2X60A

Crystal structure of t. maritima gdp-mannose pyrophosphorylase in complex with gtp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
333
structure length
333
Chain Sequence
VMKALILAGGSGERFWPLSTPETPKQFLKLFGNKSLMRWTFERVLEEMDPKDVIVVTHKDYVERTKKELPELPDENIIAEPMKKNTAPACFIGTKLADDDEPVLVLPADHRIPDTKKFWKTVKKALDALEKYDGLFTFGIVPTRPETGYGYIEIGEELEEGVHKVAQFREKPDLETAKKFVESGRFLWNSGMFLWKAREFIEEVKVCEPSIYENLKDVDPRNFEELKKAYEKVPSISVDYAVMEKSKKVRVVKADFEWSDLGNWSSVREIEGYTEESDEVILVDSDRVFVKTHNKPIAVVGLSDVIVIDTPNGILICKEEYAQKVREVVKKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANNOSE-1-PHOSPHATE GUANYLYLTRANSFERASE
publication title Structural Insights Into the Catalytic Mechanism of Bacterial Guanosine-Diphospho-D-Mannose Pyrophosphorylase and its Regulation by Divalent Ions.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 109
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.7.7.13: Mannose-1-phosphate guanylyltransferase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2x60A00
1FOAA 1ZHJA 1ZI1A 3CKQA 1VPAA 4G3PA 5JQQA 4FRAA 5AJOA 3U0YA 3U2UA 2P6WA 5EJZA 2QGIA 3D5NA 2A8WA 2AM3A 3LW6A 1VH3A 1VGZA 2W0VA 1H5TB 3ZGGA 3OC9A 5CQMX 2DPWA 1HV9A 4M2BA 2D7RA 1VGTA 4Y63A 3Q80A 2UX8A 2AM4A 1GWVA 1ZJ1A 4YS8A 4KQLA 4EEOA 1ZCYA 4KNXA 1H7LA 1SS9A 1FRWA 3OH3A 4D11A 1INJA 1MP4A 2V0KA 3R2WA 4CJCA 4EVWA 3SXDA 2GGOA 4MNDA 2ICYA 1LVWA 1O7OA 4ARWA 4J18A 5C1LA 1H5SA 2AGDA 4HO5A 5C47A 3ZGFA 4CVHA 2ZU8A 2Y6PA 3SX7A 5C4DA 3SXAA 4FRMA 1S4OA 3V90A 2XWNA 5C4FA 1TW5A 2X60A 2JCKA 3IOHA 2RJ0A 2RJ7A 2WVKA 2PA4A 3POLA 1JYLA 2YQHA 1H5SD 1NKHB 5CMGX 3T7NA 4FRBA 3E25A 5C8RA 1LL0A 1YP4A 3CKVA 2AM5A 2Y4JA 1H5RB 1JVDA 1HM0A 2RJ1A 4EEGA 1EZIA 1GWWA 4CJBA 1ZDGA 4HOCA 4Y9XA 1LZJA 1YP3A 2P73A 2RJ5A 2XMHA 4FRLA 4KNRA 4Y7FA 3T7MA 3JUKA 1MC3A 3V0PA 4B2WA 1I52A 4FREA 2FY7A 2AH9A 4KC2A 2AECA 4Y62A 2XMEA 1R7UA 3I0EA 2APCA 4Y6UA 5CMHA 1HJJA 1LZIA 2OEGA 1VGUA 4R7PA 1WT0A 1OMZA 4M28A 5CQPA 2VXMA 1ZCTA 1S4PA 3U2VA 3O3PA 4ASYA 1FO9A 4Y6NA 2YC3A 3DUVA 3V0OA 5CQNX 3GUEA 1ZIZA 1W77A 4EE5A 4P02A 3F1CA 1HM8A 2WGZA 3CKNA 4Y64A 4LW3A 3RSBA 2ZU7A 4BQHA 1WT3A 2WVMA 4NAIA 5FU8A 3K8DA 4G87A 3SXCA 1JYKA 5C1GA 1V84A 2E8BA 4KPZA 3SXGA 2QKXA 4HO0A 4B4GA 1ZCUA 1G23A 5FTSA 4LW6A 1NHEB 3V8ZA 3V8YA 1HJLA 1O0RA 2I5KA 2WVLA 1H5SB 1PZTA 1WSZA 3CU0A 4IRPA 2WAWA 3I0KA 4AAWA 1MP5A 4EE3A 1G0RA 1G97A 3OH4A 5DDTA 4XWIA 3U2XA 1VM8A 4D0ZA 5CMFX 3D8VA 2OI6A 4FRHA 2AESA 1QGSA 3CGXA 4KPXA 2JCOA 2ICXA 3I0CA 2PGYA 1G8OA 4EEMA 1MP3A 1G9RA 2AE7A 2FYDB 1JV1A 4HO4A 3NGWA 5C48A 1FR8A 4FQWA 1S4NA 1Z90A 3D98A 1R81A 2JCJA 3CKJA 4KC1A 1O23B 5FYEA 2A8UA 2W0WA 3I0JA 5FTVA 2RJ4A 2FYCB 1VZXA 5C36A 4HO9A 3T7OA 3I0LA 4NANA 4Y7UA 3ST8A 1QGQA 3USQA 3USRA 2E3DA 1H4DA 1ZDFA 3U2WA 4DECA 4HO6A 2JCLA 3SXEA 2Z87A 2X5SA 1FGXA 1G3LA 4D0TA 4AYLA 2YQSA 4EE4A 1R7VA 2GGQA 5C38A 5C4EA 4KRVA 4DDZA 1R7XA 2O1FA 1LL3A 3KIAA 4G3SA 2CU2A 2VD4A 3ZLKA 4B3UA 1IINA 4IRQA 3DJ4A 5L6VA 3HL3A 2I7BA 1G95A 1VICA 2BO4A 1INIA 1ZJ0A 5FU0A 1H7TA 5FUHA 1FR9A 1FO8A 3I0GA 4B4BA 3PKQA 5C49A 2VS5A 3R3IA 1IIMA 3OGZA 1ZJPA 4FROA 4NAKA 1H4EA 1QG8A 1G2VA 1ZI5A 2YESA 1H7QA 4FRPA 3SX8A 2MZBA 4FCEA 1H7HA 1R80A 2Y4KA 1ZI3A 4HO8A 4B42A 3PNNA 3V0NA 1V82A 4C2SA 5C3BA 3RMWA 2V0JA 3U2TA 5EIYA 3E26A 1VGWA 2YC5A 1ZCVA 3ZF8A 2BO6A 5IDSA 3V0LA 3I0FA 1TW1A 2RIZA 2I5EA 2RJ9A 1GQCA 1FXJA 2FFUA 3CKOA 3SXBA 2Y4LA 4G3QA 2PX7A 2FFVA 2PGVA 2RJ8A 2VS4A 2VFZA 2Y7AA 1LL2A 1GQ9A 4KC4A 1G1LA 1H7EA 1TVYA 4JD0A 4ECMA 1H7FA 2WEEA 5CQLX 3ZLLA 4Y7TA 5CQOA 2ZU9A 3BRKX 5I1FA 5HS2A 5C1HA 1FWYA 2YQJA 4B5BA 5EJ1A 1TZFA 4DE7A 3F1YA 5CMJA 5AJPA 1EYRA 3IOJA 4Y7GA 4P00A 4D48A 3RMVA 5L6SA 1ZJ2A 2Y4MA 3OKRA 3OH2A 1R82A 3SX5A 3TQDA 5FV9A 1KWSA 1E5KA 3QVBA 4AC3A 1NF5B 2VS3A 4HG6A 4JISA 2P72A 2RIYA 3U0XA 1H5TA 5IFYA 4HO3A 1WT2A 2V0LA 3OH1A 2OEFA 4KXOA 1ZI4A 3Q4SA 5C4BA 1PZYB 3I0HA 2Q4JA 2V0HA 4CJ8A 4ZDQA 1ZJ3A 2V0IA 4EEAA 1VZTA 5AJNA 2WE9A 5DDVA 2FYBA 1ON6A 3IOIA 5C4CA 2NXVA 1G93A 5BXCA 2YQCA 1WT1A 2BO8A 3N9WA 1VH1A 5J49A 4M4KA 1NQIB 2O1HA 1O7QA 4MYBA 4Y7VA 2OI7A 4L41C 4FRDA 3V91A 3FOQA 3PKPA 2YCMA 5C3AA 5C3DA 4HCQA 4GBPA 2VXLA 4HO2A 3BCVA 1LZ7A 1H7GA 3DK5A 1WVCA 3SX3A 1V83A 1FG5N 2XWLA 4K6RA 3TZTA 3V0MA 2QH5A 1W55A 3SPTA 2Z86A 3FWWA 3OH0A 2X5ZA 2FYAA 4D11C 1H4CA 1YP2A 1FXOA 1H3MA 4M2AA 3V0QA 3JTJA 4UEGA 1XZ6A 1K4VA 4FRQA 2OI5A 1NMMB 2VSIA 1GX0A 5IDTA 1ZJOA 1JV3A 3JUJA 4NALA 4E1KA 1H5SC 2D7IA 3I0DA 3EE5A 2D0JA 4BMAA 1H5RA 2RIXA 4AYJA 2O1GA 4KT7A 2BO7A 1W57A 1R7YA 1OQMB 1XHBA 4B4MA 4B2XA 1QWJA 1OMXA 2VSHA 3I0IX 3Q7UA 1YROB 1GX4A 1FGGA 1ON8A 2RJ6A 5CMIA 3OAMA 4FCUA 1R7TA 1VZUA 1FZWA 1LZ0A 3K8EA 2X65A 2RITA 2XWMA 4ASJA 1NWGB 1HM9A 1JVGA 1GA8A
chains in the Genus database with same CATH superfamily
1FOAA 1ZHJA 1ZI1A 3CKQA 1VPAA 4G3PA 5JQQA 4FRAA 5AJOA 3U0YA 3U2UA 2P6WA 5EJZA 2QGIA 3D5NA 2A8WA 2AM3A 3LW6A 1VH3A 1VGZA 2W0VA 1H5TB 3ZGGA 3OC9A 5CQMX 2DPWA 1HV9A 4M2BA 2D7RA 1VGTA 4Y63A 3Q80A 2UX8A 2AM4A 1GWVA 1ZJ1A 4YS8A 4KQLA 4EEOA 1ZCYA 4KNXA 1H7LA 1SS9A 1FRWA 3OH3A 4D11A 1INJA 1MP4A 2V0KA 3R2WA 4CJCA 4EVWA 3SXDA 2GGOA 4MNDA 2ICYA 1LVWA 1O7OA 4ARWA 4O6MA 4J18A 5C1LA 1H5SA 2AGDA 4HO5A 5C47A 3ZGFA 4CVHA 2ZU8A 2Y6PA 3SX7A 5C4DA 3SXAA 4FRMA 1S4OA 3V90A 2XWNA 5C4FA 1TW5A 2X60A 2JCKA 3IOHA 2RJ0A 2RJ7A 2WVKA 2PA4A 3POLA 1JYLA 2YQHA 1H5SD 1NKHB 5CMGX 3T7NA 4FRBA 3E25A 5C8RA 3CKVA 1LL0A 1YP4A 2J0AA 2AM5A 2Y4JA 1H5RB 1JVDA 1HM0A 2RJ1A 4EEGA 1EZIA 1GWWA 4CJBA 1ZDGA 4HOCA 4Y9XA 1LZJA 1YP3A 2P73A 2RJ5A 2XMHA 4FRLA 4KNRA 4Y7FA 3T7MA 3JUKA 1MC3A 3V0PA 4B2WA 1I52A 4FREA 2FY7A 2AH9A 4KC2A 2AECA 4Y62A 2XMEA 1R7UA 4FIXA 3I0EA 2APCA 4Y6UA 5CMHA 1HJJA 1LZIA 2OEGA 1VGUA 4R7PA 1WT0A 1OMZA 4M28A 5CQPA 2VXMA 1ZCTA 1S4PA 3U2VA 3O3PA 4ASYA 1FO9A 4Y6NA 2YC3A 3DUVA 3V0OA 4FIYA 5CQNX 3GUEA 1ZIZA 1W77A 4EE5A 4P02A 3F1CA 1HM8A 2WGZA 3CKNA 4Y64A 4LW3A 3RSBA 2ZU7A 4BQHA 1WT3A 2WVMA 4NAIA 5FU8A 3K8DA 4G87A 3SXCA 1JYKA 5C1GA 1V84A 2E8BA 4KPZA 3SXGA 2QKXA 4HO0A 4B4GA 1ZCUA 1G23A 5FTSA 4LW6A 1NHEB 3V8ZA 3V8YA 1HJLA 1O0RA 2I5KA 2WVLA 1H5SB 1PZTA 1WSZA 3CU0A 4IRPA 2WAWA 3I0KA 4AAWA 1MP5A 4EE3A 1G0RA 1G97A 3OH4A 5DDTA 4XWIA 3U2XA 1VM8A 4D0ZA 5CMFX 3D8VA 2OI6A 4FRHA 2AESA 1QGSA 3CGXA 4KPXA 2JCOA 2ICXA 3I0CA 2PGYA 1G8OA 4EEMA 1MP3A 1G9RA 2AE7A 2FYDB 1JV1A 4HO4A 3NGWA 5C48A 1FR8A 4FQWA 1S4NA 1Z90A 3D98A 1R81A 2JCJA 3CKJA 4KC1A 1O23B 5FYEA 2A8UA 2W0WA 3I0JA 5FTVA 2RJ4A 2FYCB 1VZXA 5C36A 4HO9A 3T7OA 3I0LA 4NANA 4Y7UA 3ST8A 1QGQA 3USQA 3USRA 2E3DA 1H4DA 1ZDFA 3U2WA 4DECA 4HO6A 2JCLA 3SXEA 2Z87A 2X5SA 1FGXA 1G3LA 4D0TA 4AYLA 2YQSA 4EE4A 1R7VA 2GGQA 5C38A 5C4EA 4KRVA 4DDZA 1R7XA 2O1FA 1LL3A 3KIAA 4G3SA 2CU2A 2VD4A 3ZLKA 4B3UA 1IINA 4IRQA 3DJ4A 5L6VA 3HL3A 2I7BA 1G95A 1VICA 2BO4A 1INIA 1ZJ0A 5FU0A 1H7TA 5FUHA 1FR9A 1FO8A 3I0GA 5D92A 4B4BA 3PKQA 5C49A 2VS5A 3R3IA 1IIMA 3OGZA 1ZJPA 4FROA 4NAKA 1H4EA 1QG8A 1G2VA 1ZI5A 2YESA 1H7QA 4FRPA 3SX8A 2MZBA 4FCEA 1H7HA 1R80A 2Y4KA 1ZI3A 4HO8A 4B42A 3PNNA 3V0NA 1V82A 4C2SA 5C3BA 3RMWA 2V0JA 3U2TA 5EIYA 3E26A 4MIXA 1VGWA 2YC5A 1ZCVA 3ZF8A 2BO6A 4O6NA 5IDSA 3V0LA 3I0FA 1TW1A 2RIZA 2I5EA 2RJ9A 1GQCA 1FXJA 2FFUA 3CKOA 3SXBA 2Y4LA 4G3QA 2PX7A 2FFVA 2PGVA 2RJ8A 2VS4A 2VFZA 2Y7AA 1LL2A 1GQ9A 4KC4A 1G1LA 1H7EA 1TVYA 4JD0A 4ECMA 1H7FA 2WEEA 5CQLX 3ZLLA 4Y7TA 5CQOA 2ZU9A 3BRKX 5I1FA 5HS2A 5C1HA 1FWYA 2YQJA 4B5BA 5EJ1A 1TZFA 4DE7A 3F1YA 5CMJA 5AJPA 1EYRA 3IOJA 4Y7GA 4P00A 4D48A 3RMVA 5L6SA 1ZJ2A 2Y4MA 3OKRA 3OH2A 1R82A 3SX5A 3TQDA 5FV9A 1KWSA 1E5KA 3QVBA 4AC3A 1NF5B 2VS3A 4HG6A 4JISA 2P72A 2RIYA 3U0XA 1H5TA 5IFYA 4HO3A 1WT2A 2V0LA 3OH1A 2J0BA 2OEFA 4KXOA 1ZI4A 3Q4SA 5C4BA 1PZYB 3I0HA 2Q4JA 2V0HA 4CJ8A 4ZDQA 1ZJ3A 2V0IA 4EEAA 1VZTA 5AJNA 2WE9A 5DDVA 2FYBA 1ON6A 3IOIA 5C4CA 2NXVA 1G93A 5BXCA 2YQCA 1WT1A 2BO8A 3N9WA 1VH1A 5J49A 4M4KA 1NQIB 2O1HA 1O7QA 4MYBA 4Y7VA 2OI7A 4L41C 4FRDA 3V91A 3FOQA 3PKPA 2YCMA 5C3AA 5C3DA 4HCQA 4GBPA 2VXLA 4HO2A 3BCVA 1LZ7A 1H7GA 3DK5A 1WVCA 3SX3A 1V83A 1FG5N 2XWLA 4K6RA 3TZTA 3V0MA 2QH5A 1W55A 3SPTA 2Z86A 3FWWA 3OH0A 2X5ZA 2FYAA 4D11C 1H4CA 1YP2A 1FXOA 1H3MA 4M2AA 3V0QA 3JTJA 4UEGA 1XZ6A 1K4VA 4FRQA 2OI5A 1NMMB 2VSIA 1GX0A 5IDTA 1ZJOA 1JV3A 3JUJA 4NALA 4E1KA 1H5SC 2D7IA 3I0DA 3EE5A 2D0JA 4BMAA 1H5RA 2RIXA 4AYJA 2O1GA 2VK9A 4Q7CA 4KT7A 2BO7A 1W57A 1R7YA 1OQMB 1XHBA 4B4MA 4B2XA 1QWJA 1OMXA 2VSHA 3I0IX 3Q7UA 1YROB 1GX4A 1FGGA 1ON8A 2RJ6A 5CMIA 3OAMA 4FCUA 2C0NA 5D91A 1R7TA 1VZUA 1FZWA 1LZ0A 3K8EA 2X65A 2RITA 2XWMA 4ASJA 1NWGB 1HM9A 1JVGA 1GA8A
chains in the Genus database with same CATH topology
1FOAA 1ZHJA 1ZI1A 3CKQA 1VPAA 4G3PA 5JQQA 4FRAA 5AJOA 3U0YA 3U2UA 2P6WA 5EJZA 2QGIA 3D5NA 2A8WA 2AM3A 3LW6A 1VH3A 1VGZA 2W0VA 1H5TB 3ZGGA 3OC9A 5CQMX 2DPWA 1HV9A 4M2BA 2D7RA 1VGTA 4Y63A 3Q80A 2UX8A 2AM4A 1GWVA 1ZJ1A 4YS8A 4KQLA 4EEOA 1ZCYA 4KNXA 1H7LA 1SS9A 1FRWA 3OH3A 4D11A 1INJA 1MP4A 2V0KA 3R2WA 4CJCA 4EVWA 3SXDA 2GGOA 4MNDA 2ICYA 1LVWA 1O7OA 4ARWA 4O6MA 4J18A 5C1LA 1H5SA 2AGDA 4HO5A 5C47A 3ZGFA 4CVHA 2ZU8A 2Y6PA 3SX7A 5C4DA 3SXAA 4FRMA 1S4OA 3V90A 2XWNA 5C4FA 1TW5A 2X60A 2JCKA 3IOHA 2RJ0A 2RJ7A 2WVKA 2PA4A 3POLA 1JYLA 2YQHA 1H5SD 1NKHB 5CMGX 3T7NA 4FRBA 3E25A 5C8RA 3CKVA 1LL0A 1YP4A 2J0AA 2AM5A 2Y4JA 1H5RB 1JVDA 1HM0A 2RJ1A 4EEGA 1EZIA 1GWWA 4CJBA 1ZDGA 4HOCA 4Y9XA 1LZJA 1YP3A 2P73A 2RJ5A 2XMHA 4FRLA 4KNRA 4Y7FA 3T7MA 3JUKA 1MC3A 3V0PA 4B2WA 1I52A 4FREA 2FY7A 2AH9A 4KC2A 2AECA 4Y62A 2XMEA 1R7UA 4FIXA 3I0EA 2APCA 4Y6UA 5CMHA 1HJJA 1LZIA 2OEGA 1VGUA 4R7PA 1WT0A 1OMZA 4M28A 5CQPA 2VXMA 1ZCTA 1S4PA 3U2VA 3O3PA 4ASYA 1FO9A 4Y6NA 2YC3A 3DUVA 3V0OA 4FIYA 5CQNX 3GUEA 1ZIZA 1W77A 4EE5A 4P02A 3F1CA 1HM8A 2WGZA 3CKNA 4Y64A 4LW3A 3RSBA 2ZU7A 4BQHA 1WT3A 2WVMA 4NAIA 5FU8A 3K8DA 4G87A 3SXCA 1JYKA 5C1GA 1V84A 2E8BA 4KPZA 3SXGA 2QKXA 4HO0A 4B4GA 1ZCUA 1G23A 5FTSA 4LW6A 1NHEB 3V8ZA 3V8YA 1HJLA 1O0RA 2I5KA 2WVLA 1H5SB 1PZTA 1WSZA 3CU0A 4IRPA 2WAWA 3I0KA 4AAWA 1MP5A 4EE3A 1G0RA 1G97A 3OH4A 5DDTA 4XWIA 3U2XA 1VM8A 4D0ZA 5CMFX 3D8VA 2OI6A 4FRHA 2AESA 1QGSA 3CGXA 4KPXA 2JCOA 2ICXA 3I0CA 2PGYA 1G8OA 4EEMA 1MP3A 1G9RA 2AE7A 2FYDB 1JV1A 4HO4A 3NGWA 5C48A 1FR8A 4FQWA 1S4NA 1Z90A 3D98A 1R81A 2JCJA 3CKJA 4KC1A 1O23B 5FYEA 2A8UA 2W0WA 3I0JA 5FTVA 2RJ4A 2FYCB 1VZXA 5C36A 4HO9A 3T7OA 3I0LA 4NANA 4Y7UA 3ST8A 1QGQA 3USQA 3USRA 2E3DA 1H4DA 1ZDFA 3U2WA 4DECA 4HO6A 2JCLA 3SXEA 2Z87A 2X5SA 1FGXA 1G3LA 4D0TA 4AYLA 2YQSA 4EE4A 1R7VA 2GGQA 5C38A 5C4EA 4KRVA 4DDZA 1R7XA 2O1FA 1LL3A 3KIAA 4G3SA 2CU2A 2VD4A 3ZLKA 4B3UA 1IINA 4IRQA 3DJ4A 5L6VA 3HL3A 2I7BA 1G95A 1VICA 2BO4A 1INIA 1ZJ0A 5FU0A 1H7TA 5FUHA 1FR9A 1FO8A 3I0GA 5D92A 4B4BA 3PKQA 5C49A 2VS5A 3R3IA 1IIMA 3OGZA 1ZJPA 4FROA 4NAKA 1H4EA 1QG8A 1G2VA 1ZI5A 2YESA 1H7QA 4FRPA 3SX8A 2MZBA 4FCEA 1H7HA 1R80A 2Y4KA 1ZI3A 4HO8A 4B42A 3PNNA 3V0NA 1V82A 4C2SA 5C3BA 3RMWA 2V0JA 3U2TA 5EIYA 3E26A 4MIXA 1VGWA 2YC5A 1ZCVA 3ZF8A 2BO6A 4O6NA 5IDSA 3V0LA 3I0FA 1TW1A 2RIZA 2I5EA 2RJ9A 1GQCA 1FXJA 2FFUA 3CKOA 3SXBA 2Y4LA 4G3QA 2PX7A 2FFVA 2PGVA 2RJ8A 2VS4A 2VFZA 2Y7AA 1LL2A 1GQ9A 4KC4A 1G1LA 1H7EA 1TVYA 4JD0A 4ECMA 1H7FA 2WEEA 5CQLX 3ZLLA 4Y7TA 5CQOA 2ZU9A 3BRKX 5I1FA 5HS2A 5C1HA 1FWYA 2YQJA 4B5BA 5EJ1A 1TZFA 4DE7A 3F1YA 5CMJA 5AJPA 1EYRA 3IOJA 4Y7GA 4P00A 4D48A 3RMVA 5L6SA 1ZJ2A 2Y4MA 3OKRA 3OH2A 1R82A 3SX5A 3TQDA 5FV9A 1KWSA 1E5KA 3QVBA 4AC3A 1NF5B 2VS3A 4HG6A 4JISA 2P72A 2RIYA 3U0XA 1H5TA 5IFYA 4HO3A 1WT2A 2V0LA 3OH1A 2J0BA 2OEFA 4KXOA 1ZI4A 3Q4SA 5C4BA 1PZYB 3I0HA 2Q4JA 2V0HA 4CJ8A 4ZDQA 1ZJ3A 2V0IA 4EEAA 1VZTA 5AJNA 2WE9A 5DDVA 2FYBA 1ON6A 3IOIA 5C4CA 2NXVA 1G93A 5BXCA 2YQCA 1WT1A 2BO8A 3N9WA 1VH1A 5J49A 4M4KA 1NQIB 2O1HA 1O7QA 4MYBA 4Y7VA 2OI7A 4L41C 4FRDA 3V91A 3FOQA 3PKPA 2YCMA 5C3AA 5C3DA 4HCQA 4GBPA 2VXLA 4HO2A 3BCVA 1LZ7A 1H7GA 3DK5A 1WVCA 3SX3A 1V83A 1FG5N 2XWLA 4K6RA 3TZTA 3V0MA 2QH5A 1W55A 3SPTA 2Z86A 3FWWA 3OH0A 2X5ZA 2FYAA 4D11C 1H4CA 1YP2A 1FXOA 1H3MA 4M2AA 3V0QA 3JTJA 4UEGA 1XZ6A 1K4VA 4FRQA 2OI5A 1NMMB 2VSIA 1GX0A 5IDTA 1ZJOA 1JV3A 3JUJA 4NALA 4E1KA 1H5SC 2D7IA 3I0DA 3EE5A 2D0JA 4BMAA 1H5RA 2RIXA 4AYJA 2O1GA 2VK9A 4Q7CA 4KT7A 2BO7A 1W57A 1R7YA 1OQMB 1XHBA 4B4MA 4B2XA 1QWJA 1OMXA 2VSHA 3I0IX 3Q7UA 1YROB 1GX4A 1FGGA 1ON8A 2RJ6A 5CMIA 3OAMA 4FCUA 2C0NA 5D91A 1R7TA 1VZUA 1FZWA 1LZ0A 3K8EA 2X65A 2RITA 2XWMA 4ASJA 1NWGB 1HM9A 1JVGA 1GA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOA A;  1ZHJ A;  1ZI1 A;  3CKQ A;  1VPA A;  4G3P A;  5JQQ A;  4FRA A;  5AJO A;  3U0Y A;  3U2U A;  2P6W A;  5EJZ A;  2QGI A;  3D5N A;  2A8W A;  2AM3 A;  3LW6 A;  1VH3 A;  1VGZ A;  2W0V A;  1H5T B;  3ZGG A;  3OC9 A;  5CQM X;  2DPW A;  1HV9 A;  4M2B A;  2D7R A;  1VGT A;  4Y63 A;  3Q80 A;  2UX8 A;  2AM4 A;  1GWV A;  1ZJ1 A;  4YS8 A;  4KQL A;  4EEO A;  1ZCY A;  4KNX A;  1H7L A;  1SS9 A;  1FRW A;  3OH3 A;  4D11 A;  1INJ A;  1MP4 A;  2V0K A;  3R2W A;  4CJC A;  4EVW A;  3SXD A;  2GGO A;  4MND A;  2ICY A;  1LVW A;  1O7O A;  4ARW A;  4J18 A;  5C1L A;  1H5S A;  2AGD A;  4HO5 A;  5C47 A;  3ZGF A;  4CVH A;  2ZU8 A;  2Y6P A;  3SX7 A;  5C4D A;  3SXA A;  4FRM A;  1S4O A;  3V90 A;  2XWN A;  5C4F A;  1TW5 A;  2X60 A;  2JCK A;  3IOH A;  2RJ0 A;  2RJ7 A;  2WVK A;  2PA4 A;  3POL A;  1JYL A;  2YQH A;  1H5S D;  1NKH B;  5CMG X;  3T7N A;  4FRB A;  3E25 A;  5C8R A;  1LL0 A;  1YP4 A;  3CKV A;  2AM5 A;  2Y4J A;  1H5R B;  1JVD A;  1HM0 A;  2RJ1 A;  4EEG A;  1EZI A;  1GWW A;  4CJB A;  1ZDG A;  4HOC A;  4Y9X A;  1LZJ A;  1YP3 A;  2P73 A;  2RJ5 A;  2XMH A;  4FRL A;  4KNR A;  4Y7F A;  3T7M A;  3JUK A;  1MC3 A;  3V0P A;  4B2W A;  1I52 A;  4FRE A;  2FY7 A;  2AH9 A;  4KC2 A;  2AEC A;  4Y62 A;  2XME A;  1R7U A;  3I0E A;  2APC A;  4Y6U A;  5CMH A;  1HJJ A;  1LZI A;  2OEG A;  1VGU A;  4R7P A;  1WT0 A;  1OMZ A;  4M28 A;  5CQP A;  2VXM A;  1ZCT A;  1S4P A;  3U2V A;  3O3P A;  4ASY A;  1FO9 A;  4Y6N A;  2YC3 A;  3DUV A;  3V0O A;  5CQN X;  3GUE A;  1ZIZ A;  1W77 A;  4EE5 A;  4P02 A;  3F1C A;  1HM8 A;  2WGZ A;  3CKN A;  4Y64 A;  4LW3 A;  3RSB A;  2ZU7 A;  4BQH A;  1WT3 A;  2WVM A;  4NAI A;  5FU8 A;  3K8D A;  4G87 A;  3SXC A;  1JYK A;  5C1G A;  1V84 A;  2E8B A;  4KPZ A;  3SXG A;  2QKX A;  4HO0 A;  4B4G A;  1ZCU A;  1G23 A;  5FTS A;  4LW6 A;  1NHE B;  3V8Z A;  3V8Y A;  1HJL A;  1O0R A;  2I5K A;  2WVL A;  1H5S B;  1PZT A;  1WSZ A;  3CU0 A;  4IRP A;  2WAW A;  3I0K A;  4AAW A;  1MP5 A;  4EE3 A;  1G0R A;  1G97 A;  3OH4 A;  5DDT A;  4XWI A;  3U2X A;  1VM8 A;  4D0Z A;  5CMF X;  3D8V A;  2OI6 A;  4FRH A;  2AES A;  1QGS A;  3CGX A;  4KPX A;  2JCO A;  2ICX A;  3I0C A;  2PGY A;  1G8O A;  4EEM A;  1MP3 A;  1G9R A;  2AE7 A;  2FYD B;  1JV1 A;  4HO4 A;  3NGW A;  5C48 A;  1FR8 A;  4FQW A;  1S4N A;  1Z90 A;  3D98 A;  1R81 A;  2JCJ A;  3CKJ A;  4KC1 A;  1O23 B;  5FYE A;  2A8U A;  2W0W A;  3I0J A;  5FTV A;  2RJ4 A;  2FYC B;  1VZX A;  5C36 A;  4HO9 A;  3T7O A;  3I0L A;  4NAN A;  4Y7U A;  3ST8 A;  1QGQ A;  3USQ A;  3USR A;  2E3D A;  1H4D A;  1ZDF A;  3U2W A;  4DEC A;  4HO6 A;  2JCL A;  3SXE A;  2Z87 A;  2X5S A;  1FGX A;  1G3L A;  4D0T A;  4AYL A;  2YQS A;  4EE4 A;  1R7V A;  2GGQ A;  5C38 A;  5C4E A;  4KRV A;  4DDZ A;  1R7X A;  2O1F A;  1LL3 A;  3KIA A;  4G3S A;  2CU2 A;  2VD4 A;  3ZLK A;  4B3U A;  1IIN A;  4IRQ A;  3DJ4 A;  5L6V A;  3HL3 A;  2I7B A;  1G95 A;  1VIC A;  2BO4 A;  1INI A;  1ZJ0 A;  5FU0 A;  1H7T A;  5FUH A;  1FR9 A;  1FO8 A;  3I0G A;  4B4B A;  3PKQ A;  5C49 A;  2VS5 A;  3R3I A;  1IIM A;  3OGZ A;  1ZJP A;  4FRO A;  4NAK A;  1H4E A;  1QG8 A;  1G2V A;  1ZI5 A;  2YES A;  1H7Q A;  4FRP A;  3SX8 A;  2MZB A;  4FCE A;  1H7H A;  1R80 A;  2Y4K A;  1ZI3 A;  4HO8 A;  4B42 A;  3PNN A;  3V0N A;  1V82 A;  4C2S A;  5C3B A;  3RMW A;  2V0J A;  3U2T A;  5EIY A;  3E26 A;  1VGW A;  2YC5 A;  1ZCV A;  3ZF8 A;  2BO6 A;  5IDS A;  3V0L A;  3I0F A;  1TW1 A;  2RIZ A;  2I5E A;  2RJ9 A;  1GQC A;  1FXJ A;  2FFU A;  3CKO A;  3SXB A;  2Y4L A;  4G3Q A;  2PX7 A;  2FFV A;  2PGV A;  2RJ8 A;  2VS4 A;  2VFZ A;  2Y7A A;  1LL2 A;  1GQ9 A;  4KC4 A;  1G1L A;  1H7E A;  1TVY A;  4JD0 A;  4ECM A;  1H7F A;  2WEE A;  5CQL X;  3ZLL A;  4Y7T A;  5CQO A;  2ZU9 A;  3BRK X;  5I1F A;  5HS2 A;  5C1H A;  1FWY A;  2YQJ A;  4B5B A;  5EJ1 A;  1TZF A;  4DE7 A;  3F1Y A;  5CMJ A;  5AJP A;  1EYR A;  3IOJ A;  4Y7G A;  4P00 A;  4D48 A;  3RMV A;  5L6S A;  1ZJ2 A;  2Y4M A;  3OKR A;  3OH2 A;  1R82 A;  3SX5 A;  3TQD A;  5FV9 A;  1KWS A;  1E5K A;  3QVB A;  4AC3 A;  1NF5 B;  2VS3 A;  4HG6 A;  4JIS A;  2P72 A;  2RIY A;  3U0X A;  1H5T A;  5IFY A;  4HO3 A;  1WT2 A;  2V0L A;  3OH1 A;  2OEF A;  4KXO A;  1ZI4 A;  3Q4S A;  5C4B A;  1PZY B;  3I0H A;  2Q4J A;  2V0H A;  4CJ8 A;  4ZDQ A;  1ZJ3 A;  2V0I A;  4EEA A;  1VZT A;  5AJN A;  2WE9 A;  5DDV A;  2FYB A;  1ON6 A;  3IOI A;  5C4C A;  2NXV A;  1G93 A;  5BXC A;  2YQC A;  1WT1 A;  2BO8 A;  3N9W A;  1VH1 A;  5J49 A;  4M4K A;  1NQI B;  2O1H A;  1O7Q A;  4MYB A;  4Y7V A;  2OI7 A;  4L41 C;  4FRD A;  3V91 A;  3FOQ A;  3PKP A;  2YCM A;  5C3A A;  5C3D A;  4HCQ A;  4GBP A;  2VXL A;  4HO2 A;  3BCV A;  1LZ7 A;  1H7G A;  3DK5 A;  1WVC A;  3SX3 A;  1V83 A;  1FG5 N;  2XWL A;  4K6R A;  3TZT A;  3V0M A;  2QH5 A;  1W55 A;  3SPT A;  2Z86 A;  3FWW A;  3OH0 A;  2X5Z A;  2FYA A;  4D11 C;  1H4C A;  1YP2 A;  1FXO A;  1H3M A;  4M2A A;  3V0Q A;  3JTJ A;  4UEG A;  1XZ6 A;  1K4V A;  4FRQ A;  2OI5 A;  1NMM B;  2VSI A;  1GX0 A;  5IDT A;  1ZJO A;  1JV3 A;  3JUJ A;  4NAL A;  4E1K A;  1H5S C;  2D7I A;  3I0D A;  3EE5 A;  2D0J A;  4BMA A;  1H5R A;  2RIX A;  4AYJ A;  2O1G A;  4KT7 A;  2BO7 A;  1W57 A;  1R7Y A;  1OQM B;  1XHB A;  4B4M A;  4B2X A;  1QWJ A;  1OMX A;  2VSH A;  3I0I X;  3Q7U A;  1YRO B;  1GX4 A;  1FGG A;  1ON8 A;  2RJ6 A;  5CMI A;  3OAM A;  4FCU A;  1R7T A;  1VZU A;  1FZW A;  1LZ0 A;  3K8E A;  2X65 A;  2RIT A;  2XWM A;  4ASJ A;  1NWG B;  1HM9 A;  1JVG A;  1GA8 A; 
#chains in the Genus database with same CATH topology
 1FOA A;  1ZHJ A;  1ZI1 A;  3CKQ A;  1VPA A;  4G3P A;  5JQQ A;  4FRA A;  5AJO A;  3U0Y A;  3U2U A;  2P6W A;  5EJZ A;  2QGI A;  3D5N A;  2A8W A;  2AM3 A;  3LW6 A;  1VH3 A;  1VGZ A;  2W0V A;  1H5T B;  3ZGG A;  3OC9 A;  5CQM X;  2DPW A;  1HV9 A;  4M2B A;  2D7R A;  1VGT A;  4Y63 A;  3Q80 A;  2UX8 A;  2AM4 A;  1GWV A;  1ZJ1 A;  4YS8 A;  4KQL A;  4EEO A;  1ZCY A;  4KNX A;  1H7L A;  1SS9 A;  1FRW A;  3OH3 A;  4D11 A;  1INJ A;  1MP4 A;  2V0K A;  3R2W A;  4CJC A;  4EVW A;  3SXD A;  2GGO A;  4MND A;  2ICY A;  1LVW A;  1O7O A;  4ARW A;  4O6M A;  4J18 A;  5C1L A;  1H5S A;  2AGD A;  4HO5 A;  5C47 A;  3ZGF A;  4CVH A;  2ZU8 A;  2Y6P A;  3SX7 A;  5C4D A;  3SXA A;  4FRM A;  1S4O A;  3V90 A;  2XWN A;  5C4F A;  1TW5 A;  2X60 A;  2JCK A;  3IOH A;  2RJ0 A;  2RJ7 A;  2WVK A;  2PA4 A;  3POL A;  1JYL A;  2YQH A;  1H5S D;  1NKH B;  5CMG X;  3T7N A;  4FRB A;  3E25 A;  5C8R A;  3CKV A;  1LL0 A;  1YP4 A;  2J0A A;  2AM5 A;  2Y4J A;  1H5R B;  1JVD A;  1HM0 A;  2RJ1 A;  4EEG A;  1EZI A;  1GWW A;  4CJB A;  1ZDG A;  4HOC A;  4Y9X A;  1LZJ A;  1YP3 A;  2P73 A;  2RJ5 A;  2XMH A;  4FRL A;  4KNR A;  4Y7F A;  3T7M A;  3JUK A;  1MC3 A;  3V0P A;  4B2W A;  1I52 A;  4FRE A;  2FY7 A;  2AH9 A;  4KC2 A;  2AEC A;  4Y62 A;  2XME A;  1R7U A;  4FIX A;  3I0E A;  2APC A;  4Y6U A;  5CMH A;  1HJJ A;  1LZI A;  2OEG A;  1VGU A;  4R7P A;  1WT0 A;  1OMZ A;  4M28 A;  5CQP A;  2VXM A;  1ZCT A;  1S4P A;  3U2V A;  3O3P A;  4ASY A;  1FO9 A;  4Y6N A;  2YC3 A;  3DUV A;  3V0O A;  4FIY A;  5CQN X;  3GUE A;  1ZIZ A;  1W77 A;  4EE5 A;  4P02 A;  3F1C A;  1HM8 A;  2WGZ A;  3CKN A;  4Y64 A;  4LW3 A;  3RSB A;  2ZU7 A;  4BQH A;  1WT3 A;  2WVM A;  4NAI A;  5FU8 A;  3K8D A;  4G87 A;  3SXC A;  1JYK A;  5C1G A;  1V84 A;  2E8B A;  4KPZ A;  3SXG A;  2QKX A;  4HO0 A;  4B4G A;  1ZCU A;  1G23 A;  5FTS A;  4LW6 A;  1NHE B;  3V8Z A;  3V8Y A;  1HJL A;  1O0R A;  2I5K A;  2WVL A;  1H5S B;  1PZT A;  1WSZ A;  3CU0 A;  4IRP A;  2WAW A;  3I0K A;  4AAW A;  1MP5 A;  4EE3 A;  1G0R A;  1G97 A;  3OH4 A;  5DDT A;  4XWI A;  3U2X A;  1VM8 A;  4D0Z A;  5CMF X;  3D8V A;  2OI6 A;  4FRH A;  2AES A;  1QGS A;  3CGX A;  4KPX A;  2JCO A;  2ICX A;  3I0C A;  2PGY A;  1G8O A;  4EEM A;  1MP3 A;  1G9R A;  2AE7 A;  2FYD B;  1JV1 A;  4HO4 A;  3NGW A;  5C48 A;  1FR8 A;  4FQW A;  1S4N A;  1Z90 A;  3D98 A;  1R81 A;  2JCJ A;  3CKJ A;  4KC1 A;  1O23 B;  5FYE A;  2A8U A;  2W0W A;  3I0J A;  5FTV A;  2RJ4 A;  2FYC B;  1VZX A;  5C36 A;  4HO9 A;  3T7O A;  3I0L A;  4NAN A;  4Y7U A;  3ST8 A;  1QGQ A;  3USQ A;  3USR A;  2E3D A;  1H4D A;  1ZDF A;  3U2W A;  4DEC A;  4HO6 A;  2JCL A;  3SXE A;  2Z87 A;  2X5S A;  1FGX A;  1G3L A;  4D0T A;  4AYL A;  2YQS A;  4EE4 A;  1R7V A;  2GGQ A;  5C38 A;  5C4E A;  4KRV A;  4DDZ A;  1R7X A;  2O1F A;  1LL3 A;  3KIA A;  4G3S A;  2CU2 A;  2VD4 A;  3ZLK A;  4B3U A;  1IIN A;  4IRQ A;  3DJ4 A;  5L6V A;  3HL3 A;  2I7B A;  1G95 A;  1VIC A;  2BO4 A;  1INI A;  1ZJ0 A;  5FU0 A;  1H7T A;  5FUH A;  1FR9 A;  1FO8 A;  3I0G A;  5D92 A;  4B4B A;  3PKQ A;  5C49 A;  2VS5 A;  3R3I A;  1IIM A;  3OGZ A;  1ZJP A;  4FRO A;  4NAK A;  1H4E A;  1QG8 A;  1G2V A;  1ZI5 A;  2YES A;  1H7Q A;  4FRP A;  3SX8 A;  2MZB A;  4FCE A;  1H7H A;  1R80 A;  2Y4K A;  1ZI3 A;  4HO8 A;  4B42 A;  3PNN A;  3V0N A;  1V82 A;  4C2S A;  5C3B A;  3RMW A;  2V0J A;  3U2T A;  5EIY A;  3E26 A;  4MIX A;  1VGW A;  2YC5 A;  1ZCV A;  3ZF8 A;  2BO6 A;  4O6N A;  5IDS A;  3V0L A;  3I0F A;  1TW1 A;  2RIZ A;  2I5E A;  2RJ9 A;  1GQC A;  1FXJ A;  2FFU A;  3CKO A;  3SXB A;  2Y4L A;  4G3Q A;  2PX7 A;  2FFV A;  2PGV A;  2RJ8 A;  2VS4 A;  2VFZ A;  2Y7A A;  1LL2 A;  1GQ9 A;  4KC4 A;  1G1L A;  1H7E A;  1TVY A;  4JD0 A;  4ECM A;  1H7F A;  2WEE A;  5CQL X;  3ZLL A;  4Y7T A;  5CQO A;  2ZU9 A;  3BRK X;  5I1F A;  5HS2 A;  5C1H A;  1FWY A;  2YQJ A;  4B5B A;  5EJ1 A;  1TZF A;  4DE7 A;  3F1Y A;  5CMJ A;  5AJP A;  1EYR A;  3IOJ A;  4Y7G A;  4P00 A;  4D48 A;  3RMV A;  5L6S A;  1ZJ2 A;  2Y4M A;  3OKR A;  3OH2 A;  1R82 A;  3SX5 A;  3TQD A;  5FV9 A;  1KWS A;  1E5K A;  3QVB A;  4AC3 A;  1NF5 B;  2VS3 A;  4HG6 A;  4JIS A;  2P72 A;  2RIY A;  3U0X A;  1H5T A;  5IFY A;  4HO3 A;  1WT2 A;  2V0L A;  3OH1 A;  2J0B A;  2OEF A;  4KXO A;  1ZI4 A;  3Q4S A;  5C4B A;  1PZY B;  3I0H A;  2Q4J A;  2V0H A;  4CJ8 A;  4ZDQ A;  1ZJ3 A;  2V0I A;  4EEA A;  1VZT A;  5AJN A;  2WE9 A;  5DDV A;  2FYB A;  1ON6 A;  3IOI A;  5C4C A;  2NXV A;  1G93 A;  5BXC A;  2YQC A;  1WT1 A;  2BO8 A;  3N9W A;  1VH1 A;  5J49 A;  4M4K A;  1NQI B;  2O1H A;  1O7Q A;  4MYB A;  4Y7V A;  2OI7 A;  4L41 C;  4FRD A;  3V91 A;  3FOQ A;  3PKP A;  2YCM A;  5C3A A;  5C3D A;  4HCQ A;  4GBP A;  2VXL A;  4HO2 A;  3BCV A;  1LZ7 A;  1H7G A;  3DK5 A;  1WVC A;  3SX3 A;  1V83 A;  1FG5 N;  2XWL A;  4K6R A;  3TZT A;  3V0M A;  2QH5 A;  1W55 A;  3SPT A;  2Z86 A;  3FWW A;  3OH0 A;  2X5Z A;  2FYA A;  4D11 C;  1H4C A;  1YP2 A;  1FXO A;  1H3M A;  4M2A A;  3V0Q A;  3JTJ A;  4UEG A;  1XZ6 A;  1K4V A;  4FRQ A;  2OI5 A;  1NMM B;  2VSI A;  1GX0 A;  5IDT A;  1ZJO A;  1JV3 A;  3JUJ A;  4NAL A;  4E1K A;  1H5S C;  2D7I A;  3I0D A;  3EE5 A;  2D0J A;  4BMA A;  1H5R A;  2RIX A;  4AYJ A;  2O1G A;  2VK9 A;  4Q7C A;  4KT7 A;  2BO7 A;  1W57 A;  1R7Y A;  1OQM B;  1XHB A;  4B4M A;  4B2X A;  1QWJ A;  1OMX A;  2VSH A;  3I0I X;  3Q7U A;  1YRO B;  1GX4 A;  1FGG A;  1ON8 A;  2RJ6 A;  5CMI A;  3OAM A;  4FCU A;  2C0N A;  5D91 A;  1R7T A;  1VZU A;  1FZW A;  1LZ0 A;  3K8E A;  2X65 A;  2RIT A;  2XWM A;  4ASJ A;  1NWG B;  1HM9 A;  1JVG A;  1GA8 A; 
#chains in the Genus database with same CATH homology
 1FOA A;  1ZHJ A;  1ZI1 A;  3CKQ A;  1VPA A;  4G3P A;  5JQQ A;  4FRA A;  5AJO A;  3U0Y A;  3U2U A;  2P6W A;  5EJZ A;  2QGI A;  3D5N A;  2A8W A;  2AM3 A;  3LW6 A;  1VH3 A;  1VGZ A;  2W0V A;  1H5T B;  3ZGG A;  3OC9 A;  5CQM X;  2DPW A;  1HV9 A;  4M2B A;  2D7R A;  1VGT A;  4Y63 A;  3Q80 A;  2UX8 A;  2AM4 A;  1GWV A;  1ZJ1 A;  4YS8 A;  4KQL A;  4EEO A;  1ZCY A;  4KNX A;  1H7L A;  1SS9 A;  1FRW A;  3OH3 A;  4D11 A;  1INJ A;  1MP4 A;  2V0K A;  3R2W A;  4CJC A;  4EVW A;  3SXD A;  2GGO A;  4MND A;  2ICY A;  1LVW A;  1O7O A;  4ARW A;  4O6M A;  4J18 A;  5C1L A;  1H5S A;  2AGD A;  4HO5 A;  5C47 A;  3ZGF A;  4CVH A;  2ZU8 A;  2Y6P A;  3SX7 A;  5C4D A;  3SXA A;  4FRM A;  1S4O A;  3V90 A;  2XWN A;  5C4F A;  1TW5 A;  2X60 A;  2JCK A;  3IOH A;  2RJ0 A;  2RJ7 A;  2WVK A;  2PA4 A;  3POL A;  1JYL A;  2YQH A;  1H5S D;  1NKH B;  5CMG X;  3T7N A;  4FRB A;  3E25 A;  5C8R A;  3CKV A;  1LL0 A;  1YP4 A;  2J0A A;  2AM5 A;  2Y4J A;  1H5R B;  1JVD A;  1HM0 A;  2RJ1 A;  4EEG A;  1EZI A;  1GWW A;  4CJB A;  1ZDG A;  4HOC A;  4Y9X A;  1LZJ A;  1YP3 A;  2P73 A;  2RJ5 A;  2XMH A;  4FRL A;  4KNR A;  4Y7F A;  3T7M A;  3JUK A;  1MC3 A;  3V0P A;  4B2W A;  1I52 A;  4FRE A;  2FY7 A;  2AH9 A;  4KC2 A;  2AEC A;  4Y62 A;  2XME A;  1R7U A;  4FIX A;  3I0E A;  2APC A;  4Y6U A;  5CMH A;  1HJJ A;  1LZI A;  2OEG A;  1VGU A;  4R7P A;  1WT0 A;  1OMZ A;  4M28 A;  5CQP A;  2VXM A;  1ZCT A;  1S4P A;  3U2V A;  3O3P A;  4ASY A;  1FO9 A;  4Y6N A;  2YC3 A;  3DUV A;  3V0O A;  4FIY A;  5CQN X;  3GUE A;  1ZIZ A;  1W77 A;  4EE5 A;  4P02 A;  3F1C A;  1HM8 A;  2WGZ A;  3CKN A;  4Y64 A;  4LW3 A;  3RSB A;  2ZU7 A;  4BQH A;  1WT3 A;  2WVM A;  4NAI A;  5FU8 A;  3K8D A;  4G87 A;  3SXC A;  1JYK A;  5C1G A;  1V84 A;  2E8B A;  4KPZ A;  3SXG A;  2QKX A;  4HO0 A;  4B4G A;  1ZCU A;  1G23 A;  5FTS A;  4LW6 A;  1NHE B;  3V8Z A;  3V8Y A;  1HJL A;  1O0R A;  2I5K A;  2WVL A;  1H5S B;  1PZT A;  1WSZ A;  3CU0 A;  4IRP A;  2WAW A;  3I0K A;  4AAW A;  1MP5 A;  4EE3 A;  1G0R A;  1G97 A;  3OH4 A;  5DDT A;  4XWI A;  3U2X A;  1VM8 A;  4D0Z A;  5CMF X;  3D8V A;  2OI6 A;  4FRH A;  2AES A;  1QGS A;  3CGX A;  4KPX A;  2JCO A;  2ICX A;  3I0C A;  2PGY A;  1G8O A;  4EEM A;  1MP3 A;  1G9R A;  2AE7 A;  2FYD B;  1JV1 A;  4HO4 A;  3NGW A;  5C48 A;  1FR8 A;  4FQW A;  1S4N A;  1Z90 A;  3D98 A;  1R81 A;  2JCJ A;  3CKJ A;  4KC1 A;  1O23 B;  5FYE A;  2A8U A;  2W0W A;  3I0J A;  5FTV A;  2RJ4 A;  2FYC B;  1VZX A;  5C36 A;  4HO9 A;  3T7O A;  3I0L A;  4NAN A;  4Y7U A;  3ST8 A;  1QGQ A;  3USQ A;  3USR A;  2E3D A;  1H4D A;  1ZDF A;  3U2W A;  4DEC A;  4HO6 A;  2JCL A;  3SXE A;  2Z87 A;  2X5S A;  1FGX A;  1G3L A;  4D0T A;  4AYL A;  2YQS A;  4EE4 A;  1R7V A;  2GGQ A;  5C38 A;  5C4E A;  4KRV A;  4DDZ A;  1R7X A;  2O1F A;  1LL3 A;  3KIA A;  4G3S A;  2CU2 A;  2VD4 A;  3ZLK A;  4B3U A;  1IIN A;  4IRQ A;  3DJ4 A;  5L6V A;  3HL3 A;  2I7B A;  1G95 A;  1VIC A;  2BO4 A;  1INI A;  1ZJ0 A;  5FU0 A;  1H7T A;  5FUH A;  1FR9 A;  1FO8 A;  3I0G A;  5D92 A;  4B4B A;  3PKQ A;  5C49 A;  2VS5 A;  3R3I A;  1IIM A;  3OGZ A;  1ZJP A;  4FRO A;  4NAK A;  1H4E A;  1QG8 A;  1G2V A;  1ZI5 A;  2YES A;  1H7Q A;  4FRP A;  3SX8 A;  2MZB A;  4FCE A;  1H7H A;  1R80 A;  2Y4K A;  1ZI3 A;  4HO8 A;  4B42 A;  3PNN A;  3V0N A;  1V82 A;  4C2S A;  5C3B A;  3RMW A;  2V0J A;  3U2T A;  5EIY A;  3E26 A;  4MIX A;  1VGW A;  2YC5 A;  1ZCV A;  3ZF8 A;  2BO6 A;  4O6N A;  5IDS A;  3V0L A;  3I0F A;  1TW1 A;  2RIZ A;  2I5E A;  2RJ9 A;  1GQC A;  1FXJ A;  2FFU A;  3CKO A;  3SXB A;  2Y4L A;  4G3Q A;  2PX7 A;  2FFV A;  2PGV A;  2RJ8 A;  2VS4 A;  2VFZ A;  2Y7A A;  1LL2 A;  1GQ9 A;  4KC4 A;  1G1L A;  1H7E A;  1TVY A;  4JD0 A;  4ECM A;  1H7F A;  2WEE A;  5CQL X;  3ZLL A;  4Y7T A;  5CQO A;  2ZU9 A;  3BRK X;  5I1F A;  5HS2 A;  5C1H A;  1FWY A;  2YQJ A;  4B5B A;  5EJ1 A;  1TZF A;  4DE7 A;  3F1Y A;  5CMJ A;  5AJP A;  1EYR A;  3IOJ A;  4Y7G A;  4P00 A;  4D48 A;  3RMV A;  5L6S A;  1ZJ2 A;  2Y4M A;  3OKR A;  3OH2 A;  1R82 A;  3SX5 A;  3TQD A;  5FV9 A;  1KWS A;  1E5K A;  3QVB A;  4AC3 A;  1NF5 B;  2VS3 A;  4HG6 A;  4JIS A;  2P72 A;  2RIY A;  3U0X A;  1H5T A;  5IFY A;  4HO3 A;  1WT2 A;  2V0L A;  3OH1 A;  2J0B A;  2OEF A;  4KXO A;  1ZI4 A;  3Q4S A;  5C4B A;  1PZY B;  3I0H A;  2Q4J A;  2V0H A;  4CJ8 A;  4ZDQ A;  1ZJ3 A;  2V0I A;  4EEA A;  1VZT A;  5AJN A;  2WE9 A;  5DDV A;  2FYB A;  1ON6 A;  3IOI A;  5C4C A;  2NXV A;  1G93 A;  5BXC A;  2YQC A;  1WT1 A;  2BO8 A;  3N9W A;  1VH1 A;  5J49 A;  4M4K A;  1NQI B;  2O1H A;  1O7Q A;  4MYB A;  4Y7V A;  2OI7 A;  4L41 C;  4FRD A;  3V91 A;  3FOQ A;  3PKP A;  2YCM A;  5C3A A;  5C3D A;  4HCQ A;  4GBP A;  2VXL A;  4HO2 A;  3BCV A;  1LZ7 A;  1H7G A;  3DK5 A;  1WVC A;  3SX3 A;  1V83 A;  1FG5 N;  2XWL A;  4K6R A;  3TZT A;  3V0M A;  2QH5 A;  1W55 A;  3SPT A;  2Z86 A;  3FWW A;  3OH0 A;  2X5Z A;  2FYA A;  4D11 C;  1H4C A;  1YP2 A;  1FXO A;  1H3M A;  4M2A A;  3V0Q A;  3JTJ A;  4UEG A;  1XZ6 A;  1K4V A;  4FRQ A;  2OI5 A;  1NMM B;  2VSI A;  1GX0 A;  5IDT A;  1ZJO A;  1JV3 A;  3JUJ A;  4NAL A;  4E1K A;  1H5S C;  2D7I A;  3I0D A;  3EE5 A;  2D0J A;  4BMA A;  1H5R A;  2RIX A;  4AYJ A;  2O1G A;  2VK9 A;  4Q7C A;  4KT7 A;  2BO7 A;  1W57 A;  1R7Y A;  1OQM B;  1XHB A;  4B4M A;  4B2X A;  1QWJ A;  1OMX A;  2VSH A;  3I0I X;  3Q7U A;  1YRO B;  1GX4 A;  1FGG A;  1ON8 A;  2RJ6 A;  5CMI A;  3OAM A;  4FCU A;  2C0N A;  5D91 A;  1R7T A;  1VZU A;  1FZW A;  1LZ0 A;  3K8E A;  2X65 A;  2RIT A;  2XWM A;  4ASJ A;  1NWG B;  1HM9 A;  1JVG A;  1GA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...