2X58A

The crystal structure of mfe1 liganded with coa
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
725
structure length
725
Chain Sequence
b'PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Crystal Structure of Liganded Rat Peroxisomal Multifunctional Enzyme Type 1: A Flexible Molecule with Two Interconnected Active Sites
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 268
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2x58A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x58A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2x58A01
3OMLA 4FS3A 3H9GA 4BL5A 3B70A 2I76A 1XHLA 2PD4A 1XG5A 5C9GA 1I8TA 4FJ2A 4GSLA 1VE9A 4BHTA 5I8ZA 1ZUD1 3I3OA 1KVRA 2B5WA 2PR2A 3AUSA 8ADHA 4J90A 3IB9A 1NQ5A 4IJWA 4JBIA 1E3WA 4DIBA 1RJMA 1Z82A 4ND2A 3AUUA 4NK4A 1JU9A 4QFDA 4F3YA 3WJAA 2Q4EA 4EJMA 3G49A 3OJFA 2WD7B 3ABIA 2EIHA 4IZIA 3H5AA 1YDEA 3BPPA 3JQDA 4CM1A 4OSPA 4LK3A 4GKVA 3RUDA 3IOYA 4OIMA 4P22A 3V2UA 4O59O 4E5PA 4LN1A 2I9PA 2OHXA 1ZBQA 1GQQA 1LDGA 1DRWA 2VUSA 4JN6B 5AYVA 4DPLA 4IDEA 4ZDFA 3E9MA 5THKA 4DQXA 3TLFA 4B79A 1ISMA 1XEAA 3E9QA 3M6IA 4IZHA 3VVCA 1FJHA 5L51A 3KTKA 5DU8A 1VSUA 4WK6A 3ONFA 2F00A 4KWHA 1LDNA 5GZ6A 3FPCA 3UF0A 2X1HA 4Q3DA 4M49A 3F6YA 4L0QA 3EAGA 1VI2A 4YLHA 1HTBA 1WNTA 3AUAA 4JJGA 1LSJA 3S2IA 3HHPA 2IRWA 2C20A 3GQVA 3QP9A 2NQTA 2ZQQA 1U4SA 2Y1FA 1H2BA 1XU7A 3WTCA 3U0BA 3EVTA 1M66A 1YQDA 4QEDA 1EE2A 3PYMA 4MVJF 1EFKA 1UZNA 1UYSA 5DBIA 9LDTA 5DCWA 4A03A 1JKIA 2EW8A 1NPTO 3JYPA 4BB6A 1SC6A 1F06A 2IYOA 5T64A 1EZ4A 2YQ4A 1I3KA 5A9SA 5KDRB 4XQEA 1WDKA 4EI2A 5KWEA 3FD8A 3BMCB 2EHDA 1E1KA 5DTWA 2O3RA 2Q1WA 2WYWA 1Q0HA 1UP7A 5ICSA 3ZU2A 1X0XA 4XRGA 3ZWNA 3FNFA 4AJ4A 1PS0A 4TQGA 3FF4A 3ULKA 4RORA 1P33A 4YAKA 2YDYA 2RCYA 2RAFA 4FGWA 3IL2A 3ZW8A 4FCCA 1LDBA 3M6NA 5KTKA 1QORA 2QX7A 4R1SA 1TLTA 4ROSA 3H0SA 3DFZA 2AQIA 1ISHA 1A4IA 4B3HA 4XYMA 4BKQA 4MXIA 4IQ0A 4R4JA 4D43A 4QFCA 4P4GA 3I6IA 3QWHA 1UAGA 3RD5A 4F46A 3L9XA 3NV9A 5L3ZA 4E5KA 2UAGA 2WDZA 5JAIA 4BQPA 3HB4X 1GAEO 2JD0A 3UOGA 3UXYA 4DQVA 4LK5A 1HEUA 4KTTE 4NU6A 5IN4A 1LRLA 3ANMA 1ZK0A 1GR0A 4LISA 1LSSA 3KTDA 3RBXA 4TRMA 2X9GA 1MB4A 1PJ4A 1VL8A 4BO5A 4G2NA 3GR6A 4JP2A 4BQRA 4ZICA 2WD7A 3P2LA 1QR6A 3U5TA 4AFNA 4GMFA 5A1TA 2X9NA 5E0NX 3EY4A 5G4KA 1UXGA 4JCOA 4NPCA 5A05A 2WD8A 2RIRA 3TRRA 2Q1SA 4BGEA 1LRKA 4F45A 1G0OA 1KYQA 3O4RA 3EC7A 3ZHXA 3OC7A 2P4HX 1H2HA 4R51A 4QQRA 4JCTA 3AJRA 3DQPA 3PJDA 3KBOA 3BTUA 2V6BA 4KDFA 3I1JA 5BR7A 3K96A 1BRMA 1LI4A 4XGKA 2DAPA 4D46A 1R12A 1ON3A 3TT7A 3IIEA 1UXHA 2CMDA 4FN7A 1U5AA 4BMNA 4Z9XA 4NH4A 1Q7BA 1R37A 4PLTA 3VPSA 5T6BA 1PWZA 2AA3A 5INFA 1NBOA 4O6VA 4AVYA 3T3WA 4PIVA 3MFMA 2P9CA 4FNBA 4BKOA 5DDIP 4JYLA 3GLMA 4GMGA 4J43A 5KDRA 2JJYA 3ETGA 1Y81A 3UKOA 1OZAA 3Q0JA 4B3JA 3BMCA 5IG2A 2YQ5A 1D4FA 3ADPA 5TNXA 3TPCA 3PFWO 4OAQA 4NG5A 1YRLA 1ADFA 3PQDA 3GAFA 1K6IA 1GU7A 1GV1A 4ZA2A 4BV8A 1O95A 2WYVA 2R00A 4OYRA 3RKUA 1C0KA 1SEVA 3BHMA 4S3MA 4ALLA 3VH4A 3ZV4A 4CL3A 2G82A 3QIVA 4KD6A 3HSKA 3PLNA 5ILOA 3QY9A 3IP1A 1I5RA 2C2YA 3V1YA 1XU9A 3GAZA 4I9HA 3ZNNA 3QREA 1J4AA 5EQFA 1VLLA 1MFPA 2B4RO 1KVSA 3MWEB 1HXHA 1VJTA 4AJPA 1UYTA 5COBA 5JMWA 1DRVA 1XYGA 1NYTA 2AG8A 1YBVA 1RWBA 4GHNA 3BA1A 1PTJA 5COAA 3L6EA 1T2EA 2PZJA 4MKXA 3EZLA 3VTFA 3A06A 1IHYA 3F3SA 4MKZA 1JXZA 2VSUC 4F47A 1P0CA 2RH4A 4FJ0A 1R0KA 4BGUA 1EBUA 1Q7GA 4U0HA 3VTZA 4I9NA 2VSSA 2X23A 4XIJA 1Y5MA 4OQZA 3A1NA 5CP8A 2PGLA 2J3KA 4NBVA 5BSEA 2FN7A 2OP0A 4DI1A 2IEDA 2ZJ1A 5IZCC 1S6YA 2NVWA 4G5HA 3PP8A 1YQGA 5IAAA 3WICA 1E7SA 1BWSA 1HE2A 2O2YA 3DAPA 1HDXA 1F0YA 1I3MA 1EMDA 5I7SA 3QMJA 3I9MA 1N1EA 5JFOA 4XGIA 2PG8A 2Q3EA 1QMGA 1P31A 2IODA 3T7EA 4W9NC 1CRWG 5JLAA 5I9NA 4IQGA 4IDGA 3WOHA 3NEPX 3VDQA 2QIOA 3H4VA 3JQ7B 4Q3CA 4BMVA 5DL1A 3E8XA 3R9SA 4R1TA 3E03A 5L9AA 4ZU2A 4YT5A 2EWMA 3H2ZA 4H15A 1MGOA 1I2CA 5HM8A 3ETDA 4I1IA 3STHA 1FK8A 2G17A 1TT5B 5J23A 2ZL0A 2DUBA 2W4QA 3GGGA 4IZBA 1B8UA 3RSHA 3CIFA 3NJ8A 1KC1A 5IN5A 1P3DA 1PEDA 2Y0EA 5GZ1A 3VAZA 1ON9A 4TRNA 3TQHA 4GX1A 2I6TA 3GGOA 1HLDA 4A10A 4P4LA 2O7SA 2OL4A 3DDNA 4CM5A 4EUEA 4IMRA 1LEHA 3WNQA 3TOZA 1HRDA 1YE3A 2HRBA 2QG4A 3BHJA 4NBUA 2Y68A 4O5OA 2B37A 1ORRA 4XDZA 5ENDA 1ZEMA 5AVOA 3UUWA 1NQTA 1Q1NA 3P85A 4RQTA 1DCIA 1GPDG 1K3TA 3L4SO 3IAHA 3L0DA 4TROA 2DEOA 3VKUA 4ALNA 3WNVA 4QECA 4E4YA 2ZQRA 2IEBA 2QZ9A 2VYND 4B4OA 1U5CA 4CV0A 4KNPA 1M6WA 4K6CA 4UUPA 3RSIA 2F9IB 4DBZA 2QQ5A 2FRDA 4J7XA 2IZ1A 1NXQA 3NTRA 4DPKA 4NIMA 3ITKA 1GUZA 3HP0A 1E7RA 2PZMA 3SLKA 2DLDA 1WVGA 4Y8VA 1DB3A 4E2ZA 3GVHA 3I5MA 4BNUA 1BGVA 5IXSA 1HNUA 1KOLA 4OLQA 2ZQYA 3WTBA 2JAHA 3QRWA 1H93A 2I3AA 5TF4A 1LC0A 5EINA 4BO6A 2SCUA 4KZPA 3QVTA 4NMHA 4B4WA 4QSMA 3CUKA 5T5QA 5LCXA 4U7WA 1R0SA 2UV8A 1JWBB 4A5OA 4K6FA 4U0GH 3RUIA 2C5AA 1LQTA 3VH3A 3MWDB 2BGLA 2EGGA 1XGKA 4GVLA 4KUEA 3WQSB 3B20A 3QV1A 3QKAA 3GNQA 4PZEA 2I5PO 3HADA 3E5RA 1N6EA 2F9YB 1JKJA 5L4LA 2I3GA 4WEOA 1NZYB 1XWFA 3ICPA 5GMOA 2HKIA 3TJRA 2QQ3A 1O6ZA 2NQ8A 1LDEA 5F5LA 4PFJA 1ZVMA 3RU9A 4CMGA 3KYCB 3HINA 4O1MA 3FR8A 1JA9A 2YZ7A 3DMTC 5EJ2A 2CF5A 3BIOA 2ZL2A 1AN9A 2D0IA 4PG8A 3INGA 1U3UA 1NWCA 2Y1EA 4R16A 1IULA 3RC2A 4IQ8A 1QXSA 4J7CA 3JQ7A 2HAEA 3HRXA 1EK6A 4YVFA 2HMWA 4YDRA 3MYBA 4WLNA 4OXKA 2PZLA 1VSVA 4U18A 2IZZA 2B35A 3GNTA 1XDWA 1U9JA 4YCAA 1TT5A 5JS6A 2GPTA 3OECA 5CPFA 4DA9A 4XYEA 1F12A 1Y1PA 3SLGA 2VSSE 3JD3A 3RWBA 3ANLA 4Z0HO 3W6ZA 5KIAA 3U3XA 2GASA 3PLRA 5HA5A 1NAHA 1L1FA 3JD4A 4JJIA 4M8SA 1KY4A 2WMDA 3BMNB 4GQAA 3BEZA 1ZSNA 4R01A 3H3FA 2QRJA 4W4TA 1NX6A 1KY5A 2BI7A 3H65A 3U4CA 1BVUA 1IL0A 1TYFA 4L76A 2D4AA 1T26A 4U19A 1QLHA 4UVDA 2C29D 1GUFA 4XWYA 1MG0A 1XNVA 4U0GA 3IUPA 1H9AA 3IAVA 1MJ3A 2DC1A 1SOWA 4IDCA 3C3XA 1IY8A 2CBYA 4R68A 1EVIA 5G0WA 4MOUA 3VZRA 3PWSA 3R0IA 3UHAA 4BB5A 3D5QA 3NDRA 1QLJA 4Y67A 5JCJA 1V3UA 2J5GA 2FR1A 1ADCA 1MG5A 2O7QA 3JQ9C 2O23A 3A14A 4PZCA 4OKNA 4YT8A 4KUGA 3GDOA 1WDLA 2PBPA 3DMYA 4DIOA 1EK5A 3AW9A 3CEAA 2VOJA 3LU1A 4YJDA 1ONPA 2Z1NA 3F1LA 5F21A 5CEJA 2H5LA 1A4UA 2CSUA 1KBZA 3KSUA 4IUYA 1SPXA 4WZ8B 4PLGA 3ZV6A 4OJNA 4TKMA 3LQFA 3RAJA 3X2FA 1HT0A 3ZHYA 4MIYA 3AM3A 4UULA 2F9YA 5EERA 1NZYA 1Y6JA 4TVBA 4FZWC 3V5NA 1E7WA 1KEWA 1E0DA 3K92A 4D0RA 3OQ6A 4GWGA 3VVBA 3RVDA 1DAPA 4BV9A 3U9TB 4KQXA 3KYCA 3DZHA 3VC7A 5TGDA 1Y7TA 5INGA 2E49A 1AHHA 2CD9A 3HWRA 3JV7A 4HBGA 3U4IA 2VHVA 3WX0A 5KNLA 2W2LA 4RL6A 3DAFA 3INRA 4FJWD 2BFPA 2J6IA 3AWDA 3IQDB 1AGNA 4K26A 2O2SA 5FFFA 3RJ5A 4BNLA 1E92A 1RM5A 4RPLA 1Q7CA 2E6UX 4HWKA 2C7VA 1QYDA 2EJ5A 4OM8A 5JNLA 1PGOA 3GKBA 3JD1A 3DBVO 4IDFA 3QYRA 3WMXA 1GEGA 1ZK2A 3AI3A 1UYRA 1CWUA 3QWAA 4NI5A 3K9QO 5DP2A 3NRCA 3I9OA 4PG5A 1NR1A 5CPBA 1H5QA 5JAZA 5FIFA 1F8GA 3UGKA 5TJHA 1DIAA 1MUUA 3GG9A 1DXYA 1XELA 2ET6A 2EERA 4ALMA 3C24A 1KVQA 4AJNA 3BMNA 4CUKA 4JGBA 3NJDA 4I08A 4FN4A 1HDOA 1MC4A 1O9BA 4MP8A 3JQFC 1ONOA 4GL4A 1OC2A 4TZKA 3GT0A 4K9DA 5EQDA 4B4UA 4MVJD 4ND1A 4FB8A 5JDIA 1IUKA 2WE7A 4RCNA 2EGHA 4BO2A 4E13A 1CIVA 5B12A 1HSZA 1CQJA 3ZHBA 1N2SA 1Y9AA 1ZMTA 1MC5A 3GN1A 1L7EA 3N7UA 4JBGA 4UEOA 2VRCA 4E3ZA 3Q2IA 4UEKA 3HZZA 1BTOA 4A2CA 1WLYA 1C0LA 5IDYA 4R41A 1EEHA 4L4RA 1JVBA 4IXWA 5JE8A 2BKAA 5DCYA 1DHRA 4RV9A 3WSWA 3ICCA 1FDTA 3NAQA 3H9JA 4P4NA 4EITA 3AU8A 1QG6A 3H3JA 3PZRA 2RBEA 3DOOA 3NT5A 3GF3A 1SCUA 4DREA 4L8KA 1I24A 4PVCA 1ENYA 3C7DB 5HWSA 3L3SA 1Z7EA 1G6KA 1E3WB 3TSCA 4BNJA 2J3JA 5B4VA 1PWXA 4OOFA 2A92A 4OHUA 3G1UA 4IM7A 1J5PA 3B1KA 4AICA 2OMEA 3WXBA 3HB5X 4I4ZA 3CINA 2NTNA 2X0JA 2NU8A 2A7KA 2EKPA 1MA0A 4CUJA 1LNQA 3BMOA 2OORA 3Q0EA 2QZZA 3SC6A 1XNYA 5CDTA 1PGJA 1V6AA 1XA0A 4GWKA 2DBRA 4CM3A 4FSHA 1PJHA 3PHJA 1H94A 1MLDA 2C54A 2NTJA 1P45A 2ZCUA 4XB2A 2ZYDA 2VNSA 1HE4A 2BF7A 3D3EA 3QWBA 3ANNA 4H16A 2GN6A 4RVUA 2HK9A 4DIFA 1O0SA 1ZCJA 4U6SA 1XNWA 2ILTA 2Y1OA 2YJZA 3E48A 5HBRA 5B4UA 5CG2A 4R3NA 5AXDA 3TDCA 1ZXLA 2DU8A 3MTGA 4ZJUA 2Y93A 2J3IA 4QX6A 4WUVA 3UVEA 3F46A 3QSGA 3V8BA 5L4NA 2QYSA 5I7EA 1ADBA 1E5LA 2A9FA 3V2GA 2P2SA 1T2AA 4CR6A 2CVZA 2HW5A 2W90A 1H9BA 3STAA 4R69A 2JFFA 5BQFA 1P77A 3LKEA 1P1HA 5KVQA 1LLDA 5ER9A 2Y99A 3WBBA 3NJBA 3QA9A 1K0UA 2E4AA 1CEQA 1LTHR 4R54A 2QYTA 1PSDA 1RM4A 3P19A 3ZU3A 3HDJA 5JDCC 5IJZA 4JJFA 3RIHA 1SNYA 4WCFA 5TC4A 1I36A 2GRAA 5DF1A 2GYYA 3BF0A 3C1OA 1YJQA 5G0SA 4FN8A 4ILKA 4DL9A 3TDKA 3TVUA 1VL0A 2B0JA 3KOUA 1ZH8A 1YGYA 5C7IO 3QWFA 2YYYA 2PNFA 4D3SA 3R9TA 3ZI0A 4TRJA 5ITWA 5DNAA 4MPDA 4NR0A 1UZMA 3QVSA 4GM2A 2NVUB 5CDUA 1GQ2A 3A28A 4QT0A 1P0FA 1IZ0A 3N6RB 1NFQA 3TL3A 3WGQA 3TZCA 3AOEC 4MIEA 1XIVA 2BFAA 3H6KA 3O26A 4Q3NA 3RC9A 4ELWA 5A3VA 2ZYAA 1MX3A 1DEHA 3W8FA 4CQMA 2R2GA 2F1KA 4DLBA 1D1TA 1F8FA 2HMVA 2DBZA 3MJTA 2OO5A 2V7PA 2PLAA 4J1TA 1YDWA 4L73A 1G1AA 2FMUA 2OUIA 4N54A 4WECA 2Q1UA 1EF9A 1TB4A 1YVEI 1PZGA 5KVVA 3ROPA 3V2HA 4X54A 4E21A 3HN2A 2NNLD 5G4KB 1GEEA 3PE8A 3W4IA 4FFLA 3ZN2A 2W3PA 1PJTA 1EQUA 3WMWA 3JQAB 5T8KA 3JQBA 4ALKA 5AQ1A 3MT6A 4HNGA 3FI9A 2GDZA 4ZN6A 1S7CA 1N9GA 4AJLA 2WYUA 1BXKA 4RVGA 1VPDA 4PVDA 1TA4A 3GFGA 9LDBA 4IZCA 1UDCA 2GERA 2FOIA 3PZKA 1ZK1A 1G0NA 4AJOA 1IHXA 4I9UA 2Q2XA 1X13A 4RGBA 5JMPA 4BNVA 2FSVA 2A35A 1PGNA 3OM9A 4UUMA 3OFSA 3LT2A 5A5EA 1PZHA 2O4UX 4DMLA 2IE0A 2VT3A 3ZWYA 5DBFA 4BNZA 1U7HA 2EV9A 2YW9A 4NZ9A 7ADHA 3R6HA 3WJ7A 4Q3BA 3ZCXA 3SWXA 3WQRA 5I9MA 3EDMA 3ROMA 3KB6A 1EVYA 1WAMA 3FNGA 4IGEA 2X22A 1DHTA 2HJRA 3OHSX 3OP4A 3CPSA 3RJ9A 4EYEA 5JC1A 1XQ6A 5TIIA 2WSBA 3KTJA 1SO8A 1U7TA 2C5EA 4PCVA 4L4SA 1DJNA 3Q6IA 4J1NA 5EESA 3UCFA 5G4LA 3AY3A 4BNFA 1EUZA 3I47A 5EPOA 5EMHA 5IDWA 1WZIA 4RLSA 1R0LA 1FDUA 2XXJA 3BTOA 5L4SA 3ST7A 3RCBA 4XZ3A 1OOEA 1HZDA 3PGJA 3I6QA 1YBMA 2CY0A 5DZSA 5GZ3A 4JFCA 2Q49A 4L74A 1DC6A 5L45A 3WQQA 1ZK4A 5IXYA 3DZGA 4R5HA 4Z0MA 4UVEA 2NVUA 3RBZA 5AXCA 4CLRB 1P74A 3D1LA 4MVJM 1V9LA 3H8VA 2J5QA 4N5NA 3PWZA 4KQWA 3PTZA 3KETA 3K8ZA 2HMUA 2YFQA 4U0JA 2PFGA 3JU1A 1GY8A 2O3QA 4JOTA 3AFNA 4ZVVA 1DLIA 4MO2A 1C3VA 4Z0TA 1T1RA 5G0VA 2NU7A 1B14A 3JYQA 3QVOA 5JCJD 1HZZA 1U3VA 2IEXA 2J5GD 4FFNA 3LYLA 4JK3A 3Q9UA 4RF5A 4GGPA 4KOAA 3C1TA 2GZ2A 4DXHA 2DFVA 3PEAA 2X24A 2YV1A 1E3EA 4YTEA 3O03A 1U1IA 2VSSF 2UUPA 1KVUA 3DJAA 3GMAA 4YJGB 2DTXA 4TWRA 4FFPA 4AJEA 2AE2A 1Q52A 4A73A 3E6AA 1DUBA 4WOJA 3JQAA 3PHIA 3GFBA 1CETA 4I42A 4IINA 1XCBA 1V0JA 3QLJA 4YQYA 3H0UA 4GX5A 1P1IA 1O94A 1P9LA 4Z3DA 2D5AA 3KEQA 3CE6A 2ZL3A 1YB1A 5IKLB 3PYXA 4IXTA 1HYGA 1LRJA 2AMFA 2DKNA 3GUCA 4OGWA 1LBEA 4JIGA 2W2LD 3KUXA 3IS3A 3VOSA 4PLHA 4NNQA 4QO8A 2FHSA 3ZV3A 2BD0A 3JYLA 4ZQEA 4J91A 4YBZA 2X4GA 3DXFA 4LCJA 1LLQA 4MKRA 1IPFA 4Z0PA 2I65A 4FBGA 4XJTA 2OP1A 4WOKA 2AEFA 2DPGA 1HL3A 1WMAA 4RQUA 3DONA 1GCUA 4B3IA 1VL6A 4OXYA 2DUUA 1J6UA 1VJ0A 2PH3A 2PGDA 3S55A 2IXAA 3NKLA 3W4JA 1ZNQO 4E12A 1KETA 3IJPA 2XOXA 4DMMA 2HDHA 4E31A 4UVGA 1PX0A 1VRGA 1LJ8A 2I67A 4D3DA 3P5MA 1BG6A 2WTBA 3WGOA 3WGYA 2FPPA 2NV6A 1PS9A 2FR8A 5T57A 2UVDA 4Y9DA 4RVHA 2FZSA 3GRPA 3MJCA 1R15A 4HFNA 4CLRA 5C3MA 1B8VA 3KYDB 1FF9A 1GL3A 1XLTA 2B36A 3KRTA 3R3JA 4OXNA 4BNYA 2NP9A 4BNKA 1PJ2A 3PWKA 1W0CA 5KVCA 1E3JA 3TZ6A 2X58A 3L77A 4B7XA 4NQZA 2NU9A 4CLOB 2FR0A 2IYPA 1HE3A 1L7DA 4BNXA 5EN4A 4A27A 3DR3A 3WLEA 1B2LA 1UZLA 3FRJA 3GVCA 3C8MA 3INTA 4BNHA 4CM9A 3IBBA 5IZ4A 2YHIB 4B7CA 2VRCD 4EW6A 1DC3A 3PQFA 3AY7A 4NK5A 1NQOA 1A7KA 3Q3CA 4EJ6A 4RF2A 1B3BA 3B6ZA 2P5YA 3OA2A 2XAAA 4XQ9A 3U4DA 1R4NA 4FDAA 4L6WA 4W99A 1W2XA 3DZJA 4IY1A 1CYDA 3KXDA 2VHZA 4FPXA 1VC2A 1HDZA 4YJGA 5DCUA 3JQ6A 4FD3A 2HRZA 1YG6A 1HWYA 4UAGA 1Z45A 2DTDA 3N58A 2O48X 3S2EA 5KJFA 2Q35A 4J6FA 5JO0A 1AXEA 4W6ZA 3GF7A 2W2KB 4GH5A 4BS9A 5T67A 2NUAA 1DIRA 4FQ8A 3ZNPA 1GYQA 3IMFA 3O8QB 4EBFA 1DAOA 3TZQA 3O38A 3WS7A 3OBBA 4Q1IA 4L9RA 3DC2A 2BGKA 3AI1A 3PXXA 6ADHA 1TG6A 4YWJA 3SLLA 4N18A 3ZDFA 2ZTVA 3GNSA 4LVCA 3PDJA 3HQ4O 4N7RA 2AEMA 1ADGA 4H3VA 3EK2A 4YAEA 2HO5A 1IOLA 3JQGB 2TMDA 5I8WA 2HMSA 4WYOB 3RI3A 2VYVA 4J3FA 4L4XA 3UICA 4HFRA 2E82A 2PD6A 3G0OA 2FBMA 4BGIA 2IDZA 3W6UA 4D42A 1T4BA 3ZZNA 5A3JA 3E1KA 1R6DA 1DBVO 3DHNA 1BDBA 5F1KA 1JTVA 3I9NA 3K8XA 1TT7A 3I4FA 4BO0A 4RVFA 4R9SA 5K6AC 3QW2A 1PZEA 1XX4A 1Y5RA 2VTDA 4DWVA 3TT6A 1I01A 1E6UA 2W8ZA 3K2BA 3L4BC 4IIVA 2B83A 3DOCA 5A04A 3E5MA 4GGOA 1RJWA 4I8XA 1DC4A 4IDBA 1WPQA 3LC7O 5U9CA 2BGMA 2VQ3A 1GCOA 1M76A 4YQZA 3LC2O 2VHWA 1MXHA 5DU6A 1XR3A 4TMFA 3PDUA 1LU9A 4CODB 3KYDA 2GGSA 4HUJA 1OC4A 3DORA 3KZVA 1H6AA 1YS4A 4YRDA 2DVMA 2WWRA 4DC0A 3WGIA 3H81A 4GLLA 5ILGA 3C1AA 5DBGA 2OGUA 3MJSA 4CLOA 3RASA 4CMEC 1ONNA 1R66A 4YAJA 5TT0A 3CKYA 2QW8A 3KTIA 4XEHA 3H5RA 4YJFB 2YHIA 4YPOA 3KLMX 4GPD1 1V8BA 3DL2A 3KEOA 3AM5A 1HDGO 1HDYA 4J4TA 4XR9A 4I5EA 4KP7A 4OG1A 1YONA 4KMSA 3P2YA 2OOSA 3GEGA 1OMOA 1PIWA 2H6EA 3IP3A 3N74A 4NJOA 4E2YA 4Z9FA 5JBIA 3EYWA 3KO8A 4UREA 4HY3A 1XKQA 1PJQA 2FZEA 4BKPA 3HNPA 1MFZA 3D64A 5KJEA 5ITVA 4M87A 2D1YA 2VWPA 2I99A 4LRSB 4Z3KA 2W2KA 1YBAA 2NM0A 1I32A 1HNOA 3NUGA 3OH8A 2VT2A 1U2GA 3O8QA 3QWIA 3VIVA 2DTEA 1R4MA 4IJVA 1ZFNA 1AE1A 2JHGA 4IMPA 4WEQA 1U28A 3JQCA 3HDYA 3DO5A 5IZCA 3AI2A 4CMHA 4DLAA 1K89A 2BELA 1BVRA 3WG9A 5KKAA 3IDSA 2LDBA 4ELXA 1AUPA 3JQGA 5JO9A 3OIGA 3GUYA 3IC5A 5K9ZA 3VPXA 5KCZA 3TV5A 4MOWA 3SC4A 4ZGWA 4HX5A 3VH1A 3C85A 4J16A 3MZ0A 4PLPA 1KEPA 4W9NA 3FNEA 4CM4B 2Y67A 2Z1MA 1T2CA 1NFFA 4YRBA 1C1XA 4AG3A 2VWGA 1FDWA 3BZUA 4RO0A 3KSDO 3G17A 2JKVA 3DBHB 2YV2A 4DYVA 3G1TA 3H9UA 1QV7A 5G1QA 4YJHB 4CMIA 2Q1TA 1PR3A 3FDUA 1AHIA 1SOVA 4GKBA 1UXKA 1WP4A 4MIOA 2J5RA 2VZ8A 4I5GA 3ZHZA 3CMCO 3RC1A 1VM6A 1LX6A 3UAGA 3QWDA 1Y8QB 5DUCA 1JVSA 3FCOA 4TRRA 5CEEA 3WFIA 1GZ3A 3C7AA 3HDQA 4NJMB 2BMAA 1PGQA 1NASA 1PJCA 1A72A 1CQIA 2V6GA 3ZWBA 2F6QA 3U62A 2P5UA 3D4OA 3EHEA 2Q4BA 3NDJA 2Q46A 3W8DA 4BIIA 4CMCA 4FB5A 1ISIA 1BXZA 1X7DA 2CNBA 1SG4A 1W6UA 1GPJA 3DTTA 3DWFA 3LF1A 5DP1A 3B1JA 3DZKA 5I7VA 5EIOA 1YH3A 4YJFA 4DQUA 3U09A 4WGGA 2J5SA 2DPHA 1I10A 3KSZO 4J0FA 1HDCA 2PGJA 4IS3A 2CVQA 3MOIA 3PHLA 2Y0CA 2Q99A 3DTYA 4Z9YA 3S2GA 3V1UA 4G2RA 2FPIA 1J7XA 3NGXA 4HP8A 4WLUA 3L9WA 4R3WA 3F5SA 5TQVA 2O3JA 3BMOB 3DOJA 1RYDA 4II3A 4JJTA 4NBTA 5FI5A 5KJ1A 2FSSA 1RM0A 3T89A 1RYEA 5JY1A 2VREA 5DU4A 5FUSA 5JAQA 2EXXA 2NU6A 3FBTA 3RKRA 5DTPA 3ZV5A 1NHWA 1XSEA 2J5IB 2CF6A 4NDNE 3VDRA 2ZL4A 1H6BA 3K50A 3OJEA 5DUFA 4JBHA 1SBYA 3GHHA 4J4BA 3RUCA 1UH5A 3L6OO 1EUDA 3DMTA 4CM7A 1YL7A 4HADA 1X15A 1FC6A 4II2A 1UP6A 3JQAD 4J1QA 5FEUA 3PHHA 4RDIA 3TRIA 2Y66A 3HUDA 1N7GA 2X5JO 3ZGYA 2GF2A 4MI2A 4GAEA 4D45A 1DFHA 2VN8A 3VPGA 4CM4A 4JWVA 3ENNA 3RUFA 3KV3O 4J4HA 3OIDA 4C7JA 5TLSA 5JXWA 1GYPA 4WCDA 2C8TA 2DT5A 2PA3A 3DBHA 2HLPA 3JQEA 1J49A 2Y0DA 4ZDEA 4LCEA 2X5OA 2XXBA 1GZ6A 4WLFA 4YJHA 4Z6KA 4ALIA 4ZDDA 4M86A 3AFMA 3PZBA 2X0RA 1HLPA 3FHLA 1E7MA 5L40A 4CLHA 2O3TA 4WCFB 1ZEJA 3T4XA 4A0SA 2EG9A 1VKNA 3GC6A 4M55A 4E5MA 2CVOA 3V1TC 1Y8QA 1A9YA 2AEJA 4HFJA 1Z6ZA 2X5KO 4WLEA 1ISFA 4NJMA 5ADHA 3WB9A 2PY6A 3WGHA 4KDEA 2GN9A 5G0UA 1KVTA 4D0SA 1NQAO 1DDOA 3P7MA 4IJUA 4J2HA 3U49A 1CF2O 5KOIA 3DHEA 3GMSA 2Y1CA 1B7GO 5B37A 2GZ1A 1N6FA 2G5CA 4QIIA 2BLLA 3WBFA 4CQLB 2PKQO 3ROQA 1NM5A 1CERA 1ZZEA 4BO7A 2ZB4A 3ZWXA 2EF1A 2HCTA 3Q9NA 3RUHA 4AJJA 2D5CA 3B1FA 4AJIA 4ND3A 4D79A 3CTMA 3OEWA 4BO4A 1E1MA 1ZW1A 4CQMB 3OETA 4K2NA 2VOEA 2VRBA 3WSVA 4Q9NA 3FTPA 5A06A 2VUUA 4JXKA 2G0TA 4E32A 1FDVA 1QV6A 2HU2A 2C7GA 3JQ9A 1ENPA 3GY0A 4JX8A 4IIUA 4BGVA 2B5VA 5EL0A 4W7HA 3TVWA 4XYBA 2V65A 3QVXA 1HYHA 1EY3A 4CM9D 3ONEA 4URFA 3WGZA 1NTOA 4KUHA 3V5IA 2C59A 2HK7A 4WPGA 2J8ZA 1KEVA 4XJSA 1HZJA 4AJKA 1EVZA 4BNTA 2G76A 4D41A 4FZWA 1N9GB 1YXMA 2J5IA 5CTBA 2O3SA 2P91A 4ONEA 1JDJA 1X14A 2WM3A 3WG5A 2BHLA 3W8EA 1P44A 4U6QA 3LAOA 3VKVA 2CUKA 3HLN1 3FTNA 3PIIA 2X9VA 4LSWA 1JLLA 3VPFA 1N5DA 2ZTLA 3TZKA 4OOEA 1KEUA 4RPKA 2ZKLA 1AXGA 3BTVA 1Y8RB 3GA0A 4DTIA 1K32A 2VHXA 5G1RA 1LSOA 1T4DA 3JD0A 4WE3A 1K6JA 4CR7A 3GH3A 3ONDA 4NFSA 1VJ1A 3E9NA 3WGGA 4GI2A 3UH1A 1V35A 3S1LA 4W7IA 3TF5A 2PK3A 4MJLA 1NVTA 3I23A 3M2PA 3UFXA 4DC1A 4O0LA 2HK8A 3FSRA 2VYVD 1T25A 5AOVA 5TS3A 1N8KA 1IZ9A 4J9VA 4PZDA 5F1OA 5L95A 2VCYA 4RLHA 2VHYA 2C07A 4XB1A 4XKJA 1TEHA 3DBRB 2C82A 5L7WA 1FC7A 3Q7HA 3U9SB 3PQEA 4YRAA 3LT1A 1OBFO 3RFTA 3M1LA 4DPMA 5E0SH 4EUFA 3GG2A 1IE3A 3JQFA 1QYVA 1SZJG 4BNMA 4PRKA 3FPLA 3T7CA 3GDGA 1O8CA 1PS8A 4CQLA 1E5QA 1LDMA 3R6DA 2O50A 4B8WA 3GK3A 3HE3A 2VWHA 1WZ8A 3ORFA 4M89A 3A4VA 2X6TA 4RPHA 4IGFA 1ULUA 4J0EA 1SEPA 2YY7A 1J0XO 3D5TA 2AG5A 2JCYA 3L07A 3VZQA 4ZQGA 4XIYA 4LMRA 3KM0A 2H63A 4YB8A 5G2OA 3CZRA 1SMKA 2O4CA 4UUNA 4YXFA 1IB6A 2NACA 1ID1A 2TMGA 1FMCA 1O5IA 1JQBA 2ZQZA 1KC3A 3QXIA 2VTEA 4IDAA 5KJCA 4RJTA 1IPEA 1PU2A 1EE9A 2ZIZA 3GF4A 1RKXA 4H7PA 1B3RA 4DLLA 4KTVE 2BFMA 4CR8A 1ULSA 4UEJA 1I2BA 1CJCA 1B16A 3EZYA 3VZPA 3DB2A 5C7LO 3I83A 3I52A 3D0OA 7MDHA 1DJQA 1QYWA 1UXJA 2NVBA 4RPJA 5ER6A 4CM8B 2JD2A 2Y1GA 4E6PA 2UDPA 1FC9A 4ZDCA 4G81A 3OA0A 4GVXA 4PLWA 5JY6A 1UDAA 4LW8A 3ZNQA 5JC8A 3GRKA 3F4BA 3ENKA 4HXYA 4JROA 1HDRA 5C90A 1U8XX 2FWMX 2JFGA 1PQWA 3TFOA 2VX2A 1Y8RA 4A7PA 1C0IA 1PJ3A 1Y9EA 4RF4A 1M6HA 1O89A 4IPTA 5C5IA 1NHGA 1Q2XA 2P68A 1E1NA 1F17A 1FDSA 1RPNA 2B69A 2UZFA 3KTHA 3T8AA 1PZFA 1QKIA 1DRUA 1PJLA 4U8GA 1LSUA 1W73A 1ZJZA 4KWBA 5JBWA 5E0SA 3PGQA 1DC5A 1GYRA 1A9ZA 1EQ2A 3BAZA 3CMMA 3ROKA 1Y7OA 5H83A 1YKFA 3KVOA 1LLCA 2VZ0A 4BKUA 2EP5A 2D59A 2R00C 3AM4A 4YEDA 4HV4A 6LDHA 1OFGA 3WIEA 4DYDA 2ZB8A 1KS9A 1PJSA 3DBRA 3Q2KA 4K1LA 4Q3AA 1XO6A 5DN9A 4DRYA 3FWZA 4M54A 1SZOA 5HS4A 1K2WA 3WYBA 4YT4A 1GZ4A 1HKUA 2YFHA 4IBOA 2A81A 3T88A 1ZJYA 5CFZA 4TZTA 1JKFA 3QVWA 3AY6A 3WDSA 2J5II 1Z73A 2ZATA 3GGPA 4I5DA 3DEYX 4MVJH 1X1TA 3NT2A 5TRTA 4WKGA 4XRRA 3SXPA 3GVPA 1C1DB 4XGNA 3RSTA 4AJ1A 1D3AA 5JDCA 1A7AA 3FF6A 1EUCA 3Q11A 4HKTA 1P1JA 4WASA 3SJ7A 1BW9A 1ENZA 1YL6A 5ICMA 1YL5A 3SX2A 1PJBA 1TXGA 4G65A 1ZSVA 5I7FA 5FF9A 1E7YA 1X0UA 3DBLB 2GUGA 4FFRA 1IYZA 2Z5LA 3SVTA 1NPYA 3GVXA 1R4NB 1Q0LA 1QYXA 1H6DA 1WZEA 2GLXA 5JCXA 3ZW9A 1SB9A 4WNIA 3D4NA 1F14A 3T8BA 2Y05A 3AOEA 2ZJ0A 3G3EA 5G0TA 5TT1A 3C7CB 1JN0A 1GADO 1DPGA 3D3WB 4WNCA 3ZU5A 2EKQA 3G79A 3NT4A 1NWHA 3O9ZA 4K28A 4CV3A 1E6EA 5A9RA 3PYLA 4N5LA 2ZCVA 4CM8A 3FBGA 4ASIA 5B1YA 4NHEA 4RZIA 3IKTA 3EMKA 1T24A 1ZKMA 4EGFA 4BNNA 2B4TO 1K6XA 3E82A 5C7OO 3R0OA 4CLEA 1GTMA 2VUTA 4OQYA 2BRUA 5JSFA 2JFHA 4OO3A 3EUWA 4EDFA 4XD2A 5A4DA 1YQXA 4PLZA 3FNHA 1PL7A 3GN2A 1P1RA 4ZQFA 3F4LA 2V6FA 1I3LA 4R9RA 4Y98A 5BT9A 1DIBA 1WMBA 2C2XA 3ZWWA 2PD3A 1P1FA 5A02A 1A5ZA 1X7GA 4LSMA 5H82A 4BUCA 2PV7A 2I66A 2LDXA 3PJGA 3PEFA 1E77A 2UYYA 3MOYA 4BNIA 3U9LA 3HE2A 3UW3A 1X0VA 2UUOA 5DOVA 3H9EO 3NTOA 4MVJA 3H0QA 5H81A 1A71A 5CDSA 3TL2A 2A7SA 4EMLA 2EJVA 2JAPA 3R3SA 2IXBA 2GN8A 3OIFA 3GEMA 1P1KA 5LDGA 4E2XA 2CE3A 3ITDA 3ZWPA 3P5SA 4NFHA 4M1QA 3WR5A 2BI8A 4L8VA 3DZBA 4W82A 3AUTA 3NDIA 2GZ3A 1LDYA 5JYEA 4JQCA 3PPIA 1DSSG 1C1DA 3K31A 3D7LA 4U0KA 4CM6A 4N5MA 2J5KA 2NWQA 3TWOA 5I9LA 3ZH2A 4Y6RA 4RYFH 1OAAA 5BSFA 1ZXBA 3WWYA 2CZCA 4WCZA 1ISJA 3H9QA 4NBWA 2BZRA 3K6JA 4CV1A 2CDCA 3E18A 4E5NA 3FWNA 4YT2A 2F6IA 3WGTA 1YB4A 2B4QA 3F5QA 3ISAA 1LA2A 2FP4A 3DBLA 4EUHA 3LZ6A 1GV0A 2C0CA 2NSDA 5ES3A 3OJLA 4IJKA 1PR9A 4C7KA 2DM6A 2EW2A 1I0ZA 3H02A 3QE3A 4C4OA 3RBVA 2Q50A 3D3WA 5KJ6A 5L53A 1HSOA 2RHCA 3WYCA 4Q3EA 3GLQA 1UXIA 3R9QA 3UCEA 4WLOA 4PN3A 5A5FA 3RC7A 1R4MB 4GX2A 1RJNA 1H6CA 4D3FA 4HC8A 2PH5A 2GO1A 4LGVA 1SB8A 3MJ4A 2OZPA 2VSUF 3AU9A 4XCVA 1UP4A 3Q0GA 3CXRA 4NBRA 3OSUA 3Q1LA 4NU5A 4BNGA 4MINA 4ESOA 1TI7A 4A26A 1BMDA 2PKRA 4ZU3A 1B26A 2X7HA 3MCVA 4FIZA 3KHUA 1HF3A 1JAYA 4XDYA 3M2TA 4K29A 1E6WA 4ZRNA 3WWZA 1V3VA 1KERA 4CLXA 1C1XB 5F3RA 3GDFA 2PTGA 3MEQA 4MVJP 4DBVO 1MXFA 3RU7A 3ZWVA 4CMIB 5BSGA 1B15A 2HUNA 3JQ8B 1NVMB 4YAIA 4D7AA 4QO7A 5JAMA 3COSA 3LF2A 4PLCA 4RYFA 1JWAB 5KJPA 2GSDA 4CMAA 2YDXA 1DOHA 2WEKA 3JYNA 4YAGA 1QYCA 3H5NA 2EJWA 4D44A 1SAYA 4FGSA 4ZRMA 3QXZA 4XYGA 4JCSA 5LC1A 2NTVA 3F9IA 3OQ1A 4CV2A 2Z95A 2DBQA 1N7HA 2QRKA 4XR4A 4U1AA 2OXIA 3P2OA 2VNAA 4WLVA 4I5FA 4JCRA 2H9IA 1GQYA 2CDAA 3OT6A 1B8PA 3F1KA 5HTOA 2JHFA 1WXDA 3GZNB 1PQUA 3WLFA 4ZHSA 3ZWMA 1N92A 4MP6A 1OD4A 3SBOA 5IFLA 1I2ZA 2P9EA 2JL1A 3CSDA 1CDOA 1M67A 1U3WA 1N1GA 1EDOA 4MVJE 5F1PA 4PG7A 4RF3A 2X8LA 3OJ0A 4YYZA 1HETA 4NEKA 1VKOA 1HE5A 4J2OA 5MDHA 1GD1O 4Y6SA 5TX7A 3ADOA 1DIHA 4OH1A 5THQA 4EMMA 2V6MA 4Y6PA 5K0ZA 4FC7A 4YA6A 4TSKA 5FYDA 5G1SA 2DFDA 4MVJI 5IF3A 1LLUA 3LT4A 4CQMD 3NYWA 3EVNA 3I9JA 4CMKA 2AQ8A 1Z75A 2D2IA 1NVGA 5CHEA 4J1SA 1T2DA 4KPKA 5GY7A 1PQPA 1YB5A 3R1IA 4GBJA 4FW8A 3UCXA 1EF8A 1BHSA 2D3TA 1E1LA 3VHRA 2VSUA 3DZIA 2HJSA 2DQ4A 4E33A 2GR9A 5BNIA 3NGLA 5LDHA 4EMPA 4CLDA 4QUKA 4LMPA 5AXAA 3K2EA 3BXXA 3MTJA 1NR7A 5AXBA 4JCQA 2X86A 3OQBA 4JLWA 2BH9A 1K39A 2QRLA 3DZFA 2JCXA 3KLPX 1GFSA 1ENOA 3NX4A 2PPYA 1H0KA 1T1SA 2DUWA 4QFEA 4F6LA 5HS6A 1UDBA 2E48A 1OI7A 3RFXA 3SEFA 5CDYA 4JYJA 2GCGA 3K73O 1YOVB 2A4KA 1NNUA 4BVAA 4FFMA 5BNTA 1DIGA 5JBXA 3ZWCA 1QRRA 1RM3A 4JVTA 1LC3A 2BFOA 4ND4A 4FR5A 4P38A 5JDIC 1N6DA 4J49A 1Z74A 1W8DA 3L6DA 3JQ8A 3PHGA 4LVUA 4RDHA 1ZK3A 4QXMA 4UVIA 1D7OA 3X2EA 2G1UA 3G64A 3PRJA 1UR5A 4RPGA 3JD2A 3V5EA 1XQ1A 4LRTB 5CG1A 3K30A 4DVJA 4UVHA 1HYEA 5JPIA 3GVIA 4MP3A 3ZNOA 1UJMA 1C0PA 3W1VA 8LDHA 3LSYA 1DFIA 3I9KA 2JCVA 4RVDA 3D4PA 2YUTA 3SJUA 4RVSA 3CH6A 2AHRA 2HSDA 2YHUA 4EEZA 2WE8A 3GZNA 2E37A 5K6AA 1EDZA 2RHRA 4R1NA 2AW5A 2D8AA 1UUFA 4ZQHA 3IKVA 1YJ8A 3L4BA 5C37A 1M75A 2Q2VA 5BNFA 2A94A 1U2DA 4CL8A 1QSGA 4MDHA 4AJHA 5CTCA 2AXQA 5F5NA 3S8MA 1GUYA 4BO1A 2NADA 3JSAA 1NFRA 2ZK7A 3KTGA 3ST9A 2Q2WA 1MP0A 2XPCA 1I3NA 4CJXA 2ZYGA 3GMDA 1C14A 1YO6A 1EBFA 2CDBA 3BTSA 1NAIA 4NNJA 4WJZA 1R16A 5A9TA 3ZWAA 2O3UA 4DGSA 5JW6A 1EVJA 3QJ5A 4DUPA 3TOXA 4PGFA 4CMEA 2PZKA 3HG7A 4HNHA 4RZHA 5FI3A 4Q0GA 4UUOA 3RQSA 2F9IA 3IJRA 1FCFA 3AK4A 3VPHA 4RCVA 3MJEA 4ZDBA 2YV3A 3KQFA 3OF2A 4PG4A 3UN1A 4B8ZA 1U8FO 3HFSA 1W4ZA 2EEZA 4ELSA 4CPDA 1ZO8A 1Z7BA 4K3WA 1V3TA 4PRLA 4GSKA 4OMRA 4IS2A 4AL4A 3GPDG 4NFYA 5INIA 3AOGA 3KYBA 1M2WA 2HMTA 1EFLA 1NPDA 1YOVA 2OBYA 5DOZA 2AE1A 2J3HA 3QK8A 4OSOA 2EP7A 4CMJA 1KIFA 5DULA 4BO8A 5MGBA 1ZIDA 1LUAA 2PKQP 1O8UA 2POQX 3QHAA 3TFQA 1NP3A 3ASVA 3GPIA 4BOYA 3GEDA 4PG6A 4WCFC 2VSUE 3DHYA 3PIDA 3JTMA 3RRVA 4YACA 4FC6A 5TSDA 1BXGB 2ZB3A 3BMQB 1PL6A 1OD2A 5ENVA 2XF8A 1E3SA 3GZ4A 4BKRA 5KVSA 4JSBA 3PGXA 4R1UA 1LQUA 2FZWA 1FXSA 4ALJA 1U3TA 5L7TA 3VZSA 1UAYA 4HNKA 4Q39A 4EZBA 1T2FA 4S1VA 3HDHA 2VZ9A 3S2FA 4HFMA 2ZTUA 5COQA 3ASUA 5L7YA 1U4OA 4J9UE 1Q51A 4ITUA 5JYDA 3W4KA 4E0BA 2OFPA 2GN4A 3LLSA 3LT0A 1WDMA 3FN4A 3RFVA 2W98A 2GD1O 3RROA 4EJ0A 2ZTMA 2FY8A 3RUAA 4FJ1A 5A03A 3JCZA 3JYOA 4QTZA 2H1SA 2EKLA 2AQKA 4QIJA 4B7UA 3TZHA 5CAEA 4TVOA 5BSHA 2QHXA 2P4QA 3U4HA 2HQ1A 3Q1TA 4MVJG 4FNDA 5T8KC 3M1AA 3GOHA 3JQBC 3PI7A 4FOSA 5DT9A 4BO9A 4PLFA 1ZSYA 2FW2A 4L75A 4ID9A 4KWIA 3I4CA 3QQPA 1WW8A 1DFGA 4B4VA 1E7QA 3OJOA 2X0IA 3PVZA 4OMUA 5TJ9A 4E30A 5FWNA 1PL8A 1ISGA 5DZKH 1ARZA 4GLOA 3I9LA 4XA8A 3PFFA 2X0NA 3ZWOA 3ETEA 4FOOA 5CDGA 2Q34A 2R6JA 3LC1O 1E3LA 3BYZA 3CZMA 3LLVA 3PK0A 4BMSA 2GNAA 5DKPA 1VRWA 2OBNA 2WJPA 4E5YA 3LVFO 3F47A 3MJVA 4INAA 1B0AA 3TNLA 4I52A 1JAXA 4IDDA 1X7HA 4F6CA 1ZMOA 1DLJA 3GHYA 3LK7A 4R5MA 1PIXA 3A9WA 4E2WA 4GX0A 3NJ4A 1D8AA 4BNWA 1BSVA 1QP8A 2FPGA 4ZD6A 4ND5A 3TN7A 1Q0QA 2VWQA 2Y1DA 3TZ3A 3K5PA 3NTQA 1GDHA 3H7AA 1YG8A 3EGOA 4TKLA 2VYNA 3RUEA 4YR9A 1UYVA 1WWKA 4O63O 4IZDA 3HN7A 1BXGA 3OICA 3MOGA 3BMQA 4J7UA 3WYEA 5IDXA 5HRUA 3U9RB 2Q2QA 3DAGA 1I33A 1K5HA 1JW9B 1X1EA 4ZQBA 1MV8A 3HJAA 1A27A 4PLYA 4XYLA 1ML3A 2JD1A 2Q45A 4PLVA 5CEFA 4U5QA 3H2SA 3IUSA 2IZ0A 5A9SB 1BDMA 4P8RA 4XQGA 2NLOA 3VH2A 3FR7A 1DO8A 1PGPA 1UIYA 3H0JA 2DBVO 4XX0A 4CMBA 4OKIA 1I30A 3WIDA 4AJ2A 1LXCA 1D1SA 3HFGA 4FFOA 5U4QA 3PJFA 3WFJA 1YWGO 4JP3A 2PWZA 4JNKA 4XQCA 4BO3A 3M6MA 5IDQA 4CUZA 2CFCA 4EEXA 3ZU4A 2P9GA 1E3IA 3PJEA 3LDHA 2GTRA 3EW7A 4OL9A 1TVEA 2ZB7A 3BHIA 2AQHA 1BW9B 3OMEA 5DZKA 3DFUA 3T4EA 5B4TA 5KKCA 3ON5A 5U1PA 2RH8A 3OEYA
chains in the Genus database with same CATH superfamily
3LHFA 5LDDC 3B6MA 2PD4A 3QQ5A 1AX9A 2IZ6A 3VYVA 4Y2JA 2RIPA 3L8ZA 1VTKA 5I7OA 3I3OA 5SZIA 3SQMA 1KVRA 2B5WA 1UMDB 2XDQB 3QJGA 2WKSA 8ADHA 3UKJA 3HUTA 3OQVA 1DO2A 4GF5A 4YYEA 5HQ3A 1G5FA 2GEJA 4JBIA 1DG1G 1ZJ5A 2A67A 2SICE 1TEVA 3RM3A 4QFDA 5BXQC 1O94C 3IPYA 1N9ZA 2YIJA 4F3YA 2VQEB 2A5DA 5KQGA 3WJAA 1VMAA 4Y2GA 2OV1A 3ABIA 3UPTA 5CURA 4C30A 1TM3E 2EKZA 1CEYA 1R8QA 1M2GA 3PUJA 4RIFA 5LYYA 2O8BA 1CNEA 1RTKA 3PENA 4P22A 4OB7A 4QSHA 2OHXA 4UUAA 4WCDA 3VO8A 5AKJA 1ORDA 1GQQA 1KI6A 5AYVA 4IDEA 2MSWA 4W1RA 2WP8J 4XQ0A 2HHJA 1YACA 3IUNA 6GPBA 2GJKA 3E9CA 1EAYA 3E9QA 4IZHA 3U26A 4ZI2A 3KTKA 5L51A 2OV4A 3B3FA 5KHLB 1ZZGA 4HRYA 4YLGA 4N6GA 2F00A 2EYUA 3FPCA 1FFGA 5AW4A 4E11A 4ZVPA 5KOYA 4Q3DA 1QKJA 5FLKA 4DCJA 1VA4A 4J75A 3EAGA 4L0QA 3DWGA 3UV3A 1K8QA 4JJGA 2A1UB 5KNDA 1XN4A 3HHPA 3QP9A 1EGVB 3QEOA 2F9LA 4BQIA 3EZ7A 1Q21A 4H3HB 2ZQQA 1U4SA 2Y1FA 5F5XA 4BFYA 4MS3B 5F78A 4IG4A 3P52A 4ZVLA 1H2BA 2VBGA 1KOJA 4MV0A 1AHPA 2VT7A 1GRNA 1JFVA 2C3YA 1EE2A 1M7BA 2HEIA 4KRXA 4D6PA 5KQPA 2FR8C 1UYSA 5DBIA 9LDTA 2IHJA 3RSCA 1TM1E 4UM8B 2VNKA 1NPTO 4E7PA 1FLAA 5T64A 2IYOA 3NIGB 2G08A 5AM4A 5JARA 2X7JA 1WDKA 1D5WA 2BGNA 1AKYA 2YV5A 4H27A 1T5BA 4HDRA 2V58A 2VJDA 4LF8B 2QE7D 4TTSA 4TX1A 5DTWA 1QGDA 1CHNA 2Q1WA 5L3VA 1C7RA 1EDEA 1GUDA 1Q0HA 2HQOA 2PYZA 2ZJ2A 4EIWA 2YWEA 4QWWA 3ZU2A 2ORWA 3L6CA 3EZ2A 2AKAB 2AN5A 1FXWF 3ULKA 3FF4A 4YQEA 3ZQUA 4E4RA 3HDVA 3HBFA 4RORA 2GBCA 2ZBFA 2VAPA 2YDYA 3G59A 3WXMA 2FFAA 2I55A 2RCYA 3AH8A 2G63A 5G1NA 3BICA 3SEQA 2PKYX 1KYVA 1QH1A 4RY2A 3VYSB 5CA1A 5CXUA 1W59A 1TLTA 3LW7A 3QU5A 3ZXXA 3ICOA 1SU4A 3KTAA 4ROSA 3H0SA 1A4IA 4B3HA 1RC8A 1EIWA 2PGNA 3QFSA 2ACVA 3OWHA 4A92A 1V3QE 1U2RA 3OF3A 4X0EA 2I4TA 1GG2A 2VATA 1C1HA 3WRWA 4FGUA 3FFTA 1U8UA 3VRHA 2D13A 4C0KA 4F46A 4UTNA 3WC4A 2UAGA 1MORA 2WDZA 5JAIA 4YP7A 3PRHA 1BYIA 1GAEO 1U7UA 2XUGA 2HA2A 5CX4A 2IYRA 3UH0A 3UXYA 4DCTA 4LK5A 1HEUA 3HL4A 4QDKA 5CBPA 2CV1A 1KJJA 1IU9A 2Q5EA 1RWKA 1GG5A 1SBNE 1F4LA 1MB4A 1NW5A 2FPXA 4G2NA 4RLQA 5K8CA 1QR6A 4HUQB 2Y1XA 2XJ9A 4AFNA 1A8UA 4GMFA 5BSMA 5E0NX 1FW6A 4B34A 5G4KA 1NN5A 1NIPA 1UXGA 2PRKA 3U3ZA 3ZQKA 5IT4A 4OX9B 2WD8A 2RIRA 3FGZA 3TRRA 2Q1SA 4BGEA 3ZDCA 3ODPA 3IOMA 2ODBA 1KYQA 1K0FA 2ZRFA 3DBIA 3F78A 3WIVA 4ESEA 4F45A 3ZHXA 2P4HX 1JJFA 4QQRA 1MGPA 3S99A 1O4WA 4JCTA 2JCGA 1NLFA 3BTUA 4MPTA 2DQSA 1OCEA 1L5QA 3N2IA 4P4TA 3UOAB 1NVDA 1MQAA 2BJHA 2C5BA 2H4WA 1BRMA 1LI4A 3AI7A 2V9ZA 1DGQA 1QH9A 1RLJA 3C8UA 3VMMA 3LECA 2AT1A 1G2PA 3MWKA 5K6TA 4ESVA 3A9CA 4RVOA 2CMDA 1U5AA 4BMNA 4G9EA 1UWKA 1BD4A 4KAJA 2O20A 3CONA 5J47A 2GKSA 1YR9A 4HPJB 5INFA 1WBJB 4KN8A 5EKXA 1OI4A 1Z16A 3P96A 3T3WA 3KJHA 1JG3A 4Z4CA 3SLRA 1FW8A 2GETA 3B3AA 3JALB 4EMUA 5CFNA 4FNBA 4ENQA 3WJ2A 3AUYA 1N0HA 4GMGA 2O59A 3THXA 1M1YA 2R11A 1I4EB 2FG5A 1OZAA 4JSTA 4B3JA 4OB8A 3HH8A 1ATZA 1I4OA 2X40A 1D4FA 1OE0A 2VZEA 3BMCA 4KMMA 5FULA 3TPCA 1WUTA 4GC5A 1LVHA 1N2EA 1YT5A 2Y77A 4NG5A 4ZP1A 2A3RA 5FQNA 1QIIA 4U7TB 2HCBA 1KJQA 1NW3A 2Y76A 1WU7A 3GAFA 3PQDA 3UMYA 1IPHA 1EFCA 2XVMA 3MUNA 2OPBA 4ZA2A 5H5JA 3C16C 1NXPA 2WYVA 1FFXA 3UKDA 4PQEA 3V4LA 4GR9A 4F2PA 3RSZA 4X41A 3NVKI 4S3MA 3PNMA 3ZV4A 2PUVA 2G80A 2G82A 3QIVA 4LVOA 2E5FA 4RS4A 4KD6A 2B4AA 1NXXA 1YQUA 3HSKA 3PLNA 5T4HA 3TM4A 3N8DA 5ILOA 1SXJB 2PUEA 3IP1A 5GGXA 5KC9A 1MPXA 1VB5A 3ZNNA 4BRWA 2XTJA 5IJAA 5EQFA 4Q3KA 1MFPA 2BISA 3P9KA 2ZSJA 1J7JA 1VJTA 3KXPA 5ALPA 5COBA 4TXJA 2C2ZA 1CEXA 1V4NA 1A9XB 1GKUB 7REQA 4WZBE 1XYGA 4JJZA 3QYAA 4DAOA 3BE4A 2CHVA 4CBVA 5COAA 3L6EA 2PJZA 121PA 1NURA 4MKXA 1TFRA 2CBXA 3DULA 4GZLA 3VTFA 3F3SA 1MT3A 1PW7A 3GLGE 1KGSA 2RH4A 4TLMB 1F9AA 2Q5QA 4K9SA 3CUYA 3GJXC 4MWDA 5JOQA 4QDOA 4OQZA 4MJ7A 2PGLA 4NBVA 1KK2A 1VLJA 2WDPA 4BWVA 2R84A 1Z17A 5IZCC 1ZN8A 2R1TB 2CWWA 4G5HA 4RANA 3WKEA 3C3KA 4BZPA 3WICA 2FLWA 1E7SA 1MJGM 3N0TA 3R09A 5H0IA 5EUQB 5SYAA 1B73A 3QF7A 2BYTA 1X80A 4RHFA 3DP7A 5CK5A 1N2CA 2B1IA 1QMGA 3MB5A 4D4KA 2SECE 2WFLB 5F9MA 1RWNA 3T7EA 2ETVA 4IDHA 4Q6WA 4ER0A 1VLVA 4ZYWA 3JQ7B 4BMVA 2BTEA 1NF2A 4I4TB 1JBQA 4FMCB 5E9QA 1PVDA 3RRBA 2QT9A 3E03A 1PFYA 4ZU2A 2ZIXA 3IELA 3U7EB 1U2SA 4EW1A 5B2EA 3BWXA 1I2CA 4EP1A 4F6RA 4BLTA 3ETDA 4M7RA 5HM8A 5LQRA 4FLEA 4GUAA 2VSFA 5E4JA 1FMJA 3FMIA 1HOTA 3RU2A 1PFVA 1U7DA 3E58A 1PEDA 3E3AA 2IEZA 5IDVA 4LC0A 3STVA 4EG8A 1PUIA 4HUTA 2GEUA 1QIDA 2A0WA 3PUIA 3B6IA 1DCKA 4D5GA 4A10A 2NPOA 2FK7A 2CMGA 2XZPA 4GQBA 2O7SA 3DDNA 5EXXA 3RYHA 4D4IA 3V8NA 2P77A 4KE6A 4B3FX 2IYNA 1QCYA 2WA2A 3AUXA 1BJTA 2QG4A 3HLYA 3BHJA 4QOSA 4UUQA 4WVFA 1KSFX 3TMYA 1ZEMA 5AVOA 3UUWA 4E5UA 1NQTA 1RFLA 3IULA 1Q1NA 3CE9A 4ISCA 5CVEA 5AM3A 1K3TA 2BEWB 2ZM5A 2E1PA 3IAHA 3L0DA 2PXCA 3MQ4A 1CW2B 2A6PA 1W85A 2WPDD 3ZHRA 3UJPA 5LZ9A 2IEBA 2QZ9A 3NBZC 2ZRNA 1U5CA 3QJYA 4B4OA 2CXPA 4DB4A 3L5KA 1SM4A 4K6CA 3DWEX 4DBZA 2FRDA 4U2BA 5E6UB 3MWGA 2P8JA 3P26A 1O58A 4DPKA 2IW3A 2BN4A 1ODJA 1XZDA 4MI6A 3ZHSA 4ZZ1A 3F73A 3DV2A 1WVGA 3I9V1 4NH0A 1UOOA 4NOLA 4IHAA 3ASYA 1JB1A 2C04A 2V9PA 4OYHA 1Y6GA 1Z4QA 1C80A 4M76B 1T5IA 3WTBA 4GRIA 1YRWA 4LX8A 2Y9ZA 3FTFA 5IKEA 2NO6A 2XCOA 1WTAA 4KZPA 4NMHA 4RUKA 4B4WA 1SWVA 1AZLA 1VSBA 5IYZF 1OD6A 2JLXA 3ZVMA 4A5OA 1FZQA 2YVUA 5CT4A 2VDMB 3NHYA 3ILYA 1AURA 1TA9A 1AO0A 1Q22A 3DVLA 1Y4ZA 4JJ4A 1MH1A 2HDWA 3WYGA 4QBFA 4B87A 1A3CA 5ULLA 2AXPA 2JJQA 2QX6A 3E5RA 2XYQA 5L4LA 1OKKA 3IXMA 3ICPA 1K7YA 5JI2E 1RAHA 4NAUA 4R2LA 4XTCS 4CMGA 3KYCB 3HINA 4ZCQA 4HLNA 1D4OA 3OKPA 5KSYA 2ZJZA 2YZ7A 4HZIA 1E9EA 4C76A 3DMTC 1NLMA 3GFVA 1YE8A 2HJGA 2XGGA 2ZRBA 3FLEA 2AN3A 2CSXA 4ED9A 3HN6A 1QFSA 1B76A 1NUQA 1TU4A 2D0IA 2HI0A 2V4MA 3BJRA 3INGA 3NB0A 4Q6BA 1I0IA 2OXCA 3GIDA 1IJBA 1C3OA 1QWSA 6Q21A 5HZKA 5IX8A 4IQ8A 1QXSA 3EDCA 1YUBA 3C5EA 1EK6A 4QRDA 5D00A 2IU0A 2HMWA 3CX3A 1SKBA 3PGVA 2H1RA 4YDRA 4WLNA 2P9BA 4A0HA 2QTVA 1HG1A 2Z3ZA 1W87A 2PZLA 3AETA 3KVVA 4OXKA 4ZVNA 2CFTA 3UMJA 2QDKA 3HUUA 1I4DD 2IZZA 2XBUA 3Q85A 4HB2A 5IT0A 1EP1B 2VDKB 5L3QB 3P85A 1XDWA 2F55A 2N75A 4Q4LA 3OM8A 4IXNA 1VYTA 2R7AA 2HFJA 2ACEA 3DTVB 4HQKA 4L5JA 3SS7X 3FPEA 4DA9A 2ZZNA 2QLLA 4TWBA 3ROGA 1JFTA 3BD7A 5JNRA 4Z0HO 3W6ZA 3USCS 1F6BA 2LPMA 1AZTA 4RK6A 2XMSA 2BMDA 5JTUA 1NW7A 2FEXA 4WBSA 4F38A 3DFMA 4JJIA 1ONSA 1ZCFA 4KAFA 1LD3A 2IY7A 2PLFA 2QJTA 3BMNB 3QE0A 3NFRA 3SIXA 3VU0A 3BEZA 1Q84A 1VKZA 4NZMA 2WUDA 1KY5A 1A96A 3U4CA 1IL0A 4O2AB 5K3DA 3FROA 3P9XA 1YQWA 3VMFA 5F9HA 1N9KA 1JF8A 3R6WA 3PBKA 1NM5C 4TV9F 4XWYA 5JMTA 1CZLA 1NBWB 1U4NA 2O2HA 3NBXX 4OHCA 1FP4B 1MG0A 3C41J 4U0GA 3IUPA 3A26A 3LAWA 2J30A 1SOWA 1TUGA 3HVJA 1FSFA 1IY8A 1Z88A 3MT7A 2FQWA 2W6PA 1UEJA 3V4ZA 5HRCA 1QIMA 3O8DA 1MH9A 3R0IA 2IHTA 4M1TA 3OQIA 1Y48E 4KU4A 3UHAA 2K7FA 1ZL0A 4XFJA 3RVRA 3TBFA 1QLJA 4CKWA 4MMZB 4Y67A 5JCJA 1T6NA 3MD9A 1QYIA 3SEAA 2C5SA 2J5GA 3SX0A 2H2AA 3NC4A 1ZD8A 2O7QA 3JQ9C 3OX1A 4PRYA 4BV3A 4Z4FA 2HXGA 1F6WA 1SBQA 2I4IA 2PBPA 3MFYA 5DHRA 3I8XA 5DHTA 1EK5A 3C0KA 4YJDA 4KLNA 2CV2A 5TVGA 2VHQA 3A7DA 3REFA 4NCBA 1Z68A 2H5LA 1A4UA 3FCYA 2NPFA 4COOA 1VE3A 4WZ8B 4PLGA 2JBWA 4OCZA 4EO9A 3IP9A 4I8DA 4LNHA 3X2FA 1KWKA 2VH1A 3NTUA 3AEXA 2GTHA 3ZHYA 3IQZA 5GTDA 1YZ3A 2HA6A 2FPUA 2ZJFA 3JWIA 2O2GA 4FZWC 3RFCA 3AESA 4W5HA 3PTAA 3DJFA 4X3OA 1IXKA 1C7IA 3ELDA 4M6WA 3J7AC 3Q8WA 3RVDA 4JP1A 1DAPA 3LLCA 3CB4A 4BV9A 1WXWA 5AM2A 4FM9A 2AH5A 3U9TB 3LPNA 1GIAA 3WMEA 4I3HA 4HN9A 4CEJA 4MRPA 2XTNA 3HWRA 1AHHA 1Y33E 2A2ZA 1LS1A 2DR3A 2E49A 1J8YF 2F7SA 2GJAA 1SXJE 2VHVA 3GJ5A 3B3QA 3U4IA 3WX0A 1TYZA 2QRVA 2W2LA 5FBVB 1BMTA 4K26A 3AWDA 2PQ2A 3W5VA 1AGNA 1H3EA 2CK3D 1JZQA 4TQAA 1RM5A 5DI3A 3SQNA 2C3UA 4DRZA 2A9PA 4LKRA 2C7VA 2AJBA 3NC1C 4DIUA 2EJ5A 3B8HA 4CKXA 3ICVA 3LX4A 4TXLA 3ESXA 3GKBA 3A9TA 4HF7A 3V8EA 4FONA 3WMXA 3EVFA 1UYRA 1W35A 4Y2TA 3D8RA 1FUUA 3AFHA 4IH1A 4BUZA 1P5ZB 5DP2A 3NRCA 5GP1A 3I9OA 4KO3S 4DCVA 3NNDA 3IOCA 4DV1B 3PI6A 4OIFA 1VCNA 4QFMA 5EEGA 2KWIA 1F8GA 1ZC3A 3T1HB 3CH4B 3OKAA 4ZDKA 2ZZMA 13PKA 3PD7A 5HZMA 1SQGA 2IGTA 4PSAA 3X1DA 4ZTUB 1EXMA 4KB5A 1U1GA 1ZQ9A 3R0ZA 3NJDA 3VPDA 3EGXB 3NRJA 4B6RA 4QXAA 3RYIB 2O19A 1KO1A 2JHCA 4D9HA 3K1YA 4F5YA 3IX7A 3GT0A 4K46A 4K9DA 5EQDA 3VKFA 4G41A 3WHIA 3W8RA 5K4HA 3Q98A 3ZLVA 1E9FA 5LNK6 4FB8A 4LY0A 5DX0A 2EFHB 4ZKDA 1JI3A 3IT1A 4XPIB 1G1MA 2WE7A 2QJFA 3SVLA 4RCNA 1V43A 1NF8A 4M88A 4KAAA 4REQB 4DV7B 1U0JA 4E13A 2A9OA 4BVJA 1CQJA 3KK0A 3LYUA 3ZHBA 2ZYTX 2QQEA 2XMRA 3GYGA 4ZEVA 2GCEA 3FI0A 5DHAA 4TVSA 4JBGA 4UEOA 4DIEA 2DJ5A 4UEKA 5AKIA 1SELA 2FB9A 3FGOA 4AF7A 4F11A 2PUHA 2QRNA 3QFHA 3IEUA 2UU9B 4MI2A 2W22A 5IDYA 3T5MA 4P32A 3WYNA 2ODWA 2JLYA 4BU1A 4IXWA 1U04A 4X1OA 5DCYA 4RV9A 1E2KA 4RKEA 1UDWA 3H9JA 3DMRA 1QHFA 2EQBA 4P4NA 3AU8A 3DE1X 1N25A 2BM9A 3MW8A 3STXA 4X8HA 2OQ2A 1RS0A 2G9RA 3SVZA 3L82B 4RESA 4WIAA 5JSZB 3VR3A 4CIBA 4ARSA 2J6BA 1T2UA 4DM3A 4BQSA 1E1DA 1AS3A 5JXGA 2PVSA 4IM7A 4AP5A 1V41E 4AICA 2OMEA 2NZWA 3WXBA 4IIYA 1T8YA 3OZBA 4YAUA 2NTNA 3G0HA 2X0JA 2A7KA 2NZJA 3BMOA 2OORA 3K0FB 1PDWA 2QZZA 2AFHB 1XNYA 4RD0A 4CEIB 1XA0A 2FUCA 1GNPA 2KW5A 4FSHA 4CM3A 1WB9A 1NP6A 1QAMA 1TQ6A 5KU1A 2ZSUA 2ZYDA 2XNDD 3LUCA 2BF7A 3TR5A 1PYDA 4H16A 3A6PC 2JAQA 1JTEA 2CHUA 4IIEA 4F4DA 4MDFA 1E5XA 2E5LB 4YAFA 2JGDB 4IDNA 1WZNA 3O84A 2C8VA 1R7RA 5B4UA 2AFVA 2VFAA 4KQFA 2J3LA 5AXDA 1ACLA 3VNVA 2FZKA 1OSNA 3UGTA 1QMPA 2OBBA 3EVDA 2C2HA 2HUPA 2V7WA 3Q0IA 4DNFA 4BXOA 4P0QB 3LI2A 1E5LA 2NXCA 2WVHA 4TSFA 3DWIA 4P3PA 1GNVA 1EGAA 1H9BA 2IH2A 4Q34A 3LJKA 5AHRA 2W6CX 3GEIA 4R40A 1A2BA 2ZJOA 4R7ZA 4ZAGA 2B1GA 4GZ6A 5BQFA 3NHUA 4HQRA 1LLDA 1XL1A 2C77A 1W0KA 3ZLUA 3BDIA 3QA9A 1Y1TA 4LJLA 4LBWA 4PSVA 4CETA 5FAKA 1X8KA 4RZ3A 1UBFA 4CZ2A 1RM4A 4MQBA 4D9IA 5IJZA 1IOZA 1W0JD 2DLNA 1S3SA 5CNIA 5KX5A 3GEPA 4WAUA 4Q4HB 3NIFB 4G07A 1ZJ6A 4Y2UA 4Z86A 5G0SA 3FOAA 4EUSA 1DTWA 4Z4IA 3D7KA 4D02A 1JFRA 1GITA 3NHJA 3KOUA 4HX9A 5C7IO 2YBDA 4UU8A 3QWFA 4FZ3A 2YYYA 3GFOA 5AHXA 4D3SA 3LFTA 4NV1A 3KUUA 3VR4A 3W2EA 1K08A 1W34A 4TRJA 4WESB 2C7QA 3R9TA 4NR0A 1L5GB 1KZ7B 1UZMA 1VIAA 4YRQA 4GM2A 3HI6A 1D0IA 3UHFA 2GN1A 3AKEA 3C45A 1IZ0A 1Q74A 3NAGA 4CKCB 4LZAA 3WGQA 3DUFA 3Q9LA 5ADUS 2BFAA 3RC9A 2ACKA 2HWXA 4N8DA 3S40A 4ELWA 1E89A 1MX3A 1DEHA 1ELOA 2J59A 2XQJA 1IN4A 2ZWOA 3GBSA 2F1KA 4C22A 1FNBA 1MB3A 2ID4A 2QD3A 1D1TA 2FNAA 1F8FA 1SXJD 2QI9C 2X8AA 1O0CA 5SICE 4PW0A 1APBA 4DYHA 3SQWA 4LJSA 2I4NA 2PLAA 1U2QA 3KL4A 4L73A 4N54A 3HJFA 3HEMA 4WECA 1R74A 2FW7A 3TIIA 1SBHA 3LO5A 4FMBB 1YVEI 5B6IA 4QREA 2KX7A 1AKEA 2ENWA 2WHXA 1FOEB 1I9GA 1PFWA 4QJBA 2QTWB 2ATEA 1FX0B 1E66A 1QP7A 1PSWA 1SXPA 2CBZA 2G88A 2VHTA 2BKVA 3N6XA 1V8FA 1TUBA 4LRYA 4YMWA 5B6JA 4DE5A 4KDCA 3W4IA 2AXEA 4M53A 1CUGA 2W3PA 4HVAA 2GK3A 3FJYA 3KPWA 5F77A 5EYPA 3WMWA 2WWYA 5JUWA 1RLMA 2QL9A 4D4GA 5AQ1A 5CB0A 3MT6A 3FI9A 1QF7A 2GDZA 4TQ9A 1RWPA 3HU5A 1YDMA 3PX3A 4HWTA 3WL5A 3WA6A 4ZI3A 9LDBA 4IZCA 1PO7A 5HP4A 3RRNA 2FOIA 3FPBA 3PZKA 2FPRA 4C6RA 2Q0QA 2ZRIA 3UB3A 1A5BB 1X13A 4ZYLA 4MLCA 5C4IA 1ABBA 4B83A 4Y9TA 3SYTA 3WWOA 3AF0A 3FTCA 4Q19A 2OZLA 3T3MB 3PGA1 2HCFA 3FFAA 3VNAA 1PDVA 2I33A 3N3BC 1SUIA 3OM9A 3QU4A 1CIJA 3OFSA 2FMHA 5DJ5A 2LBPA 3GA5A 4G1MB 5A5EA 1OXXK 1RRFA 1N6OA 5CLGA 5EQTA 3ZHQA 3O3MB 1SKYB 3GLFA 5DMHA 4IH4A 1F2UA 2ECKA 2REOA 2UYGA 1X7YB 4OYLA 1Z83A 4EMBA 2YYZA 1XPRA 2B94A 4P34A 5CXSA 3AHHA 3KB6A 5FWXA 3QU2A 3MIZA 3SGLA 4PAQA 4JKIA 3V97A 3I37X 2Q0SA 5BR1A 2X22A 4DR6B 4DEXA 4EYEA 2D62A 5K20A 4R98A 4U9UA 5TIIA 3KTJA 2WSBA 4B48A 1WX1A 2C5HA 3FKQA 1YCHA 4QPDA 2C5EA 2P2NA 1S9DA 4TLDA 3TD2A 4WN9B 1EFDN 3AY3A 5EPOA 2HB6A 2Q2OA 2KBFA 3BWVA 5EHGA 4CG2A 4JR1A 4KQ9A 1KJ8A 1P5FA 2ZI7A 5AI0A 2XHZA 4JFCA 1I7PA 1JG1A 3ZUGA 2COKA 3WQQA 3HVUA 1QQAA 5ALSA 4ZVTA 3RT7A 2DH6A 1G19A 4R5HA 3HFJA 3LCUA 4AAYA 3TZBA 4WN3A 4V0SA 3QBJA 3N6RA 4FMDB 3K9HA 1QB7A 4NX2A 1E9BA 3ZDBA 1UJCA 4KE9A 4BCDA 3T3NA 1U2EA 4CG1A 4FNAA 4P3OA 1GY8A 5I47A 4DMFA 3H2GA 4ZVVA 5BT8A 3JZIA 3W5JA 4RMGA 1T1RA 5J4YA 5G0VA 1DAGA 1Y9JA 4Q7LA 2NU7A 3GJSA 4C7VA 4X45A 3R8FA 2PIAA 4R9VA 4XWOA 4JK3A 3M34A 1ZY2A 2AR9A 4KK4A 1GRCA 2DWCA 2QMZA 3BF7A 3Q9UA 4HTFA 5B3AA 3C4JA 3HUEA 1FVFA 2X41A 1PX2A 3KSMA 3B9QA 4TN1A 5IUKC 1U1IA 3G89A 1WQ1R 3R9IA 1UPUA 3TW8A 1DWPA 2WW8A 2Z57A 4FFPA 4TWRA 4AYWA 1Q52A 2QLJA 4KGXA 4V24A 1DUBA 1JIXA 4WOJA 3PD1A 4OXIA 4IINA 5T4EA 1W2WB 2RG7A 2VDVE 1OBOA 4YQYA 3L01A 2Q1XA 3AZOA 3FOFC 4NU8X 4W63A 1BU8A 3GFTA 2VF2A 4Z9AA 4Z3DA 3KEQA 3CE6A 2WIBA 3MTEA 4B3CA 4CCSA 2ZLBA 1YB1A 4BX8A 2HCJB 1YV9A 3PYXA 4IXTA 4L9SA 3JPWA 1HQDA 1LBEA 4OGWA 2XTAA 1KJNA 1QFMA 3PDCA 3VISA 3BREA 4OI0A 4ENVA 3FBWA 1G2IA 2B78A 2PEYA 3DPUA 2UVPA 1UADA 3OPYA 2OFWA 2OILA 5AI4A 4ZZIA 1O57A 4ZQEA 1XO1A 3IXLA 1PKXA 1DRJA 3DCYA 4V39A 4LCJA 1VYUA 2EVWX 2D2XA 2I65A 4TMYA 3SU8A 4BVLA 2TMYA 4CF7A 2FUKA 1IZ8A 4XJTA 2NV2B 3E27A 2AEFA 1T3HA 2ZIAA 1L3CA 4RQUA 3RS2A 2BF4A 4OLFA 4N4AA 1U94A 3DTVD 3WZMA 2GCOB 4KLZA 3S55A 3GLIA 3HKCA 4KW7A 4IMIB 2IXAA 1LGYA 3NKLA 4I0WB 4PC3A 5FHQA 3IXQA 1EDBA 1TQ4A 4E12A 2HF7A 2OLEA 5AKKA 4DMMA 1GNSA 2BGRA 3LQYA 3M6VA 3OQPA 4K3UA 4ZANA 1Z9BA 3UGJA 4EB6B 1XTPA 2C9MA 4XH9B 1VRGA 5CX1B 4D3DA 1FL9A 3WLKX 2JCBA 3K0KA 2WTBA 5ALNA 2W58A 3TRKA 1ZS9A 2FPPA 1PS9A 3N5KA 5H9WA 2Z56A 4D25A 3UXHA 1OH7A 5A4AA 2WSMA 1R15A 5ITZA 4YX9A 1TL7C 1SRQA 3DLHA 1RIFA 4NS1A 4CLRA 3KYDB 2V4UA 4EPRA 3KRTA 5FH9A 3R3JA 2QXTA 4BNYA 2KPOA 4N01A 5LM3A 1IBLB 3CRMA 2SCUB 4MB2A 3OHPA 4QDUA 1KFEB 3BH7A 2QQGA 3T54A 3TZ6A 1TQDA 3EVEA 4NQZA 2NU9A 5TDHA 1D4ZA 4ZT4A 4ERXA 3H4TA 3I73A 4ZV4A 4IV0A 3QI2A 5EN4A 5EI5A 3WLMA 4X62B 3HB0A 1K3UB 4O8CA 5DU2A 1T9BA 2YHIB 3K09C 4GSYA 4B7CA 2VRCD 3TKYA 4P2GA 5JLJA 2QN2A 2FX2A 2OZEA 5E6RB 3L7AA 4NK5A 1ZNYA 1XJQA 1JR4A 4EJ6A 3T12A 4RF2A 4P6VF 4GRDA 2P5YA 4S1NA 2XAAA 3HA2A 3JAKA 2Q1YA 3T3IA 2X76A 3I76A 4KXXA 1H2RS 3S70A 3OOHA 2VHZA 1BWQA 3HP4A 1QHEA 1ZGGA 5KDDA 1FUYB 4KXMA 1AQIA 1JHVA 1HWYA 3PXGA 2DTDA 3N58A 1YG6A 3S2EA 5JNWA 1ITZA 1PWEA 1G9TA 1AXEA 3C1UA 2ZFUA 3TX6A 2BMJA 5T67A 1XTRA 3T6KA 2NUAA 4HJRA 1DIRA 4FQ8A 2QUHA 1HT2E 1O3YA 2OSBA 2RSLA 3FIJA 2HIHA 3LQQA 1ZM7A 3O8QB 3V7WA 4ZHQB 4HWPA 4EBFA 3WS7A 3C43A 4P93A 1UMBB 1XZAA 2WJ4A 3TZQA 4CDMA 4MJ3A 2JBHA 1NJ8A 3L0PA 2BGKA 3PXXA 6ADHA 4YRSA 4B5LA 3N7TA 3U7HB 4N18A 4LVCA 3PDJA 4LF5B 4GXNA 4N7RA 2VJAA 1IOLA 1UPCA 3EMDA 5B58C 4C20A 2CLHB 3WKCA 4CIXA 2HMSA 4MEBA 4RU1A 1B0PA 2VYVA 4WGFA 1PRYA 1Y37A 2OCDA 3HCDA 5K5EA 1C30A 2I2FA 5KWJA 2PD6A 3G0OA 4MW2A 3M3PA 3W6UA 4BGIA 5MN5A 2Q4RA 2WWTA 4MCAA 4X00A 3V1KA 2RE8A 1DXOA 4F84A 5A3JA 1R6DA 2K4MA 3DHNA 4MR9B 1MD9A 5F1KA 2PKEA 1UBCA 1KFBB 1L8LA 3UJ9A 1BHO1 2O1WA 2RGXA 3ZWKA 5HIJA 4GYKA 1CZNA 4BO0A 2Z8YM 2NAFA 4R9SA 5AI6A 4YC7A 1PT8A 1PZEA 2V5VA 4N0QA 4TT3A 1L5LA 4YRMA 4OP2A 4FGKA 5JRZA 1GLVA 1JIVA 4X84A 1Z5VA 1M0EA 1RJWA 3F2IA 4JLAA 5F51A 3DE5X 5GONA 1M6NA 3CU5A 4HYEA 1TVKA 1M76A 1G3QA 2GBLC 3AG6A 2ODEA 2QTHA 3Q4GA 1NJSA 3C3MA 3N2GB 4A36A 1YR1A 2VHWA 5UKDA 1XR3A 3OJXA 2OHFA 1G18A 3WGUA 1EP3B 4UKDA 3ZBPA 2O5CA 3T9EA 1SKYE 4HUJA 3KZVA 2WM9B 3SAJA 4D9NA 1XMIA 2GFQA 3I42A 3N2YA 4N0MA 4BX9A 4DLSA 4YRDA 4NOMA 1EFPA 3SKXA 2QK4A 2ES4A 3CZPA 2FDXA 3C1AA 1QG4A 5DBGA 3L0IB 2OGUA 2YXDA 5DBEX 4YRGA 4CLOA 1ND5A 3JVDA 1ONNA 1R66A 1AK9A 4NE7A 1QO0D 2V7EA 5BN4A 2QW8A 4LXTA 4N41A 3H5RA 4JB3A 3KLMX 2QBYA 4GG1A 2ILVA 4W9MC 3CPJB 4FILA 3DE6X 1QTNA 1ACJA 2HO4A 5TXGA 4AULA 2F8SA 5REQB 4YJ3F 3PQ6A 1SZPA 1LTKA 4WKBA 4E2YA 1YI0A 2DT8A 1E94E 1WHTA 3EYWA 2VH5R 3DKIA 3FYHA 3KO8A 4FZVA 4UREA 1FYDA 4LXIA 2FZEA 4BKPA 3HNPA 3KHSA 5CLLA 5ITVA 4Q16A 4QG3A 4X61A 2J3DA 2WTXA 1E2LA 2D1YA 3IBTA 3D02A 1XQVA 3LXRA 2W2KA 3AL3A 2NM0A 4IJ5A 4MB6A 3IEMA 2GTIA 1QH8A 4MQ4A 4WBXC 1FTGA 4RULA 1AIPA 1HNOA 2TS1A 2VT2A 1P4RA 2QSYA 1DAHA 1O6GA 3MRTA 3WIOA 1NI4A 3ZD8A 4F21A 1II8A 1IXSB 3DEHA 4IFTA 2HU8A 5AW3A 5KHAA 3UWOA 1A8SA 3CUTA 1ZFNA 2NU6B 3JQRA 2WP0A 1AE1A 2DJIA 3A1WA 3Q5DA 1E79D 3QA3E 1PAUA 1IG0A 4WEQA 3JQCA 5HBGA 3VU1A 4EB0A 9GPBA 4IWXA 1NLYA 4HBZA 1ONBA 1TK2A 2C97A 2BELA 1BVRA 3VO1A 2Y4OA 1VHDA 3IDSA 5J2TB 2M2IA 1EK1A 3PSHA 1YJBA 1XFAA 3OIGA 3GUYA 3VPXA 2Z2YA 2A5YB 2J0QA 5KDLA 5DPMA 1DMSA 4HX5A 2AR7A 4G0ZA 4E1AA 5C46F 4W5RA 2N1MA 4PLPA 5IKPA 3WGKA 3T3EA 1ZIPA 4JASB 1LH0A 1K63A 2XBLA 4KFRA 2XRYA 4H7HA 3S2UA 1ZOIA 4BE9A 1WXGA 4YRBA 4JGIA 4ZODA 1NI5A 2VWGA 5H4GA 3U39A 1Z2EA 4RWZA 2MTBA 3G17A 2HK6A 1JA0A 1M8GA 2P79A 2YV2A 4DYVA 2BC9A 4KBFA 1XF9A 4YJHB 2NW6A 1PR3A 3LX5A 3AHCA 4YN3A 1AHIA 2GJ8A 3UC5A 3UB2A 1VHJA 3LVQE 2G67A 4PSDA 4MIOA 1WUKS 2VL7A 2GPBA 2J5RA 1PNVA 2QIPA 3HEAA 1RFGE 2BFEB 4FNOA 4I5GA 4W1QA 5HQJA 4PZLA 2DY0A 5LQCA 1PZXA 3FAKA 5ECGC 5CVVA 1LX6A 3UAGA 1MOSA 2IU6A 4Y1RB 1A2QA 2D1TA 2QVYX 3C3EA 2ZVDA 4Q93A 3THWA 2IJGX 5JS1A 1NW6A 1WB6A 2EBFX 1TKBA 3W2TA 5CFLA 4MUNA 2ADMA 1A72A 1CQIA 2CYBA 1GPKA 3IFSA 3IKMB 2FUG6 3FOCA 2V6GA 1UBUS 3PLAE 2X1VA 2GA8A 3LLMA 4TXNA 1KIAA 1KQGA 2P5UA 3NCHA 1T4GA 4LZZA 5EXEA 5CITA 5HJEA 5JSHA 1H0HA 4UD2A 1UBTS 4BIIA 2NMVA 1V5EA 1CVRA 2HRCA 4NF2A 1ISIA 5E4FA 2CNBA 1GPJA 4L2IB 5DP1A 3AJAA 3LUFA 1OV6A 3REQB 1GL9B 1L8XA 1OWLA 4RHUA 4YJFA 4YUYA 2VJCA 2BKEA 4FZ5A 4D80A 2G5GX 5BUCA 2DERA 1JYSA 2J5SA 1I10A 3KSZO 4QVIA 1RRMA 4ZXFA 3JZMA 1PLJA 2PGJA 4DJEC 4MGZR 1OYOA 3UTCA 1L7XA 3CW8X 5AM1A 3P32A 4G2RA 3V1UA 3ZCRA 3FSJX 2FPIA 5DO9A 3KSBC 1QS0B 4WLUA 1LQ2A 1FMFA 1FNDA 4MKHA 1FA9A 4G0XA 1I2AA 3J81A 3F5SA 3E9DA 4B6SA 2V6IA 3JARB 3PCRB 4H7FA 4E4TA 5JVDB 4IIGA 3EBLA 3O0TA 5KTPA 2B30A 1JEQA 1RM0A 2VREA 1QU3A 1RI4A 2H1WA 2XE4A