2X58A

The crystal structure of mfe1 liganded with coa
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of Liganded Rat Peroxisomal Multifunctional Enzyme Type 1: A Flexible Molecule with Two Interconnected Active Sites
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 268
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2x58A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x58A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2x58A01
3H65A 3MJ4A 3UH1A 3U49A 1G6KA 1OAAA 1VL0A 3KTGA 1VRGA 3WYBA 1G1AA 1UYTA 4IQ0A 5DU6A 5JBWA 5KVQA 1U2DA 4G2NA 1LC3A 1QLHA 2HK8A 5KOIA 4JXKA 1A7KA 3V5EA 3AW9A 4ALKA 2X5KO 3M6NA 4GSKA 3FTNA 3PZRA 2CE3A 1CQIA 5JE8A 5KJ6A 1J49A 3GN1A 1HEUA 1XNYA 5BQFA 2RBEA 5DBGA 5JAQA 1P1RA 5DP2A 3QW2A 4UEJA 3IMFA 1Q1NA 2AQHA 3H9UA 5G0VA 2H1SA 2JCXA 4RVSA 2Q34A 3UOGA 1PZFA 3VDQA 2VWQA 1L1FA 3DBRB 2VT3A 2BMAA 1C1XA 1YDEA 3GVIA 2HK7A 3O26A 3PHGA 4Q3BA 3Q7HA 2H6EA 1BW9A 4LISA 4H15A 4G2RA 4P4GA 1JU9A 4ZRNA 4Z3DA 2P9EA 4RZIA 3K8XA 1B3BA 2ZYDA 3FD8A 3GFGA 2X7HA 2QQ3A 5CP8A 1K6XA 2WE7A 4CMKA 3RC1A 4XYGA 4YQYA 3V1TC 2ZYAA 2QW8A 2V6FA 4Y67A 3S8MA 3GNQA 1ZSYA 3BA1A 4GKVA 3AJRA 5F1OA 4KQXA 4WKGA 2PR2A 2G76A 4AJOA 1A72A 4O0LA 1TG6A 1E7QA 3IBBA 3G49A 1E1NA 1MC5A 1MV8A 4TKLA 3P85A 4FNBA 2NU7A 2RCYA 4H16A 4Y98A 4WCDA 2UVDA 4WYOB 5G1RA 2VYNA 5TT0A 4JLWA 4PZEA 4B7CA 3QVWA 2VHZA 4MOWA 2VSUA 1FDWA 4RGBA 4A03A 3BHJA 4ESOA 2O3TA 1MB4A 4TSKA 2DTDA 5TGDA 4A2CA 3EHEA 4CLRB 3ROPA 5JO9A 3ASUA 3E9MA 2OBNA 2OMEA 2X6TA 4IIUA 5AXBA 3P2YA 2CSUA 3TFOA 1HE3A 3N7UA 1SCUA 1P44A 5EQDA 1ID1A 1VL6A 2C2XA 3BMNA 2ET6A 3FI9A 4S3MA 4YT5A 3ZNQA 1E1LA 3GKBA 2VNSA 2Y1FA 1T4DA 4Z6KA 5CEJA 1EUCA 5T5QA 1UXKA 3RU7A 2NNLD 2HDHA 4OMUA 2DT5A 2JCVA 1YG8A 1NP3A 3DTTA 3B1JA 2DBQA 4YVFA 5TJ9A 1QP8A 3I9KA 3W4IA 4B3JA 4IS2A 2B36A 3KSZO 1XCBA 4LSWA 4QECA 3E03A 2HKIA 3PK0A 5AXDA 4JP2A 1O94A 1TLTA 3ABIA 1K2WA 2QYTA 1LDMA 4XEHA 5I9MA 5BT9A 3TL3A 3WG9A 2FSVA 3G64A 2BRUA 4BQRA 3WIDA 4ZQBA 2Q49A 3JQGA 1QR6A 4MO2A 5TRTA 4BO5A 4KD6A 1ZEMA 1UAYA 1GL3A 1HF3A 1GV1A 2C0CA 2NVUA 3AY3A 4J9VA 2BD0A 3A28A 4OSOA 4YJHA 3GAFA 3DO5A 3QWDA 1J6UA 3E6AA 2CY0A 3CH6A 3TWOA 5T67A 2WE8A 3RUFA 4ROSA 2E82A 3IKVA 3PYLA 2H9IA 3QJ5A 2CVOA 5DKPA 2E6UX 4J1NA 3VPSA 4PCVA 2IZ0A 3PQEA 4CMGA 5JCJD 2ZKLA 1YOVA 4YTEA 3U4HA 4CQLB 1I33A 1DC3A 1EVZA 1Y8RB 3RUEA 4DLAA 3NT4A 5IDQA 3E82A 1XWFA 2J5SA 4EW6A 2Q1SA 3VVCA 3LK7A 4OO3A 1JXZA 3BZUA 4W82A 2ZTMA 1IHXA 3FRJA 5U1PA 3D3WA 1R66A 3PRJA 1EQ2A 1UH5A 5A05A 2J3JA 4KDEA 1B7GO 1UP6A 4PG7A 3R6HA 1X15A 1J4AA 2XOXA 2Z1MA 2UV8A 1MP0A 3RC7A 5ENDA 4A26A 2EV9A 1A71A 4J6FA 4YR9A 1GFSA 2VYVA 2B5VA 2FN7A 3IIEA 1CEQA 4ZDEA 2ZTVA 4P4LA 3LF1A 4R3NA 4XGNA 5BNFA 3WGGA 3WXBA 5DZSA 2NP9A 3N6RB 1H9BA 3D1LA 4NFSA 5BSGA 4ZJUA 1QLJA 4GLLA 4NR0A 3EYWA 4U0HA 1OI7A 4XJTA 2PZMA 2F9YB 3HN7A 3U0BA 4BO6A 1T1SA 4P22A 5JLAA 5A5EA 5B4TA 1SZJG 1T2DA 1HNOA 2Q35A 5JDCA 1PJHA 1P31A 2NTVA 2BZRA 3KTIA 1N2SA 1PJ4A 2VZ0A 1GEGA 3QIVA 3JQAA 3QP9A 3AM5A 4W99A 2YV3A 4WNCA 3ZV3A 3DAGA 2HMUA 2IRWA 4EGFA 2IYPA 1Q2XA 2W90A 1YJ8A 4CV3A 4BO9A 1R0LA 2XXBA 2O2YA 1AN9A 2JFGA 2Q46A 2FR8A 1Y6JA 5DOZA 3F5QA 3L07A 3T4XA 4JYJA 4YA6A 2X22A 3QRWA 2HRZA 3Q9UA 5CG1A 3O9ZA 4L4XA 1C0LA 3SVTA 1HDGO 3Q11A 3OT6A 2C8TA 4BNKA 1YL6A 3TZQA 4IDGA 4J0EA 1WDLA 1R4MA 1Q7CA 2A9FA 1P74A 1SOWA 4G65A 2QIOA 2G1UA 2V6GA 5JXWA 1O8CA 1ZUD1 4B4UA 3GRPA 2GASA 1E7MA 4KPKA 4UULA 2QX7A 1HNUA 1U3TA 2HSDA 2Z95A 1Q52A 3GDGA 4IGFA 4R5MA 4RVDA 1PJ3A 4O63O 1Y7TA 2VOEA 1AE1A 4PLWA 1N6EA 2DBZA 1UYVA 4CV2A 3BMOA 1GPJA 1LDGA 2DFVA 1HT0A 3E48A 3QWBA 4FN4A 3MJCA 2VRCD 4CMIB 2QQ5A 3VOSA 2GN6A 1EVIA 5KJ1A 1AXEA 4FJWD 2NU6A 1HE5A 3Q9NA 5FI5A 1M6WA 1ONPA 4N7RA 4U5QA 5FWNA 1U28A 2ZL4A 1FF9A 2X4GA 1U5AA 1HDYA 1WW8A 3KXDA 4DPLA 4GM2A 1A4IA 5DBIA 3O8QA 3KZVA 1MG0A 4M86A 5IAAA 4AJ2A 2VT2A 2UUOA 2B4QA 2HMWA 5K0ZA 1WZ8A 3L6DA 1O0SA 1PJCA 2ZB7A 4B4VA 1PGOA 4YYZA 3MT6A 1RJNA 2Y0EA 2JAPA 2VRCA 1NFQA 2NADA 1DBVO 2FP4A 5EN4A 4I42A 2AE1A 4GVXA 1X0VA 4LSMA 4QFDA 5L4LA 1HSZA 4FFNA 3RVDA 5A9RA 4KMSA 3FWNA 1L7EA 3BMOB 4DRYA 1Z82A 1R6DA 4U7WA 5TSDA 3S2GA 2J5II 3PEAA 5FIFA 1NHWA 4GGOA 4Q3CA 4DIOA 1DAOA 3GG9A 3L4SO 1ML3A 1EE9A 1PS0A 2EJWA 4IJUA 4YJFB 1ZIDA 4IZIA 5H81A 3T3WA 2GR9A 1PQUA 4AJHA 3I52A 3JYOA 1ISHA 3NDJA 5A06A 2PTGA 3BMQB 3D64A 3HADA 1FDTA 3ETDA 1WDKA 3ST7A 1I01A 3RUAA 3S2IA 1PJ2A 1H0KA 3GZNA 2WEKA 1BDBA 5EINA 4WEOA 4CM9D 2PD4A 4FGSA 2J5KA 5EQFA 4YT8A 1B8UA 1D4FA 2X0RA 2P9CA 4QX6A 2PG8A 4IZBA 4I5FA 4J4BA 1HSOA 5DU8A 1MFZA 3M6MA 2WYUA 5GZ6A 2PV7A 3H0QA 4NDNE 4WUVA 2ZTLA 3KTDA 3GMSA 1R0SA 5C5IA 3JYNA 1R4NA 1XG5A 1Y1PA 2NWQA 3M2TA 4ND5A 3WX0A 1I3LA 3ZWCA 3F3SA 2VSUE 1WPQA 2VHYA 3KQFA 4N54A 4PLPA 3MOIA 4JJFA 2C7GA 2DBVO 1NFFA 1UR5A 3ITDA 5L53A 1EBUA 3DBVO 4J7UA 4GPD1 3L9WA 3C24A 2EG9A 3FNHA 4BNGA 3MJEA 5IXSA 1ON3A 1DOHA 1EE2A 2DAPA 2I6TA 3MJSA 4TMFA 1XX4A 3R1IA 1TB4A 3I47A 3D4NA 3JD2A 3GAZA 3VZRA 4I52A 4EJ0A 1UIYA 3HB4X 1YOVB 4WGGA 2Q2WA 3ANNA 3QXZA 2AG8A 4IZCA 4AJKA 4CMEC 2ZIZA 4OLQA 1UXJA 1KBZA 5CFZA 3QK8A 1DC6A 1GQYA 1HDOA 2EGHA 1T2EA 3LT4A 1UUFA 3Q3CA 3GFBA 1HE2A 2PY6A 1YH3A 2ZJ0A 1PJQA 1YG6A 3I83A 3PQDA 1DRWA 4R1TA 4ILKA 3CE6A 4MVJD 2PLAA 1C14A 1OMOA 1QYXA 4ELXA 4J0FA 3COSA 2ZQYA 2Y0DA 4EEZA 2O4UX 4K6CA 4WLNA 4D41A 2ZCUA 3ICPA 3NTRA 4CM8A 1LTHR 3JQ7A 4JCQA 4GWKA 2DKNA 1E7YA 4ZDCA 2YFHA 5T6BA 3OHSX 1XDWA 2X1HA 3FHLA 1QRRA 4Y8VA 4LN1A 1U7HA 3RUCA 4UUPA 2IYOA 3PTZA 1B2LA 1DIGA 1N92A 3IDSA 5G0TA 1SNYA 3EK2A 3ROQA 1H93A 4OHUA 2EKPA 3L0DA 5TJHA 1GZ6A 1VJ0A 3EZYA 5G0WA 4D0RA 3BHMA 1E3WA 3C85A 1XQ6A 4HFMA 5FEUA 4NI5A 1PU2A 3LT1A 1P45A 4PGFA 4R41A 2PWZA 2GNAA 2Z1NA 3PWZA 1KETA 1PWZA 4WLEA 4PRLA 4YAJA 3RJ5A 4BUCA 3ST9A 2LDXA 4CMJA 4TVBA 1X1EA 1ULUA 4PIVA 1MX3A 2AQIA 4PG4A 1B26A 3JD4A 4IM7A 1N5DA 3CTMA 3GN2A 4PN3A 4BIIA 4JROA 3FR7A 3QWHA 3VH4A 2O2SA 4CMBA 5TLSA 5JAZA 3AOGA 1O95A 4IBOA 4IQGA 1ZZEA 3R9SA 2FHSA 5U9CA 3GGOA 3MJVA 3WBBA 4L8KA 3OQ1A 2NVUB 4OMRA 4OYRA 3IC5A 1JWAB 2HQ1A 4FB5A 4K26A 4PRKA 4HWKA 3OA2A 1P1IA 3H5RA 4PLTA 2POQX 3HINA 1NHGA 1DHTA 1YB1A 5A9TA 5TF4A 3U4DA 1I24A 3CINA 1E1MA 4ND4A 4PFJA 5F5NA 4K3WA 5CDYA 1E3WB 3U4IA 4Q3NA 2NU9A 5KCZA 4HADA 3ONDA 5BNTA 4GAEA 1Y8RA 1NX6A 3K2EA 2PK3A 1VSUA 3E5RA 1PJLA 3JQ6A 3DEYX 5DU4A 4FOSA 3NT2A 1PIXA 1TA4A 2PFGA 5G4KB 3OQ6A 1B15A 1H5QA 2R2GA 1DDOA 3AY7A 3TLFA 1HWYA 1LLCA 4BMVA 5C7OO 2WD7B 1DC5A 4II3A 4ZU2A 1TVEA 1E1KA 4I1IA 1JAXA 2TMGA 1NVMB 3I9MA 9LDTA 5IDXA 4G5HA 1DLIA 1ONOA 5I7VA 3DORA 2G82A 2FWMX 3I23A 1VM6A 3V1UA 3R3SA 3LF2A 2VZ9A 4XKJA 3V8BA 1QG6A 2FMUA 4NIMA 3ADOA 2ZTUA 3RU9A 1E3JA 4OM8A 3ZU2A 3W6UA 3O8QB 2OOSA 2J5GA 3F1LA 3ZWWA 3PZBA 1LSOA 4FW8A 4IPTA 4AJIA 2CVQA 1PGNA 1U7TA 3R9TA 5IZCC 3WBFA 4IDEA 5HTOA 1E7SA 3H2SA 3VVBA 4AG3A 2QYSA 1PS8A 3CZRA 3JCZA 1BHSA 4R68A 4D3SA 3IJPA 2B0JA 3PGJA 1CRWG 5C9GA 4EJ6A 4CR7A 2AW5A 3FPLA 4D79A 3NUGA 4P8RA 4PG8A 1MUUA 2A7SA 2BKAA 2YFQA 4K9DA 1NAIA 1HZJA 1XEAA 3IAHA 5DZKH 3QHAA 1ADCA 2B4TO 3AU9A 4W7IA 2V6BA 1GZ4A 1DIAA 1NVGA 1K3TA 4FC6A 2VHXA 3ICCA 1ADBA 4B8ZA 1H94A 4TQGA 1DIBA 1KVTA 4B4OA 2XAAA 3I3OA 2VNAA 2UAGA 1P1FA 4XIJA 3OECA 1P77A 1JLLA 4XR9A 4E2WA 2GZ1A 4PVDA 5JAIA 4BOYA 4MVJA 2D4AA 3LZ6A 4HXYA 4XRRA 1ZCJA 2RH8A 3QYRA 4M54A 4Q1IA 2V6MA 3HNPA 1FMCA 3I9OA 4PZCA 3VPGA 4HNHA 3ZWOA 4E5NA 3ASVA 2WJPA 4B3IA 2NV6A 1D1SA 2O3QA 3HDHA 5JDIA 3GVHA 2EERA 5INGA 1DC4A 2HMTA 2ZQZA 1GY8A 4KDFA 1FC7A 1PSDA 3LAOA 3HSKA 4DBVO 3AUTA 4F45A 1GQQA 2HCTA 2DPGA 2ZJ1A 1E7WA 1K6JA 5IN5A 1BXGA 4RVHA 2WYWA 1QV6A 1UP7A 2HJSA 4CQMB 1Z73A 3F4BA 1F8FA 3H8VA 4KWIA 3R6DA 4YAKA 1C0KA 5DNAA 3V5NA 4PLYA 5A02A 4PLCA 3VZSA 3DZHA 2DU8A 3VDRA 4BNZA 4BNFA 3UCXA 3MOGA 3KYDB 3TSCA 1EMDA 4DL9A 2A35A 4BL5A 3RRVA 3CUKA 5A9SB 1X0UA 2PD6A 3DONA 1UZNA 3JV7A 5A3JA 3FBGA 3AUSA 4K2NA 1H2BA 2HRBA 4AL4A 2QZZA 5I7SA 4O5OA 3A14A 3VHRA 2W2KB 4LCJA 4II2A 4PVCA 1Q51A 1BXKA 3TF5A 3ITKA 3PFWO 2CFCA 1LLDA 1YQDA 1NZYB 4BKOA 5IFLA 1DFHA 2PH3A 1A9YA 3PYMA 8LDHA 3QA9A 1T26A 1G0OA 4C4OA 1RJMA 5JO0A 3O03A 3H0UA 2I65A 2WWRA 3AUAA 4R1NA 4DLLA 4I8XA 4XYBA 1YBAA 4OKNA 4PLGA 2DM6A 2O3RA 3EMKA 4BNMA 1N6DA 5AOVA 3GNSA 1F8GA 1EF9A 3RCBA 2EKQA 4WNIA 3E9QA 5BR7A 2X5OA 3JQ8A 2NVBA 3FNFA 2A94A 3N58A 4LK5A 1UP4A 3DHEA 2YV1A 3DOCA 4YQZA 4BVAA 2TMDA 3R3JA 1YBMA 4EDFA 2Q2XA 4J4TA 4I5DA 1UYRA 4WE3A 3ZN2A 4RCVA 3ZHYA 1Y7OA 1P9LA 1LDEA 3RBZA 3V5IA 3WR5A 4Z9XA 3VPXA 4BB5A 5JFOA 4ALLA 1JAYA 3FNEA 3JQAB 4FFOA 1I3MA 4J3FA 3EZLA 2NU8A 5GMOA 2QG4A 1VI2A 5HRUA 4RL6A 4F6CA 2O3SA 4L0QA 5DDIP 4RO0A 3GY0A 1K89A 1LDBA 1NYTA 4ZQGA 1KEWA 2NQTA 4CMEA 4EZBA 3ISAA 4KZPA 1N9GB 2Q4BA 4O6VA 5IN4A 1YWGO 3B20A 3PJDA 3DL2A 2AEMA 2WSBA 4XYLA 4MIEA 4QFCA 3HE2A 3P2LA 3BAZA 3WGZA 1V9LA 1EK6A 2O3JA 5B4VA 1SEPA 4N5NA 4BQPA 4FZWC 1GV0A 1QYWA 3DHNA 1RWBA 4EUFA 5MDHA 1EDZA 3BYZA 3C1TA 3GZ4A 1T2CA 3FSRA 2GDZA 1Y8QA 2Q1UA 4TZKA 3V2UA 4PG5A 1KY5A 1CWUA 1E7RA 4R9RA 1R12A 3ZU3A 3OIFA 4EUHA 4JCRA 2IZ1A 1SB8A 3NV9A 1KEVA 3GR6A 2CF6A 1XSEA 4LGVA 4CODB 4PLFA 1ZXBA 4CMAA 1DLJA 3M2PA 4CLHA 3A9WA 4EI2A 5ER6A 3BMCB 2C59A 4U0GH 2Q99A 4FDAA 1SOVA 1KS9A 1BVRA 2BHLA 4WPGA 5DOVA 3MJTA 1D8AA 3BTSA 4RZHA 4ZGWA 3WWZA 1V3VA 5ENVA 3BF0A 3AUUA 4CLRA 2J5RA 1W4ZA 5JYEA 3RFTA 3RJ9A 2I9PA 3CZMA 1IZ0A 3NYWA 4XQEA 5IZ4A 4E2XA 1NWHA 2HAEA 3QV1A 3GGGA 4E3ZA 3VC7A 2JAHA 4R1SA 3WQRA 4U6SA 4W9NC 3JQEA 3RSHA 1QSGA 3ZHXA 5L7WA 2J3HA 3OBBA 2Y1EA 5IJZA 1ISGA 4IXTA 3F9IA 5C37A 4F46A 1PGQA 1SPXA 1YL7A 3GC6A 5DUFA 3E1KA 4DQVA 4NBVA 1DUBA 3TVUA 5C7LO 1FDUA 1NTOA 1QYVA 2GPTA 4MVJE 5EPOA 1L7DA 1U5CA 5TC4A 3T4EA 5JMWA 1DEHA 1V3UA 1HTBA 3IAVA 4CM6A 1LBEA 2Y1CA 2VZ8A 3K2BA 2CBYA 1GTMA 4IQ8A 3OMEA 3VH2A 4YT2A 1R4NB 2P5UA 4AJ4A 3SJUA 3IL2A 4CV0A 1DXYA 1DFIA 4ZU3A 4RYFH 3B6ZA 4KTTE 4L74A 4YJFA 1TEHA 5B1YA 3U9RB 4M1QA 5T64A 1BXZA 3U5TA 2R00C 3WGTA 3WWYA 2VWHA 1JQBA 1B3RA 3PWSA 4GX2A 4DPMA 2WD8A 2BFAA 4U6QA 1XU7A 5AXAA 5HA5A 3JD0A 5TX7A 4CM5A 4ZICA 4RLHA 4M89A 2W3PA 2H63A 3FBTA 3ADPA 1RM0A 4J9UE 3ULKA 5JW6A 2IEXA 4FJ2A 2O50A 1EZ4A 1BRMA 4YPOA 3WGHA 4BNVA 5KDRB 3ZDFA 1NQOA 1UDCA 3H3JA 4JJTA 4L6WA 3N74A 4CJXA 4BHTA 1DPGA 4E4YA 4E2ZA 2OP0A 4LRTB 2FOIA 2QRLA 4Z9YA 2EP7A 3G0OA 5INIA 1F12A 2B83A 3HWRA 3WGOA 1PS9A 2Q50A 2F1KA 4D43A 4AJ1A 3HN2A 3OIDA 3WGQA 3D4PA 3DOJA 5JMPA 2W4QA 3PHIA 2R6JA 5COBA 3WJ7A 3ZU5A 1HLPA 5F21A 1H2HA 1O89A 3CXRA 2UYYA 1RYEA 1YS4A 1LLQA 4Y6PA 4QQRA 3F46A 4YXFA 3NRCA 3LYLA 5CDUA 3VAZA 1P1HA 4RV9A 1RYDA 4JGBA 4WLVA 3GRKA 4URFA 1QMGA 1I10A 2P9GA 4EUEA 3T7EA 1DRVA 3DBHA 3STHA 1KIFA 4BGUA 3WMWA 1I36A 1JTVA 2J5GD 3S55A 1FDSA 1IUKA 3RBVA 2NTNA 3PXXA 4BMSA 3D3EA 4Q39A 5DF1A 1HYEA 5JY6A 1PJTA 1E0DA 3GGPA 3BTVA 4IDDA 1KY4A 3H2ZA 4GH5A 2ZK7A 4RLSA 4XA8A 4ALNA 3MOYA 3V2HA 2EHDA 4I9UA 4BNXA 3RC2A 1EQUA 3HE3A 3KSUA 3STAA 3AFNA 3GLMA 1EK5A 3K31A 2X9GA 1FXSA 3ENNA 3LC1O 3P2OA 3KYCB 2YYYA 4WLOA 5IF3A 1JA9A 3GHHA 3ZWYA 1ZNQO 2VSSE 4RQUA 3R0IA 5BNIA 3GMDA 1Z6ZA 4GWGA 1H6AA 3KRTA 1PR3A 5JDIC 4NMHA 4IZDA 2GSDA 2Y67A 4RPHA 5COQA 3B1FA 4ZQFA 3ZV5A 4RCNA 3OEYA 2GGSA 3JQFC 1AGNA 3FWZA 4TROA 3TZCA 5KTKA 2OP1A 3AOEC 3SEFA 5L3ZA 3RBXA 4Z3KA 4AJLA 3IOYA 2AA3A 3OJLA 4MVJF 1ZSVA 3QY9A 5DT9A 2GERA 2BLLA 5KVCA 1GCOA 2FR1A 2C2YA 4MOUA 5E0SA 1VKNA 4QSMA 2IDZA 4YJGA 1O6ZA 4HFNA 4E0BA 1WXDA 4HY3A 2F00A 4UVEA 4NU5A 5L4NA 2BFMA 1SB9A 3A1NA 1J7XA 2WDZA 5K9ZA 2AMFA 2OORA 3KLPX 5G0SA 1J5PA 1ZXLA 1KEUA 3WDSA 3F47A 2GN4A 1TT5B 3E9NA 4ZA2A 3I5MA 5ILOA 4GX0A 3GPDG 4MVJG 1ISJA 3RKRA 2YZ7A 2YHUA 3ZW8A 3W8DA 4FD3A 1HYHA 2W2LA 2HK9A 3HDJA 4U0KA 2QHXA 4CUKA 3KYDA 2HW5A 4WCZA 4RORA 1BGVA 1TT7A 5FYDA 1OZAA 3K50A 4LK3A 4W9NA 1XNWA 4CM7A 1BMDA 4FGWA 3JD1A 1K5HA 2B4RO 3ETEA 3NX4A 4FR5A 5JYDA 1KC3A 1VRWA 3H4VA 3H6KA 1EUDA 1W8DA 3IKTA 3OICA 4HP8A 1G0NA 3AI2A 3LKEA 2Q2QA 3W4JA 1YKFA 4CUZA 5C90A 5AVOA 1AXGA 3SLKA 1HDXA 4D45A 2BI8A 1W6UA 4QO7A 1ZFNA 2FZWA 5CHEA 3RD5A 4RVGA 1A7AA 5I7FA 2ZL0A 1ZBQA 2QRJA 2GYYA 3P5MA 1A5ZA 4NEKA 1JVSA 4WEQA 5G2OA 4NQZA 2F9IB 3OJEA 4BNHA 4CQLA 2Y05A 1N1GA 2JFHA 4PLZA 2ZYGA 3PIIA 1P0FA 3RWBA 3S2FA 3SLGA 2B69A 4XZ3A 3ZWNA 3X2FA 2QRKA 4UVDA 4ALJA 1NASA 4R3WA 4B7UA 1YQGA 4I9NA 3VZPA 3U9SB 4ITUA 2D5AA 1PTJA 1XKQA 3V2GA 3OF2A 3DTYA 3ZHZA 3TDKA 1PJSA 4QUKA 3H3FA 5CPBA 1PEDA 2J6IA 3LT2A 4IY1A 3KLMX 2BI7A 4JNKA 1NXQA 3Q0EA 1VL8A 3UFXA 3BHIA 5FI3A 4R9SA 1GPDG 3OM9A 3OP4A 4QXMA 2J3IA 1HL3A 3HJAA 4MPDA 2C5EA 3NEPX 4CLOB 4FPXA 2Z5LA 4KUHA 4D0SA 2VSUF 1JKFA 2VUSA 4AJJA 4CLEA 3G3EA 4CM4A 1UDBA 4BNLA 1I8TA 2VOJA 1HZDA 4BNUA 2CDAA 5H83A 4MKZA 3QREA 2PZKA 3UXYA 3PLRA 1LSUA 3IP3A 2OFPA 4UAGA 3NJBA 2HLPA 2PGDA 3T88A 3WQSB 2D5CA 3IQDB 3GHYA 2CDBA 3OJOA 3GT0A 1N6FA 2DUUA 2Q4EA 5L7YA 4ND1A 4AICA 3JYPA 3KUXA 3LC2O 3OJ0A 3KV3O 1YB5A 2YQ4A 3WSWA 1EVYA 1DHRA 1DJNA 4XCVA 5JCJA 4IXWA 3WYCA 4BNWA 2DPHA 3GLQA 3M1LA 3ZH2A 5F3RA 3DDNA 3QXIA 3LLSA 1NPDA 4NK4A 1U4OA 3VPHA 3UCEA 5JC8A 4IDBA 4XB1A 3CSDA 5I8WA 3HFGA 3KTHA 1A27A 4LW8A 1C1DA 2YDYA 4OL9A 4ONEA 3JYQA 3NTQA 4F3YA 5A4DA 2C07A 3JQBC 3VKUA 4CM3A 3MFMA 2DTXA 2UZFA 1RM5A 1ZK4A 2BFPA 1AHHA 3U3XA 2JKVA 2JD0A 3HP0A 3DFZA 5IZCA 1ADFA 2E37A 2NQ8A 4FJ0A 4FJ1A 3BPPA 4I9HA 1DRUA 1I2CA 1EUZA 4OAQA 5IXYA 2Y1GA 5G4KA 3TOZA 1SG4A 4LVCA 1OOEA 3HDYA 3OJFA 5F5LA 5KVVA 5G1QA 4IJVA 4A7PA 2F6QA 3KTKA 2P68A 2YHIA 3BTOA 1DO8A 1WLYA 4DWVA 2FBMA 3WG5A 4R69A 3QWIA 4J7XA 1U3UA 4FIZA 1C1XB 1GDHA 2OO5A 2B35A 4A5OA 3GEMA 4ZDDA 5EJ2A 2VRBA 1GUZA 3AI1A 4FCCA 1IY8A 4XGIA 3HQ4O 2GD1O 1HZZA 1F17A 4ND3A 3Q2KA 1D3AA 5DCYA 3RKUA 2XPCA 8ADHA 5IKLB 3LLVA 4XIYA 3HZZA 5G4LA 1KVQA 1ZKMA 3MTGA 4N18A 4TRNA 1VJTA 2SCUA 3MWEB 5JBIA 4YAEA 3DFUA 1YE3A 2VTDA 1NFRA 2RAFA 3JQDA 2DQ4A 2GLXA 1VKOA 1I32A 1HRDA 2FRDA 3ZNOA 2D3TA 2D1YA 3RFVA 1PIWA 2AHRA 1F0YA 3NJ4A 4E12A 3PP8A 4IMRA 1H9AA 1Y81A 4LMRA 4QIIA 1ZJYA 5KVSA 3HRXA 1IE3A 4L73A 1DCIA 5E0NX 3PGXA 1E3LA 1N9GA 4CMIA 3PJGA 1OD2A 1T25A 4MIOA 3PDUA 4E2YA 4CM1A 4C7KA 1QYCA 3K9QO 1W2XA 1WP4A 2EJ5A 1H6CA 4Q9NA 4UVHA 4MKXA 1JW9B 4L9RA 3BMQA 2EXXA 1MLDA 2UDPA 3OETA 3UN1A 4BNYA 1FCFA 2ZL3A 1Y8QB 1GZ3A 4J2OA 1Q7GA 2P2SA 4IDCA 4M87A 4PLHA 2EKLA 2AXQA 5I8ZA 2C29D 3UHAA 1LUAA 3VIVA 1YRLA 4AFNA 1WDMA 2ZQRA 1BG6A 3TRIA 4HNGA 3UGKA 4NG5A 2FW2A 3PQFA 4BS9A 1V0JA 4EYEA 1ON9A 4IS3A 1GUYA 3CPSA 4NHEA 2FR0A 5JY1A 2CVZA 1ZW1A 3MZ0A 2P5YA 4OH1A 6LDHA 1XO6A 4YT4A 3R0OA 4NK5A 3GUYA 4B4WA 4JVTA 3QVXA 2AG5A 3HB5X 3SWXA 1BDMA 2OXIA 3GOHA 1QKIA 4NBTA 1NQTA 2IZZA 4BNIA 1UZLA 3GZNB 4JP3A 3I1JA 1NQAO 4YCAA 5EERA 1E3EA 2Q3EA 1YGYA 4GLOA 3WTBA 1E6WA 1ORRA 1PQPA 5DCUA 3GF7A 4C7JA 2I67A 4FC7A 3ONEA 2VHVA 1E6EA 3FF4A 2IODA 1Y9AA 3M1AA 1DSSG 1VSVA 3JQ9C 4GX5A 2W8ZA 2F6IA 4U0GA 4IUYA 2X0JA 4DIFA 1R37A 3QQPA 3AM3A 5KNLA 1MXHA 5FF9A 4BKRA 5LDHA 1RKXA 2ZATA 4JJGA 4E33A 3PE8A 3Q0JA 4AJNA 2HMVA 3RFXA 1IYZA 2HMSA 1C3VA 4HKTA 2W98A 3SX2A 4J91A 2GRAA 4MXIA 3ZHBA 1MA0A 3T89A 4J1SA 3L9XA 2FSSA 2EJVA 3DB2A 3VZQA 3RSTA 1QXSA 4CV1A 1T4BA 4CL8A 3RSIA 3WB9A 2CNBA 3D7LA 1U9JA 4B79A 4BV8A 5KJCA 1NWCA 3AM4A 3AWDA 5I9LA 4CL3A 3IB9A 1LEHA 1MFPA 4IIVA 5ITWA 3T8BA 4BO2A 1P33A 4IJKA 2HUNA 3NDRA 4ALIA 1SO8A 3ZV6A 1P1KA 3RAJA 3EC7A 1FC6A 1K39A 5T8KA 1DB3A 1HDRA 3GK3A 4NH4A 3PHHA 4W7HA 4A10A 3KTJA 2OBYA 4DPKA 3H9JA 2YJZA 2X86A 1BXGB 3EDMA 4J43A 2VQ3A 3QVOA 2YQ5A 4IGEA 3WYEA 4JX8A 1M66A 5I7EA 1LDNA 3LT0A 4J7CA 4RJTA 1DIRA 1ZMOA 4OGWA 3F4LA 2EGGA 4OOEA 4GKBA 1IHYA 4GHNA 4J1TA 3WGIA 5HM8A 3DBRA 4JBHA 4P38A 3U62A 3KBOA 3PIDA 4UUMA 3F5SA 3QWAA 2YUTA 2PH5A 3NGLA 1A9ZA 2B37A 3GVPA 1PZHA 1N1EA 1E3IA 1I3KA 3Q2IA 4DLBA 4MVJP 2W2KA 4EMPA 4YEDA 4R51A 4OXYA 3WIEA 2CD9A 3K8ZA 1KVUA 1ISFA 1EVJA 4FBGA 5KDRA 1V8BA 1MJ3A 4KTVE 4PG6A 4YJHB 5G1SA 1N7HA 2YV2A 4FNDA 4R5HA 1TYFA 3GQVA 2JHFA 4YAGA 4DC0A 1YJQA 4IDAA 1I0ZA 3PI7A 3V1YA 1ZMTA 2H5LA 4WOJA 1YVEI 3DBLB 3X2EA 3GF3A 1AUPA 1VC2A 3H9QA 3WJAA 3RUDA 3QE3A 1B8PA 1DIHA 3TOXA 3KEOA 3S1LA 1UXHA 4NBRA 5ES3A 2ILTA 2PGJA 3U4CA 4OQYA 4CLDA 3K73O 4TRJA 5DULA 1PGPA 3IUPA 4RF4A 1NM5A 5ADHA 4J1QA 1UAGA 1T1RA 2A4KA 1X7DA 3KOUA 4F6LA 3SJ7A 2X24A 1NVTA 1XYGA 3LC7O 4FOOA 4MVJM 4KUEA 4OQZA 3DR3A 3LQFA 2AQKA 2VYND 3FNGA 1ZO8A 5LC1A 4FS3A 4GI2A 1PZEA 2CUKA 2VWPA 5KWEA 4U0JA 3T8AA 3JQFA 1HXHA 1LU9A 1PQWA 5A3VA 3TL2A 1Y5RA 5HWSA 3K96A 5DL1A 2C5AA 2PNFA 1XNVA 3WICA 3PPIA 1OBFO 2JCYA 4HUJA 3VH3A 2X0NA 1Q0LA 2WD7A 4LVUA 4R54A 5TT1A 2VREA 2X23A 3NJDA 3QMJA 3L6EA 1TT5A 5TS3A 4YAIA 1XHLA 3NAQA 2R00A 4UUNA 4JN6B 1DFGA 4NJMA 1ZK2A 3BMCA 1RM3A 3JQ9A 4RPGA 3WLEA 5A1TA 2EWMA 1M6HA 1B16A 2EF1A 3TT7A 3R9QA 4TRMA 3MEQA 1X13A 1ISMA 2A92A 5THKA 3GPIA 4WK6A 1K6IA 1HLDA 4E13A 4JYLA 3AU8A 2PKRA 3B1KA 4IMPA 5KJEA 4FN8A 1KERA 3RQSA 1RM4A 3BIOA 2Q1WA 1GADO 1NR1A 2GN9A 2P4HX 3MCVA 4HFRA 3FPCA 1PJBA 4D3DA 3NGXA 2I3GA 5A04A 4ID9A 3OFSA 2G0TA 4NFYA 4E5MA 4JK3A 5DZKA 2GZ2A 2X9VA 2C54A 4GBJA 3NJ8A 4P4NA 1UXGA 4BO7A 3INRA 4KOAA 4RVUA 5IDWA 4JCTA 1FK8A 4WCFC 5CDTA 1I3NA 4WOKA 1T24A 3C8MA 2QZ9A 5MGBA 2HJRA 4DGSA 2PZLA 3U09A 4FZWA 4BO4A 4YRAA 3DWFA 4YRBA 3H9GA 2I3AA 3CKYA 4M55A 4BB6A 1B14A 2PA3A 1WNTA 1GD1O 2CZCA 2LDBA 3EY4A 2BH9A 2Y66A 3ZI0A 4GSLA 3JQ8B 2CDCA 1U3VA 4KP7A 3VKVA 4MI2A 1E6UA 1JDJA 2VCYA 1ONNA 3QKAA 2D2IA 3PJFA 4JCSA 1WVGA 4G81A 2VX2A 1HKUA 2EW2A 1IULA 4EEXA 3INGA 4AJEA 1B8VA 3EAGA 3JD3A 4MIYA 2O4CA 3FR8A 2F9IA 4FB8A 4DA9A 4UVIA 1V35A 4XDZA 1I2BA 2GN8A 2NSDA 1LQUA 3VPFA 5K6AC 4E30A 1E3SA 3BMNB 5DTPA 2X9NA 3H7AA 3ZU4A 3LU1A 4BKPA 1IPFA 2CF5A 3TQHA 4NJOA 4OJNA 2BF7A 2OZPA 2X8LA 1Z45A 4RDIA 1RPNA 3DMTC 4DBZA 5T8KC 5LCXA 4TZTA 3NKLA 5L7TA 3C7DB 1JWBB 4B8WA 4GL4A 3A4VA 1P3DA 4E6PA 3D4OA 3DQPA 4XX0A 1PL8A 4KNPA 4GMFA 1LXCA 1OC2A 5THQA 4TWRA 2X5JO 3UVEA 4QFEA 5CTCA 3U9TB 5JAMA 3VTFA 3A06A 3Q0GA 1MXFA 1ENYA 4XYEA 5B4UA 1HDCA 2PPYA 3INTA 4L4SA 1IPEA 4CLOA 3GF4A 3TZKA 1O5IA 4ZD6A 3GMAA 1H6DA 1BSVA 4R1UA 2PGLA 3QWFA 1M75A 3UICA 2C7VA 4PLVA 1LJ8A 5E0SH 3ZWVA 1KC1A 4HNKA 4YJGB 2G17A 1LRKA 3DAPA 4LMPA 3WFIA 3ZWMA 5CEEA 2VTEA 3JTMA 4MP6A 4NFHA 4WASA 1PX0A 2GUGA 2OL4A 4NPCA 3PVZA 4LRSB 3AFMA 4R01A 5G0UA 3KYCA 2D59A 2NTJA 1TI7A 4L4RA 3NT5A 3KETA 1XQ1A 4Y6SA 2A7KA 1QV7A 2OGUA 2JJYA 4OIMA 4DUPA 1Q0HA 3OIGA 1M76A 4XQ9A 4XR4A 1C0IA 2P4QA 3IUSA 4HX5A 4MINA 3DBHB 4J90A 3BXXA 4RDHA 4YDRA 3ORFA 4RF2A 4BO0A 4HFJA 1OFGA 4R4JA 2DLDA 4X54A 3QLJA 1D1TA 3F1KA 4ZHSA 1LDYA 1MG5A 3ZCXA 1VE9A 4RVFA 3Q6IA 1CETA 1ZJZA 2FZEA 1E77A 1LRJA 2FPGA 3W8EA 4BGVA 5L45A 4JBIA 1WMAA 2O7SA 2YW9A 3ZGYA 1U2GA 5COAA 1ULSA 4J49A 1CJCA 1NBOA 1RJWA 2BFOA 4H7PA 3DMYA 4B7XA 2GZ3A 2BGMA 4CR6A 1CIVA 5L95A 2J5QA 3I9NA 1Y5MA 4JQCA 3DBLA 4JOTA 4CQMA 3VH1A 3TFQA 3TPCA 1ENPA 2VN8A 3HFSA 4M49A 4MDHA 4Y6RA 4MJLA 4XQCA 1DJQA 3WSVA 5H82A 1ZH8A 1N7GA 3ZWAA 3OQBA 1GYRA 3I4CA 4FQ8A 4W6ZA 4QTZA 3KVOA 4I4ZA 5L40A 4QEDA 3RASA 1I30A 2V65A 3L4BC 3TT6A 3KHUA 3EVNA 3OSUA 4DMMA 4DMLA 3KB6A 5CPFA 3L6OO 1EEHA 2NLOA 1EBFA 2P91A 4KUGA 4XRGA 3MWDB 2RHRA 1U4SA 4YJDA 3HG7A 3DC2A 4J16A 2J5IB 2AE2A 4CM9A 4CQMD 2PD3A 4KQWA 1ARZA 5DTWA 1W0CA 1O9BA 1FJHA 2NVWA 4ZVVA 3RI3A 3RUIA 3LSYA 4R16A 4TRRA 5B37A 1NAHA 2RHCA 4K1LA 3GUCA 1XU9A 4MP3A 5GZ1A 4RPLA 4ZDBA 5KKAA 1Z7BA 1KEPA 3KSDO 5DCWA 4D42A 3WFJA 4MP8A 3I9JA 5ITVA 2I5PO 4GX1A 5I9NA 3FF6A 3TNLA 4GQAA 3GH3A 5U4QA 4K29A 3TV5A 1BW9B 2Y93A 4IZHA 5EESA 1BWSA 3H0SA 4UREA 1GEEA 4UEKA 1PL6A 1EF8A 3H81A 1PZGA 4EMLA 4NZ9A 3M6IA 4QO8A 3S2EA 1UXIA 3UCFA 1F06A 3RUHA 1SZOA 4ELSA 1D7OA 4UEOA 5EL0A 5JNLA 2A81A 1S6YA 4XJSA 1R0KA 4E5PA 1P0CA 1V3TA 1ZK0A 1LC0A 1ENOA 2IXBA 2FZSA 2IEBA 3DZGA 4EITA 3DMTA 4RF3A 2Q45A 4JBGA 3IJRA 4ZQHA 4CPDA 4Z0TA 5KJFA 3TZ3A 3GVCA 4WECA 1S7CA 1ZSNA 2D8AA 2DC1A 3WMXA 2ZL2A 2IE0A 3KO8A 3L4BA 5A5FA 3GDOA 2PBPA 4WLFA 5C3MA 3ROKA 4CR8A 3IS3A 3FN4A 2XXJA 5K6AA 5ER9A 1WAMA 3P5SA 2FPIA 3DZIA 5BSFA 2JHGA 1X0XA 2IXAA 2OUIA 4IDFA 2VSSF 1LI4A 3ZV4A 4DYVA 5DN9A 2VWGA 1N8KA 3ON5A 4NBUA 5F1KA 5ICMA 1MGOA 5A9SA 4HBGA 1V6AA 5JS6A 3TN7A 2WYVA 1GYPA 1P1JA 5DP1A 4J2HA 3CEAA 1EFKA 2VSSA 5BSHA 1LX6A 2DBRA 2I76A 1SMKA 3MTJA 3KEQA 4WJZA 1OC4A 4AVYA 5HBRA 2EP5A 2O48X 2X0IA 4JFCA 2W2LD 1LQTA 4DC1A 4YRDA 4EJMA 3SXPA 3WGYA 2O3UA 4OKIA 4L76A 3W4KA 2GTRA 3UW3A 3SBOA 4NJMB 2RH4A 3OMLA 2FPPA 1R15A 3G1TA 1J0XO 1ZK1A 4LCEA 1X1TA 4HC8A 4XWYA 3FCOA 3DXFA 3TZHA 3JQGB 1Z7EA 1YXMA 3D3WB 3ZNPA 1WWKA 4RPJA 3H0JA 1X7HA 1NNUA 2VUUA 4IJWA 1XELA 3AI3A 1H6BA 2YDXA 3Q1LA 3G17A 3E18A 3QVSA 3PWKA 2WM3A 4YWJA 3RC9A 5L51A 5KJPA 1Z74A 3UAGA 3B70A 4L75A 1VJ1A 5A03A 2AQ8A 4CLXA 2V7PA 1EDOA 4ELWA 2AEFA 1C0PA 1ZVMA 2X58A 3E8XA 4EBFA 4E5KA 1JN0A 1CF2O 4UUOA 1TXGA 3ANLA 4KWHA 1IZ9A 5DUCA 2GF2A 5F1PA 3K6JA 3ENKA 2ZQQA 2Q2VA 3DJAA 2Q1TA 3AOEA 3GEDA 4S1VA 1PGJA 3AY6A 2XF8A 5ICSA 3O4RA 4RPKA 2DVMA 6ADHA 3WNVA 4FFPA 4YACA 4Q3DA 4DREA 5JC1A 4WLUA 5IG2A 2JL1A 2J3KA 1KOLA 1LSJA 1SAYA 3JQAD 3JYLA 1UYSA 4OSPA 4J4HA 5JDCC 5TIIA 2G5CA 1YONA 2VUTA 3SLLA 1LA2A 1I5RA 4RQTA 4MKRA 4BGIA 3JQBA 2DEOA 1HYGA 4CM8B 5TNXA 4DIBA 1VLLA 3G1UA 3OA0A 3CMCO 4CUJA 4BV9A 4IINA 3ZZNA 5GZ3A 1NQ5A 3JU1A 3PDJA 5IDYA 3DHYA 4ALMA 1UZMA 4D44A 2JD2A 1LRLA 2ZCVA 1PL7A 5BSEA 3OH8A 5CAEA 4YBZA 4A73A 4DQXA 1PWXA 1ADGA 1XGKA 1KVSA 4DTIA 3GA0A 3WLFA 3PFFA 4E5YA 1YDWA 2Y1OA 3C1OA 3G79A 1Q7BA 3ZWPA 4Q3EA 2O23A 2VSUC 4AJPA 5CTBA 4FFRA 3C7CB 3CMMA 1K0UA 3GDFA 4CMCA 1T2FA 5JBXA 2Y99A 2C20A 5FFFA 1CYDA 4N5LA 4HV4A 3HDQA 4H3VA 3WOHA 3H02A 2EW8A 2PKQP 2IEDA 3OC7A 3LDHA 4O1MA 3AK4A 2AEJA 2DUWA 4DI1A 3BEZA 4WZ8B 4NNJA 3NDIA 4Y9DA 3O38A 4QT0A 3ZW9A 4GMGA 4U1AA 3ZWBA 2I99A 5EMHA 5DBFA 4YB8A 3PGQA 2DFDA 2RIRA 2C82A 4F47A 4ZRMA 4FFMA 1YBVA 4Z0PA 5C7IO 2ZB3A 4GVLA 3QSGA 3T7CA 3ZWXA 4CM4B 2EEZA 1UJMA 3DZFA 5HS4A 2J5IA 3WNQA 3F6YA 1NZYA 3HUDA 3I6QA 1Q0QA 5KIAA 3PEFA 4DVJA 4OOFA 5KKCA 3PZKA 4B3HA 2DUBA 3TJRA 5T57A 4FSHA 4BKUA 1WZEA 3Q1TA 4NU6A 4NBWA 4BMNA 1HETA 1GR0A 3BTUA 4BO3A 1U8XX 4OXKA 2D0IA 1ENZA 3FDUA 4NNQA 3L77A 1M2WA 4QIJA 2JFFA 1AHIA 3E5MA 1Z75A 1NPYA 3W8FA 1NR7A 2Y0CA 3ROMA 3JQCA 4BNNA 3H5NA 5JPIA 2YY7A 3DZBA 3H5AA 1QORA 3MYBA 1K32A 4FN7A 5FUSA 1UDAA 4E31A 4TVOA 3UKOA 4DYDA 3W1VA 4K6FA 5B12A 1U1IA 3K30A 4D46A 2HU2A 3EGOA 4O59O 3SC4A 1YO6A 4BGEA 1Y9EA 4XB2A 2OHXA 2UUPA 1E5LA 1EY3A 2ZB4A 3D5TA 7ADHA 3EVTA 3RIHA 1U8FO 1XLTA 3LVFO 5AYVA 3KM0A 4ZN6A 3GNTA 3U9LA 1KYQA 1HDZA 3GEGA 2EIHA 1LLUA 2BGKA 1CERA 3DZKA 2HO5A 3RROA 4MVJH 2DTEA 3GG2A 3TRRA 4XYMA 1SBYA 1XIVA 1LSSA 1X7GA 1R16A 1XA0A 3IP1A 4D7AA 4U18A 3CIFA 1ZK3A 7MDHA 1OD4A 2PZJA 4W4TA 2Y1DA 3VTZA 4ASIA 4OXNA 4A0SA 4TKMA 1YQXA 2VHWA 1IOLA 1GCUA 4INAA 2J8ZA 4RF5A 5LDGA 1IL0A 3DZJA 3W6ZA 1FC9A 4E21A 5CDSA 2NUAA 5HS6A 4XGKA 3D0OA 4JJIA 3PLNA 3K5PA 4U8GA 2GO1A 4XD2A 4L8VA 3TDCA 2GCGA 3ANMA 3EUWA 5GY7A 4Q3AA 2BGLA 4E32A 3OEWA 1E5QA 1EFLA 1ZEJA 4I5EA 1CDOA 3C3XA 1R4MB 4WCFB 1W73A 2E49A 4BO8A 1JVBA 3I6IA 4DQUA 4XQGA 3P19A 1BVUA 3PJEA 1B0AA 5L9AA 4Z0HO 4PZDA 3DAFA 2I66A 4M8SA 4DXHA 2F9YA 4ZDFA 1C1DB 1FDVA 1XR3A 1F14A 3WS7A 1WMBA 5JSFA 4BO1A 3EW7A 2WTBA 3GVXA 3TVWA 1JKIA 1SC6A 1VPDA 2E48A 1GYQA 3D5QA 3JSAA 4Q0GA 4Z9FA 4JWVA 5CDGA 4KWBA 4EMMA 3PHLA 1YL5A 2BELA 3HLN1 3PHJA 1A4UA 1YB4A 2Y68A 4ZQEA 3I9LA 4ND2A 1JKJA 5ILGA 4JIGA 3I4FA 2YHIB 3P7MA 4I5GA 4UVGA 4XDYA 5AQ1A 1U3WA 1NPTO 1QYDA 1BTOA 3TZ6A 3FTPA 2WMDA 3JQ7B 3QVTA 1GUFA 4BNTA 1T2AA 4FFLA 3K92A 1MC4A 3H9EO 1GAEO 1ISIA 1KVRA 2E4AA 3HHPA 4WCFA 5AXCA 5J23A 4JSBA 4GGPA 4I08A 1WZIA 4OG1A 1GU7A 2JD1A 2ZB8A 1X14A 3C7AA 2FY8A 1GQ2A 1HE4A 5TQVA 2VYVD 4K28A 4MVJI 3C1AA 3PYXA 5JCXA 2NM0A 4U19A 4CMHA 4D3FA 4YLHA 1I2ZA 2CMDA 2NACA 2O7QA 4BKQA 2PKQO 3UUWA 1M67A 1E92A 1PR9A 3KYBA 2B5WA 3ETGA 3L3SA 1DAPA 3SC6A 5CEFA 3UF0A 4A27A 1CQJA 5L4SA 1LNQA 4RYFA 4Z0MA 9LDBA 5INFA 1IB6A 3ONFA 5EIOA 3ZNNA 1O8UA 3DOOA 3NTOA 4JCOA 3WQQA 5CG2A 4BNJA 3WTCA 1SEVA 4N5MA
chains in the Genus database with same CATH superfamily
3H65A 4ZVPA 3MJ4A 4JC4A 1PP4A 1SK8A 2X4IA 3EULA 3HU5A 4EBFA 3M9LA 4S1WA 1L6IA 4YMVA 4ZPXA 3WL7A 5JBWA 1X7XA 5EE3A 1U2DA 3DWGA 1LC3A 2H4WA 3KWFA 4J6EA 4GI7A 4AKSA 3QW4B 3LUBA 1V3QE 2X5KO 4Q03A 4RUKA 5KQGA 3M6NA 3PNQA 2Q9AA 4PCLA 3CNHA 3BF0A 2XD4A 2CE3A 3QUSA 1FVFA 4GVPA 3ND8A 2ADMA 3G5AA 5T4FA 4BWFB 4DM7A 5JAQA 4TMTA 1VKRA 4IP0A 5TEWA 1C7EA 3EXG1 3UJ9A 3GJ7A 2AQHA 2JANA 2QNIA 4DCGA 1L1RA 4O4LB 4EVQA 1TMOA 1G20B 2O07A 4KH1A 2H8GA 1L1FA 3ZX5A 2IE8A 4WN9B 5BT8A 1IN6A 3QLUA 3JZFA 4D8UA 1C9YA 2J7PA 2BMAA 3D7KA 4QRIA 3T7TA 1SCDA 3GVIA 3HEMA 1SC9A 2HK7A 2C5SA 1RLOA 3N2YA 3O26A 1MOZA 4BLTA 3Q7HA 3D6HA 4H15A 4OLHA 2P9EA 4KXMA 2BFCB 5ICFA 5A6SA 2CKMA 2F9MA 1FFAA 2IUEA 3BFPA 3GFGA 3DVRX 2G88A 4EABA 1MO2A 1QG0A 5CP8A 1K6XA 1XQVA 2B0CA 3F6BX 4MRMA 5HYVA 3MGBA 1I6WA 1ZIPA 3KLNA 4ZZ0A 2Q62A 3QKIA 1TM3E 5GONB 4F86A 2V6FA 2BFBA 3K7EA 3GNQA 1TTQB 4QGSA 3P9PA 1T8TA 4Y2YA 3WKEA 2VVTA 1PFVA 1IBCA 5LIPA 4HRYA 4X00A 2ZROA 3BXOA 4S0XA 1MPXA 2WAAA 4CEHA 3T1YB 3IBBA 1E1NA 5I8PA 4YHBA 5IBPA 2LXNA 2XUDA 4TKLA 5AO9A 1IZ8A 3RLFA 3O1IC 4PTYA 1T1JA 2B8NA 4KQ2A 3CT4A 1UOQA 1T6NA 4Y98A 2UVDA 4H35A 3ECCA 1BGWA 1UM8A 4MV4A 4B7CA 3NHJA 5K09A 1KEKA 1OREA 1ZJ5A 3ICEA 5JD5A 3D2AA 4R83A 1XVUA 2J0EA 3NXKA 5K3AA 2CNKA 3C7TA 4EB3A 5C8VA 1QFXA 1CKEA 1XRSB 3THWB 4JI4B 3G6KA 3ZD6A 3KELA 4G56A 3BD9A 4A2CA 4TPKA 3I5XA 1OZHA 1E2BA 2FCRA 3WY9A 2B78A 3ASUA 4BNDB 2ETVA 3E9MA 2OMEA 3P2YA 1KYVA 1POXA 5T6MA 3FMFA 1XRJA 3H84A 3N7UA 4B3RB 3PGMA 1OLUB 3FMPB 4UQPA 3BB1A 5TQ2B 3FI9A 3PPYA 4J0HA 1MEOA 1FLAA 4TMXA 1N0WA 1SCAA 4PQYA 4Z6KA 4PC3A 3X1DA 1WS6A 1NGSA 3MCAA 3OO1A 4YUAA 1HV8A 4OMUA 2DT5A 1KORA 5KZMB 1NP3A 2HNAA 3DXXA 3EXG2 4M6WA 4YVFA 3WJ2A 3NOQA 2C9MA 2PKCA 4J75A 1W1IA 3K72B 3UW1A 4Y6LA 3KSZO 3W4IA 4MX8A 1XCBA 1T9GR 3E03A 3IQXA 3PDIB 2WP8J 3VR6H 2OHIA 5LQSA 4RTPA 3IH5A 2FEKA 1TUIA 1GIAA 4PQFA 4HRAA 3U4AA 3ZDXB 3G64A 1QHYA 1ZGZA 3O4GA 4ZQBA 1SULA 4KD6A 2VPZA 2PXCA 4V0RA 5TRTA 4BO5A 1ZEMA 2C1ZA 2PRZA 5GJVC 1HF3A 5HIMA 3DPIA 4YJHA 2NVUA 2O6LA 1SOMA 3GIWA 2WYIA 4NV1A 4X41A 4YYEA 3A1VA 2FDRA 1NM5C 4J8PA 5T67A 1P6UA 3MTBA 2OBMA 1RKQA 2ECPA 3IKVA 821PA 2PEZA 1GNLA 4CG0A 6CHYA 4PBTA 5KSZA 2GSWA 5CCXA 4IDOA 2WVGA 1Z5NA 3PQEA 4OIFA 3B8EA 2WV9A 4TKZA 4JUIA 2ZKLA 5DHTA 4CMGA 5JCJD 1XRNA 2AK3A 3O94A 3LPAA 3MTQA 2DLCX 1PLLA 2VJOA 5KSYA 1LV8A 1Y8RB 2ENWA 4XTRA 3S2SA 1MC1A 2HLNA 3LX4A 3OE5A 1NVVR 3D7SA 3O8LA 3NT4A 5LQNA 3R5XA 2V1UA 4UBOA 3TGWA 3Q9LA 1EFRD 2J87A 3LK7A 5ED0A 1JXZA 1NQWA 1YU6A 1JV2B 3BZUA 4AZ0B 5BPHA 3D3WA 4WSOA 2WF8A 4DZRA 4CTNA 4WIAA 3HLTA 4ERXA 3FH0A 3MK31 1AD2A 2IYUA 3DV0A 5AKYA 5B30A 5EMLA 4WMLA 1GKIA 5CNJA 1P7YA 3AF5A 2EV9A 1H23A 3DZ8A 5EWLB 4BCDA 1GFSA 2VYVA 2B5VA 4M8NE 4EFNA 4YR9A 1RPAA 2JLZA 5AUOB 1QIKA 4OQQA 3C6XA 4C43A 3OHMA 4ZT2A 3RIMA 3Q7TA 4DDMA 2Y4OA 3BZBA 3OOSA 1QZZA 4KAXA 4KQMA 3WGGA 4ARUA 5DZSA 4HDSA 3D1LA 1H9BA 1UK6A 3R4CA 1VPWA 5BOVA 3DVAB 3STTA 1N78A 2ZYWX 3PLAE 1KYXA 2VPYA 4NR0A 1UOOA 3TQIA 1SCBA 2FN3A 1EFCA 2QVZX 3B2EA 2F9YB 521PA 1SC4A 2YZKA 3H11B 4D97A 1M54A 5FV4A 1T1SA 4RS4A 3UAWA 3LA6A 4BQNA 5A5EA 1G5FA 3LL7A 3HO1A 5B4TA 5AW5A 4BAGA 3L7NA 1MIOA 1U6KA 3AXSA 4UNRA 4KR7A 4HDAA 2Q35A 3W77A 1AU9A 5JQGB 2NTVA 1GPNA 4GMXA 2VZ0A 1PJ4A 1NYQA 3KWMA 4XGRA 4WBNB 3QP9A 2YV3A 1AZLA 2HMUA 1E2JA 1ZJ4A 4BU0A 3E2MA 4L3OA 5J5AA 1Q2XA 4KYUA 4ZKEA 1L5KA 4BO9A 4M1OA 2O2YA 1AN9A 1U2TA 1KKMA 2Q46A 3NUQA 2OCYC 5EWMA 4M9RA 4YA6A 2CEAA 3WWDA 2IIVA 3BSWA 5LZ4A 2F55A 4GXTA 1U3DA 1C0LA 2MYUA 3Q11A 3OT6A 4US0R 1WJGA 3FGZA 1DG9A 1SN7A 1YL6A 3T7IA 1QBKC 4QOSA 1JEOA 4J0EA 3DLCA 2NU9B 3TZQA 1R4MA 4B3MB 2A9FA 4FE7A 4G65A 2QIOA 2RB4A 3SZRA 3VNBA 1THTA 3UJ3X 3PD0A 4TWAA 3GRPA 5CB0A 1TZMA 4KPKA 1LBSA 1SH7A 4NHOA 1NYLA 2GM5A 4UULA 1U3TA 3CLKA 2C3PA 2Z95A 2VYQA 3GDGA 4MV3A 4R5MA 4RVDA 2IHBA 1PJ3A 1EX7A 4X24A 5DX1A 3ZTTA 1S4QA 5EXPA 3V4PB 2WZDA 2ES4A 1CHNA 3BM5A 4F2GA 4X44A 3ZZ0A 1UYVA 1UKAA 2E1PA 2RI6A 3BICA 4MDYA 4O4LA 4RHUA 4BVHA 4D8WA 3ZDAA 2JA2A 1DJMA 2DFVA 2SHKA 1SXGA 1HT0A 3LT5A 3N0VA 4PINA 4S1TA 4MYRA 2VPWA 2GTHA 2GN6A 1EVIA 1AXEA 1H69A 3I1IA 4KO1S 4O1HA 4Q4JB 1ZQ1A 2HRCA 2PUHA 1MENA 4FWIB 4EW2A 5FI5A 4N7RA 1NTRA 1D1PA 2OXRA 2X5XA 2VK8A 2OECA 3OCCA 4J16C 1U31A 2RI1A 1U5AA 1B8NA 1HDYA 1WW8A 3KXDA 1GA6A 2RDMA 3O9MA 3KB8A 4YGYA 2VDQB 1CB7A 5AI8A 3A2MA 1JXQA 3KZVA 4H0NA 4RQAA 5GPBA 3OQIA 2C7RA 1WXXA 3GEEA 4LV5B 3F7TA 2VT2A 4IIBA 3BDVA 4I3HA 4UZFA 2HMWA 1I4LD 3DZDA 3Q6MA 3GUUA 5REQB 3K0CC 3G23A 4MR9B 4P83A 3UPTA 1O0SA 2PMFA 3RBAA 1QE0A 1PJCA 2SBTA 2ZB7A 3D0KA 1PGOA 1TADA 3VI4B 4EO9A 4PQRA 4HLCA 1VKHA 1PYDA 2JAPA 1X87A 2RKOA 5CFRA 4L5YA 5K1ZA 4NXNB 2FP4A 1POWA 2Z8ZA 5EN4A 4I42A 3E9DA 4L3WA 4Y2PA 1GU0A 4ZODA 5L4LA 2HYIC 4XX0B 1EX6A 3TTTA 1KAEA 1FRFS 5BUSA 2ZSJA 3FWNA 1L7EA 4FT2A 1QONA 5CNIA 2H1WA 5LB4A 4KYVA 2QW0X 4TKVA 2W00A 4BZWA 1SVIA 1AQJA 3RGWS 2VDMB 3L2OB 3WKAA 3IB6A 3PEAA 1CUSA 2J32A 4JXXA 1Z6XA 2JVJA 3BRQA 4B6EA 1ML3A 2HO4A 1G3UA 1M2NA 3OLQA 4RTRA 3T7KA 4RYLA 1H2AS 2VS1A 1CE8A 2Z2KA 4RGVA 1U2ZA 2VKTA 2Y4NA 2ZT8A 4H7FA 4Y2UA 4YJFB 4AJHA 1A1VA 3BMQB 3PDHA 3D64A 5I7UA 3HADA 2OLKA 4JI1B 1WDKA 4OHXA 3VR3D 3PDWA 5ALNA 4LXTA 2NTEA 5FUVA 2WEKA 1BDBA 1Z17A 1J07A 2XUOA 4WEOA 1RQ2A 1X80A 3GFSA 5FB3A 1IHPA 3TFWA 4ADSG 5AW8A 1DX9A 3OZAA 4MS4B 2P9CA 4HL6A 4QL3A 4QX6A 4I5FA 3SS7X 4HAZA 4IZBA 4X85A 5DU8A 1C4OA 4RA9B 1S2DA 5GZ6A 3ZE8A 3GJ5A 1BE6A 4GIBA 2WV7A 2Q5QA 3FVVA 4Y6GB 3H0QA 3KKZA 4I1PA 2HU8A 3GMSA 4G8CA 2O5CA 1URPA 1R0SA 1VHLA 3BWDD 4GPEA 4S12A 2VDJA 2DFLA 2AS0A 2ZFUA 4K9MA 1BX1A 1C9JA 1U02A 3D7RA 4FDVA 4ND5A 3F3SA 1I3LA 3VSAA 1O58A 1T4CB 4JNCA 2G5GX 5GVRA 4N54A 1YDGA 4JJFA 2ORWA 5A5VA 4GICA 1M8FA 1GLVA 2VP5A 4YUVA 1P4SA 3FPHA 3C3KA 5HZMA 5L53A 3GJRA 4I2VA 5FFNA 3DKVA 3KAPA 3BE5A 5AK6A 1IM5A 2EG9A 4O2BB 1ZOIA 3CRRA 4PCAA 2X76A 1Y42X 4BNGA 3MJEA 5IXSA 1E60A 3QMWA 5EXTA 2G80A 1Z3CA 1EK1A 1R0RE 2CK3A 1SUCA 3DTVB 3L7CA 3MJSA 4TMFA 3TAXA 3QHQA 3R1IA 1XX4A 5DKFA 1EFAA 2F9LA 2R62A 3D4NA 3K1AA 4Z3OA 3JD2A 4K9OA 3QJGA 3V7UA 1C4WA 4DGQA 2XUKA 2WIDA 2OBLA 2GD2A 3U61B 2H4YA 2OQIA 3LQ4A 4IUDS 2Q2WA 3ANNA 4IZCA 1FFBA 4IHKA 2P9FA 4Y2HA 1GQYA 3ZZTA 4J94A 2A9OA 2HNKA 3LT4A 1NMXA 1OU4A 3Q3CA 1UUFA 5HFJA 3L1IA 3RT7A 2ZJ0A 4KV9A 3JZMA 1A2OA 1T8PA 3PQDA 2QX6A 4G0NA 4F12A 1CZNA 4LZOA 4S1OA 1CR6A 1G3RA 1B73A 1C14A 1ECFA 1FYXA 1OMOA 1SCKA 3HYNA 4HWSA 5E6UB 5F7ZA 4ELXA 2ZQYA 1WXWA 2H1LA 1FLVA 2Y0DA 4UHFA 4XVHA 4EI7A 5ICGA 4WLNA 4D41A 2VTBA 3NTRA 4CM8A 2Q6TA 2KWIA 3KD2A 1VCOA 4OGLA 4G41A 4HTFB 1NBAA 4GWKA 3WGMA 4TSFA 2VKQA 4YRLA 3EGDA 5T6BA 1OH6A 3GZJA 5DGCA 3WNBA 4DLTA 1RAFA 4IOMA 1XDWA 3IE2A 2X1HA 4Y8VA 1QRRA 3RFUA 1U7HA 3AR8A 4K9RA 2D6FA 4BU1A 3PTZA 1XEWX 1RS0A 3E81A 4O4IB 4UXHA 5JZSA 5KX5F 3EK2A 1H93A 3PXBA 2APJA 1PVDA 5TJHA 1VJ0A 5G0WA 2VDPB 5J4YA 1XQ6A 1X1BA 4JR0A 2H1IA 5AT1A 3WRVA 4HN9A 1RPZA 1FDIA 3BIXA 3T0GA 4R1OA 1EP9A 1I7QB 2Z1NA 1OLSA 3PWZA 4Q4AB 2OZEA 4YAJA 2ACKA 4MS3A 5IJXA 3N7AA 1Z8NA 2DWUA 3K70D 5LD2C 1Y89A 3EAFA 2VSUE 4URWR 5J58A 1ZI9A 3ETHA 4F7WA 4DUYB 1RWPA 4JROA 5TLSA 4ZU6X 1XUOA 2V9CA 3R44A 4Q82A 5JAZA 1O95A 4IQGA 4U2BA 4JZYA 1KEEA 3K9HA 4KLNA 1GVNB 4M0DA 3MG9A 2ZZKA 2BI4A 1XZLA 3P5BA 5EKSA 4CKBB 3BEOA 3IC5A 3E15A 4OYRA 2RKWA 3BWCA 4FB5A 1N75A 4K26A 2X6QA 1P1IA 1FNMA 1FP4A 2G77B 2GKGA 4Q7EA 4Z54A 3H5RA 5JJKA 3NLLA 1E20A 4JJ6A 1DKMA 2BSXA 4N6NA 2YL2A 1YB1A 3V1MA 1KK2A 3U2QA 1NMYA 3KSRA 2RBKA 2C04A 3L43A 3LUAA 1XXHA 4F6RB 4GOND 1E3WB 3U4IA 1DV2A 5K05A 4D3XA 1J5EB 1YJ5A 4EO7A 4GAEA 1KMCA 4XX1A 1L4EA 1QTIA 4HQOA 4QYIB 1QIIA 3JQ6A 4MW0A 1U7PA 2VJMB 1MO5A 4LC1A 3LYAA 4CN9A 2PFGA 2XDWA 1J70A 1T3ZA 2A57A 2R2GA 1LWNA 1NONA 3H0CA 4UTNA 2RG7A 1BZYA 3U13A 5C7OO 4BMVA 3VAYA 4YECA 1DPFA 2WD7B 3ZLTA 3TLFA 5G1OA 3L46A 4Q47A 3WWOA 1D5WA 1NVMB 5A3QA 5K0LA 1N2JA 5I7VA 2G82A 5CHYA 1D2RA 3I23A 1UPUA 3CGWA 2XQJA 3V1UA 2QP9X 3LF2A 2GAOA 2NPIA 3JAMA 1NW6A 2WUEA 2FWPA 4JR1A 3EWSA 3E53A 4OM8A 3T4PA 2CZQA 3W6UA 5NULA 2REOA 2JHAA 1W2WB 3ZHVA 2J5GA 2XNDA 4LQLA 2NU6B 4UU0A 1BA2A 1W93A 5HHTA 1N9KA 1PGNA 4R2IA 2Q4TA 5REQA 4J29A 4IDEA 5IABA 4ND6A 2JIPA 5BR4A 2WJIA 4ESEA 4HAYA 5AVVA 2QYSA 4O4IF 2O5VA 4TLDA 3WHKA 3DDHA 1USVA 1BHSA 3IJPA 3PR1A 5CYGA 3MN1A 3PGJA 2FZLA 4CT0A 4OP1A 1LNSA 3RS5A 4QJBA 2AW5A 3FPLA 4BVEA 4MWOA 4RV4A 1XYVA 1KIMA 2CMFA 4MUHA 4P8RA 4PG8A 1ODJA 3F2VA 4LYEA 2BKAA 1Z4IA 2YFQA 4K9DA 1VGRA 5K51A 3R77A 3IAHA 1TPYA 4G0PA 4W7IA 4B43A 4QLOA 4W9MC 1CNFA 3FI0A 1U0GA 2Z8YM 3GEBA 4YPFA 3GJ3A 4A8TA 3GL9A 1DQSA 2PZEA 4GFDA 2VHXA 2FZ5A 1R6UA 3C39A 4B8ZA 2Z58A 1W7AA 3O82A 2AUTA 3LDUA 3Q3GE 4JBNA 2HJWA 4OI0A 2VNAA 3THWA 2UAGA 3M6MD 3DEIA 5JCOC 4KPYA 1XD2A 4MS1A 4BQIA 1RRCA 5JAIA 2SKEA 3U3DA 3HL4A 2C03A 4ZO9A 3RVRA 4DEXA 1KXJA 2D4AA 5JT1A 3IBSA 1ZCJA 2RH8A 4XRRA 5JWRA 1VJCA 2XT9A 1EFRA 1UKCA 3L0OA 1CX9B 4UHEA 4HPJB 5AM3A 4IO0A 1QX3A 1D7AA 2ZRBA 1GGFA 3TW6A 1W5BA 2WJPA 3QVGB 4B3IA 4B2PA 3HDHA 4H6PA 4KC0A 2EERA 3G13A 4LJAA 5INGA 1JE1A 4K2AA 3QLUC 1TM7E 1THZA 4JVMA 1PSDA 3JWHA 3N0RA 4AECA 4DBLE 3HSKA 1FC7A 1US8B 5ERGB 1EVEA 3IUBA 3MMZA 1SUWA 3AUTA 4JL5A 1GQQA 3FVRA 5MF6A 2DPGA 5J2TB 1E7WA 4FVTA 4KIFA 4AS3A 4D82A 2QMZA 1L7OA 2WYWA 1AQIA 1RBMA 1UP7A 4XJVA 3FCSB 4CKEB 1B00A 5FO1A 4NYIR 5DNAA 4D4IA 1JJVA 1BHJA 3MCTA 1BWRA 4LZPA 1X8JA 4PLCA 5A02A 2EBUA 2PGOA 4R3UC 1NZDA 3VZSA 3ZGZA 1P8JA 1W88B 5BVGB 1H4QA 1UBNA 1Z22A 4O4HF 3RRVA 2WVHA 2NZ2A 2O5EA 2XDAA 3JV7A 2L17A 5MHTA 1OBOA 2BFWA 3AUSA 2CL6X 4RM2A 3TLYA 4ER7A 1AJEA 4WZ6A 4K2NA 2OYCA 1UBSB 3WAJA 3CNLA 1W8IA 2IZ6A 2OXEA 1V2GA 2W2KB 4H59A 4LCJA 1Q51A 5L3SA 3Q7EA 1F4LA 1V9CA 4DY4A 4ZI7A 1VZ3A 4RYDA 1Y3BE 2LBPA 3DNPA 3CVWA 3F97A 2F59A 2PGIA 3ZJ4A 3FNBA 2H54A 1HTTA 4I2NA 5B3JA 1BEUB 5IFLA 2PH3A 2ZETA 4RBNA 2ONZA 4TYQA 4P5EA 1T26A 1G0OA 3SWWA 2GPAA 1VHTA 5AK4A 4QGAA 2YH2A 5IBRA 4KW7A 3W5UA 4YH1A 2XYHA 1T9AA 2WWRA 1AQYA 4DLLA 3O7MA 4WK4B 2G28A 2WHQA 3OO0A 4E14A 5I48A 2RB5A 3NCHA 4YAUA 3RHTA 2O3RA 2OHOA 3F2IA 3MUOA 4QRDA 5B7PA 2X77A 3GGCA 4HDRB 4EGQA 4TQ9A 3RCBA 5H4GA 2R47A 2OAQ1 3NANA 2YR0A 3PC4A 4KVFA 2FUKA 2BE7A 1EAYA 3MQFA 3E9QA 2C1EA 3GIDA 3R41A 4P36A 5JECA 1ZGJA 4DLXA 4F84A 4Q9IA 1KSJA 3N8KA 4K87A 3IKLA 1UP4A 5CDFE 1FS5A 4LK5A 3AEZA 4N0QA 4BVAA 2H2AA 2YV1A 1PNVA 1X1RA 4L51A 4XXHA 3UBMA 3HJRA 1F2UA 1Z2OX 2ZYUX 1YBMA 5JNSA 3X1JA 4I5DA 1UYRA 3DT9A 3FFAA 1KNQA 3JVDA 3ZN2A 4DS3A 3MLAA 1NJ1A 3U3KA 4REOA 2FZ4A 3IA7A 3DFIA 5DVZA 1WPGA 2AJDA 4KNWA 3RBZA 3RSLA 3KHSA 1QFMA 1THGA 5FI0B 2OQ2A 4G1VA 4ZHQF 4B8YA 3JZAA 1DAFA 1QCZA 3JTEA 3GU3A 4MS3B 3T9FA 1EU1A 1L7AA 3DDZX 2JLAA 3RAFC 3HTXA 4GXQA 1M8KA 2XCLA 3KOMA 3ELYA 3IVGA 3MQ4A 4LRXA 1UBCA 2H4FA 2CHVA 4QM7A 4MA4A 1QC5A 4Z99A 3LCRA 3EZLA 4J3FA 2K5UA 4JP1A 2QEQA 5IDVA 4RL6A 3EFHA 1XRMA 4EG8A 2BFDA 3E8MA 4XJXA 4ZYWA 4XIFA 1LDBA 1YZUA 2P9JA 1SUIA 2O5RA 2VJBA 3D3KA 2NQTA 4HDNB 4ZQGA 3RREA 4CMEA 5JV5A 3ISAA 1N9GB 4ZARA 4FFWA 1A7UA 2JZOA 2WSBA 4V0SA 1ZUNB 2R8EA 2C3UA 2R5NA 3P2LA 2PEYA 3NV7A 4JLUA 3WGZA 5EZSA 4R1LA 1NBIA 1EK6A 3A10A 3KVNA 3I2YX 1SKYE 4CU5A 3PEYA 2H00A 1N77A 3SC3A 4EUFA 5MDHA 3QE2A 1EDZA 3GZ4A 5EXDA 3TUJC 4LCBA 2D7JA 1Y8QA 2GDZA 2QXUA 1GFWA 3FSGA 4W1PA 1N3YA 1CWUA 4BUJA 1X42A 2WM9B 3IT0A 1SK9A 5HOQA 2DX7A 5JTUA 2W6JA 1ZITA 2WMNB 2LTAA 1HQYE 3BE4A 3T35A 1T0IA 3CHYA 4XSHA 4ER5A 1GNVA 5BXQC 2OHGA 4CODB 3CTVA 1W4CA 4S2UA 1QTQA 4GUAA 7ABPA 3NYRA 1DLJA 4QHYA 1SXJC 4XPIB 4CLHA 4W5JA 5IAEA 5AM5A 2MMCA 2VC2B 2OCBA 3E27A 4XVQA 1NVAA 3IPRA 1M8GA 4Q1CA 2C59A 5I7AA 3LVQE 1XZBA 4FZRA 4GP6A 4MW2A 3W04A 1M1NB 4M1EA 4WXPA 5CLFA 3M6FA 3N53A 4AUEA 4ZGBA 4A36A 2BHRA 1AC5A 4TT3A 4ZC8A 3BC1A 5ENVA 1P0MA 2EJBA 1CSEE 1UBRS 2VIIA 3AUUA 5CJPA 1WULS 1X38A 4GOKA 2J5RA 3RS9A 3U7GA 1W4ZA 1XJ5A 3ZDYB 4P80A 5JYEA 3CYFA 3LRXA 2I9PA 5BWNA 2KHZA 3T1NA 5H8WA 3B48A 5FFMA 3M4NA 5I9SA 3QV1A 1ZD5A 4KAJA 1JQJC 1FW6A 4AJOA 3GGGA 3JQEA 4Q3OA 1XDDA 1QSGA 2QI9C 5CYOA 1FCJA 2M9MA 5B1HA 3V8NA 3O3MB 4R6WA 5D85A 3ZD8A 4QNRA 2Y1EA 1GRCA 1VG1A 2XUHA 4IXTA 4YBRA 1WMSA 4RSHA 4KR2A 1SPXA 4D9IA 1X1DA 4ZZ1A 4DWJA 3NHKA 3IEVA 4AZ3A 4HCJA 1H2FA 5EPOA 1FDOA 1U5CA 3REQA 2QVYX 5AVXA 1DEHA 4LUCA 4XGQA 1QHXA 3N8GA 3V8EA 3T1TA 1F60A 4IQ8A 1QGUB 5EP3A 3DZCA 2J7KA 4M0MA 4A6DA 2JEOA 2VUIB 4AJ4A 1W94A 2OCKA 4RKWA 4CV0A 1Y4ZA 1DFIA 3U48A 2YN4A 3B6ZA 4TYPA 3HI4A 4YJFA 5B1YA 4IFEA 4EF4A 1KY2A 3I05A 5T64A 1BXZA 2R7KA 3AH8A 3GRFA 3JY6A 3M89A 4WW0A 5DNWA 3KQKA 4G1CA 1U3CA 1Y9ZA 1JIUA 2WD8A 3K15A 3QKRA 4NATA 4YS6A 5TX7A 3JD0A 4ZICA 5FTLA 2AG1A 4JI2B 4MJXA 1J39A 1KAHA 1ZC4A 2H63A 2V74B 2I6XA 4S24A 2JAWA 2W3PA 1RM0A 1NW4A 2IEXA 3TQFA 4F4JA 1KARA 1DEAA 5KDOA 5FOUA 3KE8A 3IKJA 1NQOA 3H3JA 2V0CA 1VSTA 1OWNA 4NAVA 5D8DA 2P75A 1T9DA 1X7XB 3L1JA 3VZCA 4E4YA 4HVCA 2OP0A 3QELB 4X1YA 4LRTB 2QRLA 3G0OA 2EP7A 3MMPA 3ZHSA 3LQQA 4D1YA 2OT3B 4HYEA 2F1KA 1CUCA 1ZI6A 1G17A 2FJ0A 4P35A 1M34B 2GD0A 1KYZA 3MMXA 2CL5A 3M6UA 1VBNA 3P2MA 1P2GA 3EEBA 1ID8A 2B3TA 3PHIA 1W44A 5COBA 1V1RA 3R3WA 4LYHA 4JHXA 3T7DA 3B3AA 4Y6PA 4QQRA 5BVGA 3TNDA 1KRHA 3LYLA 4ABTA 2WSMA 4DXAA 2GM9A 3AF2A 2XB4A 2EYUA 2EFYA 1BOFA 3QPBA 4QTYA 1QMGA 4CTMA 1TIKA 4A91A 3IVCA 1E79D 2HPHA 3KJZA 4HAXA 2DFPA 5BWOA 2R85A 4EHHA 3FVWA 1MQAA 3PPWA 3R6LA 4DFDA 1A8QA 1E98A 1PNTA 3QMMA 2IEGA 4IGAA 4AJ9A 4UHBA 5KU1A 2BUBA 3IIIA 4JEIA 2ZBEA 1Z26A 3ZDZB 3W79A 3S55A 1FDSA 3RBVA 3FWKA 2G9RA 3R0JA 3QYAA 3FNQA 3D3EA 1QOZA 3S40A 3X3HA 3M3DA 1PJTA 3BTVA 3KKKA 1KY4A 4RLSA 3UMRA 2ZK7A 4B40A 1AKRA 1MF7A 1O95D 2WVAA 2YN2A 3ZEAA 3LX8A 2P9YA 1P4RA 1AVTA 4NS1A 4YN3A 2AJ8A 1F48A 4HPXB 5J4LA 3KSUA 2OC9A 3AFNA 3N3BC 1EK5A 2VH5R 1HDIA 2CLDX 2VPTA 1XZGA 2WTNA 4EFMA 2HA0A 3P2OA 4M1KA 4PX9A 4WLOA 5T4HA 5JNWA 1H4TA 1CF4A 3ZWYA 3OZXA 4M0LA 2PFKA 2ZJ6A 4RQUA 3PXEA 3S1SA 2OYSA 3GMDA 3A37A 5ULLA 4GWGA 1H6AA 2K6GA 4BYGA 2HR1A 1RCFA 4RCNA 2ZULA 4IO1A 3W9UA 2HQRA 4K46A 2OPHA 1OF1A 3TZEA 1TU0A 4L08A 3TZCA 5KTKA 1Z0JA 1ZIYA 4MTLA 5L3ZA 1CS0A 1P2UA 3RBXA 4Z3KA 2VP4A 3OJLA 2IS4A 1D6JA 3QY9A 3MHTA 1H3FA 2GERA 1Q16A 5FHRA 1D2AA 5L8VA 1K88A 5EIXA 1NVKA 2HZBA 1P9WA 2IDZA 1QOPB 1O6ZA 1QIJA 3H9CA 3J7TA 2XZDA 3OAAA 4RAOA 4HY3A 1CU1A 1O6BA 4E0BA 2BFMA 3A1NA 2X0KA 1J7XA 1O2DA 3TZBA 4G4SP 1PKEA 5K9ZA 4J07A 2BEVB 1L8XA 4KN8A 3TOSA 4A0QA 3PQCA 4KPGA 4ZA2A 5BYKA 2PX4A 4GRAA 3VQTA 1Z13A 1CS4C 5BMVA 2AF3C 4AG6A 4HR7A 5C46F 4QEKA 4K8OA 4DCTA 3N28A 2WHXA 2BBSA 1NJGA 2ZR8A 3IBYA 3NC4A 4BECA 3ZW8A 3CX6A 1Z2CA 1HYHA 4HMQA 3NONA 4L8LA 1C29B 2PSSA 5F1YA 5CFPA 1TYAE 4MKIA 3MUEA 3V4RA 1SU7A 2QL6A 3AIOA 2HW5A 4P2BA 4RORA 2WTAA 1Q83A 3L4KA 1L5RA 1TT7A 2OUKA 4WKPA 1OZAA 1XB2A 2BDUA 4K6GA 3ZU6A 2PRKA 3A0UA 4TMWA 3KUUA 3TZLA 4FGWA 3MT0A 1K5HA 3NX4A 3PGVA 4CM7A 1VRWA 2YHSA 3B8HA 5EWLA 3H6KA 4EUSA 2ZM6B 1W8DA 2MIIA 1G2IA 1R0CA 5K8LA 3ROEA 3A36A 4REQB 3THSA 2RHBA 2ZUTA 5AVOA 1AXGA 3SU8A 1HDXA 1T0JB 5GP1A 1DO0A 4L0DA 2ZIUB 2FZWA 1YZQA 4DHEA 5CHEA 1PR0A 2RGEA 4NE2A 3EARA 4RVGA 1IAQA 5I7FA 2YWEA 2HSJA 4GW3A 5G2OA 4NQZA 1HNXB 4BY9E 4IX1A 5K0SA 2C5HA 2G67A 3BKWA 4Y7DA 2ZYGA 3BN3A 1P0FA 2QD4A 3PIIA 4TS4A 2YWBA 2UZ3A 3CLVA 2ZBFA 2BSQA 4UVDA 2WY2D 5F33A 5FDFA 1YQGA 2B1QA 1ZVKA 4I9NA 5AJUA 1KF0A 5D6OA 4DMFA 3HUFA 3U9SB 2OAEA 4NE9A 4AIIA 4C4AA 1COWD 5FPPA 1GTJ1 1IHOA 3P96A 4JI6B 2RSLA 5K01A 2OVFA 3G88A 3IDZA 3KL4A 3OF2A 3ZHZA 2WJYA 1DAIA 3TDKA 4BQOA 3RV4A 4QUKA 4UU1A 4N5DA 5TPZA 3LT2A 2V7EA 3GUHA 5C53B 9MHTA 3AHEA 3HV2A 1VYTA 2BI7A 2VDNB 5FI3A 4AB1A 2BUCA 2XQGA 4JT8A 1T5OA 5BSMA 4AMBA 1E1QD 1GPDG 1V39A 2C00A 3GLGA 2AHOA 3OM9A 1Q3TA 2WAYA 4B33A 1HL3A 1T1GA 4PX5A 4DCPA 5HKKA 5LBIA 4QYWA 2YWDA 4KQ6A 1RQNA 3EGXB 1M83A 3ZQUA 4D5GA 2X40A 1S9HA 3W7BA 5A4JA 3G3EA 4CM4A 1UDBA 1YUNA 4EMTA 1U7DA 1XROA 2VOJA 3DE0X 4NSNA 4BNUA 2CDAA 4V0LA 2QSZA 3NC1C 5H83A 1ACMA 1YDHA 4L22A 4H4DA 3PLRA 5FBZA 1LSUA 2Q4RA 2OFPA 4UAGA 2PGDA 3T88A 1CXZA 3G0DA 3TXAA 3IQDB 1OZFA 3ICVA 2E9SA 5BW8A 3PI6A 1QYRA 4YCNA 3DCNA 1I7DA 4QOHA 3E7WA 3S70A 1IBKB 2C3YA 2WK1A 5L7YA 3G8CA 1YB5A 2G6TA 4YRPA 3NWOA 1K4YA 1DHRA 4XCVA 1UQUA 5FUMA 2DYKA 3EIWA 3KB2A 2VPXA 3KTFA 4LMAA 2V0NA 4G9GA 2YMPA 5F3RA 1FYEA 4L9AA 4B3CA 2IOFK 4O25A 3AINA 1BX0A 1NPDA 5H59A 4W9RA 3FTQA 3QPAA 1S2GA 3EXEA 1U4OA 3SNKA 1BU5A 3VPHA 1VLMA 3UC5A 3NR2A 4CXMA 1SVUA 3IODA 4KAAA 3H1FA 3RSIA 3ANSA 1WCIB 1J8MF 2L0XA 3CSDA 4KR0A 4EJ2A 3KTHA 3ZY3A 1C1DA 2J45A 4F3YA 3NTQA 4RSMA 2HQSA 2NV2B 3JQBC 4Z7JA 4CM3A 2P0EA 3OZDA 4GG1A 1E2IA 4C3OB 4BQEA 2IHUA 5F98A 2DTXA 2WKWA 3X1YA 2JKVA 1ADFA 3K4HA 3OAAD 1FOEB 5BRAA 1I3OA 5IM5A 3UMSA 1Y6QA 2LKCA 3X1MA 1I2CA 2IYXA 3NBFA 4BQFA 3AR2A 3QXHA 4Y2QA 1N6RA 5G4KA 4LVCA 3OJFA 2V6JA 5FUYA 4IV0A 1Y0BA 4UOEA 1RLIA 5G1QA 3KTKA 4JODA 4X45A 5I7WA 2FBMA 1L7NA 1QAOA 4HNVA 4QEZA 2YW2A 3O47A 4TTIA 2A7XA 2PJZA 4S1PA 1RXYA 1ZMBA 3QWIA 3K94A 1QG4A 3GP3A 1A2KC 2QJWA 1LF0A 2PJRA 2OO5A 2B35A 3U7QA 4JI7B 3U39A 3EVBA 5EJ2A 2ZAGA 2JH9A 3QU5A 1L4FA 2W6PA 2YWFA 2V5UA 1QE5A 4RK4A 5C7YA 5CB4B 5JH7F 2WHEA 2H7YA 3W0LB 1SQ6A 3HQ4O 5LYJA 5LP6F 1F17A 3B53X 4KU4A 1D3AA 1X2BA 4OEHA 3LLVA 3MT9A 4XIYA 3PRKE 4B2YA 4JBYA 1CUGA 4ACAA 3GLIA 1UXOA 5HTKA 5JXIA 4HGZA 4MS4A 4AO7A 1ZKMA 4S1NA 1Z4MA 2OFWA 5AVWA 1VJTA 1M2HA 4DC9A 1ZP6A 3WK9A 4AXXA 2X7JA 3C3JA 5KPDA 1KDRA 4DT1B 4ETWA 5IULC 2AW3A 2FRDA 1K9SA 4L50A 6YASA 1DC8A 2WUGA 2XB6A 1SBNE 1RC1A 3I09A 4QOIA 3TEMA 4E12A 1PIWA 2AHRA 3PCRB 4H3SA 3RRXA 1IC6A 3EVDA 1Z16A 1XQYA 5E4TA 4IIXA 1MVNA 2V7UA 3N8NA 4HLUA 5CA1F 1HO3A