2X4IA

Orf 114a from sulfolobus islandicus rudivirus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
112
structure length
105
Chain Sequence
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGHDSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISILTLEEILKLYESGKVQFFEIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED PROTEIN 114
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus islandicus rudivirus 1 variant xx
molecule tags Unknown function
total genus 25
structure length 105
sequence length 112
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08960 DUF1874 Domain of unknown function (DUF1874)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x4iA00
2J6BA 2J85A 2X4IA 2J6CA
chains in the Genus database with same CATH superfamily
1XD2A 2RGNC 5LUBA 2WSMA 1UBHS 5IJ0B 3G9UA 3MT8A 1V48A 4FB5A 3F6EX 1EE2A 2BWJA 4Q66C 3JX9A 1GGFA 4W7HA 2PGLA 2MR6A 4BMCA 2BM1A 4RPJA 3WXBA 1LDBA 4F8JA 4JXZA 3FLBA 3I2IA 2HCBA 4OXRA 4JCCA 1B2LA 1KVRA 3GBSA 3OPXA 2EZTA 3MHTA 1N9ZA 2WWIA 2JFXA 4IS2A 1V7QA 2VJLA 2B0JA 4J07A 4WADA 5DTJA 4DR7B 1YHZA 3DE3X 1GZUA 1IBRA 1QGDA 3OKAA 4AN4A 1R9NA 4G5RA 2NVUB 3EZ2A 3R3ZA 4KGVA 2ZIXB 4CMBA 1ZBQA 3I5AA 1DHRA 1BQEA 2HA6A 4O6VA 3U44B 4YT2A 3MUOA 3LVFO 4UPDA 2R8OA 5IVIA 3W2TA 2XMCA 1A8QA 2J9GA 4WW0A 4XWYA 4RQAA 2VHWA 4IDQA 4F0JA 5G1PA 3MJRA 1WZEA 2RH9B 4Q4HB 4ME6A 1IRXA 4M9CA 4BUJA 3TNFA 2G1KA 3NM6B 4KZPA 2MU1A 2WYIA 4YMWA 4NECA 3DAOA 1U3WA 3ZWDA 4MMZB 4YT4A 3TRJA 1GZ6A 2O7VA 2CD9A 3H6GA 1SVWA 4TMWA 2H4YA 2XZTA 1B43A 3Q7PA 4X1IB 3V46A 2B7CA 4ARVA 4D25A 1BCRB 1YIDA 4G1EB 1A72A 3OUTA 2BEVA 4CGYA 4NBSA 2HSGA 4V38A 3MTGA 2WUGA 1QK4A 2R2GA 2FZ4A 1SVSA 2NTEA 4OJNA 4LDZA 2X4LA 4IAOA 4L4RA 5C8VA 5DXJA 1JEOA 4ZYLA 3MLBA 3ECCA 2B82A 2DPMA 2Q8NA 3UJ3X 2JIMA 4XVHA 4URVR 2J31A 4GBED 1V16A 2QBYB 3U1TA 2MSDB 4BVKA 3BT7A 2X13A 1TO2E 1JTEA 3KHKA 4GLBA 4KRGA 4RM2A 1IHDA 2NLOA 1BW9B 1NY5A 1TQDA 3RYFB 1L7BA 4KWHA 1AQLA 2DLDA 1YQ9A 1X14A 4JS0A 5AVSA 3E61A 3FMFA 2GKSA 4CTKA 4GX5A 4RTSA 1V95A 2M6LA 3HVKA 3JQAD 3UXHA 2BMAA 1Z63A 3EZNA 2X9NA 4WOJA 3JRWA 4G1CA 1NUQA 2I9KA 2O0JA 4X95A 2QL6A 4CLOB 1JKXA 4HQRA 1E0SA 3RC8A 3A2MA 2A59A 4WLFA 2WJJA 2RI6A 3BB1A 4L51A 1AXRA 3SSNA 3LGSA 1Y7TA 4B47A 1VLJA 1JIVA 3KVOA 3O82A 4KYVA 1P2UA 3ENNA 3A9CA 5F33A 1IY0A 3W6PA 1M73E 1U7PA 4JUAA 2J59A 3C1OA 3QKUA 4XTRA 4EYOA 3PQ4A 3Q3VA 4JB8A 3ET5A 4OP2A 5LDHA 2GPBA 5B64A 3ISVA 5LMZA 4J0CA 2WPDA 3WAGA 3R4CA 1YWGO 3PKIA 5FXMA 3ZHZA 2HJVA 1FY2A 3NHLA 1YL7A 5KX5B 1TW3A 5FI1B 1XZCA 1Y7LA 1WSWA 2FX2A 1V8BA 4JLVA 3E4CA 2GPAA 3HYLA 4QEDA 4CG1A 5JAPA 3JD2A 5ITWA 5A3QA 3OT1B 1RAIA 3BRWA 1D1QA 2EARA 2FWNA 1C8KA 2I4TA 3M70A 4O0MA 3UA4A 4QG3A 4KSCA 2P78A 2PD6A 2XQGA 3LY7A 4K8OA 4XIYA 4CNQA 5HOQA 1PBTA 1QMPA 1ZC3A 4EAAA 4R4JA 2UDPA 2W2QA 2AKEA 1YB6A 4HYEA 1CRZA 2ORVA 1DC4A 2XSZD 2EATA 4AP6A 1N5KA 4GR9A 1RQ2A 3K9QO 1EWVA 1JG7A 4RIEA 2PLRA 4RH3A 4EL0A 2W6ZA 5DSXA 2EDAA 3SR4A 2X23A 1L8QA 1J2YA 1QIIA 1A9PA 1U5AA 1Q44A 4JOQA 2AQHA 3C2QA 3AF5A 3DE1X 4RZIA 3QE2A 5AQEA 3WWEA 3KYDA 1NBMA 2FPIB 2AZMA 4FMCF 4AJNA 3GVPA 3WI7A 3OUUA 2X77A 3WJ7A 1OAKA 4TL7A 1HMYA 3FYCA 1RAEA 2O2XA 4BJ5A 1SIUA 2RGNA 4BV2A 4F93B 5KOYA 4DB2A 2XH8A 4WGGA 3Q11A 3VNRA 3EF1A 3ZQJA 3E0QA 1Z83A 5AD1A 3IVAA 1NKTA 1PUIA 1BMFD 2PD4A 4HGPA 4MS4A 4ZRNA 1REQB 5FJJA 3ZDAA 3D3WB 3ILVA 4URUR 4BFYA 1QHHA 2I67A 3AY6A 3RGGA 4BEVA 3AOEC 1EVKA 4RW0A 5LOVB 3FOBA 2N75A 3USCS 1ULBA 4Z0HO 3E1SA 4EUSA 1NYLA 1RQ7A 1Z0JA 1RWPA 2AB0A 3GOQA 1CZNA 3KAQA 3Q2IA 6CHYA 1QH1B 1UP6A 1ODKA 4D81A 3Q8KA 3K4PA 4HEA6 3WGNA 1X9HA 3MS7A 1TEVA 3CPEA 4WXHA 4HNUA 2CXHA 2XGSA 1I9CA 3N70A 1DPFA 4NDZA 1EK2A 3T94A 4ZDIA 4RD1A 4EM6A 2PLNA 4FN5A 1VBFA 5AW0A 2DT8A 1JF8A 3SCZA 5CX1B 2OO7A 2VEOA 5BSTA 1W93A 3C16C 4PYLA 3K9CA 4PANA 1JJBA 3MINA 3EGWA 5JPIA 1A9QA 4FYWA 1Z22A 1GZ5A 4L9SA 2XI4A 4NRDA 1V45E 4COKA 1ZN7A 3E27A 5LP6F 1TTPB 4E0BA 2JASA 4YEDA 1CF2O 1XRPA 4HVAA 5H9VA 3TXYA 2HHAA 3RC3A 2QV7A 5CEFA 1WX1A 5DPMA 1SB8A 2PUGA 5LP6B 2HRDA 1BYUA 4PQRA 2YXPX 2Q62A 4RQUA 3JQ8B 5DNVA 3TTXA 1ZK1A 3TOZA 5IU6A 2X6QA 1B14A 1VPTA 2VIIA 4OV6B 5F23A 3ENQA 2ZIUB 2ZTMA 2YNMD 3AM5A 3OEEA 4H77A 5BSKA 4H7KA 3N0TA 2IA5A 2H1OA 3HADA 5GWXA 1XOIA 3KT6A 4YX9A 2XWJI 2J9FA 3ZGLA 4DQUA 1EWYA 2AE2A 1SQSA 2X8JA 5CYPA 2A3NA 3TKLA 4BNNA 3OA2A 1L5ZA 3FNHA 3KNZA 1OGYA 4MQLA 1T3SA 4MW5A 1N2BA 2F17A 4WSOA 1XDSA 3HKBA 4PYIA 3TX2A 2AOTA 2XOKA 3DB2A 3ESBA 3LLCA 1RRCA 1J5XA 3NIDB 4Z99A 4BC0A 1L3CA 1UKZA 2ZSAA 4AX4A 5DXFA 3G2KA 4HR7A 4R51A 1KC1A 1EJ2A 3CLSC 3L07A 1Y5IA 5KYTA 4RHYA 2TSYB 5DM70 4YHBA 2NTVA 3OCZA 3C74A 1DIHA 2BP7B 2ZBGA 3S6JA 2E55A 4HSEA 3SIPA 2D0PB 4HCJA 4HRXA 4MRSA 1EGQA 2ZWAA 2OV1A 1RSZA 4MULA 4B8WA 1SNYA 3U3JA 5B4TA 1XNRB 4AJHA 2JPDA 3F6YA 4Z0TA 3IQFA 3ZWMA 4HWTA 2N46A 5HK8A 4TMFA 3H9EO 3FHLA 3RROA 3EXG2 4MV6A 3WRYC 1Q1AA 4E5YA 5TRTA 3ZQ4A 5ITSA 4PHCA 4DF3A 4PG8A 1S8AA 3L4SO 5K0SA 4N9QA 4XX0A 3Q6NA 2AC4A 2TMGA 4JA2A 5SZKB 1NRIA 3ZDXB 2IUUA 1IEQA 4IIGA 4DEVA 2PFGA 1WXQA 3N6RA 4UTOA 5SYNA 5LWHA 1YE3A 3BCSA 2JJ2A 2OZEA 4OXXA 4R68A 1IMJA 4RTOA 1Q1EA 2H9AA 2FQYA 1KYXA 3C24A 2LCQA 3ZIUA 4JP5A 5EJMA 1G9SA 2YW9A 2OCIA 1OAOC 2DH5A 3A28A 3N2NA 4EUKA 3B89A 4J0DA 1GEGA 4FDVA 5J4KA 1A8HA 3K1YA 1YZLA 4YMIA 2F3UA 4PSAA 4LOAA 1SUSA 4XEHA 4H0CA 2FFAA 4X20B 1QAOA 3WV5A 4M99A 3T5MA 3T5BA 5G3ZA 3HO8A 2P7IA 3BE5A 3NBKA 3PR1A 3LLMA 5I3ZA 2JFFA 1GSIA 5PGMA 4C0LA 1ZR2A 3L06A 1ONPA 1PX0A 2QVYX 4Y6PA 5F52A 4LC1A 1V1RB 3MS4A 1XVVA 2Q5OA 4E5MA 4FHGA 3RT7A 3D3QA 5D7NA 2WA1A 1N5OX 4CKBA 2OOKA 2ZTSA 5TQ0A 4D5GA 3MB8A 1QU3A 2QLBA 4Y6SA 5IPFA 4AWBA 2QX4A 3QKRA 4AQ7A 2BMVA 1QORA 1W5BA 2YH2A 3B48A 2VDWB 3IXQA 3LNTA 4HATA 3RCBA 1T6XA 3TFQA 2P2LA 2WHPA 4G1MB 3B1ZA 2J5KA 1ADBA 2ONKA 2H5EA 3A9UA 2W6QA 5D7BA 5KWSA 3K70D 3AVWA 4II2A 1HDGO 1CUZA 2AJLI 5DVZA 1Y48E 3STYA 1POWA 3IEUA 3OA0A 3QNWA 1Q1BA 5SYAA 2OO3A 3WNBA 1ZRMA 4AZWA 1E58A 1MABB 1U8AA 1B42A 3RFCA 3RVLA 1BKDR 3W6UA 3H2SA 3OBBA 3M6LA 1KEEB 4LZAA 5T57A 5DXAA 3OIDA 5BSEA 1CE8A 1Z0AA 4Q16A 4R8MA 3PJEA 1Z3IX 2AK2A 1NV8A 4HK4A 4ETIA 3L18A 3C8DA 4OM8A 4AUNA 4ARCA 1RYMA 2C03A 1P2DA 4MICA 3OZCA 3GRPA 3QXXA 2ZI3A 3GD5A 4TVOA 4C21A 4XVRA 4PHHA 2D2VA 1ST2A 2A9OA 2JCSA 5ED4A 4RTJA 4HUQB 1VG1A 1CNEA 1W96A 3MUNA 7GPBA 1SAYA 5KVAA 3QBTA 1DIGA 3L1HA 1AKMA 4QSHA 4Y9SA 4YCAA 3TIIA 3BD7A 3QA9A 1NUHA 1W49A 4PS0A 4N3BA 3TLXA 2DJ5A 2PVSA 3SXUA 1VPEA 4ACBA 4U7DA 1GJRA 2B83A 4DC1A 1UFVA 1DJMA 3LBFA 5EEGA 5EVCA 3ZUGA 1II8A 2KI5A 2NU6B 3DLPX 4I66A 5FT9A 2BJHA 3L0IB 4FKBA 2GDJA 4LZLA 3RYIA 1DQPA 2J9ZB 4R31A 3V9PA 4URWR 2K7ZA 1YL6A 2OECA 2FN3A 2ZSHA 3B3FA 3AVPA 5ALOA 5ARDA 3IOMA 1SM4A 4B35A 4XCQA 1L5LA 2J7PA 4CQJA 2IV2X 1B8VA 3PGVA 4M0DA 1N2SA 1GFSA 1L9KA 1SCBA 2JIOA 2P5TB 4KWTA 3K9LA 5DN6A 3RVJA 1KZ7B 4GQAA 5JPDA 1C1DA 2D4HA 4D6YA 1XN1A 1QFZA 2WYHA 3BBPA 4OQ4A 4Y2YA 5CM2Z 5SV2A 2FJUA 2VJMB 3K6KA 3LJKA 2HTEA 4IIVA 4PLFA 1IUKA 1R6UA 4I50F 1E7QA 1QQBA 2AQ8A 2ZB4A 1X70A 4MK4A 3WMEA 7REQB 5EJ6A 4U63A 2H1CA 4E14A 4B3CA 13PKA 3D6JA 3TTVA 4ZCRA 4NK4A 4E09A 4IXTA 1XCOA 5JZSA 4C03A 1ZO8A 1FP4B 5ITZB 5SYMA 3WKBA 3IO3A 5AW3A 3VOBA 1T5LA 2FMUA 5T8KA 4EENA 4QT4A 5A3SA 3GAAA 1CUIA 1HE1C 1SN7A 1O0CA 3FLAA 2OQRA 2WUFA 5AHKA 3ZXIA 1I5RA 3RS9A 1GSAA 3HJTA 5LNK6 4MVCA 2UUPA 3WRYA 3GLUA 4UHJA 3X43A 5A3VA 5CDFE 2H51A 4R5HA 1TT7A 2JHCA 2KQUA 2Z1NA 4ZANA 5K7SA 5FR2A 1T0PA 1VB5A 1T9CA 4C87A 5G0WA 3JR7A 1UBFA 4LEIA 4W1PA 1DBQA 1L8OA 2FMKA 3EJWA 2BLNA 1R7RA 2M2IA 3K2BA 3W4IA 5AUNB 1CR4A 1JJVA 1K8QA 2N9UA 3C6BA 2QGZA 5FF9A 1OAOA 1VI5A 1HETA 4LSMA 2GM4A 5E0KB 2QRNA 1RQLA 3WLRA 1RBMA 2FQ1A 3GU3A 4MEJA 4RYLA 4HSGA 4XWAA 2YVUA 2I2CA 5BVGA 2WD9A 1AUQA 1FFSA 2WJ3A 3SQDA 4OHXA 4M1OA 2JAQA 3LQ4A 2PXXA 1WQ3A 3G8DA 3V97A 1OFGA 1GA6A 2HQRA 5FDFA 5GVSA 5JS8A 3IA2A 1FMFA 1UP7A 2ZAGA 1V3UA 2BZSA 2O5VA 3RNOA 3AJ8A 1DAPA 4C7BA 1WEKA 2R0QC 1CY1A 4AJ9A 2HYIC 3KB2A 2OENG 3A6JA 4IG4A 3CPSA 4AK9A 1J1IA 4QOFA 1YIAA 3PDIA 2CL6X 2QMHA 1AHNA 3SF8A 5FLEX 4L5YA 5JNTA 3NBUA 3UMRA 4CXMA 1WLSA 2X8WA 1U9JA 5CM8B 3ZGYA 3LBHA 1W36C 2R87A 2YX1A 1U8ZA 4G0PA 3NMUF 1WSAA 1KP2A 3LPCA 3DEJA 1NJSA 1SBNE 2NXCA 1ISRA 3CKMA 4PGAA 4LE2A 3LCVB 2XVZA 4BO9A 3F47A 5L53A 1VL2A 3R9WA 3TOSA 4YCSA 2ZM5A 2BBSA 5AVRA 3S81A 2XMRA 1WZIA 3HYRA 4IUYA 5HZKA 1EVQA 4JU8A 3TNYA 4P31A 1EMDA 2FPMA 4BDSA 3DZ8A 1JVSA 1W35A 4FLFA 3KK0A 5JIBA 2F62A 4H17A 2PSDA 4ARIA 2OVFA 3ZWWA 4ALKA 2VS1A 2ZIAA 2QT1A 2ZR0A 4OU4A 2OWEA 3WLFA 3GVHA 2GEBA 3DC2A 2B8WA 1E1QA 1UM9B 4ID9A 1W4CA 3VC3A 1LZLA 3M3PA 3PRHA 3U5TA 1FLNA 5EJ7A 2CJWA 1P6QA 3P0HA 5ALFA 4JXKA 2HHHB 1UDBA 1SELA 4NE2A 4WNIA 2FK7A 4MVYA 4ARBA 1L1EA 2FZVA 2Y4OA 4M46A 3RLFA 3UJDA 2BFNA 4IWYA 9ABPA 3KKLA 4PPNA 1XZIA 1AN9A 3KTFA 3UPUA 1WQ4A 2EG5A 2C3MA 4A23A 2WKWA 4PX2A 2ZUCA 2UXDB 1E5LA 3AL2A 2CXTA 2AMJA 1NVVR 3Q3CA 4X85A 3UAGA 1MW9X 4O4IB 1HE5A 1EX9A 1DRJA 2P2GA 3TE7A 1WIWA 2IDMA 3HLTA 1G38A 2HDHA 1TF2A 1JHQA 4H15A 1E9DA 4AO8A 1VCNA 2UU9B 1BIFA 4P3NA 3T0IA 4QHSA 3U80A 2ERXA 2DAPA 3VHRA 2WTUA 1EA7A 1A5AB 1V1MA 1OU4A 2J0UA 3N53A 4OQXA 1TF7A 2JH3A 4X44A 2C2GA 3BRCA 2XWBF 2X4DA 3T52A 1F17A 3QVVA 4RKWA 5BN5A 4KQHA 3DBLA 4BLWA 2XYGA 4CT4B 4YI5A 1VPDA 4HDNB 5K0ZA 1AB5A 1N77A 1SURA 1U2DC 4KQGA 4DM3A 1SU8A 1PWYE 1ZNXA 2PLWA 3E9RA 4XQ0A 4EHLA 4HAVA 1DKRA 1EB8A 2GCNA 4KUEA 5KU1A 1OXUA 1UQUA 1GEEA 4LYDA 3BULA 3UWPA 3VSEA 5IS2A 2VLIA 5C53B 3SC2A 4C07A 1NQXA 4IBOA 2A5JA 1E9VA 2C9YA 4FWIB 1BGXT 2NNLD 2XYRA 3DR5A 3L4EA 4NCJA 3G68A 3H18A 1OX5A 1YFZA 3R24A 2P67A 3FHCB 5F9FA 1R2QA 2PGIA 3GDHA 3IAS6 1JZSA 2PZKA 1UJMA 4K6CA 3KOZA 4FDLA 2CHEA 2PQ6A 3EH1A 2ZUDA 4I2NA 1JPVA 2IK8A 2AR7A 1QUEA 2A4KA 1UFQA 1WXGA 4XPIB 1GHTA 3CH6A 3BZWA 5IKOA 4LXTA 1XMJA 4GR5A 3WGZA 2C0CA 1M7HA 5CT6A 4ZKDA 5F3WB 5K3FB 3R74A 1IZ7A 1DC8A 3CB4A 4H18A 2FG5A 2PNFA 4KQJA 3OQIB 3B9RA 1GTVA 1NF3A 5EJ5A 1XVAA 1E2QA 1VLQA 1GN9A 2XKJE 3H11A 5LYJA 2WYOA 1T8TA 3M5CA 3PNKA 1RQNA 4GF5A 4P54A 3UY4A 1FFXB 4MW9A 2FTKE 3EN0A 5DF1A 4C01A 2ORED 2EKPA 4RQTA 3OZAA 1Z45A 4JLPA 1T1RA 3G7UA 2XEDA 3IV6A 4G4SO 3SS8A 3KE8A 2OGWA 4OHCA 3FNEA 1L7RA 2O1XA 3JQPA 4RH1A 2X6TA 1GKYA 3GLIE 1NQTA 4ZJYA 2ZUFA 2CBZA 3TG8A 4LX8A 5L3QA 4D9BA 1GQSA 4I55F 5K3AA 3QE9Y 3PKZA 2G63A 1IQ0A 2UYCA 4AKHA 1E94E 1SOWA 4TQUS 3CCBA 4MUEA 1IQRA 2N1MA 5KKAA 4I55B 3T4UA 3VHLB 1LLCA 1MX1A 5ICGA 4AJ4A 2FW1A 4Y9DA 2G9UA 1V41E 5AOCA 1WPQA 4MJ3A 1PUXA 2BMFA 4E12A 5EJ4A 2OZLA 2NU8A 1MP0A 3N3AC 3DOUA 2ZBEA 3F4KA 2NACA 4RV4A 2NUAA 1RW4A 5LBUA 2WVJA 5K0JA 2VQ6A 3MCAA 1TVKB 3DMDA 1V11A 2G83A 1D0SA 4P7GA 1YDEA 3D7LA 1FX0B 3MCVA 2RGDA 3BILA 3VZCA 2OPBA 3EX7C 3WJ1A 5F3DA 3L7JA 2A1TS 3ADKA 2R1VA 1WA5A 4GQIA 2J5QA 1Z16A 4B3BA 4FNGA 4ZK2A 4YT5A 1JPNA 1CUJA 4KR9A 4L8LA 2XMZA 1VE7A 4JELA 4GP7A 3TL3A 5C8DA 4OI0A 1H2AS 1ZA1A 1IM8A 3CX6A 2XQJA 4MQMA 1E77A 4IYRA 4PHFA 3VO1A 1A1SA 3RG8A 3D81A 3OU2A 3R5HA 5E0OA 1DAGA 4RGYA 4JI6B 3W4JA 2Q3HA 1X8JA 3BXHA 3WZLA 1PFUA 2O3SA 4M8SA 5AYVA 4AMBA 2VPWA 4ZGBA 3F8TA 4KGZA 3HXPA 4UUPA 2COKA 5L3VA 5IYZB 4WGFA 4ZVLA 1SXQA 4JYCA 1OI7A 5B7PA 1AS0A 1YB2A 2A0WA 3PPVA 3UAXA 1LS1A 1QRDA 4WD3A 5BSRA 3WE7A 3BGSA 5BMVB 1KJZA 3FWNA 2VPQA 3PC8A 2JA1A 4N0QA 5HSGA 4CG3A 1TZBA 4YJHB 2JGDB 1N2OA 4B6FA 1JSZA 1KI6A 1NUUA 4S2UA 5HUQA 2WT8A 4CMAA 3L93A 2AUNA 2QLTA 1YVDA 3RLIA 4A91A 2B7BA 1WPGA 2O3JA 1U28C 3K1JA 2M1ZA 3DO5A 4BB5A 3DHWC 4HEHA 5AJWA 2XRMA 4K9RA 1QQ7A 2ZE5A 4BNDB 1KIFA 1E9EA 4R16A 3UAWA 4BWVA 3IEMA 4AYXA 4V0ME 1E8DA 2PGXA 4DJ5X 2V6MA 5JNUA 5LQDA 3TDMA 3WLJA 1WKVA 4OHFA 3HXQA 2KLHA 5CD1A 1SZJG 3OOHA 4II7A 3BE6A 4DV5B 3PNBA 4I5GA 4P6VF 3G8YA 5B36A 3H5LA 4JMPA 2C1XA 2MINA 1U0NA 3IP8A 1EFUA 2XWSA 3BIXA 2AS0A 3MJ4A 4GPIB 1U2DA 4I4TF 1M2GA 4WKBA 4C0HA 4JDPA 2QAGB 4QE3A 5J2UB 2DP4E 4MQ6A 5THXA 1V4BA 2AWNA 1L1FA 1TTTA 4DLSA 4ND3A 4UW9A 4ZGWA 1VJ0A 4J9VA 4YAIA 4C76A 3WP1B 3F7MA 2KWIA 1TQ2A 2WF5A 2V8OA 1YZQA 4IIJA 3CNOA 3I5MA 1KDRA 3IUYA 2V5AA 3C5HA 1YV9A 1G41A 4AZ3B 1ZM7A 4ZVKA 5DK6A 2Y0CA 3SKYA 3SEAA 2GPJA 4KMRA 4CKEB 1YTUA 3IQGX 4GI7A 3PP8A 4F7WA 3HJHA 2LUOA 1F2TA 1QG4A 3ETNA 4Y98A 1I7DA 3QVXA 3CH5A 1UBSB 3OLZA 4MZDA 4D8YA 1CNFA 3IDAA 1R0YA 2FX5A 1XXHB 3PQCA 4B80A 3JWPA 4HWGA 2Q3BA 4R2KA 2SKEA 5FBZA 1QR6A 3VM6A 2CHQA 3IP9A 1R0KA 3MUFA 3EAGA 1O9HA 1RD4A 2XWPA 1G16A 3HCBA 2VYFA 1F4PA 3K9BA 2SCUA 4G0UA 2KX7A 4G01B 1G5FA 3QJYA 4QD3A 3GO4A 1ADYA 4AQDA 1XCBA 4NH0A 5CVEA 1UAGA 2PMKA 4A8HA 3ZWQA 2ZXEA 3KOMA 1P73A 3B13B 1QMGA 2JAWA 2WYUA 1Y4UA 4C5CA 2WIFA 3D0QA 1NXOA 2QRLA 1F1BA 3I05A 3JW8A 4O2BA 3ZEAA 1DG3A 2RHTA 1C2TA 2ZUWA 3ADBA 3COJA 4HAOA 4LJLA 1NW6A 4D0NA 4CIYA 5F2NA 1OYYA 4EGAA 2X40A 1W59A 1WW3A 1ZUWA 4EQ6A 4YJFA 1OWOA 1MB9A 1I3MA 2BGIA 4CM4B 5BV1A 1WBBA 3MWEA 1NAIA 3JD4A 3AESB 4G4JA 3R9XB 2ZATA 1JV2B 4FEGA 1WXFA 3WLPA 2CNWA 2GH1A 4C4SA 2YFYA 2XB8A 1HT1E 3A3PA 2I33A 1O96A 2JGIA 4B4KA 4V1CB 2Y1EA 3Q3JB 4ND4A 4B2PA 4FFRA 3AW8A 3A3NA 2NPOA 2FMIA 2EQAA 1G55A 3KG2A 3T1VA 1XQXA 4MH0R 2QNRA 4QQFA 4DQDA 3W5BA 2FH5B 2F3QA 1FNBA 3I6QA 2C8KA 2QDXA 4IJQA 4K1XA 1SFRA 4IZHA 2PGJA 4RM3A 1N1DA 4IEFB 4RXMA 4L75A 2X8AA 3X2FA 2C0QA 4CLEA 5A2QA 3KR2A 1JE0A 1EHYA 2WFZA 2YL2A 3ANXA 2JIZA 3OT5A 3VAYA 4R7ZA 3VMMA 5A6SA 4DJFC 1TYDE 3I0NA 2XTZA 2OQIA 2FZGA 2EXXA 2HIGA 2VHJA 3BCHA 3FPGA 4K8RB 4WDRA 3UPTA 4RULA 3WSWA 5DBOA 1EX6A 5KVVA 4D6XA 3PSHA 4EHFA 4Q02A 2I29A 2VPZA 5ES3A 2XMGA 1UCFA 2C7VA 3P9XA 4P3XA 4BO4A 2O8NA 1SRRA 4F92B 1OZAA 3S1AB 4F12A 4M0MA 3G2LA 4DJDC 4HLCA 2ACKA 2R66A 2ZTHA 3B3AA 1RRKA 3IJPA 3L77A 3RYHA 4O1IA 2DX7A 4BC1A 1BZYA 4ALIA 3NAMA 1TA9A 4KDCA 1V3QE 1EZZA 4PZLA 5I7WA 2C2YA 4AKIA 3DZHA 1PWZA 2V7QA 2FY8A 5BUZA 3PD0A 1U28A 2HO4A 4B17A 2WBLC 4ENTA 4HDMA 3CVVA 4ZAZA 1OXBB 5EMKA 1KWGA 1TTHA 2OVBA 3KJQA 4ID3A 1XP5A 1TO6A 3FVTA 4NARA 2BFCB 2PZLA 1BCSA 3MMXA 1UMCB 2NXNA 3DAYA 3LF2A 4L0MA 4XYMA 1X0VA 3QF4B 2HNKA 5J40A 4IGEA 1UXOA 2AE1A 5C51B 1XSEA 2EL9A 3QWAA 4EG5A 4EVIA 3KS9A 3GQBB 2RCNA 4DJAA 4EQZA 2V5VA 4IHAA 3ZLVA 3R5KA 2WC1A 1QRUA 2W0SA 4LRWA 1YQWA 2QRHA 4P84A 2PT7A 4ZREA 3P2EA 1R50A 3FMOB 1T2CA 1IHOA 2IHZA 3GVCA 5T6MA 3GFSA 4KK4A 1YS9A 3BHMA 2H2HA 2Q99A 3DVLA 3HVHA 4ZQEA 2RFLA 3AERB 3B78A 3ZGNA 1YDMA 2WKQA 5DYYA 1WZ2A 3C3KA 4K9DA 3CT4A 1NSTA 2XXJA 1QIMA 1LK7A 4ZI7F 4TVBA 4AUMA 2OLEA 1P44A 3KVRA 1RI5A 4ZEOA 3FUXA 5CA1B 2EJVA 2ZIWB 3LPNA 2XECA 3Q41A 4EF6A 1N9GB 1U7XA 1NQVA 1JB1A 4OEHA 3VNAA 3AEQA 1ZGJA 3EF0A 1LY1A 2RHJA 5C0OE 1JNXX 1L7DA 1OFUA 3N2EA 4CCYB 4QUJA 3T9FA 3AM4A 2QQEA 4X41A 1CY2A 3AEKA 3CVJA 1YS1X 3G23A 4PPQA 3MOSA 1YD7A 3AIKA 4F4JA 4DDVA 1NM5C 3L0YA 4ZTBA 1E63A 4FI3F 1QCYA 3GJ0A 4YPFA 1CUWA 1XQ6A 1BD3A 2YMQA 1GGMA 2CDAA 5I51A 3RHFA 2E1PA 2TMKA 4FQ5A 1C3LA 2XF8A 4GVXA 1B8NA 2JEYA 3LX8A 5LLSA 5ULLA 2OILA 4HEA1 4FFNA 3D6HA 4A26A 5KTOA 3IULA 4YR7A 2J6HA 4BTEA 1OZGA 3CX3A 1DJNA 3E5MA 4NPAA 4KIUA 4EYEA 3ADOA 1W30A 2BKLA 3L8ZA 3EXFB 3D6UA 3HYTA 4MQFA 4ZEMA 1MCZA 3FAKA 3QBEA 4O2RA 2ZT8A 1JB9A 3M34A 4L5AA 4EFKA 1MAUA 1E6WA 4DC9A 5HOEA 3GNLA 5CG2A 2YWDA 4C7OA 5K2OA 4OSEA 4MS1B 1QTNA 1COWA 1UZUA 3DUFA 3L7CA 2QX8A 1YRYE 3HU2A 4OAQA 3FTCA 4JIGA 4NY1A 4ESOA 2FGKA 4MCIA 5IRCD 3QPBA 1KRXA 1UXKA 3BDAA 4FXOA 4DMGA 2IE8A 4DV3B 2CFOA 1IUPA 2D62A 3TW4A 3VC7A 5CHEA 1JPUA 2C5FA 2CDCA 2H59A 4RA9B 2XBUA 1SZCA 5CB8A 3TZKA 3IQDB 4CF6A 4JHLA 1CR6A 1Q3KA 1QNLA 4PTYA 5L4SA 1PJLA 2Q46A 5I7EA 2Z4RA 1Z28A 2WY2D 2HF2A 2QGNA 4TS4A 3BSSA 2ZT6A 3HDVA 3DVQX 4MIKA 1H3FA 1SKAA 1Y1RA 1BKSB 3HO6A 4B82A 2UZ0A 4BGDA 1MQAA 2FHPA 1WW8A 3P71T 4IFEA 4WFIA 2FPPA 3LG2A 2UAGA 3MB5A 4G97A 3RIMA 5ALYA 3FSEA 3TJMA 4DXHA 4FFBB 2G9ZA 3WYDA 1ZEMA 3H05A 4UQOA 3W6NA 1L7AA 5M34A 3EFOB 4UDOA 5G0TA 3U4QB 3TKAA 1K6MA 4Y18A 2IBMA 3D7MA 3EZGA 1VZ3A 3KQPA 1N6HA 2O6LA 4GYYA 4DLUA 3KHUA 2BLLA 2GPSA 4JP3A 4I5IA 4QLOA 3I9NA 2E4AA 1U0EA 2XA1A 1JHOA 1NT4A 1GUAA 3BDVA 3NEJA 3KCNA 3KXDA 1PJ3A 3NT4A 1T34A 4QGBA 2L82A 2O4UX 2QTFA 4JC4A 5KNLA 1H94A 3VO9A 3DXZA 3OIYA 5BSFA 5DW0A 3CZMA 4ZMSA 3O2JA 2YIDA 1AS2A 4GEGA 4DIDA 3OCJA 1RM4A 1NMSA 3PFBA 4MR9B 2BEWA 2WT9A 4C14A 1KBQA 5EZYA 4YP6A 2PS3A 4Y6OA 2GHQA 3LKVA 2GCOA 1C4OA 1DQSA 1JAYA 3DVSX 5TGDA 3ZTYA 5E6RA 3HBMA 3OPVA 2FFBA 2H8GA 2NYRA 1Z33A 3OZBA 1LK0A 2JW5A 4WASA 5LZ7A 3GUUA 1Y5MA 3RQIA 1NBAA 1NIPA 3P4UA 2XYVA 5INTA 5KTNA 3DE4X 3CXRA 2YJTD 4BRWA 3Q2KA 4YRRA 5L40A 5AM2A 3GJYA 4L6IA 4R8LA 1AKTA 2D1RA 2TMYA 4NBKA 2A84A 4O1HA 5TQVA 3WLOA 1UEIA 3QY9A 4HVCA 1Y8RA 3FXAA 3JYOA 3C3PA 4MI3A 2ISSD 2O5CA 3UV7A 2C5LA 2XGMA 3UTCA 4BO6A 3TRDA 2WIAA 5AIBA 3GLGA 2H31A 3A4YA 4MR8A 2FCAA 1KMIY 1MHTA 1CC1S 3PTAA 1SCAA 3VSDA 3U4AA 1Z7GA 3SLRA 4MARA 4ND7A 4ZVTA 5CD9A 1BVHA 3K7EA 3K8ZA 4XFKA 1N7GA 3V1UA 4E94A 2DETA 1DU4A 1JYEA 1UL1X 3QUBA 4MHOA 3ZWYA 2WUWE 4R8SA 3KPYA 3SX4A 3HXKA 1DAIA 3SF0A 3U7IA 5HCNA 2QRJA 1VE3A 2GUGA 1KNQA 4RKYA 5C5DA 4OLBA 1X8KA 2J3HA 4BKPA 4E4YA 2Z8YM 1KO8A 4KFRA 4EHDA 1WF6A 3C6KA 4C2UA 2IU4A 5IWAB 3Q88A 2WINI 2NP6A 2IS6A 5I9MA 2OFPA 5DCUA 1A4UA 5FUMA 5EMHA 2H11A 3R4VA 2GI4A 2HF7A 2P77A 4A2QA 1YUBA 3BFJA 3JSXA 3A3OA 4CF7A 1X1AA 2P9HA 3UHFA 5EY5B 2OOSA 4R2MA 1QRAA 4HEQA 5FRDA 1UC4B 3JWGA 3E82A 3MMZA 4XQ9A 1SOAA 4Q9HA 3BWBA 4YRCA 4LY3A 3ENZA 3ECSA 3H5AA 4X90A 4YJ2F 4C08A 4CZ2A 5I7HA 2DTXA 3OE7A 4N48A 3TD2A 3PWSA 1DOHA 4JOCA 3STVA 2AJ8A 4MVJE 3IR5A 3A0RB 1OBVA 3LPAA 4LJ7A 4ERXA 4EUNA 3V42A 3RNLA 1EGMB 1LV8A 1W44A 4C0JA 2QYTA 3G0IA 3UB4A 1T3GA 2IYEA 3OZ7A 2I03A 3MOIA 4KIJA 5JCJD 4KNVA 2AEFA 4N3AA 4D9MA 4QHYA 3ZCRA 3OTQA 2BFMA 1HPLA 1N6KA 4QGSA 2X0DA 2YFKA 5CAEA 3OJEA 1I51A 3CTPA 4XUCA 5HFJA 1X1DA 1YACA 3F8SA 2NYVA 1GFIA 2PS9A 3WZMA 3DFFA 1NT2A 1YR3A 3I01M 3NHKA 4PBSA 2JI6A 4Z0NA 3K32A 1NNUA 4RJLA 1LDMA 1C8LA 3IQHX 4QDJA 4E08A 2GYYA 5KJ6A 1C3VA 2PYDA 3Q10A 3E9QA 1N1GA 3UK1A 2XUDA 5KTYA 1QZTA 5CIWA 4EIWA 5J2TA 3SHOA 3B1FA 1LC3A 1YUMA 1MT3A 3HABA 4G85A 4F2PA 1C1XA 2VH2A 5DX1A 3ZTTA 3KWMA 1S2MA 5LXTA 2FCRA 3CONA 2FUKA 1KF0A 4ENQA 1GITA 1BS1A 2J48A 3PXCX 4NZZA 5JAHA 3MOGA 2C4HA 4WESB 4JLAA 3IURA 1BE6A 2QXTA 3GA5A 1DKQA 2FR1A 4J1NA 2HDNB 3TSCA 3F96A 5AVUA 1P4AA 1PFKA 2QOEA 4FZ5A 1MOZA 4IJVA 5FBKA 3NYQA 4ZVNA 3VR2A 3WSVA 2I55A 2PZAA 4G5YA 4UEWA 1XNGA 3OJ0A 4WL0A 5BWMA 9LDBA 1VG0B 1ND5A 3B6IA 3DAPA 3EF3A 1HI9A 1QX3A 1N4DA 4U2CA 4H1UA 1E4VA 3W6OA 3EMBA 5E38A 2I3DA 1U02A 2W2PA 3EIXA 2OXTA 3AYZB 3G0HA 3IPYA 2B4AA 1BHQ1 3RIYA 4HADA 5CFRA 3NC4A 4NS1A 5B3AA 1HZZA 2ISQA 4BP8A 4HRVA 5BN3A 5HIKA 1GPMA 4TTIA 1G9XA 1YF3A 3NRCA 1RKXA 2D1TA 4KXUA 1MB4A 1ZH6A 1YAHA 4EJSB 1JJAA 1ML4A 3M6MD 5MN5A 3TLEA 1YCDA 3Q7TA 3HB0A 4G0MA 2UUAB 5DNUA 5LNK1 4QUDA 5K0EA 4JT8A 5LD2C 3COWA 1WY7A 5EKSA 1TOAA 5GADl 2XCRB 1W2HA 2P3QA 5ILGA 1PKXA 1ZPDA 2QVXX 2W2OA 3KFVA 4WBSA 4WCFB 3ETLA 3UIEA 2VP2A 3CE9A 2P9GA 4KFTA 3G17A 2IZOA 3QPVA 5G3YA 3ZXXA 1FZTA 4Q15A 3QU7A 4EDFA 4CFZA 5EERA 2REQA 4HY3A 4LHEA 5FWXA 3O7MA 1DS6A 2CXUA 2WFLA 1IOVA 2GCEA 2PT6A 3ENWA 4YRTA 2VXYA 4GP6A 2HLDD 4OXKA 1QV6A 3IOCA 4MVJP 5DNDA 2CHVA 3QVGA 4AY5A 3EK2A 1MA0A 4DRYA 3BMCB 3OIWA 3GA0A 3U2QA 4IKOA 3LXXA 4PQYA 4QDZA 4G63A 1QP0A 4UU7A 3NNSA 1JS1X 1T25A 3FTQA 4JL5A 1DBPA 5LZ2A 4FHFA 2C7BA 3UFXA 2HGZA 2R7NA 1FLVA 3AHJA 4Z9BA 2P3SA 1N5LA 3QWIA 4IGFA 2O2DA 2H16A 5JTUA 4IKPA 1W4ZA 3SYKA 5TF0A 1PJ4A 3EA4A 3FY4A 3E8XA 5AKEA 1P3JA 1PFGA 4NBLA 5DGTA 5SZIA 5B1SA 4BX8A 3LQ2A 4ENSA 4X94A 2XKKA 2IS4A 3TAHA 4X64B 1OBOA 3KJNA 3RFVA 4E5NA 1F48A 2DH6A 3HA3A 4KJZA 2IZ1A 2NP7A 2BGNA 4BQIA 4G37A 4WKCA 2EBWA 5BOSB 2VTVA 2J32A 1J8FA 4OH7A 4WK2B 1H4SA 2QYSA 3OPNA 1DHTA 4KJXA 2ZU6A 3WQHA 3T1OA 1Q6YA 4RY8A 1H3EA 1NJFA 2H92A 2J4CA 3IP1A 3FWHA 2BFOA 3VNSA 2X5KO 4U7FA 2P9CA 3GUVA 1A7UA 3ILSA 5FOUA 1T4DA 2GCGA 4XWOA 4UQLA 1DJOA 3CVXA 1XMVA 2HLNA 2XTJA 3GZTB 3EXAA 2OEPA 4Y9UA 5HNKA 5LJIA 3AU9A 3C3BA 5EP4A 4C5AA 5LIRA 4FR2A 4TLLB 5E3IA 1XZQA 8AT1A 2QMYA 4BQOA 2NUPB 3IE2A 4O5AA 5CFPA 2H18A 1XZKA 1XEWX 3D43A 1WL8A 3L7MA 5AM1A 4ZXPA 4YPVA 2ECKA 3FJYA 1ZJ4A 3ZD7A 4FGWA 1YQEA 2B36A 1QZ3A 3I2JA 4JNCA 1TKCA 3CNEA 1PVDA 3KQTA 5IAKA 4RZHA 1MQ9A 3LP5A 1FDRA 2JAHA 2VBGA 3SYLA 3NGLA 4XJXA 4QL3A 8ADHA 4UBIA 2A4MA 1OU0A 5D1HA 2Y2UA 1C50A 3F9CA 4H31A 1TC1A 4FEYA 4RESA 3IOBA 3WY9A 2FJ0A 3EULA 1QDUA 5HS4A 2WT4A 2JLWA 2NPFA 3DQQA 2BR4A 5KYYA 2C00A 2ZBFA 5DV9A 2JVKA 3LCCA 3FDZA 3I2KA 4P1ZA 1UJ2A 2HA7A 3MG9A 5CVJA 3RIGA 4G5HA 4DEYA 1HNNA 4L02A 4LOJA 4GMDA 4KXFB 4RY0A 2BFPA 1I1NA 1S6YA 5FX2A 2F8TA 2I71A 1LQUA 1OI4A 5DULA 3SVTA 2HEIA 3C8ZA 3TVTA 3G2NA 4LSWA 4EMSA 1ZITA 1JLMA 1IVNA 3CLUC 4RY9A 3RHTA 1QIFA 2I6SA 1VKHA 2QQ5A 5SICE 1X2EA 4PNZA 1POXA 2NNWB 3KEOA 2HZ7A 3BPSA 2GETA 4MWZA 1W2WB 3W04A 3QOYA 4EB6B 3TOVA 4D56A 4LFAB 2VDKB 5K6RA 3HJRA 2GAJA 2R6GA 4JB3A 2B34A 2JGJA 1P33A 1XC7A 3UT6A 4WK6A 2H2AA 1P7YA 4ZIRA 4KR7A 3KQHA 5IBCA 4YRGA 1PL6A 2R5FA 1J25A 1KQ3A 2EGGA 2OCAA 4ITRC 5ILOA 3ZDBA 4WNAB 3KZXA 5GONF 4ESVA 4AI6A 1ZH4A 4CM1A 1SHTX 1NW9B 2AA3A 4HQNA 3KLMX 3ZNOA 4ZK6A 5A4AA 3VAZA 3ZJUA 2YVAA 2R1TB 4QO7A 1GM5A 2FPXA 2FZ5A 3CRZA 4FWBA 4R1TA 4YUWA 1K6XA 3MEQA 1T5TA 4TT3D 5GONB 4GEKA 3RIHA 3C8MA 3OWHA 4S1TA 3SHFA 3C1UA 3OQJA 5ALNA 3R7SA 1XTTA 4JUCA 1EXNA 4DYDA 5JV5A 5LIPA 4IFIA 4PSCA 3HUEA 4ODIA 1F60A 2RGWA 3IAS1 4Z8XA 1Y89A 2C92A 3AIOA 3AL3A 4I36A 4IH1A 4CMJA 2WJHA 1ZNQO 4QLBA 3BK2A 2I6GA 2P65A 3ANYB 3RS8A 3FGPA 4M4SA 4L78A 2GAIA 3WOHA 1NTOA 2ZJZA 5JMWA 1NI3A 1Z7BA 4NMLA 3VR6D 4E5DA 2DJIA 4PNPA 3UN1A 4EEXA 4UCXA 4MJXA 1SVOA 1EVZA 1U9CA 1TD1A 1U2TA 2PA3A 3NJ8A 3SOPA 1T36B 4KPYA 3AOGA 3QU5A 3SHVA 5JQGF 3M6AA 2V96A 1AO3A 2WJPA 1YSCA 2HMAA 3EVGA 2Y6VA 4IVPA 6Q21A 3R8CA 1H22A 1I6KA 1P75A 1ZN8A 2FV8A 4M1MA 5DTEA 5EUMA 4ZDJA 5KVQA 1YA4A 2W71A 3SIXA 1G5QA 5I9BA 5AJXA 3OEYA 3DGFC 2CVZA 4WBNB 2ZXUA 1R0WA 4RVFA 5E8RA 1N2XA 3E1GA 4CEHA 3LV8A 1JRLA 2PX2A 2IIQA 1Z7YA 2O2SA 3D6AA 3GZNB 3PZBA 2PUWA 1FRFS 5TT1A 3Q5EA 2XZDA 2FPSA 1UFOA 2R6ZA 4ZP1A 3B20A 3RPEA 1SBIA 1WS6A 2JGLA 1RRGA 1SUPA 2J0EA 3P2JA 5KYXA 1DKUA 2XKBA 1G20A 3DMPA 4MEAA 1I2CA 2G17A 4LWOA 5FP0A 1MIOB 3H2KA 4OQLA 3IKMB 4GYKA 4IIYA 4ZC1A 2ZJAA 2MSEB 2X2OA 4RKFA 4DIMA 1VJ1A 4EI7A 4ZVSA 3HVRA 1N3BA 1E2NA 1VDZA 1Z75A 1H8HD 3AIMA 4V0OA 2YICA 3BF8A 2YN2A 2JFZA 3ZIAD 1E3LA 3C7AA 1UKBA 2PSJA 2Z08A 3OKCA 1T2VA 4NR0A 4C6SA 1FDTA 3VR4D 4M53A 4S0ZA 3A1NA 1E5VA 2ZYIA 2H52A 4N9WA 2Y67A 7MDHA 5AVYA 1EFKA 4OB8A 3L7BA 4HH4A 3DPIA 5TS2A 5A2GA 4R2JA 1PZFA 3CXUA 1EM8B 2J8ZA 2YNMC 5IF9A 2DUUA 4LDQA 2GZ2A 3VO8A 4RHFA 1U0FA 4F4IA 2HT1A 1B41A 4CTNA 2Y92A 4UD6A 4MVJM 3MCZA 4RKRA 4BLOA 4ILKA 1S96A 1SVUA 5HZGA 1ZK2A 3O74A 2CB0A 4H27A 2XCLA 4KYTA 4AJ1A 4F9TA 1CUEA 4YMUA 5LPNA 1NW4A 3WGQA 3WYFA 2GVDC 4FOPA 3UQYS 1XL1A 1OTHA 1EUZA 3WLIA 2QTAA 1YZTA 5B1YA 4X7PA 4JGGA 5EYPB 1WLYA 3NWEA 2IDKA 3OTIA 5CLQA 3I61A 4YALA 1I01A 2P9YA 2X0NA 3G0DA 3QU4A 5NULA 1N2JA 4BFZA 2GBPA 3MAGA 1KZ6A 2WE8A 3N75A 3GLTA 3R0XA 2L0XA 4G1BA 4H0FA 4NBNA 1QVRA 3JQ7B 5FFMA 5JAIA 2CLSA 3UK7A 5CTAA 4NCHA 5REQA 2BEVB 1NPYA 2WJVA 3IA7A 3RQSA 2B21A 3GT7A 3WL7A 2C88A 1TEZA 2VK1A 4RFSA 2GA9A 1O6CA 1PFVA 3FRIA 5JRDS 1UPXA 3JQQA 4H2DA 3SHQA 1CFJA 4D44A 2JLSA 1ORRA 1XFAA 1SKMA 2GZSA 2Q1TA 1IN5A 3GH1A 4MW1A 1QAMA 5K09A 1V16B 5CVVA 3RDPA 4FCCA 5LA6B 3VV2A 2JHGA 4I1IA 2XDWA 4RD3A 5A7FA 3WFJA 3L5OA 2PWYA 2AFHA 2A9PA 2AC2A 4NFSA 2JJYA 3UHOA 1SXIA 4DCVA 2WP8J 3P0IA 4RUKA 4MIEA 1KXJA 3HA7A 3KQVA 5CK4A 1ETHA 4COOA 3PLNA 4H1HA 1KO7A 4I7EA 4KPGA 4Y6GB 2Z9DA 2HH9A 3LUBA 3I9OA 1HQDA 1EI9A 1NRJB 3ACDA 1P0CA 3JALA 4RVUA 1U8YA 4YQYA 3WSTA 2HK8A 3AJDA 2FNAA 2ZVDA 3GDFA 2ZJ3A 4NMMA 2BE9A 4WTOA 5TC4A 4C3UA 4QZVA 3UFBA 3ZGZA 5DT2A 4IIBA 4RDIA 4ZU1X 3VUEA 3HO1A 3HLKA 3BGOS 3RAGA 3KR9A 2B4KA 4MRNA 5LCXA 1TQHA 2B5OA 1ORIA 2C84A 3L9XA 3S44A 4MTLA 2HA4A 2FN4A 5CRIA 3YASA 2RGXA 2B9EA 1JVBA 1XRNA 2WJGA 4DQXA 4I6EA 1RVDA 1UKVY 1ZAKA 2E87A 3A2LA 5JJLA 2OV8A 3TQRA 3FETA 1IZYA 1GY8A 1ZX1A 3D6TB 3LY8A 1AK9A 4BNJA 5DWQA 4KMSA 4RC9A 1WVGA 1JEAA 3ZY6A 3IAM6 1XWWA 1ZWKA 2BM0A 2EFEB 5BT9A 5TR9A 1CQIA 1GLGA 1QO7A 5FI3A 2UYGA 5TY0A 2IYXA 2R60A 1HNZB 2XUFA 2JGMA 2C54A 2FEPA 2CCKA 2OB2A 3QUTA 5B1IA 5JZOA 3AXTA 3WLNA 3CVUA 2POQX 4JQZA 1JLHA 3E9EA 4HPJB 2O7NA 5HF6A 1JEYB 5ES4B 4B3JA 2X1HA 4KDRA 3E22A 4IXDA 1SU7A 4MLZA 1O8BA 1FE8A 2D0IA 2DYKA 1RBYA 1EQAA 1U8XX 3JQAB 1VMEA 2C5GA 5KJCA 3UGJA 4P0TA 1K3FA 3FJ1A 1B23P 1CUUA 4HAXA 5P8WA 2ZJ2A 3A1FA 5FTLA 2ILVA 2XV1A 3CEAA 1E98A 3KYDB 1P9RA 1TK3A 1UIMA 1H1DA 1X87A 4HB2A 1BGWA 4M9UA 3IQZA 4DNXA 1LB1B 4E1VA 4M1WA 2IQ5A 5FYDA 2V45A 1G8SA 2GJ8A 3LHIA 1TM2A 4FZRA 2C2XA 3MILA 3O2QB 1JHYA 4RYDA 4UKDA 1IMOA 4IIEA 3TLGB 1N9KA 2J45A 5DLEA 4J90A 3V5NA 1RJEA 4AROA 4F2DA 3NEAA 4NPCA 2W6NA 2JK0A 4HH0A 4MS4B 1M5TA 4ZI5A 1HT2E 2MYNA 3JD0A 1QHHB 2M1XA 1D1TA 4WECA 2XEXA 1JQ5A 3ZCTA 4PLVA 3E84A 1MXHA 1Y3DE 1H23A 5TLSA 2VPXA 1P2BA 1M8GA 1PL8A 4TTPA 3RREA 4HZIA 2VDUE 2YNMA 3AVQA 3IMFA 3M1IA 4F3NA 1G3UA 1QHNA 1ZGGA 4J9UE 5C37A 2OY0A 2GFIA 3JR3A 5HIJA 1MDBA 1LQ2A 4DUPA 4DWVA 2GN6A 2EGUA 2VT3A 3I39X 1G2IA 4FS8A 4E5SA 1OZHA 4XOUA 4EPXA 5JMOA 3KR1A 4KWEA 3TSAA 5JJ5A 3WAJA 5EXPA 4QOIA 3ZVRA 2V9ZA 1FXSA 1LJUA 4N40A 1PSZA 4I4NA 2ECQA 2VI5A 1Z0UA 4JODA 4N5IX 1LSUA 1PO7A 1YI8A 2ET6A 2R8XA 2ASEA 4O2AA 3WL6A 5BN1A 4E2ZA 1V9CA 3JRXA 3OOEA 4Z2YA 5AJUA 4EECA 5ADVA 4KGDA 2RHCA 5TQJA 1II9A 4JBNA 1DFIA 3MINB 5I5EA 3V8RA 3HDHA 4BFCA 4FNOA 5FH9A 4KL8S 4HGQA 1AKVA 4OHYA 3RS2A 3RVQA 2QK4A 4TSRA 5IDVA 4ZYWA 2XXAA 1GZHB 4JVLA 3HG7A 2G9RA 3D8HA 2BFEA 3L8EA 3SMQA 2EKDA 3VYUB 4AVYA 1X7GA 3DEAA 3U1VA 1QO0D 1TM5E 1HZJA 2HK7A 1U94A 4LMAA 3LUJA 4C43A 1MBZA 5K4HA 2W48A 3A04A 5ESXA 4EAQA 4L4SA 5I47A 3N2KB 1WPXA 4A8PA 4E32A 2PUEA 2IKSA 2YYZA 4FFVA 1H6DA 3QPWA 1SXHA 2P6MA 5BORA 2C7GA 1NP3A 4GBGA 1IQPA 1T4CA 3Q5DA 4J1QA 1DC3A 1T2NA 4LRYA 4GAEA 4HQLA 4B4VA 1PW5A 4XGIA 3Q7EA 2CE7A 2Z83A 3MIIA 1FNNA 2JH8A 2X8JB 5IBRA 4LYYA 5FL7D 3X1JA 3ZDEA 1DCFA 1QLHA 3KXKA 3NLLA 3FYDA 3H5VA 2QTZA 5AO9A 3WBBA 2HU7A 2OCDA 3KLNA 5B3JC 5EIOA 2OXFA 4NI5A 4R9NA 5DBHX 4Z3KA 3VYTB 3KHTA 1W47A 4ZEXA 4X65B 4I4IA 2PUDA 1NTRA 1R1DA 2HC9A 4TT8A 2CY0A 3LL7A 5KJFA 1BOFA 4TN1A 5IZ4A 4R3NA 1QGOA 1R9JA 4ASUA 3V8EA 2R48A 1KSJA 1W29A 2FUG6 1XK6A 1DSSG 2XODA 2GBIA 2ZW9A 2EFCB 1AK1A 3OIVA 2C97A 4OUDA 5CJPA 3ERCA 1AK2A 5JXWA 1NPDA 2IQIA 2VK8A 1VXRA 2OTCA 1B26A 2SKDA 1HYEA 3DD5A 3HBNA 4KX5A 4U2EA 4TZ6A 5CXSA 4URZR 3IVXA 3SDZA 3SHWA 1UWCA 5AVVA 5BV7A 3IXMA 1VLLA 3V34A 4ZVUA 4NV3A 3WFIA 1UQTA 3CJRA 3FPBA 1RZRD 2VDOB 1KVSA 3KZVA 4QNNA 1OBCA 4M54A 5MGBA 4KLAA 3L7LA 2YWJA 3LO8A 3OY2A 1WOMA 1C9JA 2BUAA 1BOOA 2WVGA 2H5IA 3RFXA 3HR4A 4TYPA 1FFWA 1PVVA 1EBFA 1FQJA 1M1NA 1WU8A 1T3HA 1Y9ZA 3V4FA 2XT9A 5H80A 3QPAA 5GGYA 3UXYA 4BDTA 1ZJWA 4CL3A 4D9EA 1DTSA 3I4CA 3SDSA 2PQ0A 1XQ9A 3PFHA 3PTLA 4QYIB 3RSLA 5AP9A 3ZI0A 3ZGXA 2QWXA 2IWHA 1CQJB 1Z34A 3HSYA 3SKXA 4DNPA 3RRBA 5K4GA 1H0KA 2VCHA 4HLUC 2OHVA 3PR2B 1JZQA 1QV9A 1YZHA 3BD9A 4ITVA 2Y4NA 1JJFA 1MEOA 4KXVA 2EKQA 1THTA 2ZT5A 4HWOA 1NSFA 2PX8A 4L8FA 4UD2A 2VRNA 3T9DA 5BUQA 2OD9A 3FHOA 3PUVA 2WW8A 1R12A 1UMDB 4R41A 1PT6A 3EDOA 2MJLA 2JJMA 2UVQA 3TPFA 1YI1A 3H65A 1TLLA 3BZUA 2JKZA 2W58A 2Y1OA 2DCMA 4NBVA 4PRLA 4CFYA 4XQCA 3EGVA 3A9WA 3C5WP 1GPYA 2KSQA 2NV0A 3BMNA 3TH5A 3ZZUA 3AY3A 3QVJA 4X1OA 4PSVA 2PGDA 1N25A 5EP3A 2DQSA 1BFDA 1E2EA 4WN3A 4ZRDA 3KQLA 5IBPA 2WOJA 1Q12A 4CM6A 4WLUA 1EAYA 2GDZA 2PX0A 4MGIR 3DS8A 4KV9A 2C9ZA 5TT0A 5KU7A 5ALDA 1YKFA 2IYWA 2R84A 3C6QA 3F2VA 3THRA 2E5FA 1VL8A 1XU7A 1X2BA 2CVHA 4UNNA 5LVAA 1Q95A 3NXKA 1F9AA 4MTCA 2GHTA 5E9QA 1O95D 3KYBA 5H3HA 2JZCA 4I1UA 1JHMA 3PUHA 1ECCA 3M2TA 4BNYA 4RE5A 4D3XA 1XTZA 2B4QA 1MC1A 2QZSA 2R8PA 4IQ8A 5EFOA 3AI1A 2WNHA 3ONWA 3PNLA 3ZYCA 4RBNA 5DB4A 3WGJA 4C0AC 4Q4CA 2CL0X 3V4OA 2E0IA 1EFAA 3TIVA 1VFPA 1JEQB 1A4RA 1JLLB 1BMDA 2Q27A 2QG9A 3DL7A 2OR3A 1RMTA 3OSZA 1ZXXA 2WICA 4HQOA 4Y6QA 1R18A 4Y7CA 3CSUA 3W9SA 3W5DA 3O8RA 1CYDA 1G5HA 5CCEA 2UZ1A 3BE4A 5EQJB 2AMFA 2WM2A 3KKPA 2QPAA 4M98A 3PQEA 1F0PA 1FUUA 3N86A 1Q83A 1VMKA 3VNVA 4JWTA 4K88A 3WK7A 1U0JA 2HMTA 4GPTA 1KIMA 4LC0A 3DXXA 1O6GA 2PU5A 1V5IA 1ZK3A 2QXUA 3RU7A 1SXPA 5CDSA 2Y05A 4B9EA 3DE2X 4MROA 2VC2B 3MMSA 4G67A 2CNDA 4D3ZA 1XCJA 2HU8A 3AF0A 3W1EA 1QIDA 4DQKA 1SIBE 3RWMB 3DDWA 3IALA 1E3TA 1WCYA 2PQMA 5HJ2A 3K70B 4D4IA 1RWOA 1XCGB 5TS3A 4IQ4A 3FPAA 3JZIA 3J7TA 1DINA 3QE3A 3C4QA 2OBFA 3GGDA 3A05A 2APJA 1BGVA 1JR3D 1DQYA 1AVTA 5BQFA 4D9FA 1MX9A 4IHJA 3BK1A 5FWNA 4D92A 1QTRA 4OMUA 2ZSKA 5BWLA 2FJPA 3DV9A 1L1RA 4FDMA 5B3JA 4EFLA 3EAQA 2CK3D 3ZZNA 3X1DA 3L46A 1QFXA 2XUHA 3KAPA 3MTBA 4BAGA 3ZHXA 2B5VA 3OH8A 1L4YA 1XTJA 3RTAA 3T7SA 4EGJA 1O4VA 1S8OA 3AU8A 2DWPA 3H13A 1ADJA 121PA 2PH7A 5LZ5A 2NYAA 4IOLA 2C04A 4LHVA 1LLDA 2QRUA 1MB0A 2V7WA 2HSWA 1HLGA 2VT6A 4IX1A 4LXQA 1VYVA 5DW3A 1IG0A 1NNEA 3TQOA 4N5LA 4UHKA 2DG2A 1VGQA 1YTLA 2ZJ5A 2I7TA 2KJQA 2EWVA 3G2JA 3L7YA 1ITZA 1UBCA 3FPKA 2GN4A 3QVOA 4S35A 1F9EA 1FQOA 4DMCA 2ZYHA 4BECA 1MOQA 1MNQA 4EKIA 3KM0A 3VJKA 4BCCA 1O6BA 4IMIB 4RK0A 3BICA 1YB1A 2B3TA 3TOCA 4DNFA 1YBHA 3HC7A 2AIRA 1IBLB 1I3LA 2HK9A 3S5UA 2YCLA 3ASUA 4Q1DA 1FRZA 4AL4A 4JCOA 4XJSA 4BNHA 4UEOA 4MV3A 5KYVA 3PL1A 1DL5A 2HXYA 1CUSA 1NA5A 3H8JA 4BVBA 2XMBA 4P7FA 1Q0SA 5ADUS 1PHRA 4YDSA 4KREA 3P9QA 4Q4AA 4ESHA 3TL6A 1FDUA 3JQGA 2Q4EA 1VJGA 3CG4A 3O5AA 3ZWKA 3B3JA 1FMTA 1U1GA 4F5EA 3AFNA 4MQEA 4QWMA 3LFUA 5GV8A 1ICIA 1NDUA 4NONA 3KD3A 2LBPA 3EXG1 5BVGB 4PC7A 2J3IA 3SZGA 1JQLB 1OFVA 3LO5A 4LDAA 4QNRA 3I04M 4HZUA 3TUJC 1EFPA 2I3GA 2BM8A 3B6EA 4LCEA 6REQA 4Z54A 4AS1A 1WTAA 1KZHA 2PKQO 3QYJA 4FHEA 5JZMA 2ZITA 1L5VA 2HJWA 3CINA 4V0SA 4WZBB 1UKCA 3EXIA 5E9JA 5EUCA 3TQCA 1CDOA 2DR3A 1LA2A 2F9LA 3FGNA 4QJBA 3KPWA 2RJOA 4KI0A 4TTAA 3RVPA 1JA1A 3PDIB 4YLEA 2CZQA 1D2MA 1IM5A 1QHEA 3NBXX 3LLSA 2JLQA 1XE3A 2NN3C 3EXEB 3DDCA 3MA0A 1RFGE 2BN4A 1MRZA 2HKIA 3SF8B 3VJRA 3BFKA 4BV9A 2XZOA 5G1OA 2X3FA 3P45A 3ONEA 4Z3DA 3KZ1E 4KTVE 4RSHA 3ZDFA 2C94A 5A5EA 1RLMA 3CNHA 4QJ5A 1K6IA 4YCJA 2OFXA 3ZYZA 5BWNA 5CDGA 1K5HA 4F85A 4EUHA 1Z7WA 4D97A 1F12A 1ES9A 2C2BA 4V03A 3CVYA 2O7RA 1VKRA 2XUJA 3OM1A 4U0KA 4G5QA 2GB4A 5FAKA 3LC0A 1V96A 4ZOEA 3P20A 1G8HA 5LQMA 2B98A 1N1EA 3BMXA 3VR5A 1HTWA 2DFVA 4HMQA 1AKNA 1D03A 3N05A 3R1IA 3K8OE 1ECLA 1GDDA 5IJ9B 3I1JA 5A9SB 3R5TA 3ZWBA 1WCXA 4KI7A 3G0OA 4QTYA 2QIPA 4LGMA 1M8JA 3BMOB 3ZCSA 5IVKA 5B4UA 4D3DA 1ULSA 4EFMA 4P86A 4ER7A 2ONZA 4OOEA 2QUJA 3K8YA 2HA5A 2AX4A 2ZM6B 2REXB 1J2EA 4C3VA 4BFUA 1BN7A 2YS7A 5FLXA 3BJMA 3U9SA 2JI8A 5NLLA 4H3SA 1K1EA 1KOFA 4NESA 1TTQB 2O48X 1RPJA 3DHVA 4X71A 3WIBA 4D9KA 1IULA 3LZDA 3GRKA 3WK4A 1RJGA 3EQ2A 4CI0B 5JISA 4UMEA 1M1YA 1GRVA 2GF2A 2ZZMA 1US8A 2CCJA 5TPWB 1Y1SA 2GTHA 4LBWA 3UMJA 2R6R1 5ALVA 3F67A 2YMLA 2ACWA 2AOVA 3BXZA 8GPBA 4YDRA 4YXWA 1U8TA 4LJSA 2WMDA 1L7VC 1C7EA 1SBYA 2EP7A 2QGFA 3SNHA 2WG0A 4YRJA 2BTQA 1JHAA 5E4JA 3VX4A 3DM9B 1KQPA 3G89A 3H5RA 3HFGA 3JVEA 4HNQA 1VL5A 4NU0A 4OK5A 2GLTA 4EZIA 3D8RA 1UFKA 3BGWA 3BL5A 4Q7EA 1AF7A 1J7KA 4ZO8A 3TPZA 3Q2OA 3ZCVA 1CYEA 3OG9A 3GRFA 3OPYB 5D2CA 1FUIA 1WM1A 5BN5B 1E1MA 1N92A 3DBLB 2EAUA 4P3YA 5B7QA 1ATZA 4HDSB 3TRHA 3DO8A 3T3MB 5K3OA 1WXXA 1WAMA 4LA4A 4X7BA 1DAFA 1L8LA 1QUFA 2BDEA 3EODA 3GLSA 2F1KA 2WOOA 3FYSA 4WLNA 4HQKA 1ODJA 4KN8A 4AMZA 2V9PA 1GNVA 3W5HA 2Q4DA 3H3JA 3QKWA 3DW1X 5JS7A 4N47A 5H8WA 2UZAA 1O4WA 1W88A 1DG9A 3VPFA 5JSZA 2Y3IA 2G9NA 4PCVA 3THWB 1DZ3A 621PA 2OV2A 3H42B 4C4TA 4A73A 3BJRA 1HE4A 4D4HA 4F06A 1CUAA 3ML1A 2D5BA 4YMTA 2XDQB 4LBZA 4POAA 2ZTLA 1MFZA 4TM7A 1KMMA 3RF7A 2VJQA 1IFXA 3K6JA 3HEAA 2E1RA 3L3BA 2FYTA 3MPUA 4KO8A 1ESZA 3EUAA 3GFVA 1YU6A 2UVPA 5AI0A 1EG2A 3O1HB 4LOIA 4LWQA 4EK9A 4YDHB 4JLNA 4N5DA 1E5XA 3I1FA 1WV1A 2X0IA 2C2WA 2G9VA 2N0SA 3DHYA 1M2FA 3LOPA 3ROQA 2Q8PA 1C7IA 1I30A 1Q21A 3CCFA 3QA3E 2HR1A 4GXNA 5H59A 5JWHA 5HHTA 3IUPA 5IT5A 5LYJF 1JBKA 4JDUA 4B7ZA 1YS6A 1LDYA 1B16A 2H06A 3EY4A 1B3BA 2FLWA 2IGTA 5AKHA 2Y9MB 3MRSA 2YZMA 3U3KA 5HKOA 1XLUA 1CEXA 3CSSA 1W6RA 1P0IA 2QR3A 1OX6A 2DFKB 2VHCA 1QSGA 1QYCA 2WUDA 3GPIA 4Q48A 1F6BA 1HL3A 1Z8FA 2H1HA 1RYHA 3N0RA 4IINA 4K9PA 4X63A 3VJMA 4K9LA 2C2KA 1EHCA 4L28A 5KJEA 4XTCS 3X0DA 3OJOA 3MVEA 2HSEA 3I72A 3KD2A 1XCMA 1YFJA 4G8JA 5ERXA 2GVNA 4NMWA 4Q4DA 4TMYA 1V7ZA 5WRFA 3T12A 3ZBTA 1GDHA 4DA8A 5KSOA 2JLYA 2OAQ1 3LK6A 1C7FA 3T3HA 1AQNA 1ZY2A 3AJEA 3RUPA 3FMPB 2H4JA 1P81A 1M0EA 2VL7A 2AQKA 1Z4NA 2IXEA 1RXWA 2PMBA 3O8NA 5G4KA 2JGAA 3GFTA 3AF2A 2AYZA 4JBIA 1AHPA 2VUIB 2FK8A 1LQTA 4P4TA 2R8ZA 3Q9SA 4RA6A 4EBBA 4MWGA 3J7AC 1P8JA 3JWIA 2RJNA 3RT1A 2FP3A 3M0EA 2F7SA 1HKHA 1K7SN 4TMXA 4R9UC 3NUZA 5CCDA 3V4ZA 1PTJC 4B2LA 4B8YA 5KIAA 2REOA 4M9ZA 1DEAA 2HWXA 2X0JA 4HYTA 1E92A 1VYHA 3DA8A 4JC8A 5C4MA 1QK5A 2NU8B 4DOMA 1G8AA 2C3PA 4H4DA 4KXLA 2ZTUA 1G42A 5K0BA 1JFRA 1G8MA 3KXLA 4Y2RA 1V11B 2RHWA 3GLKA 3ACCA 3OI7A 5IDYA 4OQYA 3NHAA 3RSQA 4HWKA 1E9AA 4RS4A 1HE2A 1E7MA 3GEDA 2ZKIA 3I6YA 5AHOA 1W85B 1Z0FA 4FSDA 2V0GA 1H93A 2JAPA 2Y93A 3IIIA 1AHHA 3T7DA 1VHLA 5DBFA 3VVCA 1MV5A 2IPXA 4LJ9A 3FTPA 3K20A 1DO2A 2RB5A 2WTXA 4IDGA 4CKCB 4JSTA 5JXJA 2ONYA 2P2YA 2C7RA 3PCXA 4JLKA 1KMQA 3CR8A 4P83A 1PR9A 1EGAA 1U0HC 5CA0F 2V6GA 3R0IA 4QOSA 4J0EA 2IP1A 3W2GA 3U1BA 1CZKA 1GL9B 3P9CA 2Z5FA 3EGCA 3GVXA 3IT2A 1T2DA 2HWYA 2V98A 3KJIA 3WMXA 3LPDA 4BMVA 1T13A 1ZOPA 2QTGA 4KLZA 4L7QA 3TLKA 2EYQA 3FIJA 1TW2A 2ZDQA 1KTVA 4DYVA 3OEHA 1P6UA 2XLBA 2QSUA 4OLJA 4ABTA 1OQAA 4DIEA 4N6OA 1TKRA 2DRIA 4IWNA 4LYHA 3HJBA 4BMNA 3AHCA 2WF8A 3B7GA 3E8SA 4RO0A 3ZWXA 3PUWA 3EIHA 1NBHA 1HE3A 4F71A 4C5BA 2ZRDA 5CHYA 2DHQA 4GG1A 2PAAA 4HJRA 4RZSA 4TWRA 2RKBA 4MVJD 4CT5A 4JWKA 1EXWA 2W8BB 4PX3A 3X1XA 4UBMA 3ZJ5A 4BVHA 3WJAA 4L9WA 2R7MA 1UBKS 2YW2A 4R0NA 1U3DA 3VSAA 2ZJOA 4DV2B 4G0WA 1ZVKA 1RYYA 2D00A 1AUXA 1JFLA 1P61B 1ECGA 1J8VA 1NE2A 3KUKA 3PA6A 2HY7A 3WDKA 4K81B 4GP9A 4XDYA 4AN1A 2P35A 4AICA 4Y30A 4IIJF 3LUHA 1H5UA 2E18A 1L4KA 2P9BA 3I6IA 3ZGVA 3TZHA 3AEXA 1Z5VA 2QSYA 3S4YA 4U2BA 3MGCA 5COAA 4IIJB 2VOJA 1B8OA 1L5QA 2BGKA 4XVCA 4TV8A 2VAXA 1P3DA 1S4QA 3SVLA 1TZMA 2G4VA 5L6LB 2G40A 5EXXA 3Q85A 5EE9A 1PZNA 3QJGA 1XJWA 3B1YA 4BUCA 3I52A 1NI4B 2WDPA 3DYBA 4RVHA 1KXZA 3E7WA 6ADHA 3HCRA 2AFRA 4N39A 2E5WA 4TRJA 4OFWA 3OO0A 2IXAA 3QHPA 3FHTA 1EINA 2B4YA 1J4AA 3NIGB 4XM2A 4PO9A 4YFYA 4ALJA 5HRCA 3RYCA 3LWZA 5GPBA 1M7GA 1NWHA 3VJLA 3C6MA 2SECE 2R5NA 4LZWA 2VAWA 2XMPA 2YRXA 3CMCO 3JQFC 4FQ7A 4MUNA 1QGUA 2A86A 4O2BF 5CLHA 3SGLA 3V4SA 3F97A 3G2QA 4B2YA 2EZUA 4I5FA 3AHGA 3K0CC 3BWMA 4M7WA 3V4LA 2Z8XA 2FMTA 2NO1A 1YT5A 3ILXA 4AIRA 4P32A 2FDRA 4F97A 2P90A 4LXIA 3C3MA 3F71A 3QEAZ 3HI4A 4BX9A 1ZBDA 3KJFA 1FP7A 3WWDA 4BP1A 1ONBA 4MXDA 4W5HA 4XUDA 4P3KA 4JI0B 1OFUX 1ULTA 4EJMA 4WOBA 1P8AA 2A14A 5A4JA 3GAFA 3DAGA 3L0CA 4YJFB 1QU2A 5CB4B 2P75A 1OE0A 1DG1G 3BWDD 4O29A 1FBTA 4XYEA 1YJQA 2EF0A 4YA6A 4B4OA 4LMRA 1XK7A 2REBA 3TIGA 3ZV6A 2I7DA 3A6DA 3OPYI 1PTJA 2EBUA 3GWGA 4DR2B 4HDOB 4KR0A 3ROGA 3H5WA 3W9YA 5F5NA 1GRRA 4FIDA 5AW5A 5LFAA 4EHIA 3OM0A 5KQSA 1L4MA 2UUCB 2EZ9A 4CIBA 1NBOA 2HYDA 1G9TA 3QMWA 2D0OB 4DCUA 1N7IA 4BWFB 3RVMA 2BKAA 1TMGE 3IKLA 4ZT4A 1C5KA 3GLHB 5DGDA 3N39C 3KVNA 5AXAA 3KUUA 2H4WA 2H63A 3O84A 4HGOA 3LTNC 3OJFA 5C1IA 3IPRA 1FDVA 1JQDA 2FOIA 2GFQA 1JI0A 3DOHA 1JIIA 3H04A 3KT3A 3O03A 5A0FA 4GOMD 5KTSA 3HWX1 5A6SB 3PPIA 3TLBA 4HGNA 1D4AA 3ZWVA 4ML3A 2W6JD 1C3XA 1IEWA 5FEUA 2Y6UA 4TL8A 2QRPA 1AQIA 5FOSA 4F8YA 5DM0A 1PWXA 1IJBA 3W7AA 5A7HA 3M1LA 2WYWA 1QIEA 1T2AA 2FPKA 2HFKA 2IUFA 3A1EA 3HCDA 4XB2A 5I9NA 2AFIA 2AW3A 4CL8A 4XLLA 1KYZA 2I66A 1I3NA 3AP1A 2FR8C 1BWQA 1H9AA 3B85A 4A1FA 4B85A 3ICCA 4P4LA 3FCCA 4R7TA 3OE4A 2DPYA 3NORA 2W8ZA 1YI0A 2EKLA 1XZAA 2SKCA 3EZXA 1JN0A 2ZAYA 5D3QA 5A6VA 5A62A 3EGXB 1H6BA 1D2GA 2VBCA 4AY4A 2QP9X 1J23A 2BDTA 2Z9BA 3OM8A 4LF9B 1FUEA 5IDQA 3CF0A 3KE9A 3QMVA 4LDNA 4OHZA 5ELMA 1JBEA 3A32A 1KQGA 1QG6A 1XG5A 3MGKA 3W5VA 4TXLA 1I6LA 2IEDA 3L49A 2Q7DA 4LHZA 2VFAA 3F98A 3ZWPA 4HV4A 3F6SA 5LWQA 4WXYB 4GVLA 1J9GA 4C1BA 1DFHA 2PBZA 1NASA 1F8YA 3CUVA 4D4GA 1OWMA 1ACMA 2FOXA 4NQZA 2QF7A 3PA8A 3WLHA 1LBEA 1WHTA 2RAPA 3OE5A 1G63A 2O8VA 4Z7JA 2P1RA 3W7VA 5HGJA 1F4LA 8MHTA 3W9UA 4YJ3A 4QTTB 1INLA 4TROA 4W5OA 3IAM1 3TCKA 3HM9A 1SKQA 2CXXA 4RHUA 1H6CA 3O3MB 4PSKA 1RZVA 1J42A 2NWQA 2EU8A 3QBDA 3K0SA 3QU9A 2JCVA 3MWLA 3FOAA 3R0QA 3J81A 1JJ7A 3PEVA 1PWHA 1E9RA 1ZHHA 1U1CA 3URKA 2ZLBA 2Y99A 3PUYA 4Z3OA 3N8KA 3VNUA 1U0TA 5LYYA 3B3QA 3W90A 5A4DA 5AJTA 4NXMB 3W0LB 4ZI3A 2R96A 1RM3A 5JY1A 2WTAA 1RXUA 4M1TA 1JMYA 2B6HA 3T3IA 2GD6A 3ONVA 4X7MA 4ED9A 4GKJB 1M0SA 2EX4A 4G84A 1ANKA 1BE8A 1PX2A 2WIBA 4V2UA 2R6AA 3L8FA 5JD3A 2B6NA 2BW0A 4ND8B 3FI0A 1E3QA 2BEUB 1EXVA 4XGQA 4R5MA 3PX7A 1H8ED 1YXMA 3FMVA 4CDRA 3ELYA 3AEQB 2MSCB 2PD3A 4B3DA 3JATA 2H57A 5T4HA 1MKYA 2HOQA 1JH8A 1KY3A 4FEAA 4NEHB 4BGVA 3CZ4A 5BQPA 2CVPA 2G80A 1JT9A 4B32A 1W7AA 4LMPA 2DU8A 5CFQA 3BGDA 4M0PA 3CM0A 1S5PA 3PHIA 3KUXA 4CR8A 4RGQA 1L7QA 1KAEA 1QP8A 5E1BA 3JQFA 1OWPA 4LGYA 1XZJA 5DIZA 4UM9B 1DIOB 3O8OA 5A02A 2FWMX 1RBQA 3ENKA 2HF8A 2GRAA 3EH2A 1D04A 2R8YA 3K0CA 4HOYA 4U4AA 4Q1VA 1FJXA 1OH5A 3LF1A 1JTVA 5JVDA 2FVXA 4ZAGA 2PUJA 1RJDA 3MT0A 4KR6A 4WN9B 2GNAA 4GD3Q 3RJ9A 3UJHA 4BN0A 4JIMA 2XUQA 3EBPA 3GFFA 4Q5IA 4H6PA 4X45A 5F2KA 4J3FA 16PKA 2QJTA 3H0KA 3TVYA 1NVKA 2P62A 5FO0A 3WHLA 3VMFA 1R4NA 5D1NA 2AOXA 2R4TA 2NADA 1PV1A 2XNSA 1IK6A 4C3OB 4B7CA 2W2NA 4MQFB 1DBIA 4ZC8A 3D6VA 2E89A 4RFVA 3WDSA 4CV2A 1T9GS 2X9LA 4JBLA 1VBKA 3GW8A 3UAZA 3EG9B 3REFA 4UVHA 2FZWA 1ZS9A 3JQ9A 3T1TA 1PNTA 3GA7A 5JSYA 3ZD8A 2YWEA 5IUNC 1L5HB 4WK0B 3DUFB 4MO2A 1YMVA 4Q03A 3GVIA 3WRXC 4FZVA 3L6DA 3PE4A 1HSOA 5JJKA 3UK2A 5FJIA 1UBEA 4GDFA 2DBZA 3DNFA 1KHHA 2X58A 2Z2JA 4AJ2A 5GOZA 5C18A 2HQSA 2JDID 3HKDA 1KI2A 1NMEA 3QMPA 4JLDA 3VAAA 3X1KA 7ABPA 1R3UA 5BRNA 4REOA 1TI7A 3P9IA 1XMXA 4DNOA 5JQWA 1IDOA 3MF4A 3MQ2A 2GO7A 4QICA 2OD2A 4E5UA 4B6RA 1NBME 5J3JA 2R6JA 4KH0A 2MYTA 2PX6A 3EEQA 3KSDO 4BNKA 3NNNA 1YCGA 2J67A 1RWMA 2FR8A 2BHNA 3D2CA 3ND5A 4M1QA 2BHRA 2FRVA 3QVMA 2C77A 4XW2A 4AN0A 4QPJC 3H7AA 1Z5WA 2O2ZA 3IV9A 4DE5A 1U1FA 4CVNA 4ZPJA 4GPD1 3EEIA 4R1OA 4LDJA 1O57A 1V6CA 1A3CA 2Q0QA 4QGHA 3WAKA 2XA2A 4ENUA 5BVHB 5KHOC 5EMLA 4D4MA 1D0IA 1E0DA 1U5CA 1MU0A 1UM8A 2FE1A 3Q98A 5EXEA 3T3PB 4L2IB 1PJZA 1CS4C 4R54A 2FUG1 3KEQA 3UJAA 3LXUX 3WHIA 2VJBA 2HV9A 5EZYF 1TIPA 4DWJA 2ATXA 4HFJA 1BXRA 4Q93A 1E3IA 5FLYA 3UT5B 5A0TA 3G9QA 3SFVA 1EXDA 3EEBA 4ZOLA 2Y71A 3T7EA 2XAUA 2QLMA 4UPEA 1TCBA 2CYAA 1DWQA 2XNCA 3GZ4A 1KI4A 3P1JA 1AA6A 1O5TA 1L5MA 4A0FA 1WSBA 1WP9A 5E6RB 1JYFA 4UOQA 5BPFA 4IDDA 4U2DA 1ST3A 3L05A 1RRFA 1NZFA 5EJFA 1MNAA 2H4HA 2WU1A 2Z95A 3M4XA 3RRNA 3QLVC 2BKEA 3KPVA 5EL0A 3SYTA 4D02A 1T8WA 2XE4A 1KPIA 1F5SA 1IXYA 1YC2A 1RAAA 1UR5A 4RGBA 1M76A 3GEPA 4CQMA 3KSZO 3G88A 3I76A 1XBTA 4NYIR 4XB1A 4XRGA 1Y5LA 4JSRA 4U00A 4IPTA 1XDBA 3CZ5A 2QHXA 1HYGA 3PC7A 3HYNA 1Y8RB 2A0KA 3VTKA 5JO0A 4M1KA 8ABPA 1WMFA 5G0VA 1XX6A 5IK2D 2RHGB 4R69A 4BMYA 2Z30A 1I3KA 2BCGY 1HF3A 3DH0A 3IUNA 4KAXA 4MR8B 3EASA 4OFZA 4RMIA 1SQ6A 1YASA 4OI4A 4M0LA 4UUBA 1E20A 4WERA 1Q15A 5JCJA 3JZFA 3VPCA 1HT0A 1DV2A 1T3ZA 2Z5LA 2GD1O 2X15A 4XZ3A 3MXTA 1FNDA 1IXKA 4F5DA 3BSWA 1D07A 3SD7A 4PBRA 2FSIA 2X42A 4ISCA 5A4IS 2OHGA 1CQZA 4YONB 1HLFA 3A6EA 3C5EA 4JR1A 4TQGA 2X2PA 5FPPA 2EIXA 3ZK8A 1GKUB 2AKAB 2YHBA 2QUKA 2HRZA 1CZUA 1DWUA 2XMQA 3WRWA 1F8XA 4D4JA 1M67A 5TGTA 4AG6A 4NJMB 2QN7A 1DEHA 5HR5A 4MKXA 3EWSA 4YASA 4RPLA 3ZUPA 4CMEA 4RTNA 5ALLA 3SE7A 2QRVB 4U39A 1QYRA 1N6RA 4MGZR 1B76A 4RKEA 2HFJA 3REQA 4EG7A 1VA4A 3EVEA 4XGKA 1MJ5A 2I76A 1HG0A 4J1SA 2FPUA 4Q39A 3CWCA 1X19A 5ESDA 4JBYA 4C2TA 3IVMA 4FOLA 4AS3A 1YR8A 4AAYA 3GJ3A 2HRCA 1AB6A 3M81A 2YHIB 4KQ1A 4HWRA 4E5PA 1XLTC 3ZX5A 4GZ5A 1D4FA 3GEIA 3I9MA 1PGPA 1U2EA 4JB2A 3V3KA 5AVZA 5KQPA 5LL6P 2ETVA 1W0CA 2TECE 1UBMS 1PS0A 2X2FA 3UC5A 5KOJB 3WRXA 2FW7A 4JKIA 5HKKD 4GSKA 1SVNA 5J2TF 2GJ9A 3MGGA 2V65A 2ZBPA 5EWJA 2V0CA 5BSMA 1U9IC 3KZNA 3CE6A 2OQ2A 5LXTF 1E2DA 1ID8A 1OREA 3F90A 2ZYSA 3EMKA 4FMDB 4X6LA 2QJOA 1DBRA 1L5YA 3KCQA 2OZPA 3KZCA 2QPOA 1GAQA 4FW8A 4S24A 3MTJA 3H9BA 3AUKA 2VYND 3TR5A 4HGRA 2E48A 3VR3D 3V33A 1WMAA 1DC6A 2ZR7A 2OWDA 4W5WA 2X7HA 1MZVA 3PRYA 3LKDA 4D6PA 2RAVA 2NO6A 1HT3A 3AKYA 4D8VA 1JHZA 2AL7A 2BFDA 4MHSA 1PP4A 1OFIA 1XDDA 2ZSEA 4FT4A 3BKXA 4GC5A 5ALZA 1TQ4A 4OFBA 2ZYDA 1ISPA 3H2HA 2YJZA 1OXXK 3ESRA 4WOKA 2PO7A 3BRQA 4ZT5A 4ZJPA 4IH9A 1TUIA 5K45A 4I46A 4YWJA 4FX5A 4CG2A 4Z7QB 4PS1A 3IAHA 2QRGA 3E8MA 1E2UA 4CDGA 2FN8A 1OYVA 1NUTA 1YMUA 2NXJA 5BN3B 2R00A 3CH7A 3FA2A 4IOKA 3NCHA 1KDPA 5CNMA 1ID1A 1NXTA 5IN5A 4Y6LA 4NCBA 2QJFA 1SQGA 2Z2XA 4L0QA 3KLPX 4YVFA 4DQLA 4F3TA 4Z1MD 1I5OA 1Y3IA 3DJFA 4TRMA 3PQ8A 4MYCA 5DTMA 4BS9A 4D1YA 3HBLA 1DDOA 4MQ5A 4RTQA 5J58A 1U4NA 1GZ4A 1Z4MA 4QFCA 4GX0A 4OQNA 4R1LA 2A78A 3ZIDA 3URMA 5AW9A 3WTBA 3KQQA 1CJMA 2I7VA 1IBMB 2FA9A 2O7QA 3L6BA 4EEKA 1SA0A 1Z0SA 1M2OB 2P5YA 3HB1A 3HCAA 3O9MA 1CG6A 1SB9A 3I62A 1YZGA 2DTDA 4BB9A 8OHMA 2GBLC 3CLTC 1RDFA 2DGDA 5L3SA 5EN4A 4Y0AA 3RG2A 1DX4A 4BGEA 1S3FA 4BQEA 3IE0A 1YK1A 3L1IA 4OQZA 1KJ8A 2X14A 3EW9A 4Z0PA 2D8MA 2R8RA 4EG6A 4O3FA 2YJ3A 1R3DA 1OXVA 4Y2GA 1ZI6A 5BN4A 2B61A 4WINA 3HY6A 5AWFC 3UCFA 4WEOA 3ONDA 1X7YB 4JBWA 1LBQA 5FI5A 1KMCA 1XN4A 1XZEA 4QU9A 4RL6A 2C9OA 3H2BA 1YQDA 3AP2A 1C4KA 5C8YB 1KTIA 3NM4A 3LKBA 1G8KA 1E59A 5JD4A 4KE6A 1AHIA 4FFPA 4BWYA 3QI2A 1B00A 5MF6A 3DDSA 1LRJA 3ROPA 1T24A 1OLUA 2O7SA 2W2KA 4KCGA 2ZWIA 3WWOA 3GCXA 2AN1A 4K1LA 1VIMA 3TL2A 4JJIA 4ZAWA 1ML3A 4ZHQA 1NOKA 4NJEB 4A0QA 1RPNA 2NU9B 3DEFA 3H97