The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
25
|
Knots found |
|
sequence length |
112
|
structure length |
105
|
Chain Sequence |
b'NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGHDSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISILTLEEILKLYESGKVQFFEIIV'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb |
| molecule keywords |
UNCHARACTERIZED PROTEIN 114
|
| source organism |
Sulfolobus islandicus rudivirus 1 variant xx
|
| molecule tags |
Unknown function
|
| total genus |
25
|
| structure length |
105
|
| sequence length |
112
|
| chains with identical sequence |
B, C, D
|
| other databases |
 KnotProt 2.0: S +31
|
| ec nomenclature | |
| pdb deposition date | 2010-01-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08960 | DUF1874 | Domain of unknown function (DUF1874) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
