNDA 2PNFA 1FDUA 3ZJUA 4P3XA 5JXIA 5AOBA 5KTRA 3DV0B 4KX3A 4A8PA 4KREA 3AT1A 5BN3A 2J3MA 5LQUA 1COWA 2HMTA 4OJYA 1CJCA 5KYWB 4WUTA 2JHPA 3F3KA 3ZXIA 4PR3A 2Y66A 2XXAB 2H65A 3B1YA 5H16A 2O52A 4NC9A 5HR5A 1A4RA 1IULA 1E6MA 2DJIA 3JYOA 1XNJA 4M9RA 2G5TA 4RMJA 5EYPA 5K3SA 1D04A 2W43A 2OXFA 3Q2OA 4K9KA 5ITVA 2Z6AA 1X1CA 3VISA 3SJAA 1JHVA 1NI3A 1HNNA 1T25A 2IE8A 2ORIA 3N2IA 4ND4A 4WZBB 3JQGA 5CB6A 2VQEB 1QCZA 2VWPA 2GZ3A 3GC6A 1M9NA 3FH0A 3IVGA 2YV1A 4WNYA 4GXQA 2BVNA 5BMVF 3ICEA 1JSXA 1W46A 3L41A 4AROA 1Z29A 4BJ3A 5B2FA 2GRAA 1LS6A 4EP1A 3CPSA 3GMIA 2W6JD 4XPZA 3L9WA 1VGRA 2CV1A 1EVEA 1GGHA 4Z3OA 1NOIA 2G88A 3GYBA 1U90A 4AKHA 1G0NA 2C20A 5C2JB 2QTVA 3BKXA 3EGVA 3O1IC 5CDFA 3RAEC 1IM8A 3V7YA 5KU7A 3T54A 1O1YA 2BCEA 3O82A 3U7EB 4EPWA 3W3AH 2Z57A 3GT7A 1PK8A 3FNFA 5A6SA 1B41A 3SOPA 5HDQA 1YR8A 4IY1A 1YCDA 2C4VA 3A3NA 3FNGA 4JBNA 5AW9A 3PRKE 2BMEA 1WBDA 2P62A 1RM4A 3G89A 1ODSA 4UBMA 3MAAC 4HAYA 3RREA 4L9WA 1BYIA 5DGIA 4E70A 4EHLA 2XWJI 4YASA 1FQJA 3UPDA 1W5BA 3V9PA 3D8TA 2Z8ZA 3QWBA 2O6LA 1KYQA 4RXUA 1XOIA 4TLDA 4DIUA 2VF5X 3L7AA 1KSFX 2X7JA 2VHXA 4RV9A 2QE7A 1FW8A 3KYDA 1G4UR 4ANFA 3F78A 1WXHA 1DLIA 3JAMA 1JAXA 2JK0A 2NACA 1DUVG 3H5LA 3DL4A 2LV8A 5IT5A 3VHLB 4WN9B 3UT6A 1TMKA 1YDMA 4JLMA 3IPCA 3ROEA 3B1ZA 3ZEIA 2YWEA 1L5HB 3A11A 3I9LA 3VR6H 4JJIA 5GZ1A 2O8CA 3UMGA 3O8OB 3R3YA 1QYWA 2KWIA 3GDOA 5B6IA 3CJRA 2POQX 3C3JA 5DXJA 3IUMA 4YRLA 3LVQE 4EECA 4FQ5A 3PKZA 4L6AA 1DXYA 5LMNB 4A8TA 5E6UA 3FAKA 1AA9A 1LSOA 1GQOA 2Q8PA 3LVRE 1CUWA 4Z9XA 4AUNA 5JCPA 4OQQA 3H2BA 1KEWA 1ZITA 4OHCA 2P4HX 4Y7DA 5HUHA 3IQWA 5KNCH 2O23A 4CKEB 1DARA 2X9NA 3OJLA 1ONNA 2JLCA 5KKAA 5LR6A 6PFKA 2R9VA 3GBVA 1EDOA 3KDAA 4E7PA 4ZTUB 1L5KA 5AUPB 2PTGA 2P9JA 4RE6A 4XB6B 4AJOA 3HSSA 1T6BY 2F4NA 2UYQA 2WKSA 3OZIA 1S2MA 3GJ0A 4LZJA 3JWPA 5ALGA 4NV1A 4ZZ3A 1V3QE 2H5JA 3ICOA 1PYGA 3EXEA 5H83A 3SE7A 1OLOA 1SKUA 2DPGA 1EVKA 4D9MA 3K6RA 2YMPA 1IHPA 2QTMA 1CIJA 1ADFA 3OIDA 3OX3A 3R44A 3JPWA 4G5RA 1R37A 4UHKA 4XYMA 2JJYA 4ZT2A 3T4PA 1JXMA 4FYXA 1JLLB 1PWHA 1KGDA 4M9QA 1OA0A 2EFDB 3JTMA 4RC9A 3W34A 1EHIA 1KI4A 4NU5A 3I09A 1WY7A 3P32A 5T4HA 2ZUTA 2VBCA 5L45A 1PFKA 2G1PA 5CU7A 2FTKE 1GQ2A 2HOQA 1UT8A 1S8AA 2A14A 2OCIA 2RGCA 1DWUA 4M1WA 4XQGA 5DW0A 5BW6B 4F4FA 5IHXA 2PN1A 3W8EA 2D59A 3PHBE 4O4IF 2YWFA 4ARZA 1COWD 1O58A 1LBHA 1SVWA 3NASA 4R9UC 4XCQA 2X3UA 3WYFA 2EP5A 3MXTA 2JFBA 4Q9AA 1QIIA 3OMXA 4JZKA 2HXYA 4A8JB 1LX7A 3BZWA 3KE9A 4QQNA 1M2NA 1PWXA 1I9GA 4W9NA 4M86A 3L79A 4XJVA 1Q17A 4RA6B 2QY9A 3GUUA 3C1TA 3QKRB 1G6Q1 4ZHQB 1MTZA 3SG0A 2XE6A 1IC6A 3C6KA 1M6NA 5IKOA 1RSZA 3QF7A 1NJ2A 4F84A 4KDRA 1YRYE 3G79A 1U3TA 1UWLA 3MRXA 4EZBA 2OCAA 1WUIS 1PD0A 4DR5B 1EKXA 1NTRA 1FNSA 5AQEA 2QRKA 2Y1DA 1X0VA 2BRUC 1KOJA 2ZW9A 4LI0A 1WBBA 3ZLJA 4ZEWA 4BDSA 3CMCO 3JY6A 3F5QA 1MX9A 5CVTA 3QEAZ 4KTTE 3KR9A 1VPDA 1WETA 1NDHA 2X41A 5EJ4A 3GRRA 3OTOB 1YA4A 3AINA 2OLEA 3GRCA 1SOUA 4JSYA 4IIDA 3DE3X 1UDWA 1ZVJA 4L9AA 4G8CA 3U3ZA 2BFCA 1ORRA 1GGMA 1RAIA 4MQEA 5GP1A 4W7HA 2F8SA 3LAWA 2AF3C 4FINA 5JYBA 3LF1A 3PDUA 4QPDA 4QTXA 5LYJA 2VJYA 4P4GA 3FLAA 2YHIB 1N8NA 3IBTA 1QXSA 1TAHA 4I55F 4XM1A 3GNSA 3X1DA 1SVSA 1WUTA 3REOA 1J39A 1HLPA 4LSWA 4GX2A 2A1TS 3FYUB 3LGAA 4YWHA 4CL0A 4JX9A 4L0MA 1YUMA 2QE7D 2IYQA 1JVNA 3S68A 2N0SA 3S8EA 4MRSA 3GHHA 3V55A 1MX1A 1X1EA 1XLUA 3PQCA 3NIFB 4F4JA 4M98A 5BN1A 1DRVA 4JT8A 3ZU2A 1A7AA 3KLMX 4FTWA 5DXAA 3VC1A 1S6YA 3S3TA 2UZ0A 3KHSA 4QREA 4FB5A 4LOLA 4B9EA 3C3XA 1P3Y1 3WNDA 3FI9A 4DIBA 4QFMA 4Z8YA 1K7EB 4HLUC 4LMBA 5D85A 3DDHA 1PYDA 4COOA 4XWOA 1Q91A 3FKQA 4MKGA 2H5LA 1KJYA 1O6GA 3TJZA 1D5CA 2PWPA 3SZRA 4F86A 2AYZA 4ES6A 5T8KA 4CKWA 4KUHA 2DKOA 2YZKA 4Z49A 1JSZA 1ZN7A 3HI6A 2VYNA 3AB3A 3DQZA 1RQNA 5FA6A 1A76A 2IYTA 3HDTA 3OFKA 3QKSA 1IIRA 3IT2A 2DKNA 1CEXA 3GEDA 3LUDA 3M7IA 4MPJA 2ZE6A 3DBOB 1N5DA 4ZKEA 1JFFB 1DX6A 1YJQA 4YXWA 2NQ2C 4BE4A 3QFRA 3CVWA 1R6VA 4HDRB 4NXNB 1JR3A 5J59A 8GPBA 3WWCA 1D2EA 2XNHA 2YWBA 4Q5IA 1ESEA 4V0OA 3DMPA 5G4KA 4A27A 4QOFA 4F56A 3DJYA 1M72A 4DQKA 3JSAA 2EBUA 2C5GA 2V58A 2OHGA 1VCMA 1X74A 1YI8A 4C6RA 4US2R 3B89A 4FD3A 1ONBA 1MZPA 2YYSA 2GN0A 2GJAA 4L8GA 3STXA 1YR1A 3VYVA 3ZV7A 5I3CA 4P1ZA 1NA5A 2IXBA 3IEIA 1E6CA 2PGLA 2YWDA 3QVGA 4J43A 3PQ4A 3L8DA 1KRXA 4TUYA 1YL5A 1QFXA 4Z86A 3BHIA 4BATA 1RLMA 2QTLA 5KC8A 4DLNA 3QU2A 1DEOA 5DLYA 4W9RA 3SC6A 2O6HA 2HN9A 2QTAA 1I7LA 1ZD2P 3PENA 1TEVA 4XGNA 3G0BA 4R6WA 2HFKA 5KWJA 3U7HB 4L57A 4R71A 3DW1X 3T7KA 4DXHA 3IILA 4JC4A 5UKDA 4HNUA 2V74B 1AS0A 1F2VA 5SYAA 5AKGA 2EJBA 5I7HA 4WL0A 1OX5A 3E3LA 4I5FA 1PQYA 3OQIA 4Z3DA 3HCAA 3U6BA 3RSLA 5B5SA 3K8OE 3W4IA 2R6AA 1PKEA 1I1QB 1CRQA 1WV0A 3AUTA 4BP9A 3RTCA 1U0NA 1IXKA 4GI3A 2C54A 3Q10A 4MARA 2HWXA 4PPFA 3GLHB 2WFMA 5KNBH 3Q8KA 1X1BA 2M32A 2PEYA 3ICVA 2BKAA 4JJ4A 4LDNA 4F5ZA 3ONDA 1WXDA 1WXIA 4RZXA 1TB4A 5JNUA 1Z2NX 3NG1A 5GV7A 5JAMA 1T8YA 3WLLA 2Z08A 4YRNA 2H0QA 1OVGA 4TSFA 3HCNA 5A2QA 1CFZA 5C7IO 4DDHA 3E22A 3BQNB 3O2NA 3ZWXA 1PZHA 3TR0A 3ZCUA 3ND7A 3NIDB 4CNBA 2RJ3A 1JI3A 1PEAA 3DBLA 2V7GA 3NYIA 1U0RA 1CR6A 3A7EA 1Y4AE 4WNCA 1HEYA 5SYMA 2RE8A 3WDKA 2PLAA 1AXGA 2GRJA 3A26A 4YWJA 3T34A 4XM2A 3D8HA 4KN6A 3R0QA 1W8IA 4TWAA 1CVRA 4ZEXA 4C05A 3OTQA 1AZWA 1CQZA 1A0OA 1ONPA 2JFVA 2W37A 4DCTA 1M2HA 4LRQA 1VLVA 2HNBA 1OI2A 2GN6A 3KQOA 4BP8A 5C37A 4Y6SA 1UZMA 3OCUA 1QANA 2B8TA 5JW6A 1EXDA 3I53A 2QV7A 4JYBA 4BKOA 3B3FA 5A9SB 3PQ2A 4TYPA 2OK7A 2PUBA 1E9CA 1P4RA 2BM0A 1Z0KA 2CDRA 3D64A 1P1RA 3L7JA 3F97A 1TC1A 2I99A 3LT2A 4FDUA 2YVLA 3JZDA 4QDTA 4X84A 1WDTA 1XN4A 2CD7A 4L3VA 5HJ7A 3PEWA 4W8HA 4GNKA 1N5MA 1IXSB 2MDTA 5IBQA 3DHEA 1E5XA 3LC1O 5DX0A 3W9YA 1CUVA 1V1MA 5JBNA 2XB6A 4H15A 4Y0VA 5H80A 1HQDA 4QPZA 5FWAA 3MTEA 3MCZA 3FPLA 2PBLA 3PNMA 1EU1A 1QOZA 2QMQA 1QFZA 3G68A 4NFSA 1T8TA 2VYND 3QNWA 2OGTA 4M88A 1QIHA 5C46F 3THWB 1VKNA 2IS2A 3SHVA 2DLCX 3O4IA 4GL2A 1QUFA 3E8XA 3FA2A 4DQ0A 3BULA 1WDLA 4Q4CA 4P36A 4KOEC 3VH2A 4YXWD 3A6HA 3T4UA 1C4KA 1GG2A 4OLFA 3RTAA 1JR3D 5KOYA 4B17A 1QP7A 1ZJJA 1OLUB 3K4HA 4MVJP 4Q01A 1C30B 2VCEA 3DO6A 1YUBA 3A3PA 3QUCA 5CAEB 5LP6A 4OGKA 2TYSB 5IN5A 4X62B 3DR5A 3NV7A 2QVGA 4NJOA 5J1SB 4CLHA 1N0IA 1XZJA 3KFVA 2WVHA 1SHKA 3NV9A 2CFRA 3H16A 4UCWA 2DOKA 4FGUA 4EIWA 1U2EA 3C8HA 3U9SA 1PR1A 4QC2A 3FOEC 2ZSHA 3BH0A 4B3MB 5C5EA 3LP6A 2BD0A 1WQ4A 2HB6A 1DAFA 1Z16A 1VXOA 1O4WA 1ZGGA 3A9WA 3GMDA 4HUTA 3CT6A 1KBQA 1XO1A 2DWPA 1QCDA 2JJMA 2O7QA 5ESXA 2REBA 1I9CA 1DLJA 2LTAA 4WPGA 5HM8A 2OQ2A 3I6BA 5EERA 5FO0A 1JJBA 4BB0A 1UAGA 3T06B 4L8WB 2AE1A 1X13A 1ICIA 1K7FB 2ZRJA 4MKFA 4BX9A 3S81A 2HWYA 1D0SA 1G64A 3LOPA 1ZD1A 5DF1A 8ADHA 2WVAA 3PX3A 4YAFA 2X58A 5GINE 2R84A 1B2RA 1X7HA 5JD4A 2FW8A 3WDLA 4CIWA 2DB3A 3A6JA 4ZC8A 5C5DA 1I33A 1O0SA 4D6XA 1Z0IA 5HCUA 2WWRA 3DA8A 3EQZA 2D5AA 4ENVA 4Y2TA 4G85A 2NZJA 2QXTA 2IVZA 1ETUA 2GFHA 3OIGA 1FJHA 3IR5A 1KMNA 2I33A 1OZGA 3SEFA 4RTOA 1ECFA 2IQ5A 5GIPE 4R0MA 1BKDR 3JWJA 4KQ9A 2J0UB 3I01M 3P2MA 4ZVMA 4HWPA 3H2YA 4BLQA 5I51A 1D2RA 2BGNA 1XELA 3JWHA 3V3KA 5KOJA 1IVNA 1V8DA 2X42A 2VPQA 2ZRKA 4MQFA 2J3KA 2AMLA 1VJ1A 2CVOA 1VRVA 1E9BA 4KWCA 4OP2A 4TMWA 5DN9A 3W5VA 2MSWA 3OBBA 1RABA 1TQ8A 1TF5A 1USUA 3BXGA 3OQBA 3Q98A 3TPCA 3VUFA 1A7JA 3D7SA 3IB6A 4HX2A 3A58B 2G8NA 3TZBA 2X2EA 3KKNA 4CGYA 3R6GA 1CDOA 1X3LA 4KB5A 4ZRNA 3C74A 4RF4A 3I0MA 2VP6A 4HQ0A 2OB2A 4J0CA 3UOWA 1BGXT 4UOZA 1DB3A 2CFTA 1F6BA 1NG9A 2OUKA 2Z2IA 5FBVB 3LUJA 2IP4A 3LQ4A 4NCNA 2KB0A 1N2BA 1U4SA 2P9HA 4BJ1A 4CM8B 4GLOA 3SDZA 3I5XA 2MWMA 5KWEA 1AZTA 3GYGA 1ABEA 1QG0A 5ILQA 1M1UA 1G38A 3PIDA 4PC2A 4PO3X 2CKDA 5HIAA 5TQJA 3WA7A 3UAOA 1X1AA 4G36A 4K87A 1U2SA 1YZHA 3QWIA 4DDMA 1BCSB 5KDLA 2CHGA 3NT2A 2AUNA 3WB0A 3MGKA 4QBKA 3WJ2A 4WXRA 4IQGA 4QWMA 1GSIA 3O4HA 4NESA 1PFYA 5EP2A 3OY2A 3F96A 1KOGA 1IY9A 1H2WA 3I83A 5D3MB 3HFRA 3R23A 2VNHA 4F60A 5LA6F 3WGJA 1TVKA 4DDWA 1D2HA 1KZ1A 3IH5A 2JL1A 3WLQA 3JZFA 4LXIA 5LWQA 4JJ6A 2RBGA 3SFTA 1P8AA 3A6GA 1CY2A 2YNMA 5C81A 1N7JA 3W8NA 1U0SY 3T52A 1WHSB 3ZDDA 1XRRA 3ZX4A 4PICA 1RAAA 5FD8A 1EIZA 1FLNA 5IM4F 1S1CA 4IG9A 4AN4A 1GZVA 2GPNA 4RNDB 3RE1A 4ZDKA 1VHDA 3LDUA 4D4IA 3A1TA 4IOMA 4B0PA 1BCRA 1HG0A 2EWVA 3QHAA 3CONA 1GNVA 1KYTA 1UBOS 5A4KA 4HV4A 1Q19A 5DYGA 4D25A 2FZLA 2DYKA 2HNAA 1FVFA 5FL7A 1U2GA 2WWGA 1UK6A 1DAOA 2H54A 3C43A 4UCQA 2RHMA 1Q0ZA 5FA8A 5BSFA 3VH3A 3V2GA 5C80A 2LDBA 2Z6VA 3F47A 4ZQEA 2C3MA 4X3PA 3GLGA 4BVAA 3WS7A 3HN2A 2IZZA 2VA9A 2X1MA 3GLKA 4OAOA 3V6MA 2AK2A 2OG1A 4BV8A 3NKFA 4R7ZA 4EHJA 1SXIA 4BPBA 2C3UA 4BLVA 2XMBA 5KI6A 2FUEA 1E20A 1YH3A 2BTQA 3ZOZA 3SD7A 5JNTA 1TCAA 1C7FA 1IHXA 1K06A 3SJ7A 1I7DA 1RVDA 3ODGA 1QPGA 1ZQ9A 3U44A 1F2TB 4IGFA 1Z7EA 1NQXA 2HLNA 3D6FA 1F1BA 4Y3UA 4C3OB 4DCNA 2ZIWB 1G5FA 3IHWA 2PKQP 4LXGA 4RE5A 2OXIA 1Y8QB 1CVLA 2VDJA 3K9GA 4XOUA 4EMTA 1DQRA 1W36B 2UVQA 1N25A 4TV9A 5BOSA 1S2OA 1YFKA 3CWZA 2UVPB 4LWQA 1FP4B 3VPAA 1BX1A 1H5QA 1ZKMA 5LQCA 3KL2A 3G23A 2P9YA 4BGUA 2SCUB 4BFTA 1PZGA 4HDSA 3E7XA 1Z3IX 3MOGA 3N7TA 2X5XA 4GVPA 1ECGA 1P1KA 4UEWA 5F1OA 5HZGA 4ENRA 1PL7A 5FHRA 5CG1A 4UHCA 3IVXA 5BWLA 5EQDA 3H1BA 2N3ZA 2ZTHA 1V2HE 2I4OA 4B09A 3B9QA 1NVGA 2REXB 3D4IA 5EJIA 3ZKWB 4TZTA 3T9CA 1T1JA 2JFUA 3K5PA 4GLBA 3RK0A 4AX4A 2CF6A 2Q3EA 5C8YF 4MVJG 4N8SA 4R05A 4YLYA 3AJEA 3F98A 1U0GA 3HL4A 3ABQB 3HP1A 3JVUA 3WL6A 5BV2P 1Z13A 3FOFC 1ZR2A 1NF2A 1R0YA 1W30A 3DT6A 1GP2A 2VZEA 1UKVY 2OLKA 1FLVA 2VJKA 1CXZA 5EKXA 2GPBA 7AT1A 2IH2A 2IEBA 4J75A 1W2HA 1G2QA 1I6WA 3NAQA 4KLCA 2OGUA 1GFZA 3FNIA 4X1IA 4A9AA 4CW7A 1HE8B 5TMBA 1C3XA 3QBTA 4UMEA 3UBMA 3UPTA 5BMVB 4R1TA 1RI5A 1H6BA 2H31A 4KVFA 4URFA 3RYIA 3L6BA 4EPRA 1KC1A 4J9UE 3UMJA 3CUVA 1QK3A 1PR2A 1K4KA 2W2KB 3G5MA 1E7RA 5LVAA 1FS6A 2QKYA 4QNMA 3BSFA 4ILKA 2NAPA 4QRIA 4KK4A 2E48A 3DF7A 4IJWA 1Z8FA 3BD8A 4AUKA 1RS0A 4O3MA 1QAQA 1RT9A 3Q12A 4IRMA 1ORTA 3KQQA 4K8RB 4LNUB 3SQXA 2H2IA 2VRCA 4RNCA 1OWMA 5JSYA 3T7RA 2FPLA 3A6DA 3SC2A 3HDHA 3K6KA 4IDGA 2XRFA 3TQCA 4ABTA 1ZSYA 2X4DA 2HSDA 4IDBA 1D7AA 3T5BA 4CMIA 2UUAB 1XA0A 3PFKA 1R4NB 1VDZA 2YNMD 4FMBB 5F51A 2XMZA 4QZVA 1L9KA 5G1NA 4BN4A 2ZQ5A 4CIYA 4J7XA 3SKXA 2Z3WA 1GDDA 3B52X 2CWWA 1UJBA 1Y5NA 3VOSA 4GS5A 2G70A 1DAKA 4H3SA 1Z4NA 1QS0A 2H4JA 4NS4A 2ZSBA 5AMXA 2E6UX 3D8NA 3PDCA 5JD3A 1M0TA 1Y37A 2HZ7A 1GPJA 2M6SA 3ZHXA 1E64A 1JU9A 1PCXA 3EB9A 4PZ9A 1Z5VA 4MVJA 4TX1A 3RVPA 3SI7A 3TM5A 4YV7A 1VQ1A 1JZSA 3OZ7A 3FTDA 5FL7D 5EHZA 1UPAA 3QF4B 3BCUA 2AEEA 3O38A 3IDQA 3L3BA 1ADJA 4R3WA 5EIOA 3FOCA 3TUZC 4GSYA 4GEGA 2RHGB 4JEMA 4UDNA 3TLYA 4F3NA 2B3DA 3KB8A 1SK9A 1SOWA 1Z6QA 3MERA 4G81A 4OHMA 2OBBA 4QBHA 4QL3A 4Y1RA 5KVQA 3VBEA 5BUSA 4FJ2A 1HMPA 1CY6A 1ZSNA 2FQ1A 2JCSA 3OQ1A 3RWBA 1VE7A 4WKNA 4KKVA 4J6EA 4KYTA 4NCJA 4RGBA 3RRJA 2L18A 1CP3A 1OASA 4EJ2A 2I6TA 4JBGA 4KMMA 4RIGA 3ZVNA 1T36B 1XJ0A 1DKQA 4RGVA 5LMCA 2JA1A 1EFDN 2O3SA 2CUNA 2OVFA 3IC5A 3RJ9A 1J22A 2SKCA 4MWOA 1S2NA 5KMGA 5ECDA 2KE5A 1TAUA 3K9NA 4QUKA 5IG2A 3HVJA 4G5QA 3TSAA 2O2SA 5JOQA 4RELA 3SZUA 2VXCA 5AVXA 1KI2A 2H4ZA 5P21A 1YTUA 1GEEA 2R62A 3LTEA 4HDAA 2GPYA 4PNHA 4EPYA 4MUIA 3AMVA 1UANA 3IDOA 4OO3A 1V41E 4KQEA 4EHDA 4GC9A 1C1DA 5G0TA 1SUFA 3K0AB 3SPXA 2PS9A 3ER8A 1WCWA 4YLEA 5FPQA 3UCFA 2BSQA 1PVVA 2VHVA 1S3GA 3ECAA 3TRFA 3TTXA 3ZGNA 4ZMRA 3AOEA 4KN8A 3TIGA 1T5LA 1SGWA 5A3QA 4D2IA 4EL5A 4C0XA 4OJTA 4DSTA 3RRZA 1MHPA 1MJFA 1W5EA 3K4QA 4YDRA 1TD9A 2R47A 4N18A 3IJ5A 4NP6A 1YD7A 2PRSA 5C32A 1O87A 4PWZA 4EF4A 1JQKA 4OXIA 5EGSA 4CV2A 5ICFA 4HAXA 3JS5A 3RW9A 4O4IB 4N47A 5D5PA 2WJWA 3DWGA 5KS2A 1XU7A 2NPIA 3JQ9A 2EX1A 2XUJA 1L7QA 5EHQA 3WQHA 2QBYB 1N5LA 3RK4A 3ANMA 2DFNA 4AULA 3FHCB 4MR7B 4KFSA 4LZZA 1L4YA 4GZ5A 5K8VA 1ZCFA 4GRDA 3H7AA 4FILA 4HAOA 4ZZ2A 3F8WA 2IX9A 4O1IA 1H2RS 1TK2A 2UYCA 1ZKDA 3AQ4A 2WP8J 1AN0A 4D6YA 4B3SB 3TSCA 1G8HA 3DZFA 3L92A 4KH1A 4F5WA 1ZGZA 2WJAA 4IVRA 1GN9A 1EVLA 3TL6A 4RMNA 2FFRA 4FYKA 1Y3BE 2FPGB 2P77A 4RS3A 2CXQA 4U2FA 1ISIA 1W0KA 2QW0X 4NMLA 4CIVA 1FYEA 4QWWA 4EGSA 3BKWA 5JRDS 3UGJA 1RXVA 1KJQA 5LQJA 2B0CA 1QU3A 1D6SA 1ELOA 1G1MA 4JQZA 1KEZA 4ZZ0A 2QSYA 5F3RA 4BO5A 4B3CA 4EKYA 3GXOA 3IAEA 2QD3A 1X77A 3ZLBA 2F64A 1DX9A 2B1IA 1QV7A 3DULA 3B70A 4PBSA 4XWTA 2OC4A 4A2QA 4KNWA 4M4SA 2VRCD 2VJOA 2AN3A 5WRFA 5TXGA 1DWOA 1MVLA 2CHEA 2XD9A 4QGSA 4YT8A 1DRJA 4RKEA 3T7DA 1EWQA 1U1DA 3IIKA 1NBOA 3HPQA 3ICCA 3OD5A 5E8JA 4URVR 5BVGB 5A4DA 5C4IA 3EZLA 1R9NA 3DTVA 1XROA 4ER3A 3ICPA 1QIGA 3GFQA 5FWDA 4I55B 3IE2A 1NLYA 4PR0A 1JQJC 1C29B 4U7PB 4EJ6A 2JI7A 5F5XA 2DU8A 2VT3A 3D3WA 3VGJA 3KELA 4K0KB 5BPHA 1UQRA 1YCHA 5A7GA 5CYOA 4UQOA 2IRWA 1HL3A 4LXTA 2HLHA 4RJJA 4X3CA 4MVJD 5EZYF 5BR7A 4JJKA 1OA1A 3P94A 3QA3E 1MJHA 3TO5A 4TYMA 1E2KA 2C0PA 5EP4A 1V71A 3T12A 1GITA 3PUHA 1NLZA 1R5OA 2ZUBA 2AA3A 1WTAA 4RK6A 4DLBA 1IG3A 4CR7A 1FFEA 1Y4SA 4K9PA 1U7XA 3ZWKA 4A16A 3S27A 3BG5A 5HXAA 1JT9A 4FR5A 3E6AA 2HFJA 1Q1EA 2CJPA 2ICAA 2C8JA 3F3YA 4KYIB 3ZOKA 3OCCA 4KR9A 1BEEA 4MUAA 2ATEA 3FR8A 4HFMA 3QY0A 3UJNA 3PC6A 1WSDA 1DIOB 4RZ2A 4LISA 3N0WA 2Q8QA 3NO4A 1NW7A 2EKLA 2AUTA 4PLGA 4UBOA 2WFAA 4FDVA 1YFJA 3MBOA 3FG9A 3O0DA 4FHZA 4HZUB 5D84A 2XGSA 1P74A 3DG9A 4MI9A 2J0QA 2MOKA 3OZVA 4HJXA 3QFCA 4FYHA 4IF6A 3TSYA 1Q0SA 4EQ6B 1XDBA 3M1LA 2OPHA 4N7JA 1MABB 1HMYA 2JIOA 4Z2AA 4QPJC 2YUIA 2CDBA 1TM2A 1H1LB 1QYDA 2ZIXA 4EGQA 2VTBA 4TS9A 1J90A 1NT2A 1V4NA 3EY9A 4YCDA 4AZVA 1YR3A 3HLYA 3C6YA 2A30A 1JILA 3E9DA 5IMSA 3BX1A 4WZ6A 1XN1A 3L6RA 4OH7A 2QYTA 3ROZA 3R7WB 3TQFA 3WIVA 2HJWA 3A6PC 2CD9A 2GK7A 4LY9A 5HRUA 3ADKA 5K45A 3DZCA 4UJ5A 1IRIA 4PVCA 1G291 2CLEB