2X55A

Yersinia pestis plasminogen activator pla (native)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
290
structure length
274
Chain Sequence
QLIPNISPDSFTVAASTGMLSGKSHEMLYDAETGRKISQLDWKIKNVAILKGDISWDPYSFLTLNARGWTSLASGSGNMDDYDWMNENQSEWTDHSSHPATNVNHANEYDLNVKGWLLQDENYKAGITAGYQETRFSWTATGGSYSYNNGAYTGNFPKGVRVIGYNQRFSMPYIGLAGQYRINDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAKVFAEFTYSKYDESIGGDAAGISNKNYTVTAGLQYRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAGULASE/FIBRINOLYSIN
publication title An Active Site Water Network in the Plasminogen Activator Pla from Yersinia Pestis
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Hydrolase
total genus 80
structure length 274
sequence length 290
ec nomenclature ec 3.4.23.48: Plasminogen activator Pla.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01278 Omptin Omptin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.90 Mainly Beta Beta Barrel Lipocalin OMPT-like 2x55A00
1I78A 2X56A 2X55A 4DCBA 2X4MA
chains in the Genus database with same CATH superfamily
2GTLO 1LKEA 2RA6A 4IAWA 4BX7B 1LIFA 3B2LA 1OSPO 2UZ2A 5F1EA 4BX5B 1I04A 1LELA 1SRHA 5F58A 4Z28A 4GGZA 4WFUA 1VWOB 3RE6A 1R0UA 1STRB 5CSEA 1GT3A 1HMTA 2Y32A 1B8EA 4GU8A 4HPAA 3WZOA 5HBSA 1LCZA 3EBKA 1X8NA 3D96A 5HZQA 1SXWA 1CBIA 2XSTA 3PECA 3FEPA 3RDUA 1UZ2X 2JGSA 3HTYA 3HWEA 4CDCA 3T1DA 1AVEA 1SXYA 2Q9SA 3OJYC 1SRGA 2A2GA 2ANSA 1E00A 4NV8A 4IMOA 2MM3A 4IABA 3C78X 1RBPA 2WEWA 1GXAA 4L3RA 4TKBA 1ZNEA 2RTFB 2R73A 1VYGA 2OFBA 3P6CA 4GH7A 3S5VA 4NYRA 2QO5A 2OY8A 4FGIB 1U0XA 2LB6A 4GJSA 4TKHA 4MVEA 4YVBA 4MVIA 1EXSA 4GNYA 4IBAA 1PBYA 4NV7A 5H9LA 4ARHA 4ORRA 1FELA 3B2HA 4ZHGA 3EBWA 3MBTA 1TW4A 4MVLA 1SWSA 1T8VA 1OPBA 4R0BA 2X8FA 5HTEA 3WJFA 1DZJA 5HZ6A 5HZ5A 1VWFB 2KT4B 4ZHCA 2AT5X 2JU8A 3ZI8A 1SWGA 2OY1O 1IKEA 3AKMA 2IZFB 1SWQA 1EIOA 1EIIA 5AQ6A 4XMHA 1X71A 1UYOX 1MM9A 1G74A 4LKTA 5HCCC 3E3CA 3VU1A 4HPCA 4XMEA 3C76X 1DZKA 2X56A 3F9DA 3CR6A 4QZUA 2IZJA 4CSBA 5FENA 4BCSA 4DNEA 4QGXA 5LKEA 2OF8A 4NLIA 3IFBA 1OEJA 1JIWI 1VWAB 1SWFA 3S5XA 1KGLA 3WVMA 1MEPA 5H9KA 1L6MA 1YWAA 2PY1A 2JMBA 3NPOA 2AH7X 1NGLA 2C1QA 5IRWA 3WJCA 2F01A 1B0OA 3GE2A 3WZNA 4O4SA 5EPQA 1OBPA 4DCBA 4ZFXA 1QFVA 4A8ZA 4I3DA 4I9RA 1LFOA 2IZAA 3H3IA 2X4MA 1O1UA 3FIDA 3Q6LA 1A3YA 1HXLA 2GTLN 2RTMA 4FBOA 4Y0RA 1SWNA 1N9YA 2FWVA 1RAVA 2LKKA 3FMZA 4GKCA 1GX3A 4EEJA 1PBOA 1FDQA 1VWRB 4NNSA 5IO6A 4U8UN 1DFVA 4N7DA 5LJBA 1JMXA 1HMSA 1SWEA 2F09A 3BU9A 1PEEA 3U0DA 3CKGA 2MF6A 5CHKA 1VWPB 1KT7A 1EPAA 4BX7A 1ICMA 2EU7X 3CKFA 5H8TA 3U9PC 2AF5A 4BX5A 4Y59A 1VYOA 3KVNA 1LDQA 5D48A 3FR4A 4ORWA 5D45A 3VG6A 4EKVA 1MOYA 4KT5A 1QY1A 2QCBA 5L8OA 3BY0A 3EMMA 3UEXA 2OVDA 2ZAIA 1OBQA 2LFOA 3ELXA 4LZUA 3JS1A 1HQPA 1RSTB 1KXOA 1LF7A 3NBXX 5EDCA 3KFFA 5AJCA 2OL8O 2AT8X 2GTLM 4GUZA 3WJGA 1SMPI 4KCAA 4FBVA 3K3LA 1ICNA 3FR2A 3P6GA 2Q2PA 4HPBA 1KQWA 1LCVA 1QY0A 1NP1A 1X8OA 2R56A 3JQOA 2IZCB 3SLTA 4ES7A 3P6HA 2RTKA 2X32A 3BX8A 2OL7A 2W2FA 3WXQA 4QQ1A 4GNWA 2BT9A 2OFMX 2N93A 4YGHA 5DPQA 3FA7A 1KT4A 3VGWA 5IXGA 5FQ7E 2RTNB 4GK9A 4ZGFA 1QABE 1MVGA 2BSZA 2Q39A 2AT3X 3SLOA 4YDAA 1GT5A 3LV4A 4NP1A 3O22A 3P6DA 3APUA 1QG5A 4GDAA 4CPHA 4Y0PA 1SWLA 2FRSA 4ZH6A 2LBVA 3OBLA 1BWYA 1IIUA 3FA6A 1HY2A 3NADA 4GZVA 2FKGA 3VG5A 2WSJA 3WJDA 1G7NA 1RXKA 1KT3A 5B10O 2ALLX 5LJKA 1KQXA 1BSOA 1Y9LA 2BS6A 3FDCA 1DF3A 4NW4A 3T2XA 3HK1A 1EQDA 1TOUA 5K06A 4LKPA 2CM9A 3BLGA 2MWHA 1P6PA 3L4RA 3RDMA 4CPEA 2CM4A 1FTPA 1LICA 4A1HA 2FS7A 2GTFX 1HQQA 5F2BA 4U46A 3NR3A 2OL6O 1JYJA 1NP4A 1E2TA 1NDJA 2JU3A 2K23A 1SWPA 5LJHA 1QQSA 2VFCA 4INNA 1CRBA 5FQ8E 3ZW0A 1HBPA 1X8PA 1ZRYA 4TKJA 1NBXA 3FW4A 1SY3A 1JMZA 1GM6A 3KZAA 5L8IA 5IO7A 1E06A 3HWFA 2HKDA 4ON1A 2NP1A 1VWMB 2XKLA 1CBRA 2AT6X 2RTHB 5EZ2A 1K24A 3P02A 3ZW2A 3NQ3A 1XKIA 2RTAA 3HOEA 4FQBB 4YGGA 3VPJE 4IAXA 3RDXA 2FLJA 4GJVA 1QWDA 5DG4A 3TZSA 1NQNA 1SWKA 5F7GA 2G8CO 3VE1A 2HZRA 2ZAGA 4IB6A 5B2AO 1G85A 3D95A 4WFVA 4OMXA 2A8GA 1DZMA 3QQ2A 2ZSCA 1NQMA 2RN4A 5HZ8A 4YBUA 1RLBE 1VWDB 1IW2A 1ZNGA 3VG7A 1N0SA 3MM0A 3ZWEA 2O62A 4ORYA 3WZPA 3PQUA 3T6LA 2OFAA 2RTEB 2OYBO 1JZUA 1GX8A 1DF8A 1OEKA 1SY0A 2X8SA 1ERXA 1YWBA 1BRQA 4YFPA 4JO6A 1FENA 4BVMA 4KH8A 5EDBA 3WJEA 4AZPA 2ASNX 3STMX 4CDFA 1N4JA 1ZNDA 2RTOB 3DSZA 3KQ0A 4L1NA 1SLFB 4GGTA 4OS8A 5HCDC 2LBAA 4U3QA 5HAEA 5LJCA 1BBPA 3D4RA 3FENA 3ZW1B 3MX7A 2BS5A 3T6FA 3MG5A 2WPUA 3VHIA 2HMBA 4CV7A 1ERBA 2IZGB 4CPFA 1SWRA 3WOVA 4YCHA 1Y53X 3APWA 2YG2A 2HZQA 3CQNA 4M6SA 4U9CA 4WBKA 3VG3A 1SRIA 1AVGI 1IFCA 1SWJA 5HZ9A 5KHPA 3TGBA 4O49A 1O1VA 1JJJA 4KC7A 4JGLA 4QRLA 2KTDA 2CBRA 2ACOA 2FR2A 2RCQA 3RDOA 4ALOA 2IZEB 1STSB 3F8AA 4B55A 3KFGA 5FFHA 2RTRB 1WUBA 3P24A 4ZHHA 2R74A 3RY2A 4CPIA 4I60A 2OY5O 1MUPA 2A5BA 2RTLA 4ZHDA 3RDQA 2FHNX 5K67A 1VWLB 3B2KA 4YMYA 4O3WA 2FKJA 4ID2A 1GT1A 1E5PA 4JHQA 1VWJB 2IZHB 4Y5DA 2I5ZO 3S60A 4CDEA 3EYCA 4D6BA 5BVTA 2RD7C 1A57A 1RXJA 2WWPA 3C77X 4BX6B 4OS0A 1LNMA 4Z6JA 2UYWA 4RUUA 2A3FX 2KD2A 2A5CA 2YMSA 2X8TA 3VG4A 1HBQA 4ORSA 1LIDA 1X8UA 1JV4A 4I6SA 3ZUOA 1CBQA 2ACPX 2KW1A 3AUMO 4GD9A 1BM5A 4BQUA 5BVQA 2OVAA 2Z4IA 4IMNA 4Z2PA 3D9WA 3RKGA 2Q4NA 4YKMA 1TXLA 3RSWA 3O2YA 1HXZA 2JOZA 1GX9A 4ML7B 5LJGA 1SWHA 3KFIA 1GGLA 2E4JA 1SA8A 3SZHA 3NQ9A 5B5FA 4DQ3A 1QY2A 4I9SA 2GC9A 4ORUA 1N43A 3VHHA 2RTPB 2WQAE 3PH5A 1ZNHA 3B2IA 3B2JA 2BHVA 1CBSA 4EQAC 4GE1A 5IRUA 1NC9A 1AELA 2JU7A 3SZJA 4TQ2A 2VFBA 2X55A 2IZDB 1SREA 1RSUB 3BDRA 5KIDA 2C1SA 1LPJA 5B5GA 2K62A 3RE5A 1UYNX 5K68A 1GT4A 3APXA 1EPBA 3PPTA 3VG2A 3BRNA 1JBHA 1KL4A 4NNTA 2MJIA 1DC9A 1SWBA 2A13A 5CE4A 1I4UA 2L9CA 2PI3O 2W2BA 4BBOA 1LIEA 1S2PA 3TGCA 2QOMA 4GDZA 4I3BA 1SWCA 2RTCB 1N7YA 1KL3A 3GAQA 3HPEA 3O19A 1EALA 2QO4A 1WBIA 1K3BA 2Y3EA 3T2WA 4ZH9A 4Z2OA 1I9HA 1SXXA 1Y9TA 1BSQA 2AT0X 2DJGA 2MO5A 3IA8A 3PDFA 4IRWA 2QO6A 4O4OA 4TNNA 1EW3A 3STNA 3UAQA 3WYQA 3CBCA 4OMWA 2X45A 4HPDA 4QYPA 2HYSA 5AJBA 3U03A 4EFGA 1BRPA 1IFBA 4UU2A 3V8UA 2WR6A 4Y0QA 4XMCA 1YWCA 2CBSA 4QAEA 1VWHB 2RTDB 2POAA 3VE2A 1LIBA 4YGZA 3SAOA 1LDOA 1OEEA 1E02A 4KIIA 4O4XA 4RUNA 3F6ZB 4AYHA 4O3ZA 1LUQA 3SZIA 4BJ8A 3VHMA 3AEHA 1VWGB 2AMMX 4O3XB 1BLRA 4O9SA 2BLGA 1BSYA 2IZBA 1JJUA 3Q34A 3UEUA 4IB8A 4U8UO 2C4IA 4Y0SA 2VDFA 3ZQ3A 1VWCB 4GRJA 3PEDA 1DZPA 1X89A 2QMIA 4MIRA 1I06A 3S26A 2DJFA 3NX1A 4AZRA 1GKAB 3BX7A 5L3YA 1SY2A 4BX6A 5HTDA 2BC3A 2CZTA 5D4AA 3APVA 1EUOA 1IJ8A 3WJBA 3WZQA 4AZOA 1VPRA 2DM5A 2G5LA 2RTGB 3TGAA 2L5PA 1JYDA 3X00A 1Y0GA 1PTSA 2OFRX 4XMDA 4YKOA 5H9NA 5FQ6E 4GETA 4WHIA 3HWDA 5JD2A 3SLJA 4QGWA 2L67A 1PM1X 2OVSA 1YWDA 2WQ9A 2RTJA 2P8GA 1JJXA 3PP6A 4TLJA 3SOTA 1T0VA 1SLEB 1SWDA 1VWNB 3WBGA 2HLVA 4AZMA 4QYNA 1ALBA 4ODDA 1VWKB 1D3SA 1ZNKA 2CZUA 1S44A 3RDSA 3I17A 5B3MO 4A1YA 1QFTA 4OELA 1JQPA 1ACDA 3BSZE 3RZYA 1ADLA 2G7BA 1N9MA 4YFRA 4HWMA 1SLGB 3EW2A 5LKFA 2RTBB 2OY7A 4CPHB 4YBPA 2CAMA 5IO5A 1UREA 3FLLA 3LTWA 4ZR2A 5B11O 5AEOA 2IFBA 3AKNA 1YP6A 1OBUA 5B29A 2JN3A 1SWUA 3N91A 5F6ZA 4D6AA 5EEEA 1Y55X 5HA1A 3FEKA 3NP1A 3P6EA 1BJ7A 1FEMA 3LHNA 3QKGA 4MVKA 1ML7A 2HNXA 2Q2MA 2FR3A 2OZQA 4QNIA 5F6BA 3EW1A 5BVSA 2JW1A 1VWEB 4OS3A 3UEVA 3UEWA 3STKA 5H9AA 4Z2VA 2LA7A 1G5WA 4LQZA 1W5RA 4ALBA 4AW8A 1IKJA 2WUTA 1MX8A 1EI5A 1KL5A 4EXZA 3EC5A 1BEBA 1I78A 1KT6A 1VWBB 1YUPA 1MDCA 2M4LA 3PH6A 5EEDA 4A60A 2RTQB 2W2AA 3FELA 1U18A 4YDBA 2QM9A 4BGFA 3DTQA 5L8NA 2X46A 1CJ5A 2X34A 3NQKA 4MEEA 3FW5A 4LZVA 2RCTA 1PMPA 2Y3FA 3HOLA 3PK2A 4KC8A 3ZW0B 1AB0A 4Z27A 4OEMA 4ZHFA 1B56A 4AZNA 4EDEA 1SLDB 1Y52X 2IZLB 4IB9A 4YH0A 4ZJ0A 5LJEA 2KTSA 3PQSA 1MK5A 2WEXA 1A2DA 2FGSA 1FJ1E 3FYFA 4GGRA 4K19A 3MVFA 5BYPA 2A0AA 5JR8A 5FAZA 3ZUIA 4N7CA 5C0NA 1O8VA 2NNDA 2L68A 2GJ5A 3RWXA 4FBRA 2G78A 2NNEA 4ZGUA 1KZWA 5HWZA 2NNQA 1VYFA 3KFHA 1HMRA 1GKAA 1SY1A 1SRFA 1KFFA 2FT9A 1I05A 2FS6A 3WYPA 3CQRA 4OKAA 3NX2A 4ORXA 2FTBA 2OVEA 3OE3A 4I3CA 3RBYA 1T68X 1XCAA 3BS2A 4PSQA 2FHLA 3EM0A 2RQ0A 3BU1A 3G7XA 4IB7A 3CBSA 4NLJA 4YCEA 5IRAA 4CDDA 4C5PA 2MHDA 4U8UM 1X8QA 2QOSC 1A18A 2Z4HA 1VWIB 3JSQA 4COTA 4HFOA 2AKQA 4QGVA 1VWQB 3HWGA 2AVIA 4MISA 4TJZA 1HN2A 3FIQA 1RXHA 3P6FA 5B27A 1H91A 1SRJA 1TVQA 1KOIA 1OPAA 5LJDA 4AZQA 3FA8A 5CYBA 3OD9A 2AL0X 5D8JA 1SXUA 3ZW1A 4PJ2A 3RY1A 1DV9A 3I0AA 2G79A 4XMGA 1SWTA 2I5VO 3TF6A 1D2UA 2IZIA 4I95A 4UU3A 4NYQA 4M7MA 3ZZVA 3CWKA 4BOEA 1AVDA 1U17A 1LCWA 1SWAA 2RTIB 1Z24A 3FR5A 4XMFA 4CK4A 2GH7A 1STPA 1TOWA 1ZNLA 4QZTA 1SWOA 1YP7A 4O4UA 5HCEC 1KT5A 1FE3A 3D97A 5KICA 1B4MA 3CMPA 1KZXA 2F73A 1W6FA 4DQ4A 4YFQA 4ZCBA 2IZKA 1AQBA 1MX7A 3ELZA 1YIVA 2A2UA 4O3YA 5HA0A 4JNJA 5D47A 3FA9A 1W4TA 1S7DA 2OF9A
chains in the Genus database with same CATH topology
1I78A 2X56A 2X55A 4DCBA 2X4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I78 A;  2X56 A;  2X55 A;  4DCB A;  2X4M A; 
#chains in the Genus database with same CATH topology
 2GTL O;  1LKE A;  2RA6 A;  4IAW A;  4BX7 B;  1LIF A;  3B2L A;  1OSP O;  2UZ2 A;  5F1E A;  4BX5 B;  1I04 A;  1LEL A;  1SRH A;  5F58 A;  4Z28 A;  4GGZ A;  4WFU A;  1VWO B;  3RE6 A;  1R0U A;  1STR B;  5CSE A;  1GT3 A;  1HMT A;  2Y32 A;  1B8E A;  4GU8 A;  4HPA A;  3WZO A;  5HBS A;  1LCZ A;  3EBK A;  1X8N A;  3D96 A;  5HZQ A;  1SXW A;  1CBI A;  2XST A;  3PEC A;  3FEP A;  3RDU A;  1UZ2 X;  2JGS A;  3HTY A;  3HWE A;  4CDC A;  3T1D A;  1AVE A;  1SXY A;  2Q9S A;  3OJY C;  1SRG A;  2A2G A;  2ANS A;  1E00 A;  4NV8 A;  4IMO A;  2MM3 A;  4IAB A;  3C78 X;  1RBP A;  2WEW A;  1GXA A;  4L3R A;  4TKB A;  1ZNE A;  2RTF B;  2R73 A;  1VYG A;  2OFB A;  3P6C A;  4GH7 A;  3S5V A;  4NYR A;  2QO5 A;  2OY8 A;  4FGI B;  1U0X A;  2LB6 A;  4GJS A;  4TKH A;  4MVE A;  4YVB A;  4MVI A;  1EXS A;  4GNY A;  4IBA A;  1PBY A;  4NV7 A;  5H9L A;  4ARH A;  4ORR A;  1FEL A;  3B2H A;  4ZHG A;  3EBW A;  3MBT A;  1TW4 A;  4MVL A;  1SWS A;  1T8V A;  1OPB A;  4R0B A;  2X8F A;  5HTE A;  3WJF A;  1DZJ A;  5HZ6 A;  5HZ5 A;  1VWF B;  2KT4 B;  4ZHC A;  2AT5 X;  2JU8 A;  3ZI8 A;  1SWG A;  2OY1 O;  1IKE A;  3AKM A;  2IZF B;  1SWQ A;  1EIO A;  1EII A;  5AQ6 A;  4XMH A;  1X71 A;  1UYO X;  1MM9 A;  1G74 A;  4LKT A;  5HCC C;  3E3C A;  3VU1 A;  4HPC A;  4XME A;  3C76 X;  1DZK A;  2X56 A;  3F9D A;  3CR6 A;  4QZU A;  2IZJ A;  4CSB A;  5FEN A;  4BCS A;  4DNE A;  4QGX A;  5LKE A;  2OF8 A;  4NLI A;  3IFB A;  1OEJ A;  1JIW I;  1VWA B;  1SWF A;  3S5X A;  1KGL A;  3WVM A;  1MEP A;  5H9K A;  1L6M A;  1YWA A;  2PY1 A;  2JMB A;  3NPO A;  2AH7 X;  1NGL A;  2C1Q A;  5IRW A;  3WJC A;  2F01 A;  1B0O A;  3GE2 A;  3WZN A;  4O4S A;  5EPQ A;  1OBP A;  4DCB A;  4ZFX A;  1QFV A;  4A8Z A;  4I3D A;  4I9R A;  1LFO A;  2IZA A;  3H3I A;  2X4M A;  1O1U A;  3FID A;  3Q6L A;  1A3Y A;  1HXL A;  2GTL N;  2RTM A;  4FBO A;  4Y0R A;  1SWN A;  1N9Y A;  2FWV A;  1RAV A;  2LKK A;  3FMZ A;  4GKC A;  1GX3 A;  4EEJ A;  1PBO A;  1FDQ A;  1VWR B;  4NNS A;  5IO6 A;  4U8U N;  1DFV A;  4N7D A;  5LJB A;  1JMX A;  1HMS A;  1SWE A;  2F09 A;  3BU9 A;  1PEE A;  3U0D A;  3CKG A;  2MF6 A;  5CHK A;  1VWP B;  1KT7 A;  1EPA A;  4BX7 A;  1ICM A;  2EU7 X;  3CKF A;  5H8T A;  3U9P C;  2AF5 A;  4BX5 A;  4Y59 A;  1VYO A;  3KVN A;  1LDQ A;  5D48 A;  3FR4 A;  4ORW A;  5D45 A;  3VG6 A;  4EKV A;  1MOY A;  4KT5 A;  1QY1 A;  2QCB A;  5L8O A;  3BY0 A;  3EMM A;  3UEX A;  2OVD A;  2ZAI A;  1OBQ A;  2LFO A;  3ELX A;  4LZU A;  3JS1 A;  1HQP A;  1RST B;  1KXO A;  1LF7 A;  3NBX X;  5EDC A;  3KFF A;  5AJC A;  2OL8 O;  2AT8 X;  2GTL M;  4GUZ A;  3WJG A;  1SMP I;  4KCA A;  4FBV A;  3K3L A;  1ICN A;  3FR2 A;  3P6G A;  2Q2P A;  4HPB A;  1KQW A;  1LCV A;  1QY0 A;  1NP1 A;  1X8O A;  2R56 A;  3JQO A;  2IZC B;  3SLT A;  4ES7 A;  3P6H A;  2RTK A;  2X32 A;  3BX8 A;  2OL7 A;  2W2F A;  3WXQ A;  4QQ1 A;  4GNW A;  2BT9 A;  2OFM X;  2N93 A;  4YGH A;  5DPQ A;  3FA7 A;  1KT4 A;  3VGW A;  5IXG A;  5FQ7 E;  2RTN B;  4GK9 A;  4ZGF A;  1QAB E;  1MVG A;  2BSZ A;  2Q39 A;  2AT3 X;  3SLO A;  4YDA A;  1GT5 A;  3LV4 A;  4NP1 A;  3O22 A;  3P6D A;  3APU A;  1QG5 A;  4GDA A;  4CPH A;  4Y0P A;  1SWL A;  2FRS A;  4ZH6 A;  2LBV A;  3OBL A;  1BWY A;  1IIU A;  3FA6 A;  1HY2 A;  3NAD A;  4GZV A;  2FKG A;  3VG5 A;  2WSJ A;  3WJD A;  1G7N A;  1RXK A;  1KT3 A;  5B10 O;  2ALL X;  5LJK A;  1KQX A;  1BSO A;  1Y9L A;  2BS6 A;  3FDC A;  1DF3 A;  4NW4 A;  3T2X A;  3HK1 A;  1EQD A;  1TOU A;  5K06 A;  4LKP A;  2CM9 A;  3BLG A;  2MWH A;  1P6P A;  3L4R A;  3RDM A;  4CPE A;  2CM4 A;  1FTP A;  1LIC A;  4A1H A;  2FS7 A;  2GTF X;  1HQQ A;  5F2B A;  4U46 A;  3NR3 A;  2OL6 O;  1JYJ A;  1NP4 A;  1E2T A;  1NDJ A;  2JU3 A;  2K23 A;  1SWP A;  5LJH A;  1QQS A;  2VFC A;  4INN A;  1CRB A;  5FQ8 E;  3ZW0 A;  1HBP A;  1X8P A;  1ZRY A;  4TKJ A;  1NBX A;  3FW4 A;  1SY3 A;  1JMZ A;  1GM6 A;  3KZA A;  5L8I A;  5IO7 A;  1E06 A;  3HWF A;  2HKD A;  4ON1 A;  2NP1 A;  1VWM B;  2XKL A;  1CBR A;  2AT6 X;  2RTH B;  5EZ2 A;  1K24 A;  3P02 A;  3ZW2 A;  3NQ3 A;  1XKI A;  2RTA A;  3HOE A;  4FQB B;  4YGG A;  3VPJ E;  4IAX A;  3RDX A;  2FLJ A;  4GJV A;  1QWD A;  5DG4 A;  3TZS A;  1NQN A;  1SWK A;  5F7G A;  2G8C O;  3VE1 A;  2HZR A;  2ZAG A;  4IB6 A;  5B2A O;  1G85 A;  3D95 A;  4WFV A;  4OMX A;  2A8G A;  1DZM A;  3QQ2 A;  2ZSC A;  1NQM A;  2RN4 A;  5HZ8 A;  4YBU A;  1RLB E;  1VWD B;  1IW2 A;  1ZNG A;  3VG7 A;  1N0S A;  3MM0 A;  3ZWE A;  2O62 A;  4ORY A;  3WZP A;  3PQU A;  3T6L A;  2OFA A;  2RTE B;  2OYB O;  1JZU A;  1GX8 A;  1DF8 A;  1OEK A;  1SY0 A;  2X8S A;  1ERX A;  1YWB A;  1BRQ A;  4YFP A;  4JO6 A;  1FEN A;  4BVM A;  4KH8 A;  5EDB A;  3WJE A;  4AZP A;  2ASN X;  3STM X;  4CDF A;  1N4J A;  1ZND A;  2RTO B;  3DSZ A;  3KQ0 A;  4L1N A;  1SLF B;  4GGT A;  4OS8 A;  5HCD C;  2LBA A;  4U3Q A;  5HAE A;  5LJC A;  1BBP A;  3D4R A;  3FEN A;  3ZW1 B;  3MX7 A;  2BS5 A;  3T6F A;  3MG5 A;  2WPU A;  3VHI A;  2HMB A;  4CV7 A;  1ERB A;  2IZG B;  4CPF A;  1SWR A;  3WOV A;  4YCH A;  1Y53 X;  3APW A;  2YG2 A;  2HZQ A;  3CQN A;  4M6S A;  4U9C A;  4WBK A;  3VG3 A;  1SRI A;  1AVG I;  1IFC A;  1SWJ A;  5HZ9 A;  5KHP A;  3TGB A;  4O49 A;  1O1V A;  1JJJ A;  4KC7 A;  4JGL A;  4QRL A;  2KTD A;  2CBR A;  2ACO A;  2FR2 A;  2RCQ A;  3RDO A;  4ALO A;  2IZE B;  1STS B;  3F8A A;  4B55 A;  3KFG A;  5FFH A;  2RTR B;  1WUB A;  3P24 A;  4ZHH A;  2R74 A;  3RY2 A;  4CPI A;  4I60 A;  2OY5 O;  1MUP A;  2A5B A;  2RTL A;  4ZHD A;  3RDQ A;  2FHN X;  5K67 A;  1VWL B;  3B2K A;  4YMY A;  4O3W A;  2FKJ A;  4ID2 A;  1GT1 A;  1E5P A;  4JHQ A;  1VWJ B;  2IZH B;  4Y5D A;  2I5Z O;  3S60 A;  4CDE A;  3EYC A;  4D6B A;  5BVT A;  2RD7 C;  1A57 A;  1RXJ A;  2WWP A;  3C77 X;  4BX6 B;  4OS0 A;  1LNM A;  4Z6J A;  2UYW A;  4RUU A;  2A3F X;  2KD2 A;  2A5C A;  2YMS A;  2X8T A;  3VG4 A;  1HBQ A;  4ORS A;  1LID A;  1X8U A;  1JV4 A;  4I6S A;  3ZUO A;  1CBQ A;  2ACP X;  2KW1 A;  3AUM O;  4GD9 A;  1BM5 A;  4BQU A;  5BVQ A;  2OVA A;  2Z4I A;  4IMN A;  4Z2P A;  3D9W A;  3RKG A;  2Q4N A;  4YKM A;  1TXL A;  3RSW A;  3O2Y A;  1HXZ A;  2JOZ A;  1GX9 A;  4ML7 B;  5LJG A;  1SWH A;  3KFI A;  1GGL A;  2E4J A;  1SA8 A;  3SZH A;  3NQ9 A;  5B5F A;  4DQ3 A;  1QY2 A;  4I9S A;  2GC9 A;  4ORU A;  1N43 A;  3VHH A;  2RTP B;  2WQA E;  3PH5 A;  1ZNH A;  3B2I A;  3B2J A;  2BHV A;  1CBS A;  4EQA C;  4GE1 A;  5IRU A;  1NC9 A;  1AEL A;  2JU7 A;  3SZJ A;  4TQ2 A;  2VFB A;  2X55 A;  2IZD B;  1SRE A;  1RSU B;  3BDR A;  5KID A;  2C1S A;  1LPJ A;  5B5G A;  2K62 A;  3RE5 A;  1UYN X;  5K68 A;  1GT4 A;  3APX A;  1EPB A;  3PPT A;  3VG2 A;  3BRN A;  1JBH A;  1KL4 A;  4NNT A;  2MJI A;  1DC9 A;  1SWB A;  2A13 A;  5CE4 A;  1I4U A;  2L9C A;  2PI3 O;  2W2B A;  4BBO A;  1LIE A;  1S2P A;  3TGC A;  2QOM A;  4GDZ A;  4I3B A;  1SWC A;  2RTC B;  1N7Y A;  1KL3 A;  3GAQ A;  3HPE A;  3O19 A;  1EAL A;  2QO4 A;  1WBI A;  1K3B A;  2Y3E A;  3T2W A;  4ZH9 A;  4Z2O A;  1I9H A;  1SXX A;  1Y9T A;  1BSQ A;  2AT0 X;  2DJG A;  2MO5 A;  3IA8 A;  3PDF A;  4IRW A;  2QO6 A;  4O4O A;  4TNN A;  1EW3 A;  3STN A;  3UAQ A;  3WYQ A;  3CBC A;  4OMW A;  2X45 A;  4HPD A;  4QYP A;  2HYS A;  5AJB A;  3U03 A;  4EFG A;  1BRP A;  1IFB A;  4UU2 A;  3V8U A;  2WR6 A;  4Y0Q A;  4XMC A;  1YWC A;  2CBS A;  4QAE A;  1VWH B;  2RTD B;  2POA A;  3VE2 A;  1LIB A;  4YGZ A;  3SAO A;  1LDO A;  1OEE A;  1E02 A;  4KII A;  4O4X A;  4RUN A;  3F6Z B;  4AYH A;  4O3Z A;  1LUQ A;  3SZI A;  4BJ8 A;  3VHM A;  3AEH A;  1VWG B;  2AMM X;  4O3X B;  1BLR A;  4O9S A;  2BLG A;  1BSY A;  2IZB A;  1JJU A;  3Q34 A;  3UEU A;  4IB8 A;  4U8U O;  2C4I A;  4Y0S A;  2VDF A;  3ZQ3 A;  1VWC B;  4GRJ A;  3PED A;  1DZP A;  1X89 A;  2QMI A;  4MIR A;  1I06 A;  3S26 A;  2DJF A;  3NX1 A;  4AZR A;  1GKA B;  3BX7 A;  5L3Y A;  1SY2 A;  4BX6 A;  5HTD A;  2BC3 A;  2CZT A;  5D4A A;  3APV A;  1EUO A;  1IJ8 A;  3WJB A;  3WZQ A;  4AZO A;  1VPR A;  2DM5 A;  2G5L A;  2RTG B;  3TGA A;  2L5P A;  1JYD A;  3X00 A;  1Y0G A;  1PTS A;  2OFR X;  4XMD A;  4YKO A;  5H9N A;  5FQ6 E;  4GET A;  4WHI A;  3HWD A;  5JD2 A;  3SLJ A;  4QGW A;  2L67 A;  1PM1 X;  2OVS A;  1YWD A;  2WQ9 A;  2RTJ A;  2P8G A;  1JJX A;  3PP6 A;  4TLJ A;  3SOT A;  1T0V A;  1SLE B;  1SWD A;  1VWN B;  3WBG A;  2HLV A;  4AZM A;  4QYN A;  1ALB A;  4ODD A;  1VWK B;  1D3S A;  1ZNK A;  2CZU A;  1S44 A;  3RDS A;  3I17 A;  5B3M O;  4A1Y A;  1QFT A;  4OEL A;  1JQP A;  1ACD A;  3BSZ E;  3RZY A;  1ADL A;  2G7B A;  1N9M A;  4YFR A;  4HWM A;  1SLG B;  3EW2 A;  5LKF A;  2RTB B;  2OY7 A;  4CPH B;  4YBP A;  2CAM A;  5IO5 A;  1URE A;  3FLL A;  3LTW A;  4ZR2 A;  5B11 O;  5AEO A;  2IFB A;  3AKN A;  1YP6 A;  1OBU A;  5B29 A;  2JN3 A;  1SWU A;  3N91 A;  5F6Z A;  4D6A A;  5EEE A;  1Y55 X;  5HA1 A;  3FEK A;  3NP1 A;  3P6E A;  1BJ7 A;  1FEM A;  3LHN A;  3QKG A;  4MVK A;  1ML7 A;  2HNX A;  2Q2M A;  2FR3 A;  2OZQ A;  4QNI A;  5F6B A;  3EW1 A;  5BVS A;  2JW1 A;  1VWE B;  4OS3 A;  3UEV A;  3UEW A;  3STK A;  5H9A A;  4Z2V A;  2LA7 A;  1G5W A;  4LQZ A;  1W5R A;  4ALB A;  4AW8 A;  1IKJ A;  2WUT A;  1MX8 A;  1EI5 A;  1KL5 A;  4EXZ A;  3EC5 A;  1BEB A;  1I78 A;  1KT6 A;  1VWB B;  1YUP A;  1MDC A;  2M4L A;  3PH6 A;  5EED A;  4A60 A;  2RTQ B;  2W2A A;  3FEL A;  1U18 A;  4YDB A;  2QM9 A;  4BGF A;  3DTQ A;  5L8N A;  2X46 A;  1CJ5 A;  2X34 A;  3NQK A;  4MEE A;  3FW5 A;  4LZV A;  2RCT A;  1PMP A;  2Y3F A;  3HOL A;  3PK2 A;  4KC8 A;  3ZW0 B;  1AB0 A;  4Z27 A;  4OEM A;  4ZHF A;  1B56 A;  4AZN A;  4EDE A;  1SLD B;  1Y52 X;  2IZL B;  4IB9 A;  4YH0 A;  4ZJ0 A;  5LJE A;  2KTS A;  3PQS A;  1MK5 A;  2WEX A;  1A2D A;  2FGS A;  1FJ1 E;  3FYF A;  4GGR A;  4K19 A;  3MVF A;  5BYP A;  2A0A A;  5JR8 A;  5FAZ A;  3ZUI A;  4N7C A;  5C0N A;  1O8V A;  2NND A;  2L68 A;  2GJ5 A;  3RWX A;  4FBR A;  2G78 A;  2NNE A;  4ZGU A;  1KZW A;  5HWZ A;  2NNQ A;  1VYF A;  3KFH A;  1HMR A;  1GKA A;  1SY1 A;  1SRF A;  1KFF A;  2FT9 A;  1I05 A;  2FS6 A;  3WYP A;  3CQR A;  4OKA A;  3NX2 A;  4ORX A;  2FTB A;  2OVE A;  3OE3 A;  4I3C A;  3RBY A;  1T68 X;  1XCA A;  3BS2 A;  4PSQ A;  2FHL A;  3EM0 A;  2RQ0 A;  3BU1 A;  3G7X A;  4IB7 A;  3CBS A;  4NLJ A;  4YCE A;  5IRA A;  4CDD A;  4C5P A;  2MHD A;  4U8U M;  1X8Q A;  2QOS C;  1A18 A;  2Z4H A;  1VWI B;  3JSQ A;  4COT A;  4HFO A;  2AKQ A;  4QGV A;  1VWQ B;  3HWG A;  2AVI A;  4MIS A;  4TJZ A;  1HN2 A;  3FIQ A;  1RXH A;  3P6F A;  5B27 A;  1H91 A;  1SRJ A;  1TVQ A;  1KOI A;  1OPA A;  5LJD A;  4AZQ A;  3FA8 A;  5CYB A;  3OD9 A;  2AL0 X;  5D8J A;  1SXU A;  3ZW1 A;  4PJ2 A;  3RY1 A;  1DV9 A;  3I0A A;  2G79 A;  4XMG A;  1SWT A;  2I5V O;  3TF6 A;  1D2U A;  2IZI A;  4I95 A;  4UU3 A;  4NYQ A;  4M7M A;  3ZZV A;  3CWK A;  4BOE A;  1AVD A;  1U17 A;  1LCW A;  1SWA A;  2RTI B;  1Z24 A;  3FR5 A;  4XMF A;  4CK4 A;  2GH7 A;  1STP A;  1TOW A;  1ZNL A;  4QZT A;  1SWO A;  1YP7 A;  4O4U A;  5HCE C;  1KT5 A;  1FE3 A;  3D97 A;  5KIC A;  1B4M A;  3CMP A;  1KZX A;  2F73 A;  1W6F A;  4DQ4 A;  4YFQ A;  4ZCB A;  2IZK A;  1AQB A;  1MX7 A;  3ELZ A;  1YIV A;  2A2U A;  4O3Y A;  5HA0 A;  4JNJ A;  5D47 A;  3FA9 A;  1W4T A;  1S7D A;  2OF9 A; 
#chains in the Genus database with same CATH homology
 1I78 A;  2X56 A;  2X55 A;  4DCB A;  2X4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...