2X55A

Yersinia pestis plasminogen activator pla (native)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
290
structure length
274
Chain Sequence
b'QLIPNISPDSFTVAASTGMLSGKSHEMLYDAETGRKISQLDWKIKNVAILKGDISWDPYSFLTLNARGWTSLASGSGNMDDYDWMNENQSEWTDHSSHPATNVNHANEYDLNVKGWLLQDENYKAGITAGYQETRFSWTATGGSYSYNNGAYTGNFPKGVRVIGYNQRFSMPYIGLAGQYRINDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAKVFAEFTYSKYDESIGGDAAGISNKNYTVTAGLQYRFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAGULASE/FIBRINOLYSIN
publication title An Active Site Water Network in the Plasminogen Activator Pla from Yersinia Pestis
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Hydrolase
total genus 80
structure length 274
sequence length 290
ec nomenclature ec 3.4.23.48: Plasminogen activator Pla.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01278 Omptin Omptin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.90 Mainly Beta Beta Barrel Lipocalin OMPT-like 2x55A00
2X55A 1I78A 4DCBA 2X4MA 2X56A
chains in the Genus database with same CATH superfamily
1JMZA 1TVQA 3FA6A 1OPBA 3S5XA 4AW8A 4COTA 3WJBA 4IABA 4ORYA 4IMOA 3KQ0A 5F6ZA 2L5PA 2CBSA 2X8FA 4IB8A 1SLEB 4TKBA 1VWOB 2IZDB 1LIDA 4YFRA 1HQQA 4GZVA 4GE1A 4Y0PA 3WJEA 1Y9TA 1LKEA 3HWFA 3T1DA 1NC9A 1S2PA 2C1QA 1ERBA 1SY1A 4CK4A 5F6BA 3TGAA 4A1HA 4AZMA 1HY2A 2VFBA 1EXSA 3ZW0A 1Z24A 3NADA 3ZUOA 2IZHB 1GT5A 3FELA 1DV9A 4AZNA 2X46A 3WJCA 1SWHA 2A2UA 1MM9A 1LPJA 1IKEA 1ZNDA 4OMWA 3S60A 3FA9A 3PDFA 5HCEC 1U17A 4Y0QA 4BBOA 2GTLN 3PECA 2JW1A 2G5LA 5L8NA 4O3WA 1AVGI 1SWPA 2L67A 4QGWA 4ZH6A 4CSBA 4DCBA 1DZKA 2OFRX 1FELA 3NPOA 4ODDA 2I5VO 2IZJA 2LKKA 3QKGA 4FBVA 1LIFA 1S44A 2BSZA 1AB0A 2W2BA 1AVEA 4ML7B 3RBYA 2GTFX 1BBPA 1X71A 2X45A 3LHNA 4TNNA 2RQ0A 2OFBA 4NV8A 5D4AA 4KCAA 1CJ5A 5C0NA 4UU2A 1ERXA 2DM5A 3CWKA 4NYRA 1VWNB 3WZPA 1ML7A 5BVQA 1SY0A 3WZOA 4N7DA 1I4UA 2WQ9A 4NLIA 4ZGFA 3O19A 3WJGA 3LV4A 1SWTA 3RSWA 2CM4A 1OEKA 1VYGA 2Q9SA 3VE1A 4NYQA 5H9KA 1HMRA 3FEPA 1ACDA 4OKAA 1ZRYA 4ARHA 1P6PA 1RAVA 1VWJB 1PTSA 1R0UA 3STKA 1BLRA 1FDQA 3VHIA 4BVMA 4GGRA 3ZQ3A 2HZQA 1RXJA 1MEPA 5IO5A 1O1VA 2ALLX 2OY8A 4IMNA 4I95A 4L1NA 1EALA 4C5PA 2QOSC 5EEDA 4HPDA 4QYNA 3SZIA 1ICMA 4OS3A 1NQNA 1LUQA 1QWDA 1X8NA 3ZZVA 2PY1A 3APVA 5LJBA 4O4XA 1SXUA 3FENA 3TF6A 4CPFA 1OBUA 1CBQA 2WR6A 4QAEA 4O3XB 1T68X 4QZTA 4U8UN 5LKEA 1BRQA 1X89A 4I9SA 4BX5B 3VPJE 2BT9A 3ZW1B 2LA7A 2GTLM 3CR6A 3WBGA 4A60A 1NBXA 4I6SA 4MVEA 3ZI8A 3EM0A 5KHPA 4YFPA 1RXHA 1BEBA 3GE2A 2M4LA 2IZAA 1VWRB 3D96A 1EIOA 3PQSA 1KOIA 2O62A 1GX3A 4CPIA 4GETA 3ZW1A 2MWHA 1SXYA 1UYNX 4GRJA 5F7GA 1OBQA 4QGVA 4I3DA 2X8SA 5B10O 5HCDC 1SWRA 2RTFB 1LCZA 1VWPB 1EI5A 1N9YA 3FA8A 1AQBA 3TZSA 1ZNKA 2RTNB 1KQWA 3P6EA 3H3IA 4Y59A 1LELA 3NX2A 4K19A 5LJEA 3UEWA 1NGLA 3MBTA 1ZNHA 5LKFA 2OY1O 3WXQA 1STSB 3CBSA 5JD2A 1STRB 1QFTA 2A5BA 3CKGA 2KW1A 5HWZA 4JNJA 4YDAA 1YWCA 4Y5DA 4WFUA 3JS1A 3I0AA 2YMSA 3WJFA 2JMBA 3B2HA 3DTQA 4NNSA 1E5PA 1YUPA 1VWHB 5HCCC 1LFOA 1VWQB 1SWEA 5FENA 1PBYA 2ANSA 1BM5A 2RTRB 3B2IA 4R0BA 1X8QA 4KH8A 2IZLB 4GJSA 4LQZA 1D3SA 4U46A 4BOEA 2AF5A 1JBHA 2CZTA 4LKPA 2OL8O 1B8EA 2FHNX 3ELZA 4QYPA 4U8UM 1LIEA 1DC9A 1U18A 1MK5A 2K23A 5IXGA 2VDFA 4ORSA 1EPBA 1I05A 1VWBB 4O4SA 2RTKA 3OD9A 3G7XA 3PH5A 4YCEA 2IZIA 1CBSA 3F6ZB 4L3RA 2IZFB 4ES7A 2K62A 4ORRA 1UYOX 1HN2A 2CZUA 2FT9A 5EPQA 4QZUA 2QOMA 1HXZA 4Z6JA 4I3CA 3ZW0B 1EUOA 1S7DA 1SWQA 1VWKB 4OS0A 4XMFA 1PEEA 5L8OA 4YDBA 2DJGA 1SRIA 2R73A 1SY2A 1VWDB 4CDDA 3VG5A 1VYOA 1SWJA 3HWEA 4IB9A 4TKJA 4U3QA 1H91A 3STMX 1RSUB 1PM1X 1ZNEA 3FW4A 2G8CO 5B5GA 2OFAA 2POAA 5K68A 3WJDA 4BQUA 2Y32A 3RE6A 4FBRA 1LCVA 2Y3FA 4GGTA 1FENA 1TXLA 2AL0X 3P02A 3T6LA 4NV7A 1DZMA 2FGSA 5L3YA 1O1UA 3SZHA 3TGBA 2HKDA 2FS6A 3VU1A 4Z28A 1RBPA 2Z4HA 2CBRA 3O22A 2QO6A 1E06A 4AZPA 3CQRA 4U9CA 4Z27A 4MVKA 1KT6A 1LCWA 5LJDA 4ZHDA 4ZHCA 3EW1A 5IRWA 2Q2MA 5F1EA 1GM6A 2RTQB 1VWCB 3VHHA 1KFFA 3C78X 1W4TA 2E4JA 1KT7A 2RTEB 2X8TA 3NX1A 4IB6A 2KTDA 4AZQA 3F9DA 1EPAA 1RLBE 4XMGA 1VWGB 3UAQA 2IZCB 4ZGUA 5AEOA 5HZ9A 1QG5A 5LJHA 4YBPA 2R74A 1OBPA 2KD2A 4PJ2A 3X00A 5B29A 5HZQA 2WUTA 1PBOA 2OVSA 2WWPA 4HPBA 2AMMX 3U9PC 2AT3X 1SRGA 5DG4A 1SWAA 1MDCA 1K24A 2ASNX 2F01A 4GJVA 2FRSA 4BGFA 4GGZA 3RDMA 1SREA 5EDBA 3P6FA 4IB7A 2FR3A 1X8UA 4EDEA 1N4JA 1QFVA 2RTGB 4NNTA 4Y0RA 3I17A 1QY0A 3QQ2A 4TQ2A 2FKGA 1VWAB 4TLJA 2A8GA 1AVDA 4HFOA 2LBVA 2EU7X 4MISA 1SWNA 4ALBA 3HOEA 5B11O 3EBKA 3FR2A 5AJBA 5IO6A 2GH7A 2HLVA 3KFIA 4WHIA 2XSTA 1EQDA 3SLTA 1SWFA 2FS7A 2JU7A 2WQAE 2Z4IA 2ZSCA 1L6MA 3F8AA 4ZH9A 3VG2A 3WYQA 5KICA 1Y0GA 1E2TA 2QM9A 1SWBA 1Y9LA 3APWA 4I60A 5DPQA 2RTPB 1KT5A 3U03A 4XMCA 2KTSA 1A18A 1HQPA 3HWDA 4DQ3A 2L9CA 2OY5O 2OY7A 1SWCA 4Z2PA 2ACOA 1FTPA 2IZEB 3CQNA 3NBXX 1MX8A 3JSQA 4GUZA 3RDQA 3C76X 2FKJA 3D4RA 1SY3A 3U0DA 4ORWA 3HTYA 2BC3A 4TJZA 2L68A 2RCTA 1N9MA 4GK9A 5FAZA 1Y55X 2NNEA 2RTHB 3VG4A 4ZHHA 4KC8A 1ADLA 4YKOA 1GXAA 3RDSA 5IRUA 2G78A 3Q34A 5HTDA 4YH0A 2MM3A 1A3YA 4EXZA 4TKHA 1QY1A 2QCBA 3RDXA 3BSZE 1IFBA 3ELXA 3N91A 1GX9A 4NLJA 1CRBA 3P24A 4OEMA 5L8IA 5AJCA 5K67A 1JJXA 4HPAA 5KIDA 5D8JA 3FR5A 2OVAA 2Q39A 3BS2A 4HPCA 3BDRA 1SRFA 2GTLO 2MF6A 2FTBA 4BJ8A 4CDCA 5HZ5A 3S5VA 1NQMA 4DQ4A 3KFGA 1SXWA 3BU1A 4CPHA 1JIWI 2JU8A 2X34A 5D47A 3HPEA 1WBIA 1U0XA 1SA8A 3FLLA 4O9SA 2NNDA 1Y52X 1KGLA 2OYBO 3FEKA 4RUUA 4IAXA 1SLDB 3OJYC 3KZAA 4ORUA 4OMXA 4YFQA 4ALOA 5CHKA 1HXLA 3FW5A 4MVIA 4EFGA 1ZNGA 2ACPX 3PQUA 3BX7A 3Q6LA 1T8VA 2LBAA 1T0VA 2IZKA 1YP6A 2OZQA 2F73A 3VG6A 2HZRA 1N43A 1JQPA 1YP7A 1SLFB 3NP1A 4BX7B 3SLJA 2MO5A 3WYPA 1N7YA 1DZPA 3LTWA 4YBUA 3CMPA 2OVEA 2OFMX 2ZAGA 4JGLA 3CKFA 4JO6A 4KT5A 5HBSA 4BX6A 4YCHA 2CAMA 1DF3A 1VPRA 2X4MA 2A13A 1ALBA 1KT3A 1VWFB 5LJGA 4LZVA 4M6SA 4D6BA 2C4IA 3RE5A 3UEVA 4BX7A 1QQSA 5HA0A 4CPEA 1MUPA 1KT4A 1AELA 4ZHGA 3BY0A 3ZUIA 1B4MA 1BSYA 1JZUA 1I9HA 3EC5A 3P6DA 2A5CA 4I3BA 1LICA 2KT4B 1IKJA 5FFHA 4U8UO 1BSOA 4FBOA 1CBRA 2WEXA 3SZJA 4EKVA 2WEWA 4Y0SA 2IZGB 3T2XA 2FHLA 2X55A 2Y3EA 3FYFA 2AVIA 5F58A 1OPAA 3D97A 4IAWA 3WZQA 5FQ6E 5HAEA 1VWMB 3NQKA 4UU3A 4A1YA 2LB6A 2WSJA 1EW3A 1RSTB 4NW4A 4NP1A 2RN4A 1IIUA 2BHVA 4CV7A 3MG5A 4QNIA 4XMDA 1SRJA 4A8ZA 1SWGA 2FLJA 1JV4A 1YWAA 2F09A 2OF9A 1N0SA 4XMHA 1UZ2X 4O3YA 2IFBA 5CYBA 4Z2VA 3DSZA 3NQ3A 2FR2A 2MJIA 3BRNA 1G74A 1I06A 3KFFA 4GDZA 3VGWA 3T6FA 3EW2A 1IFCA 4Z2OA 1JJJA 5HTEA 1SWLA 3VG7A 1JYJA 2QMIA 2GC9A 5D48A 1BSQA 1SXXA 3AKNA 1O8VA 1SLGB 4MIRA 5H8TA 2BS5A 5B5FA 1GT4A 1RXKA 2I5ZO 3T2WA 1X8PA 1B56A 1PMPA 1W5RA 2VFCA 4HWMA 4ZFXA 1OEEA 2X56A 4CDFA 3OE3A 3IFBA 4GU8A 5H9AA 2RTDB 3STNA 5FQ8E 1GX8A 4ORXA 4M7MA 2FWVA 3MX7A 4B55A 1ZNLA 3UEUA 1HMTA 1LNMA 2OL6O 3KVNA 1E02A 2AT0X 3JQOA 1I04A 3ZWEA 3VG3A 5IO7A 3D9WA 1D2UA 1NP1A 1UREA 1MOYA 2RTMA 3WVMA 4AZRA 4ZJ0A 5BVTA 3PP6A 3RZYA 4JHQA 2A0AA 1YWDA 1KL4A 3GAQA 4YKMA 5HA1A 4O4OA 3AEHA 1ICNA 3HK1A 2OVDA 4GNYA 3P6GA 4EQAC 3AUMO 4GDAA 5B2AO 4QGXA 1LIBA 5K06A 5H9NA 2UYWA 1DZJA 3EBWA 4GH7A 4ID2A 3MM0A 1SWSA 3KFHA 1GT3A 1XKIA 1SMPI 2NNQA 1GT1A 1OEJA 2CM9A 3C77X 1A57A 3NR3A 3RY2A 2LFOA 3K3LA 3PPTA 4GD9A 4LKTA 4YGGA 1JYDA 1X8OA 3D95A 3VE2A 2RTCB 1SWOA 3WOVA 5LJKA 3SOTA 4FQBB 1TOUA 3S26A 2RTAA 3FA7A 2G7BA 1VWEB 3FR4A 3PK2A 5B3MO 5B27A 1HBPA 5EDCA 4ZR2A 3OBLA 1FJ1E 1HBQA 5AQ6A 5BVSA 4IBAA 2Q4NA 1I78A 2RTJA 4OS8A 1EIIA 1YWBA 3AKMA 4MVLA 1DF8A 1VWIB 3RDOA 4YVBA 5JR8A 4WBKA 2QO4A 1A2DA 1K3BA 1IJ8A 2A3FX 2X32A 4CPHB 2AT6X 4O3ZA 4AZOA 3IA8A 1KQXA 2A2GA 2XKLA 3UEXA 3ZW2A 2OL7A 1IW2A 1MX7A 2DJFA 2AT8X 2W2FA 1FE3A 2YG2A 3V8UA 4GNWA 4QRLA 5LJCA 4RUNA 3RWXA 2RTLA 2GJ5A 1BJ7A 2P8GA 1QY2A 1TW4A 2N93A 4EEJA 4YMYA 2PI3O 1B0OA 4LZUA 4ZCBA 1NP4A 1KXOA 2G79A 4O4UA 5HZ6A 1BRPA 1G5WA 4AYHA 1OSPO 3SAOA 1E00A 2W2AA 3O2YA 5F2BA 5EZ2A 4FGIB 3NQ9A 4BX5A 2C1SA 2AH7X 4KC7A 2RCQA 3BLGA 2HNXA 2AT5X 4QQ1A 1BWYA 1SRHA 3RY1A 4D6AA 4BX6B 2HMBA 1DFVA 2RD7C 2JGSA 4INNA 1KL3A 1GKAB 4DNEA 3TGCA 3B2JA 2JU3A 4YGZA 4KIIA 4BCSA 3BX8A 2RTOB 1G85A 3E3CA 4WFVA 3APUA 4I9RA 5D45A 1VWLB 2MHDA 1JJUA 4O49A 3PH6A 3WZNA 1YIVA 3B2LA 3FIQA 4MEEA 4ON1A 2BLGA 2QO5A 3EMMA 1VYFA 1GKAA 1MVGA 2Q2PA 3HOLA 1G7NA 1QABE 4XMEA 1KZXA 4N7CA 3PEDA 1LF7A 2R56A 3EYCA 4PSQA 1CBIA 2HYSA 3L4RA 1LDOA 2ZAIA 3B2KA 1W6FA 4YGHA 1JMXA 3MVFA 2BS6A 3P6CA 5EEEA 3VHMA 5CE4A 2IZBA 2NP1A 2RTBB 4IRWA 3CBCA 5HZ8A 1WUBA 4ZHFA 5IRAA 1Y53X 2JN3A 1SWKA 1SWDA 5FQ7E 3SLOA 5H9LA 2OF8A 3HWGA 3BU9A 4CDEA 3RDUA 1GGLA 2AKQA 1TOWA 1LDQA 1KZWA 5CSEA 3APXA 3FIDA 1XCAA 2JOZA 2UZ2A 1KL5A 2RA6A 3RKGA 4GKCA 1FEMA 5BYPA 1HMSA 1NDJA 2RTIB 2WPUA 4OELA 3P6HA 3FDCA 1STPA 1SWUA 3FMZA
chains in the Genus database with same CATH topology
2X55A 1I78A 4DCBA 2X4MA 2X56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X55 A;  1I78 A;  4DCB A;  2X4M A;  2X56 A; 
#chains in the Genus database with same CATH topology
 1JMZ A;  1TVQ A;  3FA6 A;  1OPB A;  3S5X A;  4AW8 A;  4COT A;  3WJB A;  4IAB A;  4ORY A;  4IMO A;  3KQ0 A;  5F6Z A;  2L5P A;  2CBS A;  2X8F A;  4IB8 A;  1SLE B;  4TKB A;  1VWO B;  2IZD B;  1LID A;  4YFR A;  1HQQ A;  4GZV A;  4GE1 A;  4Y0P A;  3WJE A;  1Y9T A;  1LKE A;  3HWF A;  3T1D A;  1NC9 A;  1S2P A;  2C1Q A;  1ERB A;  1SY1 A;  4CK4 A;  5F6B A;  3TGA A;  4A1H A;  4AZM A;  1HY2 A;  2VFB A;  1EXS A;  3ZW0 A;  1Z24 A;  3NAD A;  3ZUO A;  2IZH B;  1GT5 A;  3FEL A;  1DV9 A;  4AZN A;  2X46 A;  3WJC A;  1SWH A;  2A2U A;  1MM9 A;  1LPJ A;  1IKE A;  1ZND A;  4OMW A;  3S60 A;  3FA9 A;  3PDF A;  5HCE C;  1U17 A;  4Y0Q A;  4BBO A;  2GTL N;  3PEC A;  2JW1 A;  2G5L A;  5L8N A;  4O3W A;  1AVG I;  1SWP A;  2L67 A;  4QGW A;  4ZH6 A;  4CSB A;  4DCB A;  1DZK A;  2OFR X;  1FEL A;  3NPO A;  4ODD A;  2I5V O;  2IZJ A;  2LKK A;  3QKG A;  4FBV A;  1LIF A;  1S44 A;  2BSZ A;  1AB0 A;  2W2B A;  1AVE A;  4ML7 B;  3RBY A;  2GTF X;  1BBP A;  1X71 A;  2X45 A;  3LHN A;  4TNN A;  2RQ0 A;  2OFB A;  4NV8 A;  5D4A A;  4KCA A;  1CJ5 A;  5C0N A;  4UU2 A;  1ERX A;  2DM5 A;  3CWK A;  4NYR A;  1VWN B;  3WZP A;  1ML7 A;  5BVQ A;  1SY0 A;  3WZO A;  4N7D A;  1I4U A;  2WQ9 A;  4NLI A;  4ZGF A;  3O19 A;  3WJG A;  3LV4 A;  1SWT A;  3RSW A;  2CM4 A;  1OEK A;  1VYG A;  2Q9S A;  3VE1 A;  4NYQ A;  5H9K A;  1HMR A;  3FEP A;  1ACD A;  4OKA A;  1ZRY A;  4ARH A;  1P6P A;  1RAV A;  1VWJ B;  1PTS A;  1R0U A;  3STK A;  1BLR A;  1FDQ A;  3VHI A;  4BVM A;  4GGR A;  3ZQ3 A;  2HZQ A;  1RXJ A;  1MEP A;  5IO5 A;  1O1V A;  2ALL X;  2OY8 A;  4IMN A;  4I95 A;  4L1N A;  1EAL A;  4C5P A;  2QOS C;  5EED A;  4HPD A;  4QYN A;  3SZI A;  1ICM A;  4OS3 A;  1NQN A;  1LUQ A;  1QWD A;  1X8N A;  3ZZV A;  2PY1 A;  3APV A;  5LJB A;  4O4X A;  1SXU A;  3FEN A;  3TF6 A;  4CPF A;  1OBU A;  1CBQ A;  2WR6 A;  4QAE A;  4O3X B;  1T68 X;  4QZT A;  4U8U N;  5LKE A;  1BRQ A;  1X89 A;  4I9S A;  4BX5 B;  3VPJ E;  2BT9 A;  3ZW1 B;  2LA7 A;  2GTL M;  3CR6 A;  3WBG A;  4A60 A;  1NBX A;  4I6S A;  4MVE A;  3ZI8 A;  3EM0 A;  5KHP A;  4YFP A;  1RXH A;  1BEB A;  3GE2 A;  2M4L A;  2IZA A;  1VWR B;  3D96 A;  1EIO A;  3PQS A;  1KOI A;  2O62 A;  1GX3 A;  4CPI A;  4GET A;  3ZW1 A;  2MWH A;  1SXY A;  1UYN X;  4GRJ A;  5F7G A;  1OBQ A;  4QGV A;  4I3D A;  2X8S A;  5B10 O;  5HCD C;  1SWR A;  2RTF B;  1LCZ A;  1VWP B;  1EI5 A;  1N9Y A;  3FA8 A;  1AQB A;  3TZS A;  1ZNK A;  2RTN B;  1KQW A;  3P6E A;  3H3I A;  4Y59 A;  1LEL A;  3NX2 A;  4K19 A;  5LJE A;  3UEW A;  1NGL A;  3MBT A;  1ZNH A;  5LKF A;  2OY1 O;  3WXQ A;  1STS B;  3CBS A;  5JD2 A;  1STR B;  1QFT A;  2A5B A;  3CKG A;  2KW1 A;  5HWZ A;  4JNJ A;  4YDA A;  1YWC A;  4Y5D A;  4WFU A;  3JS1 A;  3I0A A;  2YMS A;  3WJF A;  2JMB A;  3B2H A;  3DTQ A;  4NNS A;  1E5P A;  1YUP A;  1VWH B;  5HCC C;  1LFO A;  1VWQ B;  1SWE A;  5FEN A;  1PBY A;  2ANS A;  1BM5 A;  2RTR B;  3B2I A;  4R0B A;  1X8Q A;  4KH8 A;  2IZL B;  4GJS A;  4LQZ A;  1D3S A;  4U46 A;  4BOE A;  2AF5 A;  1JBH A;  2CZT A;  4LKP A;  2OL8 O;  1B8E A;  2FHN X;  3ELZ A;  4QYP A;  4U8U M;  1LIE A;  1DC9 A;  1U18 A;  1MK5 A;  2K23 A;  5IXG A;  2VDF A;  4ORS A;  1EPB A;  1I05 A;  1VWB B;  4O4S A;  2RTK A;  3OD9 A;  3G7X A;  3PH5 A;  4YCE A;  2IZI A;  1CBS A;  3F6Z B;  4L3R A;  2IZF B;  4ES7 A;  2K62 A;  4ORR A;  1UYO X;  1HN2 A;  2CZU A;  2FT9 A;  5EPQ A;  4QZU A;  2QOM A;  1HXZ A;  4Z6J A;  4I3C A;  3ZW0 B;  1EUO A;  1S7D A;  1SWQ A;  1VWK B;  4OS0 A;  4XMF A;  1PEE A;  5L8O A;  4YDB A;  2DJG A;  1SRI A;  2R73 A;  1SY2 A;  1VWD B;  4CDD A;  3VG5 A;  1VYO A;  1SWJ A;  3HWE A;  4IB9 A;  4TKJ A;  4U3Q A;  1H91 A;  3STM X;  1RSU B;  1PM1 X;  1ZNE A;  3FW4 A;  2G8C O;  5B5G A;  2OFA A;  2POA A;  5K68 A;  3WJD A;  4BQU A;  2Y32 A;  3RE6 A;  4FBR A;  1LCV A;  2Y3F A;  4GGT A;  1FEN A;  1TXL A;  2AL0 X;  3P02 A;  3T6L A;  4NV7 A;  1DZM A;  2FGS A;  5L3Y A;  1O1U A;  3SZH A;  3TGB A;  2HKD A;  2FS6 A;  3VU1 A;  4Z28 A;  1RBP A;  2Z4H A;  2CBR A;  3O22 A;  2QO6 A;  1E06 A;  4AZP A;  3CQR A;  4U9C A;  4Z27 A;  4MVK A;  1KT6 A;  1LCW A;  5LJD A;  4ZHD A;  4ZHC A;  3EW1 A;  5IRW A;  2Q2M A;  5F1E A;  1GM6 A;  2RTQ B;  1VWC B;  3VHH A;  1KFF A;  3C78 X;  1W4T A;  2E4J A;  1KT7 A;  2RTE B;  2X8T A;  3NX1 A;  4IB6 A;  2KTD A;  4AZQ A;  3F9D A;  1EPA A;  1RLB E;  4XMG A;  1VWG B;  3UAQ A;  2IZC B;  4ZGU A;  5AEO A;  5HZ9 A;  1QG5 A;  5LJH A;  4YBP A;  2R74 A;  1OBP A;  2KD2 A;  4PJ2 A;  3X00 A;  5B29 A;  5HZQ A;  2WUT A;  1PBO A;  2OVS A;  2WWP A;  4HPB A;  2AMM X;  3U9P C;  2AT3 X;  1SRG A;  5DG4 A;  1SWA A;  1MDC A;  1K24 A;  2ASN X;  2F01 A;  4GJV A;  2FRS A;  4BGF A;  4GGZ A;  3RDM A;  1SRE A;  5EDB A;  3P6F A;  4IB7 A;  2FR3 A;  1X8U A;  4EDE A;  1N4J A;  1QFV A;  2RTG B;  4NNT A;  4Y0R A;  3I17 A;  1QY0 A;  3QQ2 A;  4TQ2 A;  2FKG A;  1VWA B;  4TLJ A;  2A8G A;  1AVD A;  4HFO A;  2LBV A;  2EU7 X;  4MIS A;  1SWN A;  4ALB A;  3HOE A;  5B11 O;  3EBK A;  3FR2 A;  5AJB A;  5IO6 A;  2GH7 A;  2HLV A;  3KFI A;  4WHI A;  2XST A;  1EQD A;  3SLT A;  1SWF A;  2FS7 A;  2JU7 A;  2WQA E;  2Z4I A;  2ZSC A;  1L6M A;  3F8A A;  4ZH9 A;  3VG2 A;  3WYQ A;  5KIC A;  1Y0G A;  1E2T A;  2QM9 A;  1SWB A;  1Y9L A;  3APW A;  4I60 A;  5DPQ A;  2RTP B;  1KT5 A;  3U03 A;  4XMC A;  2KTS A;  1A18 A;  1HQP A;  3HWD A;  4DQ3 A;  2L9C A;  2OY5 O;  2OY7 A;  1SWC A;  4Z2P A;  2ACO A;  1FTP A;  2IZE B;  3CQN A;  3NBX X;  1MX8 A;  3JSQ A;  4GUZ A;  3RDQ A;  3C76 X;  2FKJ A;  3D4R A;  1SY3 A;  3U0D A;  4ORW A;  3HTY A;  2BC3 A;  4TJZ A;  2L68 A;  2RCT A;  1N9M A;  4GK9 A;  5FAZ A;  1Y55 X;  2NNE A;  2RTH B;  3VG4 A;  4ZHH A;  4KC8 A;  1ADL A;  4YKO A;  1GXA A;  3RDS A;  5IRU A;  2G78 A;  3Q34 A;  5HTD A;  4YH0 A;  2MM3 A;  1A3Y A;  4EXZ A;  4TKH A;  1QY1 A;  2QCB A;  3RDX A;  3BSZ E;  1IFB A;  3ELX A;  3N91 A;  1GX9 A;  4NLJ A;  1CRB A;  3P24 A;  4OEM A;  5L8I A;  5AJC A;  5K67 A;  1JJX A;  4HPA A;  5KID A;  5D8J A;  3FR5 A;  2OVA A;  2Q39 A;  3BS2 A;  4HPC A;  3BDR A;  1SRF A;  2GTL O;  2MF6 A;  2FTB A;  4BJ8 A;  4CDC A;  5HZ5 A;  3S5V A;  1NQM A;  4DQ4 A;  3KFG A;  1SXW A;  3BU1 A;  4CPH A;  1JIW I;  2JU8 A;  2X34 A;  5D47 A;  3HPE A;  1WBI A;  1U0X A;  1SA8 A;  3FLL A;  4O9S A;  2NND A;  1Y52 X;  1KGL A;  2OYB O;  3FEK A;  4RUU A;  4IAX A;  1SLD B;  3OJY C;  3KZA A;  4ORU A;  4OMX A;  4YFQ A;  4ALO A;  5CHK A;  1HXL A;  3FW5 A;  4MVI A;  4EFG A;  1ZNG A;  2ACP X;  3PQU A;  3BX7 A;  3Q6L A;  1T8V A;  2LBA A;  1T0V A;  2IZK A;  1YP6 A;  2OZQ A;  2F73 A;  3VG6 A;  2HZR A;  1N43 A;  1JQP A;  1YP7 A;  1SLF B;  3NP1 A;  4BX7 B;  3SLJ A;  2MO5 A;  3WYP A;  1N7Y A;  1DZP A;  3LTW A;  4YBU A;  3CMP A;  2OVE A;  2OFM X;  2ZAG A;  4JGL A;  3CKF A;  4JO6 A;  4KT5 A;  5HBS A;  4BX6 A;  4YCH A;  2CAM A;  1DF3 A;  1VPR A;  2X4M A;  2A13 A;  1ALB A;  1KT3 A;  1VWF B;  5LJG A;  4LZV A;  4M6S A;  4D6B A;  2C4I A;  3RE5 A;  3UEV A;  4BX7 A;  1QQS A;  5HA0 A;  4CPE A;  1MUP A;  1KT4 A;  1AEL A;  4ZHG A;  3BY0 A;  3ZUI A;  1B4M A;  1BSY A;  1JZU A;  1I9H A;  3EC5 A;  3P6D A;  2A5C A;  4I3B A;  1LIC A;  2KT4 B;  1IKJ A;  5FFH A;  4U8U O;  1BSO A;  4FBO A;  1CBR A;  2WEX A;  3SZJ A;  4EKV A;  2WEW A;  4Y0S A;  2IZG B;  3T2X A;  2FHL A;  2X55 A;  2Y3E A;  3FYF A;  2AVI A;  5F58 A;  1OPA A;  3D97 A;  4IAW A;  3WZQ A;  5FQ6 E;  5HAE A;  1VWM B;  3NQK A;  4UU3 A;  4A1Y A;  2LB6 A;  2WSJ A;  1EW3 A;  1RST B;  4NW4 A;  4NP1 A;  2RN4 A;  1IIU A;  2BHV A;  4CV7 A;  3MG5 A;  4QNI A;  4XMD A;  1SRJ A;  4A8Z A;  1SWG A;  2FLJ A;  1JV4 A;  1YWA A;  2F09 A;  2OF9 A;  1N0S A;  4XMH A;  1UZ2 X;  4O3Y A;  2IFB A;  5CYB A;  4Z2V A;  3DSZ A;  3NQ3 A;  2FR2 A;  2MJI A;  3BRN A;  1G74 A;  1I06 A;  3KFF A;  4GDZ A;  3VGW A;  3T6F A;  3EW2 A;  1IFC A;  4Z2O A;  1JJJ A;  5HTE A;  1SWL A;  3VG7 A;  1JYJ A;  2QMI A;  2GC9 A;  5D48 A;  1BSQ A;  1SXX A;  3AKN A;  1O8V A;  1SLG B;  4MIR A;  5H8T A;  2BS5 A;  5B5F A;  1GT4 A;  1RXK A;  2I5Z O;  3T2W A;  1X8P A;  1B56 A;  1PMP A;  1W5R A;  2VFC A;  4HWM A;  4ZFX A;  1OEE A;  2X56 A;  4CDF A;  3OE3 A;  3IFB A;  4GU8 A;  5H9A A;  2RTD B;  3STN A;  5FQ8 E;  1GX8 A;  4ORX A;  4M7M A;  2FWV A;  3MX7 A;  4B55 A;  1ZNL A;  3UEU A;  1HMT A;  1LNM A;  2OL6 O;  3KVN A;  1E02 A;  2AT0 X;  3JQO A;  1I04 A;  3ZWE A;  3VG3 A;  5IO7 A;  3D9W A;  1D2U A;  1NP1 A;  1URE A;  1MOY A;  2RTM A;  3WVM A;  4AZR A;  4ZJ0 A;  5BVT A;  3PP6 A;  3RZY A;  4JHQ A;  2A0A A;  1YWD A;  1KL4 A;  3GAQ A;  4YKM A;  5HA1 A;  4O4O A;  3AEH A;  1ICN A;  3HK1 A;  2OVD A;  4GNY A;  3P6G A;  4EQA C;  3AUM O;  4GDA A;  5B2A O;  4QGX A;  1LIB A;  5K06 A;  5H9N A;  2UYW A;  1DZJ A;  3EBW A;  4GH7 A;  4ID2 A;  3MM0 A;  1SWS A;  3KFH A;  1GT3 A;  1XKI A;  1SMP I;  2NNQ A;  1GT1 A;  1OEJ A;  2CM9 A;  3C77 X;  1A57 A;  3NR3 A;  3RY2 A;  2LFO A;  3K3L A;  3PPT A;  4GD9 A;  4LKT A;  4YGG A;  1JYD A;  1X8O A;  3D95 A;  3VE2 A;  2RTC B;  1SWO A;  3WOV A;  5LJK A;  3SOT A;  4FQB B;  1TOU A;  3S26 A;  2RTA A;  3FA7 A;  2G7B A;  1VWE B;  3FR4 A;  3PK2 A;  5B3M O;  5B27 A;  1HBP A;  5EDC A;  4ZR2 A;  3OBL A;  1FJ1 E;  1HBQ A;  5AQ6 A;  5BVS A;  4IBA A;  2Q4N A;  1I78 A;  2RTJ A;  4OS8 A;  1EII A;  1YWB A;  3AKM A;  4MVL A;  1DF8 A;  1VWI B;  3RDO A;  4YVB A;  5JR8 A;  4WBK A;  2QO4 A;  1A2D A;  1K3B A;  1IJ8 A;  2A3F X;  2X32 A;  4CPH B;  2AT6 X;  4O3Z A;  4AZO A;  3IA8 A;  1KQX A;  2A2G A;  2XKL A;  3UEX A;  3ZW2 A;  2OL7 A;  1IW2 A;  1MX7 A;  2DJF A;  2AT8 X;  2W2F A;  1FE3 A;  2YG2 A;  3V8U A;  4GNW A;  4QRL A;  5LJC A;  4RUN A;  3RWX A;  2RTL A;  2GJ5 A;  1BJ7 A;  2P8G A;  1QY2 A;  1TW4 A;  2N93 A;  4EEJ A;  4YMY A;  2PI3 O;  1B0O A;  4LZU A;  4ZCB A;  1NP4 A;  1KXO A;  2G79 A;  4O4U A;  5HZ6 A;  1BRP A;  1G5W A;  4AYH A;  1OSP O;  3SAO A;  1E00 A;  2W2A A;  3O2Y A;  5F2B A;  5EZ2 A;  4FGI B;  3NQ9 A;  4BX5 A;  2C1S A;  2AH7 X;  4KC7 A;  2RCQ A;  3BLG A;  2HNX A;  2AT5 X;  4QQ1 A;  1BWY A;  1SRH A;  3RY1 A;  4D6A A;  4BX6 B;  2HMB A;  1DFV A;  2RD7 C;  2JGS A;  4INN A;  1KL3 A;  1GKA B;  4DNE A;  3TGC A;  3B2J A;  2JU3 A;  4YGZ A;  4KII A;  4BCS A;  3BX8 A;  2RTO B;  1G85 A;  3E3C A;  4WFV A;  3APU A;  4I9R A;  5D45 A;  1VWL B;  2MHD A;  1JJU A;  4O49 A;  3PH6 A;  3WZN A;  1YIV A;  3B2L A;  3FIQ A;  4MEE A;  4ON1 A;  2BLG A;  2QO5 A;  3EMM A;  1VYF A;  1GKA A;  1MVG A;  2Q2P A;  3HOL A;  1G7N A;  1QAB E;  4XME A;  1KZX A;  4N7C A;  3PED A;  1LF7 A;  2R56 A;  3EYC A;  4PSQ A;  1CBI A;  2HYS A;  3L4R A;  1LDO A;  2ZAI A;  3B2K A;  1W6F A;  4YGH A;  1JMX A;  3MVF A;  2BS6 A;  3P6C A;  5EEE A;  3VHM A;  5CE4 A;  2IZB A;  2NP1 A;  2RTB B;  4IRW A;  3CBC A;  5HZ8 A;  1WUB A;  4ZHF A;  5IRA A;  1Y53 X;  2JN3 A;  1SWK A;  1SWD A;  5FQ7 E;  3SLO A;  5H9L A;  2OF8 A;  3HWG A;  3BU9 A;  4CDE A;  3RDU A;  1GGL A;  2AKQ A;  1TOW A;  1LDQ A;  1KZW A;  5CSE A;  3APX A;  3FID A;  1XCA A;  2JOZ A;  2UZ2 A;  1KL5 A;  2RA6 A;  3RKG A;  4GKC A;  1FEM A;  5BYP A;  1HMS A;  1NDJ A;  2RTI B;  2WPU A;  4OEL A;  3P6H A;  3FDC A;  1STP A;  1SWU A;  3FMZ A; 
#chains in the Genus database with same CATH homology
 2X55 A;  1I78 A;  4DCB A;  2X4M A;  2X56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...