2X6GA

X-ray structure of macrophage inflammatory protein-1 alpha (d27a)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
ADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C MOTIF CHEMOKINE 3
publication title Polymerization of Mip-1 Chemokine (Ccl3 and Ccl4) and Clearance of Mip-1 by Insulin-Degrading Enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2010-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2x6gA00
2SDFA 1EOTA 3LWEA 2B2WC 1CM9A 2HUGA 1EIGA 1B2TA 4DN4M 2J7ZA 1WTPA 3I8ZA 3I91A 1O7ZA 1U4MA 4X3SA 1JE4A 1PDQA 2K01A 1X32A 2L12A 3IFDA 5EPLA 1IKMA 1EIHA 4XT3B 1A15A 1F2LA 3TZDA 1Q3LA 1SAPA 3DM1A 2MP1A 1B50A 1NCVA 4HCSA 2HCIA 2MJ8A 1G6ZA 5EJWA 4HEDA 4X3TA 2B2YC 1BNZA 2L1BA 3H91A 1X3PA 3DEPA 4QUCA 4X3UA 1RTOA 2K03A 2KUMA 5T1IA 3MTSA 4IUQA 3TN2A 1QE6A 1HFGA 2NWGA 3I90A 1O7YA 4IURA 5D14A 2B2UA 1RODA 2K05A 1VMPA 4O42A 3R93A 1GUWA 1HUNA 2K1BA 4CJ1B 2BDNA 3HP3A 4RWSC 1AZQA 2FINB 4XDXA 1CA6A 1HRJA 2KEEA 1XX8A 2B2TA 1RTNA 2FHTA 1F9QA 4HAEA 1DOKA 5DNFA 1NR4A 2JYOA 1S4ZA 3DEOA 4ZLTF 3N52A 2HDLA 2MPMA 4MN3A 2M2LA 4ZAIA 3F2UA 1O80A 3UI2A 1IKLA 1WTRA 1TVXA 4IUPA 5E4XA 1DZ1A 2JP1A 5EPKA 3G7LA 4R9WA 2H1EA 2N55A 1WTOA 3FDTA 1MSHA 1PFNA 3I3CA 4RAUC 5CMDA 5CORA 1SSOA 1ZXTA 1WTVA 4IUUA 1QG7A 5AFWA 1RJTA 1WD1A 1J8IA 3IL8A 2RA4A 5CBAE 2FFKB 1HHVA 1LV9A 1DONA 2K28A 4NW2A 1WTWA 1EQTA 2FJ2A 4X3KA 1F9RA 2Q8TA 2MGSA 1C8CA 1BO0A 1F9SA 2HCCA 1ESRA 2L4NA 4QUFA 1E0BA 2IL8A 2RSNA 1XYIA 2B2UC 5E4WC 3FPUB 1U4PA 1WD0A 3QO2A 5COYA 1NAPA 1ILQA 1MGSA 2EE1A 2KECA 1ILPA 1X3QA 2X6LA 1PFMA 5D65A 1BBXC 4ZK9B 2B2TC 2KOLA 1B4OA 4OIJA 4ZKCB 2DY8A 1G91A 1BF4A 5T1GA 2D9UA 1KNEA 2L9HA 1VMCA 3Q6SA 5JJZA 1RHPA 2B2YA 1JICA 2Q8RE 2EPBA 1MSGA 1EL0A 1ICWA 2RSOA 1PFBA 1MI2A 4U68A 4R8IA 4CJ2C 2B2VA 3KBXA 4CJ0B 4IUVA 4HSVA 1B3AA 5CBEE 2X6GA 4XT1B 2KVMA 1AZPA 2HDMA 1B53A 1ML0D 1U4LA 1IL8A 1G2SA 2NYZD 2R3ZA 3GV3A 4MHEA 4ZKBB 2XIWA 1HUMA 5EKIA 4RA8A 3KUPA 2B2WA 1G2TA 1SDFA 4OIKA 1U4RA 3GV6A 3MWYW 1DOLA 4UAIA 1J9OA 1F9PA 2K04A 4IUTA 1KNAA 1AP0A 1NR2A 2B2VC 2CVRA 2DY7A 3P7JA 3ONAB 1WTQA 4LMQD 1HFNA 1WVLA 1PLFA 2KEDA 1M8AA 2L11A 5EQ0A 1CA5A 1HA6A 2X69A 5EPJA 1QNKA 2VXWA 2RVLA 1DOMA 2FMMA 2N88A 2EOTA 3SVMA 1WTXA 2NZ1D 3D6WA
chains in the Genus database with same CATH superfamily
3J81j 2F0NA 1EY0A 3J7AV 2HD3A 4DUYL 1UNSA 1B1ZA 1SXTA 3A8JE 3GTMH 5IP9H 3TZDA 1DJRD 2VY3A 4HCSA 5JEAH 1I4QA 4KTAA 1DCZA 3S9WA 4JI6L 1STEA 2UUAL 4XYQA 1I5FA 2JA5H 4QUCA 1L2FA 2K03A 4A3MB 5T1IA 4RG1A 3NHHA 4IPGA 4OWWB 1HFGA 2KENA 4IURA 4NP5A 3I4NB 2K05A 1Y1WH 1RF2D 3JAML 2AWOA 2RHQB 2BA1A 1K3RA 3A5ZB 4XDXA 1D5MC 1PH9A 2O4XA 4ID6A 1TWHB 3SXHA 1A3UA 5KYIA 4A3BH 2EJFC 5M3FG 3DWPA 2KCMA 4HIMA 1FL0A 2HHHL 4IFDI 1KIXA 1WTOA 5GAGC 4JYAL 1WI5A 1WTVA 4O2DA 1WD1A 1A3TA 1EWIA 2E76C 2FFKB 4PNYA 2F0GA 1KQSA 1FR3A 2WACA 1BKBA 1NMGA 1SR3A 3U58A 1E2ZA 3OSOA 4ZCKA 1IL2A 2B2UC 4WFN3 1EYDA 1GUOA 3A5UA 1E2VA 4DR1Q 1EY8A 3LWUA 3S2HB 2PYKA 2RBMA 2X6LA 1ICFB 2JA7B 2E2HB 1LTTD 4CDEC 5JOBA 4DAVA 3TP7A 3MXGA 3K59A 1XPUA 1Q46A 3U9SA 1V9PA 1T9HA 4CKCA 4EQNA 4IFDJ 5CBEE 3A8KE 4ZRZA 1XXGA 3I73A 2QGQA 5C0XG 3M4YA 2NZOA 1MBYA 2GVAA 4H44C 1LYLA 3VR6A 3RZOB 4OIKA 3GV6A 1D1KA 4GOPC 1AP0A 3KDFA 4XQQA 4DUYQ 2ES2A 2BE5C 4BXXG 2UUBL 2Y0SG 1QNKA 2IX0A 2RVLA 1DOMA 3T4AC 3HOXH 4A93B 4YCVA 4PZ8A 1EOTA 2B2WC 1VQ4A 3PCOB 4JI6Q 3S1QH 1TWFB 1EQVA 4EQ5A 4L5RC 1GUGA 4TSSA 3I7FA 1RL2A 4I65A 3MFGA 4IOCA 1YEZA 2M00A 1EY7A 1A15A 4LF4L 2PNRC 2IHEA 4CBVA 4GLXA 4X65Q 1I4GA 1A8VA 2EY6A 3VYSA 3BYTB 3J81i 4JPBW 1LTGD 3HKZE 3PSIA 1BVSA 3TN2A 5KRUA 1JMCA 1VQKA 1EEFD 4PQXA 1DXMA 1LT3D 4LFCL 5TSSA 4A3DH 5ELDA 1RODA 3K57A 2A19A 4DV4L 3MXPA 3I2ZA 4X64L 1E2WA 1XX8A 1DYQA 2E8GA 2BDOA 2GVBA 4J6HA 1I94Q 4BY7G 4PMCA 1F9QA 4DK0A 4C3HG 5C44H 1Y14B 1GKHA 4LF6Q 1RIPA 5HURA 2Q2TA 2KBNA 3HOVH 3H0GH 1BUVT 1PRTD 1NBWA 2F1MA 3H94A 3FMCA 3CPWA 1EIFA 5KNDA 5IP7G 2HQEA 1E7ZA 1N32L 4JBJA 1SE8A 1SJED 5LMUL 1VQ5A 5M5YH 3T51B 2LMCB 4RGNA 3NELA 2IX3A 5K36G 1VF5C 2WKDA 1GOZA 1IHZA 5FLXE 2YU9B 2SNSA 4LF5Q 2R92G 5IYDH 3E5SA 4QB4A 1EEID 1S72A 2WAQG 4IALA 5K5PA 1IBKL 2B2TC 4LFAQ 4EGVA 4F8MA 1KDCA 4OWXB 3J80E 3Q24A 1SFOB 2R7ZB 1JB7A 2K32A 1N34L 1L0YB 4ZQ3A 1ENAA 1EL0A 2RSOA 1B3QA 4U68A 3GTKH 1S5BD 4CJ2C 2F0WA 4FXKC 5J22A 3FEWX 3OIPA 1VQOA 2UUBQ 3WDNA 3CC7A 1JWMD 2G9HD 4OX9L 1SYBA 4DU9A 4DR6Q 5IYBG 5FJ8G 1B44D 3A8IE 3CMAA 4BBSH 4K0KL 1LTSD 4IZ8A 1VQAA 4DUZQ 2DY7A 2B8FA 2F0TA 4LMQD 4XTCS 3KYHC 4CHTB 2ZJQA 2D5DA 3GTGB 1F2ZA 1E1OA 1WTXA 1Y1VH 5CV4A 4N9PA 5C3WA 1QOHA 1KDAA 2B63H 2NB0A 2NTTA 4HN7A 4RFBA 2DUDA 1S5CD 3HOZH 5IIFA 1K83B 2L12A 2NVXB 4LFCQ 1SAPA 2BH2A 1NCVA 4C2MH 1VQHA 1WOCA 2UU9L 3H3VC 2JQOA 2NBFA 1X9NA 4FF3A 1U5KA 2SOBA 4E6IA 2V1CC 3O13A 1UEAB 4A3JH 1FJGL 4A3KH 2Z9HA 1HUNA 1YHAA 3CCLA 4L5TA 4RWSC 1N33Q 2OQ0A 2VS1A 4U673 3K5MA 3SHLA 2AMCB 1V1PB 2PQAB 4GKKL 2JA9A 3SR1A 5LMUQ 1FGUA 1VS0A 2Q2IA 3C1EA 3PUVA 1K73C 4KN7C 4IJHA 2A68C 1VDZA 3IRBA 4C3JH 4LUZA 2JA6H 1GJXA 2NVTB 2H1EA 5DM63 2F3IA 4K8JA 3E9HA 1Y8NB 1SSOA 2QILA 1QG7A 4ULLA 3M4OB 1LABA 1WTHA 1ZYRD 3AFQA 5IT9c 2VUMG 3GD7A 2CQAA 1X3GA 4BA1I 1BOSA 1I4XA 1E3PA 1R9TH 1L0XB 1JE5A 1EZ8A 1HZ9A 3BS1A 1IBKQ 5CC4A 3N6RA 4C1NK 2IL8A 1N34Q 2E2JB 3PGZA 5C5LA 3GTPH 5C6AA 2EYHA 1XWEA 3S15H 3NENA 1XMOQ 1TS2A 4K6DA 3M7GA 2WINB 1SNPA 2E5LL 3CRLC 4OX9Q 3S14H 2ICEC 3R2TA 4HMJA 4BBRG 4DK1A 2Z6BA 2SNMA 1AZPA 4A3IH 3HOWH 3FKIB 3A7AB 1EY4A 2VZAA 3GV3A 1FGBD 4A4IA 1PHJA 3PV0A 4WRDA 3HOUH 3EJIA 2JSOA 1W3SA 5M3FB 2OTJA 2G9DA 3S16B 3TP5A 4OO1H 2UXBL 5EQ0A 5BN3A 1F77A 2NVYH 2UXDQ 5C3XA 2F4VL 2E2IB 3D0FA 5J39A 2UU9Q 2NVQB 5FLMG 5I6YA 3HS0C 3I8ZA 3FPPA 2KJXA 2LXJA 2AQ1B 4RGTA 3KK7A 4LAAA 1FJGQ 1QCBD 1Q86C 1PH7A 3UDGA 2IJ0A 4AH6A 2DNCA 1CZGA 1QWYA 4OELB 1C9OA 4GKKQ 1STHA 3JAMc 5IGGA 3G6EA 4K14A 5KEEA 5JJKA 3PIPA 1O78A 1EYAA 2PI2E 4IO9A 3M85A 4XXEA 1UE5A 2F03A 2KHSA 3T56B 2I5HA 3DEOA 5NUCA 3DXJC 2MPMA 1XTDA 5M3MG 2JP1A 1PYWD 4XQNA 1K0RA 1WJJA 1B70B 2A73B 4P71A 3GTQB 2JJQA 2JA8H 3AB9A 4JI2Q 3ER0A 3CCVA 3S24A 4P75A 4B3SQ 4GN3B 3S17B 2Y0SB 4NXNL 3F2BA 5GAEC 1YHBA 3KLRA 1GD7A 1V1OA 4ABNA 2MGSA 4R8NA 4EVOA 1SYEA 3MVVA 4WJ4A 1BO0A 4K5VA 2E5LQ 3E0EA 3ULLA 3W1BA 2CHBD 2CH4W 4JVZA 5E4WC 4PZ6A 3JC66 4F7XA 3DUZA 2F0UA 4UP8A 5EGTA 2G5DA 3CXCA 2PW5A 2ZT9C 2WB1B 4DV7L 1AH9A 1SNDA 4LW1A 4WORA 1MD2D 3VR3A 3E6ZX 1XTCD 5D3IB 3CCQA 1CHQD 3U4VA 3PO3B 5BR8L 3PUYA 2UXBQ 1PTOF 1ML0D 1I3QB 2YYZA 3KUPA 3I4MG 1SDFA 4JV5Q 2AQ2B 4UAIA 1CTMA 1TWHH 5M9OA 2CVRA 3L7ZC 3RLOA 3PIO3 1WVLA 1PLFA 2F0PA 2L15A 1EY5A 1XNQL 3CP0A 3CQZH 1EZ6A 3R3OA 3EVQA 4GNXA 4HSPA 1X54A 2OCEA 1AW7A 1PTOH 1JE4A 2K01A 3J80L 4C56C 3TREA 3HOYH 2J4XA 2ZTCA 1N36Q 2K52A 3D4DA 5IYCG 4HEDA 3HRZC 2K5WA 3MFYA 1BNZA 3MZ5A 2CQOA 5HY6A 1VQBA 4BY1G 2IW3A 1XPRA 5J3BA 3K0XA 3BYYB 2WAQB 5M5WH 1SRUA 3S1NH 2YTVA 5I6WA 4R4OA 3W2DA 4AQYQ 4CJ1B 3GTLB 3PMFA 2ID0A 1JQYD 3BVMA 4FDBA 1RTNA 3OW7A 4A3EG 1AE2A 3L0OA 3S1MH 4IPCA 5CV5A 4PG3A 4DV0L 1UAPA 3F2UA 2PMZB 3MXNA 1IKLA 4NXNQ 4KKSA 1S5ED 2GN5A 4JI4Q 3EQLC 1OXUA 2EYJA 4RAUC 1TWGB 2ASBA 3NP8A 3K5NA 4KKTA 1LT4D 4IFDG 1EQRA 4NB3A 1U0LA 1EQTA 1EIYB 1D5ZC 2PNHA 5FKAC 1LTLA 3AU7A 1ESRA 3K0YA 3CU7A 4ZUJA 2K5QA 2BE5D 3KF6A 5IP9G 3KJOA 3GQBA 1BBXC 4ZK9B 5JEAG 5BR8Q 4G57A 1I4PA 1K8MA 3BG3A 1ET6A 2JA5G 3EN2A 3Q6SA 2JE6I 1SE4A 4QF4A 1TT2A 1UE1A 3HFZB 4CJ0B 1Y1WG 1F2MA 1U4LA 1B8AA 1XNQQ 1KHIA 1SNCA 4ZKBB 5EBCA 4PMBA 4DV6Q 1PFSA 3HGBA 3MWYW 2N8NA 1EFID 4A3BG 1JB3A 2RDFA 3VDYA 1HFNA 1FNUA 2X69A 1K0SA 4A3CH 2EOTA 1QB5D 4FYDA 1IYJB 1WTPA 2H4OA 1HNZL 1XNRQ 3SE0A 3UDIA 4OEMB 4CDFC 2HCIA 1B9MA 3M9BA 2DJGC 4JOIC 4GNXC 3DEPA 4TVAB 4NXML 3D3RA 4YY3Q 4JI0Q 1TWAB 2A6EC 1GUWA 4L5SA 4K2KA 3ULPA 1W6KA 2Z4IA 1ENFA 2FHTA 4Y7NB 3PUWA 2MUYA 1K9MC 3PUXA 2ENBA 1S4ZA 4ZLTF 1SMXA 2PO4A 1KTKA 4ZAIA 1PXUA 2R93H 1HZCA 3BDCA 4KMUC 3M3YB 4IN3A 1B9NA 5A35A 2F0DA 3DLLA 2K5HA 5C4XH 4GKJL 1A3VA 4DR7L 1N9WA 1P8LA 4O0AA 1Q8IA 2D0PA 4C3IG 4DAYA 4C1NI 1MSHA 2EDGA 3NEMA 2HQLA 2QDBA 4R1JA 4DR5L 5KGUA 1J8IA 4XIGS 3CKIB 5CBAE 1DONA 5C4JB 2VQEL 5I9PA 1EY9A 3HOXG 1CFMA 4DR3L 4YCWA 2Q8TA 4HJ9A 1KD1C 3TBIB 3NSWA 2RSNA 3D31A 4IUNA 1YJ9A 3OHXC 3P20A 1U4PA 1BCPF 3I55A 1OXSC 4RHRA 1ILQA 1X3QA 3E0JA 2BH8A 1CI3M 3EA6A 3J7A5 4G7ZC 1NUCA 5JJLA 4XQJA 5GAHC 3V2TA 2EPBA 1ICWA 1CZWA 4A3DG 4QIWE 4GN5A 4F88A 1V1QA 5JVH3 3W3AA 5CGKA 1JORA 3SK6A 2EYOA 4JBMA 1PVOA 2PI2A 5C44G 4DV2Q 2CW0C 2HIXA 1PH5A 3VR2A 1BBWA 1NR2A 1KC8C 4GOPB 3C3LA 1D7QA 2TMPA 3BDOA 5M3MB 2EYLA 3HOVG 1QILA 3H0GG 4POGA 1I50B 1GUSA 1CA5A 4J15A 2F0VA 2F3VA 5KIXA 3Q0AA 3SVMA 3TEHB 1BR9A 1ILPA 2ZTDA 5FK9C 4DXGA 1JWSD 3CCEA 3FHWA 2DJFC 5IGBA 4DV3L 1CKNA 4QY7A 3NBHA 4RKLA 4IJLA 1Q3LA 4FO2A 2A68D 1H9RA 4YHHL 4DKAC 1G6ZA 4CGYB 2B2YC 2R7FA 4YIJA 1TY0A 2CKZB 2KUMA 3C2PA 1EU3A 3PF4A 1IZ6A 4JW0A 1TS5A 5IYDG 3IKJA 3ND9A 3SK8A 5KYLA 4TKOB 3CCMA 4QGUA 3R93A 4DK3C 2K1BA 1YNJC 3KBGA 3T1YL 1VQMA 1KLUD 2UUAQ 2NUCA 4DR7Q 5EBDA 3Q22A 1JWUD 3UI2A 3KLSX 4P2CB 5E4XA 2RKSA 4AYBE 1XMQL 4XYOA 4UP9A 4HTHA 2VQEQ 3WWVA 4DR3Q 3U4ZA 3I4MB 4WJWA 3QB3A 1DGSA 3FKIH 5CORA 2L55A 4BBSG 4K5XA 1X3EA 3TRZA 1TXYA 2NN6H 3Q23A 3D4RA 1CSQA 3P1HA 1S3OA 2LS01 1A0IA 2I07B 2WV6D 1VQIA 2HHHQ 1Y1VG 5M5XB 3F1ZA 1MJEA 4R4QA 5BN4A 2B63G 4JYAQ 4V0BA 3I72A 3HOZG 3FPUB 4M1UB 1A2TA 1BBUA 4BY1B 1STYA 3MC0B 3NQIA 1CK1A 4R4CA 5G3LD 4NPSA 2E2DC 4A3JG 2OF1A 4A3KG 2I46A 1M1KC 2TSSA 4A75A 4XT1B 3ND8A 2HDMA 2ZJPA 5C5MA 3GTJB 2KCCA 2L0CA 1Q7YC 1J9OA 3S2DB 4HIKA 3Q8DA 1KRSA 4MNOA 1WTQA 5FLXc 5CV7A 3AFPA 3EIVA 2N88A 2AKWB 3TQYA 4C3JG 2JA6G 3U9OA 3K5OA 2NN6I 4KY5A 1EIGA 4OXPA 3J80c 3KDFB 3GTQH 2P5ZX 1L0WA 1E24A 1R4PB 4RHSA 3S1RB 1CSPA 3A56A 5EJWA 2QDLA 1DM0B 3T1YQ 3CHBD 5DAUA 2RQXA 4JI8L 3MHBA 3GTMB 5IE8A 1QE6A 3KLSA 5I2YA 4L5QA 1HTLD 1E1TA 4LF4Q 1SYFA 3OYYA 3TS2A 2OEOA 4JCVE 5ELOA 2JA5B 4IQZA 4Y52H 1JOOA 4FVMA 4OL7A 4AYBG 3HKZG 1Y1WB 3HKSA 1YHQA 3UDXA 4A3IG 1YITA 4DV4Q 3HOWG 1PYSB 3G7LA 4X64Q 3PO3H 4ILWA 2F0IA 1AE3A 3D4WA 3JAMi 1PFNA 4A3BB 1QUQA 1STNA 1K3BC 3HOUG 4IUUA 1TY2A 2IY5B 1TR5A 4HIDA 5C0XI 2RA4A 4OO1G 4EQPA 2OXPA 2ZM6L 3GTOB 1Q82C 1VQCA 4K6LA 4B3TL 3J81E 2L4NA 1WCMH 4HIOA 1N32Q 4LF8L 3PO2H 2K50A 2D2CC 2MO0A 5JPMC 3K7UC 3DHQA 4OHJA 1EY6A 4JI5L 1K8OA 2ZXOA 2EY2A 5C3EH 4Q5VA 1QZGA 2DY8A 1TS4A 5IGCA 1M4VA 4B3RL 5CV6A 1TIID 3URYA 2B2VA 3TSSA 1OTCA 2Z4HA 1OO9B 4N9TA 5ELCA 1UUPA 5C0XJ 4A3GH 3T1HL 1KXLA 5AJ3L 1BCPC 5KNBA 4PV1C 4BA2I 4C3IB 2KHJA 2NZ1D 2F0HA 5D14A 1A2UA 3R8BA 3LWEA 1B2TA 3UDFA 2JA8G 2NZHA 3TMEA 4K0KQ 4JI8Q 1EIHA 2K5NA 1X32A 3PIOA 1STAA 3HOXB 5EKLA 2AQ3B 3NPPA 4H13C 3S1QB 2L1BA 3RUZA 2DN8A 2MNAA 3D8GA 3HZXA 3G71A 1HZAA 2MQHA 1YNNC 3NBIA 5A2QE 5CV8A 3K58A 1AZQA 1ET9A 2FINB 4RCNA 4A3FH 1HRJA 3RD4A 3L9AX 3KFUA 3RZDH 1LTID 2A69D 1J5EL 4A3DB 1WYDA 3QOJA 4A3LH 3A7LA 4IUPA 1I6HB 2ZM6Q 4DAMA 2AUJD 4LUVA 4B3TQ 2I0QA 3I56A 1PZJD 2IHFA 3QJYA 4LF8Q 2ZTEA 3H0GB 1NTGA 3HOVB 2A6HC 2A74C 1VQFA 4WJ3M 4LF7L 2HT1A 1JR0D 1SNMA 1FNVA 1EUJA 1GUNA 1ESFA 3GO5A 3X3MA 3RMHA 1N8RC 3JAME 5M5YB 2RCNA 4JK1C 3MA2B 1Q81C 4DV5L 4NMZA 1XJVA 5COYA 4MTKA 2WFWA 3STBC 2KECA 2EYPA 3HOYG 4J8QA 2KCTA 3V96A 4DNIA 1LTBD 2CWPA 3ZJYC 1D2BA 4KHPL 2F4IA 4LNQA 2EYMA 1BF4A 3RLFA 1A62A 2Q8RE 1A6XA 3K7AB 1CT1D 4ODGA 3AQQA 3OWEB 1PA6A 3CC2A 1Y8OB 1G2SA 4JI3L 1GXDC 5EKIA 1RCVD 4KV6A 3GTKB 4RMFA 1DOLA 1KNAA 1HCZA 2B2VC 5IWAL 2QF7A 2A6ED 3H15A 5F2DA 1S40A 2M9VA 3J7ZC 1IBML 1CM9A 2K75A 4BBSB 2ZJRA 2FMCA 4APVA 2AWNA 4KD4A 1LT6D 5I2XA 4A3MH 3IFDA 2AHOB 4BY7B 3I4NH 4ME3A 1Y1VB 4C3HB 3OOCA 4H0LC 2F4VQ 2B63B 3I4OA 5C4JH 5C4ZA 3CCSA 4KK7A 3PQIA 1VQLA 2PQEA 2VW9A 2KQ3A 1CHPD 4NKLA 3I70A 4C2MB 5FLXL 4ALPA 2F0QA 3NK9A 2N49A 4P72A 4B9XA 2CFMA 1RKNA 4JI7L 4GLVB 4A3JB 4LF9L 1LTAD 1QNUA 1FVIA 2BCOA 2XWJB 1PV4A 3ZYYX 4P73A 1IBLL 4LF7Q 2R92B 4HR7B 1CQVA 1T5XD 2QCPX 2OT2A 5CMDA 5I4DA 2PCFB 4K2LA 1Y8PB 1NE3A 4N8X1 2MO1A 3H09A 1PYBA 4R4TA 2K28A 2EYFA 4C3JB 2JA6B 2B39A 4NW2A 2C9OA 3S2HH 4A3CG 1H95A 5CV9A 2JA7H 2E2HH 1C8CA 1I50H 3SK5A 4KHPQ 2CW0D 1GHKA 3CPFA 1HH2P 3CF5A 1R9TB 4FF2A 3A0JA 4UP7A 2QW7A 4KJOA 3NE5B 1B4OA 4ZKCB 4TRDA 4JI3Q 5D3DA 4X66L 3OTOL 3HEJA 3RZOH 1HQMC 2FXQA 3GTPB 3BZKA 3G4SA 3UE1A 5LMNL 2ZXRA 4DV7Q 1B3AA 1PTOD 4KI0A 1IL8A 2XNAC 4KJNA 4LJZC 4A93H 2A69C 1IBMQ 1HPCA 3HKZB 1U4RA 4LFBL 3NWSA 2EY5A 1TWFH 1PZID 3J81L 3HOWB 2R93G 1I4HA 1YNJD 5ISRA 3NTHA 2FMMA 2Z1CA 1HJPA 1FYCA 1PH4A 1EWCA 4HJAA 5C4XG 4YCUA 4ZYSA 3HOUB 4L63B 1SMYC 4DN4M 5E1FA 1O7ZA 4X3SA 1PH2A 3F8TA 2C35B 3UE0A 2NVYB 4FF1A 4I7ZC 3F2CA 2EXDA 1T5EA 4YWKA 3QG1A 1JT8A 3H91A 1P16A 4GNXB 4X3UA 1IW7C 1SE2A 4FXGC 5JAVA 1AFPA 5M5XH 3I90A 1O7YA 2F0LA 4LF9Q 2B2UA 1VMPA 5EAYA 4X6AH 4KKUA 1CA6A 3BZDB 2F0JA 4O1NA 4OONA 4HCEA 5IGEA 3SGIA 2ZXPA 3LX0A 2VUMB 1OXTA 3V05A 5LMNW 2EJMA 2MFIA 3BU2A 5GQOA 5IY0A 3RR5A 2LSSA 5LHY1 2RHSB 3I3CA 1QJOA 3LGJA 1VQ9A 4DV0Q 2JXMB 3T16A 2YU9H 4GS3A 3ERSX 1HHVA 2V4DA 3MXNB 3S2DH 2WKCA 2XRQD 4BBRB 3DM3A 1VQPA 4QUFA 4CDDC 1SFOH 5A2QL 2R7ZH 4Z9CB 4HMIA 1KAAA 2EE1A 1Z6HA 1M90C 5LMNQ 2EZVA 2JEBI 1II3A 3NTIA 1Y69U 3S1RH 1MKHA 2L9HA 4GZYC 3KLWA 2K33A 3J7YW 2XTIA 3H3VH 2Y0SE 4LFBQ 4R8IA 3K80C 3CCUA 1LTRD 3KBXA 3KF6B 3GP7A 4IUVA 1MHWC 1K28A 4HSVA 3AMUA 2F52A 1K8GA 3A74A 3G48A 3GTGH 2UUCL 1EWHA 3MAQA 1PZKD 1X6OA 3EBEA 2K04A 3EROA 3ONAB 2KA7A 2WB1E 1IXRA 1K83H 1I4RA 2I5MX 2NVXH 3OPOA 4X65L 2B8GA 2DGYA 1SE3A 2SDFA 4NDXA 2Z0SA 3FKIG 2QKIC 1PDQA 1J6QA 2NN6G 3CQZB 2BA0A 4RGMA 4DFAA 3MEHA 3BVGA 1Q12A 3CMEA 5DM73 4JBWA 1PTOB 1C7YA 2EY1A 1I94L 1X3PA 2PW7A 3GTOH 1UEBA 1HNZQ 4LF6L 3HOYB 1Q8KA 1VCIA 2XGTA 3A54A 3NQTA 3SEBA 4O42A 4AIMA 1LO5D 2XSCA 3H3VI 4OWTB 1Q1EA 3J80i 1CKMA 2B2TA 4RCOA 1QZHA 4HAEA 5M5WB 2NVTH 1VQEA 4NXMQ 3S1NB 2XN9C 2EQSA 4DNTB 2Q2UA 3VR4A 3M4OH 1PRTF 1QVGA 1PTOC 2B3GA 2ICIA 5HGQA 3K81C 3S1MB 3FDTA 4HJ7A 3VA7A 1ZKOA 4QMGA 5CYUA 2WAQE 3NUCA 1YIJA 4LF5L 5G3LF 2YTXA 4RKBA 1NJIC 2E2JH 3W5OA 3TDQA 1G6PA 1R4QB 3QR8A 2FJ2A 1D1IA 1EYCA 3C1FA 4B9WA 4JBKA 4LFAL 4GKJQ 4DAYB 1H9SA 3ERQA 4TQUS 1F9SA 1RD9D 4C3IH 2KHIA 4KD3A 4DR5Q 1BCPD 2PMZE 3AYHB 5E3FA 1QVCA 1PFMA 1LUZA 1VQNA 5D65A 1A63A 5HGTA 4B08A 3C46A 1DD2A 1SNOA 5JEAJ 1LACA 2D9UA 4DR6L 2UUCQ 1MSGA 2EVBA 5ELEA 4DUZL 2QEJC 5M3FH 3S16H 3TP8A 1TWCB 1G291 2EIFA 1Q1BA 1KLGD 2WB1G 3LNNA 1V43A 1SEBD 5C4HA 2E2IH 1SYCA 2NVQH 1QVFA 1YNND 3X3NA 4A76A 2JEAI 2O5IC 1AEXA 1IYVA 1JCKB 4DV1L 3PO3G 4K8IA 1I6HH 1NY4A 1X55A 1JJGA 1X56A 5EPLA 3T53B 1IKMA 4L6TB 1F2LA 4UPAA 1KAWA 2MP1A 4KHZA 2MJ8A 4A3EB 1N33L 1SNQA 4QCLA 1GVPA 4G7HC 3CD6A 1GO3E 1WCMG 1BDOA 1V1PA 2PQAA 4DV3Q 1CKNB 1O7IA 4M8AA 3PO2G 2YTYA 4IUQA 1I6VC 1F2YA 2NWGA 3NBHB 2A6HD 1UE6A 1EYGA 2VL6A 1JJCB 4YHHQ 5C3EG 5C0XH 4YWLA 3L2PA 4DR2L 4QL5A 2F0EA 4UDUC 3QOLA 5DNFA 2DNEA 4FP5D 3STBD 3S17H 4BXXH 2L5TA 1C4QA 1TVXA 3FP9A 3K7AH 3TZUA 1W2BA 1CUKA 4CKBA 2K7VA 3H6MA 3PF5A 4R4IA 1G51A 1H9SB 4A3GG 1TQOA 2VNUD 5J1ZA 5JPNC 4KLKA 1STBA 2F0SA 2BOSA 2R93B 1MIUA 5C4XB 2NTSA 4G4KA 2H5XA 4CKEA 1XMQQ 1XMOL 1CQFA 3FVQA 2R7DA 3VA5A 5FO9B 1S5DD 2ATWA 2IT1A 3KOJA 4G7OC 2LKVA 3BZCA 4S3SA 1WD0A 2K6AA 2LFNA 4KN4C 1VQ8A 1LLRD 1FD7D 4DR4L 1YBYA 4HJ8A 4BY7H 4Q0FA 1I3QH 3M4PA 1KNEA 1BQQT 1WTWA 1G8ZD 4C3HH 4MTNA 1IYUA 2SEBD 3BJUA 3ITPA 3KJPA 1B53A 4A3FG 2UXDL 4X62L 5IP7H 1BXTA 4I7AA 4DV1Q 2IWHA 1GM5A 1L1OA 2AUKA 4DPGA 1JJ2A 1Q90A 1PH8A 4L8JA 4A3LG 3J81c 4DK6C 1H9JA 3P7JA 1BCPB 2KEDA 1PMRA 2B29A 2VQFL 5K36H 1WTRA 1OXXK 5LL6S 4QJFA 4DAPA 5JJIA 3I91A 2R92H 3PUZA 4UY8C 3MXUA 1B7YB 1YNXA 3IAYA 1Z47A 3SK4A 4ME5A 3GTLH 3ULJA 4MZ9A 4DR2Q 5IT9E 3MTSA 5H1SE 5IODA 1SN8A 1NNXA 2BDNA 5ELFA 2N78A 5IYBH 1DOKA 5FJ8H 1K8AC 2JYOA 2OWOA 4JI2L 3CC4A 1TWGH 4B3SL 4FF4A 2HIVA 3N52A 2HDLA 3MEFA 3DMUA 5EPKA 4DXFA 5LL6X 1PRTB 3M7NA 2O2LD 2N55A 2PZWA 2UXCL 1AN8A 5GADC 1SLJA 5DLQE 1RJTA 1C48A 4FXDA 2R6GA 2MHVA 3IL8A 1O7LA 1EFWA 5I9OA 3VYUA 3M4QA 4DR4Q 2A8VA 1VQ6A 4V190 1FNWA 3TP6A 1U9RA 2EJGC 1GHJA 1QUQB 3OMCA 2RF4A 1CKOA 3QO2A 4A3MG 1PRTC 4DF7A 3I4NG 2KCNA 5C44B 1Z9FA 3VR5A 4RGOS 4X62Q 1SMYD 1VMCA 5DEHA 1JICA 3RNUA 2PZTA 4JV5L 2OTLA 1L1OB 1VQGA 4FNFA 1MJCA 1C0AA 4JI5Q 4H02A 2VQFQ 2D0OA 4B3ML 2NYZD 4IOAA 4H7BA 3K6OA 3NWTA 2LXKA 2E74C 2Q2HA 1HUMA 4LWCA 3R2IA 1IW7D 2XWBB 3F2DA 1G2TA 1YJWA 4B3RQ 4IUTA 3OW2A 4ZUIA 2OQKA 1H9MA 1M8AA 4OGQC 2VUMH 4GLAC 1N36L 1LM0A 1X65A 1HA6A 2N3SA 1KABA 3J7AF 2A1AA 2CH4A 1L1OC 3TS0A 3DWQA 3T1HQ 1PH1A 5AJ3Q 1U4MA 3BVZA 3OIQA 2Z6KA 3A55A 2K5DA 1KDBA 3DM1A 1TWAH 4AQYL 2D62A 5FOBB 2A5HA 2JA7G 2K14A 2K5VA 4OO1I 2CWAA 4UHVA 4Y7NH 3WOEA 4IPHA 4BBRH 3SDZA 3I4LA 3GDEA 3QWNA 1HZBA 4JI1L 1TU2B 5EKKA 3HP3A 1D8LA 1D6EC 3M3YH 2KEEA 4JI4L 1EU4A 2VB2X 1LT5D 1KRTA 1SROA 2UXCQ 1RDPD 1NR4A 3U50C 4KHVA 1SYGA 5KNCA 2F0KA 4F87A 3RLNA 1HA5A 4MN3A 5ELBA 2I5LX 1SBBB 1DZ1A 4CDCC 3HOZB 4A93G 1OXVA 5FLMH 1J5EQ 4QIWB 4N8FA 5CR3A 1XPOA 3D6CA 3P75A 2WP8J 3VYTA 3OWFA 2K4KA 1X3FA 1HXYD 2IPKD 2HCCA 4DA2A 4A3KB 1XYIA 3HG9A 1D5XC 3CCRA 2C5CA 5BN5A 1NAPA 1VQJA 1MGSA 1HNWL 3B6YA 3W1GA 2KOLA 1JOKA 4OIJA 1WFQA 1WCMB 4B3MQ 1UWVA 3PO2B 1V8QA 5JJZA 5JVG3 4DV6L 5FO8B 2EXZA 4JOIA 4BS9A 1SYDA 2PZUA 4DV5Q 1ONLA 2GA4B 1MI2A 3KF8A 1HR0L 1ZYRC 5C3EB 1SJHD 2KVMA 5M3MH 1PH6A 3VYRA 4EQOA 1TKWB 2RCFA 2R3ZA 3BDLA 4MHEA 1UE7A 4QQBX 5L37A 4RH6A 2YV5A 1ASYA 1XNRL 5FO7B 1F9PA 4LUOA 2PPBC 2F0MA 3E9IA 1ZEQX 2L11A 1ASZA 2VXWA 3RN5A 1YVCA 1NSNS 4POFA 4A3GB 2HUGA 3NTKA 2XRSD 4GN4B 1HNXL 2J7ZA 5IGDA 2E75C 4YY3L 2RDGA 4DNRB 4JI0L 3E3XA 3S15B 2XVSA 5IWAQ 4XT3B 2F3WA 1B50A 4EX5A 3S14B 2F0OA 4X3TA 1HQRD 4JI1Q 4AYBB 3PIP3 1Z7TA 1ENCA 3RN2A 1RTOA 2R7ZG 3ICEA 5IOCA 1VQ7A 2IX1A 4A3IB 2Z6KC 2Q8IB 4LK1C 4J1MA 2ALYB 2O5JC 2JK8A 3K5LA 1EOVA 3T13A 4IPDA 1YJNA 3I4MH 4YWMA 1HR0W 2M2LA 4MIUA 1O80A 2J0TD 4A3FB 3DWAA 4PMWA 2R61A 4R9WA 2RDHA 3RZDB 3AEVA 1TWCH 1GUTA 4PZ7A 4JI7Q 1ZXTA 3OMGA 1JC7A 3EFXD 5AFWA 1HTPA 4JG2A 3IFTA 5IGFA 1LV9A 1HNWQ 4JC0A 1H9KA 2JN4A 5ELNA 5IT9L 4X3KA 5IYCH 1F9RA 1IBLQ 2CCZA 4BY1H 1E0BA 3L3OC 4DGZA 3CAMA 1STGA 4BWGB 2LY7A 4P74A 3CCJA 1VQDA 3KF8B 5E7NA 1HR0Q 1W6JA 1NMFA 3WOFA 1G91A 1VF7A 3QIAA 5T1GA 2Z8LA 3GTJH 1RHPA 2B2YA 4A3EH 4DV2L 4DR1L 1PFBA 1KL9A 3CRKC 2QA4A 4GOPA 2QEXA 3K8AA 1JOQA 2X6GA 3CW2C 4KY7A 4K5WA 2JA8B 1E22A 5GROA 3FRPB 2XIWA 1S5FD 2VB3X 4RA8A 2B2WA 4HJ5A 4X66Q 3OTOQ 1YI2A 1HNXQ 1YZ6A 1EQQA 4KY6A 3NXWA 4IFDH 1TS3A 2WIIB 5EPJA 2F0FA 1PH3A 3G6JB 3D6WA
chains in the Genus database with same CATH topology
2F0NA 1EY0A 3J7AV 1UNSA 1B1ZA 1SXTA 3A8JE 3TZDA 1DJRD 4HCSA 5JEAH 4KTAA 1I4QA 1DCZA 3S9WA 1STEA 4XYQA 4QUCA 2K03A 4A3MB 5T1IA 3NHHA 1HFGA 4IURA 4NP5A 3I4NB 2K05A 1RF2D 3JAML 2AWOA 2BA1A 4XDXA 1D5MC 2O4XA 4ID6A 1TWHB 3SXHA 1A3UA 5KYIA 2EJFC 3DWPA 4IFDI 1WTOA 1WTVA 1WD1A 1A3TA 2FFKB 2E76C 4PNYA 2F0GA 1FR3A 2WACA 1E2ZA 3OSOA 2B2UC 4WFN3 1EYDA 1GUOA 1E2VA 1EY8A 3LWUA 3S2HB 2PYKA 2RBMA 2X6LA 2JA7B 2E2HB 1LTTD 5JOBA 4DAVA 3TP7A 3MXGA 3K59A 3U9SA 4CKCA 4EQNA 4IFDJ 5CBEE 3A8KE 4ZRZA 1XXGA 3I73A 5C0XG 3M4YA 1MBYA 4H44C 3VR6A 3RZOB 4OIKA 3GV6A 1D1KA 1AP0A 4XQQA 2BE5C 1QNKA 2IX0A 2RVLA 1DOMA 3T4AC 4A93B 1EOTA 2B2WC 1TWFB 1EQVA 1GUGA 4TSSA 4I65A 3MFGA 2M00A 1EY7A 1A15A 2PNRC 4CBVA 1I4GA 2EY6A 3VYSA 3BYTB 1LTGD 3TN2A 5KRUA 1EEFD 4PQXA 1DXMA 1LT3D 5TSSA 5ELDA 1RODA 3K57A 3MXPA 1E2WA 1XX8A 1DYQA 4J6HA 2BDOA 4PMCA 1F9QA 4DK0A 4C3HG 5HURA 1BUVT 1PRTD 2F1MA 3H94A 3FMCA 5KNDA 2HQEA 1SJED 3T51B 2LMCB 4RGNA 2IX3A 5K36G 1VF5C 2WKDA 1GOZA 1IHZA 5FLXE 2YU9B 2SNSA 3E5SA 4QB4A 1EEID 4IALA 5K5PA 2B2TC 4EGVA 4F8MA 1KDCA 3J80E 3Q24A 1SFOB 2R7ZB 2K32A 1L0YB 4ZQ3A 1ENAA 1EL0A 2RSOA 4U68A 1S5BD 4CJ2C 2F0WA 4FXKC 5J22A 3FEWX 3OIPA 3WDNA 1JWMD 2G9HD 1SYBA 4DU9A 1B44D 3A8IE 1LTSD 4IZ8A 2DY7A 2B8FA 2F0TA 4LMQD 4XTCS 4CHTB 2D5DA 3GTGB 1F2ZA 1WTXA 5CV4A 4N9PA 5C3WA 1QOHA 1KDAA 2NB0A 2NTTA 4HN7A 4RFBA 1S5CD 5IIFA 1K83B 2L12A 2NVXB 1SAPA 1NCVA 3H3VC 2NBFA 4FF3A 2SOBA 4E6IA 3O13A 1UEAB 1HUNA 4RWSC 4U673 3K5MA 3SHLA 1V1PB 3SR1A 3PUVA 3C1EA 4KN7C 2A68C 1VDZA 1GJXA 2NVTB 2H1EA 5DM63 4K8JA 1Y8NB 1SSOA 2QILA 1QG7A 4ULLA 3M4OB 1LABA 1ZYRD 3GD7A 2CQAA 4BA1I 1BOSA 1I4XA 1L0XB 1EZ8A 3BS1A 5CC4A 3N6RA 4C1NK 2IL8A 2E2JB 5C5LA 5C6AA 2EYHA 1XWEA 1TS2A 4K6DA 3M7GA 2WINB 1SNPA 3CRLC 2ICEC 3R2TA 4HMJA 4DK1A 2SNMA 1AZPA 3FKIB 3A7AB 1EY4A 3GV3A 1FGBD 3PV0A 4WRDA 3EJIA 2JSOA 5M3FB 2G9DA 3S16B 3TP5A 4OO1H 5EQ0A 5BN3A 1F77A 5C3XA 2E2IB 5J39A 2NVQB 5I6YA 3HS0C 3I8ZA 3FPPA 2KJXA 2AQ1B 4RGTA 3KK7A 4LAAA 1QCBD 2IJ0A 2DNCA 1CZGA 1QWYA 1STHA 5IGGA 4K14A 5KEEA 1O78A 1EYAA 3M85A 4XXEA 2F03A 2KHSA 3T56B 3DEOA 5NUCA 3DXJC 2MPMA 2JP1A 1PYWD 4XQNA 2A73B 3GTQB 3AB9A 3S17B 2Y0SB 3KLRA 1V1OA 4ABNA 2MGSA 4R8NA 4EVOA 1SYEA 3MVVA 1BO0A 4K5VA 2CHBD 5E4WC 4F7XA 3DUZA 2F0UA 5EGTA 2PW5A 2ZT9C 2WB1B 1SNDA 4WORA 1MD2D 3VR3A 3E6ZX 1XTCD 5D3IB 1CHQD 3PO3B 3PUYA 1PTOF 1ML0D 1I3QB 2YYZA 3KUPA 1SDFA 2AQ2B 4UAIA 1CTMA 5M9OA 2CVRA 3L7ZC 3PIO3 1WVLA 1PLFA 2F0PA 1EY5A 1EZ6A 3R3OA 3EVQA 4HSPA 1AW7A 1PTOH 1JE4A 2K01A 3J80L 4C56C 2J4XA 3D4DA 4HEDA 3HRZC 2K5WA 3MFYA 1BNZA 3MZ5A 2IW3A 3BYYB 2WAQB 5I6WA 3W2DA 3GTLB 4CJ1B 3PMFA 2ID0A 1JQYD 3BVMA 1RTNA 3OW7A 5CV5A 1UAPA 3F2UA 2PMZB 3MXNA 1IKLA 4KKSA 1S5ED 3EQLC 1OXUA 2EYJA 4RAUC 1TWGB 3NP8A 3K5NA 4KKTA 1LT4D 4IFDG 1EQTA 1D5ZC 5FKAC 3AU7A 1ESRA 3K0YA 3CU7A 4ZUJA 2K5QA 2BE5D 3GQBA 1BBXC 4ZK9B 5JEAG 4G57A 1I4PA 1K8MA 3BG3A 1ET6A 3Q6SA 2JE6I 1SE4A 4QF4A 1TT2A 4CJ0B 1F2MA 1U4LA 1SNCA 4ZKBB 5EBCA 4PMBA 3HGBA 3MWYW 1EFID 1JB3A 2RDFA 1HFNA 1FNUA 2X69A 2EOTA 1QB5D 4FYDA 1WTPA 2H4OA 3SE0A 2HCIA 1B9MA 3DEPA 3D3RA 1TWAB 2A6EC 1GUWA 4K2KA 1W6KA 2Z4IA 1ENFA 2FHTA 4Y7NB 3PUWA 2MUYA 3PUXA 2ENBA 1S4ZA 4ZLTF 2PO4A 1KTKA 4ZAIA 1PXUA 3BDCA 4KMUC 3M3YB 4IN3A 1B9NA 5A35A 2F0DA 1A3VA 4DAYA 1Q8IA 4C3IG 4C1NI 1MSHA 2EDGA 2QDBA 5KGUA 1J8IA 4XIGS 3CKIB 5CBAE 1DONA 5C4JB 5I9PA 1EY9A 1CFMA 2Q8TA 3TBIB 3NSWA 2RSNA 3D31A 4IUNA 3OHXC 3P20A 1U4PA 1BCPF 1OXSC 4RHRA 1ILQA 1X3QA 3E0JA 1CI3M 3EA6A 4G7ZC 1NUCA 4XQJA 3V2TA 2EPBA 1ICWA 1CZWA 4F88A 5JVH3 3W3AA 5CGKA 1JORA 3SK6A 2EYOA 2CW0C 3VR2A 1NR2A 3C3LA 2TMPA 3BDOA 5M3MB 2EYLA 1QILA 1I50B 1GUSA 1CA5A 2F0VA 2F3VA 5KIXA 3Q0AA 3SVMA 1BR9A 1ILPA 4DXGA 5FK9C 1JWSD 5IGBA 3NBHA 4RKLA 1Q3LA 4FO2A 2A68D 1H9RA 1G6ZA 4CGYB 2B2YC 4YIJA 1TY0A 2KUMA 3C2PA 1EU3A 1TS5A 3IKJA 3SK8A 3ND9A 5KYLA 4TKOB 3R93A 2K1BA 1YNJC 3KBGA 1KLUD 2NUCA 5EBDA 3Q22A 1JWUD 3UI2A 3KLSX 4P2CB 5E4XA 2RKSA 4XYOA 4HTHA 3I4MB 4WJWA 3QB3A 5CORA 2L55A 4K5XA 2NN6H 3Q23A 3D4RA 3P1HA 2LS01 2I07B 2WV6D 5M5XB 5BN4A 4V0BA 3I72A 3FPUB 4M1UB 1A2TA 4BY1B 1STYA 3MC0B 3NQIA 1CK1A 5G3LD 2E2DC 2OF1A 2I46A 2TSSA 4XT1B 3ND8A 2HDMA 5C5MA 3GTJB 2KCCA 2L0CA 1J9OA 3S2DB 1WTQA 5CV7A 2N88A 4C3JG 3U9OA 3K5OA 2NN6I 4KY5A 1EIGA 1R4PB 4RHSA 3S1RB 3A56A 5EJWA 1DM0B 3CHBD 5DAUA 2RQXA 3MHBA 3GTMB 1QE6A 3KLSA 5I2YA 1HTLD 1SYFA 2OEOA 2JA5B 4IQZA 1JOOA 4FVMA 4OL7A 1Y1WB 3G7LA 4ILWA 2F0IA 3D4WA 1PFNA 4A3BB 1STNA 4IUUA 1TY2A 1TR5A 5C0XI 2RA4A 4OO1G 4EQPA 2OXPA 3GTOB 4K6LA 3J81E 2L4NA 2D2CC 5JPMC 3DHQA 4OHJA 1EY6A 1K8OA 2ZXOA 2EY2A 4Q5VA 2DY8A 1TS4A 5IGCA 1M4VA 5CV6A 1TIID 3URYA 2B2VA 3TSSA 2Z4HA 1OO9B 4N9TA 5ELCA 1UUPA 5C0XJ 1BCPC 5KNBA 4PV1C 4BA2I 4C3IB 5D14A 2NZ1D 2F0HA 1A2UA 3R8BA 3LWEA 1B2TA 3TMEA 1EIHA 1X32A 1STAA 3HOXB 5EKLA 2AQ3B 3NPPA 4H13C 3S1QB 2L1BA 3RUZA 2DN8A 3D8GA 3HZXA 1YNNC 3NBIA 5A2QE 5CV8A 3K58A 1AZQA 1ET9A 2FINB 4RCNA 1HRJA 3RD4A 3L9AX 1LTID 2A69D 4A3DB 3QOJA 3A7LA 4IUPA 1I6HB 2AUJD 1PZJD 3QJYA 3HOVB 3H0GB 2A6HC 2A74C 1JR0D 1SNMA 1FNVA 1GUNA 1ESFA 3GO5A 3X3MA 3RMHA 3JAME 5M5YB 4JK1C 3MA2B 4NMZA 5COYA 2KECA 2EYPA 4J8QA 3V96A 1LTBD 1D2BA 2F4IA 2EYMA 1BF4A 3RLFA 2Q8RE 1A6XA 3K7AB 1CT1D 4ODGA 3OWEB 1Y8OB 1G2SA 1GXDC 5EKIA 1RCVD 4KV6A 3GTKB 1DOLA 1KNAA 1HCZA 2B2VC 2QF7A 2A6ED 5F2DA 2M9VA 1CM9A 4BBSB 2FMCA 2AWNA 4KD4A 1LT6D 5I2XA 3IFDA 4BY7B 1Y1VB 4C3HB 3OOCA 4H0LC 2B63B 5C4ZA 4KK7A 2PQEA 2KQ3A 1CHPD 4NKLA 3I70A 4C2MB 5FLXL 2F0QA 3NK9A 4B9XA 1RKNA 4A3JB 1LTAD 1QNUA 2BCOA 2XWJB 3ZYYX 2R92B 4HR7B 1CQVA 1T5XD 2QCPX 2OT2A 5CMDA 5I4DA 2PCFB 4K2LA 1Y8PB 3H09A 2K28A 2EYFA 4C3JB 2JA6B 2B39A 4NW2A 2C9OA 5CV9A 1C8CA 3SK5A 2CW0D 1GHKA 1R9TB 4FF2A 4KJOA 3NE5B 1B4OA 4ZKCB 4TRDA 5D3DA 3HEJA 1HQMC 3GTPB 2ZXRA 1B3AA 1PTOD 4KI0A 1IL8A 2XNAC 4KJNA 4LJZC 2A69C 1HPCA 3HKZB 1U4RA 3NWSA 2EY5A 1PZID 3J81L 3HOWB 1I4HA 1YNJD 5ISRA 3NTHA 2FMMA 2Z1CA 1FYCA 1EWCA 4ZYSA 3HOUB 4L63B 1SMYC 4DN4M 5E1FA 1O7ZA 4X3SA 2NVYB 4FF1A 4I7ZC 1T5EA 3QG1A 3H91A 4X3UA 1IW7C 1SE2A 4FXGC 5JAVA 1AFPA 3I90A 1O7YA 2F0LA 2B2UA 1VMPA 4KKUA 1CA6A 3BZDB 2F0JA 4O1NA 5IGEA 4HCEA 2ZXPA 3LX0A 2VUMB 1OXTA 3V05A 2EJMA 5LHY1 3I3CA 1QJOA 2JXMB 3T16A 1HHVA 2V4DA 2WKCA 2XRQD 4BBRB 4QUFA 5A2QL 4Z9CB 4HMIA 1KAAA 2EE1A 1Z6HA 2EZVA 2JEBI 1II3A 3NTIA 1Y69U 2L9HA 4GZYC 2K33A 3J7YW 4R8IA 1LTRD 3KBXA 3GP7A 4IUVA 4HSVA 3AMUA 1EWHA 3MAQA 1PZKD 3EROA 2K04A 3ONAB 2KA7A 1I4RA 3OPOA 2B8GA 1SE3A 2SDFA 4NDXA 2QKIC 1PDQA 2NN6G 3CQZB 2BA0A 4RGMA 4DFAA 3MEHA 3BVGA 1Q12A 5DM73 4JBWA 1PTOB 2EY1A 1X3PA 2PW7A 3HOYB 1VCIA 3A54A 3NQTA 3SEBA 4O42A 1LO5D 2XSCA 1Q1EA 2B2TA 4RCOA 4HAEA 5M5WB 3S1NB 2XN9C 4DNTB 3VR4A 1PRTF 1PTOC 2ICIA 3S1MB 3FDTA 3VA7A 1ZKOA 4QMGA 5CYUA 3NUCA 5G3LF 4RKBA 3TDQA 1R4QB 2FJ2A 1D1IA 1EYCA 3C1FA 4B9WA 1H9SA 3ERQA 4TQUS 1F9SA 1RD9D 4KD3A 1BCPD 5E3FA 1PFMA 5D65A 5HGTA 4B08A 3C46A 1DD2A 1SNOA 5JEAJ 1LACA 2D9UA 1MSGA 2EVBA 5ELEA 2QEJC 3TP8A 1TWCB 1G291 1Q1BA 1KLGD 3LNNA 1V43A 1SEBD 5C4HA 1SYCA 1YNND 3X3NA 2JEAI 2O5IC 1AEXA 1IYVA 1JCKB 4K8IA 5EPLA 3T53B 1IKMA 4L6TB 1F2LA 2MP1A 4KHZA 2MJ8A 4A3EB 1SNQA 4QCLA 4G7HC 1BDOA 1V1PA 4M8AA 4IUQA 1I6VC 1F2YA 2NWGA 2A6HD 5C0XH 2F0EA 4UDUC 3QOLA 5DNFA 2DNEA 4FP5D 2L5TA 1C4QA 1TVXA 3TZUA 4CKBA 2K7VA 3H6MA 1H9SB 1TQOA 2VNUD 5J1ZA 5JPNC 1STBA 2F0SA 2BOSA 2R93B 5C4XB 2NTSA 4G4KA 4CKEA 1CQFA 3FVQA 3VA5A 5FO9B 1S5DD 2IT1A 4G7OC 2LKVA 4S3SA 1WD0A 2K6AA 2LFNA 4KN4C 1LLRD 1FD7D 4Q0FA 1WTWA 1KNEA 1BQQT 1G8ZD 1IYUA 2SEBD 3ITPA 1B53A 1BXTA 2IWHA 2AUKA 1Q90A 4L8JA 1H9JA 3P7JA 1BCPB 2KEDA 1PMRA 5K36H 1WTRA 1OXXK 5LL6S 4DAPA 3I91A 3PUZA 3MXUA 3IAYA 1Z47A 3SK4A 4ME5A 5IT9E 3MTSA 5IODA 2BDNA 5ELFA 1DOKA 2JYOA 4FF4A 3N52A 2HDLA 3DMUA 5EPKA 4DXFA 5LL6X 1PRTB 3M7NA 2O2LD 2N55A 2PZWA 1AN8A 1RJTA 1C48A 4FXDA 2R6GA 2MHVA 3IL8A 1O7LA 5I9OA 3VYUA 4V190 1FNWA 3TP6A 1U9RA 2EJGC 1GHJA 3OMCA 3QO2A 1PRTC 4DF7A 2KCNA 5C44B 3VR5A 4RGOS 1SMYD 1VMCA 5DEHA 1JICA 2PZTA 4FNFA 2NYZD 4H7BA 3K6OA 3NWTA 2E74C 1HUMA 3R2IA 1IW7D 2XWBB 1G2TA 4IUTA 4ZUIA 1H9MA 1M8AA 4OGQC 1HA6A 1KABA 3J7AF 3DWQA 1U4MA 3BVZA 3OIQA 3A55A 2K5DA 1KDBA 3DM1A 2D62A 5FOBB 2A5HA 4OO1I 3WOEA 3SDZA 3I4LA 3QWNA 1TU2B 5EKKA 3HP3A 1D6EC 2KEEA 1EU4A 2VB2X 1LT5D 1RDPD 1NR4A 4KHVA 1SYGA 5KNCA 2F0KA 4F87A 1HA5A 4MN3A 5ELBA 1SBBB 1DZ1A 3HOZB 1OXVA 4QIWB 5CR3A 3D6CA 3P75A 2WP8J 3VYTA 3OWFA 1HXYD 2IPKD 2HCCA 4DA2A 4A3KB 1XYIA 3HG9A 1D5XC 2C5CA 5BN5A 1NAPA 1MGSA 2KOLA 1JOKA 4OIJA 1WCMB 3PO2B 1V8QA 5JJZA 5JVG3 5FO8B 2EXZA 4BS9A 1SYDA 2PZUA 1ONLA 2GA4B 1MI2A 3KF8A 1ZYRC 5C3EB 1SJHD 2KVMA 3VYRA 4EQOA 1TKWB 2R3ZA 3BDLA 4MHEA 4RH6A 5FO7B 1F9PA 2PPBC 2F0MA 1ZEQX 2L11A 2VXWA 1NSNS 4A3GB 2HUGA 3NTKA 2XRSD 2J7ZA 5IGDA 2E75C 3S15B 2RDGA 4DNRB 2XVSA 4XT3B 2F3WA 1B50A 3S14B 2F0OA 4X3TA 1HQRD 4AYBB 3PIP3 1Z7TA 1ENCA 1RTOA 5IOCA 2IX1A 4A3IB 2Q8IB 4LK1C 4J1MA 2O5JC 3K5LA 3T13A 2M2LA 4MIUA 1O80A 2J0TD 4A3FB 3DWAA 4PMWA 2R61A 4R9WA 2RDHA 3RZDB 1GUTA 1ZXTA 3OMGA 1JC7A 3EFXD 5AFWA 1HTPA 3IFTA 5IGFA 1LV9A 1H9KA 5IT9L 4X3KA 1F9RA 1E0BA 3L3OC 4DGZA 1STGA 4BWGB 2LY7A 1W6JA 3WOFA 1G91A 1VF7A 3QIAA 5T1GA 2Z8LA 1RHPA 2B2YA 1PFBA 3CRKC 1JOQA 2X6GA 4KY7A 4K5WA 2JA8B 3FRPB 2XIWA 1S5FD 2VB3X 4RA8A 2B2WA 4KY6A 3NXWA 4IFDH 1TS3A 2WIIB 5EPJA 2F0FA 3G6JB 3D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SDF A;  1EOT A;  3LWE A;  2B2W C;  1CM9 A;  2HUG A;  1EIG A;  1B2T A;  4DN4 M;  2J7Z A;  1WTP A;  3I8Z A;  3I91 A;  1O7Z A;  1U4M A;  4X3S A;  1JE4 A;  1PDQ A;  2K01 A;  1X32 A;  2L12 A;  3IFD A;  5EPL A;  1IKM A;  1EIH A;  4XT3 B;  1A15 A;  1F2L A;  3TZD A;  1Q3L A;  1SAP A;  3DM1 A;  2MP1 A;  1B50 A;  1NCV A;  4HCS A;  2HCI A;  2MJ8 A;  1G6Z A;  5EJW A;  4HED A;  4X3T A;  2B2Y C;  1BNZ A;  2L1B A;  3H91 A;  1X3P A;  3DEP A;  4QUC A;  4X3U A;  1RTO A;  2K03 A;  2KUM A;  5T1I A;  3MTS A;  4IUQ A;  3TN2 A;  1QE6 A;  1HFG A;  2NWG A;  3I90 A;  1O7Y A;  4IUR A;  5D14 A;  2B2U A;  1ROD A;  2K05 A;  1VMP A;  4O42 A;  3R93 A;  1GUW A;  1HUN A;  2K1B A;  4CJ1 B;  2BDN A;  3HP3 A;  4RWS C;  1AZQ A;  2FIN B;  4XDX A;  1CA6 A;  1HRJ A;  2KEE A;  1XX8 A;  2B2T A;  1RTN A;  2FHT A;  1F9Q A;  4HAE A;  1DOK A;  5DNF A;  1NR4 A;  2JYO A;  1S4Z A;  3DEO A;  4ZLT F;  3N52 A;  2HDL A;  2MPM A;  4MN3 A;  2M2L A;  4ZAI A;  3F2U A;  1O80 A;  3UI2 A;  1IKL A;  1WTR A;  1TVX A;  4IUP A;  5E4X A;  1DZ1 A;  2JP1 A;  5EPK A;  3G7L A;  4R9W A;  2H1E A;  2N55 A;  1WTO A;  3FDT A;  1MSH A;  1PFN A;  3I3C A;  4RAU C;  5CMD A;  5COR A;  1SSO A;  1ZXT A;  1WTV A;  4IUU A;  1QG7 A;  5AFW A;  1RJT A;  1WD1 A;  1J8I A;  3IL8 A;  2RA4 A;  5CBA E;  2FFK B;  1HHV A;  1LV9 A;  1DON A;  2K28 A;  4NW2 A;  1WTW A;  1EQT A;  2FJ2 A;  4X3K A;  1F9R A;  2Q8T A;  2MGS A;  1C8C A;  1BO0 A;  1F9S A;  2HCC A;  1ESR A;  2L4N A;  4QUF A;  1E0B A;  2IL8 A;  2RSN A;  1XYI A;  2B2U C;  5E4W C;  3FPU B;  1U4P A;  1WD0 A;  3QO2 A;  5COY A;  1NAP A;  1ILQ A;  1MGS A;  2EE1 A;  2KEC A;  1ILP A;  1X3Q A;  2X6L A;  1PFM A;  5D65 A;  1BBX C;  4ZK9 B;  2B2T C;  2KOL A;  1B4O A;  4OIJ A;  4ZKC B;  2DY8 A;  1G91 A;  1BF4 A;  5T1G A;  2D9U A;  1KNE A;  2L9H A;  1VMC A;  3Q6S A;  5JJZ A;  1RHP A;  2B2Y A;  1JIC A;  2Q8R E;  2EPB A;  1MSG A;  1EL0 A;  1ICW A;  2RSO A;  1PFB A;  1MI2 A;  4U68 A;  4R8I A;  4CJ2 C;  2B2V A;  3KBX A;  4CJ0 B;  4IUV A;  4HSV A;  1B3A A;  5CBE E;  2X6G A;  4XT1 B;  2KVM A;  1AZP A;  2HDM A;  1B53 A;  1ML0 D;  1U4L A;  1IL8 A;  1G2S A;  2NYZ D;  2R3Z A;  3GV3 A;  4MHE A;  4ZKB B;  2XIW A;  1HUM A;  5EKI A;  4RA8 A;  3KUP A;  2B2W A;  1G2T A;  1SDF A;  4OIK A;  1U4R A;  3GV6 A;  3MWY W;  1DOL A;  4UAI A;  1J9O A;  1F9P A;  2K04 A;  4IUT A;  1KNA A;  1AP0 A;  1NR2 A;  2B2V C;  2CVR A;  2DY7 A;  3P7J A;  3ONA B;  1WTQ A;  4LMQ D;  1HFN A;  1WVL A;  1PLF A;  2KED A;  1M8A A;  2L11 A;  5EQ0 A;  1CA5 A;  1HA6 A;  2X69 A;  5EPJ A;  1QNK A;  2VXW A;  2RVL A;  1DOM A;  2FMM A;  2N88 A;  2EOT A;  3SVM A;  1WTX A;  2NZ1 D;  3D6W A; 
#chains in the Genus database with same CATH topology
 3J81 j;  2F0N A;  1EY0 A;  3J7A V;  2HD3 A;  4DUY L;  1UNS A;  1B1Z A;  1SXT A;  3A8J E;  3GTM H;  5IP9 H;  3TZD A;  1DJR D;  2VY3 A;  4HCS A;  5JEA H;  1I4Q A;  4KTA A;  1DCZ A;  3S9W A;  4JI6 L;  1STE A;  2UUA L;  4XYQ A;  1I5F A;  2JA5 H;  4QUC A;  1L2F A;  2K03 A;  4A3M B;  5T1I A;  4RG1 A;  3NHH A;  4IPG A;  4OWW B;  1HFG A;  2KEN A;  4IUR A;  4NP5 A;  3I4N B;  2K05 A;  1Y1W H;  1RF2 D;  3JAM L;  2AWO A;  2RHQ B;  2BA1 A;  1K3R A;  3A5Z B;  4XDX A;  1D5M C;  1PH9 A;  2O4X A;  4ID6 A;  1TWH B;  3SXH A;  1A3U A;  5KYI A;  4A3B H;  2EJF C;  5M3F G;  3DWP A;  2KCM A;  4HIM A;  1FL0 A;  2HHH L;  4IFD I;  1KIX A;  1WTO A;  5GAG C;  4JYA L;  1WI5 A;  1WTV A;  4O2D A;  1WD1 A;  1A3T A;  1EWI A;  2E76 C;  2FFK B;  4PNY A;  2F0G A;  1KQS A;  1FR3 A;  2WAC A;  1BKB A;  1NMG A;  1SR3 A;  3U58 A;  1E2Z A;  3OSO A;  4ZCK A;  1IL2 A;  2B2U C;  4WFN 3;  1EYD A;  1GUO A;  3A5U A;  1E2V A;  4DR1 Q;  1EY8 A;  3LWU A;  3S2H B;  2PYK A;  2RBM A;  2X6L A;  1ICF B;  2JA7 B;  2E2H B;  1LTT D;  4CDE C;  5JOB A;  4DAV A;  3TP7 A;  3MXG A;  3K59 A;  1XPU A;  1Q46 A;  3U9S A;  1V9P A;  1T9H A;  4CKC A;  4EQN A;  4IFD J;  5CBE E;  3A8K E;  4ZRZ A;  1XXG A;  3I73 A;  2QGQ A;  5C0X G;  3M4Y A;  2NZO A;  1MBY A;  2GVA A;  4H44 C;  1LYL A;  3VR6 A;  3RZO B;  4OIK A;  3GV6 A;  1D1K A;  4GOP C;  1AP0 A;  3KDF A;  4XQQ A;  4DUY Q;  2ES2 A;  2BE5 C;  4BXX G;  2UUB L;  2Y0S G;  1QNK A;  2IX0 A;  2RVL A;  1DOM A;  3T4A C;  3HOX H;  4A93 B;  4YCV A;  4PZ8 A;  1EOT A;  2B2W C;  1VQ4 A;  3PCO B;  4JI6 Q;  3S1Q H;  1TWF B;  1EQV A;  4EQ5 A;  4L5R C;  1GUG A;  4TSS A;  3I7F A;  1RL2 A;  4I65 A;  3MFG A;  4IOC A;  1YEZ A;  2M00 A;  1EY7 A;  1A15 A;  4LF4 L;  2PNR C;  2IHE A;  4CBV A;  4GLX A;  4X65 Q;  1I4G A;  1A8V A;  2EY6 A;  3VYS A;  3BYT B;  3J81 i;  4JPB W;  1LTG D;  3HKZ E;  3PSI A;  1BVS A;  3TN2 A;  5KRU A;  1JMC A;  1VQK A;  1EEF D;  4PQX A;  1DXM A;  1LT3 D;  4LFC L;  5TSS A;  4A3D H;  5ELD A;  1ROD A;  3K57 A;  2A19 A;  4DV4 L;  3MXP A;  3I2Z A;  4X64 L;  1E2W A;  1XX8 A;  1DYQ A;  2E8G A;  2BDO A;  2GVB A;  4J6H A;  1I94 Q;  4BY7 G;  4PMC A;  1F9Q A;  4DK0 A;  4C3H G;  5C44 H;  1Y14 B;  1GKH A;  4LF6 Q;  1RIP A;  5HUR A;  2Q2T A;  2KBN A;  3HOV H;  3H0G H;  1BUV T;  1PRT D;  1NBW A;  2F1M A;  3H94 A;  3FMC A;  3CPW A;  1EIF A;  5KND A;  5IP7 G;  2HQE A;  1E7Z A;  1N32 L;  4JBJ A;  1SE8 A;  1SJE D;  5LMU L;  1VQ5 A;  5M5Y H;  3T51 B;  2LMC B;  4RGN A;  3NEL A;  2IX3 A;  5K36 G;  1VF5 C;  2WKD A;  1GOZ A;  1IHZ A;  5FLX E;  2YU9 B;  2SNS A;  4LF5 Q;  2R92 G;  5IYD H;  3E5S A;  4QB4 A;  1EEI D;  1S72 A;  2WAQ G;  4IAL A;  5K5P A;  1IBK L;  2B2T C;  4LFA Q;  4EGV A;  4F8M A;  1KDC A;  4OWX B;  3J80 E;  3Q24 A;  1SFO B;  2R7Z B;  1JB7 A;  2K32 A;  1N34 L;  1L0Y B;  4ZQ3 A;  1ENA A;  1EL0 A;  2RSO A;  1B3Q A;  4U68 A;  3GTK H;  1S5B D;  4CJ2 C;  2F0W A;  4FXK C;  5J22 A;  3FEW X;  3OIP A;  1VQO A;  2UUB Q;  3WDN A;  3CC7 A;  1JWM D;  2G9H D;  4OX9 L;  1SYB A;  4DU9 A;  4DR6 Q;  5IYB G;  5FJ8 G;  1B44 D;  3A8I E;  3CMA A;  4BBS H;  4K0K L;  1LTS D;  4IZ8 A;  1VQA A;  4DUZ Q;  2DY7 A;  2B8F A;  2F0T A;  4LMQ D;  4XTC S;  3KYH C;  4CHT B;  2ZJQ A;  2D5D A;  3GTG B;  1F2Z A;  1E1O A;  1WTX A;  1Y1V H;  5CV4 A;  4N9P A;  5C3W A;  1QOH A;  1KDA A;  2B63 H;  2NB0 A;  2NTT A;  4HN7 A;  4RFB A;  2DUD A;  1S5C D;  3HOZ H;  5IIF A;  1K83 B;  2L12 A;  2NVX B;  4LFC Q;  1SAP A;  2BH2 A;  1NCV A;  4C2M H;  1VQH A;  1WOC A;  2UU9 L;  3H3V C;  2JQO A;  2NBF A;  1X9N A;  4FF3 A;  1U5K A;  2SOB A;  4E6I A;  2V1C C;  3O13 A;  1UEA B;  4A3J H;  1FJG L;  4A3K H;  2Z9H A;  1HUN A;  1YHA A;  3CCL A;  4L5T A;  4RWS C;  1N33 Q;  2OQ0 A;  2VS1 A;  4U67 3;  3K5M A;  3SHL A;  2AMC B;  1V1P B;  2PQA B;  4GKK L;  2JA9 A;  3SR1 A;  5LMU Q;  1FGU A;  1VS0 A;  2Q2I A;  3C1E A;  3PUV A;  1K73 C;  4KN7 C;  4IJH A;  2A68 C;  1VDZ A;  3IRB A;  4C3J H;  4LUZ A;  2JA6 H;  1GJX A;  2NVT B;  2H1E A;  5DM6 3;  2F3I A;  4K8J A;  3E9H A;  1Y8N B;  1SSO A;  2QIL A;  1QG7 A;  4ULL A;  3M4O B;  1LAB A;  1WTH A;  1ZYR D;  3AFQ A;  5IT9 c;  2VUM G;  3GD7 A;  2CQA A;  1X3G A;  4BA1 I;  1BOS A;  1I4X A;  1E3P A;  1R9T H;  1L0X B;  1JE5 A;  1EZ8 A;  1HZ9 A;  3BS1 A;  1IBK Q;  5CC4 A;  3N6R A;  4C1N K;  2IL8 A;  1N34 Q;  2E2J B;  3PGZ A;  5C5L A;  3GTP H;  5C6A A;  2EYH A;  1XWE A;  3S15 H;  3NEN A;  1XMO Q;  1TS2 A;  4K6D A;  3M7G A;  2WIN B;  1SNP A;  2E5L L;  3CRL C;  4OX9 Q;  3S14 H;  2ICE C;  3R2T A;  4HMJ A;  4BBR G;  4DK1 A;  2Z6B A;  2SNM A;  1AZP A;  4A3I H;  3HOW H;  3FKI B;  3A7A B;  1EY4 A;  2VZA A;  3GV3 A;  1FGB D;  4A4I A;  1PHJ A;  3PV0 A;  4WRD A;  3HOU H;  3EJI A;  2JSO A;  1W3S A;  5M3F B;  2OTJ A;  2G9D A;  3S16 B;  3TP5 A;  4OO1 H;  2UXB L;  5EQ0 A;  5BN3 A;  1F77 A;  2NVY H;  2UXD Q;  5C3X A;  2F4V L;  2E2I B;  3D0F A;  5J39 A;  2UU9 Q;  2NVQ B;  5FLM G;  5I6Y A;  3HS0 C;  3I8Z A;  3FPP A;  2KJX A;  2LXJ A;  2AQ1 B;  4RGT A;  3KK7 A;  4LAA A;  1FJG Q;  1QCB D;  1Q86 C;  1PH7 A;  3UDG A;  2IJ0 A;  4AH6 A;  2DNC A;  1CZG A;  1QWY A;  4OEL B;  1C9O A;  4GKK Q;  1STH A;  3JAM c;  5IGG A;  3G6E A;  4K14 A;  5KEE A;  5JJK A;  3PIP A;  1O78 A;  1EYA A;  2PI2 E;  4IO9 A;  3M85 A;  4XXE A;  1UE5 A;  2F03 A;  2KHS A;  3T56 B;  2I5H A;  3DEO A;  5NUC A;  3DXJ C;  2MPM A;  1XTD A;  5M3M G;  2JP1 A;  1PYW D;  4XQN A;  1K0R A;  1WJJ A;  1B70 B;  2A73 B;  4P71 A;  3GTQ B;  2JJQ A;  2JA8 H;  3AB9 A;  4JI2 Q;  3ER0 A;  3CCV A;  3S24 A;  4P75 A;  4B3S Q;  4GN3 B;  3S17 B;  2Y0S B;  4NXN L;  3F2B A;  5GAE C;  1YHB A;  3KLR A;  1GD7 A;  1V1O A;  4ABN A;  2MGS A;  4R8N A;  4EVO A;  1SYE A;  3MVV A;  4WJ4 A;  1BO0 A;  4K5V A;  2E5L Q;  3E0E A;  3ULL A;  3W1B A;  2CHB D;  2CH4 W;  4JVZ A;  5E4W C;  4PZ6 A;  3JC6 6;  4F7X A;  3DUZ A;  2F0U A;  4UP8 A;  5EGT A;  2G5D A;  3CXC A;  2PW5 A;  2ZT9 C;  2WB1 B;  4DV7 L;  1AH9 A;  1SND A;  4LW1 A;  4WOR A;  1MD2 D;  3VR3 A;  3E6Z X;  1XTC D;  5D3I B;  3CCQ A;  1CHQ D;  3U4V A;  3PO3 B;  5BR8 L;  3PUY A;  2UXB Q;  1PTO F;  1ML0 D;  1I3Q B;  2YYZ A;  3KUP A;  3I4M G;  1SDF A;  4JV5 Q;  2AQ2 B;  4UAI A;  1CTM A;  1TWH H;  5M9O A;  2CVR A;  3L7Z C;  3RLO A;  3PIO 3;  1WVL A;  1PLF A;  2F0P A;  2L15 A;  1EY5 A;  1XNQ L;  3CP0 A;  3CQZ H;  1EZ6 A;  3R3O A;  3EVQ A;  4GNX A;  4HSP A;  1X54 A;  2OCE A;  1AW7 A;  1PTO H;  1JE4 A;  2K01 A;  3J80 L;  4C56 C;  3TRE A;  3HOY H;  2J4X A;  2ZTC A;  1N36 Q;  2K52 A;  3D4D A;  5IYC G;  4HED A;  3HRZ C;  2K5W A;  3MFY A;  1BNZ A;  3MZ5 A;  2CQO A;  5HY6 A;  1VQB A;  4BY1 G;  2IW3 A;  1XPR A;  5J3B A;  3K0X A;  3BYY B;  2WAQ B;  5M5W H;  1SRU A;  3S1N H;  2YTV A;  5I6W A;  4R4O A;  3W2D A;  4AQY Q;  4CJ1 B;  3GTL B;  3PMF A;  2ID0 A;  1JQY D;  3BVM A;  4FDB A;  1RTN A;  3OW7 A;  4A3E G;  1AE2 A;  3L0O A;  3S1M H;  4IPC A;  5CV5 A;  4PG3 A;  4DV0 L;  1UAP A;  3F2U A;  2PMZ B;  3MXN A;  1IKL A;  4NXN Q;  4KKS A;  1S5E D;  2GN5 A;  4JI4 Q;  3EQL C;  1OXU A;  2EYJ A;  4RAU C;  1TWG B;  2ASB A;  3NP8 A;  3K5N A;  4KKT A;  1LT4 D;  4IFD G;  1EQR A;  4NB3 A;  1U0L A;  1EQT A;  1EIY B;  1D5Z C;  2PNH A;  5FKA C;  1LTL A;  3AU7 A;  1ESR A;  3K0Y A;  3CU7 A;  4ZUJ A;  2K5Q A;  2BE5 D;  3KF6 A;  5IP9 G;  3KJO A;  3GQB A;  1BBX C;  4ZK9 B;  5JEA G;  5BR8 Q;  4G57 A;  1I4P A;  1K8M A;  3BG3 A;  1ET6 A;  2JA5 G;  3EN2 A;  3Q6S A;  2JE6 I;  1SE4 A;  4QF4 A;  1TT2 A;  1UE1 A;  3HFZ B;  4CJ0 B;  1Y1W G;  1F2M A;  1U4L A;  1B8A A;  1XNQ Q;  1KHI A;  1SNC A;  4ZKB B;  5EBC A;  4PMB A;  4DV6 Q;  1PFS A;  3HGB A;  3MWY W;  2N8N A;  1EFI D;  4A3B G;  1JB3 A;  2RDF A;  3VDY A;  1HFN A;  1FNU A;  2X69 A;  1K0S A;  4A3C H;  2EOT A;  1QB5 D;  4FYD A;  1IYJ B;  1WTP A;  2H4O A;  1HNZ L;  1XNR Q;  3SE0 A;  3UDI A;  4OEM B;  4CDF C;  2HCI A;  1B9M A;  3M9B A;  2DJG C;  4JOI C;  4GNX C;  3DEP A;  4TVA B;  4NXM L;  3D3R A;  4YY3 Q;  4JI0 Q;  1TWA B;  2A6E C;  1GUW A;  4L5S A;  4K2K A;  3ULP A;  1W6K A;  2Z4I A;  1ENF A;  2FHT A;  4Y7N B;  3PUW A;  2MUY A;  1K9M C;  3PUX A;  2ENB A;  1S4Z A;  4ZLT F;  1SMX A;  2PO4 A;  1KTK A;  4ZAI A;  1PXU A;  2R93 H;  1HZC A;  3BDC A;  4KMU C;  3M3Y B;  4IN3 A;  1B9N A;  5A35 A;  2F0D A;  3DLL A;  2K5H A;  5C4X H;  4GKJ L;  1A3V A;  4DR7 L;  1N9W A;  1P8L A;  4O0A A;  1Q8I A;  2D0P A;  4C3I G;  4DAY A;  4C1N I;  1MSH A;  2EDG A;  3NEM A;  2HQL A;  2QDB A;  4R1J A;  4DR5 L;  5KGU A;  1J8I A;  4XIG S;  3CKI B;  5CBA E;  1DON A;  5C4J B;  2VQE L;  5I9P A;  1EY9 A;  3HOX G;  1CFM A;  4DR3 L;  4YCW A;  2Q8T A;  4HJ9 A;  1KD1 C;  3TBI B;  3NSW A;  2RSN A;  3D31 A;  4IUN A;  1YJ9 A;  3OHX C;  3P20 A;  1U4P A;  1BCP F;  3I55 A;  1OXS C;  4RHR A;  1ILQ A;  1X3Q A;  3E0J A;  2BH8 A;  1CI3 M;  3EA6 A;  3J7A 5;  4G7Z C;  1NUC A;  5JJL A;  4XQJ A;  5GAH C;  3V2T A;  2EPB A;  1ICW A;  1CZW A;  4A3D G;  4QIW E;  4GN5 A;  4F88 A;  1V1Q A;  5JVH 3;  3W3A A;  5CGK A;  1JOR A;  3SK6 A;  2EYO A;  4JBM A;  1PVO A;  2PI2 A;  5C44 G;  4DV2 Q;  2CW0 C;  2HIX A;  1PH5 A;  3VR2 A;  1BBW A;  1NR2 A;  1KC8 C;  4GOP B;  3C3L A;  1D7Q A;  2TMP A;  3BDO A;  5M3M B;  2EYL A;  3HOV G;  1QIL A;  3H0G G;  4POG A;  1I50 B;  1GUS A;  1CA5 A;  4J15 A;  2F0V A;  2F3V A;  5KIX A;  3Q0A A;  3SVM A;  3TEH B;  1BR9 A;  1ILP A;  2ZTD A;  5FK9 C;  4DXG A;  1JWS D;  3CCE A;  3FHW A;  2DJF C;  5IGB A;  4DV3 L;  1CKN A;  4QY7 A;  3NBH A;  4RKL A;  4IJL A;  1Q3L A;  4FO2 A;  2A68 D;  1H9R A;  4YHH L;  4DKA C;  1G6Z A;  4CGY B;  2B2Y C;  2R7F A;  4YIJ A;  1TY0 A;  2CKZ B;  2KUM A;  3C2P A;  1EU3 A;  3PF4 A;  1IZ6 A;  4JW0 A;  1TS5 A;  5IYD G;  3IKJ A;  3ND9 A;  3SK8 A;  5KYL A;  4TKO B;  3CCM A;  4QGU A;  3R93 A;  4DK3 C;  2K1B A;  1YNJ C;  3KBG A;  3T1Y L;  1VQM A;  1KLU D;  2UUA Q;  2NUC A;  4DR7 Q;  5EBD A;  3Q22 A;  1JWU D;  3UI2 A;  3KLS X;  4P2C B;  5E4X A;  2RKS A;  4AYB E;  1XMQ L;  4XYO A;  4UP9 A;  4HTH A;  2VQE Q;  3WWV A;  4DR3 Q;  3U4Z A;  3I4M B;  4WJW A;  3QB3 A;  1DGS A;  3FKI H;  5COR A;  2L55 A;  4BBS G;  4K5X A;  1X3E A;  3TRZ A;  1TXY A;  2NN6 H;  3Q23 A;  3D4R A;  1CSQ A;  3P1H A;  1S3O A;  2LS0 1;  1A0I A;  2I07 B;  2WV6 D;  1VQI A;  2HHH Q;  1Y1V G;  5M5X B;  3F1Z A;  1MJE A;  4R4Q A;  5BN4 A;  2B63 G;  4JYA Q;  4V0B A;  3I72 A;  3HOZ G;  3FPU B;  4M1U B;  1A2T A;  1BBU A;  4BY1 B;  1STY A;  3MC0 B;  3NQI A;  1CK1 A;  4R4C A;  5G3L D;  4NPS A;  2E2D C;  4A3J G;  2OF1 A;  4A3K G;  2I46 A;  1M1K C;  2TSS A;  4A75 A;  4XT1 B;  3ND8 A;  2HDM A;  2ZJP A;  5C5M A;  3GTJ B;  2KCC A;  2L0C A;  1Q7Y C;  1J9O A;  3S2D B;  4HIK A;  3Q8D A;  1KRS A;  4MNO A;  1WTQ A;  5FLX c;  5CV7 A;  3AFP A;  3EIV A;  2N88 A;  2AKW B;  3TQY A;  4C3J G;  2JA6 G;  3U9O A;  3K5O A;  2NN6 I;  4KY5 A;  1EIG A;  4OXP A;  3J80 c;  3KDF B;  3GTQ H;  2P5Z X;  1L0W A;  1E24 A;  1R4P B;  4RHS A;  3S1R B;  1CSP A;  3A56 A;  5EJW A;  2QDL A;  1DM0 B;  3T1Y Q;  3CHB D;  5DAU A;  2RQX A;  4JI8 L;  3MHB A;  3GTM B;  5IE8 A;  1QE6 A;  3KLS A;  5I2Y A;  4L5Q A;  1HTL D;  1E1T A;  4LF4 Q;  1SYF A;  3OYY A;  3TS2 A;  2OEO A;  4JCV E;  5ELO A;  2JA5 B;  4IQZ A;  4Y52 H;  1JOO A;  4FVM A;  4OL7 A;  4AYB G;  3HKZ G;  1Y1W B;  3HKS A;  1YHQ A;  3UDX A;  4A3I G;  1YIT A;  4DV4 Q;  3HOW G;  1PYS B;  3G7L A;  4X64 Q;  3PO3 H;  4ILW A;  2F0I A;  1AE3 A;  3D4W A;  3JAM i;  1PFN A;  4A3B B;  1QUQ A;  1STN A;  1K3B C;  3HOU G;  4IUU A;  1TY2 A;  2IY5 B;  1TR5 A;  4HID A;  5C0X I;  2RA4 A;  4OO1 G;  4EQP A;  2OXP A;  2ZM6 L;  3GTO B;  1Q82 C;  1VQC A;  4K6L A;  4B3T L;  3J81 E;  2L4N A;  1WCM H;  4HIO A;  1N32 Q;  4LF8 L;  3PO2 H;  2K50 A;  2D2C C;  2MO0 A;  5JPM C;  3K7U C;  3DHQ A;  4OHJ A;  1EY6 A;  4JI5 L;  1K8O A;  2ZXO A;  2EY2 A;  5C3E H;  4Q5V A;  1QZG A;  2DY8 A;  1TS4 A;  5IGC A;  1M4V A;  4B3R L;  5CV6 A;  1TII D;  3URY A;  2B2V A;  3TSS A;  1OTC A;  2Z4H A;  1OO9 B;  4N9T A;  5ELC A;  1UUP A;  5C0X J;  4A3G H;  3T1H L;  1KXL A;  5AJ3 L;  1BCP C;  5KNB A;  4PV1 C;  4BA2 I;  4C3I B;  2KHJ A;  2NZ1 D;  2F0H A;  5D14 A;  1A2U A;  3R8B A;  3LWE A;  1B2T A;  3UDF A;  2JA8 G;  2NZH A;  3TME A;  4K0K Q;  4JI8 Q;  1EIH A;  2K5N A;  1X32 A;  3PIO A;  1STA A;  3HOX B;  5EKL A;  2AQ3 B;  3NPP A;  4H13 C;  3S1Q B;  2L1B A;  3RUZ A;  2DN8 A;  2MNA A;  3D8G A;  3HZX A;  3G71 A;  1HZA A;  2MQH A;  1YNN C;  3NBI A;  5A2Q E;  5CV8 A;  3K58 A;  1AZQ A;  1ET9 A;  2FIN B;  4RCN A;  4A3F H;  1HRJ A;  3RD4 A;  3L9A X;  3KFU A;  3RZD H;  1LTI D;  2A69 D;  1J5E L;  4A3D B;  1WYD A;  3QOJ A;  4A3L H;  3A7L A;  4IUP A;  1I6H B;  2ZM6 Q;  4DAM A;  2AUJ D;  4LUV A;  4B3T Q;  2I0Q A;  3I56 A;  1PZJ D;  2IHF A;  3QJY A;  4LF8 Q;  2ZTE A;  3H0G B;  1NTG A;  3HOV B;  2A6H C;  2A74 C;  1VQF A;  4WJ3 M;  4LF7 L;  2HT1 A;  1JR0 D;  1SNM A;  1FNV A;  1EUJ A;  1GUN A;  1ESF A;  3GO5 A;  3X3M A;  3RMH A;  1N8R C;  3JAM E;  5M5Y B;  2RCN A;  4JK1 C;  3MA2 B;  1Q81 C;  4DV5 L;  4NMZ A;  1XJV A;  5COY A;  4MTK A;  2WFW A;  3STB C;  2KEC A;  2EYP A;  3HOY G;  4J8Q A;  2KCT A;  3V96 A;  4DNI A;  1LTB D;  2CWP A;  3ZJY C;  1D2B A;  4KHP L;  2F4I A;  4LNQ A;  2EYM A;  1BF4 A;  3RLF A;  1A62 A;  2Q8R E;  1A6X A;  3K7A B;  1CT1 D;  4ODG A;  3AQQ A;  3OWE B;  1PA6 A;  3CC2 A;  1Y8O B;  1G2S A;  4JI3 L;  1GXD C;  5EKI A;  1RCV D;  4KV6 A;  3GTK B;  4RMF A;  1DOL A;  1KNA A;  1HCZ A;  2B2V C;  5IWA L;  2QF7 A;  2A6E D;  3H15 A;  5F2D A;  1S40 A;  2M9V A;  3J7Z C;  1IBM L;  1CM9 A;  2K75 A;  4BBS B;  2ZJR A;  2FMC A;  4APV A;  2AWN A;  4KD4 A;  1LT6 D;  5I2X A;  4A3M H;  3IFD A;  2AHO B;  4BY7 B;  3I4N H;  4ME3 A;  1Y1V B;  4C3H B;  3OOC A;  4H0L C;  2F4V Q;  2B63 B;  3I4O A;  5C4J H;  5C4Z A;  3CCS A;  4KK7 A;  3PQI A;  1VQL A;  2PQE A;  2VW9 A;  2KQ3 A;  1CHP D;  4NKL A;  3I70 A;  4C2M B;  5FLX L;  4ALP A;  2F0Q A;  3NK9 A;  2N49 A;  4P72 A;  4B9X A;  2CFM A;  1RKN A;  4JI7 L;  4GLV B;  4A3J B;  4LF9 L;  1LTA D;  1QNU A;  1FVI A;  2BCO A;  2XWJ B;  1PV4 A;  3ZYY X;  4P73 A;  1IBL L;  4LF7 Q;  2R92 B;  4HR7 B;  1CQV A;  1T5X D;  2QCP X;  2OT2 A;  5CMD A;  5I4D A;  2PCF B;  4K2L A;  1Y8P B;  1NE3 A;  4N8X 1;  2MO1 A;  3H09 A;  1PYB A;  4R4T A;  2K28 A;  2EYF A;  4C3J B;  2JA6 B;  2B39 A;  4NW2 A;  2C9O A;  3S2H H;  4A3C G;  1H95 A;  5CV9 A;  2JA7 H;  2E2H H;  1C8C A;  1I50 H;  3SK5 A;  4KHP Q;  2CW0 D;  1GHK A;  3CPF A;  1HH2 P;  3CF5 A;  1R9T B;  4FF2 A;  3A0J A;  4UP7 A;  2QW7 A;  4KJO A;  3NE5 B;  1B4O A;  4ZKC B;  4TRD A;  4JI3 Q;  5D3D A;  4X66 L;  3OTO L;  3HEJ A;  3RZO H;  1HQM C;  2FXQ A;  3GTP B;  3BZK A;  3G4S A;  3UE1 A;  5LMN L;  2ZXR A;  4DV7 Q;  1B3A A;  1PTO D;  4KI0 A;  1IL8 A;  2XNA C;  4KJN A;  4LJZ C;  4A93 H;  2A69 C;  1IBM Q;  1HPC A;  3HKZ B;  1U4R A;  4LFB L;  3NWS A;  2EY5 A;  1TWF H;  1PZI D;  3J81 L;  3HOW B;  2R93 G;  1I4H A;  1YNJ D;  5ISR A;  3NTH A;  2FMM A;  2Z1C A;  1HJP A;  1FYC A;  1PH4 A;  1EWC A;  4HJA A;  5C4X G;  4YCU A;  4ZYS A;  3HOU B;  4L63 B;  1SMY C;  4DN4 M;  5E1F A;  1O7Z A;  4X3S A;  1PH2 A;  3F8T A;  2C35 B;  3UE0 A;  2NVY B;  4FF1 A;  4I7Z C;  3F2C A;  2EXD A;  1T5E A;  4YWK A;  3QG1 A;  1JT8 A;  3H91 A;  1P16 A;  4GNX B;  4X3U A;  1IW7 C;  1SE2 A;  4FXG C;  5JAV A;  1AFP A;  5M5X H;  3I90 A;  1O7Y A;  2F0L A;  4LF9 Q;  2B2U A;  1VMP A;  5EAY A;  4X6A H;  4KKU A;  1CA6 A;  3BZD B;  2F0J A;  4O1N A;  4OON A;  4HCE A;  5IGE A;  3SGI A;  2ZXP A;  3LX0 A;  2VUM B;  1OXT A;  3V05 A;  5LMN W;  2EJM A;  2MFI A;  3BU2 A;  5GQO A;  5IY0 A;  3RR5 A;  2LSS A;  5LHY 1;  2RHS B;  3I3C A;  1QJO A;  3LGJ A;  1VQ9 A;  4DV0 Q;  2JXM B;  3T16 A;  2YU9 H;  4GS3 A;  3ERS X;  1HHV A;  2V4D A;  3MXN B;  3S2D H;  2WKC A;  2XRQ D;  4BBR B;  3DM3 A;  1VQP A;  4QUF A;  4CDD C;  1SFO H;  5A2Q L;  2R7Z H;  4Z9C B;  4HMI A;  1KAA A;  2EE1 A;  1Z6H A;  1M90 C;  5LMN Q;  2EZV A;  2JEB I;  1II3 A;  3NTI A;  1Y69 U;  3S1R H;  1MKH A;  2L9H A;  4GZY C;  3KLW A;  2K33 A;  3J7Y W;  2XTI A;  3H3V H;  2Y0S E;  4LFB Q;  4R8I A;  3K80 C;  3CCU A;  1LTR D;  3KBX A;  3KF6 B;  3GP7 A;  4IUV A;  1MHW C;  1K28 A;  4HSV A;  3AMU A;  2F52 A;  1K8G A;  3A74 A;  3G48 A;  3GTG H;  2UUC L;  1EWH A;  3MAQ A;  1PZK D;  1X6O A;  3EBE A;  2K04 A;  3ERO A;  3ONA B;  2KA7 A;  2WB1 E;  1IXR A;  1K83 H;  1I4R A;  2I5M X;  2NVX H;  3OPO A;  4X65 L;  2B8G A;  2DGY A;  1SE3 A;  2SDF A;  4NDX A;  2Z0S A;  3FKI G;  2QKI C;  1PDQ A;  1J6Q A;  2NN6 G;  3CQZ B;  2BA0 A;  4RGM A;  4DFA A;  3MEH A;  3BVG A;  1Q12 A;  3CME A;  5DM7 3;  4JBW A;  1PTO B;  1C7Y A;  2EY1 A;  1I94 L;  1X3P A;  2PW7 A;  3GTO H;  1UEB A;  1HNZ Q;  4LF6 L;  3HOY B;  1Q8K A;  1VCI A;  2XGT A;  3A54 A;  3NQT A;  3SEB A;  4O42 A;  4AIM A;  1LO5 D;  2XSC A;  3H3V I;  4OWT B;  1Q1E A;  3J80 i;  1CKM A;  2B2T A;  4RCO A;  1QZH A;  4HAE A;  5M5W B;  2NVT H;  1VQE A;  4NXM Q;  3S1N B;  2XN9 C;  2EQS A;  4DNT B;  2Q2U A;  3VR4 A;  3M4O H;  1PRT F;  1QVG A;  1PTO C;  2B3G A;  2ICI A;  5HGQ A;  3K81 C;  3S1M B;  3FDT A;  4HJ7 A;  3VA7 A;  1ZKO A;  4QMG A;  5CYU A;  2WAQ E;  3NUC A;  1YIJ A;  4LF5 L;  5G3L F;  2YTX A;  4RKB A;  1NJI C;  2E2J H;  3W5O A;  3TDQ A;  1G6P A;  1R4Q B;  3QR8 A;  2FJ2 A;  1D1I A;  1EYC A;  3C1F A;  4B9W A;  4JBK A;  4LFA L;  4GKJ Q;  4DAY B;  1H9S A;  3ERQ A;  4TQU S;  1F9S A;  1RD9 D;  4C3I H;  2KHI A;  4KD3 A;  4DR5 Q;  1BCP D;  2PMZ E;  3AYH B;  5E3F A;  1QVC A;  1PFM A;  1LUZ A;  1VQN A;  5D65 A;  1A63 A;  5HGT A;  4B08 A;  3C46 A;  1DD2 A;  1SNO A;  5JEA J;  1LAC A;  2D9U A;  4DR6 L;  2UUC Q;  1MSG A;  2EVB A;  5ELE A;  4DUZ L;  2QEJ C;  5M3F H;  3S16 H;  3TP8 A;  1TWC B;  1G29 1;  2EIF A;  1Q1B A;  1KLG D;  2WB1 G;  3LNN A;  1V43 A;  1SEB D;  5C4H A;  2E2I H;  1SYC A;  2NVQ H;  1QVF A;  1YNN D;  3X3N A;  4A76 A;  2JEA I;  2O5I C;  1AEX A;  1IYV A;  1JCK B;  4DV1 L;  3PO3 G;  4K8I A;  1I6H H;  1NY4 A;  1X55 A;  1JJG A;  1X56 A;  5EPL A;  3T53 B;  1IKM A;  4L6T B;  1F2L A;  4UPA A;  1KAW A;  2MP1 A;  4KHZ A;  2MJ8 A;  4A3E B;  1N33 L;  1SNQ A;  4QCL A;  1GVP A;  4G7H C;  3CD6 A;  1GO3 E;  1WCM G;  1BDO A;  1V1P A;  2PQA A;  4DV3 Q;  1CKN B;  1O7I A;  4M8A A;  3PO2 G;  2YTY A;  4IUQ A;  1I6V C;  1F2Y A;  2NWG A;  3NBH B;  2A6H D;  1UE6 A;  1EYG A;  2VL6 A;  1JJC B;  4YHH Q;  5C3E G;  5C0X H;  4YWL A;  3L2P A;  4DR2 L;  4QL5 A;  2F0E A;  4UDU C;  3QOL A;  5DNF A;  2DNE A;  4FP5 D;  3STB D;  3S17 H;  4BXX H;  2L5T A;  1C4Q A;  1TVX A;  3FP9 A;  3K7A H;  3TZU A;  1W2B A;  1CUK A;  4CKB A;  2K7V A;  3H6M A;  3PF5 A;  4R4I A;  1G51 A;  1H9S B;  4A3G G;  1TQO A;  2VNU D;  5J1Z A;  5JPN C;  4KLK A;  1STB A;  2F0S A;  2BOS A;  2R93 B;  1MIU A;  5C4X B;  2NTS A;  4G4K A;  2H5X A;  4CKE A;  1XMQ Q;  1XMO L;  1CQF A;  3FVQ A;  2R7D A;  3VA5 A;  5FO9 B;  1S5D D;  2ATW A;  2IT1 A;  3KOJ A;  4G7O C;  2LKV A;  3BZC A;  4S3S A;  1WD0 A;  2K6A A;  2LFN A;  4KN4 C;  1VQ8 A;  1LLR D;  1FD7 D;  4DR4 L;  1YBY A;  4HJ8 A;  4BY7 H;  4Q0F A;  1I3Q H;  3M4P A;  1KNE A;  1BQQ T;  1WTW A;  1G8Z D;  4C3H H;  4MTN A;  1IYU A;  2SEB D;  3BJU A;  3ITP A;  3KJP A;  1B53 A;  4A3F G;  2UXD L;  4X62 L;  5IP7 H;  1BXT A;  4I7A A;  4DV1 Q;  2IWH A;  1GM5 A;  1L1O A;  2AUK A;  4DPG A;  1JJ2 A;  1Q90 A;  1PH8 A;  4L8J A;  4A3L G;  3J81 c;  4DK6 C;  1H9J A;  3P7J A;  1BCP B;  2KED A;  1PMR A;  2B29 A;  2VQF L;  5K36 H;  1WTR A;  1OXX K;  5LL6 S;  4QJF A;  4DAP A;  5JJI A;  3I91 A;  2R92 H;  3PUZ A;  4UY8 C;  3MXU A;  1B7Y B;  1YNX A;  3IAY A;  1Z47 A;  3SK4 A;  4ME5 A;  3GTL H;  3ULJ A;  4MZ9 A;  4DR2 Q;  5IT9 E;  3MTS A;  5H1S E;  5IOD A;  1SN8 A;  1NNX A;  2BDN A;  5ELF A;  2N78 A;  5IYB H;  1DOK A;  5FJ8 H;  1K8A C;  2JYO A;  2OWO A;  4JI2 L;  3CC4 A;  1TWG H;  4B3S L;  4FF4 A;  2HIV A;  3N52 A;  2HDL A;  3MEF A;  3DMU A;  5EPK A;  4DXF A;  5LL6 X;  1PRT B;  3M7N A;  2O2L D;  2N55 A;  2PZW A;  2UXC L;  1AN8 A;  5GAD C;  1SLJ A;  5DLQ E;  1RJT A;  1C48 A;  4FXD A;  2R6G A;  2MHV A;  3IL8 A;  1O7L A;  1EFW A;  5I9O A;  3VYU A;  3M4Q A;  4DR4 Q;  2A8V A;  1VQ6 A;  4V19 0;  1FNW A;  3TP6 A;  1U9R A;  2EJG C;  1GHJ A;  1QUQ B;  3OMC A;  2RF4 A;  1CKO A;  3QO2 A;  4A3M G;  1PRT C;  4DF7 A;  3I4N G;  2KCN A;  5C44 B;  1Z9F A;  3VR5 A;  4RGO S;  4X62 Q;  1SMY D;  1VMC A;  5DEH A;  1JIC A;  3RNU A;  2PZT A;  4JV5 L;  2OTL A;  1L1O B;  1VQG A;  4FNF A;  1MJC A;  1C0A A;  4JI5 Q;  4H02 A;  2VQF Q;  2D0O A;  4B3M L;  2NYZ D;  4IOA A;  4H7B A;  3K6O A;  3NWT A;  2LXK A;  2E74 C;  2Q2H A;  1HUM A;  4LWC A;  3R2I A;  1IW7 D;  2XWB B;  3F2D A;  1G2T A;  1YJW A;  4B3R Q;  4IUT A;  3OW2 A;  4ZUI A;  2OQK A;  1H9M A;  1M8A A;  4OGQ C;  2VUM H;  4GLA C;  1N36 L;  1LM0 A;  1X65 A;  1HA6 A;  2N3S A;  1KAB A;  3J7A F;  2A1A A;  2CH4 A;  1L1O C;  3TS0 A;  3DWQ A;  3T1H Q;  1PH1 A;  5AJ3 Q;  1U4M A;  3BVZ A;  3OIQ A;  2Z6K A;  3A55 A;  2K5D A;  1KDB A;  3DM1 A;  1TWA H;  4AQY L;  2D62 A;  5FOB B;  2A5H A;  2JA7 G;  2K14 A;  2K5V A;  4OO1 I;  2CWA A;  4UHV A;  4Y7N H;  3WOE A;  4IPH A;  4BBR H;  3SDZ A;  3I4L A;  3GDE A;  3QWN A;  1HZB A;  4JI1 L;  1TU2 B;  5EKK A;  3HP3 A;  1D8L A;  1D6E C;  3M3Y H;  2KEE A;  4JI4 L;  1EU4 A;  2VB2 X;  1LT5 D;  1KRT A;  1SRO A;  2UXC Q;  1RDP D;  1NR4 A;  3U50 C;  4KHV A;  1SYG A;  5KNC A;  2F0K A;  4F87 A;  3RLN A;  1HA5 A;  4MN3 A;  5ELB A;  2I5L X;  1SBB B;  1DZ1 A;  4CDC C;  3HOZ B;  4A93 G;  1OXV A;  5FLM H;  1J5E Q;  4QIW B;  4N8F A;  5CR3 A;  1XPO A;  3D6C A;  3P75 A;  2WP8 J;  3VYT A;  3OWF A;  2K4K A;  1X3F A;  1HXY D;  2IPK D;  2HCC A;  4DA2 A;  4A3K B;  1XYI A;  3HG9 A;  1D5X C;  3CCR A;  2C5C A;  5BN5 A;  1NAP A;  1VQJ A;  1MGS A;  1HNW L;  3B6Y A;  3W1G A;  2KOL A;  1JOK A;  4OIJ A;  1WFQ A;  1WCM B;  4B3M Q;  1UWV A;  3PO2 B;  1V8Q A;  5JJZ A;  5JVG 3;  4DV6 L;  5FO8 B;  2EXZ A;  4JOI A;  4BS9 A;  1SYD A;  2PZU A;  4DV5 Q;  1ONL A;  2GA4 B;  1MI2 A;  3KF8 A;  1HR0 L;  1ZYR C;  5C3E B;  1SJH D;  2KVM A;  5M3M H;  1PH6 A;  3VYR A;  4EQO A;  1TKW B;  2RCF A;  2R3Z A;  3BDL A;  4MHE A;  1UE7 A;  4QQB X;  5L37 A;  4RH6 A;  2YV5 A;  1ASY A;  1XNR L;  5FO7 B;  1F9P A;  4LUO A;  2PPB C;  2F0M A;  3E9I A;  1ZEQ X;  2L11 A;  1ASZ A;  2VXW A;  3RN5 A;  1YVC A;  1NSN S;  4POF A;  4A3G B;  2HUG A;  3NTK A;  2XRS D;  4GN4 B;  1HNX L;  2J7Z A;  5IGD A;  2E75 C;  4YY3 L;  2RDG A;  4DNR B;  4JI0 L;  3E3X A;  3S15 B;  2XVS A;  5IWA Q;  4XT3 B;  2F3W A;  1B50 A;  4EX5 A;  3S14 B;  2F0O A;  4X3T A;  1HQR D;  4JI1 Q;  4AYB B;  3PIP 3;  1Z7T A;  1ENC A;  3RN2 A;  1RTO A;  2R7Z G;  3ICE A;  5IOC A;  1VQ7 A;  2IX1 A;  4A3I B;  2Z6K C;  2Q8I B;  4LK1 C;  4J1M A;  2ALY B;  2O5J C;  2JK8 A;  3K5L A;  1EOV A;  3T13 A;  4IPD A;  1YJN A;  3I4M H;  4YWM A;  1HR0 W;  2M2L A;  4MIU A;  1O80 A;  2J0T D;  4A3F B;  3DWA A;  4PMW A;  2R61 A;  4R9W A;  2RDH A;  3RZD B;  3AEV A;  1TWC H;  1GUT A;  4PZ7 A;  4JI7 Q;  1ZXT A;  3OMG A;  1JC7 A;  3EFX D;  5AFW A;  1HTP A;  4JG2 A;  3IFT A;  5IGF A;  1LV9 A;  1HNW Q;  4JC0 A;  1H9K A;  2JN4 A;  5ELN A;  5IT9 L;  4X3K A;  5IYC H;  1F9R A;  1IBL Q;  2CCZ A;  4BY1 H;  1E0B A;  3L3O C;  4DGZ A;  3CAM A;  1STG A;  4BWG B;  2LY7 A;  4P74 A;  3CCJ A;  1VQD A;  3KF8 B;  5E7N A;  1HR0 Q;  1W6J A;  1NMF A;  3WOF A;  1G91 A;  1VF7 A;  3QIA A;  5T1G A;  2Z8L A;  3GTJ H;  1RHP A;  2B2Y A;  4A3E H;  4DV2 L;  4DR1 L;  1PFB A;  1KL9 A;  3CRK C;  2QA4 A;  4GOP A;  2QEX A;  3K8A A;  1JOQ A;  2X6G A;  3CW2 C;  4KY7 A;  4K5W A;  2JA8 B;  1E22 A;  5GRO A;  3FRP B;  2XIW A;  1S5F D;  2VB3 X;  4RA8 A;  2B2W A;  4HJ5 A;  4X66 Q;  3OTO Q;  1YI2 A;  1HNX Q;  1YZ6 A;  1EQQ A;  4KY6 A;  3NXW A;  4IFD H;  1TS3 A;  2WII B;  5EPJ A;  2F0F A;  1PH3 A;  3G6J B;  3D6W A; 
#chains in the Genus database with same CATH homology
 2F0N A;  1EY0 A;  3J7A V;  1UNS A;  1B1Z A;  1SXT A;  3A8J E;  3TZD A;  1DJR D;  4HCS A;  5JEA H;  4KTA A;  1I4Q A;  1DCZ A;  3S9W A;  1STE A;  4XYQ A;  4QUC A;  2K03 A;  4A3M B;  5T1I A;  3NHH A;  1HFG A;  4IUR A;  4NP5 A;  3I4N B;  2K05 A;  1RF2 D;  3JAM L;  2AWO A;  2BA1 A;  4XDX A;  1D5M C;  2O4X A;  4ID6 A;  1TWH B;  3SXH A;  1A3U A;  5KYI A;  2EJF C;  3DWP A;  4IFD I;  1WTO A;  1WTV A;  1WD1 A;  1A3T A;  2FFK B;  2E76 C;  4PNY A;  2F0G A;  1FR3 A;  2WAC A;  1E2Z A;  3OSO A;  2B2U C;  4WFN 3;  1EYD A;  1GUO A;  1E2V A;  1EY8 A;  3LWU A;  3S2H B;  2PYK A;  2RBM A;  2X6L A;  2JA7 B;  2E2H B;  1LTT D;  5JOB A;  4DAV A;  3TP7 A;  3MXG A;  3K59 A;  3U9S A;  4CKC A;  4EQN A;  4IFD J;  5CBE E;  3A8K E;  4ZRZ A;  1XXG A;  3I73 A;  5C0X G;  3M4Y A;  1MBY A;  4H44 C;  3VR6 A;  3RZO B;  4OIK A;  3GV6 A;  1D1K A;  1AP0 A;  4XQQ A;  2BE5 C;  1QNK A;  2IX0 A;  2RVL A;  1DOM A;  3T4A C;  4A93 B;  1EOT A;  2B2W C;  1TWF B;  1EQV A;  1GUG A;  4TSS A;  4I65 A;  3MFG A;  2M00 A;  1EY7 A;  1A15 A;  2PNR C;  4CBV A;  1I4G A;  2EY6 A;  3VYS A;  3BYT B;  1LTG D;  3TN2 A;  5KRU A;  1EEF D;  4PQX A;  1DXM A;  1LT3 D;  5TSS A;  5ELD A;  1ROD A;  3K57 A;  3MXP A;  1E2W A;  1XX8 A;  1DYQ A;  4J6H A;  2BDO A;  4PMC A;  1F9Q A;  4DK0 A;  4C3H G;  5HUR A;  1BUV T;  1PRT D;  2F1M A;  3H94 A;  3FMC A;  5KND A;  2HQE A;  1SJE D;  3T51 B;  2LMC B;  4RGN A;  2IX3 A;  5K36 G;  1VF5 C;  2WKD A;  1GOZ A;  1IHZ A;  5FLX E;  2YU9 B;  2SNS A;  3E5S A;  4QB4 A;  1EEI D;  4IAL A;  5K5P A;  2B2T C;  4EGV A;  4F8M A;  1KDC A;  3J80 E;  3Q24 A;  1SFO B;  2R7Z B;  2K32 A;  1L0Y B;  4ZQ3 A;  1ENA A;  1EL0 A;  2RSO A;  4U68 A;  1S5B D;  4CJ2 C;  2F0W A;  4FXK C;  5J22 A;  3FEW X;  3OIP A;  3WDN A;  1JWM D;  2G9H D;  1SYB A;  4DU9 A;  1B44 D;  3A8I E;  1LTS D;  4IZ8 A;  2DY7 A;  2B8F A;  2F0T A;  4LMQ D;  4XTC S;  4CHT B;  2D5D A;  3GTG B;  1F2Z A;  1WTX A;  5CV4 A;  4N9P A;  5C3W A;  1QOH A;  1KDA A;  2NB0 A;  2NTT A;  4HN7 A;  4RFB A;  1S5C D;  5IIF A;  1K83 B;  2L12 A;  2NVX B;  1SAP A;  1NCV A;  3H3V C;  2NBF A;  4FF3 A;  2SOB A;  4E6I A;  3O13 A;  1UEA B;  1HUN A;  4RWS C;  4U67 3;  3K5M A;  3SHL A;  1V1P B;  3SR1 A;  3PUV A;  3C1E A;  4KN7 C;  2A68 C;  1VDZ A;  1GJX A;  2NVT B;  2H1E A;  5DM6 3;  4K8J A;  1Y8N B;  1SSO A;  2QIL A;  1QG7 A;  4ULL A;  3M4O B;  1LAB A;  1ZYR D;  3GD7 A;  2CQA A;  4BA1 I;  1BOS A;  1I4X A;  1L0X B;  1EZ8 A;  3BS1 A;  5CC4 A;  3N6R A;  4C1N K;  2IL8 A;  2E2J B;  5C5L A;  5C6A A;  2EYH A;  1XWE A;  1TS2 A;  4K6D A;  3M7G A;  2WIN B;  1SNP A;  3CRL C;  2ICE C;  3R2T A;  4HMJ A;  4DK1 A;  2SNM A;  1AZP A;  3FKI B;  3A7A B;  1EY4 A;  3GV3 A;  1FGB D;  3PV0 A;  4WRD A;  3EJI A;  2JSO A;  5M3F B;  2G9D A;  3S16 B;  3TP5 A;  4OO1 H;  5EQ0 A;  5BN3 A;  1F77 A;  5C3X A;  2E2I B;  5J39 A;  2NVQ B;  5I6Y A;  3HS0 C;  3I8Z A;  3FPP A;  2KJX A;  2AQ1 B;  4RGT A;  3KK7 A;  4LAA A;  1QCB D;  2IJ0 A;  2DNC A;  1CZG A;  1QWY A;  1STH A;  5IGG A;  4K14 A;  5KEE A;  1O78 A;  1EYA A;  3M85 A;  4XXE A;  2F03 A;  2KHS A;  3T56 B;  3DEO A;  5NUC A;  3DXJ C;  2MPM A;  2JP1 A;  1PYW D;  4XQN A;  2A73 B;  3GTQ B;  3AB9 A;  3S17 B;  2Y0S B;  3KLR A;  1V1O A;  4ABN A;  2MGS A;  4R8N A;  4EVO A;  1SYE A;  3MVV A;  1BO0 A;  4K5V A;  2CHB D;  5E4W C;  4F7X A;  3DUZ A;  2F0U A;  5EGT A;  2PW5 A;  2ZT9 C;  2WB1 B;  1SND A;  4WOR A;  1MD2 D;  3VR3 A;  3E6Z X;  1XTC D;  5D3I B;  1CHQ D;  3PO3 B;  3PUY A;  1PTO F;  1ML0 D;  1I3Q B;  2YYZ A;  3KUP A;  1SDF A;  2AQ2 B;  4UAI A;  1CTM A;  5M9O A;  2CVR A;  3L7Z C;  3PIO 3;  1WVL A;  1PLF A;  2F0P A;  1EY5 A;  1EZ6 A;  3R3O A;  3EVQ A;  4HSP A;  1AW7 A;  1PTO H;  1JE4 A;  2K01 A;  3J80 L;  4C56 C;  2J4X A;  3D4D A;  4HED A;  3HRZ C;  2K5W A;  3MFY A;  1BNZ A;  3MZ5 A;  2IW3 A;  3BYY B;  2WAQ B;  5I6W A;  3W2D A;  3GTL B;  4CJ1 B;  3PMF A;  2ID0 A;  1JQY D;  3BVM A;  1RTN A;  3OW7 A;  5CV5 A;  1UAP A;  3F2U A;  2PMZ B;  3MXN A;  1IKL A;  4KKS A;  1S5E D;  3EQL C;  1OXU A;  2EYJ A;  4RAU C;  1TWG B;  3NP8 A;  3K5N A;  4KKT A;  1LT4 D;  4IFD G;  1EQT A;  1D5Z C;  5FKA C;  3AU7 A;  1ESR A;  3K0Y A;  3CU7 A;  4ZUJ A;  2K5Q A;  2BE5 D;  3GQB A;  1BBX C;  4ZK9 B;  5JEA G;  4G57 A;  1I4P A;  1K8M A;  3BG3 A;  1ET6 A;  3Q6S A;  2JE6 I;  1SE4 A;  4QF4 A;  1TT2 A;  4CJ0 B;  1F2M A;  1U4L A;  1SNC A;  4ZKB B;  5EBC A;  4PMB A;  3HGB A;  3MWY W;  1EFI D;  1JB3 A;  2RDF A;  1HFN A;  1FNU A;  2X69 A;  2EOT A;  1QB5 D;  4FYD A;  1WTP A;  2H4O A;  3SE0 A;  2HCI A;  1B9M A;  3DEP A;  3D3R A;  1TWA B;  2A6E C;  1GUW A;  4K2K A;  1W6K A;  2Z4I A;  1ENF A;  2FHT A;  4Y7N B;  3PUW A;  2MUY A;  3PUX A;  2ENB A;  1S4Z A;  4ZLT F;  2PO4 A;  1KTK A;  4ZAI A;  1PXU A;  3BDC A;  4KMU C;  3M3Y B;  4IN3 A;  1B9N A;  5A35 A;  2F0D A;  1A3V A;  4DAY A;  1Q8I A;  4C3I G;  4C1N I;  1MSH A;  2EDG A;  2QDB A;  5KGU A;  1J8I A;  4XIG S;  3CKI B;  5CBA E;  1DON A;  5C4J B;  5I9P A;  1EY9 A;  1CFM A;  2Q8T A;  3TBI B;  3NSW A;  2RSN A;  3D31 A;  4IUN A;  3OHX C;  3P20 A;  1U4P A;  1BCP F;  1OXS C;  4RHR A;  1ILQ A;  1X3Q A;  3E0J A;  1CI3 M;  3EA6 A;  4G7Z C;  1NUC A;  4XQJ A;  3V2T A;  2EPB A;  1ICW A;  1CZW A;  4F88 A;  5JVH 3;  3W3A A;  5CGK A;  1JOR A;  3SK6 A;  2EYO A;  2CW0 C;  3VR2 A;  1NR2 A;  3C3L A;  2TMP A;  3BDO A;  5M3M B;  2EYL A;  1QIL A;  1I50 B;  1GUS A;  1CA5 A;  2F0V A;  2F3V A;  5KIX A;  3Q0A A;  3SVM A;  1BR9 A;  1ILP A;  4DXG A;  5FK9 C;  1JWS D;  5IGB A;  3NBH A;  4RKL A;  1Q3L A;  4FO2 A;  2A68 D;  1H9R A;  1G6Z A;  4CGY B;  2B2Y C;  4YIJ A;  1TY0 A;  2KUM A;  3C2P A;  1EU3 A;  1TS5 A;  3IKJ A;  3SK8 A;  3ND9 A;  5KYL A;  4TKO B;  3R93 A;  2K1B A;  1YNJ C;  3KBG A;  1KLU D;  2NUC A;  5EBD A;  3Q22 A;  1JWU D;  3UI2 A;  3KLS X;  4P2C B;  5E4X A;  2RKS A;  4XYO A;  4HTH A;  3I4M B;  4WJW A;  3QB3 A;  5COR A;  2L55 A;  4K5X A;  2NN6 H;  3Q23 A;  3D4R A;  3P1H A;  2LS0 1;  2I07 B;  2WV6 D;  5M5X B;  5BN4 A;  4V0B A;  3I72 A;  3FPU B;  4M1U B;  1A2T A;  4BY1 B;  1STY A;  3MC0 B;  3NQI A;  1CK1 A;  5G3L D;  2E2D C;  2OF1 A;  2I46 A;  2TSS A;  4XT1 B;  3ND8 A;  2HDM A;  5C5M A;  3GTJ B;  2KCC A;  2L0C A;  1J9O A;  3S2D B;  1WTQ A;  5CV7 A;  2N88 A;  4C3J G;  3U9O A;  3K5O A;  2NN6 I;  4KY5 A;  1EIG A;  1R4P B;  4RHS A;  3S1R B;  3A56 A;  5EJW A;  1DM0 B;  3CHB D;  5DAU A;  2RQX A;  3MHB A;  3GTM B;  1QE6 A;  3KLS A;  5I2Y A;  1HTL D;  1SYF A;  2OEO A;  2JA5 B;  4IQZ A;  1JOO A;  4FVM A;  4OL7 A;  1Y1W B;  3G7L A;  4ILW A;  2F0I A;  3D4W A;  1PFN A;  4A3B B;  1STN A;  4IUU A;  1TY2 A;  1TR5 A;  5C0X I;  2RA4 A;  4OO1 G;  4EQP A;  2OXP A;  3GTO B;  4K6L A;  3J81 E;  2L4N A;  2D2C C;  5JPM C;  3DHQ A;  4OHJ A;  1EY6 A;  1K8O A;  2ZXO A;  2EY2 A;  4Q5V A;  2DY8 A;  1TS4 A;  5IGC A;  1M4V A;  5CV6 A;  1TII D;  3URY A;  2B2V A;  3TSS A;  2Z4H A;  1OO9 B;  4N9T A;  5ELC A;  1UUP A;  5C0X J;  1BCP C;  5KNB A;  4PV1 C;  4BA2 I;  4C3I B;  5D14 A;  2NZ1 D;  2F0H A;  1A2U A;  3R8B A;  3LWE A;  1B2T A;  3TME A;  1EIH A;  1X32 A;  1STA A;  3HOX B;  5EKL A;  2AQ3 B;  3NPP A;  4H13 C;  3S1Q B;  2L1B A;  3RUZ A;  2DN8 A;  3D8G A;  3HZX A;  1YNN C;  3NBI A;  5A2Q E;  5CV8 A;  3K58 A;  1AZQ A;  1ET9 A;  2FIN B;  4RCN A;  1HRJ A;  3RD4 A;  3L9A X;  1LTI D;  2A69 D;  4A3D B;  3QOJ A;  3A7L A;  4IUP A;  1I6H B;  2AUJ D;  1PZJ D;  3QJY A;  3HOV B;  3H0G B;  2A6H C;  2A74 C;  1JR0 D;  1SNM A;  1FNV A;  1GUN A;  1ESF A;  3GO5 A;  3X3M A;  3RMH A;  3JAM E;  5M5Y B;  4JK1 C;  3MA2 B;  4NMZ A;  5COY A;  2KEC A;  2EYP A;  4J8Q A;  3V96 A;  1LTB D;  1D2B A;  2F4I A;  2EYM A;  1BF4 A;  3RLF A;  2Q8R E;  1A6X A;  3K7A B;  1CT1 D;  4ODG A;  3OWE B;  1Y8O B;  1G2S A;  1GXD C;  5EKI A;  1RCV D;  4KV6 A;  3GTK B;  1DOL A;  1KNA A;  1HCZ A;  2B2V C;  2QF7 A;  2A6E D;  5F2D A;  2M9V A;  1CM9 A;  4BBS B;  2FMC A;  2AWN A;  4KD4 A;  1LT6 D;  5I2X A;  3IFD A;  4BY7 B;  1Y1V B;  4C3H B;  3OOC A;  4H0L C;  2B63 B;  5C4Z A;  4KK7 A;  2PQE A;  2KQ3 A;  1CHP D;  4NKL A;  3I70 A;  4C2M B;  5FLX L;  2F0Q A;  3NK9 A;  4B9X A;  1RKN A;  4A3J B;  1LTA D;  1QNU A;  2BCO A;  2XWJ B;  3ZYY X;  2R92 B;  4HR7 B;  1CQV A;  1T5X D;  2QCP X;  2OT2 A;  5CMD A;  5I4D A;  2PCF B;  4K2L A;  1Y8P B;  3H09 A;  2K28 A;  2EYF A;  4C3J B;  2JA6 B;  2B39 A;  4NW2 A;  2C9O A;  5CV9 A;  1C8C A;  3SK5 A;  2CW0 D;  1GHK A;  1R9T B;  4FF2 A;  4KJO A;  3NE5 B;  1B4O A;  4ZKC B;  4TRD A;  5D3D A;  3HEJ A;  1HQM C;  3GTP B;  2ZXR A;  1B3A A;  1PTO D;  4KI0 A;  1IL8 A;  2XNA C;  4KJN A;  4LJZ C;  2A69 C;  1HPC A;  3HKZ B;  1U4R A;  3NWS A;  2EY5 A;  1PZI D;  3J81 L;  3HOW B;  1I4H A;  1YNJ D;  5ISR A;  3NTH A;  2FMM A;  2Z1C A;  1FYC A;  1EWC A;  4ZYS A;  3HOU B;  4L63 B;  1SMY C;  4DN4 M;  5E1F A;  1O7Z A;  4X3S A;  2NVY B;  4FF1 A;  4I7Z C;  1T5E A;  3QG1 A;  3H91 A;  4X3U A;  1IW7 C;  1SE2 A;  4FXG C;  5JAV A;  1AFP A;  3I90 A;  1O7Y A;  2F0L A;  2B2U A;  1VMP A;  4KKU A;  1CA6 A;  3BZD B;  2F0J A;  4O1N A;  5IGE A;  4HCE A;  2ZXP A;  3LX0 A;  2VUM B;  1OXT A;  3V05 A;  2EJM A;  5LHY 1;  3I3C A;  1QJO A;  2JXM B;  3T16 A;  1HHV A;  2V4D A;  2WKC A;  2XRQ D;  4BBR B;  4QUF A;  5A2Q L;  4Z9C B;  4HMI A;  1KAA A;  2EE1 A;  1Z6H A;  2EZV A;  2JEB I;  1II3 A;  3NTI A;  1Y69 U;  2L9H A;  4GZY C;  2K33 A;  3J7Y W;  4R8I A;  1LTR D;  3KBX A;  3GP7 A;  4IUV A;  4HSV A;  3AMU A;  1EWH A;  3MAQ A;  1PZK D;  3ERO A;  2K04 A;  3ONA B;  2KA7 A;  1I4R A;  3OPO A;  2B8G A;  1SE3 A;  2SDF A;  4NDX A;  2QKI C;  1PDQ A;  2NN6 G;  3CQZ B;  2BA0 A;  4RGM A;  4DFA A;  3MEH A;  3BVG A;  1Q12 A;  5DM7 3;  4JBW A;  1PTO B;  2EY1 A;  1X3P A;  2PW7 A;  3HOY B;  1VCI A;  3A54 A;  3NQT A;  3SEB A;  4O42 A;  1LO5 D;  2XSC A;  1Q1E A;  2B2T A;  4RCO A;  4HAE A;  5M5W B;  3S1N B;  2XN9 C;  4DNT B;  3VR4 A;  1PRT F;  1PTO C;  2ICI A;  3S1M B;  3FDT A;  3VA7 A;  1ZKO A;  4QMG A;  5CYU A;  3NUC A;  5G3L F;  4RKB A;  3TDQ A;  1R4Q B;  2FJ2 A;  1D1I A;  1EYC A;  3C1F A;  4B9W A;  1H9S A;  3ERQ A;  4TQU S;  1F9S A;  1RD9 D;  4KD3 A;  1BCP D;  5E3F A;  1PFM A;  5D65 A;  5HGT A;  4B08 A;  3C46 A;  1DD2 A;  1SNO A;  5JEA J;  1LAC A;  2D9U A;  1MSG A;  2EVB A;  5ELE A;  2QEJ C;  3TP8 A;  1TWC B;  1G29 1;  1Q1B A;  1KLG D;  3LNN A;  1V43 A;  1SEB D;  5C4H A;  1SYC A;  1YNN D;  3X3N A;  2JEA I;  2O5I C;  1AEX A;  1IYV A;  1JCK B;  4K8I A;  5EPL A;  3T53 B;  1IKM A;  4L6T B;  1F2L A;  2MP1 A;  4KHZ A;  2MJ8 A;  4A3E B;  1SNQ A;  4QCL A;  4G7H C;  1BDO A;  1V1P A;  4M8A A;  4IUQ A;  1I6V C;  1F2Y A;  2NWG A;  2A6H D;  5C0X H;  2F0E A;  4UDU C;  3QOL A;  5DNF A;  2DNE A;  4FP5 D;  2L5T A;  1C4Q A;  1TVX A;  3TZU A;  4CKB A;  2K7V A;  3H6M A;  1H9S B;  1TQO A;  2VNU D;  5J1Z A;  5JPN C;  1STB A;  2F0S A;  2BOS A;  2R93 B;  5C4X B;  2NTS A;  4G4K A;  4CKE A;  1CQF A;  3FVQ A;  3VA5 A;  5FO9 B;  1S5D D;  2IT1 A;  4G7O C;  2LKV A;  4S3S A;  1WD0 A;  2K6A A;  2LFN A;  4KN4 C;  1LLR D;  1FD7 D;  4Q0F A;  1WTW A;  1KNE A;  1BQQ T;  1G8Z D;  1IYU A;  2SEB D;  3ITP A;  1B53 A;  1BXT A;  2IWH A;  2AUK A;  1Q90 A;  4L8J A;  1H9J A;  3P7J A;  1BCP B;  2KED A;  1PMR A;  5K36 H;  1WTR A;  1OXX K;  5LL6 S;  4DAP A;  3I91 A;  3PUZ A;  3MXU A;  3IAY A;  1Z47 A;  3SK4 A;  4ME5 A;  5IT9 E;  3MTS A;  5IOD A;  2BDN A;  5ELF A;  1DOK A;  2JYO A;  4FF4 A;  3N52 A;  2HDL A;  3DMU A;  5EPK A;  4DXF A;  5LL6 X;  1PRT B;  3M7N A;  2O2L D;  2N55 A;  2PZW A;  1AN8 A;  1RJT A;  1C48 A;  4FXD A;  2R6G A;  2MHV A;  3IL8 A;  1O7L A;  5I9O A;  3VYU A;  4V19 0;  1FNW A;  3TP6 A;  1U9R A;  2EJG C;  1GHJ A;  3OMC A;  3QO2 A;  1PRT C;  4DF7 A;  2KCN A;  5C44 B;  3VR5 A;  4RGO S;  1SMY D;  1VMC A;  5DEH A;  1JIC A;  2PZT A;  4FNF A;  2NYZ D;  4H7B A;  3K6O A;  3NWT A;  2E74 C;  1HUM A;  3R2I A;  1IW7 D;  2XWB B;  1G2T A;  4IUT A;  4ZUI A;  1H9M A;  1M8A A;  4OGQ C;  1HA6 A;  1KAB A;  3J7A F;  3DWQ A;  1U4M A;  3BVZ A;  3OIQ A;  3A55 A;  2K5D A;  1KDB A;  3DM1 A;  2D62 A;  5FOB B;  2A5H A;  4OO1 I;  3WOE A;  3SDZ A;  3I4L A;  3QWN A;  1TU2 B;  5EKK A;  3HP3 A;  1D6E C;  2KEE A;  1EU4 A;  2VB2 X;  1LT5 D;  1RDP D;  1NR4 A;  4KHV A;  1SYG A;  5KNC A;  2F0K A;  4F87 A;  1HA5 A;  4MN3 A;  5ELB A;  1SBB B;  1DZ1 A;  3HOZ B;  1OXV A;  4QIW B;  5CR3 A;  3D6C A;  3P75 A;  2WP8 J;  3VYT A;  3OWF A;  1HXY D;  2IPK D;  2HCC A;  4DA2 A;  4A3K B;  1XYI A;  3HG9 A;  1D5X C;  2C5C A;  5BN5 A;  1NAP A;  1MGS A;  2KOL A;  1JOK A;  4OIJ A;  1WCM B;  3PO2 B;  1V8Q A;  5JJZ A;  5JVG 3;  5FO8 B;  2EXZ A;  4BS9 A;  1SYD A;  2PZU A;  1ONL A;  2GA4 B;  1MI2 A;  3KF8 A;  1ZYR C;  5C3E B;  1SJH D;  2KVM A;  3VYR A;  4EQO A;  1TKW B;  2R3Z A;  3BDL A;  4MHE A;  4RH6 A;  5FO7 B;  1F9P A;  2PPB C;  2F0M A;  1ZEQ X;  2L11 A;  2VXW A;  1NSN S;  4A3G B;  2HUG A;  3NTK A;  2XRS D;  2J7Z A;  5IGD A;  2E75 C;  3S15 B;  2RDG A;  4DNR B;  2XVS A;  4XT3 B;  2F3W A;  1B50 A;  3S14 B;  2F0O A;  4X3T A;  1HQR D;  4AYB B;  3PIP 3;  1Z7T A;  1ENC A;  1RTO A;  5IOC A;  2IX1 A;  4A3I B;  2Q8I B;  4LK1 C;  4J1M A;  2O5J C;  3K5L A;  3T13 A;  2M2L A;  4MIU A;  1O80 A;  2J0T D;  4A3F B;  3DWA A;  4PMW A;  2R61 A;  4R9W A;  2RDH A;  3RZD B;  1GUT A;  1ZXT A;  3OMG A;  1JC7 A;  3EFX D;  5AFW A;  1HTP A;  3IFT A;  5IGF A;  1LV9 A;  1H9K A;  5IT9 L;  4X3K A;  1F9R A;  1E0B A;  3L3O C;  4DGZ A;  1STG A;  4BWG B;  2LY7 A;  1W6J A;  3WOF A;  1G91 A;  1VF7 A;  3QIA A;  5T1G A;  2Z8L A;  1RHP A;  2B2Y A;  1PFB A;  3CRK C;  1JOQ A;  2X6G A;  4KY7 A;  4K5W A;  2JA8 B;  3FRP B;  2XIW A;  1S5F D;  2VB3 X;  4RA8 A;  2B2W A;  4KY6 A;  3NXW A;  4IFD H;  1TS3 A;  2WII B;  5EPJ A;  2F0F A;  3G6J B;  3D6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...