2X5IC

Crystal structure echovirus 7
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPVLNTPGSNQFMTSDDFQSPSAMPQFDVTPHMDIPGEVHNLMEIAEVDSVVPVNNIKANLQSMDAYHIEVNTGNYQGEKIFAFQMQPGLESVFKRTLMGEILNYYAHWSGSIKLTFTFCGSAMATGKLLLAYSPPGADVPATRKQAMLGTHMIWDIGLQSSCVLCIPWISQTHYRLVQQDEYTSAGNVTCWYQTGIVVPPGTPNKCVVLCFASACNDFSVRMLRDTPFIGQTALLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Interaction of Decay-Accelerating Factor with Echovirus 7.
pubmed doi rcsb
molecule tags Virus
total genus 41
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2x5iC00
1H8TB 1VB4A 1B35B 4WM8B 1C8M3 1NA1B 1NY72 3M8LA 4QPIB 5K0UB 1B35C 4GB31 4Q4Y2 1H8TA 2ZZQA 4QPIC 4WM8C 3VBSC 5JZGC 2HWF2 1NA1A 1ZBE1 3JBG1 5K0UA 1VB2A 1C8NA 1D4M1 1HRI3 2X5IA 1QJX1 1AR83 2GH8A 1VBE1 1ZBA3 1AYN1 1DDLA 2R063 3JD73 1R092 1R1A1 1VAKA 3VDDA 1MQTB 2WZR3 1RHI3 2WFF3 1NY71 1MQTC 1OPOA 1HRI2 1NCRC 1AR73 4Q4X3 2RM23 5A32B 4FTBA 2QQPA 1PIV3 2R042 1EAH3 1V9U2 1RHI2 2WFF2 5J98B 1C8M1 5BNOA 2MEV2 1NCQA 1R091 5CFCB 4N43B 4Q4X2 4RQPC 5CFCC 1PIV2 4N43C 5C8CB 1EAH2 1VBA3 1HRI1 3VBUB 1BEV2 1AR81 1ZBA1 5D8AB 1RUH2 3VBUC 5C8CA 2R061 3DPRC 5D8AC 1TME3 2R041 4CEWB 3VBOC 1PVC2 1RHI1 2WFF1 5ACA3 4RFT0 1CD3G 1VBA2 1QJY3 4CEWC 2R073 1QJU2 4Q4X1 1VRH2 2RM21 2FZ1A 5J96B 1PIV1 1EAH1 3ZFGB 5ACA2 2HWD3 4RS5A 5BNPC 3ZFGA 5A33A 1FMD3 5C9AB 4Y4YA 1GFF2 2RS33 1Z7S3 1VBA1 2HWE2 5C9AA 1E57A 1ASJ3 1QJU1 1VRH1 5ACA1 1Z7S2 1QJY1 1RUG3 4GMP3 2R071 4YVSC 3NAPA 5AC93 5CFDB 4JGYA 1PGL1 4EJRA 3CJIC 2XPJA 2HWD1 1COV2 4IV1B 5CFDA 1BBT2 1PO23 1RUG2 4N53C 1FOD3 4IV1C 1FMD1 3IDEA 1ND3B 2RS31 1RVF2 1ND3C 4WM7A 1Z7S1 4GH4C 5FMOL 4QPGB 2XBO3 1ND2B 5GKAC 4QPGC 3ZFEB 1FOD2 1ND2C 4IV3B 3ZFEC 1QJX2 1RUE3 1RUG1 1QQP3 4GMP1 1OOPA 2XBO2 4IV3A 1R1A2 2HWC3 1RVF1 1HRV3 1TMF3 1POV0 1H8TC 1RMU3 3VBFA 1RUE2 3VBRB 1NA1C 4Q4W3 1PO21 2X5IB 5K0UC 1FOD1 1HXS3 2X5IC 3VBRA 1HRV2 3VDDB 1C8M2 4Q4V3 2XBO1 3VDDC 1BMV1 3ZFFA 1F8VA 1HXS2 1CJDA 1AL0G 2RMU3 1AR82 4BCUA 1RUE1 1ZBA2 1QQP1 2R062 3JD72 5BNOB 2HWC1 4FSJA 4PDWB 2BBVA 1NCQB 5BNOC 2WZR2 1HRV1 1TMF1 1NCQC 4CDQB 4PDWA 1RB8G 2BFUL 1AR72 4Q4W1 2RM22 4CDQA 1HXS1 2RS13 5C8CC 2HWB3 4CDUA 1HQNA 3JD71 4FTEA 2FZ2A 2WZR1 1X33A 1AR93 2RR13 2RMU1 4CDWB 1AR71 2HWB2 4YVWB 4RS5B 1TME2 3J8F3 3S6PA 4RS5C 4CDWA 1SMVA 5A33B 4YVWA 5FMOS 1NG0A 1AR92 2RR12 3ZFGC 1QJY2 2WS93 2R072 3VBHA 1R083 1RUJ3 1PGL2 5C9AC 2RS11 2HWD2 1AYM3 2HWB1 2VQ0A 1OHFA 1FMD2 3FBMA 1TME1 2TBVA 2RS32 3NAPB 1RUJ2 4NWWA 1AR91 2RR11 4JGYB 3NAPC 2RS53 1ASJ2 4JGYC 4SBVA 5ABJB 5DDJ3 1RUC3 3J8F1 5CFDC 1MEC3 1A6CA 5ABJA 1FPN3 4CDXB 2WS91 4WM7B 3TN93 5AC92 4CDXA 1WCDJ 4WM7C 4RR3A 1RUJ1 1VBB3 1FPN2 1ASJ1 5BNNA 1PO22 1AR63 1OOPB 1OOPC 4IV3C 2BFUS 5C4WA 1RUI3 1BMV2 2IZWA 3JB8A 3VBFB 5AC91 5L7OA 5DDJ1 3VBFC 1VBE3 1MEC1 1FPN1 1QQP2 1RUI2 4AEDB 3TN91 3VBRC 2HWC2 1K5MA 4JGZB 3ZFFB 4Q4Y3 1TMF2 4AEDA 1M06G 3ZFFC 1RMU2 4JGZA 2HWF3 1POV3 4Q4W2 4CEYA 1AR61 3VBSB 5JZGB 1X36A 2WLPA 1R093 3LOBA 1HX6A 1B35A 1RUI1 4Q4V2 4WM8A 4QPIA 3VBSA 5JZGA 2ZTNA 1AL23 1NOVA 4PDWC 1AUYA 2RMU2 1RMU1 1VBD3 4CDQC 2R043 5LK7B 4CDUB 1V9U3 1AL22 1NCRB 4LLFA 2DF7A 2MEV3 4CDUC 4Q4Y1 1MQTA 2PLV3 4Y5Z0 4Q4V1 1NCRA 2HWF1 1POV1 1VBD2 2GSYA 1RUD3 1BEV3 5A32A 2RS12 2BPA2 1RUH3 2ZAHA 4RQPB 2PLV2 4CDWC 1PVC3 1AL21 4YVWC 4NWVA 1EV13 4RQPA 5CFCA 4N43A 1RUD2 3VBHB 3DPRB 1QJU3 1VRH3 3VBHC 3VBOB 1PO13 1VBD1 3VBUA 3DPRA 1QJZA 5D8AA 1V9U1 3J8F2 1EV12 3VBOA 1RUF3 2MEV1 1F2NA 2PLV1 2Y26A 4CEWA 2WS92 1PO12 1R082 2HWE3 1RUD1 3ZXAC 1BEV1 5BNPB 1RUF2 1RUH1 1AYM2 1PGW2 5BNPA 4RHV3 1PVC1 4GMP0 1EV11 5ABJC 1VBC3 4FTSA 4RR3B 2RS52 1PO11 4CDXC 4RR3C 4RHV2 1R081 1W39A 5DDJ2 5BNNB 1RUC2 1COV3 4YVSB 2WWSA 1RUF1 1BBT3 1MEC2 5BNNC 1AYM1 1PGW1 1VBC2 3CJIB 4YVSA 3TN92 1RVF3 5C4WB 2HWE1 1VBB2 3CJIA 1IHMA 4GB33 4N53B 5C4WC 5L7OB 2RS51 5L7OC 1ZBE3 3JBG3 4RHV1 4GH4B 4N53A 4IV1A 1AR62 1RUC1 1D4M3 4Z92B 1QJX3 1AYN3 1K5MB 1ND3A 1VBC1 4GH4A 4GB32 1R1A3 1K5MC 1ZBE2 3JBG2 4QPGA 5FOJB 4AEDC 1ND2A 3HAGA 4CEYB 1D4M2 2BUKA 1VBB1 1COV1 4JGZC 1VBE2 3ZFEA 1BBT1 1AYN2 3JB4C 4CEYC
chains in the Genus database with same CATH superfamily
2LS6A 3ORJA 3NKTA 1NLRA 4WZCA 1B35B 3G7DA 1PGSA 2A3YA 4JRAA 5D1IA 1JZ5A 2VR4A 1KEXA 2D44A 3K77A 3T0BA 1H8TA 3AJYA 3VBSC 3F2ZA 2HWF2 4AW7A 3K3OA 4P5YA 3VKOA 4LOSA 1ENRA 2XHKA 3VZNA 2B8MA 1QJX1 1AR83 3ZXLA 1VBE1 4JKKA 5GM0A 4YW5A 3OY8A 3HQRA 3PVBB 1DDLA 5FPBA 3CZJA 4CVUA 1US3A 4AI3A 3VDDA 2RG4A 1O5UA 1F31A 2PFWA 3NWKA 4K8FA 4Y26A 4ORFA 1MQTC 1OPOA 1YEWA 1HRI2 1JW6A 1K3IA 5LA2A 3M3OA 4GJZA 3WDVA 4E4ZA 2ZEWA 4S2FA 4A42A 3CKHA 4P9YA 4BXFA 2P6CA 4UFKA 2PA7A 1PIV3 3PTRB 2WINB 2QQPA 1WMXA 3SHRA 2WFF2 4KWUA 5J98B 4X8PA 2XWJB 5EP9A 2VBBA 5FO8B 1R091 3C7HA 5CFCB 1QU0A 2IFWA 3WW4A 4P5HA 4Y5SA 2XVLA 4G4FA 5FQ0B 4XF1A 1VIWB 1DQ4A 1KS4A 1SLIA 2IXLA 2K9ZA 5F2WA 5CKMA 1AR81 2I74A 2ZEYA 4P14A 5ANQA 1JZ6A 1G6NA 2GP5A 1G8WA 5CU1A 4M01A 3ACIA 1IGOA 3NMBA 1FYUA 4C0HA 4M3CB 3ABZA 1TME3 1NLSA 2R041 4DMIA 1PVC2 2A3WA 4RFT0 2GU9A 1RC6A 5EXOA 1VBA2 1YHFA 2VMDA 3N36A 4DUXA 4XACA 3GJBA 4BWOA 4NR1A 1PIV1 4IEYA 4Z2WA 4M00A 2WN3A 3DL3A 3AL6A 1UNBA 2P2KA 5T50A 4UFJA 3VD4A 3W20A 3ZN6A 1ULOA 2ZS6B 1MZ6A 3WF1A 3ZYFA 3O1UA 1FMD3 5C9AB 3PVOA 1MS4A 2RS33 3UNPA 4ISQA 4X6RB 3POIA 2BRTA 2R1BA 3KQ4B 2MHFA 1HW5A 2GNMA 4SLIA 4GWNA 1VMJA 1ASJ3 2DVAA 1IKPA 1AJKA 1G7YA 4QXKA 1ALYA 4ZPIA 2AENA 3WQ1A 1U12A 3TEWA 1CAXA 1IG3A 3FMGA 3NNMA 5FZAA 2ILMA 1OKQA 3GZEA 3AP9A 1C5HA 4FPHA 1OH4A 2EIGA 2YBPA 2BGCA 2YC2A 4YVSC 2PHTA 3FLTA 3ZN4A 2PAEA 2XR4A 2Y6FA 3HMYA 4HKLA 5CFDB 2VOTA 4CP9A 2YPJA 1P8JA 4EJRA 2X53S 5JR7B 3CJIC 5KR7A 2VMCA 3AKQA 3RZHA 4YW3A 3E6DA 2BVVA 1HLCA 3HBKA 4RGGA 1W05A 3UKNA 1PO23 2W46A 1WW6A 5AVAA 1FMD1 2CNAA 3IDEA 4DXTA 3ASIA 2BU9A 5CIRA 2O0OA 1ONAA 3VN4A 2RS31 4DEQA 4XFGA 1ZRRA 1DQ0A 4Q1RA 3PHMA 1ND3C 2BGPA 4WM7A 1D2SA 1TQ5A 4JDNA 4Q1PA 1FNYA 4QPGB 1CPMA 4ZONA 4XXAA 5B4XA 4L99A 3B69A 4CP1A 2Y6GA 2VZUA 5T52A 3RDIA 5DG2A 1C4RA 1SFYA 3MIEA 5KHGA 1ND2C 1SBEA 1OQ1A 4K7JA 4IEXA 3O1MA 2IWGB 2FMDA 2YZ4A 2CGPA 3ACFA 3O12A 3ZFEC 4N8MA 3RMXA 3WG2A 5EWSA 1H2MA 5IAXA 1X7NA 4KWJA 1W3XA 2WQZC 2XVGA 4Q26A 4NIDA 4C1XA 4M0NA 5GLTA 1H30A 1NLQA 3BTZA 2WSUA 2BV4A 1VJ2A 4ZXEA 5FZHA 1YFWA 1S1AA 3W59A 4TLGA 1RMU3 4LQRA 1RUE2 4Q4W3 1PO21 2OQ6A 2C4XA 4LKSA 5CYYA 4BK4A 2QQOA 3AKPA 3AL5A 5FY0A 2C6SA 4IEZA 1UYZA 5EPAA 3D8CA 1ZX5A 4QQHA 3VDDB 4D94A 1C8M2 4OMDA 2JDUA 3GALA 1MS1A 4O9GA 1CESA 3H7JA 1HXS2 1CJDA 1QH6A 3OPWA 2NN8A 2W08A 4YM3A 2NMOA 1ZBA2 1GSLA 1LR5A 1LULA 3J7NA 3ZXDA 4OI0A 4COVA 2ATFA 5I0TA 4KG8A 2OT7A 1CONA 3RPQA 5K9YA 4I01A 4FSJA 2XJTA 1UAIA 3OBRA 1O8SA 1CVNA 2C5DA 4A45A 2BBVA 1SLAA 4XEZA 2XL7A 3A0KA 5E6HA 2DCYA 2P3IA 3MW3A 4OQ8A 2ET7A 1NCQC 4V1PA 3VLBB 1UXZA 1N1TA 4NIHA 2GN3A 4PDWA 4Y3OA 4Q4W1 4YSFA 2VOXA 1U5YA 2RM22 4BB3A 2BNNA 5IWFA 2H0BA 3BOPA 4FOVA 4CDQA 1UMZA 1YQ8A 3KQRA 3H1YA 3EQEA 5DAVA 5F6KA 3MLLA 1JODA 3ZXKA 4EZHA 2ARXA 3LEIA 1H8VA 2J1UA 4BLJA 2Z5WA 4ATEA 3JD71 1O7FA 4LHLA 3LFIA 3TAYA 3MLKA 4UW6A 5LRRA 4HSLA 2WABA 4DUVA 2WZR1 4LT5A 3HR9A 3CU7A 4R4ZA 2P1BA 5L73A 1X33A 4AWDA 2XUMA 1AR93 4OUSA 1MZ5A 3QCWA 5FXZA 5A3LA 1YQCA 2Y8KA 1OFNA 1KDMA 1AR71 3H3UA 4Y5TA 2PHDA 3PVNA 3QOPA 3IMMA 1YJKA 2HEYF 3AKRA 4TN7A 1W8WA 2PHXA 3JU9A 3DV8A 4YWAA 2D6OX 1QMJA 3GBWA 5J1XA 2BYVE 2WS93 3DEMA 1AX0A 2R072 3APBA 1KDKA 3M2MA 2E63A 2EA7A 3VBHA 3ZSEA 4A6SA 4PF1A 5C70A 5C8WA 1RUJ3 4XF3A 2D7FA 5C9AC 5FO9B 5IVCA 1PGL2 2H6CA 5FYUA 1CAXB 4EN6B 4CCKA 2VPVA 1AYM3 2Y33A 1PK6A 4FI9A 3HVDA 4D7SA 2DV9A 2QQMA 5JCTA 1MS9A 1YIFA 2W5FA 3FBMA 5JSOA 4LK6A 4COZA 4C8DA 3OGJA 4E4HA 4JQTA 1AR91 3POBA 1LHVA 4NAMA 3ZPOA 4CP9B 4YFWA 1DGRA 1DZTA 3PIJA 1VMHA 2C0ZA 4SBVA 5ABJB 4RGAA 1X50A 3FWEA 3I2DA 3I3QA 5DDJ3 4BISA 3JXSA 2J1VA 3SEEA 5FZGA 5CFDC 1A6CA 2EICA 5CA6A 2XVKA 3I59B 5IK8A 2XGXA 2WS91 2I07B 5JXIA 3LA7A 3EB7A 4WM7B 3TN93 3LAGA 2WAAA 3T1MA 1UOJA 4XTMA 5FLIA 3RS6A 4JV4A 1F4AA 2JB8A 2ZXQA 3OOXA 3OB8A 3R4UA 1RUJ1 3CLPA 3PU3A 2WO2A 4BK5A 1ST8A 4EROA 1LOFC 2L9LA 3NW4A 3SH3A 1ZNPA 3SNMA 2LW8A 3T4HB 3E1F1 5BNNA 5L9BA 1OA3A 3FX3A 2Q1MA 2OS2A 4XFHA 3NV3A 4NPMA 1GP4A 1VMFA 5IJRA 3VB9A 1H2NA 2ZKNA 3OBZA 3CO2A 3GJAA 2BFUS 1OQDA 4D8MA 3SISA 3ETQA 2ZGOA 1BMV2 2IZWA 3MIHA 4J1XA 3JB8A 5AC91 5DDJ1 5F9TA 2RVAA 1WWYA 3VBFC 4ITCA 2YPDA 1W0NA 3DYMA 5FZDA 4OI1A 3ZXEA 2VMFA 5F2SA 1UOFA 4RGKA 2Z2SB 4MGQA 4XBLA 4Y1UA 1RJ8A 2QQJA 2FDFA 4N9IA 3IAQA 4K1YA 5F3EA 3TN91 4K9SA 2DDUA 1F5FA 4E9KA 4XJAA 3SCHA 3OD0A 3ZYRA 3PVEA 1BLZA 4LOTA 1KQRA 3OJBA 4R9DA 5JPNB 3TEYA 1Y43B 1QF3A 2EXKA 3U07A 2HWF3 1POV3 4LULA 2O14A 4AK3A 1DCSA 2ZGUA 4CEYA 4LO6B 4CSWA 2B9VA 2W0XA 4PQ9A 3BCWA 1EYBA 1GLHA 1I9RA 2DUOA 1O4ZA 3CZUA 4KU8A 3DKWA 1AF9A 1PNGA 1XQNA 2WLPA 4Q0UA 4QGMA 1I5ZA 2O8QA 4B1MA 3LA3A 2ZMNA 4R4XA 4Q4V2 2GDFA 4LO4B 3VBSA 2WQ8A 4R52A 3WW3A 4BOWA 2ZA9A 1JOBA 2AEYA 4PHZA 1V6NA 1D2QA 3E6CC 2FMYA 3M1HA 4CCJA 3HPNA 1CX1A 1UX6A 4ZU5A 4A2UA 1W06A 4Q0QA 5LK7B 1N47A 4Z2AA 2H0VA 2YROA 5BYNA 2D5FA 4INDA 3WUCA 2DF7A 3R05A 5JXGA 1MQTA 3PDQA 2PLV3 1JMUB 5FDBA 5DG1A 3IT8A 3W5MA 2VM9A 3VL8A 4EWDA 2HWF1 1T6BX 1POV1 2A7AA 2NYYA 3CBNA 2QCSB 1MR5A 1Y3TA 4QPYA 1LKNA 4GQ7A 1WZXA 5ERLA 4DXRA 4QX5A 5A32A 3UETA 4YM2A 4PLMA 3AYCA 1PVC3 1I6XA 3C2UA 4COYA 1RXGA 4CZSA 3AMMA 1RUD2 1CZTA 3VBHB 1GV9A 4U2AA 5FK7A 3DPRB 1QGLA 1CAVB 2HEWF 2XHNA 1NKGA 3VBOB 2HH9A 5B2GB 1NXMA 4D3WA 1PK6B 3ILRA 3DYPA 4CCOA 1KJRA 2AR6A 3VDBA 2WNVB 3LEKA 1EV12 1RUF3 1F2NA 1W6PA 2ADEA 2ZKLA 2DVGA 4U36A 2PLV1 1D4VB 1E5SA 2BGOA 1UY3A 1LHOA 1EPWA 3POSA 4MX3A 3RZJA 3EMRA 4XUOA 3I2FA 1PZ7A 3I97A 2ZEZA 3UJOA 4ARYA 5BNPB 5FWJA 5FY9A 2ZX3A 2RDQA 1ZRFA 1LU2A 3D6EA 4QX2A 4GULA 4NHKA 5H9QA 1W9YA 5LZ6A 5DZFA 1JYNA 3J7HA 4A7YA 4DIQA 1PVC1 3WHUA 1Q8SA 1OUXA 3IZOA 4W4ZA 5ABJC 2AYHA 3O0WA 4HN0A 4KWLA 4L0PA 3MW2A 3N9MA 1DQ2A 3D4KA 3GHMA 1AX2A 5F8PA 3SC7X 1OPMA 4QAWA 4HG6B 3E6BA 2Y0IA 1PX4A 4AOCA 1DFQA 2R7EB 5FYYA 1O3SA 4KH9A 1R081 5DUVA 1W39A 3ZR5A 2FDGA 5BNNB 3U4XA 1RUC2 3IPVA 1Y9MA 3POJA 2VNRA 2VOVA 4K3UA 5FCCA 1HQWA 1RUF1 4UAPA 1LODA 5C3QA 1MEC2 3C8XA 1PGW1 1XNDA 2BOJA 1BKZA 3B00A 3VD9A 1YNAA 4YG0A 4YVSA 3VDAA 4FAHA 4Y1ZA 5K8SA 1CAWA 3M4FA 5F3CA 3OYWB 2GMEA 3CJIA 1W0PA 1IHMA 3LB9A 3MLJA 4N53B 3WG4A 1LAJA 4QGLA 4ZZ5A 5JI9A 1BVVA 3VKFC 2RS51 2D97A 4E2QA 2J1AA 4FFGA 1AR62 3AMNA 4Y22A 1D4M3 2V4VA 2WNUC 3Q8FA 4HONA 1X9TA 1UYPA 3LD8A 1AYN3 4BQ5A 1ND3A 1WD3A 2D6NA 2ZAAA 4H7MA 4MV2A 5FREA 3RZMA 4Q29A 5JAXA 2D3PA 1K5MC 1UU5A 2A75A 3JQXA 1ZBE2 1H4GA 1GP5A 2CDPA 2DTWA 3JBG2 3N7LA 4HXCA 4L11A 4NE9A 4R9AA 5FP3A 5LB6A 1ND2A 4CEYB 3WINE 4K21A 3DKQA 5B4NA 3L2HA 3ZFEA 5FBJA 3EO6A 2UWCA 1DG6A 3H8UA 3IDAA 2VMEA 5CISA 1XSRA 1C8M3 1NA1B 3M8LA 1KGYA 1GR3A 4AAPA 4JC1A 2C1FA 5FZ8A 4IEUA 2Y34A 1JZ3A 5FPXA 4WM8C 1DLLA 2E53A 3RNSA 2VQTA 4L97A 3HIFA 3LPFA 1O3QA 2VH9A 4ES9A 5FR3A 3POEA 3KF3A 1D4M1 4FVVA 2PXJA 2X29A 2ZGMA 1ZBA3 3H1MA 1AYN1 1IS5A 3OF1A 5L36A 4BMEA 5FUPA 1O4TA 3CL1A 3MGUA 1QNWA 4MGSA 1MQTB 3GBGA 4OHWA 2A6WA 4QKBA 4CXXA 1RHI3 1BYHA 1NY71 5DABA 5FLJA 3USUB 3PTYA 4NUBA 3J4UH 4XFCA 2RM23 1GOHA 1HJFA 2UY9A 2JDKA 5A32B 4FTBA 4NROA 1GBGA 1YRZA 2D3RA 4YZ4A 4D7YA 5KHKA 1O59A 3URFA 1JHNA 1DYKA 4FPLA 2CY6A 2QFEA 5JMCA 1UQXA 1C8M1 1UPSA 3ES4A 2Y0OA 2MEV2 1IS6A 4Z07A 2QVSB 1XYPA 2KD7A 2SBAA 4HBNA 1NCQA 3RFRA 4Q4X2 3MI8A 5FZ9A 2VTXJ 1HN1A 2DFCA 5C8CB 5EQUA 3LSEA 1EAH2 3HQXA 4KL1A 4WVWA 2WNEA 5T5PA 4RFRB 5TSWA 5LY2A 3WR0A 4CCMA 3CMGA 4PCRA 1ZBA1 3UGHA 5FQ0A 3DF0A 2XQXA 2P3YA 3VBUC 4K8RB 1XNBA 1JOJA 3A21A 3PUQA 3DPRC 2GC2A 2HJIA 1F9KA 2Q1FA 1V6KA 1RHI1 1W2AX 3HEIA 3KGZA 1S0FA 3VBOC 2OUHA 1TVGA 4M3CA 4EQVA 2B4KA 2R073 2WNVC 2HBTA 1QJU2 4FXGB 1OA4A 3ZX7A 3MFAA 3I2IA 1KRIA 1VRH2 2RM21 2LUWA 2F17A 2FZ1A 2VBDA 3ES1A 4OYUA 3Q8AA 4XF0A 2NQYA 4C0BA 4D69A 1OT5A 3OPZA 3ZFGB 1JXNA 5ACA2 3O1SA 4W6XA 1IPSA 1VRBA 1PZ8A 4IETA 5BNPC 4OHYA 5A33A 1BVP1 1K42A 1UU6A 5A80A 3WW1A 2CWSA 3ELNA 1GFF2 4M4RA 3NJZA 5FZKA 2Y60A 1QXPA 3FUQA 3ZLIA 3WDTA 2W87A 1U5IA 4BM8A 4GIQA 1NE6A 1SDDB 5C9AA 1EPZA 1E57A 2CHHA 2PAMA 3O0XA 1N3QA 4CE8A 3GYDA 1K12A 1OLRA 3KCXA 1ZZ9A 4LKFA 2XDVA 2JE8A 4YW1A 2G9GA 2OPWA 2WQ4A 5JSRA 2QQUA 1W99A 4Z82A 1Z7S2 2CAUA 4YPJA 1H9WA 3B01A 4DUWA 2R071 1CAWB 3TBDA 2IC1A 3VD5A 2PELA 3ZN5A 3S0MA 2QDNA 1OUSA 1JYVA 2ZGPA 4DQAA 3AVRA 1QDOA 2AZ5A 4Y33A 1PGL1 1W2TA 4IGOA 4H7LA 2QQVA 3MUY1 1XB9A 2JEMA 5FZBA 1U5ZA 3AMPA 2Z4FA 5CFDA 4Y22B 3ZIXA 4CA9A 1RUG2 5J48A 3SQOA 2VMGA 3FN9A 4N53C 1FOD3 3MPBA 5KXCA 1E5IA 1W8FA 1ND3B 1SZBA 3SEPA 3LZZA 3HN3A 4FT8A 5JDBA 4LA3A 3MBWA 1PM7A 1W6OA 2VVDA 2JDNA 2VUCA 5FMOL 1JYTA 2Z79A 1WMFA 4BXSV 2XBO3 1AVBA 1WCSA 2YB7A 4LNVA 1ND2B 3BIEA 1CZSA 1LOFA 2XLAA 3ZFEB 3RJ2X 3THPA 4IV3B 2C24A 3FHQA 3VDCA 5FYSA 3BI3A 1TNFA 4XBQA 5FP9A 2VZTA 3BB6A 2G9FA 2J1RA 5C5UA 3LIHA 5JLVA 1XYOA 1DZQA 4XXPA 4AHZA 4QKDA 4XFBA 1NX9A 2PMWB 1YIPA 1RVF1 1HRV3 2BWCA 4CTEA 4FBFA 4URAA 1POV0 1CQ9A 1ZZCA 1CIWA 4IGPA 3VBFA 4CCLA 4YZ5A 2QKDA 4Z1VA 2AEZA 1LGNA 3S5QA 3VBRB 1NA1C 5H9RA 3VKNA 4YW6A 1SFNA 2MNGA 1FOD1 3WX5A 1HV0A 3QACA 1LJ7A 2W95A 1YC61 1JH5A 2AACA 4MZUA 1T6GC 2UYAA 4PT6A 3N9PA 4FOYA 4Q4V3 4UW5A 2XBO1 5FZIA 1BMV1 3LOIA 3CQOA 1UMHA 4DRVA 1F8VA 1DYPA 4ASMB 1W2OA 3NNJA 1F5JA 3NQHA 3KD4A 5EZWA 4P9XA 4XURA 1OF4A 5LW9A 2B42B 2F4PA 5LY1A 1TNRA 2E51A 4LXLA 4M0HA 4YM0A 2G4IA 4Q0PA 3N9QA 2E7AA 3OD4A 2XJVA 2R062 4NMIA 1KJLA 3B93A 3ILNA 1QIQA 3MV01 1NCQB 4OUEA 4URTA 1M4WA 1HRV1 1N1SA 5CG8A 3RI9A 5HCBA 3ZSMA 3T2PA 3AXEA 1MVEA 3T2TA 3HT2A 5A3WA 1UOBA 4CPBD 3POWA 3Q9OA 5E88A 5D21A 5FZCA 2WZ8A 3L2YA 4HFSA 4UXAA 3ZYGA 4ZXKA 3WW2A 3NJXA 4PBOA 2D6KA 2K0GA 5C8CC 4AF9A 1URXA 2HWB3 2JDYA 3PUHA 5ANNA 2WT2A 1HQNA 4R9BA 1VE0A 3VHNA 3CIHA 4FTEA 4NOTA 5DUUA 3EBRA 2PTMA 1N3OA 2QBXA 3GBFA 4IXLA 4BE3A 5DUXA 2RR13 5A6ZA 1FATA 4XIKA 2OXBA 4Z8BA 4QXBA 4XE9A 4QHOA 4CDWB 4I02A 2UYBA 4YVWB 5EV7A 4A7ZA 5DAQA 3SMHA 3K2OA 1AJOA 2P3KA 2BOIA 4I09A 4AEJA 1G9CA 4DZGA 3KB5A 2VQUA 3S6PA 1UMIA 5LASA 5A33B 2ZZJA 3HQUA 1NG0A 5FPAA 4AI0A 1UXXX 3OGGA 3ZFGC 1J1LA 1QJY2 4QXHA 4AI1A 3C7GA 2JJ6A 1XNTA 1GZWA 1I3HA 2KA3A 2XJUA 5T5JA 1OC1A 1BK1A 1CIYA 2O1QA 1WBFA 1D0GA 3K4DA 2E7QA 1SCSA 2GNBA 5FY5A 4NHLA 2HWD2 5KXDA 4UFLA 3POFA 2HWB1 4OLLA 3THTA 5HCHA 1MZFA 4IEOA 2VQ0A 3AC0A 1TME1 4HSJA 2TBVA 4OCTA 4PI0A 1ENXA 5T54A 4NWWA 1Q8OA 2RR11 2BQPA 3BALA 4PJYA 1A3KA 1DGRN 3NAPC 4BQ2A 3RZLA 2WT0A 4JGYC 5APAA 2Q8CA 3JCIA 3HN1A 1GUIA 4FPYA 4NIIA 1RUC3 2FDHA 1VAMA 4UFMA 1MEC3 2ORZA 3QH7A 4WVVA 5ABJA 1FPN3 3WLUA 5FZ0A 3W58A 3BPZA 4B4RA 1W6OB 4GD4A 2VXJA 5K4LA 5HV4A 1QH7A 1H1IA 1R1ZA 2MPFA 3I59A 1WCDJ 2Y38A 1GQGA 1EUUA 4XOGA 4K1ZA 2ZX1A 1AXYA 2D6MA 1KD7A 1ASJ1 1JU4A 2FCTA 1MPXA 2IFRA 3VGIA 5BPXA 2Q8OA 2JDMA 2WLQA 3WP3A 3ZXJA 1Y7BA 4TSVA 1DIWA 1AR63 2VXRA 2W1WA 3AZZA 3A22A 2AREA 4IUGA 4NHXA 5GZEA 4DPNA 3I2OA 4CCEA 4P9GA 3A4UA 3CHXA 3HBZA 2BBAA 4EN8B 1JZ2A 4LORA 2WBKA 1OOPC 2QE3A 4IV3C 5EFUA 3BPSA 4LHNA 2EALA 3VBFB 1UWWA 3DXUA 3NNLA 4CUCA 2D98A 3RZGA 1FV2A 2WNUA 1MEC1 2JICA 1UY0A 4JDOA 1W6QA 1FPN1 1VPHA 3TEXA 5ISLA 2P4EA 4WZFA 1QQP2 4NRPA 1RUI2 3KT1A 4DB5A 2OX0A 2UWBA 2PHUA 3AK0A 3VBRC 1K5MA 4P9JA 3QBQA 4XJZA 5KHHA 3I3BA 4EN7B 3BGAA 1UL9A 1TG7A 3MEPA 4JZRA 2ETEA 4AEKA 3BODA 1M06G 1TMF2 5H9PA 2ZPXA 1GOFA 1YLLA 1S0BA 5KHIA 1JBCA 1AR61 5DAWA 2DBIA 3TOJA 5GZCA 5F7UA 5KBFA 3KHBA 4UBGA 5FPLA 2VZ1A 2VMHA 2YBSA 3DXTA 4RSUA 3ZSLA 3RRDA 2CV6A 5F1RA 5JZGB 4QDSA 2WAOA 3LOBA 2XJRA 1UYXA 3NKGA 4FTSA 4WM8A 3I54A 3PURA 1GP6A 1MACA 3KF5A 2WO3A 4UBHA 2VOWA 3J7MA 1HN0A 2VNVA 4PBPA 5FZLA 3RZKA 4QMAA 5I8TA 3LCPA 4P00B 3HNMA 1ULFA 1UCXA 4LA2A 4AYUA 1RMU1 4AVSA 3LEMA 5A6XA 2GNTA 1ZM1A 4LEJA 4GAZA 5FK8A 3U10A 1C1LA 1AL22 1NCRB 1WLWA 2QQIA 2P17A 4LLFA 4QM9A 1ZREA 1LESA 1S4CA 2MEV3 1CPNA 4FPGA 4H2AA 5EYYA 3N9LA 2CGOA 1ULGA 4ASLA 3KWVA 4ASKA 3AYEA 4QHZA 2ZMLA 1SLBA 2FCUA 2OVUA 3KV6A 5IFPA 4XDOA 2E26A 4PLOA 4S2DA 1GQHA 3THDA 1VBD2 5I0SA 2O8OA 3O1TA 1C28A 4BJ0A 2A6XA 2CGNA 3KT7A 1REDA 3QLQA 4HKWA 1MVQA 2A70A 2RS12 3HNBM 1YUDA 2BPA2 2ZAHA 2CYFA 4RQPB 4HMZA 1CWPA 5BUVA 2G9ZA 2IXIA 4J25A 4LUKA 1F35A 2JDHA 1IPKA 4MOAA 4WV8A 4GJYA 4OVEA 4CDWC 1RINA 2V72A 4XF4A 4YVWC 4LBKA 2BNOA 3ZO0B 4XC9A 4XBNA 3MF9A 4XUPA 3TWIA 4AQ6A 4YZ1A 5FOBB 2WO7A 1GZWB 5F39A 1QJU3 4FFIA 2VD7A 1VRH3 2D3SA 1ULPA 2PQQA 1PO13 5EJ1B 3VBUA 5T5LA 4N90A 3DPRA 1QJZA 5GLZA 4PF5A 4BDVB 2G1MA 1CAVA 2BERA 1CGPA 3VBOA 1AXKA 2MEV1 3T08A 1IG0A 4FPJA 4O9EA 2WNVA 4CXYA 5G04L 2QQKA 5J36A 2YV8A 5FKBA 1OD3A 4GWIA 5FZ7A 2WDBA 2PAKA 4CCCA 3AZWA 1H2LA 3WCSA 3U0ZA 1MS0A 4MG2A 1L7LA 2VCMA 1HB3A 2IVIB 1S0JA 3DGTA 3HT1A 4QB1A 5FAXA 5BNPA 5HBAA 3H3LA 5JOXA 2ZX2A 4XJUA 1EUTA 1WLTA 3IIIA 4B1LA 1CZVA 3WF2A 2AUYA 1VBC3 5CNAA 4W65A 5G05L 1UZVA 1LENA 3FHIB 1PO11 4JTOA 2X10A 3UK9A 4ZS2A 4RR3C 4RHV2 3K46A 3ZXGA 1ZRDA 4CP2A 1W0OA 2XH6A 2WZPP 4NPRA 3T1LA 4BU2A 2DTYA 4Q5OA 1JZ7A 2B45X 1AYM1 3LSDA 2DCZA 4JKLA 5CBLA 2A73B 2VOKA 1JS9A 4Q2FA 2HLEA 2OQ7A 5IAVA 2PYTA 3P3NA 2YFUA 4JAAA 1OVPA 4XHBA 1VBB2 5FPVA 4BIFA 1JUHA 4GB33 4MVTA 5J37A 3IIAA 1S2EA 2XWBB 5IK7A 5L7OC 4OUMA 2WNUB 1UKRA 5FMDA 3OYWA 4E4DX 1W6QB 4GH4B 4N53A 4XDPA 1XXNA 3VZKA 3WD5A 5CZKA 4QQOA 2QQWA 2ZGQA 4BQWA 1K5MB 1VBC1 5LBBA 1W04A 4P9LA 4QDQA 1SCRA 4CPBA 4EWAA 4YARA 1K5JA 4CP0A 1NZCA 4DOUA 3GXUA 2XKOA 5C3PA 2NMNA 3J26N 1VBE2 4F7ZA 2CWMA 3PJQA 5H9SA 5FP7A 2ET1A 2KM2A 1RGSA 2DFBA 4HANA 3RG0A 1LCLA 2JENA 1XNKA 4QX3A 4AI2A 5A3TA 1DGWA 4MLOA 4WM8B 4A44A 4GA9A 4XUQA 5K0UB 2VZOA 2HYKA 2ORXA 4GB31 2VZRA 2YYOA 3AP4A 4QPIC 1SHWB 2UWAA 5JOYA 4LK7A 5JZGC 4BHPA 3K51A 3UKVA 2Y64A 1NA1A 2W39A 2YBKA 1LGCA 4XQDA 2VL4A 4LIVA 1C8NA 4LBQD 1HRI3 1O6UA 1LHUA 1X8EA 2GH8A 2R0FA 3SKVA 3ECQA 2R063 1X9PA 1R092 4AFDA 4N7IA 3FFZA 2YU2A 4RL7A 3BUCA 1VAKA 4HPKB 2QQNA 3KT4A 4IW3A 3SITA 4CDUC 1BXHA 2WFF3 4CU6A 3PUAA 1RTVA 3N9NA 5C5TA 1NCRC 1PZ9A 2IXCA 2WUHA 2ZEXA 3FE5A 3O5SA 5JXJA 3C7EA 1A8MA 1W3VA 2YU1A 4GKXA 4JCKA 3USUA 1BQPA 2N7GA 2R042 4GWMA 1W28A 2HKXA 5FBZA 2HBUA 1WW4A 1OD5A 2IVJA 3AB0A 3ME2A 4R9CA 5K7PA 2V5DA 4RQPC 1QXJA 1PIV2 2BW8A 2WL1A 4N43C 3MZHA 1VBA3 1HRI1 3HNYM 1C3HA 1XE7A 2JDAA 3VBUB 4D6SA 1D7PM 1GANA 5A7QA 4KGGA 1RUH2 5JUVA 5C8CA 3VZOA 2R061 1OI6A 1QXRA 4XZPA 5D8AC 1FAYA 1J3QA 1HIXA 5F5CA 1ULEA 2WFF1 5FXVA 2QJVA 2RV9A 2XL9A 3KM5A 5J7MA 1PMIA 1QJY3 2JE9A 1ODMA 1Y9QA 2DBNA 4CEWC 4IE0A 3V0BA 4YG6A 4EN9B 1OFSA 3C7FA 1WW5A 4LO8A 3TRSB 2EAAA 2H6BA 1W9SA 2D40A 4Q0SA 2HWD3 5LEKA 4EWEA 1PX3A 2WNOA 4NAOA 3BOWA 1ENQA 4PI2A 1PHMA 1Z78A 1W90A 2WR9A 5FP4A 5GLUA 3K75B 3ZFGA 3AMQA 1UOGA 4C1WA 1JTZX 2JDPA 3F95A 3VHOA 1VBA1 2HWE2 3FZ3A 3D0JA 1LRHA 1RUOA 1QWRA 1V00A 1LOEA 1GICA 2V73A 4NHYA 2DUPA 3MICA 4MSVA 1J84A 4PLNA 4TLFA 4YRDA 5FZ1A 3UJQA 2VQAA 1LEDA 3S57A 2FHRA 4MGTA 5JXHA 5CKQA 2VVFA 5A3OA 2XJQA 4YGDA 1QJY1 4MHUA 3NL1A 3NV2A 2JD4A 1WUVA 4A7KA 4QQ2A 1HB4A 4IL7A 5LA0A 3NAPA 4Q8KA 1NQJA 1AZDA 4BLIA 2NM1A 4JGYA 1WD4A 2VUAA 3CEWA 3MUZ1 3S30A 1LOAA 3BN6A 1MZEA 3T30A 2HYXA 3WHTA 4GXLA 4XCAA 5SV8A 2HWD1 2OA2A 2DURA 3P6BA 3ZDVA 1OH3A 3LGRA 4J1WA 4AAXA 1G9AA 3GDBA 4IV1C 2QNKA 4DFSA 4DINB 4O65A 5LATA 4GH4C 3WVJA 2DVFA 4S2GA 1W9WA 4XFFA 2FDJA 3ZMOA 1YCIA 5C33A 1JI6A 4I0BA 1ENSA 5HXMA 2XONA 2UY8A 1VAVA 3I7DA 2RE9A 5FZ6A 2E31A 1RUE3 3E5UA 1J1TA 2J7MA 4CU8A 1QQP3 4JQRA 4UW4A 1NE4A 4WBBA 1OOPA 4IV3A 4X6QB 3SCGA 2WA3A 1R1A2 5CVRA 5JIAA 4A3XA 2QZ2A 3CNAA 2DCTA 4K20A 1UY2A 2J1EA 1TMF3 5FYVA 4XMAA 5I0DA 5DZEA 4EN0A 1OF3A 1SLLA 5K0UC 4XDQA 4ONUA 2X09A 2GMPA 4I3GA 2ARAA 1HXS3 2X5IC 3LWCA 3SCFA 3VBRA 5FYTA 4BYYA 1ZA7A 5M0TA 4KNCA 2VU9A 3I4IA 3S7EA 4JTNA 5A1AA 2R1DA 2WSVA 5F5IA 1GWMA 1OBNA 1IS3A 3AYDA 1DLCA 4LITA 4E8CA 2A1XA 5IVFA 1W8UA 1Y9GA 3VV1A 2ZJCA 5GZFA 5KHJA 5IK5A 3I49A 3PMEA 2JG8B 2VW1A 1AL0G 3MHZA 1L7QA 3FJSA 1DU3D 4L92A 2WT1A 4S2HA 3USSA 4FPFA 4BCUA 1RUE1 4N9HA 5DQ0A 2VGDA 2BDRA 5LBEA 1QQP1 1RL3A 1UKGA 4W8JA 4C90A 4ZZ8A 3JD72 4AG4A 2W1SA 3GF6A 1HDKA 4JHTA 5GLVA 3B9CA 4BQ3A 3NNFA 1WKYA 5FZ3A 5BNOC 2WZR2 1FNZA 4AVBA 2I45A 3RVHA 1TMF1 1FX5A 3K4ZA 1YQ2A 3GCXA 1NYWA 3AJZA 4XJWA 3SKJE 4BPZA 5CG9A 2ZHMA 5EJ3A 1AR72 2Z69A 4KG0A 5JI7A 1OVSA 1WCUA 4XF9A 5I0UA 4AHWA 1XE8A 3POGA 4AE2A 1HXS1 4NPLA 2YDEA 4OI2A 4TWTA 3ETPA 3ROUA 5I8YA 2RS13 2YC4A 3Q8CA 5HI0A 4HT1T 1V6OA 1XNAA 1JU3A 3EYPA 2EIEA 3RYKA 1ODNA 4CDUA 1C1FA 2RDNA 5FPZA 1SBDA 5C3OA 5I91A 3V0BB 5GZGA 2FZ2A 3WY6A 4JVAA 5A1FA 4BQYA 1KITA 4KMQA 4COWA 5FJHA 4NJ4A 5KC5A 3HD8B 5EJZB 2VJXA 2EXJA 5HCAA 5JOWA 3AYAA 4AVAA 3H9AA 4HKOA 1PMHX 2JG9C 3ATGA 1H6YA 1ZZ7A 1SMVA 3NV4A 3KGLA 4LBJA 4RS5C 2ZOEB 3NJVA 4YVWA 2GMMA 5FMOS 4FP3A 2R30A 3NV1A 4CDWA 5IK4A 1ZRIA 1AR92 1GNHA 3PLQA 1XRUA 3KVAA 1YFXA 2F6BA 5JWPA 3RYRA 1OLME 2C9KA 4LLOA 1OMIA 3KMHA 2Q0AA 3WG3A 1J3PA 2BJSA 1JN2P 2PQSA 1JZ8A 4ATFA 5JSPA 4LBLA 2RS11 3AZYA 4AL9A 4XVHA 1IKQA 1D0HA 1DHKB 4JX0A 5F3GA 2AC1A 1OHFA 4JHZA 5FV3A 5F3IA 3IKWA 1X8MA 3A23A 3NAPB 1RUJ2 3MIDA 3ZOIA 4JGYB 5A3MA 1H1MA 4Q0VA 5D2AA 2E6VA 2AH2A 3OUHA 2DU1A 2WYFA 3OCPA 4IQPA 4B7KA 1F4HA 4LHSA 1SBFA 3PL0A 1G9BA 1QDCA 3ITQA 1LHWA 3ACHA 4CDXB 4OQ9A 5GJ6A 4A6OA 1NQDA 4MYEA 1GMMA 3C3VA 4XTPA 1KXGA 4BH9A 2A6ZA 5AC92 1WW7A 5BXXA 2QUOA 5IVEA 4LE3A 3IBMA 5T5OA 1A8DA 4RR3A 4XFIA 1VBB3 2G19A 3WNOA 1QY4A 2NZ9A 4HZFA 5FYCA 3OEBA 1O8PA 1C5IA 2D6LX 1SFPA 1LOGA 3N9OA 1W9TA 1ZZBA 2JIJA 3KV9A 1OOPB 3ACLA 3WDYA 1GOGA 2JKBA 4AI8A 4CU7A 1LOBA 4DY5A 1U0AA 5JOZA 2YG0A 2ARBA 2A6VA 4D0QA 2Z42A 2JD9A 4P9WA 3WDXA 1S0DA 2ADDA 3AKTA 4WVMA 4D6RA 4JKMA 1WCQA 4P9IA 5L7OA 1SLTA 5C71A 3FBYA 5IVYA 1ZYBA 5FYHA 3WV6A 1VBE3 3WOGA 1SPPA 5BV6A 4QPWA 4UOJA 1XC6A 3H8RA 2JECA 2EXIA 2XLFA 2GNDA 3MO4A 2W92A 4AEDB 4MH0E 1DF0A 3D3AA 3M70A 2HWC2 4O61A 4Y1VA 3JQWA 4HETA 4JGZB 5FZEA 4YG3A 4QQPA 5FJKA 4I30A 2W1QA 5HPOA 5E16A 4FXKB 3ZFFC 4AZZA 2QQLA 3I3DA 5CEHA 2GN7A 2XQRA 4M3CF 2RHPA 2VZSA 3AXDA 3M7AA 4UF0A 4DRRA 1YQ5A 3PMSA 4E27A 3IM0A 4LE4A 1UY1A 5T3NA 3I2JA 5FLHA 2WRAA 3VUOA 1QJFA 2WFPA 4FQZA 1YWKA 2JG8C 1R093 3P3PA 1GU3A 1HX6A 1KFXL 5A6YA 3N7MA 4F3JA 4QPIA 3A7QA 5JZGA 2ZTNA 1UIKA 3ZYHA 2WN2A 3WF4A 4QX7A 3P5BA 2IXKA 4OI4A 3VHRA 1N1YA 2IXJA 2RMU2 3WNPA 5L9RA 1N3PA 1KFUL 5A3NA 5E1RA 2R043 3OUIA 4CDUB 4YZ2A 1UY4A 4PIYA 2XJPA 3UL2A 5FMBA 3VZLA 1AHSA 3HOBA 4XHXA 3W9AA 2VW2A 1ULDA 5FRAA 1EP0A 5C3SA 1V0AA 1UX7A 4Y1XA 2ZHKA 3KSCA 1V6JA 3POYA 1X82A 4I0AA 1YFYA 5GZDA 4Q4V1 1NCRA 4LJHA 3U78A 5DUWA 3WUDA 2RDSA 5CAZA 1GYKA 4UFIA 2OPKA 4E2GA 2P34A 2XUEA 3MIGA 4I3PA 2GSYA 1BCXA 4LBMA 1RUD3 1STMA 2F4LA 5IVJA 3ZPYA 3Q8BA 1RUH3 1ULCA 4L8QA 4B29A 4H14A 1GZCA 2PLV2 1IZ3A 3OGRA 1SACA 4GWJA 3K48A 3TNQA 1FXZA 3WDWA 4QGNA 2DCJA 3FC0A 1EV13 4NWVA 4RQPA 3AMHA 3OTFA 4N43A 2WJSA 4YM1A 2FBEA 1DGWX 4FO9A 5F5QA 1YQ6A 4HN1A 1LTEA 3HJRA 1Q8PA 2GC0A 2VUDA 3U4SA 3AP5A 3NVCA 4XAEA 2VC9A 4DEVA 5D8AA 5A7OA 3MDPA 1CR7A 1MS8A 5FYMA 3J8F2 4B7EA 3PUIA 3IB3A 5FXWA 1UN1A 3WP6A 1XYNA 4XQ4A 2Y26A 4CEWA 1I5PA 2ZGKA 4QKNA 1XJAA 3IAPA 1CAUA 2ID4A 3WF0A 5EHDA 2LROA 1R082 3I2KA 2HWE3 1RUD1 3ZXAC 4BA6A 1JZ4A 3R0RA 5DXDA 2A6YA 1RUF2 3T09A 1RUH1 3DCQA 1G86A 1PGW2 4XFAA 5FP8A 3ZMNA 2GAUA 1GQPA 5IW0A 5CADA 4YGCA 4YZ3A 2K46A 1EV11 2WZEA 3INAA 1GWLA 5FTTC 5FY1A 2ES3A 2OUJA 3B3QE 4LBQB 4RR3B 5FMCA 3WQ7A 3BU0A 5EYXA 1G9FA 2RS52 5C6CA 2HEVF 2NP0A 5FY4A 4CDXC 4HL0A 4KWKA 1UZYA 2W9XA 3WZ1A 2WKKA 1W6NB 1POQA 1S0IA 2SLIA 2Y6JA 3OPTA 2VULA 4IE5A 2YY1A 1YXWA 5CKNA 3BTYA 4FOWA 1W2UA 5L19A 3MV11 2PHLA 3NRUA 3RI8A 5IT6A 2RDRA 1H6XA 2VE1A 4XETA 3D5OA 1Y4WA 2HWE1 4WVMB 5L7OB 5C4WC 4YW4A 3IMNA 1UU4A 2JWPA 5HCFA 3SLIA 3QD6A 5KWRA 1SPPB 1ZBE3 3KVBA 3JBG3 1ACCA 5EIYB 5IATA 1WCKA 4HVOA 4IV1A 3UYJA 4AFCA 1GWKA 1ZZ6A 1RUC1 4Z92B 4ZU7A 4EE2A 4QU2A 2E9QA 1JYCA 3BIWE 3NO8A 1RJ7A 4GH4A 1Q3EA 4HLTA 3V65A 1R1A3 4M3CE 4V2VA 3ZYJB 2DWRA 4IERA 1YYNA 3LIGA 1PVXA 4LPLA 4W6YA 4XAAA 2V09A 2Q8DA 4ZS3A 4AEDC 1RIRA 3HAGA 1D4M2 4XQWA 5GLWA 4UF0B 4JGZC 1UZ0A 1AYN2 3JB4C 3M3CA 1OURA 4V2WA 5T55A 4BQ1A 1W8NA 4QB6A 4CUBA 3J7LA 5A70A 3ENRA 1Q56A 1Q8QA 1GZ9A 4IGQA 4TXWA 1H8TB 1VB4A 2C9AA 4LKDA 5AFBA 2D93A 3E5QA 2AGSA 1NY72 4QPIB 2CU5A 4CXWA 2RJLA 1B35C 4Q4Y2 5F37A 2ZZQA 1S0GA 3U14A 3WT3A 4BQ4A 2B39A 3SH5A 4B4PA 4MHRA 4QX0A 1ZBE1 3JBG1 3OY8B 5K0UA 1DQ5A 1VB2A 5KXEA 4XJ9A 1KS5A 4TZDA 2X5IA 1CJPA 2YXSA 3A0NA 2WA4A 3CF6E 3J9SA 1WA6X 2Q1ZB 2ZMKA 2YUEA 4MGKE 4QX8A 2VG9A 4FCAA 3X29B 3JD73 2EIDA 4QXCA 1R1A1 3W21A 2ENRA 1GNYA 4ARXA 3FHAA 2ARCA 2WZR3 1TEIA 4Y4RA 3T4VA 2WC2A 5J09A 4NVPA 2W3JA 2EXHA 4HPKA 2OYZA 5FZFA 3C7OA 3VL9A 4DS0A 1AR73 4DXSA 3AVSA 4Q4X3 5DMYA 1UYYA 4I0WB 4FFFA 2YFZA 4QT6A 5FYZA 3KCCA 5FYIA 3O7OA 5IVVA 1EAH3 1LHNA 1V9U2 1WLDA 1RHI2 3DECA 3FUOA 4IEQA 1WGPA 2K2SA 3AFGA 4J6GA 3ZYBA 5BNOA 2VCCA 3UGGA 4A3ZA 3W5NA 1IOAA 1Q8VA 5DN2A 4AR2A 3HWJA 1GNZA 2A3XA 5FXXA 4N43B 5F6LB 1DQ6A 5HXVA 3B7MA 4AVTA 4ZKTB 1O3TA 5CFCC 4DXZA 1AX1A 3VZJA 1TZOA 3PU8A 4Y20A 1BEV2 2XKPA 1E5HA 2BP6A 4Y1YA 5D8AB 3OG2A 2VTXA 3K3NA 4N7UA 2GZWA 4NIAA 2DVDA 4G9SB 2IUWA 3B5LB 5LCWL 1LGBA 1OA2A 2W68A 4OHZA 4OMCA 3TB0A 4CEWB 5ACA3 2B46X 2LM3A 2VZQA 3KZ4C 5E8AA 1CAUB 1CD3G 4QB2A 4EYUA 3L9JT 1OXCA 5CB7A 1OQEA 2X05A 1VALA 2WO1A 4Q4X1 2VECA 3EXUA 5DAPA 3MFCA 5FZMA 5J96B 2WYSA 2W1UA 5A6QA 2JB4A 1EAH1 3WDUA 2OKXA 1ZZ8A 3ZN6B 4H3WA 4D7TA 2JG9A 3PUSA 5LRSA 4RS5A 2PHWA 3B9IA 2W47A 4FAGA 3ZSJA 4XZUG 1B09A 1H2KA 1V70A 2NLRA 3GCWA 1O3RA 4UYBA 2Q4SA 5FKCA 4Y4YA 3U1XA 4H55A 1XBFA 1Z7S3 2B7YA 3N7KA 3H8OA 3H42B 3FL7A 1IQAA 1QJU1 4YFZA 1A34A 3AP7A 1VRH1 2YGMA 1CX4A 4YNIA 1F15A 4JRLA 3WSOA 1XE0A 4E2SA 3N4MA 3WNNA 3LDRA 2A71A 5ACA1 3IWZA 4XUTA 3B02A 3E97A 1MS5A 1XU1A 5FZOA 1RUG3 1LU1A 3IDBB 1A78A 2JE7A 4GMP3 3RJRA 3UT0A 4XYXA 4X8NA 5AC93 1HQLA 3UESA 4AVVA 4B3NA 3ILFA 5A7PA 5IVBA 4EV0A 4W50A 2XPJA 4P02B 5AFEA 1COV2 4IV1B 3O1VA 5FPUA 1BBT2 2FDKA 2W52A 4OFGA 3CJXA 1IS4A 1E5RA 3H0OA 5FY8A 5JMOA 3WNKA 3KLSA 3R6SA 3M3IA 4FP2A 1JYWA 4I2OA 1RVF2 4LO5B 3LA2A 1Z7S1 2E32A 1PM4A 1REFA 1YFUA 2BNMA 5IUQA 4ET7A 2RJ2A 3BTXA 3I3EA 4QPGC 5GKAC 1S2KA 5J3UA 3O1OA 2R6QA 1FOD2 1YO8A 4KQ7A 4AHXA 3NJYA 1NAEA 3ST7A 2PHRA 2XOMA 1QJX2 2VCBA 1SG3A 2ZX0A 2UURA 4GZ9A 1BZWA 3RYPA 1RUG1 4AFBA 3I8TA 4GMP1 3CDZB 5IFTA 2XBO2 3LDBA 3H8XA 1UF2C 1Q43A 2W94A 2HWC3 3GNEA 2R0HA 1MS3A 4AFMA 3TYJA 4IEVA 4LHKA 4C91A 2FCVA 4QKFA 1DYOA 4K6BA 1WA4A 4XIOA 2GC3A 1H8TC 2ZBJA 3NNGA 4YW7A 3RQ0A 2X5IB 1LNSA 2Q30A 3K4AA 4WVZA 4P08A 2LTNA 4K40A 3H1WA 4KBZA 3B94A 1UO9A 2EVXA 3WF3A 4TTGA 2ZABA 1HRV2 2QDRA 2ERFA 5DZGA 2QTWB 1QOTA 1REEA 4MUVA 3KCYA 2FDIA 3BTAA 1CN1A 3T3YA 1OLMA 3VDDC 3ZFFA 3LQCA 4PIZA 2JDZA 2VZVA 2YC0A 3PJYA 4NRQA 1W9FA 3AP6A 3DUIA 4OHXA 3ZVXA 3S5AA 4FFHA 4UI9L 2Y6KA 2CL2A 2RMU3 1XU2A 1AR82 1N1VA 1V6IA 3VHPA 2JG8A 1JUIA 5BNOB 1HJGA 4MGIE 1NXD1 2BTVC 4MGZE 2HWC1 2XMLA 4PDWB 3O1RA 4CUGA 1DP0A 1US2A 3AFKA 2P6HA 4CDQB 1ZA4A 3M3EA 1RB8G 2BFUL 2ZGSA 2Q5TA 4Y20B 4NRMA 3WNMA 2ZX4A 5SV5A 3GZTB 3ZYPA 1HV1A 2W2IA 4ISRA 3UKTA 1DZRA 2P37A 2KR2A 4LTAA 4NO4A 4OHVA 5A7NA 2FD8A 3GZAA 1OSGA 3KV4A 1IPJA 1VR3A 1QEXA 3OBAA 3D0SA 2VZPA 3ZIWA 2R32A 3Q8EA 2CAVA 3V56A 2J42A 3FFQA 3O1PA 2KXLA 2W91A 2VBPA 2ZHNA 4JDMA 3ZR6A 2TUNA 2RMU1 3WQBA 3BVCA 3MPPG 3MIFA 1V6LA 5LA1A 1C57A 4L2NA 1J59A 2HWB2 3OEAA 4AGGA 2JG9B 2JIGA 4RS5B 3T2QA 4G3YC 4KU7A 1SDWA 3D82A 5AVPA 2GALA 1TME2 3J8F3 3THCA 2D43A 3AM2A 4CU9A 3GGLA 4FPKA 5LBFA 3MYXA 1SEFA 2D5HA 2RR12 3VZMA 5IYYA 3QH6A 4DY3A 3OGSA 2DVBA 1S0EA 4BMBA 1W8OA 1R083 2BEOA 4AEMA 2OW4A 2ZGNA 2DCKA 2GH2A 3IN9A 3P1IA 3H7YA 2NPIA 5FIXA 1VP6A 3ZDSA 2P3JA 4FPCA 5LBCA 2D6PA 2ZHLA 5FZOB 1V6MA 1FMD2 2RJKA 2VNGA 3KV5A 4DNYA 2XG3A 1JYXA 4D6QA 2RS32 4BZ4A 5FYBA 4GALA 4KGQA 4BIOA 4CCDA 1FI2A 4QQLA 2RS53 4B8EA 1LB2A 1ASJ2 1WLCA 2VCAA 3EJKA 3N35A 3SXWA 1YI9A 1UD1A 3I2HA 1QHDA 4MXWA 3AZVA 2ZGTA 4LR4A 2B9UA 4LO7A 4NHMA 3J8F1 3LFMA 4AI9A 5KXBA 1W03A 4LBOA 4UWDA 4QM8A 3BKZA 1DBNA 5DPNA 1FV3A 2FQPA 2JXAA 3DYOA 1UZZA 1QNYA 5A7WA 1AXZA 3UV9A 2VTFA 1O91A 2VW0A 2JX9A 1DGLA 2CSGA 4QX1A 2ZACA 3OUJA 4MO3M 3I3MA 1O4YA 4R8HA 4CDXA 4WM7C 3LKJA 4IDZA 3RSJA 4IE6A 4IESA 3WQ0A 5E89A 3V0AA 4META 1FPN2 3WP4A 4ZHNA 2WWUA 3ZYIB 1PO22 5LEJA 3JUUA 2XLGA 2V5YA 1ZVFA 5FO7B 3PNAA 4NIGA 1W6MA 1QOOA 1OLQA 3BU7A 4FPOB 3N3HA 3U11A 5I93A 1S2BA 4B4QA 4YGEA 1PNFA 1SQ4A 5C4WA 1RUI3 2LRPA 2DUQA 3O0VA 1BJQA 4PQQA 3VD7A 4AGRA 2QZ3A 3VD3A 5KC6A 4F8AA 4LBNA 3WXPA 1JOPA 1W8TA 3FLRA 4LIUA 5F5AA 5BY5A 2WIIB 2XJSA 4QDRA 1L3JA 1H4HA 3MF6A 5JPMB 2TEPA 4YYOA 2C26A 3ON7A 4YGBA 1QJEA 1RXFA 3KS7A 4XPVA 2Q8EA 3GM8A 2VMIA 2VO5A 1RYYA 3ALQA 3MW4A 3ZFFB 1DQ1A 3AX4A 4W6WA 4A41A 4Q4Y3 4UT5A 4AEDA 3U37A 1WMDA 3SH4A 1RMU2 3I2GA 4JGZA 2OZJA 2XB6C 4Q4W2 4A4AA 2VNOA 1LEMA 3IDCB 2DU0A 1XOYA 4NN0A 4ES8A 1H0BA 1J3RA 4IEWA 3T2OA 3VBSB 3T0DA 1TE1B 1X36A 4XILA 4LUMA 1BK0A 1B35A 2E7TA 2PHFA 1QOSA 1RUI1 3LE0A 3GHNA 4QD2A 1RITA 4AHYA 1T2XA 4GKYA 1AL23 1XNCA 4AQTA 4HVRA 1NOVA 3R4DB 2GC1A 4PDWC 4XCBA 2EAKA 1G9DA 1AUYA 4HOOA 3RWKX 3O14A 3LEGA 1H1AA 3LPGA 2YMZA 1VBD3 1HB1A 3V64A 4AFAA 4ZY9A 4CDQC 3VKMA 4RN5A 2BWAA 1V9U3 4ZU4A 4Q4Y1 4IE7A 3DN7A 4HK8A 4E8DA 1W2NA 4Y5Z0 2B5HA 2VAUA 2X8KA 4XMIA 4CCNA 5JIUA 3RWNA 3H3ZA 1APNA 1Q5OA 2LALA 1LOCA 4KI5M 3UGFA 4E4SA 5C7GA 2R49A 1BEV3 3OSDA 4M4PA 3H50A 3T0AA 1J83A 4TYSA 1U5XA 3RZZA 5LWBA 4CYDA 4RYDA 2IXHA 4DO0A 2J1SA 5LA9A 5BNQA 2ZGRA 5LK5A 5C3RA 1H9PA 4OZXA 1AL21 1O5LA 4IE4A 4OULA 1FT9A 5CFCA 2Y6LA 4XABA 3ZKYA 1UIJA 3ZM8A 2EF6A 4UW3A 5DAXA 2TNFA 4L9BA 3WNLA 4XW3A 3FLPA 2VY0A 3RGBA 3VBHC 3R4SA 5FWEA 1HKDA 1VBD1 2J1TA 3E5XA 4IEPA 1NT0A 1W6PB 4MGYE 3WG1A 4COUA 1JYIA 2P5BA 1RUNA 1V9U1 2CTVA 2XXZA 5A3UA 4AXOA 1PK6C 3JZVA 2UU8A 3LF7A 4LMFA 1JHJA 2VUJA 4QU1A 2WS92 3NSTA 3EHKA 4MXVA 3MIBA 5FY7A 1J58A 1PO12 4KBBA 1WBLA 1HB2A 1OKOA 4Q27A 2E33A 4CRQA 1L7RA 2V4AA 3N7JA 1BEV1 4MXWB 2PN5A 4MADA 1GZTA 2OIIA 1AYM2 1YJLA 1XSQA 1SLCA 2A5ZA 4RA0A 4RHV3 5I8SA 5IHRA 5A7WB 4LKEA 4CUAA 2ZCWA 3BYWA 4GMP0 4EZ4A 1UPIA 3PIGA 5I0RA 1S55A 2I2SA 3ZXFA 1Z0HA 2JKXA 4OZOA 1PMJX 3VKLA 3IPVB 4F83A 1XPWA 4QWNA 1NZIA 4BQXA 2BVBA 3OGVA 3V0AB 5DDJ2 4AQ2A 2ZGLA 4LBQA 4FPEA 1COV3 5FUIA 2Y6HA 2WWSA 4YVSB 1QKQA 1BBT3 5BNNC 3GZUC 3ZSKA 1VBC2 1WMEA 2YHJA 1GKBA 1W8ZA 1NUKA 1W6MB 1W6NA 1UZWA 1W8HA 3CJIB 2YGLA 3OBTA 4Y24A 3TN92 3WP5A 1RVF3 4O7XA 5C4WB 1R64A 2WWJA 5FZ4A 2GP3A 3ZKUA 4HVQA 1UW8A 1S0CA 3U75A 1EY2A 3AKSA 3M3QA 4PIXA 4YLZA 5JVVA 4YW2A 4AGVA 3ACGA 3G6JB 1IQDC 4Q8LA 3KHCA 5A1LA 1K45A 4RHV1 2DYCA 5HV0A 4HK9A 1I1EA 4AVCA 1QJX3 5A3PA 1VLNA 5A7SA 2J22A 5L9VA 4RD7A 1BHGA 1ZRCA 3LDKA 4GB32 2VVEA 4XJ8A 3RMYA 3WNXA 5F32A 1YI7A 3TNPB 2CDOA 4QPGA 4FQ4A 4AQSA 5FOJB 4QHBA 3S7IA 1LECA 3WEZA 5FFOC 2VZ3A 5FUNA 2BUKA 1VBB1 3TEZA 1COV1 2EIBA 2OZ6A 1BBT1 4XUNA 2R16A 4CEYC 5GALA 5JR2A 2BZDA 3WCRA 3AZXA 4FOQA 4UFHA
chains in the Genus database with same CATH topology
3NKTA 1NLRA 4WZCA 1B35B 3G7DA 1PGSA 2A3YA 4JRAA 5D1IA 2D44A 1H8TA 3AJYA 3VBSC 2HWF2 4AW7A 3VKOA 1ENRA 2XHKA 3VZNA 2B8MA 1QJX1 1AR83 3ZXLA 1VBE1 5GM0A 4YW5A 3OY8A 3PVBB 1DDLA 4AI3A 3VDDA 1O5UA 1F31A 2PFWA 3NWKA 4K8FA 4Y26A 4ORFA 1MQTC 1OPOA 1HRI2 1JW6A 3M3OA 3WDVA 4E4ZA 4S2FA 4P9YA 2PA7A 1PIV3 2QQPA 2WINB 3SHRA 2WFF2 5J98B 4X8PA 2XWJB 5FO8B 1R091 5CFCB 1QU0A 2IFWA 3WW4A 4P5HA 2XVLA 4G4FA 5FQ0B 4XF1A 1VIWB 1DQ4A 1KS4A 1SLIA 2IXLA 2K9ZA 1AR81 2I74A 4P14A 1G6NA 1G8WA 5CU1A 4M01A 1IGOA 1FYUA 4C0HA 4M3CB 4DMIA 1TME3 1NLSA 2R041 1PVC2 2A3WA 4RFT0 2GU9A 1RC6A 5EXOA 1VBA2 1YHFA 3N36A 4BWOA 4NR1A 1PIV1 4IEYA 4Z2WA 4M00A 3DL3A 2P2KA 5T50A 3ZN6A 2ZS6B 1MZ6A 1FMD3 5C9AB 3PVOA 1MS4A 2RS33 4ISQA 4X6RB 2R1BA 2MHFA 1HW5A 2GNMA 4SLIA 4GWNA 2DVAA 1ASJ3 4QXKA 1IKPA 1AJKA 1G7YA 3WQ1A 1ALYA 2AENA 1U12A 1CAXA 3FMGA 2ILMA 1OKQA 3AP9A 1C5HA 4FPHA 2EIGA 2BGCA 4YVSC 2PHTA 3FLTA 3ZN4A 2PAEA 3HMYA 4HKLA 5CFDB 2YPJA 4EJRA 2X53S 5JR7B 3CJIC 3AKQA 4YW3A 3E6DA 2BVVA 1HLCA 4RGGA 3UKNA 1PO23 1WW6A 5AVAA 1FMD1 2CNAA 3IDEA 3ASIA 5CIRA 2O0OA 1ONAA 3VN4A 2RS31 4XFGA 1ZRRA 1DQ0A 4Q1RA 3PHMA 1ND3C 4WM7A 1D2SA 1TQ5A 4JDNA 4Q1PA 1FNYA 4QPGB 1CPMA 4XXAA 4L99A 3B69A 4CP1A 3RDIA 5T52A 5DG2A 1C4RA 1SFYA 3MIEA 5KHGA 1ND2C 1SBEA 1OQ1A 4K7JA 4IEXA 2IWGB 2FMDA 2YZ4A 2CGPA 3ZFEC 3O12A 3RMXA 3WG2A 5EWSA 1H2MA 1X7NA 4KWJA 2WQZC 4Q26A 2XVGA 4C1XA 4M0NA 5GLTA 1H30A 2WSUA 1VJ2A 1YFWA 1S1AA 3W59A 1RMU3 1RUE2 4Q4W3 1PO21 3AKPA 4IEZA 3D8CA 1ZX5A 4QQHA 3VDDB 4D94A 1C8M2 3GALA 1MS1A 4O9GA 1CESA 3H7JA 1HXS2 1CJDA 1QH6A 2NN8A 2W08A 4YM3A 2NMOA 1ZBA2 1GSLA 1LR5A 1LULA 3ZXDA 4OI0A 4COVA 2ATFA 5I0TA 4KG8A 1CONA 3RPQA 5K9YA 4I01A 4FSJA 2XJTA 1UAIA 3OBRA 1CVNA 2C5DA 2BBVA 1SLAA 4XEZA 2XL7A 3A0KA 2DCYA 2P3IA 3MW3A 2ET7A 1NCQC 4V1PA 3VLBB 1N1TA 2GN3A 4PDWA 4Q4W1 4YSFA 2VOXA 1U5YA 2RM22 2BNNA 2H0BA 3BOPA 4FOVA 4CDQA 1UMZA 3KQRA 5F6KA 3H1YA 3EQEA 3MLLA 3ZXKA 2ARXA 1H8VA 4BLJA 2Z5WA 4ATEA 3JD71 1O7FA 4LHLA 3TAYA 3MLKA 4UW6A 5LRRA 4HSLA 2WZR1 4LT5A 3HR9A 3CU7A 4R4ZA 5L73A 1X33A 4AWDA 2XUMA 1AR93 4OUSA 1MZ5A 3QCWA 5A3LA 1OFNA 1KDMA 1AR71 3H3UA 2PHDA 3PVNA 3QOPA 1YJKA 2HEYF 3AKRA 2PHXA 3JU9A 3DV8A 2D6OX 1QMJA 3GBWA 2BYVE 2WS93 1AX0A 2R072 3APBA 1KDKA 3M2MA 2E63A 2EA7A 3VBHA 3ZSEA 5C8WA 1RUJ3 4XF3A 2D7FA 5C9AC 5FO9B 1PGL2 2H6CA 1CAXB 4EN6B 2VPVA 1AYM3 1PK6A 4D7SA 2DV9A 5JCTA 1MS9A 1YIFA 3FBMA 5JSOA 4COZA 3OGJA 1AR91 1LHVA 4YFWA 1DGRA 1DZTA 2C0ZA 4SBVA 5ABJB 4RGAA 1X50A 3FWEA 3I2DA 5DDJ3 5CFDC 1A6CA 5CA6A 2XVKA 3I59B 5IK8A 2XGXA 2WS91 2I07B 3LA7A 4WM7B 3TN93 3LAGA 3T1MA 4XTMA 5FLIA 3RS6A 4JV4A 3R4UA 1RUJ1 3CLPA 4EROA 1LOFC 3NW4A 3SH3A 1ZNPA 3SNMA 5BNNA 1OA3A 3FX3A 2Q1MA 4XFHA 3NV3A 1H2NA 2ZKNA 3CO2A 2BFUS 1OQDA 3SISA 3ETQA 2ZGOA 1BMV2 2IZWA 3MIHA 4J1XA 3JB8A 5AC91 5DDJ1 5F9TA 3VBFC 4ITCA 3ZXEA 4OI1A 2Z2SB 4XBLA 4Y1UA 1RJ8A 4N9IA 3TN91 4K1YA 4K9SA 4E9KA 1F5FA 4XJAA 3SCHA 3OD0A 3ZYRA 3PVEA 4R9DA 1KQRA 3OJBA 5JPNB 1Y43B 1QF3A 2EXKA 3U07A 2HWF3 1POV3 4LULA 4AK3A 4CEYA 2ZGUA 4LO6B 2W0XA 4PQ9A 3BCWA 1EYBA 1GLHA 1I9RA 2DUOA 1O4ZA 4KU8A 3DKWA 2WLPA 1AF9A 1PNGA 1XQNA 4Q0UA 4QGMA 1I5ZA 2O8QA 3LA3A 2ZMNA 4R4XA 4Q4V2 2GDFA 4LO4B 3VBSA 4R52A 3WW3A 4BOWA 2ZA9A 1V6NA 1D2QA 3E6CC 2FMYA 3M1HA 1UX6A 4ZU5A 4A2UA 5LK7B 4Q0QA 1N47A 2H0VA 2YROA 2D5FA 4INDA 3WUCA 2DF7A 3R05A 1MQTA 2PLV3 5FDBA 5DG1A 3IT8A 3VL8A 4EWDA 2HWF1 2A7AA 1POV1 2NYYA 2QCSB 1MR5A 1Y3TA 4QPYA 1LKNA 4GQ7A 4QX5A 5A32A 4YM2A 4PLMA 3AYCA 1PVC3 1I6XA 3C2UA 4COYA 4CZSA 3AMMA 1RUD2 3VBHB 1GV9A 4U2AA 3DPRB 1QGLA 1CAVB 2HEWF 3VBOB 5B2GB 1NXMA 4D3WA 1PK6B 3ILRA 1KJRA 2AR6A 2WNVB 1EV12 1RUF3 1F2NA 1W6PA 2ZKLA 2DVGA 4U36A 2PLV1 1D4VB 1LHOA 1EPWA 3POSA 4MX3A 1PZ7A 3UJOA 5BNPB 2ZX3A 1ZRFA 1LU2A 3D6EA 4GULA 4NHKA 5H9QA 5DZFA 4A7YA 1PVC1 3WHUA 1Q8SA 5ABJC 2AYHA 3O0WA 4HN0A 4KWLA 3MW2A 1DQ2A 3D4KA 3GHMA 1AX2A 4FTSA 1OPMA 3E6BA 2Y0IA 1DFQA 1O3SA 4KH9A 1R081 5DUVA 1W39A 5BNNB 3U4XA 1RUC2 3IPVA 4K3UA 2VNRA 2VOVA 5FCCA 1HQWA 1RUF1 1LODA 1MEC2 1PGW1 1XNDA 3B00A 1BKZA 1YNAA 4YG0A 4YVSA 4FAHA 4Y1ZA 5K8SA 1CAWA 3M4FA 3OYWB 2GMEA 3CJIA 1W0PA 1IHMA 3LB9A 3MLJA 4N53B 3WG4A 4QGLA 5JI9A 1BVVA 3VKFC 2RS51 2D97A 4E2QA 1AR62 3AMNA 4Y22A 1D4M3 2WNUC 1AYN3 1ND3A 1WD3A 2D6NA 2ZAAA 4H7MA 4MV2A 5FREA 4Q29A 1K5MC 1UU5A 2D3PA 2A75A 3JQXA 1ZBE2 1H4GA 2DTWA 3JBG2 3N7LA 4L11A 4R9AA 1ND2A 4CEYB 3WINE 4K21A 3L2HA 3ZFEA 3EO6A 2UWCA 1DG6A 3H8UA 1C8M3 1NA1B 3M8LA 1GR3A 4JC1A 2C1FA 4IEUA 5FPXA 4WM8C 1DLLA 2E53A 3RNSA 4L97A 3HIFA 1O3QA 2VH9A 4ES9A 1D4M1 4FVVA 2X29A 2ZGMA 1ZBA3 3H1MA 1AYN1 1IS5A 3OF1A 5L36A 4BMEA 1O4TA 3CL1A 3MGUA 1QNWA 1MQTB 3GBGA 4OHWA 2A6WA 1RHI3 1BYHA 1NY71 5FLJA 3USUB 3PTYA 3J4UH 4XFCA 2RM23 2UY9A 5A32B 4FTBA 1GBGA 1YRZA 2D3RA 4YZ4A 4D7YA 5KHKA 3URFA 1JHNA 1DYKA 4FPLA 2CY6A 2QFEA 5JMCA 3ES4A 1C8M1 1UPSA 2Y0OA 2MEV2 1IS6A 4Z07A 2QVSB 1XYPA 2SBAA 4HBNA 1NCQA 4Q4X2 3MI8A 2DFCA 5C8CB 3LSEA 1EAH2 3HQXA 4KL1A 4WVWA 2WNEA 5T5PA 5TSWA 3WR0A 4PCRA 1ZBA1 5FQ0A 3DF0A 3VBUC 1XNBA 1JOJA 3DPRC 2GC2A 2HJIA 1F9KA 1V6KA 1RHI1 3KGZA 3VBOC 1S0FA 2OUHA 4M3CA 2R073 2WNVC 4FXGB 1QJU2 1OA4A 3ZX7A 3MFAA 1KRIA 1VRH2 2RM21 2LUWA 3ES1A 2FZ1A 4XF0A 4C0BA 2NQYA 4D69A 3OPZA 3ZFGB 1JXNA 5ACA2 4W6XA 4OHYA 1PZ8A 4IETA 5BNPC 5A33A 1BVP1 1UU6A 3WW1A 2CWSA 3ELNA 1GFF2 3NJZA 1QXPA 3FUQA 3WDTA 1U5IA 4BM8A 4GIQA 1NE6A 5C9AA 1EPZA 1E57A 2PAMA 3O0XA 1N3QA 3GYDA 1OLRA 3KCXA 1ZZ9A 4YW1A 2G9GA 2WQ4A 5JSRA 4Z82A 1Z7S2 2CAUA 1H9WA 3B01A 2R071 1CAWB 3TBDA 2IC1A 2PELA 3ZN5A 3S0MA 2QDNA 2ZGPA 4DQAA 1QDOA 2AZ5A 1PGL1 4H7LA 2JEMA 1U5ZA 3AMPA 5CFDA 3ZIXA 4Y22B 1RUG2 5J48A 2VMGA 4N53C 1FOD3 3MPBA 5KXCA 1ND3B 3LZZA 4FT8A 5JDBA 4LA3A 1PM7A 1W6OA 2VVDA 5FMOL 2Z79A 1WMFA 2XBO3 1AVBA 1WCSA 4LNVA 1ND2B 1LOFA 2XLAA 3ZFEB 3RJ2X 3THPA 4IV3B 1TNFA 4XBQA 3BB6A 2G9FA 5JLVA 1XYOA 1DZQA 4XXPA 4AHZA 4XFBA 1YIPA 1RVF1 1HRV3 2BWCA 4CTEA 4FBFA 1POV0 1CQ9A 1ZZCA 1CIWA 3VBFA 4YZ5A 2QKDA 4Z1VA 1LGNA 3VBRB 1NA1C 5H9RA 3VKNA 1SFNA 2MNGA 1FOD1 3WX5A 1HV0A 3QACA 1LJ7A 1JH5A 4MZUA 1T6GC 2UYAA 4FOYA 4Q4V3 4UW5A 2XBO1 1BMV1 3LOIA 4DRVA 1F8VA 1DYPA 4ASMB 1F5JA 3KD4A 5EZWA 4P9XA 2B42B 2F4PA 1TNRA 2E51A 4M0HA 4YM0A 2G4IA 4Q0PA 2E7AA 3OD4A 2XJVA 2R062 1KJLA 3B93A 3ILNA 1NCQB 4URTA 1M4WA 1HRV1 1N1SA 5CG8A 3RI9A 5HCBA 3ZSMA 3AXEA 1MVEA 3T2TA 3HT2A 3POWA 3Q9OA 5E88A 3L2YA 4HFSA 4UXAA 3ZYGA 4ZXKA 3WW2A 4PBOA 2D6KA 2K0GA 5C8CC 4AF9A 1URXA 2HWB3 2WT2A 1HQNA 4R9BA 3VHNA 4FTEA 4NOTA 5DUUA 3EBRA 2PTMA 1N3OA 3GBFA 4BE3A 4IXLA 5DUXA 2RR13 1FATA 4XIKA 4Z8BA 4XE9A 4CDWB 4I02A 2UYBA 4YVWB 5EV7A 4A7ZA 3SMHA 1AJOA 2P3KA 4AEJA 4I09A 1G9CA 4DZGA 3KB5A 3S6PA 5A33B 2ZZJA 1NG0A 4AI0A 3OGGA 3ZFGC 1J1LA 1QJY2 4AI1A 2JJ6A 1GZWA 1I3HA 2KA3A 2XJUA 5T5JA 1BK1A 2O1QA 1WBFA 1D0GA 2E7QA 1SCSA 2GNBA 4NHLA 2HWD2 5KXDA 2HWB1 4OLLA 3THTA 1MZFA 4IEOA 2VQ0A 1TME1 4HSJA 2TBVA 1ENXA 5T54A 4NWWA 1Q8OA 2RR11 2BQPA 3BALA 4PJYA 1A3KA 1DGRN 3NAPC 2WT0A 4JGYC 3JCIA 3HN1A 4FPYA 1RUC3 1VAMA 1MEC3 3QH7A 4WVVA 5ABJA 1FPN3 3WLUA 3W58A 3BPZA 4B4RA 1W6OB 1QH7A 1H1IA 1R1ZA 2MPFA 3I59A 1WCDJ 2Y38A 1GQGA 4XOGA 4K1ZA 2ZX1A 1AXYA 2D6MA 1KD7A 1ASJ1 3VGIA 2IFRA 5BPXA 2Q8OA 2WLQA 3WP3A 3ZXJA 1Y7BA 4TSVA 1DIWA 1AR63 2VXRA 3AZZA 5GZEA 1O3TA 2AREA 4DPNA 4P9GA 3A4UA 3HBZA 4EN8B 5EFUA 1OOPC 2QE3A 4IV3C 4LHNA 2EALA 3VBFB 2D98A 1FV2A 2WNUA 1MEC1 2JICA 4JDOA 1W6QA 1FPN1 4WZFA 1QQP2 4DB5A 1RUI2 3KT1A 2UWBA 2PHUA 3AK0A 3VBRC 1K5MA 4P9JA 3QBQA 4XJZA 5KHHA 4EN7B 3MEPA 1UL9A 2ETEA 4AEKA 3BODA 1M06G 1TMF2 5H9PA 2ZPXA 1YLLA 1S0BA 5KHIA 1JBCA 1AR61 3TOJA 5GZCA 5KBFA 4UBGA 5JZGB 2VMHA 3ZSLA 4RSUA 5F1RA 3RRDA 2CV6A 3LOBA 2XJRA 3NKGA 4WM8A 3I54A 1MACA 4UBHA 2VOWA 4PBPA 4QMAA 5I8TA 3LCPA 1ULFA 1UCXA 4LA2A 4AYUA 1RMU1 4AVSA 2GNTA 1ZM1A 4LEJA 3U10A 1C1LA 1AL22 1NCRB 1WLWA 2P17A 4LLFA 4QM9A 1ZREA 1LESA 2MEV3 4CDUC 1CPNA 4FPGA 5EYYA 4ASLA 2CGOA 1ULGA 3AYEA 2ZMLA 1SLBA 2OVUA 3U0ZA 4PLOA 4S2DA 5I0SA 1GQHA 1VBD2 2O8OA 1C28A 2A6XA 2CGNA 3KT7A 1REDA 3QLQA 4HKWA 1MVQA 2A70A 2RS12 2BPA2 1YUDA 2ZAHA 2CYFA 4RQPB 4HMZA 5BUVA 2IXIA 4LUKA 4WV8A 1IPKA 4CDWC 4OVEA 1RINA 4XF4A 4YVWC 4LBKA 2BNOA 3ZO0B 5FOBB 4XBNA 3MF9A 3TWIA 4AQ6A 4YZ1A 1GZWB 1QJU3 1VRH3 2D3SA 2PQQA 1PO13 3VBUA 5T5LA 4N90A 3DPRA 1QJZA 5GLZA 4PF5A 1CAVA 1CGPA 3VBOA 1AXKA 2MEV1 4O9EA 4FPJA 2WNVA 5J36A 2YV8A 2PAKA 3AZWA 1H2LA 3WCSA 1MS0A 1S0JA 3DGTA 3HT1A 5BNPA 5FAXA 5HBAA 5JOXA 2ZX2A 4XJUA 1WLTA 2AUYA 1VBC3 5CNAA 4W65A 1LENA 3FHIB 1PO11 4JTOA 3UK9A 4RR3C 4RHV2 3ZXGA 1ZRDA 4CP2A 1W0OA 2XH6A 2WZPP 4NPRA 3T1LA 2DTYA 2B45X 1AYM1 3LSDA 2DCZA 5CBLA 2A73B 2VOKA 4Q2FA 2PYTA 3P3NA 4JAAA 4XHBA 1VBB2 4BIFA 1JUHA 4GB33 4MVTA 5J37A 3IIAA 2XWBB 5IK7A 5L7OC 4OUMA 2WNUB 1UKRA 3OYWA 4E4DX 1W6QB 4GH4B 4N53A 1XXNA 3VZKA 3WD5A 4QQOA 2ZGQA 1K5MB 1VBC1 4P9LA 1SCRA 4EWAA 4YARA 4CP0A 1NZCA 4DOUA 2XKOA 2NMNA 3J26N 1VBE2 4F7ZA 2CWMA 3PJQA 5H9SA 2ET1A 2KM2A 1RGSA 2DFBA 4HANA 3RG0A 1LCLA 2JENA 1XNKA 4AI2A 1DGWA 4MLOA 4WM8B 4GA9A 5K0UB 2HYKA 4GB31 3AP4A 2YYOA 4QPIC 5JOYA 2UWAA 5JZGC 4BHPA 3K51A 3UKVA 1NA1A 2W39A 4XQDA 1LGCA 1C8NA 4LBQD 1HRI3 1LHUA 1X8EA 2GH8A 2R0FA 3ECQA 2R063 1R092 4AFDA 4N7IA 3FFZA 4RL7A 1VAKA 4HPKB 3KT4A 3SITA 1BXHA 2WFF3 1RTVA 1NCRC 1PZ9A 2IXCA 3FE5A 3O5SA 1A8MA 4JCKA 4GKXA 3USUA 1BQPA 2N7GA 2R042 4GWMA 2HKXA 5FBZA 1WW4A 1OD5A 3ME2A 3AB0A 4R9CA 5K7PA 4RQPC 1QXJA 1PIV2 2BW8A 2WL1A 4N43C 3MZHA 1VBA3 1HRI1 3VBUB 1C3HA 1XE7A 1GANA 4KGGA 1RUH2 5C8CA 3VZOA 2R061 1OI6A 1QXRA 4XZPA 5D8AC 1FAYA 1J3QA 1HIXA 1ULEA 2WFF1 2QJVA 3KM5A 2XL9A 5J7MA 1PMIA 1QJY3 2JE9A 1Y9QA 4CEWC 3V0BA 4YG6A 4EN9B 1OFSA 1WW5A 4LO8A 3TRSB 2EAAA 2H6BA 2D40A 4Q0SA 2HWD3 5LEKA 4EWEA 3BOWA 1ENQA 1PHMA 1Z78A 5GLUA 3ZFGA 3AMQA 4C1WA 1JTZX 3VHOA 1VBA1 2HWE2 3FZ3A 3D0JA 1LRHA 1RUOA 1QWRA 1V00A 1LOEA 1GICA 2V73A 2DUPA 3MICA 4MSVA 4PLNA 4TLFA 4YRDA 3UJQA 2VQAA 1LEDA 2FHRA 2VVFA 2XJQA 4YGDA 1QJY1 3NL1A 3NV2A 2JD4A 1WUVA 4A7KA 4QQ2A 4IL7A 3NAPA 4Q8KA 1NQJA 1AZDA 4BLIA 2NM1A 4JGYA 1WD4A 2VUAA 3CEWA 3S30A 1LOAA 1MZEA 3WHTA 4GXLA 5SV8A 2HWD1 2OA2A 2DURA 3LGRA 4J1WA 1G9AA 4IV1C 2QNKA 4DFSA 4DINB 4GH4C 3WVJA 2DVFA 4S2GA 4XFFA 3ZMOA 1YCIA 5C33A 4I0BA 1ENSA 2UY8A 1VAVA 3I7DA 2RE9A 1RUE3 3E5UA 1J1TA 1QQP3 4JQRA 4UW4A 1NE4A 4WBBA 1OOPA 4IV3A 4X6QB 3SCGA 2WA3A 1R1A2 5CVRA 5JIAA 4A3XA 2QZ2A 3CNAA 2DCTA 4K20A 1TMF3 4XMAA 5DZEA 4EN0A 1SLLA 5K0UC 4XDQA 4ONUA 2GMPA 4I3GA 1HXS3 2X5IC 3LWCA 3SCFA 3VBRA 4BYYA 4KNCA 2VU9A 3I4IA 3S7EA 4JTNA 2R1DA 2WSVA 1IS3A 3AYDA 3VV1A 2ZJCA 5GZFA 5KHJA 5IK5A 3PMEA 2JG8B 2VW1A 1AL0G 3FJSA 1DU3D 4L92A