2X5UL

80 microsecond laue diffraction snapshot from crystals of a photosynthetic reaction centre without illumination.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced structural changes in a photosynthetic reaction center caught by Laue diffraction.
pubmed doi rcsb
molecule keywords PHOTOSYNTHETIC REACTION CENTER CYTOCHROME C SUBUNIT
molecule tags Photosynthesis
total genus 93
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 2x5uL01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 2x5uL02
2HITM 2UXLL 5PRCM 3DTSL 1JH0M 4H9LL 1RZZL 1JGYM 2GNUL 1PCRM 1E6DM 3ZUML 1K6NL 4IN5M 3DU3L 3T6EM 2JBLM 3DU2M 3G7FM 1MPSL 2GMRL 1S00L 2WX5M 3DSYM 4TQQM 1RG5M 1RY5L 2HHKM 4HBHL 2UWUL 4LWYM 1EYSL 1F6NL 1E14M 1YF6L 1FNQM 1JGXL 1VRNL 2UX3M 1AIGL 2JIYL 2J8DL 2UWSM 3I4DM 2WJNL 2UWWL 1DV6M 2BNSB 5PRCL 5LRIM 1JGZM 1QOVL 2UWTM 2PRCM 1RGNL 1L9JM 2BOZL 1KBYL 2JIYM 3PRCM 1DXRM 1PSSL 2UWVM 1M3XL 6PRCL 2I5NM 2JJ0L 2UXJL 1AIJL 1DV3M 1DS8L 1FNQL 4HBJM 2HG9M 3WMML 2UWSL 3DTAM 1PSTL 1YSTL 4IN6M 2UX4L 5LRIL 4RCRM 2BNSA 2X5UM 1FNPM 4N7LM 3V3YL 2WJML 1RVJL 2HJ6L 2J8CL 3DUQM 1L9BL 3T6DM 7PRCL 1L9JL 2RCRL 2UX5L 4IN7M 4CASB 3PRCL 2UXKL 2HG3M 5LSEM 2HITL 3D38M 1JH0L 1JGYL 2UXMM 1PCRL 1E6DL 4N7KM 1K6LM 1UMXM 4IN5L 3T6EL 3ZUWM 2JBLL 4IN6L 4RCRL 3DU2L 3G7FL 4TQQL 2WX5L 3DSYL 4H99M 1RG5L 3V3ZM 1RQKM 2HHKL 3DTRM 1PRCM 2UX4M 4LWYL 2UXLM 1E14L 4IN7L 4H9LM 2UX3L 1RZZM 5LSEL 4CASC 2GNUM 3I4DL 1DV6L 3ZUMM 1R2CM 1JGZL 1JGWM 1K6NM 2UXML 3DU3M 2UWTL 2PRCL 2BNPB 2HH1M 1MPSM 1S00M 1RY5M 4HBHM 1DXRL 2UWUM 1EYSM 1YF6M 2UWVL 2I5NL 1RQKL 1JGXM 1VRNM 1AIGM 2J8DM 1DV3L 2WJNM 4HBJL 1OGVM 2HG9L 2UWWM 3DTAL 1QOVM 1R2CL 1JGWL 1FNPL 1RGNM 2X5UL 2X5VM 4N7LL 1RZHM 2BOZM 1KBYM 2BNPA 2HH1L 3DUQL 3T6DL 3DTSM 1PSSM 1M3XM 2HG3L 6PRCM 3D38L 2JJ0M 2UXJM 1AIJM 1DS8M 3WMMM 3DTRL 4N7KL 1K6LL 1PSTM 1OGVL 1UMXL 1YSTM 3ZUWL 2GMRM 3V3YM 2WJMM 1RVJM 2HJ6M 2J8CM 2X5VL 4H99L 1L9BM 7PRCM 1F6NM 1RZHL 2RCRM 2UX5M 3V3ZL 2UXKM 1PRCL
chains in the Genus database with same CATH superfamily
2HITM 2UXLL 3WRYC 5PRCM 3DTSL 1JH0M 4H9LL 1RZZL 1JGYM 2GNUL 1PCRM 1E6DM 3ZUML 1K6NL 4IN5M 3DU3L 3T6EM 2JBLM 3DU2M 3G7FM 1MPSL 2GMRL 1S00L 2WX5M 3DSYM 4TQQM 1RG5M 1RY5L 2HHKM 4HBHL 2UWUL 4LWYM 1EYSL 1F6NL 1E14M 1YF6L 1FNQM 1JGXL 1VRNL 2UX3M 1AIGL 2JIYL 2J8DL 2UWSM 3I4DM 2WJNL 2UWWL 1DV6M 2BNSB 5PRCL 5LRIM 1JGZM 1QOVL 2UWTM 2PRCM 1RGNL 1L9JM 2BOZL 1KBYL 2JIYM 3PRCM 1DXRM 1PSSL 2UWVM 1M3XL 6PRCL 2I5NM 2JJ0L 2UXJL 1AIJL 1DV3M 1DS8L 1FNQL 4HBJM 2HG9M 3WMML 3VKWA 2UWSL 3DTAM 1PSTL 1YSTL 4IN6M 2UX4L 5LRIL 4RCRM 2BNSA 2X5UM 1FNPM 4N7LM 3WRXC 3V3YL 2WJML 1RVJL 2HJ6L 2J8CL 3DUQM 1L9BL 3T6DM 7PRCL 1L9JL 2RCRL 2UX5L 4IN7M 4CASB 3PRCL 2UXKL 2HG3M 5LSEM 2HITL 3D38M 1JH0L 1JGYL 2UXMM 1PCRL 1E6DL 4N7KM 1K6LM 1UMXM 4IN5L 3T6EL 3ZUWM 2JBLL 4IN6L 4RCRL 3DU2L 3G7FL 4TQQL 2WX5L 3DSYL 4H99M 1RG5L 3V3ZM 1RQKM 2HHKL 3DTRM 1PRCM 2UX4M 4LWYL 2UXLM 1E14L 4IN7L 4H9LM 2UX3L 1RZZM 5LSEL 4CASC 2GNUM 3I4DL 1DV6L 3ZUMM 1R2CM 1JGZL 1JGWM 1K6NM 2UXML 3DU3M 2UWTL 2PRCL 2BNPB 2HH1M 1MPSM 1S00M 1RY5M 4HBHM 1DXRL 2UWUM 1EYSM 1YF6M 2UWVL 2I5NL 1RQKL 1JGXM 1VRNM 1AIGM 2J8DM 1DV3L 2WJNM 4HBJL 1OGVM 2HG9L 2UWWM 3DTAL 1QOVM 1R2CL 1JGWL 1FNPL 1RGNM 2X5UL 2X5VM 4N7LL 1RZHM 2BOZM 1KBYM 2BNPA 2HH1L 3DUQL 3T6DL 3DTSM 1PSSM 1M3XM 2HG3L 6PRCM 3D38L 2JJ0M 2UXJM 1AIJM 1DS8M 3WMMM 3DTRL 4N7KL 1K6LL 1PSTM 1OGVL 1UMXL 1YSTM 3ZUWL 2GMRM 3V3YM 2WJMM 1RVJM 2HJ6M 2J8CM 2X5VL 4H99L 1L9BM 7PRCM 1F6NM 1RZHL 2RCRM 2UX5M 3V3ZL 2UXKM 1PRCL
chains in the Genus database with same CATH topology
2HITM 2UXLL 5PRCM 3DTSL 1JH0M 4H9LL 1RZZL 1JGYM 2GNUL 1PCRM 1E6DM 3ZUML 1K6NL 4IN5M 3DU3L 3T6EM 2JBLM 3DU2M 3G7FM 1MPSL 2GMRL 1S00L 2WX5M 3DSYM 4TQQM 1RG5M 1RY5L 2HHKM 4HBHL 2UWUL 4LWYM 1EYSL 1F6NL 1E14M 1YF6L 1FNQM 1JGXL 1VRNL 2UX3M 1AIGL 2JIYL 2J8DL 2UWSM 3I4DM 2WJNL 2UWWL 1DV6M 2BNSB 5PRCL 5LRIM 1JGZM 1QOVL 2UWTM 2PRCM 1RGNL 1L9JM 2BOZL 1KBYL 2JIYM 3PRCM 1DXRM 1PSSL 2UWVM 1M3XL 6PRCL 2I5NM 2JJ0L 2UXJL 1AIJL 1DV3M 1DS8L 1FNQL 4HBJM 2HG9M 3WMML 2UWSL 3DTAM 1PSTL 1YSTL 4IN6M 2UX4L 5LRIL 4RCRM 2BNSA 2X5UM 1FNPM 4N7LM 3V3YL 2WJML 1RVJL 2HJ6L 2J8CL 3DUQM 1L9BL 3T6DM 7PRCL 1L9JL 2RCRL 2UX5L 4IN7M 4CASB 3PRCL 2UXKL 2HG3M 5LSEM 2HITL 3D38M 1JH0L 1JGYL 2UXMM 1PCRL 1E6DL 4N7KM 1K6LM 1UMXM 4IN5L 3T6EL 3ZUWM 2JBLL 4IN6L 4RCRL 3DU2L 3G7FL 4TQQL 2WX5L 3DSYL 4H99M 1RG5L 3V3ZM 1RQKM 2HHKL 3DTRM 1PRCM 2UX4M 4LWYL 2UXLM 1E14L 4IN7L 4H9LM 2UX3L 1RZZM 5LSEL 4CASC 2GNUM 3I4DL 1DV6L 3ZUMM 1R2CM 1JGZL 1JGWM 1K6NM 2UXML 3DU3M 2UWTL 2PRCL 2BNPB 2HH1M 1MPSM 1S00M 1RY5M 4HBHM 1DXRL 2UWUM 1EYSM 1YF6M 2UWVL 2I5NL 1RQKL 1JGXM 1VRNM 1AIGM 2J8DM 1DV3L 2WJNM 4HBJL 1OGVM 2HG9L 2UWWM 3DTAL 1QOVM 1R2CL 1JGWL 1FNPL 1RGNM 2X5UL 2X5VM 4N7LL 1RZHM 2BOZM 1KBYM 2BNPA 2HH1L 3DUQL 3T6DL 3DTSM 1PSSM 1M3XM 2HG3L 6PRCM 3D38L 2JJ0M 2UXJM 1AIJM 1DS8M 3WMMM 3DTRL 4N7KL 1K6LL 1PSTM 1OGVL 1UMXL 1YSTM 3ZUWL 2GMRM 3V3YM 2WJMM 1RVJM 2HJ6M 2J8CM 2X5VL 4H99L 1L9BM 7PRCM 1F6NM 1RZHL 2RCRM 2UX5M 3V3ZL 2UXKM 1PRCL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIT M;  2UXL L;  5PRC M;  3DTS L;  1JH0 M;  4H9L L;  1RZZ L;  1JGY M;  2GNU L;  1PCR M;  1E6D M;  3ZUM L;  1K6N L;  4IN5 M;  3DU3 L;  3T6E M;  2JBL M;  3DU2 M;  3G7F M;  1MPS L;  2GMR L;  1S00 L;  2WX5 M;  3DSY M;  4TQQ M;  1RG5 M;  1RY5 L;  2HHK M;  4HBH L;  2UWU L;  4LWY M;  1EYS L;  1F6N L;  1E14 M;  1YF6 L;  1FNQ M;  1JGX L;  1VRN L;  2UX3 M;  1AIG L;  2JIY L;  2J8D L;  2UWS M;  3I4D M;  2WJN L;  2UWW L;  1DV6 M;  2BNS B;  5PRC L;  5LRI M;  1JGZ M;  1QOV L;  2UWT M;  2PRC M;  1RGN L;  1L9J M;  2BOZ L;  1KBY L;  2JIY M;  3PRC M;  1DXR M;  1PSS L;  2UWV M;  1M3X L;  6PRC L;  2I5N M;  2JJ0 L;  2UXJ L;  1AIJ L;  1DV3 M;  1DS8 L;  1FNQ L;  4HBJ M;  2HG9 M;  3WMM L;  2UWS L;  3DTA M;  1PST L;  1YST L;  4IN6 M;  2UX4 L;  5LRI L;  4RCR M;  2BNS A;  2X5U M;  1FNP M;  4N7L M;  3V3Y L;  2WJM L;  1RVJ L;  2HJ6 L;  2J8C L;  3DUQ M;  1L9B L;  3T6D M;  7PRC L;  1L9J L;  2RCR L;  2UX5 L;  4IN7 M;  4CAS B;  3PRC L;  2UXK L;  2HG3 M;  5LSE M;  2HIT L;  3D38 M;  1JH0 L;  1JGY L;  2UXM M;  1PCR L;  1E6D L;  4N7K M;  1K6L M;  1UMX M;  4IN5 L;  3T6E L;  3ZUW M;  2JBL L;  4IN6 L;  4RCR L;  3DU2 L;  3G7F L;  4TQQ L;  2WX5 L;  3DSY L;  4H99 M;  1RG5 L;  3V3Z M;  1RQK M;  2HHK L;  3DTR M;  1PRC M;  2UX4 M;  4LWY L;  2UXL M;  1E14 L;  4IN7 L;  4H9L M;  2UX3 L;  1RZZ M;  5LSE L;  4CAS C;  2GNU M;  3I4D L;  1DV6 L;  3ZUM M;  1R2C M;  1JGZ L;  1JGW M;  1K6N M;  2UXM L;  3DU3 M;  2UWT L;  2PRC L;  2BNP B;  2HH1 M;  1MPS M;  1S00 M;  1RY5 M;  4HBH M;  1DXR L;  2UWU M;  1EYS M;  1YF6 M;  2UWV L;  2I5N L;  1RQK L;  1JGX M;  1VRN M;  1AIG M;  2J8D M;  1DV3 L;  2WJN M;  4HBJ L;  1OGV M;  2HG9 L;  2UWW M;  3DTA L;  1QOV M;  1R2C L;  1JGW L;  1FNP L;  1RGN M;  2X5U L;  2X5V M;  4N7L L;  1RZH M;  2BOZ M;  1KBY M;  2BNP A;  2HH1 L;  3DUQ L;  3T6D L;  3DTS M;  1PSS M;  1M3X M;  2HG3 L;  6PRC M;  3D38 L;  2JJ0 M;  2UXJ M;  1AIJ M;  1DS8 M;  3WMM M;  3DTR L;  4N7K L;  1K6L L;  1PST M;  1OGV L;  1UMX L;  1YST M;  3ZUW L;  2GMR M;  3V3Y M;  2WJM M;  1RVJ M;  2HJ6 M;  2J8C M;  2X5V L;  4H99 L;  1L9B M;  7PRC M;  1F6N M;  1RZH L;  2RCR M;  2UX5 M;  3V3Z L;  2UXK M;  1PRC L; 
#chains in the Genus database with same CATH topology
 2HIT M;  2UXL L;  3WRY C;  5PRC M;  3DTS L;  1JH0 M;  4H9L L;  1RZZ L;  1JGY M;  2GNU L;  1PCR M;  1E6D M;  3ZUM L;  1K6N L;  4IN5 M;  3DU3 L;  3T6E M;  2JBL M;  3DU2 M;  3G7F M;  1MPS L;  2GMR L;  1S00 L;  2WX5 M;  3DSY M;  4TQQ M;  1RG5 M;  1RY5 L;  2HHK M;  4HBH L;  2UWU L;  4LWY M;  1EYS L;  1F6N L;  1E14 M;  1YF6 L;  1FNQ M;  1JGX L;  1VRN L;  2UX3 M;  1AIG L;  2JIY L;  2J8D L;  2UWS M;  3I4D M;  2WJN L;  2UWW L;  1DV6 M;  2BNS B;  5PRC L;  5LRI M;  1JGZ M;  1QOV L;  2UWT M;  2PRC M;  1RGN L;  1L9J M;  2BOZ L;  1KBY L;  2JIY M;  3PRC M;  1DXR M;  1PSS L;  2UWV M;  1M3X L;  6PRC L;  2I5N M;  2JJ0 L;  2UXJ L;  1AIJ L;  1DV3 M;  1DS8 L;  1FNQ L;  4HBJ M;  2HG9 M;  3WMM L;  3VKW A;  2UWS L;  3DTA M;  1PST L;  1YST L;  4IN6 M;  2UX4 L;  5LRI L;  4RCR M;  2BNS A;  2X5U M;  1FNP M;  4N7L M;  3WRX C;  3V3Y L;  2WJM L;  1RVJ L;  2HJ6 L;  2J8C L;  3DUQ M;  1L9B L;  3T6D M;  7PRC L;  1L9J L;  2RCR L;  2UX5 L;  4IN7 M;  4CAS B;  3PRC L;  2UXK L;  2HG3 M;  5LSE M;  2HIT L;  3D38 M;  1JH0 L;  1JGY L;  2UXM M;  1PCR L;  1E6D L;  4N7K M;  1K6L M;  1UMX M;  4IN5 L;  3T6E L;  3ZUW M;  2JBL L;  4IN6 L;  4RCR L;  3DU2 L;  3G7F L;  4TQQ L;  2WX5 L;  3DSY L;  4H99 M;  1RG5 L;  3V3Z M;  1RQK M;  2HHK L;  3DTR M;  1PRC M;  2UX4 M;  4LWY L;  2UXL M;  1E14 L;  4IN7 L;  4H9L M;  2UX3 L;  1RZZ M;  5LSE L;  4CAS C;  2GNU M;  3I4D L;  1DV6 L;  3ZUM M;  1R2C M;  1JGZ L;  1JGW M;  1K6N M;  2UXM L;  3DU3 M;  2UWT L;  2PRC L;  2BNP B;  2HH1 M;  1MPS M;  1S00 M;  1RY5 M;  4HBH M;  1DXR L;  2UWU M;  1EYS M;  1YF6 M;  2UWV L;  2I5N L;  1RQK L;  1JGX M;  1VRN M;  1AIG M;  2J8D M;  1DV3 L;  2WJN M;  4HBJ L;  1OGV M;  2HG9 L;  2UWW M;  3DTA L;  1QOV M;  1R2C L;  1JGW L;  1FNP L;  1RGN M;  2X5U L;  2X5V M;  4N7L L;  1RZH M;  2BOZ M;  1KBY M;  2BNP A;  2HH1 L;  3DUQ L;  3T6D L;  3DTS M;  1PSS M;  1M3X M;  2HG3 L;  6PRC M;  3D38 L;  2JJ0 M;  2UXJ M;  1AIJ M;  1DS8 M;  3WMM M;  3DTR L;  4N7K L;  1K6L L;  1PST M;  1OGV L;  1UMX L;  1YST M;  3ZUW L;  2GMR M;  3V3Y M;  2WJM M;  1RVJ M;  2HJ6 M;  2J8C M;  2X5V L;  4H99 L;  1L9B M;  7PRC M;  1F6N M;  1RZH L;  2RCR M;  2UX5 M;  3V3Z L;  2UXK M;  1PRC L; 
#chains in the Genus database with same CATH homology
 2HIT M;  2UXL L;  5PRC M;  3DTS L;  1JH0 M;  4H9L L;  1RZZ L;  1JGY M;  2GNU L;  1PCR M;  1E6D M;  3ZUM L;  1K6N L;  4IN5 M;  3DU3 L;  3T6E M;  2JBL M;  3DU2 M;  3G7F M;  1MPS L;  2GMR L;  1S00 L;  2WX5 M;  3DSY M;  4TQQ M;  1RG5 M;  1RY5 L;  2HHK M;  4HBH L;  2UWU L;  4LWY M;  1EYS L;  1F6N L;  1E14 M;  1YF6 L;  1FNQ M;  1JGX L;  1VRN L;  2UX3 M;  1AIG L;  2JIY L;  2J8D L;  2UWS M;  3I4D M;  2WJN L;  2UWW L;  1DV6 M;  2BNS B;  5PRC L;  5LRI M;  1JGZ M;  1QOV L;  2UWT M;  2PRC M;  1RGN L;  1L9J M;  2BOZ L;  1KBY L;  2JIY M;  3PRC M;  1DXR M;  1PSS L;  2UWV M;  1M3X L;  6PRC L;  2I5N M;  2JJ0 L;  2UXJ L;  1AIJ L;  1DV3 M;  1DS8 L;  1FNQ L;  4HBJ M;  2HG9 M;  3WMM L;  2UWS L;  3DTA M;  1PST L;  1YST L;  4IN6 M;  2UX4 L;  5LRI L;  4RCR M;  2BNS A;  2X5U M;  1FNP M;  4N7L M;  3V3Y L;  2WJM L;  1RVJ L;  2HJ6 L;  2J8C L;  3DUQ M;  1L9B L;  3T6D M;  7PRC L;  1L9J L;  2RCR L;  2UX5 L;  4IN7 M;  4CAS B;  3PRC L;  2UXK L;  2HG3 M;  5LSE M;  2HIT L;  3D38 M;  1JH0 L;  1JGY L;  2UXM M;  1PCR L;  1E6D L;  4N7K M;  1K6L M;  1UMX M;  4IN5 L;  3T6E L;  3ZUW M;  2JBL L;  4IN6 L;  4RCR L;  3DU2 L;  3G7F L;  4TQQ L;  2WX5 L;  3DSY L;  4H99 M;  1RG5 L;  3V3Z M;  1RQK M;  2HHK L;  3DTR M;  1PRC M;  2UX4 M;  4LWY L;  2UXL M;  1E14 L;  4IN7 L;  4H9L M;  2UX3 L;  1RZZ M;  5LSE L;  4CAS C;  2GNU M;  3I4D L;  1DV6 L;  3ZUM M;  1R2C M;  1JGZ L;  1JGW M;  1K6N M;  2UXM L;  3DU3 M;  2UWT L;  2PRC L;  2BNP B;  2HH1 M;  1MPS M;  1S00 M;  1RY5 M;  4HBH M;  1DXR L;  2UWU M;  1EYS M;  1YF6 M;  2UWV L;  2I5N L;  1RQK L;  1JGX M;  1VRN M;  1AIG M;  2J8D M;  1DV3 L;  2WJN M;  4HBJ L;  1OGV M;  2HG9 L;  2UWW M;  3DTA L;  1QOV M;  1R2C L;  1JGW L;  1FNP L;  1RGN M;  2X5U L;  2X5V M;  4N7L L;  1RZH M;  2BOZ M;  1KBY M;  2BNP A;  2HH1 L;  3DUQ L;  3T6D L;  3DTS M;  1PSS M;  1M3X M;  2HG3 L;  6PRC M;  3D38 L;  2JJ0 M;  2UXJ M;  1AIJ M;  1DS8 M;  3WMM M;  3DTR L;  4N7K L;  1K6L L;  1PST M;  1OGV L;  1UMX L;  1YST M;  3ZUW L;  2GMR M;  3V3Y M;  2WJM M;  1RVJ M;  2HJ6 M;  2J8C M;  2X5V L;  4H99 L;  1L9B M;  7PRC M;  1F6N M;  1RZH L;  2RCR M;  2UX5 M;  3V3Z L;  2UXK M;  1PRC L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...