2X58A

The crystal structure of mfe1 liganded with coa
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of Liganded Rat Peroxisomal Multifunctional Enzyme Type 1: A Flexible Molecule with Two Interconnected Active Sites
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 268
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2x58A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x58A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2x58A01
5G4LA 1YG8A 4BNZA 3H65A 1EDZA 3HB5X 4NU6A 4YR9A 4YT2A 5I7FA 1MP0A 3F5SA 4HNGA 4R68A 2I66A 2DPGA 4G81A 4QX6A 4TRRA 4BGVA 4ASIA 3K5PA 1OZAA 3UXYA 2FWMX 4NNQA 3EDMA 1ZXLA 1IOLA 2PV7A 2GDZA 2F6QA 2EJ5A 1EEHA 1H0KA 1UYTA 2UZFA 3AI2A 1ZVMA 3EAGA 4LRTB 3W8EA 3GEMA 5C7LO 5IZCC 2OHXA 4CLRA 5DF1A 4RL6A 2VHWA 3ANLA 1PWZA 3JQ9C 3BMQB 3U5TA 1K6JA 4CMIA 1I8TA 2E49A 3CKYA 5GZ6A 1SAYA 4AICA 4PLGA 4IZIA 3RU9A 3DOCA 4ZVVA 3JQFC 5F3RA 2Z1MA 3PRJA 4K1LA 2J3JA 4WCFB 4CMGA 4DVJA 4OQZA 4DLLA 5L4SA 1B8PA 3VDRA 1YB4A 1DAOA 5A02A 1SZJG 2Q1WA 1N1EA 4UVHA 1I0ZA 2P9CA 4CQMD 2X8LA 3C7DB 3ZWWA 4JBHA 2PNFA 4CMIB 2WEKA 3H8VA 3W4KA 4MVJP 3PQEA 4U19A 3F3SA 4BO1A 4II3A 1BDBA 3W4JA 1DCIA 4DBVO 4XA8A 2BF7A 2YHUA 5EESA 4MVJH 2NACA 4BHTA 2CSUA 2P5UA 2AG8A 1C1XA 1PS8A 3TFQA 4P4LA 2WJPA 4IGEA 4J7XA 1YBAA 2G82A 4QEDA 1B26A 2FR8A 3NJDA 1M75A 3H0SA 1MB4A 4IZDA 4F6CA 4IGFA 5TNXA 3FN4A 1B16A 1YL5A 3LU1A 4R41A 4L9RA 3AU9A 4E21A 7MDHA 2NQTA 4JJGA 1Q7BA 3TV5A 1R16A 3JQAA 3GVPA 5T8KA 5C37A 5KJFA 1TXGA 4Y6PA 4MIOA 5JMPA 1E3LA 4PLVA 1GQ2A 5G4KA 3KTKA 4BO2A 4E2ZA 3ICCA 3WGTA 5L7TA 3NX4A 4W7IA 4FQ8A 1F14A 4W6ZA 3DHEA 1I01A 3ST9A 3MWDB 1HKUA 3FSRA 4IXWA 3UCEA 3V2GA 5L7WA 1Y7OA 5JBXA 4LK3A 2FW2A 1U2GA 2C5EA 1N6DA 4ND2A 2RHRA 5EN4A 4MPDA 1GZ3A 2WSBA 3KHUA 5CP8A 4E31A 3FPLA 4PG4A 3ST7A 2RAFA 2X22A 3I9NA 3QE3A 5DP1A 3AK4A 1EUDA 3R6HA 3DDNA 4XCVA 1UYRA 2H5LA 1E3EA 1AE1A 1E7YA 2BH9A 4GVLA 3UOGA 4AJ2A 3GVHA 4BNIA 1R15A 1K6XA 3KSZO 3IB9A 1UDAA 4RLSA 1ARZA 1Q7CA 3QJ5A 4BL5A 1D1TA 4W9NC 1E6WA 1GYRA 2XAAA 2B35A 5AYVA 4U5QA 3ZU3A 4YT8A 4ND3A 4ROSA 2X5JO 4AJ4A 4YJGB 1VJ1A 4TQGA 1HDZA 2CF5A 5ES3A 1BXZA 2HMSA 3JYLA 3VH2A 1UAGA 3UICA 5JDIC 1PZFA 1E3JA 3DTYA 2YJZA 4BNMA 3PWSA 4EUEA 2P9GA 2YW9A 2QRJA 4NBRA 1UDBA 3RC7A 4JOTA 4HX5A 1QSGA 3ZU4A 1GPJA 4FNDA 2CDAA 2ZQZA 2X9GA 4BNGA 3DZIA 4E4YA 4HFJA 5KJ1A 1C1XB 1FC6A 1P0FA 1VPDA 3TZ3A 2CVZA 4L4RA 4BNKA 4Z0HO 2VZ0A 1GEGA 2VZ8A 3IP3A 1RJNA 4JBIA 2Q4EA 4BUCA 3DBHB 4DL9A 4CODB 2FP4A 1UZLA 4IDCA 5AXCA 3SX2A 1KERA 3W6UA 3L4SO 4WLOA 2HDHA 3G79A 4OJNA 3AOGA 5JC8A 1T26A 5H81A 4B8ZA 1RYEA 3OEWA 3X2EA 1JVBA 3OC7A 2DUBA 3KOUA 3PHGA 4RVFA 1IHXA 3WG9A 1Y8RB 1GPDG 3QLJA 4OOFA 4Z9XA 4IDGA 4MKRA 1BSVA 5DUFA 4FS3A 1UP6A 2W4QA 1R4NA 3K30A 3AM5A 4UVGA 2W98A 3PYMA 1EY3A 5JO9A 5I7SA 1EQ2A 2WWRA 5ADHA 2NM0A 1Z73A 1G0NA 2X0RA 3U9RB 4UUOA 3WGHA 1HE5A 3QHAA 4CMEA 4A73A 1XCBA 2DPHA 5JCJA 1IZ0A 3GFGA 3A28A 1UXKA 1B2LA 1XKQA 5ICSA 1EF9A 3PLNA 1ON3A 2HK8A 4LRSB 4MVJG 2D1YA 3NDRA 3WIEA 4F3YA 4MOWA 4OIMA 4FJWD 1NZYB 4J9VA 1BW9A 2OP0A 3G1TA 1KC3A 2FR0A 4O5OA 2EGGA 4OKIA 5I9NA 3AY3A 2D3TA 5ILOA 3VZRA 1SZOA 3H0UA 2YV3A 5AXAA 3OJ0A 2OOSA 4XYBA 2AE2A 3WSVA 3WIDA 4I1IA 2X86A 1ZIDA 1DIGA 4WOJA 2CNBA 1X1EA 4RO0A 3GC6A 2P5YA 2X4GA 3ADOA 1DIAA 3GY0A 1OC4A 1XLTA 2WD7B 4LCEA 5B4TA 1I24A 3N7UA 2BZRA 3PJFA 3UKOA 1JAXA 3B70A 5KKCA 4FN4A 4GVXA 4CLHA 2V6GA 4BVAA 1QYWA 1JKJA 2O3JA 4EJMA 4YAKA 2PGJA 3NTOA 5KDRB 3RROA 3TQHA 1XELA 2JAPA 2RBEA 4CL3A 2CUKA 4GPD1 3C85A 2VSUE 1XQ1A 1WZEA 3F9IA 4MXIA 2GTRA 2Z95A 1FDSA 5A3JA 1UP4A 1DDOA 1HDXA 4RJTA 3T88A 2O2YA 1NYTA 2UVDA 4ZDDA 3PJEA 1V3TA 1H2BA 4J7UA 2PZMA 3WNQA 2GGSA 1P33A 3CE6A 3HFGA 4LSMA 5DP2A 1I3MA 2HAEA 5L9AA 1NWCA 4FJ1A 4LMPA 4LVCA 1PTJA 5A1TA 3OT6A 3DAFA 2I3AA 4NFSA 5G0UA 3PQFA 3AFNA 3FCOA 4IS3A 5TJ9A 1VRWA 2IRWA 3E9NA 4MIYA 3GQVA 4WASA 3PGJA 2X7HA 3H5RA 1YQGA 1DBVO 2JHFA 5CDTA 2ZTUA 1NAIA 3OHSX 1J7XA 1R4NB 4LK5A 4H3VA 2Q2QA 1UXGA 3JD4A 1U7TA 3BMNB 2OL4A 4YT4A 3I6QA 1JTVA 2B4QA 5K0ZA 1E3WA 4GGPA 2Q3EA 5HM8A 1XNYA 3KM0A 4YLHA 2HK9A 3KYBA 3GRPA 1N9GA 2BFOA 3L3SA 3IL2A 3UHAA 3DHYA 2NLOA 3C7AA 1YH3A 1KETA 1PR3A 5BNIA 3PI7A 1DFIA 1ZK0A 5F1OA 4PG6A 4A5OA 1H2HA 1R6DA 3C1OA 3T4EA 1LQTA 4IIVA 3RKUA 2Q99A 2PY6A 1D8AA 4XZ3A 3HDJA 4RZIA 5CTBA 4U6SA 3NV9A 3B6ZA 1XO6A 4PIVA 4WEQA 3TT7A 3ZV5A 2OORA 1U4OA 1ADGA 4WKGA 3U62A 4WCZA 4J1SA 3K6JA 3PEFA 4RPGA 2ZB7A 4EDFA 3OJEA 3JD1A 4IMRA 1DLIA 2VX2A 3PWKA 2ZKLA 4BO3A 1GDHA 1GL3A 4GLOA 4UVIA 1BTOA 1P44A 2VYVA 2WYUA 3WMWA 1AUPA 3PDJA 3Q11A 3PP8A 4KTTE 1ZJZA 3L77A 3BTVA 4EW6A 1R0KA 3KZVA 1PIWA 1VSVA 4E2YA 4EJ6A 4FB5A 1ENPA 1Y5MA 2G5CA 4R51A 1X0XA 4IJWA 2NWQA 4NMHA 3GPIA 1PJSA 2VSUF 3STAA 2X23A 4ND5A 1N7GA 1GEEA 1BDMA 3Q0EA 1UYSA 5DU6A 4GMGA 4KUHA 1PJ4A 3QIVA 4ONEA 1T1SA 3I9OA 2NNLD 4YVFA 2PGDA 2IYOA 2QZ9A 3AWDA 4DUPA 5AXBA 2DM6A 1MG0A 4B4VA 3ZNPA 1CDOA 5KVCA 3SJUA 1ZSNA 5F21A 3KTDA 4ALNA 3EVNA 4PZDA 2PKRA 1YDEA 4K6CA 2C7VA 4QT0A 4CR8A 3MOYA 3TLFA 1OOEA 3D3WA 2NQ8A 2UYYA 1F8FA 3O03A 2FPIA 4ZQBA 3GEGA 4TKMA 1M76A 3PTZA 3QSGA 2ZL2A 3T7EA 4OH1A 5DDIP 3E9MA 5JDCC 4HNKA 3WTCA 3H2ZA 3INGA 5C9GA 4FB8A 3WOHA 2I67A 4WLEA 3EC7A 4AL4A 4F45A 4CM4B 3F1KA 3EZYA 4OL9A 3N6RB 4LSWA 3ZWYA 3W6ZA 3ETEA 4BMSA 5JY1A 5JC1A 3CIFA 2J8ZA 1KVUA 2VHVA 1S7CA 4YEDA 4EEXA 1LUAA 1J0XO 1HE3A 1TG6A 4R1NA 4DIBA 2D4AA 3GLQA 3ANMA 1W4ZA 2FHSA 1ZMTA 4NU5A 1B3BA 4YAGA 1E0DA 4E5YA 2YV1A 5KCZA 1N1GA 1B0AA 4ZDBA 4KQXA 3OA2A 3WMXA 4GI2A 4E0BA 4D46A 3TT6A 3E03A 4WLVA 3I9KA 3Q2KA 3VH1A 4MI2A 3K2BA 4Z0PA 3IKVA 1T24A 2R00C 4KTVE 3S1LA 4CMBA 1YE3A 3NT4A 3TOZA 4JP2A 1U3WA 1D7OA 3ENKA 3GDFA 3H0JA 5KVVA 2VT2A 4FGWA 2DUUA 4PLHA 4WZ8B 3PE8A 4RV9A 2BGMA 2Y66A 3AW9A 1BW9B 1XSEA 2Q1UA 1SPXA 5LDGA 3OQBA 1BRMA 4CMCA 4XYMA 5HWSA 4CM8B 1I32A 3QWDA 1NASA 2JCXA 2ZTLA 1WP4A 4ND1A 4DC1A 5IXYA 1K39A 5T6BA 5LCXA 2TMDA 4CR7A 3QXIA 3DBLB 3S55A 2OP1A 4YDRA 4CM3A 3DJAA 1PGPA 3WSWA 1EBUA 4XB1A 4U0JA 4DTIA 5KDRA 1EVYA 3S2IA 3EUWA 4ZQGA 4Q3NA 5JS6A 2D8AA 5TJHA 3H2SA 1K6IA 3LSYA 4PRKA 5INGA 4KWBA 1NP3A 1LDEA 2EG9A 4MVJE 2EXXA 5G2OA 1YOVB 5LC1A 5JAMA 3RASA 4CV1A 3IJRA 1E7WA 4ZHSA 1GR0A 1AXEA 3L6EA 4DQUA 4IUYA 3QK8A 2FRDA 1QG6A 3M1AA 1CF2O 1VL0A 4F47A 1MUUA 4J0FA 1ISMA 4I5DA 2YDYA 3EZLA 4DMMA 4JLWA 3R9TA 2Y1EA 5KTKA 2HJRA 3WQQA 3NGLA 1I33A 2V65A 4OM8A 1QYCA 4JCRA 4I8XA 4BGIA 1P1HA 5L40A 1WW8A 1CQIA 1ID1A 4L8KA 5DZKA 3WLFA 1CQJA 3LKEA 1P1IA 3INRA 3LT2A 1Z45A 3ZWVA 2OBYA 3R3JA 1BWSA 2FPPA 3CH6A 3ITKA 1PJLA 5H82A 2FBMA 2UV8A 3O9ZA 4BV8A 5JYEA 3L0DA 4OG1A 1V3VA 1YJQA 3TDKA 4G5HA 4I5GA 4Y98A 4NI5A 1FXSA 3CXRA 4JQCA 4WYOB 2DBZA 3P5MA 4EITA 4XIYA 4NIMA 4K26A 5BSHA 1CEQA 2CY0A 4RQUA 2I99A 2OUIA 3QVWA 1M6WA 1L7EA 4RDHA 1M6HA 2WM3A 3FWNA 1PZEA 1ZKMA 4FGSA 3O8QB 4Z9YA 2B4RO 4R69A 5CDYA 3JV7A 3WX0A 3TL3A 5T64A 3GGPA 1ENZA 4AJLA 1TYFA 3VH4A 1AHIA 1R4MB 3OQ6A 4PG8A 5FEUA 4IXTA 4R4JA 3GR6A 2EEZA 1NBOA 2GZ3A 3RCBA 1LEHA 3WQRA 4U0HA 1ENOA 3ROPA 1DLJA 2ZIZA 3MCVA 2R00A 4ID9A 4ZQHA 1LDMA 4GH5A 2EIHA 3ZWOA 5G0VA 3ZWNA 1ZK3A 4U7WA 2FMUA 3O4RA 1HL3A 2RIRA 3ZV4A 3NRCA 4R01A 1E7QA 1PJCA 2Q1SA 4FSHA 5KJPA 4QFEA 3U9TB 4HFRA 1E3WB 2RCYA 3U09A 2QQ5A 3GT0A 2NU8A 4R1SA 4CQLB 1T25A 2W8ZA 3D4NA 5KIAA 3ZNOA 1XNVA 5JPIA 4E13A 4CLEA 3NJBA 4XRRA 4M49A 2VHZA 4YRAA 2PTGA 5IN5A 4RYFA 4D7AA 3UUWA 5L51A 1HSZA 1Q0QA 6LDHA 1PZHA 2PWZA 2VWGA 3GZNA 3JQDA 2ZL3A 1TI7A 4TZTA 4YTEA 1OFGA 2JFGA 3ONFA 2AHRA 4NR0A 5HTOA 4U0GA 3WWZA 3R9QA 1FDWA 5TS3A 2O3UA 5CDGA 5A3VA 1UUFA 1SEVA 3BTSA 1T2AA 3E5MA 1WDMA 2IZ0A 3PFWO 1EVIA 4QUKA 3IAHA 4DI1A 3D4PA 1BHSA 1ONOA 1A27A 2PD6A 1HNOA 3SC6A 2NP9A 4K2NA 3DEYX 5IN4A 1EBFA 3RUFA 3IS3A 2JKVA 3QMJA 1NQ5A 2SCUA 4IQGA 3BHMA 1YGYA 4YAEA 5EQFA 4CUKA 1N7HA 2DBVO 3G0OA 3HG7A 2DT5A 1MXFA 3KYCA 3LYLA 4WE3A 4WCFA 1MJ3A 3BPPA 2ZCVA 3R1IA 1NR1A 2HMVA 1YKFA 3DZKA 4CQMA 3VIVA 5I9LA 4R1TA 4AJNA 2NU9A 1FC9A 4B3IA 2FR1A 5TQVA 3JQGA 1LU9A 3ON5A 3VVBA 5JBWA 3W8DA 1NHWA 1I10A 1WXDA 4K29A 4R5HA 2Q49A 2CE3A 2Y68A 3U3XA 1KBZA 1ZK1A 3KETA 4EGFA 3V5NA 4OYRA 4O1MA 5K6AA 4FFNA 1X7DA 2DBQA 3A06A 2D2IA 5JAZA 3PIIA 3SXPA 5AXDA 1LJ8A 2GN6A 2IEBA 3ANNA 4GBJA 2XXJA 4J6FA 4FOSA 4BO5A 3D5QA 4J4HA 5AVOA 4FOOA 1Z74A 3ZDFA 3RC9A 4L74A 2J3IA 3C8MA 4R3NA 2QYSA 3JYOA 1NQTA 5I7EA 1AHHA 1R0LA 3DORA 4BNLA 1RPNA 4KUEA 2O4UX 2D59A 3OJFA 2ZATA 2QHXA 5L53A 1LX6A 1ULSA 1EDOA 5C7OO 4MVJI 1E5QA 4MOUA 4YJHA 4DPKA 5IXSA 3BMOA 1YJ8A 3WS7A 3I6IA 4OMRA 1S6YA 1TT5B 3L9XA 1A4UA 1WNTA 5B4UA 1GQQA 4Z3KA 1YL6A 4M87A 1PSDA 3KTGA 2OFPA 4YACA 1Z7EA 4A7PA 3QY9A 4N7RA 4U0KA 4MVJM 3MJVA 4C4OA 1SOVA 2Y0EA 3GGOA 3A4VA 5T67A 5T5QA 1LC0A 5THQA 2YFQA 2CMDA 4IDDA 4RVGA 3K92A 3PZKA 3MT6A 1I2CA 2Y0DA 5KJ6A 4BO0A 1HYEA 1LBEA 3JD2A 2B5VA 3BHJA 4HNHA 2UUPA 4Q39A 1HTBA 4XGNA 4ZA2A 4CPDA 2EP7A 4EJ0A 4DYVA 2NU7A 1H6CA 2J3KA 2I76A 3ZV6A 3GAZA 3QVOA 3O38A 2O7SA 5JO0A 3Q0JA 4ZDEA 2QX7A 3EVTA 1PEDA 3KB6A 4PVCA 3JU1A 5IFLA 2C5AA 3BZUA 1ZNQO 5A06A 3I3OA 2VWHA 1PU2A 3GMSA 3SJ7A 4U0GH 1JLLA 1KS9A 1VE9A 3HB4X 3OSUA 3QWFA 3GH3A 4WPGA 4CQMB 3NYWA 1DC3A 4JIGA 1BXGA 2D5AA 2Q50A 3AY7A 1UH5A 3EMKA 3ZWCA 2C29D 4BO8A 4IS2A 1KVRA 2GZ2A 4E12A 1DAPA 4N5NA 5EIOA 4IQ0A 4PG5A 2PH5A 1DIRA 1P1KA 1VRGA 4HADA 2VYNA 1ISFA 4K6FA 2ZQQA 3PEAA 2FZEA 1RM0A 4NK5A 4CV3A 2Y93A 1OMOA 5TC4A 5DZKH 2A94A 5BSEA 1IULA 2DAPA 2YYYA 3JQ8A 4DLAA 4I9HA 1KVSA 4WJZA 2XF8A 3DZBA 3UAGA 3M2TA 3HINA 5J23A 4HBGA 1FF9A 3E5RA 3VC7A 1BXKA 1EE2A 3FR7A 1L1FA 1G0OA 4NFYA 3S2EA 4B7UA 1XHLA 3BMNA 4UEOA 2BKAA 4JJTA 8ADHA 2FPGA 1JA9A 2V7PA 9LDTA 1SB8A 2C2XA 5B1YA 3FNEA 3CZRA 3JCZA 3QWAA 4RYFH 1QXSA 4YBZA 3DBVO 3KVOA 4YYZA 1HLPA 3GMAA 1H9AA 4PZEA 3JD0A 4D41A 2GSDA 3KO8A 3TSCA 2O3QA 1RM4A 1X7HA 3AM3A 3D4OA 1PGNA 5G0WA 4II2A 3V2HA 3GOHA 3RBZA 3DZGA 5ITWA 3FDUA 1TVEA 2NTVA 3JQAB 1PIXA 3VTFA 4BQRA 4WCDA 5CTCA 4NZ9A 3I9MA 4OAQA 1QYXA 4FFLA 2YY7A 1BMDA 4TWRA 3WGZA 4NQZA 4EUHA 3M6NA 3R0OA 1U9JA 2WDZA 1YBMA 2NVUB 1CERA 2Y05A 1NFFA 3G1UA 3FWZA 1KIFA 4L4SA 2IODA 1Y5RA 1GY8A 3N74A 3VZSA 3ROQA 3KEQA 4CJXA 3RQSA 3HFSA 4CM7A 4CM1A 1HZDA 2I6TA 4E30A 5IF3A 1HSOA 5U9CA 3ABIA 3KLPX 5E0SA 1LA2A 2NTJA 4QFDA 1O8CA 4MVJD 4OSOA 5TLSA 4M55A 1PJQA 4DREA 1RJMA 4RZHA 1GV0A 3INTA 3FTPA 4G65A 1XNWA 4HC8A 1FDVA 3PHHA 2YV2A 3OH8A 4RF5A 1J6UA 2PR2A 4XDZA 3DONA 3AU8A 1H6AA 4G2RA 1OD2A 1SNYA 2GZ1A 1SO8A 5K6AC 2J5GD 4S3MA 4MINA 3WWYA 4CMJA 4EMPA 1O0SA 2H1SA 3OBBA 2PA3A 3D0OA 3AY6A 1P1RA 4FJ0A 5GZ3A 1E1KA 3T3WA 5ENVA 3CEAA 3FD8A 3P5SA 5JDIA 3BF0A 3IUPA 1Y1PA 1T2DA 4Z6KA 1EUCA 2HO5A 4BNVA 3H9UA 2XOXA 5CPBA 2C82A 2UAGA 4KMSA 1ZXBA 2VT3A 5U4QA 3D3WB 2IE0A 2Y99A 4GWKA 4WLUA 3V2UA 3I5MA 5DCUA 2Q1TA 2VOJA 1WDLA 2QG4A 1PWXA 3VDQA 9LDBA 2HMTA 2EJWA 1EQUA 4AJ1A 5KJCA 4E5NA 3NJ8A 4K3WA 1NFQA 3ITDA 3ONEA 3WTBA 4B7XA 3B1KA 4ELXA 4IBOA 2HK7A 4DLBA 2ZB4A 3DMTC 3LAOA 1VSUA 2B4TO 4WK6A 4FCCA 4RORA 1IB6A 1HNUA 1DHTA 1ZCJA 4E3ZA 2X6TA 3E18A 4DC0A 3PK0A 3HZZA 3DBHA 4A03A 1HLDA 3DFUA 3ZU2A 3AOEC 3EGOA 2B37A 4WLNA 2F1KA 2E48A 3SLKA 1ISGA 3NUGA 4XQ9A 4RQTA 5IDXA 2EW8A 5CFZA 2NV6A 1Y6JA 3QQPA 4OGWA 1JXZA 5MDHA 3CUKA 3UGKA 2BMAA 4IIUA 3STHA 4CM6A 1DC6A 5L45A 3LC7O 4KD6A 5DOVA 1HDCA 3TZHA 5A05A 2YQ4A 1NNUA 2DTXA 3WGOA 1W6UA 1JWBB 2H63A 5DULA 3QREA 3BA1A 4JSBA 1PQUA 1V0JA 4GX1A 2FOIA 4AJOA 5TIIA 3ZHYA 2Q2VA 5CEJA 3NDJA 5COAA 1U7HA 2H9IA 2ZQYA 4BQPA 5C5IA 1CETA 5EPOA 1ZH8A 4BNUA 4J0EA 1TEHA 2BGLA 2G0TA 3VAZA 3D64A 3I23A 4CV2A 5DUCA 2BELA 1RM3A 2ZJ1A 3PPIA 4X54A 1D1SA 1ZZEA 1E3IA 3VPHA 4BMNA 1GAEO 1P9LA 2P9EA 4P38A 2F9IB 3AFMA 1X15A 2QRKA 4A26A 2YUTA 1JN0A 1YQXA 3R0IA 3W8FA 4BNJA 4WEOA 3WLEA 4B4WA 1C1DA 4J91A 4UULA 3ZH2A 2JFFA 3H3JA 3RVDA 1T2EA 2CZCA 3KSUA 2CF6A 4BKUA 2VREA 3GN1A 3SVTA 2PG8A 4AFNA 2O50A 2R6JA 4RVDA 5HBRA 2QQ3A 1M2WA 1DPGA 1PGJA 1ENYA 2PKQO 3MOGA 3M6MA 4HV4A 3B1FA 3Q3CA 2C8TA 1Y9AA 1YOVA 4K28A 3MTGA 5U1PA 3TPCA 5I8WA 4DQXA 1XQ6A 1P45A 1HE4A 3VOSA 3WGGA 3QVSA 4XEHA 4YB8A 1FK8A 4BKQA 3RFXA 3LLSA 2VWQA 4L8VA 2GASA 4AJIA 2P4HX 1R4MA 1I30A 3MYBA 1E1NA 1MGOA 5JCJD 5TT1A 2BFMA 3BXXA 4JN6B 1CRWG 1T2CA 4O6VA 2EKLA 4KWIA 5L95A 1HETA 3COSA 3D7LA 3Q7HA 3HJAA 3RUEA 2PLAA 2B69A 4Z3DA 4R54A 1O94A 4YXFA 1DUBA 3TVWA 3ZWXA 3L4BA 4HY3A 5IDWA 1O6ZA 2Y1FA 4IZHA 4D45A 5DCYA 2EHDA 3Q2IA 5FF9A 5BR7A 2GYYA 2F00A 1UXJA 3WDSA 3KUXA 4OHUA 2JAHA 3ICPA 1DO8A 5JNLA 3KTJA 2YZ7A 4WECA 1KVTA 4BIIA 5KJEA 3A9WA 4IJKA 1R12A 4NH4A 3LVFO 1KYQA 3DXFA 3S2GA 4S1VA 4BOYA 3C1TA 3GHHA 4J7CA 2O23A 4RPHA 4YPOA 1Y7TA 1LDGA 3JYQA 4LVUA 3H7AA 1X7GA 4B4UA 3FNFA 4OXYA 3NJ4A 4DPMA 4UUNA 5BT9A 5AQ1A 4CLOA 3IBBA 1A7KA 1XU9A 3ZW8A 4PLCA 1ONNA 4U18A 4XRGA 2F9IA 3BTUA 4XQCA 4HFNA 1ZEMA 4PVDA 3N58A 3NTQA 1VM6A 3O8QA 1WZ8A 3HN2A 4KDEA 3B20A 1FCFA 1GD1O 2ZK7A 5BQFA 3KQFA 3E6AA 4A10A 1KY5A 4I42A 3OECA 4EZBA 2BLLA 3LZ6A 4CL8A 4I9UA 2EF1A 5JY6A 5A9TA 5HS4A 3KXDA 3V1TC 3FR8A 3MJTA 5EERA 4FZWC 2B36A 2VSUC 3BIOA 4DPLA 1YO6A 2DU8A 4KPKA 3K2EA 1ISJA 3JQGB 2VTDA 1C14A 4WCFC 4Y67A 5JAQA 3PYXA 4JVTA 3GK3A 4CM8A 4O63O 3VPGA 2ZB8A 4A2CA 2CDCA 4KDFA 4PLYA 3ZN2A 4JXKA 4GX5A 5KOIA 2Y1GA 1YBVA 2FZSA 3F46A 3JYNA 1I36A 4R9SA 3GAFA 5BNFA 1ZSVA 3WGQA 3TZCA 3WJ7A 5JDCA 1LRJA 1LNQA 1L7DA 1ISIA 3BAZA 1XGKA 5GZ1A 4INAA 4HUJA 2C54A 1PGOA 1PX0A 2R2GA 2BFPA 4IJVA 3LT1A 2DVMA 4AJKA 2JD2A 2AA3A 2VOEA 1LDNA 2GN9A 4LMRA 2WMDA 1R66A 2VUSA 1T2FA 4TVBA 3DTTA 4OO3A 4XJTA 4ZDCA 4BB5A 1GFSA 3GDOA 3M2PA 3U4DA 4ELSA 4P22A 5INFA 3M6IA 4WGGA 2NU6A 1KOLA 1IE3A 2Y1OA 2J6IA 1ZJYA 3QA9A 1T4BA 1NTOA 4E33A 4JFCA 2O7QA 3BHIA 1TB4A 1NWHA 2A35A 1JQBA 1CYDA 4ALMA 2PZLA 4J1TA 4D42A 3HUDA 1LDYA 2YFHA 3WBBA 1FDTA 1Y8QA 1YWGO 1ZK2A 3AM4A 2GRAA 3DMTA 3ZU5A 2EW2A 4KQWA 2C2YA 3PJGA 2J5GA 3ZWAA 2C7GA 4TMFA 4NBVA 5EMHA 1WZIA 4IMPA 4YWJA 1MFPA 2ZQRA 3L6DA 4R3WA 3S2FA 3ZZNA 3K50A 1WAMA 4UREA 1JKIA 4W4TA 2AEJA 1IHYA 1SBYA 1I2ZA 3GG2A 4BNXA 1B15A 3HDHA 4NBTA 3F47A 4UEKA 1SB9A 2A4KA 5FI5A 3LF2A 3U4IA 3WQSB 4P8RA 1UYVA 4DIFA 1PZGA 1DC5A 1F0YA 1MV8A 1U8XX 4XR4A 3WG5A 3L6OO 3CMCO 8LDHA 4UVDA 1VI2A 2W2KA 4NJOA 3WGYA 3GVIA 4GQAA 1YB1A 4GWGA 4J2HA 4W9NA 5ER9A 4AJEA 1A72A 1U3UA 3G49A 4E5MA 3GZ4A 4BO6A 2VSSE 3L9WA 4GKBA 4O59O 1LXCA 1BVUA 1EVZA 4M54A 2OMEA 4H7PA 3I9LA 1E6UA 3VTZA 4NEKA 1BXGB 1NR7A 3JQFA 4NJMB 2HU2A 1ON9A 4I52A 2BI8A 5DU8A 2WD7A 3OIDA 2O3TA 4OKNA 3W4IA 5B12A 1E7RA 4AVYA 2IEXA 5IKLB 1IYZA 3DZHA 2Y67A 1EK5A 3F4BA 1NPDA 1VJTA 2G17A 5ITVA 3RIHA 3GDGA 4G2NA 4RF4A 4BNWA 1XX4A 3NT2A 1Q2XA 2X58A 1H93A 3ZI0A 1KEWA 5COBA 2NVWA 5E0NX 1HDRA 2W90A 3NAQA 2LDXA 3H9GA 2J3HA 2PZJA 1B3RA 3AUSA 3GUCA 2GNAA 2VQ3A 2VTEA 3HQ4O 4FN7A 2Y1CA 2O48X 4ALJA 4OXKA 4Q3BA 3TL2A 3HNPA 5KKAA 1LLCA 3GN2A 3JQBA 2BGKA 1C0LA 4IY1A 2X5KO 3ROKA 2GF2A 1NXQA 1A4IA 3KLMX 3R6DA 3T89A 4J1QA 1ZSYA 3Q6IA 1MC5A 1UP7A 3I83A 4Z0TA 4QFCA 2IXAA 1N6FA 3F4LA 4E32A 5G1SA 3TVUA 4HP8A 4DBZA 1IL0A 3U9LA 1E7SA 5KWEA 4JJFA 1QP8A 2CD9A 1DJQA 3MJEA 3RKRA 3B1JA 3TN7A 1SC6A 5CHEA 5CG2A 1Q51A 1W2XA 1KY4A 3NEPX 3OQ1A 3FTNA 1V6AA 2RH8A 2J5RA 1P3DA 2VYND 3IUSA 4RCVA 2IDZA 1K3TA 3H9EO 1ZBQA 4DXHA 1HF3A 1Y8RA 3GLMA 1P77A 4PLPA 2GD1O 1O8UA 1U3TA 4RVSA 4JYLA 1VKNA 3ORFA 1C3VA 4H16A 4JBGA 3I4FA 1K5HA 4CMAA 1JAYA 1NHGA 2NVUA 4B4OA 1P0CA 3AUTA 4B3HA 1FC7A 3BMCB 2DFVA 3LF1A 5IDYA 4BKPA 3SLLA 4TSKA 3OJOA 3DFZA 3KEOA 3QKAA 1J49A 4CV0A 1R0SA 1GZ6A 3DAPA 1WPQA 4XYLA 5JLAA 4CMKA 3LC2O 2GERA 4R16A 3Q1TA 1TLTA 2A81A 1JWAB 2OO5A 1E77A 1MLDA 4B8WA 5BSGA 3DBLA 2Q4BA 3BMQA 2IXBA 3SBOA 1X0VA 2VNAA 1SCUA 3GVXA 3MWEB 3WJAA 3FNHA 1DC4A 1MC4A 1LSSA 3P2LA 1D4FA 2RH4A 4BNTA 1YDWA 1ZK4A 3H9JA 2GCGA 3R9SA 4EUFA 2AQIA 3GNQA 5DN9A 1VC2A 3K96A 1QRRA 4D3FA 4EMMA 1EMDA 3VPSA 3WFIA 3PIDA 3NKLA 2PBPA 1A9ZA 2G76A 3RWBA 2X1HA 1LRKA 1H6DA 3T7CA 3MZ0A 3S8MA 1OC2A 2HRBA 4IJUA 1O9BA 4J4TA 1X13A 3GRKA 4ZRNA 1B8VA 1TT5A 4PG7A 2EGHA 1PL6A 4M1QA 1W0CA 3GG9A 3H81A 2V6MA 2A9FA 4TZKA 2VHYA 2CVOA 2IEDA 2VWPA 2X0JA 3TDCA 1LDBA 1PJTA 1Y9EA 1QKIA 2P68A 1U8FO 4LN1A 3H02A 5GMOA 1V9LA 1VJ0A 4GSLA 3JYPA 3RSHA 5INIA 1ADBA 1K89A 4D79A 2WYVA 1W73A 2CDBA 3OEYA 5K9ZA 3H5AA 1SOWA 2AQ8A 4IQ8A 1U2DA 4U8GA 1KEVA 2HKIA 3Q0GA 4KUGA 1GU7A 1DRUA 3VZQA 3QYRA 2AW5A 3T8AA 3TWOA 4JGBA 4P4GA 4ZQFA 1HYGA 1UJMA 3U4HA 3P7MA 3EY4A 2YHIB 4BO9A 4JYJA 2F9YA 5DU4A 3UCFA 2JD0A 4AJPA 4FBGA 2ZYGA 1C1DB 1RM5A 1UDCA 3DOJA 4NBWA 4KNPA 1NFRA 2FY8A 2HRZA 1SG4A 4ESOA 4XDYA 4GHNA 3U49A 1SEPA 3DR3A 4NBUA 4PRLA 4QO8A 2AMFA 1DFGA 4JCSA 4MIEA 3ZHXA 3LT0A 4PFJA 1AN9A 4YJFA 3GPDG 2DBRA 2DQ4A 3OIFA 2DC1A 1MA0A 4FFOA 1Z75A 5CDSA 1QMGA 1NX6A 3C1AA 3I52A 3PZRA 3W1VA 4MJLA 1P74A 3OJLA 2YDXA 4Q3AA 3DB2A 3V8BA 5F1KA 3VZPA 1N2SA 5HS6A 1GUYA 1QR6A 2VZ9A 2OXIA 1DRWA 4B7CA 2DFDA 2LDBA 3UVEA 3P85A 1A7AA 1OBFO 1LC3A 3AOEA 2EERA 4JWVA 1DIHA 4OQYA 4WUVA 2HCTA 4J90A 4D43A 1M67A 4UUPA 3VKVA 3LQFA 3JQAD 2V6BA 2W2LA 4ND4A 5EJ2A 3SLGA 4JCTA 1KEUA 2VSSF 4XGIA 4YQZA 2J5KA 1Q0LA 1NVMB 5AOVA 3OIGA 1E3SA 3GNTA 4IPTA 3JQ6A 3MJSA 1WMBA 4PCVA 5A5FA 3JQ7A 4FPXA 2E4AA 4GSKA 5G1QA 4J3FA 2GO1A 1GUFA 1KVQA 4JK3A 3JQBC 3EHEA 1F06A 4XWYA 1MXHA 4CUZA 1BGVA 2I5PO 5A5EA 3FI9A 2ILTA 4UVEA 2O2SA 4J16A 2QW8A 4FFRA 3RUHA 1FJHA 1EF8A 3FHLA 4URFA 2DUWA 2NUAA 3CMMA 1GUZA 3KTHA 3RBXA 3FBTA 5CG1A 2F6IA 3PGQA 3C7CB 3BEZA 2POQX 4MDHA 3WNVA 4XIJA 5KVSA 3T8BA 2NVBA 5ER6A 4CLRB 3K31A 2YHIA 4Q9NA 3DAGA 3GEDA 2EKPA 1DIBA 3GVCA 3AI3A 3IIEA 5DTWA 1YB5A 3DZFA 3I1JA 3GF7A 3K8ZA 1GADO 4RF3A 3G17A 4MP6A 3IAVA 1GTMA 3RU7A 5JYDA 5JAIA 3HRXA 1OI7A 3RUAA 1J5PA 4W82A 4PZCA 5C7IO 1N5DA 1E92A 6ADHA 3WYBA 3PHLA 2FN7A 3GUYA 4YJFB 5ENDA 1V3UA 2BD0A 5CEEA 5C90A 2P4QA 1HZZA 1C0IA 1NVTA 4EYEA 4I4ZA 3TF5A 3QP9A 4H15A 4E6PA 5DOZA 3RSIA 3QWHA 3CINA 4RPLA 2HJSA 1J4AA 2B83A 4WNIA 4A27A 2O3SA 5L3ZA 4ALKA 3MJ4A 1GCUA 4J1NA 2P2SA 2ZB3A 5TGDA 3E82A 3GF4A 5GY7A 2Y0CA 2VSSA 1NAHA 3NT5A 5G0TA 2A7KA 4DWVA 3KTIA 4D0SA 2O3RA 3NGXA 3JQ9A 4Q1IA 2X24A 5KNLA 4XR9A 4CM9D 1Y81A 1U5AA 3A14A 4XQEA 2O4CA 3OICA 1Q7GA 4ZDFA 3KV3O 3OM9A 4KWHA 3RAJA 1MFZA 5TSDA 1F17A 1ZMOA 4IZCA 1G6KA 4D44A 4IDAA 2EKQA 4BV9A 5A9SB 4L75A 4GGOA 4Q3CA 4YRBA 3WR5A 4QIJA 3E48A 2VUTA 2FSSA 4IDFA 5A4DA 3MFMA 2UUOA 4UUMA 1ISHA 5T8KC 3FPCA 1VKOA 2DTEA 3PQDA 2DKNA 4I08A 3JQ7B 5FI3A 4DA9A 2Z1NA 4WOKA 4IZBA 1KEPA 4GKVA 3ZW9A 4FC7A 3ZNNA 4YAIA 4D3DA 1UXHA 1Z82A 3HE3A 4FFMA 5G4KB 1P1JA 3D1LA 2IZ1A 3OF2A 3DO5A 3VPFA 4CM5A 3UCXA 2AEMA 4BNYA 3CSDA 2ZTVA 1GQYA 5T57A 2QIOA 3WYEA 2I9PA 1ULUA 2ZTMA 1CIVA 3DWFA 3T4XA 5CPFA 1Q52A 4KP7A 2D0IA 4FDAA 4YCAA 3RRVA 5FIFA 3TOXA 1PQWA 4PLWA 2EP5A 4IDBA 5EQDA 3FF6A 3A1NA 3HDQA 1C0PA 1N9GB 2X5OA 4TVOA 3ULKA 5JW6A 2PPYA 4FFPA 5F1PA 5TF4A 1FMCA 1B8UA 1P1FA 4NK4A 2GUGA 1O5IA 3EYWA 2PZKA 1ML3A 3WXBA 4MKZA 1TA4A 4J43A 3Q1LA 3CZMA 1IPFA 3O26A 2C0CA 2JJYA 2PGLA 1ZEJA 1B14A 1FDUA 4W99A 3ZCXA 4BNNA 3KBOA 3R3SA 1VL6A 4CLOB 5IZCA 3ENNA 3BTOA 4LISA 4C7JA 3QXZA 3K9QO 1M66A 4U1AA 1ZFNA 4BO7A 1BVRA 1JU9A 2IYPA 2AEFA 5F5LA 3AUUA 3SC4A 3GKBA 1HDGO 1EK6A 2VHXA 3FF4A 4HFMA 1LSJA 1HWYA 1QV7A 4BNFA 3ZV3A 4YQYA 3LC1O 2AQHA 2PKQP 3IC5A 3CTMA 3UH1A 1W8DA 3ZHBA 1V35A 3OFSA 2HUNA 4TRNA 2J5II 5A9SA 2VN8A 1DFHA 2JFHA 1LLDA 3ASVA 3VHRA 2PD4A 2Y1DA 4WNCA 5G1RA 4TKLA 4YJHB 1H94A 4Z9FA 4GL4A 4JNKA 2VNSA 1I3LA 1U4SA 3VKUA 1NQAO 1PJ3A 4IM7A 4NG5A 3RI3A 4BGUA 2HMUA 1JVSA 1YXMA 3GNSA 3ASUA 3TRIA 3AJRA 4QQRA 3ONDA 3TZKA 3DQPA 2HQ1A 2VRCA 3KYDB 4YJDA 1Z7BA 5TRTA 1N92A 1WDKA 4M89A 4ZJUA 3LK7A 4Y6RA 5IAAA 2EWMA 4FNBA 1DXYA 2VYVD 2W2KB 2HLPA 2PH3A 2F9YB 4HXYA 1NVGA 2H6EA 5ICMA 2ZL0A 3K8XA 2E6UX 3V5IA 2AE1A 3RC1A 1E1MA 4R1UA 5DCWA 4ZD6A 1RYDA 1PQPA 4GM2A 1IPEA 1LSUA 1G1AA 2AG5A 5KVQA 5DTPA 4HKTA 4MO2A 2XPCA 2GN4A 2EV9A 4N5LA 2CVQA 3BMCA 1UZNA 3X2FA 2OGUA 1Y8QB 1V8BA 4ITUA 3HLN1 4B3JA 3MEQA 4UAGA 4R5MA 1E6EA 4J49A 2FZWA 4EBFA 2VSUA 3G3EA 4Q3EA 2PD3A 3OP4A 4B79A 4MVJF 5DBGA 5JSFA 1SMKA 5I7VA 2JD1A 5FYDA 4BKRA 2GLXA 3P19A 3D5TA 3H0QA 2WTBA 2PK3A 3GF3A 4ELWA 2A92A 4M86A 3H9QA 1IY8A 3TJRA 3V1YA 5ILGA 3DZJA 5A9RA 1LTHR 2X9VA 3I4CA 1XYGA 2UDPA 2PFGA 1QYVA 4RVUA 2FSVA 2XXBA 4ALIA 4L73A 2DEOA 4BNHA 3QVTA 1K2WA 3JTMA 4EEZA 1H6BA 3ADPA 1LQUA 4JP3A 4XQGA 4IINA 1VL8A 3TZ6A 4XKJA 4FC6A 1EUZA 1GV1A 3K73O 3QRWA 3TFOA 3HP0A 2E37A 2Q46A 4J4BA 4MKXA 1XA0A 4TRJA 3DC2A 5IZ4A 3FBGA 4Q3DA 3OETA 1GCOA 3DOOA 1WWKA 3RUDA 4F6LA 2Q35A 4DIOA 5H83A 1D3AA 2AQKA 3PXXA 3F5QA 4Y9DA 4CM4A 2IZZA 1QYDA 1X14A 5COQA 4CMHA 3UW3A 5DKPA 1HRDA 5I9MA 4CQLA 2JHGA 3GZNB 3HHPA 3H3FA 3M1LA 3I47A 4AG3A 2Q2XA 4ILKA 3F1LA 4BO4A 3E9QA 2EJVA 1QV6A 4QO7A 1I3KA 1PR9A 1Q0HA 2BI7A 2Q45A 2HW5A 5JE8A 1WMAA 3EK2A 1PJBA 3L4BC 3PVZA 1ZUD1 1LI4A 3PLRA 1PS0A 3DMYA 2OBNA 4BB6A 3JSAA 5LDHA 4E5KA 3IJPA 3IKTA 1UR5A 4LW8A 3RFVA 1DHRA 3QVXA 2VCYA 4RPKA 4AJHA 5B4VA 2C59A 3KYCB 4XGKA 4ZU2A 4YJGA 5DBFA 2J5QA 4I9NA 4PLFA 4KOAA 1P31A 2X0NA 4I5EA 5B37A 4FZWA 2P91A 4E2XA 3UF0A 2G1UA 5CDUA 1Q1NA 4ZQEA 3SWXA 3ZHZA 1RWBA 2RHCA 4XJSA 1GZ4A 1ADFA 4J9UE 1GYQA 2CFCA 3LT4A 4UEJA 1H5QA 4BKOA 3NTRA 1DOHA 2B5WA 3H6KA 4FJ2A 3PYLA 4CUJA 1N6EA 4OXNA 4OMUA 4FW8A 2ET6A 4QSMA 4R9RA 4ZU3A 1KC1A 3CPSA 3GFBA 2I65A 3ETDA 3OMLA 3GGGA 3TRRA 4CR6A 4NPCA 3TZQA 1O95A 2CBYA 3RSTA 1U28A 3G64A 4XD2A 3WGIA 3WBFA 3UN1A 1ORRA 3P2YA 1B7GO 2OZPA 4LCJA 2C20A 3PGXA 1ZO8A 3U0BA 2J5SA 1EFLA 1VLLA 4IDEA 4WLFA 4DGSA 3DBRB 1AXGA 1CJCA 4P4NA 1DSSG 2GPTA 2TMGA 4BMVA 4L0QA 3H4VA 4OOEA 1HEUA 2WE7A 3ZNQA 1AGNA 4HWKA 4NNJA 4PGFA 5BNTA 2BFAA 5DL1A 4XYGA 4DRYA 3QV1A 3PJDA 4AJJA 1HDYA 3RJ9A 4QIIA 1HDOA 2GN8A 3H5NA 3HSKA 2ZCUA 1UZMA 4YAJA 1HT0A 4Y6SA 1U1IA 3PDUA 3HWRA 4RLHA 4RGBA 5DT9A 1HZJA 1T4DA 3JD3A 3TNLA 2X0IA 3Q9NA 3DL2A 3VVCA 2V6FA 3ZWMA 4OSPA 1PGQA 4E5PA 5C3MA 1IUKA 3RBVA 1PL7A 4BGEA 4QXMA 2W2LD 2D5CA 2HMWA 4JCOA 4OLQA 4Y8VA 5L4LA 1T1RA 2E82A 4CLXA 1YS4A 4GLLA 3SEFA 1R37A 3UFXA 3RJ5A 2NADA 1PJ2A 5HA5A 2X9NA 4NFHA 1YL7A 4F46A 1XU7A 4XX0A 4I5FA 2ZL4A 1YVEI 3GMDA 2GR9A 1NQOA 3RC2A 7ADHA 3HN7A 1UAYA 3PFFA 1A71A 4GX0A 2QRLA 1RJWA 1JW9B 1LLUA 2AXQA 2DLDA 1U5CA 1LLQA 4RDIA 1U3VA 4FN8A 2Q2WA 3IMFA 3VH3A 1XEAA 3OA0A 1MG5A 3NDIA 1QLHA 3P2OA 4W7HA 1UXIA 5F5NA 4MP8A 5L4NA 1NPYA 1I3NA 3E8XA 5DZSA 4Z0MA 4LGVA 3D3EA 2Q34A 2A7SA 1MX3A 2JCVA 3QW2A 1RKXA 5FWNA 3ROMA 1JDJA 2VRCD 1HE2A 4L76A 3HE2A 4MVJA 1F12A 4N54A 3QWBA 3IP1A 4XYEA 2WE8A 4YA6A 1WVGA 4J2OA 1EVJA 3WICA 3MTJA 3JQ8B 3RD5A 5E0SH 3PZBA 5TX7A 3JQEA 4NDNE 4NJMA 4GAEA 3LLVA 4CLDA 1YQDA 3F6YA 5CAEA 3ZWBA 2ZYAA 4ZRMA 4C7KA 4ZGWA 1BG6A 4O0LA 3DBRA 4ZN6A 1DRVA 1X0UA 3HADA 4A0SA 3Q9UA 1LSOA 4RF2A 3WYCA 2VUUA 4U6QA 5HRUA 5DNAA 1UIYA 5I8ZA 5FUSA 1I2BA 5DBIA 1YG6A 4FR5A 4QECA 1TT7A 3KYDA 2NSDA 3IOYA 5G0SA 4DYDA 4BS9A 3V5EA 3U9SB 1IZ9A 1PS9A 2DTDA 4JROA 1H9BA 1NPTO 2HSDA 1LRLA 1HXHA 4EI2A 3RUCA 2C07A 1A9YA 2ZYDA 3BMOB 1C0KA 3KRTA 4JJIA 1PL8A 1CWUA 3C3XA 2BHLA 1DJNA 1ZW1A 3U4CA 2WD8A 3PHJA 2NTNA 1XDWA 2QZZA 3E1KA 5IJZA 4RVHA 3L07A 4RPJA 4TROA 3GHYA 1F8GA 4YT5A 4D3SA 2YQ5A 3C24A 5IG2A 4L4XA 4PLZA 5A03A 1E7MA 1JKFA 4XB2A 3I9JA 3QWIA 4DMLA 3ISAA 1EFKA 4QTZA 3OMEA 2ZJ0A 4PN3A 1E5LA 4FD3A 1E1LA 1X1TA 5TT0A 4ALLA 1OAAA 4KZPA 1XR3A 5JMWA 3PWZA 3RUIA 3MOIA 4YRDA 4EMLA 4TRMA 1N8KA 5JCXA 3V1UA 3MJCA 2J5IB 2QYTA 4PLTA 1I5RA 3AI1A 1QLJA 4K9DA 5EINA 3ETGA 4ZICA 1NZYA 2I3GA 4GMFA 1ADCA 4NHEA 4N5MA 3VPXA 2BRUA 3RFTA 4Q0GA 1XWFA 3KSDO 3HDYA 5JFOA 1DB3A 4GX2A 1QORA 1HYHA 5JBIA 4JX8A 4FIZA 3DHNA 3ZGYA 1PJHA 3WFJA 4D0RA 3GA0A 4L6WA 2VRBA 3FRJA 4RCNA 1O89A 2WYWA 1K0UA 2J5IA 5CEFA 3BYZA 3EW7A 3ZWPA 5IDQA 1K32A 1OD4A 4DQVA 1YONA 3FNGA 1XG5A 1XIVA 4N18A 3IQDB 5MGBA 1ONPA 3JQCA 4E2WA 1EE9A 2JCYA 5L7YA 3AUAA 4CMEC 5JXWA 3PHIA 2Z5LA 4M8SA 1EZ4A 1GYPA 3LDHA 5BSFA 2JL1A 1WLYA 3WB9A 1NM5A 1DEHA 3IDSA 1A5ZA 4MP3A 1YRLA 5FFFA 5THKA 4CM9A 4JCQA 5A04A 2W3PA 2B0JA 1Z6ZA 5EL0A
chains in the Genus database with same CATH superfamily
1PT9A 1J8YF 5G4LA 1YG8A 4QD3A 3H65A 3BL6A 2BEKA 1EDZA 1NQWA 3KKLA 4UJ3A 5BPFA 4PZPA 4P86A 5KNDD 1MP0A 5KUTA 3VMFA 2QTHA 3DCYA 4R68A 3EPPA 2I66A 5IKPA 4CDMA 2IPNA 1MTOA 5JHGB 4BGVA 4MZXA 4QLOA 2ZYVX 4ASIA 4EYKA 3D31A 2JKYA 4E22A 4O4JF 3SQOA 3TEJA 3GJ8A 1QCDA 1M1YE 1QE5A 2FWMX 4E07A 1HMYA 1XRNA 1V7ZA 5JH7A 2YVKA 4A8JA 1SCIA 3D6UA 4IO1A 2PV7A 2GDZA 1EEHA 3ZY4A 1T34A 1S2IA 1P4SA 1TZMA 2P1RA 1C81A 1ZVMA 4UTXA 5A0FA 4AN1A 2EKBA 2VAMA 1WBDA 5CA1B 2LBPA 4IIFA 2OHXA 3VSAA 2XDWA 4RL6A 5AD1A 1YZTA 4N1AA 1PWZA 2YXPX 3BMQB 4FHEA 4CMIA 1NKTA 1F6BA 1GNVA 4QFBA 4B7AA 1N25A 5GZ6A 1SAYA 3AF6A 3IXMA 4AKGA 1EAYA 3MB5A 2NO4A 4JR2A 3SAJA 1O7JA 3RU9A 3DOCA 3M9LA 3IGFA 1TK2A 3JQFC 2FCRA 2Z1MA 5LLSA 4PHTA 4Y2TA 3RABA 3FYDA 2G1JA 4C5BA 3ZI7A 3E4CA 3UJ8A 5L4SA 1S3FA 4AY3A 5LOVF 3UKDA 4NCBA 3UXHA 1E79A 1EI9A 1N1EA 1I0ZA 3C7DB 4PPFA 3NVMB 5E3HA 2PNFA 5FKJA 2HHHB 4IILA 1IN7A 1XTVA 2WEKA 4HLUC 4M1MA 4W5OA 4LTDA 4D92A 1X7WB 3PQEA 4NBKA 3VOBA 4ARIA 1L3CA 4II3A 3D8SA 3KLBA 4OATA 1GP2A 4L6CA 1MABA 3VU1A 2HF8A 4YIHA 2JBAA 1AOXA 2P5UA 3TFQA 2F48A 3K2IA 1G5PA 2YINC 4P4LA 1SBQA 4KPFC 2WNIA 4Z2YA 4J7XA 2A5JA 1B23P 4QEDA 1LTKA 3H0SA 3QXSA 3IAS1 3H5IA 4CFZA 3G9XA 5LIPA 3AU9A 3E7WA 3S44A 4ZEXA 4Q93A 2NO0A 2XDQB 4R2XA 3R7SA 1C7JA 3UBMA 3GVPA 3IILA 4LHEA 5C37A 1X87A 1LVHA 3Q7EA 2V7EA 1XROA 5JMPA 1PW5A 2MHCA 2RJ3A 3OJCA 1JR3E 5HEKA 1XTJA 2EX1A 3CF0A 3KTKA 4FWBA 1CY1A 4Z8YA 1EUDB 4KV7A 3WGTA 1KU6A 3M0EA 4UAJA 1PT5A 2QVYX 2WU3A 2FE4A 5DNYB 5IWAB 4LNHA 2QRUA 3AHIA 3V2GA 1XZGA 1Y7OA 3UCEA 2QSYA 2IGTA 2JF0A 1U2GA 4KH1A 4TXHA 3NKFA 3T06B 1N6DA 4M9XA 3EULA 3BWCA 3IJEB 3ZDYB 2WLTA 2RHRA 4H7KA 2JJ1D 1U0LA 1ZMXA 3KHUA 3TI7A 2HGSA 3D7KA 2FF5A 3R0QA 3LFHA 4IKEA 4JS0A 4PG4A 3F9CA 2WJGA 1ESZA 1NMZA 2XT6A 3AK4A 1CCWA 1VL5A 3LUPA 3WK7A 3R6HA 2Q9UA 1Z0AA 2H5LA 4YMWA 2QL7A 3PF9A 1E62A 3KIPA 1E7YA 2MJLA 3FSJX 3EEBA 5A3SA 4HT3B 1R15A 1II8A 1V25A 3GT4A 2FYTA 3T5DA 3ER8A 3L6RA 3OUTA 1Q7CA 2ID8A 2QTMA 3QJ5A 3JRXA 2GD0A 2XUKA 1J7KA 1GYRA 1TA9A 2XAAA 2B35A 2FX5A 2I4TA 2XUQA 4C6TB 5AVUA 2KSQA 4ROSA 4JY7A 2WWVD 4AJ4A 1OVMA 4GXQA 1HDZA 2P6RA 1Q74A 1LF0A 2O1SA 1L4MA 1Z0FA 3S5JA 3UICA 1E3JA 1U90A 3N2GA 1F7UA 2PT5A 3PWSA 4LNAA 1CR1A 2YW9A 4NBRA 1CP3A 1BDJA 1KY2A 2PUHA 1QSGA 3NAMA 4HX5A 3G5MA 5DRTA 3U7JA 4EPVA 4JYAB 2WRZA 3MAJA 5EA2A 3R3WA 2V58A 3PC3A 3BWDD 4X64B 3ZVNA 2FUEA 4U7FA 3ASZA 4ZZIA 3KL4A 5KJ1A 1AO0A 3AGQA 3IIMA 3VISA 1C1XB 2BGIA 1N2CE 2NV2B 4TV9F 1RAGA 2I4LA 1VPDA 2IHYA 3DLHA 4B2YA 3HM2A 4HB0A 3BGVA 1ZVKA 2LXNA 2NV0A 2E6KA 2VSYA 3FTCA 3M4NA 4Q1BA 4KITB 3GGCA 1GEGA 2VZ8A 3IP3A 3ESCA 3NHFA 4F06A 3JQPA 3B85A 4ITRC 5IHPA 2GPSA 2PJRA 5ABPA 2QD3A 4CODB 2FP4A 2ERXA 1UZLA 3CFYA 2ZIXB 4RV5A 5AXCA 3SX2A 3T5GA 1XEFA 1KERA 3W6UA 1P8AA 2AC7A 2D2VA 2Z9DA 4BLSA 2HDHA 4GEGA 4JBYA 3TLGB 1CZHA 3UWOA 4DEYA 1LPBB 4YUVA 3N59A 1IJEA 4B8ZA 2FDRA 3W5CA 3EPKA 3OEWA 4N41A 1BVHA 3ZBUA 2GBFA 3VU9A 4OQFA 3NFRA 2DH5A 3KOUA 2DUBA 4LBYA 2BM1A 1VIDA 2ZE8A 3HU2A 5DMHA 3WG9A 3QNWA 1WXGA 2V8OA 3LW7A 5GJVC 1TM7E 3U3ZA 1Y8RB 1GPDG 2VK2A 4KAJA 4OOFA 2JI7A 4MDYA 4IDGA 3A9UA 5K0SA 1YQUA 3AIMA 4XW2A 4CI0B 2HDWA 2W4QA 2D62A 1GUBA 1T1IA 3K30A 4BRWA 3AVOA 3NHSA 4DLZA 1PTKA 3A9TA 4KVAA 3PYMA 3HWWA 2CLKB 1EY3A 2QR3A 3UJ9A 3EIHA 1EQ2A 3CCFA 1K5PA 4AS1A 3KCQA 2OYCA 1J09A 3VSDA 2AB0A 4ZOCA 4CMEA 2DPHA 4ZOLF 5E6RB 3ADKA 3GFGA 5JCJA 1N2ZA 1W1IA 1W5SA 3A28A 5EQJB 1PYOA 4CKYA 1H69A 2GQ0A 1D2NA 2WF9A 1ULAA 2HN9A 3AF2A 4BB9A 4JXXA 2FDCA 1EF9A 3PLNA 2ERYA 3NS7A 5A4MS 2HK8A 5AK0A 6CHYA 1JHAA 4QQ8A 4F2PA 4MOWA 4F3YA 4LJ8A 1QB8A 4FJWD 1J1ZA 5FO1A 1ICEA 1EP9A 4J9VA 1BW9A 4FONA 3UOAB 3WDMA 4QLBA 1XYYA 4O5OA 5ILOA 1QC5A 5E7IA 3UIEA 2D3TA 3M6MD 3VNBA 2PV0A 3VZRA 4DDWA 5AXAA 5IKOA 3OUZA 4A36A 2QTTA 4JKIA 2V3WA 2AE2A 3WSVA 2VTBB 4FR2A 1ZIDA 4QRIA 3CB4A 1KJIA 2K6GA 2G7MC 2KBEA 2CNBA 1VBFA 2AF4C 3OM8A 4HB3A 1MQSA 1XL0A 1RYMA 3OOYA 4X93A 1VB5A 2OFFA 1DIAA 3HN6A 4XWTA 3OTOB 3AONB 4F0JA 3PTAA 2WD7B 4LCEA 4E2FA 2XD9A 3N7UA 4GPIB 5CYFA 1SUIA 5CCEA 3CKKA 3PJFA 4FR0A 3C3WA 3UKOA 1JAXA 2ZVQX 1NBWB 3DNMA 3WGJA 2IV3A 4YCDA 1UM9A 2ILVA 4YALA 3WADA 1J1IA 1JTEA 4ERXA 5CLHA 3NTOA 3RROA 3AWIA 1M1NA 2JAPA 3PKIA 2RBEA 4CL3A 3RLIA 1XDZA 1VKRA 3C85A 4LYJA 3TBKA 1IJKA 2WUWE 2WVAA 3SQLA 1XQ1A 5FUQA 1WZEA 1P4RA 5JAOA 1IM2A 2Z95A 3DEFA 3NTVA 3ZD7A 1V47A 4DCNA 4OMFG 1JEQB 5BNWA 3ACCA 5M2QA 2H17A 5J59A 2G9NA 3C6XA 1HDXA 4GC9A 5CFOA 1Z4QA 3INYA 4H0FA 1JUDA 1O94C 2UVDA 5D5HA 1XTIA 4I4LA 4F96A 1TPZA 3O91A 3LGXA 3PJEA 4JLOA 4TV8F 4AWBA 4F5YA 2R62A 3WNQA 3CE6A 3LXRA 3L0SA 4LSMA 5BN3A 1TTQB 2HAEA 1ZL0A 3H05A 4WBNB 1PTJA 5FL3A 5A1TA 5K4HA 5LNK6 2I3AA 3AFNA 2XOKD 1VRWA 4BWGA 5AW1A 3GQVA 2H18A 3LX8A 1U2EA 5FOXA 3UMBA 5CFQA 5AUPB 3WHPA 2VP4A 2B82A 2WM2A 3BG5A 3IQHX 1BMTA 4UHBA 4H3VA 4E1VA 2Q2QA 3JD4A 2XE7A 2Q3BA 3BMNB 1YUMA 4LYGA 1E8MA 2OL4A 4X1YB 1JTVA 2B4QA 4YT4A 1E9DA 2V7WA 5FA6A 5HM8A 4UNQA 3HYRA 3E81A 4RNCA 5J4VA 4Y2VA 1E2GA 4LVNA 1JFSA 1P1CA 1XZDA 2WTEA 1J2TA 3VZCA 4BRUA 5JSYA 1RZRD 2X3YA 3WBJA 3QJGA 2R6R1 1C9EA 4N0QA 3KPUA 3F6SA 1KMHA 1YH3A 4EO7A 1PR3A 3WLKX 4DZZA 3PI7A 2O2ZA 4QEZA 2PRKA 3MIZA 2VAPA 3N76A 4A5OA 4J8PA 4PNZA 1H2HA 6YASA 1GZVA 4FX2A 5FNZA 2DHQA 1LQTA 1ZR4A 1RYYA 5ICFA 5JMTA 4P08A 2QP3A 5IUKC 2PY6A 4HZGA 5ALHA 4DCVA 4B31A 3ORRA 5ANRB 3HDJA 1CUAA 1NY6A 3FOEC 5CTBA 1JKMA 1QMPA 2QIPA 4LV5B 4NBNA 4HMOA 3SHOA 2GEUA 2OYSA 2D06A 3PE4A 4PIVA 3SQMA 2IYFA 3VO1A 3FDIA 4OYLA 2FW6A 5CM9C 5ELLA 1ADGA 3U62A 2W58A 2XRYA 2V5UA 4J1SA 3BQ9A 4HNVA 5JQWA 3MUFA 4ZEOA 2BAGA 3JD1A 5DYWA 4YJ2F 1M10A 1YJAA 2XMDA 3CVJA 4ZDKA 1GDHA 3RSOA 1WF3A 5HJEA 1IB0A 5A3QA 2EZUA 3WQBA 5BVHA 1SG6A 4KDRA 3AR4A 1G4UR 1VKZA 1PRYA 3JARB 4ZCLA 4DLVA 5CBPB 1Y48E 2Z09A 3DMFA 1U94A 3I72A 2NXCA 2CLHB 2J08A 2OK8A 2WBLC 3WLQA 2AXPA 2FMHA 1Y5MA 4R2JA 1BN7A 4R51A 1X0XA 4IJWA 5J58A 2C97A 3DP7A 1E1CB 3GPIA 4JKOA 3P0FA 4YFYA 3R8XA 3VHLB 1IN6A 2VSUF 2OTCA 2DY1A 2X23A 3OIWA 3OJWA 3RT7A 1XRJA 2V7XA 1O4WA 4GNKA 5D86A 5BWMA 4JVNA 3QIVA 1T1SA 3CLUD 4KRYA 4OL0A 2RGRA 1KHTA 2A0YA 1AC5A 3GARA 1DAFA 2QZ9A 4DUPA 4WQMA 1LPNA 5AXBA 3TTSA 2G1KA 3K94A 2NO5A 4EY4A 4UQPA 2DM6A 4XTCS 3TLZA 3AVWA 2R6HA 4RKRA 5KREA 2B8TA 5KVCA 1WCV1 3DNFA 3O4IA 3HACA 3OPYA 1RI4A 5F21A 1XCJA 2E5FA 5IW8A 4DZTA 3E22B 4QT0A 2C7VA 4UCWA 1DELA 4JBNA 1OOEA 5DI3B 3SQWA 3MWYW 3T7RA 1SUBA 4TYMA 5AK6A 4TKMA 2QXTA 1P9OA 1BS9A 4DLKA 4HNKA 2D2FA 4PC1A 3J81A 2VRWA 3ICEA 4G0MA 1JLMA 5AK4A 2FVXA 2Z57A 3O1HB 1S2GA 2ZRCA 1JZTA 3EC7A 4WLEA 3WOHA 4ZJPA 1XV5A 1Z06A 5GPBA 4F45A 3DMNA 3UAOA 1OT5A 4CF6A 3P9YA 2CCKA 1DKPA 4LSWA 2ADMA 2CXRA 3ETEA 2GPBA 4CKEB 5JY1A 5JC1A 3SIWA 4YP1A 1RKBA 4Q1VA 4CIDA 3CIFA 1G64A 2TSYB 3VHXA 1ETUA 2VHVA 3SE7A 2PU7A 2WK1A 4QUEA 2J4FA 2I1VB 1V2GA 3GLQA 2NTYC 1B3BA 1RZVA 4QOJA 1KARA 4G4IA 1KDZA 2EJBA 1E0DA 1KDTA 4ZDBA 2HREA 3VR3D 1E18A 5J2UA 4KACA 3WMXA 4E0BA 1YVRA 5PGMA 2GAFA 3E03A 3HO8A 3Q2KA 3K0FA 4WLVA 1OFIA 4F38A 1M0TA 1L7NA 3HRHA 2E2WA 1IBCA 5J63A 4KRFA 4KTVE 5DLPA 3TOZA 1HZZC 4KX5A 4FGWA 3EIUA 1DJPA 4BP8A 4WZ8B 5DBHX 4RV9A 4AY2A 3T3HA 2YMPA 3AW9A 1MQAA 3D0RA 4L16A 2IPAB 2AKYA 1ISPA 1BW9B 5AVXA 5KYNA 2P9BA 2H8GA 1SPXA 5LDGA 1NYQA 1CB0A 2OKGA 3AFHA 3OT1B 4LOJA 4AN0A 4C4RA 2XQKA 3LHIA 2G36A 4FDLA 2YX1A 1NASA 4O4LA 1GNLA 5KSPA 1WP4A 1T8YA 1GXSA 1BCRB 1ZXXA 5T6BA 5IXYA 3KTOA 4CR7A 4PTZA 3QXIA 1C9DB 1ZOOA 3GEBA 4PSVA 4YDRA 5CW2A 5M04A 3DJAA 3F73A 1JIJA 1RC8A 3D8UA 3BDIA 4MYSA 1ZD4A 3HBAA 3U56A 3OUUA 4FI3F 1V7PC 3DO8A 3OLCX 3WDKA 2F8SA 4M60A 1EVYA 5KDRA 3K9NA 4ER6A 1Q6ZA 3EUWA 4D8VA 4ZZ0A 5JS6A 5JV5A 5C34B 1N34B 3CRMA 3ZJVA 5TJHA 3MD9A 1F8UA 4ERNA 3IUQA 4KWBA 4MVJE 3PCRB 5G2OA 1R6BX 1YOVB 3CF4A 5TVGA 3IQFA 3VR6H 2QE6A 3RASA 4AWXA 1OA0A 4N48A 2NXWA 1A9TA 1OH8A 2IC5A 1SQGA 4IUYA 1ISRA 2W2XA 2NOAA 1D1PA 2FEOA 2J85A 2LIPA 4NOKA 5JD6A 3H86A 3FTEA 3ZHOA 4F47A 2WSMA 3U39A 1ISMA 5HQ3B 3PUIA 5B3KA 2Q0SA 3EZLA 4JD5A 4OA5A 4JUDX 1T35A 1XZAA 1Y8CA 1XDDA 4TVKA 1ZU4A 3IRVA 1WSBA 2Q07A 4MR7B 3JU3A 5ENZA 2IKSA 3A2LA 2WFAA 1QK5A 5ALEA 2RCNA 1VECA 2V65A 1JIVA 1NXVA 2UVPA 2J0SA 1BE6A 2KX7A 1YZFA 4I8XA 1L7VC 1P1HA 4IOKA 4KSBA 4BGIA 3AVUA 4PYOA 4X66B 3SZLA 4DSNA 4QXQA 1WTAA 4ZVNA 4EB6B 1CQIA 2Y4NA 2ZUCA 4UMDA 4EYSA 4AW9A 5EIWA 1MO2A 1Z4JA 1JEOA 2GTPA 3LT2A 1OASA 2JCSA 2HNKA 3R3JA 3CH6A 2FPPA 3ITKA 4RFVA 3ZHVA 1P61B 1LS6A 2R11A 1Y6GA 3O9ZA 4BV8A 2PMBA 4OG1A 2AH5A 1XVVA 1KO1A 2BGNA 3TDKA 2ZRGA 3S5UA 1VXOA 1XQ9A 5ESWA 3I5XA 3MLBA 3NV7A 2R1VA 4X41A 4EWLA 2XW6A 3CXRA 3QHPA 2DPLA 1K9VF 1X8XA 3E2PA 3QBVA 4Z9BA 1MJNA 4EITA 1I3CA 3EGXB 4WK4B 2NO6A 1ULTA 3M1YA 5BSHA 1WUTA 5J43A 1P7ZA 2E1PA 3QVWA 2EFYA 3G1WA 1M6WA 3M89A 3LO5A 1WUIS 2BMJA 2DHEA 4JYMA 3FROA 4QAJA 3V34A 821PA 1SKQA 2HMAA 3EPRA 3W05A 2Q3CA 3CM0A 1VYUA 1VYTA 1RAIA 4FGSA 1ZN2A 1RRFA 3WNCA 4INPA 1GGJA 1TUBA 1VKJA 2B4RO 5CDYA 2VTKA 5H4HA 4F2HA 4HNUA 2L17A 1XO1A 3JV7A 3TL3A 4AJLA 3GGPA 4O4LB 4PO9A 2CL7X 4KR3A 4J0JA 3VH4A 5FEUA 4MB6A 1ELOA 4YH1A 2Z56A 3RK0A 3WQRA 3QPVA 3MTBA 4RPIA 4EI7A 4XVUA 1ES9A 3FOWA 5FWYB 3GLIB 1JR6A 4L9AA 3R3UA 1YR1A 2H16A 2ZIZA 2R00A 3DXXA 2CHVA 3MCVA 4K40A 1JFRA 1LDMA 4GH5A 2EIHA 2JFZA 1GN9A 3ZWNA 3QX3A 2FMUA 2N1BA 1Z4LA 3EZ6A 4RMHA 4WH0A 3A3YA 1QG0A 4R01A 1E7QA 1PJCA 5FTWA 4FSHA 1XD9A 3PUYA 1FE8A 1BN6A 4LE1A 1E3WB 1U7WA 5B7GA 1L4HA 1P2SA 4Q6BA 3VAYA 1WY5A 5DU2A 5AKYA 4N6GA 1HTTA 4RQBA 2ZFUA 4RY8A 4PRZA 4TKUA 2NIPA 3BBPA 1L8XA 1QH8A 4G0NA 4GOJA 5KTSA 3P26A 2LIVA 1NDHA 2BGUA 3CSSA 5L51A 2DPXA 1DX4A 3JQDA 3KFLA 4JI8B 2QUKA 1Y82A 1EWTA 5DSZA 3HV0A 4DQ0A 2ONKA 1I6KA 1P7YA 1OFGA 3QUTA 1E61A 1HQKA 2PX4A 2R7LA 1FDWA 2HA4A 3ESAA 3HU5A 1GPKA 1CD5A 3MWFA 3ZE8A 5CDGA 1BEEA 5A3VA 1PI3A 4FMDB 2EG5A 2PLWA 4MCJA 1WDMA 2AVNA 4DVGA 3IAHA 4EP1A 1NI4A 5KQLA 4V0MA 3HJFA 1ONOA 3T9DA 2R1VB 2NP9A 5IN4A 1V5EA 2GJ8A 2MTBA 5EHQA 3W2EA 5EJ8A 1QTRA 1WZCA 2ZPTX 1MB2A 4TL6A 5HF6A 2A3NA 4DE5A 4OBBA 5CVJA 3CW2A 1H2WA 2E4WA 3HG7A 4OJTA 3IE1A 1CDZA 1V8FA 4H6PA 3GXBA 2R8OA 4WE3A 5CH8A 1EWQA 2JCBA 3HK2A 1NR1A 2HMVA 3DZKA 4U2CA 2XCLA 2XGOA 5I9LA 4G5OA 1YS2X 3TG2A 4AJNA 1IEWA 4B3IA 2AD5A 3QF7A 3SC2B 3GGJA 3JQGA 4LBVA 1VG0B 4DABA 1YRQA 2XCRB 1SCUB 4K2AA 1M6YA 4HDMA 4OGLA 3A9VA 4Q9LA 1MRNA 1NHWA 1I10A 3ECSA 3W8DA 3ZS8A 4R5HA 4TYYA 1BE0A 4MMZB 1AKVA 1ZRMA 3U3XA 2GK3A 3PR2B 1KBZA 5G1PA 2W0SA 3TX6A 2FPUA 4AU1A 5GOZA 4OYRA 4LRQA 1NOIA 1X7DA 4CW7A 2UXCB 1TM5E 2CE7A 2V6IA 4C7XA 1XF1A 1JSLA 2HMYB 3IR6A 1OLSA 3PIIA 2GN6A 2IEBA 1BNCA 1CDEA 2FG7C 3ANNA 3P0RA 4FOSA 1MPTA 2VH1A 4X1KA 2QDXA 4QELA 4J4HA 5F73A 3S7TA 2WU4A 3QVLA 3K1YA 5BSMA 1UBNA 1KR5A 2XUGA 2ID4A 3RC9A 2JAOA 3L7CA 2AS0A 4FHZA 2ZT5A 4M0MA 2G28A 1Y3IA 4H1VA 4C4AA 3M4XA 2B8EA 1Z5UA 1YHNA 2F1OA 4BNLA 3OF5A 4KUEA 2O4UX 4F4FA 4UTNA 4H1WA 1NKVA 3OJFA 2ZATA 2WUEA 1EM6A 4PQYA 5CVTA 1X92A 3CVYA 3T1NA 4POOA 1ZAKA 3FZYA 1JT2A 1ZVVA 2QMQA 2OD7A 2PO7A 4EKDA 1EIZA 2PYZA 1FU8A 4DPKA 2VJBA 1H1DA 3F2IA 1WQ4A 3IEKA 3P0JA 1RPJA 4UU0A 5C4IA 6REQA 1H9CA 1L4BA 5TQ0B 3F6CA 5TE9A 1S1MA 2FN9A 1OXVA 3ERCA 2ZUVA 4U39A 3HVHA 4Z3KA 3RS2A 3KTGA 1GNSA 1TMGE 3KWLA 1U2GC 4NAUA 3QY9A 2JLSA 4P7KA 3A9RA 4TSRA 4OD0A 4QOFA 5EIBC 3BH0A 5HR5A 4J0HA 2Y0EA 3DULA 2HK6A 1VXRA 3WLOA 3A4VA 5T67A 3VJMA 2JAUA 2YFQA 3PZKA 3MT6A 1U7ZA 2VJMA 3DXZA 1LBIA 1LKZA 3EMVA 3G5AA 4C6RA 1E2QA 2PMFA 3KVRA 3HKCA 1EB9A 4HJRA 3USCS 1RHRA 1W34A 2B5VA 2XTZA 2JFOA 3PXCX 4KYUA 4ZA2A 3ZY2A 3DMHA 3X1DA 4ARSA 3PJRA 2BFCB 2VDNB 3DW1X 4MB2A 2IYAA 4BBZA 4H77A 3AIIA 4CF5A 2XX3A 3ZD9A 3ZDZB 4EJSB 1YZHA 3IO5A 3DE6X 2X7XA 4MDEA 4ZDEA 2QX7A 4OGGA 1H3EA 1PEDA 2BGTA 3FPEA 4PVCA 2Z8ZA 5AKIA 1W4LA 4PZ9A 4Q4LA 1L7AA 1VE5A 5EP2A 5A06A 3TEFA 5KNDH 4JAVC 2ORYA 2VWHA 1PU2A 4U0GH 3SJ7A 1I1NA 1OBCA 1QVZA 3HB4X 3JVUA 3SKXA 3SYMA 4DLYA 4OQNA 4EY7A 1DC3A 1YKGA 1BXGA 2D5AA 2PRSA 2WQ7A 4X85A 1UH5A 4QYXA 1JKXA 3ZWCA 1V4NA 1DBSA 1KJJA 2C29D 3DDZX 3GLHE 3PXEA 4IS2A 4P2GA 1DAPA 2IF0A 3R3VA 4ZODA 5UKDA 1U8UA 3TSOA 2FN3A 3CSUA 4PG5A 1J00A 4DLPA 2QL5A 2O6HA 1ISFA 1NW4A 2OORC 2VYNA 1K4KA 3OEHD 2REOA 3PEVA 2FZEA 4K6FA 1SD2A 2D1TA 5ESDA 2HFKA 4PXYA 5GONB 4AROA 4CV3A 3NMUF 3HJHA 2OXCA 4BMOB 2O5EA 4J3JA 3MBIA 4QASA 2A94A 1BIFA 5BSEA 3SX0A 5ALFA 1XU4A 3QH4A 3C41J 2CLSA 5LYYA 5CCBA 2XF8A 3D81A 3KWJA 1X38A 5AVSA 4IEEA 3W90A 4HBGA 2R4TA 3ILXA 5BOVA 3W5IA 5ALYA 4Z4EA 3MB8A 4Q7JB 3BMNA 4L9WA 4ER0A 5K05A 1MIOA 2FPGA 2GD6A 2J33A 3H97A 4LRWA 1GRRA 4CG0A 1I7QB 1QHGA 3MTQA 3CNLA 3ORYA 4LYEA 1VPEA 3WP0A 5FAXA 2DXIA 3CZRA 1EUYA 1EXMA 1QXSA 3G23A 4Q12A 1KSHA 3DBVO 1HLPA 3GMAA 1H9AA 3FLBA 4F7DA 1B6TA 1GDTA 3A27A 3VJKA 2O3QA 4Y1RA 1X7HA 2WMYA 2NW6A 3PRHA 2OCDA 3IXLA 4XVRA 1KTIA 4URXR 1MH9A 1OX4B 1NXOA 4II2A 3ZVMA 3TCXB 2C2WA 4FCTA 2V54A 3H8WA 1RWMA 1FYWA 1FP1D 1M8GA 3N8NA 3FOBA 5F7XA 3UQZA 4IHKA 3I9MA 3CLSC 4FFLA 5D3KA 4FYXA 1FX1A 4NTZA 4BEVA 4BCBA 4EUHA 1DX9A 1DTWA 4ZAZA 2NVUB 1Z8NA 1D4OA 1JJFA 2AXEA 3EG5A 3KZMA 1NFFA 3R44A 3RSGA 3FWZA 1KIFA 3QG1A 4HDRA 4Q34A 3PS9A 1IRXA 1DBQA 1JR3D 4RHTA 4KYIB 1AN0A 5H80A 4PV7A 3OFKA 4CM1A 1HZDA 1ULZA 3IPCA 4E30A 1JHXA 1F6DA 5IHXA 2YWFA 4ED9A 1QHNA 3KPYA 4XWGA 2VP6A 5U9CA 4ABTA 2Z6QA 3KLPX 4XE5A 3MFMA 2O07A 3IAUA 1ODIA 3IAXA 1LA2A 2B9VA 3P9RA 4KQCA 4QFDA 4OSEA 4XUGB 4JEHA 3W9BA 2AKEA 1I9GA 5TLSA 4UHCA 4DREA 1RJMA 1CLUA 1GV0A 4H3HB 3GBVA 3EA5A 4WKNA 1DKLA 5K4AA 3OWHA 4HC8A 3OH8A 2MINA 2OO3A 3E4DA 1J6UA 4PFQA 4AY6A 1CRZA 2PEYA 2XYVA 1ZM2A 1E89A 3TB4A 1SG0A 2RG1A 3VVLA 3URMA 1JIXA 3WWYA 1R0BA 4MINA 3TLBA 4F56A 1USUA 2ASVA 2H1SA 3D0OA 1E9FA 1SXJE 3AY6A 1P1RA 1SXQA 5GZ3A 4LCBA 5AHKA 5E95A 2IV7A 3UWKA 3ZE0B 1I7LA 1X86B 2J9GA 3CEAA 4Z6KA 3DTVA 2HO5A 4BNVA 1T6BY 3TTYA 1GWNA 3OC6A 1GRVA 1GKKA 4EG6A 5L95A 3SXJA 4ZDIA 3E05A 1G42A 5U4QA 4GDMA 1J5XA 4KO8A 1VGRA 5AMXA 4BYMA 4F86A 2IE0A 1WVIA 3DAHA 3VSEA 2W2PA 5DCUA 1XB2A 2Q1TA 3MAAC 3PEUA 4OI2A 5FEMA 5JEDA 2HMTA 2EJWA 2ZUWA 2AMYA 1NFQA 4OU5A 2H2WA 1EXDA 4ZMBA 3CLUC 5I5GA 2B4TO 1C7IA 1Q19A 3ANTA 1IB6A 1ZQ9A 1HNUA 1P73A 4UDXX 4Z2AA 3RT9A 1ZD9A 2OFXA 2W48A 2PGAA 3PK0A 4RESA 1RRKA 3IESA 3DFUA 2V0CA 3ZU2A 3EGOA 3AX6A 3KDSE 1IVNA 2F1KA 1OTHA 3M3HA 2AEEA 4Q4HB 4BLOA 5K3BA 2EW8A 2YXLA 3QQPA 1Y6JA 2RC5A 2B4KA 5MDHA 1BWPA 2DUJA 3CUKA 1NNEA 4BJ5A 3NBKA 4NEQA 5A3RA 5JS2A 3LC7O 3HP7A 1FMLA 4MGYR 4S1OA 3ZGLA 4QM7A 3TQRA 1OX6A 2YQ4A 5EKSA 4KWEA 2AJLI 1SKYB 5BO5A 2IUSA 5IYZB 1W6UA 1ECCA 2IY8A 1JWBB 2H63A 4R2WA 5IEJA 4DLSA 4UM7A 4A2PA 3JATA 1CFZA 2DFPA 3AH8A 4TS9A 1EFVA 1UIMA 1DAGA 1XEXB 2MR5A 4FNMA 3UV7A 4C76A 4LG1A 2R9VA 2CJXA 1MIHA 3ZHYA 1XD2B 3NDJA 5COAA 2PWPA 5C5IA 3WWEA 2A2ZA 4BV2A 1KQPA 3QVMA 4HLQB 4L15A 2G0TA 1JFLA 3VAZA 5DTIA 1GGFA 1DKUA 1QZ3A 1CG6A 3I23A 1RNLA 1U0OC 3V8NA 4MR9A 4FCWA 1RM3A 3U4AA 1P9RA 1B41A 1FUYB 2XMPA 3ZHQA 3TG8A 1BYUA 1L7MA 2Y0BA 3FUTA 4R83A 3TB6A 1EFHA 1GAEO 2XVYA 3EY9A 1KJ9A 3HGTA 3Q9SA 1IMJA 4KYTA 4ZOLA 5ES4B 2F9IB 1X15A 5HOQA 2QRKA 5A5VA 4CFYA 2DX7A 3QA3E 1YQXA 3W8FA 5JSUA 2DYKA 3UAZA 1C1DA 4MYCA 4J91A 2HJVA 1GA4A 4CXMA 2QLJA 3N2EA 3VDNB 2I3DA 2ZJYA 3GN1A 3VZDA 7GPBA 5EFZA 3I04M 2VR1A 2O50A 4ND7A 5F9MA 3ESYA 2A59A 4ES6A 3Q3CA 2KS6A 2OAQ1 2Q27A 3ZJ5A 5BWCA 1Y7PA 4NDAA 2GARA 4M0UA 2O8CB 1BROA 5U1PA 1GTL1 1GZDA 1IFXA 1WXWA 2PT6A 4YRLA 4J0CA 3LCJA 2FV8A 3R5XA 3WHLA 3BIXA 1FK8A 3ODPA 3OVMA 3F97A 4AJIA 4WNAA 1E1NA 1M9NA 2Q0HA 1MGOA 3O83A 3N2IA 2R96A 1F4VA 4HQRA 3O8DA 5KHLB 1CRWG 1T2CA 2OKCA 2EKLA 4KWIA 3FCSB 2IEIA 2ZCJA 3AHFA 4J2UA 4PHHA 1NYLA 1L5WA 1T4CB 5KTYA 2GJAA 1X39A 4HYEA 4O2AA 1Z07A 4EHHA 4UNRA 3N2NA 4PGMA 3TVWA 3VKHA 4HLCA 1SVKA 1GPYA 1TIPA 2CDNA 3Q1KA 1MX1A 1YJCA 5DCYA 4JUFA 5GVSA 2EHDA 4B9EA 2BM8A 2IYWA 2WICA 3DJYA 3D4IA 3ELWA 5G53C 2AK3A 5BR7A 3WLRA 1TVMA 3KZKA 3ICPA 4QDKA 5HILA 5ALIA 2J07A 3HVRA 2YZ7A 4WECA 4B75A 3MAGA 3IIJA 1XJ0A 2QPOA 1KFBB 1KYQA 4JYZA 3NBZC 3DXFA 2NOGA 1TKRA 2YXDA 1QHFA 2FWBA 4BOYA 4S0XA 1GTG1 4C1BA 2I9KA 3GHHA 1DOZA 4RPHA 4YIKA 4A8HA 4I4TA 4LVUA 1QVRA 4PAWA 3NB0A 4B4UA 3G9TA 3VOAA 3NJ4A 2Q7OE 4KVGA 2ODPA 4JWKA 1IY9A 3P97A 3TGLA 5KWIA 1I6MA 2XJ4A 3B12A 2VJDA 3IV6A 4U18A 2FOLA 2FVYA 2JFVA 1Y7IA 3BTUA 4HFNA 1ZEMA 1C8VB 4PPNA 1PKXA 3ENWA 3IKLA 4RJJA 2IYUA 3O8QA 4UM9D 2VT6A 4HTAA 3B20A 1A8UA 3BWBA 4IVQA 4X90A 5AUQA 4Z3OA 3KQFA 1LBTA 2X8JA 1KY5A 1KPIA 3GP3A 3OECA 4HG2A 4R31A 5EPUA 2FF7A 1Z37A 3LGSA 4IXNA 3MJTA 1KDPA 4EJ2A 1VPLA 1E4EA 1SR8A 1U81A 5BXYA 1JHRA 2VSUC 4DPLA 4M3NA 3HCBA 2DU8A 4KPKA 3K2EA 3TJZA 1RYFA 5A6SB 2PRZA 2VTDA 4IHJF 1CEEA 4Y67A 1S4MA 2CCJA 2MINB 5HXAA 4CM8A 4O63O 3VPGA 1J0AA 5LQAA 2CKDA 4KDFA 4X1IA 2FFBA 4PLYA 2ZUTA 2ZIAA 4ZHQF 2B61A 2Y1GA 2C1EA 3GEPA 3JZAA 1NKSA 1ZNWA 5ETJA 3GAFA 1Q3TA 4QGHA 2VF7A 3WJ7A 1H66A 3AKCA 3Q8XB 3D6FA 4RIEA 3NQ41 1JYFA 3OZFA 1QBKC 1QFSA 2R2GA 5I3ZA 2BFPA 1TK3A 3R6WA 4HGNA 1UMBB 1C0EA 5ADUS 1KI8A 2ZJZA 3L2OB 1FP7A 2J0UA 2XYPA 1WVMA 3D43A 2GN9A 4LMRA 3M3DA 1IJBA 1IBKB 1R66A 1NXPA 5DNDA 5HE9A 1AKEA 3IAEA 1RU3A 3TOSA 3T4UA 3Q7PA 4HVTA 4ZAXA 2RE8A 3NIGB 3LS2A 2JBAB 1J8FA 2AI3A 3O73A 4D8XA 1F0NA 2R6ZA 3IEIA 5INFA 4B3DA 4M1YA 1G55A 3M6IA 3UK2A 4CTMA 2NU6A 3EXHB 4HGQA 2J0VA 2X1MA 1MJGM 4R7GA 4U3JB 2VSNA 3QA9A 3RUHA 2WABA 2ZULA 4JGIA 3AR7A 2GN0A 4RZQA 2X0EA 4B6QA 3PQCA 1TB4A 2XYRA 5G41A 3REFA 3T8YA 4J75A 3VUEA 4AP9A 4URVR 3BJZA 3RH0A 3S40A 3T0FA 4JJEA 2ZBPA 1LDYA 2QNIA 3O84A 1GN8A 4F8EA 1WOMA 2AYYA 1YWGO 1ZK2A 3AUJB 2FZ5A 3DMTA 4DLXA 4CIXA 1RMQA 2C2YA 4XFJA 2EFGA 2HLDD 2XZLA 1VLHA 5EMHA 2VJMB