2X6GA

X-ray structure of macrophage inflammatory protein-1 alpha (d27a)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
ADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C MOTIF CHEMOKINE 3
publication title Polymerization of Mip-1 Chemokine (Ccl3 and Ccl4) and Clearance of Mip-1 by Insulin-Degrading Enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2010-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2x6gA00
5CBEE 1O7YA 1X3QA 3I3CA 2EOTA 2KOLA 2B2WC 2EPBA 1WTXA 2NWGA 1CM9A 1MSHA 1J9OA 1PLFA 3I8ZA 3DEOA 4IURA 4ZK9B 1G2SA 2B2WA 2B2VA 2KECA 2EE1A 1DZ1A 2K28A 2FMMA 2L1BA 1U4MA 4LMQD 1PDQA 1NR2A 4U68A 4XT1B 2XIWA 2MJ8A 1BO0A 5EJWA 1RODA 2B2YC 2B2TC 2RSNA 1JICA 4QUFA 1B4OA 3QO2A 4XT3B 2B2TA 2B2YA 1NCVA 1XX8A 2X6LA 2MGSA 1IL8A 3MTSA 3TN2A 2N55A 1SDFA 4XDXA 3IL8A 1IKLA 3TZDA 2K01A 1WD0A 4RWSC 3D6WA 3N52A 3MWYW 1F9PA 1ZXTA 2L4NA 4HSVA 4OIJA 4MN3A 1WVLA 3KBXA 2FHTA 2H1EA 1X32A 3GV6A 1AZPA 2DY8A 1X3PA 2B2VC 1BF4A 2D9UA 2JP1A 1ICWA 1HFNA 3IFDA 1WD1A 2HCCA 5T1IA 2KEDA 2RA4A 2HDMA 1IKMA 5CBAE 1MSGA 2KVMA 1WTOA 4X3KA 1HA6A 3HP3A 5EPJA 4DN4M 4ZKBB 5CORA 1RTNA 4ZKCB 4RA8A 1CA6A 1G6ZA 1NR4A 5AFWA 4CJ1B 1F2LA 1RHPA 4IUTA 2KUMA 4X3SA 5CMDA 1U4PA 1O80A 1B50A 2RSOA 2VXWA 1F9SA 1SSOA 3P7JA 4HAEA 5D14A 1DOKA 1WTRA 1JE4A 2M2LA 1C8CA 5EPKA 3R93A 1PFMA 1ML0D 1BBXC 2FINB 1B2TA 1KNAA 1QG7A 1KNEA 4UAIA 1HFGA 4NW2A 3I90A 2HDLA 2NYZD 1DOLA 1DOMA 2MP1A 1CA5A 1PFNA 5JJZA 3Q6SA 2L11A 1EOTA 4X3TA 2Q8RE 5E4XA 1M8AA 2J7ZA 3KUPA 3F2UA 1AP0A 2K04A 4ZLTF 1PFBA 1RTOA 2HCIA 1LV9A 1MGSA 1HHVA 2K05A 1B3AA 1WTQA 5EQ0A 1U4LA 2IL8A 1ILQA 3DEPA 2X69A 1WTVA 2DY7A 2L9HA 5EPLA 4R8IA 5COYA 1SAPA 4IUQA 1MI2A 1XYIA 2FJ2A 1J8IA 2R3ZA 1E0BA 1RJTA 1VMCA 1S4ZA 3I91A 3LWEA 5DNFA 1F9RA 4HEDA 1TVXA 3FPUB 4QUCA 5E4WC 1A15A 4OIKA 3G7LA 1BNZA 1WTWA 1EL0A 2JYOA 1EIHA 4IUPA 1WTPA 5D65A 3FDTA 3GV3A 1O7ZA 2L12A 2Q8TA 2HUGA 4MHEA 1G91A 1EIGA 2NZ1D 3ONAB 1AZQA 4CJ2C 2FFKB 2MPMA 2BDNA 2CVRA 2K03A 2X6GA 4O42A 1GUWA 1HUNA 3DM1A 1QNKA 1ILPA 1ESRA 1B53A 2N88A 5EKIA 1QE6A 4IUUA 1Q3LA 4X3UA 2KEEA 1HUMA 1DONA 2K1BA 2B2UC 2SDFA 3H91A 4R9WA 1NAPA 4CJ0B 1U4RA 3SVMA 2B2UA 4RAUC 1EQTA 1HRJA 4ZAIA 5T1GA 1G2TA 3UI2A 2RVLA 4HCSA 1F9QA 4IUVA 1VMPA
chains in the Genus database with same CATH superfamily
2DNCA 4RH6A 2HIVA 1VQOA 3CCMA 3F1ZA 4LFBQ 5I2XA 3V05A 3A5ZB 3E3XA 3T16A 2G9DA 1EY0A 5ELBA 4XIGS 4ME3A 4LF6Q 2VQEQ 1EIYB 2XIWA 5DM73 5EJWA 3HOWB 2R7DA 2WIIB 4R4CA 2B2TA 2G9HD 1NCVA 4L5TA 1S40A 1KXLA 3CW2C 4XDXA 4DUYL 4A3KG 1SYBA 3T1YQ 3HFZB 1V1QA 4XQNA 4LF8Q 3CCRA 1EY7A 5JJLA 2E74C 3LGJA 3EN2A 3D0FA 1BVSA 2JXMB 2RCNA 4X3KA 1SYDA 1CA6A 1Z6HA 4P72A 1XMQL 2VXWA 3BDCA 3JAMi 1HTPA 2PZUA 3CCVA 3MAQA 3HOUB 3K7UC 3U9OA 2IHFA 1HFGA 3I72A 1GUNA 5C0XG 2NN6G 1SJHD 1VQFA 1K0RA 3PGZA 1Q12A 5HGQA 4DR3L 3HOUH 1WCMB 1UE7A 1VQNA 1HHVA 3VR2A 4DV4L 2JEAI 3VA7A 4NXMQ 1WTQA 2IL8A 5LL6S 2L9HA 2XGTA 4R8IA 4LW1A 3EQLC 1SNPA 5COYA 5G3LF 1I4RA 4X66L 1WCMH 4YHHQ 1E0BA 2KCMA 1VQKA 2IPKD 1TVXA 4RG1A 5IGEA 1PRTF 1IHZA 4GOPA 2I0QA 3FDTA 3GV3A 3G6JB 1JB3A 1IBML 4GLAC 3IKJA 3S1RB 3G6EA 1Q3LA 1XNRQ 3STBD 1XTCD 2PMZB 3OTOL 1VQ6A 4BY1B 3HOYG 4HJAA 2A6ED 1YVCA 4U673 3VDYA 4DV0Q 4A3CH 3S1RH 1IYVA 3GQBA 3RUZA 1PFNA 2R6GA 1BOSA 2JA5B 4A3DB 5ELOA 3TDQA 2F0UA 4DPGA 4UHVA 3GO5A 3J80L 1PYWD 1F2ZA 4C2MH 1VQ7A 1MIUA 3DHQA 5ELEA 4A3EG 4XT1B 2CKZB 2JA5H 4A3DH 3KLWA 1GXDC 1Y1VG 5J1ZA 2B63H 2RKSA 4C3JB 3PIO3 1PH4A 2K5DA 1PTOD 2QDBA 1CSPA 1HNWQ 1UEAB 3PIPA 2IX1A 1J6QA 4C3JH 1V1PB 3HOUG 1LO5D 1SYEA 2GN5A 3SHLA 2ATWA 1BXTA 4EQOA 3QOJA 2RHSB 4NP5A 4LF9L 1Y8PB 4GN5A 4LF4Q 3C3LA 1Q82C 2OWOA 1RTNA 3QR8A 2CHBD 1SNMA 1ASZA 2WV6D 4KJOA 1BCPF 1V1OA 5CMDA 2CCZA 4DR6Q 4WORA 4RGMA 4YCVA 2B39A 1WTRA 5M3MB 2F4VQ 1C8CA 1JWMD 4B3RQ 5EPKA 3ERSX 2G5DA 2KQ3A 1Y1WB 1EWCA 1EYDA 5C5MA 4DV3L 5M3MH 1TS3A 3I4NB 2IJ0A 4IPCA 5K36H 1ZYRC 1EZ8A 1Y1WH 4OX9Q 5IGDA 1JE5A 1N32L 1YZ6A 5K5PA 1S3OA 2JN4A 3CCJA 1E1TA 5DM63 4BA1I 1QZGA 3I4NH 1AH9A 2HQEA 3P75A 3EVQA 1ASYA 4Y52H 5FLXc 3I91A 2F0MA 2OF1A 5DEHA 2QCPX 1I6VC 3KFUA 2XN9C 4DV1Q 4AQYQ 3KLSX 4DK0A 2BDOA 3W1BA 5CYUA 5C44B 2JA5G 3I55A 4A3DG 1W6JA 3S2HB 1PH6A 1B9MA 2B63G 4PMBA 5JOBA 3NP8A 4RKLA 1DONA 2ZTDA 2B2UC 2NVYH 4CJ0B 5C44H 4RGTA 3Q0AA 1I5FA 3S2HH 3U50C 2N49A 2KOLA 2B2WC 4IPHA 5M5XB 2UUAQ 1VQGA 5C3XA 3HOZB 1S5BD 1UNSA 4C1NK 2EE1A 5GQOA 3C2PA 3PO3B 3PO2B 4CDEC 1XNQQ 4CGYB 1LTSD 4QCLA 1M90C 5M5XH 4B3TL 3AFPA 3L3OC 5NUCA 4QGUA 3NUCA 4XT3B 3HOZH 3LNNA 5BR8Q 3PO2H 2BA1A 2N55A 4TKOB 1J5EL 4A3GH 1XPOA 4PG3A 5E3FA 2PI2A 4FP5D 1F9PA 4JI5L 3KBXA 1HCZA 2F0TA 2QILA 3OWEB 4LNQA 1X3PA 3M4QA 1BF4A 1HFNA 3S1NB 1Y1WG 5KNCA 4KHPQ 2AUKA 3A7AB 3Q24A 4QJFA 3AB9A 3SDZA 1G6ZA 3J81E 3HOVH 5FKAC 3M85A 1NR4A 3L7ZC 4N8X1 1F2LA 2KUMA 4X62Q 1QUQA 2F0OA 3S1NH 4FVMA 3BDLA 2EYHA 1CTMA 5IYDH 1EQVA 3HRZC 1SRUA 2EYOA 1C0AA 1KNEA 2F3VA 3DM3A 4JOIA 3ZYYX 4WRDA 1PFSA 2KCTA 2PMZE 1HZCA 1K8GA 4LFAQ 2C5CA 3NBHB 3A74A 4DA2A 1ONLA 2K04A 4ZLTF 1LTGD 1LV9A 4K6LA 3KDFB 1KD1C 3SK8A 3BZCA 2PW7A 4X6AH 2DJFC 1N34L 3PF4A 1V43A 1R9TB 4HEDA 3CC2A 3OW7A 1HNXQ 4BBRG 5ISRA 3NPPA 1Q7YC 1GHJA 2ZM6Q 1PZJD 3TQYA 5EAYA 4DR4L 4QIWB 1F2YA 1KAAA 4L5RC 1QZHA 2PYKA 4KMUC 3S16B 5KYIA 5CV4A 2N88A 5EKIA 4X64Q 1EY6A 5IYCH 1IBLQ 2YU9H 1HUMA 3BS1A 1JJ2A 4A3GG 3BVGA 3BVMA 2ZT9C 4ZRZA 1LT4D 1KDAA 4ZUJA 3ULJA 2OQKA 5IT9c 5I9OA 2KA7A 5IODA 1LT5D 2WAQB 1WTXA 1CM9A 2PQAA 4IURA 5C4ZA 1VQJA 1VF7A 3TP6A 3GTOB 4LMQD 3L2PA 5AJ3Q 3HOVG 1BO0A 4JI4L 1YNJD 2EYFA 4GNXC 2GVBA 4ODGA 2J0TD 4QUFA 4OO1H 2B2YA 1YNXA 2O2LD 4BBSB 5IYDG 3GTOH 1CK1A 1L0YB 4RCOA 4DUYQ 4NPSA 3BVZA 2K5NA 3H3VI 2F3WA 1XTDA 2L4NA 1CHQD 4MN3A 1A2TA 2PNHA 1VQEA 1YJWA 4OXPA 3EIVA 4BBSH 2VW9A 1IZ6A 4DAYB 1MD2D 5ELCA 2RA4A 1L0WA 1Q90A 4L8JA 3L0OA 4R4QA 2ES2A 5AFWA 1S5CD 4PZ6A 5KNBA 3DLLA 1STNA 1SSOA 4JI6L 1F2MA 1NBWA 4A3JG 1WJJA 2LKVA 3CCUA 3IAYA 4FF4A 4JV5L 1DM0B 1EUJA 4UAIA 4XXEA 4Q0FA 1D1KA 5JJZA 2WKDA 4N9PA 4DNIA 4DV4Q 3PSIA 1MJCA 1U0LA 1A6XA 1BBWA 1LTAD 4FNFA 4HIDA 2Z4HA 4X66Q 1YI2A 3HG9A 4DAMA 3R3OA 2WINB 3NK9A 5DNFA 4KHVA 5GAGC 1I4GA 1SE8A 2F0PA 3S1MB 3KJOA 3MEFA 5D65A 5IGFA 4IUNA 4IALA 2KENA 4ILWA 1OXXK 2HUGA 1H95A 2PO4A 4KN4C 2MPMA 4QQBX 5EBCA 1VCIA 2M00A 1QNKA 1I6HH 1O7IA 3T13A 4A3LG 4NB3A 3OTOQ 1M1KC 2K1BA 2PZTA 3A0JA 1TS5A 5L37A 2UXCL 1EQTA 4X65L 1CZGA 5KGUA 5H1SE 3CCEA 1K83B 4BBSG 4R4IA 3NBIA 3PUXA 5J39A 2BA0A 1J9OA 5IWAL 2E2HB 5CGKA 2R7ZB 3CQZB 2EY6A 3D8GA 2JJQA 1OXVA 4KY5A 5JAVA 4DR2L 2B2TC 3RZDB 1YHAA 1X3FA 1C9OA 1IL2A 2OQ0A 3MXNA 2I5HA 2E2HH 3QOLA 2R7ZH 1TT2A 3CQZH 3H0GB 4ULLA 3IL8A 3MEHA 4B3SL 1SMYC 1KRTA 1WVLA 5D3IB 1SN8A 3TP8A 2H1EA 5C3EB 4O2DA 3K6OA 3TEHB 2DY8A 4NXNL 3K5MA 2PI2E 1NNXA 1WD1A 4LF9Q 1FNWA 1MSGA 5ELDA 5C3EH 2ZJRA 4ZKBB 4ZKCB 1ICFB 1U5KA 2XRSD 5CORA 2UXBL 2UUBL 2YTXA 4K8JA 4YWMA 1RD9D 1DOKA 4QIWE 1BQQT 3BJUA 1DYQA 4GZYC 4CDCC 1EU3A 4KKUA 3GTJB 2B8GA 4R4OA 3U4ZA 4K5VA 1YITA 4DV3Q 3M4OB 3J80c 1K73C 2QGQA 4JI7L 1C48A 4RHRA 4ZQ3A 4X3TA 4DV7L 3KBGA 1UWVA 3F2UA 1HJPA 4JBWA 1JMCA 1N32Q 1B3AA 4FYDA 4HJ5A 3M4OH 3GTPB 3DEPA 1LTTD 4KTAA 4IUQA 4K5WA 5FO8B 1L2FA 2KHJA 4P2CB 4GOPC 4DUZL 3FPUB 2CH4W 1BNZA 4JG2A 4IUPA 1FL0A 3C46A 1CUKA 3KF8A 3K59A 5IIFA 2OCEA 5FOBB 3ONAB 1YJ9A 1ZYRD 2JQOA 1B9NA 4GNXB 3BYTB 1SNCA 3J7YW 2AMCB 4GKJL 1NAPA 2ENBA 5IP7H 1FR3A 1HRJA 1CKNA 3PIP3 1LT3D 2K05A 3DMUA 5CBEE 2MQHA 3VR3A 1RCVD 2EOTA 2PW5A 2EPBA 3UE0A 1EZ6A 2I46A 1N33L 2DNEA 1DGSA 5C0XH 3R2TA 2NN6H 5EKLA 4EGVA 3FEWX 5GAEC 1VQHA 3PCOB 2L1BA 4IO9A 3VYTA 2N8NA 1Z9FA 5KYLA 1JB7A 1RODA 1EY5A 3UDIA 1VQ9A 2BCOA 1B4OA 3QO2A 3GP7A 1XX8A 1J5EQ 3G4SA 2X6LA 1IL8A 5CV7A 3WWVA 1EFWA 1SDFA 2AWOA 1H9SB 1XPUA 4JI5Q 2EVBA 1ZKOA 4YWKA 3PV0A 4EQNA 3KOJA 3OYYA 4C3HH 5JJIA 3LX0A 4KD4A 2O5IC 4A3BG 4IFDH 4M8AA 2V1CC 4DR1L 4DAVA 4BWGB 3C1FA 2ASBA 2KEDA 4GN4B 5CBAE 4B9WA 3Q22A 3HOYB 2LXKA 2K52A 5LMNL 4EQPA 5I6WA 4X3SA 1B44D 4HAEA 1KABA 1D8LA 1MHWC 3J81L 3HOYH 2ZXPA 3ND9A 3I90A 5CV8A 2F0VA 4A3EB 1BKBA 2A68C 2J7ZA 3KUPA 4YCWA 1VQCA 5LHY1 3AYHB 1Y1VB 2VL6A 2LFNA 2NVXH 2RCFA 1KHIA 3T1HQ 2X69A 3ER0A 2E76C 4A3EH 2RBMA 5BN5A 2F0GA 4K14A 1N34Q 3CPFA 2QKIC 4LUOA 2FJ2A 1Y1VH 5IP7G 3I56A 1X3EA 2RQXA 5E4WC 1O78A 3G7LA 4F8MA 2EJMA 4DR4Q 2HT1A 1EIGA 2AKWB 1S5FD 3UDGA 2JEBI 2K03A 2LXJA 3W2DA 4FF1A 3RN2A 1FVIA 2VB2X 4GKKL 4GS3A 4AYBB 2MUYA 4LF7L 1PRTC 4R9WA 3RLNA 2D2CC 4DF7A 4C3HG 3GTGH 1KDBA 4RGOS 4IFDG 2E2JB 1VQ5A 3I8ZA 1P16A 3K5LA 3V96A 3NSWA 4ALPA 1DD2A 1G6PA 2B2VA 3PF5A 1YBYA 5A2QL 2F0WA 2O4XA 1PDQA 4A93G 4JI4Q 3QG1A 2E2JH 3ULPA 1D1IA 2WB1B 1DXMA 4CHTB 1I4PA 2J4XA 2Q2IA 3FMCA 2K33A 4DKAC 3JAML 1GOZA 1STAA 3D6WA 2KHIA 4C2MB 4HSVA 1TWGB 2CH4A 5FO7B 3T56B 1ENFA 1OTCA 1NTGA 1KL9A 3MXUA 1ICWA 2B63B 2HDMA 1K3RA 3F8TA 1I4QA 1TWGH 1HA6A 3OOCA 4V0BA 1LTRD 4DN4M 1IBKL 2F0FA 3TMEA 4JI6Q 1U4PA 3S14B 3MA2B 3OWFA 4PZ8A 4JV5Q 4LK1C 3O13A 3IFTA 4JOIC 3QJYA 4GOPB 2BH8A 4E6IA 1V9PA 3CRLC 5I9PA 3S14H 1ESFA 5FLMH 4ABNA 2L11A 3NQTA 2XWBB 4CDFC 5J22A 1A8VA 3L9AX 1MGSA 4K6DA 1BCPC 2MO1A 3HZXA 4JW0A 4DNTB 3NTIA 4K5XA 1A0IA 3FPPA 1JJGA 2F0JA 2HIXA 3A54A 5JEAJ 1UE1A 2Q8IB 1KDCA 3LWEA 3J81j 4YWLA 4OL7A 4LAAA 4AYBG 1Q1EA 5KIXA 1EIHA 5HGTA 1EQRA 4FXGC 3NXWA 4PQXA 4CJ2C 3T51B 1GVPA 3CU7A 3FRPB 1G8ZD 1QE6A 1D2BA 3OHXC 1YHQA 4HSPA 2UXCQ 4X65Q 4UP7A 4P75A 1XMOL 2WB1G 1G2TA 4HCSA 4G7OC 2HQLA 4HMIA 2KCCA 5I2YA 3BYYB 1VQ4A 1SMXA 4WJ3M 4G7HC 3DEOA 3WOFA 4DV2L 2HHHL 1LUZA 2NVYB 1VQMA 1NR2A 4DR2Q 5IGCA 2MJ8A 1PV4A 1I94L 2VNUD 1TWFB 2B2YC 1YIJA 2RHQB 1VQPA 3CPWA 1X54A 1TXYA 4BBRB 2D62A 2F0EA 1JQYD 1JCKB 1TU2B 1TWFH 3MWYW 3E0JA 1SFOB 2FHTA 5FLMG 2M9VA 1STYA 1GJXA 1STEA 2VUMB 4F7XA 1T5EA 4BBRH 4B3ML 5KNDA 4DR5L 3KF6A 1SFOH 2UXBQ 4A3GB 4FO2A 3K81C 4CJ1B 2VUMH 2EJGC 1B1ZA 1L1OA 4YY3L 1B50A 3OMGA 2DUDA 1SJED 4H0LC 1I3QB 2EZVA 3X3NA 1KNAA 1QG7A 1RKNA 2A6HD 2E2DC 1DOLA 4JI7Q 2Z0SA 1H9RA 4ZYSA 4DV7Q 1UEBA 1SMYD 4AYBE 4KKSA 3HOVB 2Q8RE 2LMCB 1M8AA 2SNSA 1I3QH 3GTQB 3PUVA 4DXFA 5D3DA 4DXGA 1SE4A 1ENAA 5EQ0A 2F3IA 3C1EA 3NEMA 5EBDA 3GTQH 1GD7A 1YEZA 4HR7B 4DUZQ 1PRTB 2KHSA 1NJIC 3OIQA 4KLKA 2F0SA 1EQQA 2UXDL 3CMAA 2WB1E 1EL0A 2B3GA 1WTPA 3K80C 4IQZA 1FNUA 4JBJA 1Q86C 4HMJA 3CF5A 5F2DA 3ICEA 4G57A 2O5JC 2N3SA 4IZ8A 5IP9G 3DM1A 2EY2A 2VQEL 4A3JB 3NE5B 4H7BA 1GHKA 2IHEA 2R92H 4GKJQ 3MXGA 4RCNA 1H9MA 2K5VA 4I7ZC 4HIMA 1KC8C 2LSSA 3CRKC 5T1GA 1K28A 4A3JH 2R3ZA 5E1FA 4DU9A 3T1YL 3AFQA 2CQOA 1LTID 1N33Q 1D6EC 4RHSA 5C3WA 1IW7C 4TVAB 1SNQA 3RLOA 2YU9B 2EYLA 1A63A 4U68A 4JI1L 2VUMG 4GLXA 1QUQB 5GAHC 1YJNA 4WJ4A 3I4LA 1HPCA 3RR5A 4OWXB 4JK1C 2EY1A 4RWSC 1TQOA 4JCVE 4PZ7A 4APVA 4MIUA 1WYDA 2A8VA 5A2QE 4QL5A 3U4VA 2NUCA 1D5ZC 1IYJB 4QMGA 2PNRC 4DR1Q 4NKLA 2D9UA 1P8LA 1ET9A 2EIFA 5T1IA 3OIPA 2EYMA 4DV6L 1BCPB 2R61A 5LMNQ 4KKTA 2E2IB 4RA8A 2A19A 3JAME 1O80A 4A3LH 2JE6I 1F9SA 3F2BA 4R8NA 3EJIA 1PFMA 2DJGC 2FINB 1HR0L 1SROA 3MFYA 4XQJA 5IGBA 2E2IH 3R8BA 5M5WH 4K0KL 1AFPA 2K32A 1H9KA 3NENA 3Q6SA 4J15A 5IE8A 2VY3A 1FJGL 2A74C 2R92G 1U4LA 5EPLA 1F77A 1XMQQ 5JEAG 4KN7C 4IPGA 4LJZC 1PTOF 2ICIA 3GTLB 4J8QA 4DK6C 4DV0L 4DV5L 1F9RA 4A3IB 1RIPA 1HNZL 1A15A 1M4VA 1E2WA 3SR1A 2PQAB 4B08A 4FXDA 4CBVA 1K8MA 2QA4A 1O7ZA 2Q8TA 4HJ8A 4DR3Q 3GTLH 4J6HA 2NZ1D 1HZ9A 4A3IH 1E1OA 2A68D 3T4AC 1VQDA 4WJWA 3BDOA 3RZOH 3HOXG 4GKKQ 3E9IA 5GADC 3H3VC 4NMZA 3A55A 1TIID 2I07B 3KYHC 2MFIA 3J81c 4LF7Q 1WOCA 2SDFA 2A73B 4MNOA 2LY7A 3P1HA 1I50B 1PZKD 1HNWL 4I65A 1I6HB 2Z6KA 4K2LA 3RNUA 4DAPA 1IBMQ 4ME5A 1EYAA 1G291 1I50H 1SYFA 1FNVA 4L6TB 3HS0C 2L55A 1UAPA 3MXPA 5G3LD 2SNMA 1K8AC 4FXKC 1Q81C 4RMFA 4LFCL 5BN3A 3TS0A 4B3RL 4IJHA 3QWNA 3N52A 1KRSA 1PRTD 1STBA 3FKIH 3MZ5A 1CSQA 5DLQE 3TRZA 2K5HA 1TWHB 4C3IG 1QWYA 3M4YA 1GUGA 3VR5A 4G7ZC 4N9TA 3U9SA 3DWPA 3TS2A 3J7AF 1IBKQ 2NBFA 3HP3A 3SXHA 1TWHH 2JA9A 4B9XA 3PQIA 4DK1A 1PH3A 1Y8OB 1IXRA 5C6AA 1D7QA 5LMNW 1OO9B 1ML0D 2ZTCA 2AUJD 2A6HC 1B8AA 4FF2A 1B2TA 1FYCA 4RFBA 3CCSA 1UE5A 4JI0L 1N8RC 2NVQH 4HJ7A 3F2DA 1EOTA 4UPAA 4C1NI 4A3IG 3DUZA 2Y0SG 1OXUA 5GROA 1SE2A 2N78A 3CCQA 1W2BA 1ILQA 2CWAA 2UUCL 1HZBA 3JAMc 1QVCA 3A56A 4BY7H 2JA7H 1VMCA 1S4ZA 4A3BB 1CI3M 1C4QA 2JA8G 3DWQA 1D5XC 5JVG3 1TR5A 4AH6A 2XRQD 1LACA 4JI2L 3EBEA 4A3BH 3TBIB 2CVRA 2X6GA 2ZTEA 3KJPA 1RF2D 4O42A 4M1UB 3Q23A 3MXNB 4JBKA 1JOOA 1BCPD 3URYA 4XYQA 4OWWB 1XMOQ 4DGZA 5BR8L 5CV6A 3WOEA 4L63B 4A3FB 3FKIG 1KAWA 2BE5C 2E5LL 1X6OA 1T5XD 1MSHA 2L5TA 3J7A5 5M9OA 1G2SA 1QILA 2HHHQ 4A3FH 2FMMA 2RDFA 1SR3A 1I94Q 4UP8A 4G4KA 3S24A 1TY0A 1S5ED 1O7LA 3TSSA 1JICA 3I73A 4I7AA 4S3SA 2JA6G 1BBUA 1PYSB 3E9HA 3K7AB 4KK7A 2K01A 1ZXTA 2D5DA 3ITPA 1I4HA 2OTLA 4B3MQ 4OELB 5IT9L 4DR5Q 2D0PA 3K7AH 3ULLA 4P71A 1STHA 3M3YB 3SK6A 1D5MC 3JC66 3CAMA 3A5UA 1W6KA 2Y0SE 4B3TQ 1EIFA 1JORA 1RHPA 4IUTA 2OXPA 2A69C 1E24A 1PZID 1R4QB 4C3HB 5D14A 3M3YH 2JA7G 4BY7G 3BG3A 1E2VA 1KIXA 4JPBW 3D4WA 3VYSA 5M3FH 4NW2A 2HDLA 5JPMC 2F0KA 3I7FA 2EJFC 1CKMA 1HQRD 4A93B 3SK5A 1JJCB 3M9BA 4JBMA 4PNYA 1EWIA 1AP0A 3T53B 1QJOA 2R93G 1EY8A 1EOVA 1XJVA 2EYJA 4A93H 3LWUA 1PH8A 1N9WA 3K58A 4WFN3 3DXJC 2OT2A 1AE3A 1FGBD 4HIOA 1CKNB 2CFMA 4MZ9A 4P73A 3UE1A 2MO0A 5IY0A 5KEEA 2NVTB 3E5SA 3H3VH 1A3VA 2NVXB 1NUCA 4HJ9A 2FMCA 2ICEC 4A3FG 3J7ZC 4DFAA 3GTMB 4KY6A 4AIMA 4K8IA 2NVTH 3VR4A 4UY8C 5AJ3L 4Y7NB 2K14A 3PUZA 1K9MC 5C4XG 3HEJA 5EKKA 1VQ8A 3GTMH 1XWEA 4MTNA 2WACA 2KCNA 4Y7NH 3HOWH 2F0IA 1JT8A 1F9QA 2CW0D 4JVZA 1ZEQX 1X3QA 4FDBA 1HTLD 2H4OA 3WDNA 1SLJA 1LLRD 4F87A 3AEVA 5EGTA 1HXYD 4JI1Q 1LT6D 1YHBA 1PYBA 1YNNC 2NZOA 4P74A 1X3GA 3GTGB 5FLXE 2SOBA 5FJ8H 1Y8NB 2F0QA 3H94A 5M3FG 3W3AA 4EQ5A 2B8FA 1X32A 3GV6A 2Z9HA 3OPOA 4JYAL 1G51A 2VQFL 2Q2UA 3J80i 1JOKA 2XNAC 3U58A 2EDGA 2Z6BA 2Z4IA 2F0HA 4DV6Q 1LTBD 2KVMA 1EFID 1IW7D 4L5QA 1L1OC 1KLUD 4A75A 3HKZG 1BUVT 3VA5A 2Q2HA 3S2DB 3BZKA 5FK9C 1NMGA 2RDHA 2LS01 4HTHA 4OGQC 4R4TA 5KRUA 1CFMA 1HR0Q 2OEOA 4PMCA 1EWHA 4K0KQ 2V4DA 2GVAA 3S2DH 1DOMA 3A8IE 2QEXA 2H5XA 1V1PA 1VQBA 4BS9A 2UU9L 1FJGQ 1PFBA 2HCIA 4OONA 3I4MB 1K0SA 1WTVA 4F88A 3RN5A 3DWAA 4OO1I 2VS1A 3VR6A 1NY4A 4CKCA 4DV5Q 2A1AA 3HOWG 2HD3A 1TWAB 3I4MH 5JPNC 1HNZQ 1N36L 2XSCA 1AEXA 3R2IA 4EX5A 2QDLA 4BY1H 5ELNA 1G91A 1TWAH 2CQAA 3CP0A 1Z47A 1TWCB 2BDNA 1CHPD 3A7LA 4ZUIA 1SNOA 2F1MA 3PUWA 4V190 4JI8L 5FJ8G 1U9RA 4A3MB 1TWCH 3H91A 1KLGD 4R1JA 3RD4A 3TP5A 2ID0A 3B6YA 5FO9B 1V8QA 5BN4A 1NMFA 2L15A 4ZAIA 2RVLA 3FVQA 1T9HA 4HCEA 4IOAA 2NZHA 3CCLA 1UE6A 3I3CA 2AHOB 1S72A 3CD6A 2PQEA 4A3MH 2NWGA 1PLFA 2PZWA 1S5DD 2EXDA 1SXTA 1GUOA 2K6AA 1U4MA 2RF4A 4QB4A 1RL2A 3PMFA 1EEFD 1HQMC 1NSNS 1K8OA 1WCMG 2BOSA 5LMUL 2SEBD 3HKZE 4LFCQ 3MTSA 4LUVA 3H15A 1IKLA 3CKIB 1VF5C 1TS2A 3QB3A 4CDDC 2PPBC 1QCBD 5IWAQ 2CWPA 1Q1BA 1PXUA 2HCCA 2K5QA 2I5LX 3M4PA 5IP9H 2IY5B 4YCUA 1EY9A 4A3CG 2RSOA 3MVVA 3I4MG 3J7AV 3HKSA 2M2LA 3W5OA 1PH2A 3FHWA 3S1QB 1B3QA 1II3A 5CV5A 4DNRB 1PH7A 4B3SQ 5IT9E 2E8GA 2IX0A 4JI0Q 4BY1G 1PH9A 1HR0W 2MP1A 4NXNQ 3MC0B 3K0XA 3PUYA 5E4XA 3S1QH 1TS4A 4JI3L 1Z7TA 2ALYB 1R4PB 2L0CA 2WP8J 4DK3C 2P5ZX 2UUCQ 5I4DA 2AQ2B 2UUBQ 1FGUA 3V2TA 2IX3A 1SAPA 4DR7L 4ZCKA 1CKOA 2DGYA 4ID6A 3QIAA 1ENCA 1BR9A 4QUCA 4C3JG 4A3MG 5CR3A 1MBYA 3MFGA 4JI2Q 4LWCA 1X65A 3NBHA 1X56A 5A35A 3KDFA 5IGGA 1JWUD 2KEEA 3PO3H 3KLRA 2RDGA 1TKWB 2TSSA 1Q8KA 3NQIA 1JR0D 2CW0C 4RAUC 4Q5VA 2E5LQ 5CC4A 2C9OA 3RLFA 4LF5L 4IUVA 4TSSA 5M3MG 4X3UA 1A3UA 2Z6KC 1O7YA 1STGA 1SE3A 5K36G 5M5YB 2VZAA 4LFBL 2R92B 1FD7D 1VQAA 1A2UA 2KECA 3KF6B 2K28A 2MNAA 3I4NG 4LF6L 1L1OB 2KJXA 4UDUC 2EY5A 2F0NA 5M5YH 1X55A 2AQ3B 1SNDA 2NB0A 3UDFA 4A4IA 5JEAH 3UDXA 1EY4A 1WD0A 4GN3B 2BE5D 1AZPA 4FF3A 3HOXB 4LF8L 4KY7A 3IFDA 1HZAA 2NTTA 3GDEA 1JWSD 1IKMA 4QY7A 1PHJA 4CKEA 5EPJA 3T1HL 4A76A 5C5LA 5I6YA 3HOXH 1Q8IA 5C44G 2EXZA 2JSOA 1Y14B 4JC0A 3PIOA 2EQSA 2C35B 3HGBA 3M7GA 3AQQA 2DN8A 3KLSA 1TY2A 1CA5A 3S17B 1R9TH 5C0XI 2NN6I 1RTOA 3K8AA 4DAYA 3K5NA 3S9WA 2BH2A 3STBC 2AQ1B 3HOZG 4KV6A 4NXML 1QVGA 3I2ZA 2A6EC 3S17H 3PO3G 3PO2G 3CHBD 5M5WB 2PCFB 4RGNA 3ERQA 4UP9A 3BU2A 3G48A 3SGIA 4YHHL 1J8IA 3S16H 5LL6X 2A69D 4C3IB 3TREA 3VYRA 1WTWA 3Q8DA 4IFDI 1PA6A 3F2CA 3I70A 2IW3A 2L12A 3K5OA 4MHEA 4TQUS 4C3IH 1GO3E 1SYCA 1W3SA 3X3MA 2NTSA 1E7ZA 1PTOC 1QVFA 1SEBD 1LTLA 2ZXOA 2QF7A 4POFA 1XNRL 3BZDB 1KQSA 2B2UA 1MKHA 1LABA 3J80E 3UI2A 4HN7A 3E0EA 5C4HA 4BA2I 2Y0SB 3RZOB 1LM0A 4IOCA 4ZK9B 2E75C 2B2WA 1DZ1A 1EEID 3EA6A 4KJNA 4L5SA 3NHHA 1CQFA 1PH5A 4KHZA 1PH1A 4H02A 1BDOA 2RSNA 3TZUA 1QNUA 2YTVA 1VQLA 4KD3A 2EYPA 2K7VA 5JVH3 4O0AA 2JA8B 1VDZA 1VQIA 3SE0A 3TN2A 1PVOA 4KI0A 4OEMB 2R7FA 2GA4B 5CV9A 3NTHA 3D4RA 4JYAQ 4XTCS 1B70B 1CQVA 1LYLA 1SYGA 4QF4A 5FLXL 2VQFQ 4J1MA 2JA8H 4RKBA 2JP1A 4POGA 3A8JE 1GUTA 4IN3A 5IYCG 4GLVB 1HH2P 1QOHA 1VS0A 1E2ZA 4LF4L 3GD7A 3S15B 3FKIB 1JC7A 3NELA 5TSSA 2QW7A 4DR6L 3P7JA 1YNND 1OXSC 1JE4A 3R93A 4HIKA 1Y69U 1BBXC 2F4VL 2K50A 1DJRD 2IWHA 3H09A 3S15H 2FXQA 1RDPD 3K0YA 2ZXRA 4IJLA 1KTKA 2UU9Q 5C0XJ 3A8KE 2F03A 3S1MH 1E3PA 2Z8LA 2YYZA 5ELFA 3E6ZX 1EU4A 2K5WA 5IYBH 2K4KA 2WAQG 2JA6B 4OX9L 4OO1G 4TRDA 2QEJC 1B7YB 2F0DA 3N6RA 3K57A 1MI2A 3D3RA 1XYIA 2NVQB 4BXXH 1N36Q 1RJTA 2JA6H 3KK7A 1Q46A 2JYOA 5C4JB 4C56C 4DV1L 4AQYL 4IFDJ 3VYUA 3OMCA 1WFQA 1L0XB 5IOCA 1K83H 1OXTA 1GUWA 1HUNA 4O1NA 5HURA 4BY7B 2JA7B 5C4JH 3MHBA 4JI8Q 2A5HA 3ND8A 3D4DA 4EVOA 4CKBA 3G71A 1U4RA 4K2KA 1CZWA 3RZDH 1HA5A 2ZJPA 1K3BC 5JJKA 1WI5A 2I5MX 3H0GH 3OSOA 2VB3X 2D0OA 1NE3A 2R93B 2UUAL 1A62A 4H13C 1WTHA 1AE2A 3CXCA 1I4XA 3H6MA 1XNQL 5LMUQ 3SK4A 2MHVA 2R93H 1XXGA 1PMRA 2F4IA 3EFXD 4GNXA 1DCZA 2MGSA 1MJEA 3NWSA 3TZDA 2KBNA 3NTKA 3FP9A 3W1GA 2XWJB 4OIJA 4XYOA 1E22A 5E7NA 1AW7A 2B2VC 4IPDA 4XQQA 2OTJA 4DV2Q 4PMWA 3GTJH 4Z9CB 1UUPA 5IYBG 2JK8A 5DAUA 3I4OA 1WTOA 1GKHA 4KHPL 5C4XB 1EYGA 3M7NA 3CC4A 3SEBA 3CC7A 2WAQE 1EYCA 3AU7A 4A3KB 4BXXG 3P20A 4X62L 1GM5A 2B29A 1C7YA 4OHJA 1IYUA 2XTIA 5C4XH 3GTPH 3GTKB 1H9SA 2NYZD 4H44C 4A3KH 3EROA 3RMHA 4PV1C 1GUSA 4JI3Q 2YTYA 3IRBA 1ET6A 2F52A 4LFAL 3GTKH 2TMPA 1XPRA 2ZJQA 1JOQA 2XVSA 3D6CA 2F0LA 3ZJYC 2R7ZG 2DY7A 5M3FB 4YY3Q 3D31A 4DR7Q 1PTOB 4OWTB 2WKCA 1QB5D 3OW2A 3J81i 1AN8A 3AMUA 2YV5A 2WFWA 1A3TA 3H0GG 4OIKA 2K75A 1PTOH 3KF8B 3CMEA 2IT1A 1HNXL 2AWNA 2ZM6L 2Q2TA 3HKZB 4LUZA 5C3EG 1AZQA 1SBBB 2FFKB 1YNJC 4YIJA 3TP7A 1ILPA 1B53A 1ESRA 4IUUA 4X64L 1CT1D 1X9NA 4MTKA 1IBLL 3SVMA 3NWTA 2Z1CA 1H9JA 4N8FA 5J3BA 4LF5Q 2UXDQ 4NDXA 5HY6A 1VMPA
chains in the Genus database with same CATH topology
2DNCA 4RH6A 5I2XA 3V05A 3T16A 2G9DA 1EY0A 5ELBA 4XIGS 2XIWA 5DM73 5EJWA 3HOWB 2WIIB 2B2TA 2G9HD 1NCVA 4XDXA 1SYBA 4XQNA 1EY7A 2E74C 2JXMB 4X3KA 1SYDA 1CA6A 1Z6HA 2VXWA 3BDCA 1HTPA 2PZUA 3MAQA 3HOUB 3U9OA 1HFGA 3I72A 1GUNA 5C0XG 2NN6G 1SJHD 1Q12A 1WCMB 1HHVA 3VR2A 2JEAI 3VA7A 1WTQA 2IL8A 5LL6S 2L9HA 4R8IA 3EQLC 1SNPA 5COYA 5G3LF 1I4RA 1E0BA 2IPKD 1TVXA 5IGEA 1PRTF 1IHZA 3FDTA 3GV3A 3G6JB 1JB3A 3IKJA 3S1RB 1Q3LA 1XTCD 2PMZB 4BY1B 2A6ED 4U673 1IYVA 3GQBA 3RUZA 1PFNA 2R6GA 1BOSA 2JA5B 4A3DB 3TDQA 2F0UA 3GO5A 3J80L 1PYWD 1F2ZA 3DHQA 5ELEA 4XT1B 1GXDC 5J1ZA 2RKSA 4C3JB 3PIO3 2K5DA 1PTOD 2QDBA 1UEAB 2IX1A 1V1PB 1LO5D 1SYEA 3SHLA 1BXTA 4EQOA 3QOJA 4NP5A 1Y8PB 3C3LA 1RTNA 2CHBD 1SNMA 2WV6D 4KJOA 1BCPF 1V1OA 5CMDA 4WORA 4RGMA 2B39A 1WTRA 5M3MB 1C8CA 1JWMD 5EPKA 2KQ3A 1Y1WB 1EWCA 1EYDA 5C5MA 1TS3A 3I4NB 2IJ0A 5K36H 1ZYRC 1EZ8A 5IGDA 5K5PA 5DM63 4BA1I 2HQEA 3P75A 3EVQA 3I91A 2F0MA 2OF1A 5DEHA 2QCPX 1I6VC 2XN9C 3KLSX 4DK0A 2BDOA 5CYUA 5C44B 1W6JA 3S2HB 1B9MA 4PMBA 5JOBA 3NP8A 4RKLA 1DONA 2B2UC 4CJ0B 4RGTA 3Q0AA 2KOLA 2B2WC 5M5XB 5C3XA 3HOZB 1S5BD 1UNSA 4C1NK 2EE1A 3C2PA 3PO3B 3PO2B 4CGYB 1LTSD 4QCLA 3L3OC 5NUCA 3NUCA 4XT3B 3LNNA 2BA1A 2N55A 4TKOB 5E3FA 4FP5D 1F9PA 3KBXA 1HCZA 2F0TA 2QILA 3OWEB 1X3PA 1BF4A 1HFNA 3S1NB 5KNCA 2AUKA 3A7AB 3Q24A 3AB9A 3SDZA 1G6ZA 3J81E 5FKAC 3M85A 1NR4A 3L7ZC 1F2LA 2KUMA 2F0OA 4FVMA 3BDLA 2EYHA 1CTMA 1EQVA 3HRZC 2EYOA 1KNEA 2F3VA 3ZYYX 4WRDA 2C5CA 4DA2A 1ONLA 2K04A 4ZLTF 1LTGD 1LV9A 4K6LA 3SK8A 2PW7A 1V43A 1R9TB 4HEDA 3OW7A 5ISRA 3NPPA 1GHJA 1PZJD 4QIWB 1F2YA 1KAAA 2PYKA 4KMUC 3S16B 5KYIA 5CV4A 2N88A 5EKIA 1EY6A 1HUMA 3BS1A 3BVGA 3BVMA 2ZT9C 4ZRZA 1LT4D 1KDAA 4ZUJA 5I9OA 2KA7A 5IODA 1LT5D 2WAQB 1WTXA 1CM9A 4IURA 5C4ZA 1VF7A 3TP6A 3GTOB 4LMQD 1BO0A 1YNJD 2EYFA 4ODGA 2J0TD 4QUFA 4OO1H 2B2YA 2O2LD 4BBSB 1CK1A 1L0YB 4RCOA 3BVZA 2F3WA 2L4NA 1CHQD 4MN3A 1A2TA 1MD2D 5ELCA 2RA4A 1Q90A 4L8JA 5AFWA 1S5CD 5KNBA 1STNA 1SSOA 1F2MA 2LKVA 3IAYA 4FF4A 1DM0B 4UAIA 4XXEA 4Q0FA 1D1KA 5JJZA 2WKDA 4N9PA 1A6XA 1LTAD 4FNFA 2Z4HA 3HG9A 3R3OA 2WINB 3NK9A 5DNFA 4KHVA 1I4GA 2F0PA 3S1MB 5D65A 5IGFA 4IUNA 4IALA 4ILWA 1OXXK 2HUGA 2PO4A 4KN4C 2MPMA 5EBCA 1VCIA 2M00A 1QNKA 3T13A 2K1BA 2PZTA 1TS5A 1EQTA 1CZGA 5KGUA 1K83B 3NBIA 3PUXA 5J39A 2BA0A 1J9OA 2E2HB 5CGKA 2R7ZB 3CQZB 2EY6A 3D8GA 1OXVA 4KY5A 5JAVA 3RZDB 2B2TC 3MXNA 3QOLA 1TT2A 3H0GB 4ULLA 3IL8A 3MEHA 1SMYC 1WVLA 5D3IB 3TP8A 5C3EB 2H1EA 3K6OA 2DY8A 3K5MA 1WD1A 1FNWA 1MSGA 5ELDA 4ZKBB 4ZKCB 2XRSD 5CORA 4K8JA 1RD9D 1DOKA 1BQQT 1DYQA 4GZYC 1EU3A 4KKUA 3GTJB 2B8GA 4K5VA 3M4OB 1C48A 4RHRA 4ZQ3A 4X3TA 3KBGA 3F2UA 4JBWA 1B3AA 4FYDA 3GTPB 3DEPA 1LTTD 4KTAA 4IUQA 4K5WA 5FO8B 4P2CB 3FPUB 1BNZA 4IUPA 3C46A 3KF8A 3K59A 5IIFA 5FOBB 3ONAB 1ZYRD 1B9NA 3BYTB 1SNCA 3J7YW 1NAPA 2ENBA 1FR3A 1HRJA 3PIP3 1LT3D 2K05A 3DMUA 5CBEE 3VR3A 1RCVD 2EOTA 2PW5A 2EPBA 1EZ6A 2I46A 2DNEA 5C0XH 3R2TA 2NN6H 5EKLA 4EGVA 3FEWX 2L1BA 3VYTA 5KYLA 1RODA 1EY5A 2BCOA 1B4OA 3QO2A 3GP7A 1XX8A 2X6LA 1IL8A 5CV7A 1SDFA 2AWOA 1H9SB 2EVBA 1ZKOA 3PV0A 4EQNA 3LX0A 4KD4A 2O5IC 4IFDH 4M8AA 4DAVA 4BWGB 3C1FA 2KEDA 5CBAE 4B9WA 3Q22A 3HOYB 4EQPA 5I6WA 4X3SA 1B44D 4HAEA 1KABA 3J81L 2ZXPA 3ND9A 3I90A 5CV8A 2F0VA 4A3EB 2A68C 2J7ZA 3KUPA 5LHY1 1Y1VB 2LFNA 2X69A 2E76C 2RBMA 5BN5A 2F0GA 4K14A 2QKIC 2FJ2A 2RQXA 5E4WC 1O78A 3G7LA 4F8MA 2EJMA 1EIGA 1S5FD 2JEBI 2K03A 3W2DA 4FF1A 2VB2X 4AYBB 2MUYA 1PRTC 4R9WA 2D2CC 4DF7A 4C3HG 1KDBA 4RGOS 4IFDG 2E2JB 3I8ZA 3K5LA 3V96A 3NSWA 1DD2A 2B2VA 5A2QL 2F0WA 2O4XA 1PDQA 3QG1A 1D1IA 2WB1B 1DXMA 4CHTB 1I4PA 2J4XA 3FMCA 2K33A 3JAML 1GOZA 1STAA 3D6WA 4C2MB 4HSVA 1TWGB 5FO7B 3T56B 1ENFA 3MXUA 1ICWA 2B63B 2HDMA 1I4QA 1HA6A 3OOCA 4V0BA 1LTRD 4DN4M 2F0FA 3TMEA 1U4PA 3S14B 3MA2B 3OWFA 4LK1C 3O13A 3IFTA 3QJYA 4E6IA 3CRLC 5I9PA 1ESFA 4ABNA 2L11A 3NQTA 2XWBB 5J22A 3L9AX 1MGSA 4K6DA 1BCPC 3HZXA 4DNTB 3NTIA 4K5XA 3FPPA 2F0JA 3A54A 5JEAJ 2Q8IB 1KDCA 3LWEA 4OL7A 4LAAA 1Q1EA 5KIXA 1EIHA 5HGTA 4FXGC 3NXWA 4PQXA 4CJ2C 3T51B 3CU7A 3FRPB 1G8ZD 1QE6A 1D2BA 3OHXC 4HSPA 1G2TA 4HCSA 4G7OC 4HMIA 2KCCA 5I2YA 3BYYB 4G7HC 3DEOA 3WOFA 2NVYB 1NR2A 5IGCA 2MJ8A 2VNUD 1TWFB 2B2YC 4BBRB 2D62A 2F0EA 1JQYD 1JCKB 1TU2B 3MWYW 3E0JA 1SFOB 2FHTA 2M9VA 1STYA 1GJXA 1STEA 2VUMB 4F7XA 1T5EA 5KNDA 4A3GB 4FO2A 4CJ1B 2EJGC 1B1ZA 1B50A 3OMGA 1SJED 4H0LC 1I3QB 2EZVA 3X3NA 1KNAA 1QG7A 1RKNA 2A6HD 2E2DC 1DOLA 1H9RA 4ZYSA 1SMYD 4KKSA 3HOVB 2Q8RE 2LMCB 1M8AA 2SNSA 3GTQB 3PUVA 4DXFA 5D3DA 4DXGA 1SE4A 1ENAA 5EQ0A 3C1EA 5EBDA 4HR7B 1PRTB 2KHSA 3OIQA 2F0SA 1EL0A 1WTPA 4IQZA 1FNUA 4HMJA 5F2DA 4G57A 2O5JC 4IZ8A 3DM1A 2EY2A 4A3JB 3NE5B 4H7BA 1GHKA 3MXGA 4RCNA 1H9MA 4I7ZC 3CRKC 5T1GA 2R3ZA 5E1FA 4DU9A 1LTID 1D6EC 4RHSA 5C3WA 1IW7C 1SNQA 2YU9B 2EYLA 4U68A 3I4LA 1HPCA 4JK1C 2EY1A 4RWSC 1TQOA 4MIUA 5A2QE 2NUCA 1D5ZC 4QMGA 2PNRC 4NKLA 2D9UA 1ET9A 5T1IA 3OIPA 2EYMA 1BCPB 2R61A 2E2IB 4KKTA 4RA8A 3JAME 1O80A 2JE6I 1F9SA 4R8NA 3EJIA 1PFMA 2FINB 3MFYA 4XQJA 5IGBA 3R8BA 1AFPA 2K32A 1H9KA 3Q6SA 2A74C 1U4LA 5EPLA 1F77A 5JEAG 4KN7C 4LJZC 1PTOF 2ICIA 3GTLB 4J8QA 1F9RA 4A3IB 1A15A 1M4VA 1E2WA 3SR1A 4B08A 4FXDA 4CBVA 1K8MA 1O7ZA 2Q8TA 4J6HA 2NZ1D 2A68D 3T4AC 4WJWA 3BDOA 3H3VC 4NMZA 3A55A 1TIID 2I07B 2SDFA 2A73B 2LY7A 3P1HA 1I50B 1PZKD 4I65A 1I6HB 4K2LA 4DAPA 4ME5A 1EYAA 1G291 1SYFA 1FNVA 4L6TB 3HS0C 2L55A 1UAPA 3MXPA 5G3LD 2SNMA 4FXKC 5BN3A 3QWNA 3N52A 1PRTD 1STBA 3MZ5A 1TWHB 4C3IG 1QWYA 3M4YA 1GUGA 3VR5A 4G7ZC 4N9TA 3U9SA 3DWPA 3J7AF 2NBFA 3HP3A 3SXHA 4B9XA 4DK1A 1Y8OB 5C6AA 1OO9B 1ML0D 2AUJD 2A6HC 4FF2A 1B2TA 1FYCA 4RFBA 1EOTA 4C1NI 3DUZA 1OXUA 1SE2A 1ILQA 3A56A 1VMCA 1S4ZA 4A3BB 1CI3M 1C4QA 3DWQA 1D5XC 5JVG3 1TR5A 2XRQD 1LACA 3TBIB 2CVRA 2X6GA 1RF2D 4O42A 4M1UB 3Q23A 1JOOA 1BCPD 3URYA 4XYQA 4DGZA 5CV6A 3WOEA 4L63B 4A3FB 2BE5C 1T5XD 1MSHA 2L5TA 5M9OA 1G2SA 1QILA 2FMMA 2RDFA 4G4KA 1TY0A 1S5ED 1O7LA 3TSSA 1JICA 3I73A 4S3SA 4KK7A 3K7AB 2K01A 1ZXTA 2D5DA 3ITPA 1I4HA 5IT9L 3M3YB 1STHA 3SK6A 1D5MC 1W6KA 1JORA 1RHPA 4IUTA 2OXPA 2A69C 1PZID 1R4QB 4C3HB 5D14A 3BG3A 1E2VA 3D4WA 3VYSA 4NW2A 2HDLA 5JPMC 2F0KA 2EJFC 1HQRD 4A93B 3SK5A 4PNYA 1AP0A 3T53B 1QJOA 1EY8A 2EYJA 3LWUA 3K58A 4WFN3 3DXJC 2OT2A 1FGBD 5KEEA 2NVTB 3E5SA 1A3VA 2NVXB 1NUCA 2FMCA 2ICEC 4DFAA 3GTMB 4KY6A 4K8IA 3VR4A 4Y7NB 3PUZA 3HEJA 5EKKA 1XWEA 2WACA 2KCNA 2F0IA 1F9QA 2CW0D 1ZEQX 1X3QA 1HTLD 2H4OA 3WDNA 1LLRD 4F87A 5EGTA 1HXYD 1LT6D 1YNNC 3GTGB 5FLXE 2SOBA 1Y8NB 2F0QA 3H94A 3W3AA 2B8FA 1X32A 3GV6A 3OPOA 1JOKA 2XNAC 2EDGA 2Z4IA 2F0HA 1LTBD 2KVMA 1EFID 1IW7D 1KLUD 1BUVT 3VA5A 3S2DB 5FK9C 2RDHA 2LS01 4HTHA 4OGQC 5KRUA 1CFMA 2OEOA 4PMCA 1EWHA 2V4DA 1DOMA 3A8IE 1V1PA 4BS9A 1PFBA 2HCIA 3I4MB 1WTVA 4F88A 3DWAA 4OO1I 3VR6A 4CKCA 1TWAB 5JPNC 2XSCA 1AEXA 3R2IA 1G91A 2CQAA 1Z47A 1TWCB 2BDNA 1CHPD 3A7LA 4ZUIA 1SNOA 2F1MA 3PUWA 4V190 1U9RA 4A3MB 3H91A 1KLGD 3RD4A 3TP5A 2ID0A 5FO9B 1V8QA 5BN4A 4ZAIA 2RVLA 3FVQA 4HCEA 3I3CA 2PQEA 2NWGA 1PLFA 2PZWA 1S5DD 1SXTA 1GUOA 2K6AA 1U4MA 4QB4A 3PMFA 1EEFD 1HQMC 1NSNS 1K8OA 2BOSA 2SEBD 3MTSA 1IKLA 3CKIB 1VF5C 1TS2A 3QB3A 2PPBC 1QCBD 1Q1BA 1PXUA 2HCCA 2K5QA 1EY9A 2RSOA 3MVVA 3J7AV 2M2LA 3S1QB 1II3A 5CV5A 4DNRB 5IT9E 2IX0A 2MP1A 3MC0B 3PUYA 5E4XA 1TS4A 1Z7TA 1R4PB 2L0CA 2WP8J 5I4DA 2AQ2B 3V2TA 2IX3A 1SAPA 4ID6A 3QIAA 1ENCA 1BR9A 4QUCA 4C3JG 5CR3A 1MBYA 3MFGA 3NBHA 5A35A 5IGGA 1JWUD 2KEEA 3KLRA 2RDGA 1TKWB 2TSSA 3NQIA 1JR0D 2CW0C 4RAUC 4Q5VA 5CC4A 2C9OA 3RLFA 4IUVA 4TSSA 4X3UA 1A3UA 1O7YA 1STGA 1SE3A 5K36G 5M5YB 2R92B 1FD7D 1A2UA 2KECA 2K28A 2KJXA 4UDUC 2EY5A 2F0NA 2AQ3B 1SNDA 2NB0A 5JEAH 1EY4A 1WD0A 2BE5D 1AZPA 4FF3A 3HOXB 4KY7A 3IFDA 2NTTA 1JWSD 1IKMA 4CKEA 5EPJA 5C5LA 5I6YA 1Q8IA 2EXZA 2JSOA 3HGBA 3M7GA 3KLSA 2DN8A 1TY2A 1CA5A 3S17B 5C0XI 2NN6I 1RTOA 4DAYA 3K5NA 3S9WA 2AQ1B 4KV6A 2A6EC 3CHBD 5M5WB 2PCFB 4RGNA 3ERQA 1J8IA 5LL6X 2A69D 4C3IB 3VYRA 1WTWA 4IFDI 3I70A 2IW3A 2L12A 3K5OA 4MHEA 4TQUS 1SYCA 3X3MA 2NTSA 1PTOC 1SEBD 2ZXOA 2QF7A 3BZDB 2B2UA 1LABA 3J80E 3UI2A 4HN7A 5C4HA 4BA2I 2Y0SB 3RZOB 4ZK9B 2E75C 2B2WA 1DZ1A 1EEID 3EA6A 4KJNA 3NHHA 1CQFA 4KHZA 1BDOA 2RSNA 3TZUA 1QNUA 4KD3A 2EYPA 2K7VA 5JVH3 2JA8B 1VDZA 3SE0A 3TN2A 4KI0A 2GA4B 5CV9A 3NTHA 3D4RA 4XTCS 1CQVA 1SYGA 4QF4A 5FLXL 4J1MA 4RKBA 2JP1A 3A8JE 1GUTA 4IN3A 1QOHA 1E2ZA 3GD7A 3S15B 3FKIB 1JC7A 5TSSA 3P7JA 1YNND 1OXSC 1JE4A 3R93A 1Y69U 1BBXC 1DJRD 2IWHA 3H09A 1RDPD 3K0YA 2ZXRA 1KTKA 5C0XJ 3A8KE 2F03A 5ELFA 2Z8LA 2YYZA 3E6ZX 1EU4A 2K5WA 2JA6B 4OO1G 4TRDA 2QEJC 2F0DA 3N6RA 3K57A 1MI2A 3D3RA 1XYIA 2NVQB 1RJTA 3KK7A 2JYOA 5C4JB 4C56C 4IFDJ 3VYUA 3OMCA 1L0XB 5IOCA 1OXTA 1GUWA 1HUNA 4O1NA 5HURA 4BY7B 2JA7B 3MHBA 2A5HA 3ND8A 3D4DA 4EVOA 4CKBA 1U4RA 4K2KA 1CZWA 1HA5A 3OSOA 2VB3X 2R93B 4H13C 1I4XA 3H6MA 3SK4A 2MHVA 1XXGA 1PMRA 2F4IA 3EFXD 1DCZA 2MGSA 3NWSA 3TZDA 3NTKA 2XWJB 4XYOA 4OIJA 1AW7A 2B2VC 4XQQA 4PMWA 4Z9CB 1UUPA 5DAUA 1WTOA 5C4XB 3M7NA 3SEBA 1EYCA 3AU7A 4A3KB 3P20A 4OHJA 1IYUA 3GTKB 1H9SA 2NYZD 4H44C 3EROA 3RMHA 4PV1C 1GUSA 1ET6A 2TMPA 1JOQA 2XVSA 3D6CA 2F0LA 2DY7A 5M3FB 3D31A 1PTOB 2WKCA 1QB5D 1AN8A 3AMUA 1A3TA 4OIKA 1PTOH 2IT1A 2AWNA 3HKZB 1AZQA 4YIJA 1SBBB 1YNJC 2FFKB 3TP7A 1ILPA 1B53A 1ESRA 4IUUA 1CT1D 3SVMA 3NWTA 2Z1CA 1H9JA 4NDXA 1VMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBE E;  1O7Y A;  1X3Q A;  3I3C A;  2EOT A;  2KOL A;  2B2W C;  2EPB A;  1WTX A;  2NWG A;  1CM9 A;  1MSH A;  1J9O A;  1PLF A;  3I8Z A;  3DEO A;  4IUR A;  4ZK9 B;  1G2S A;  2B2W A;  2B2V A;  2KEC A;  2EE1 A;  1DZ1 A;  2K28 A;  2FMM A;  2L1B A;  1U4M A;  4LMQ D;  1PDQ A;  1NR2 A;  4U68 A;  4XT1 B;  2XIW A;  2MJ8 A;  1BO0 A;  5EJW A;  1ROD A;  2B2Y C;  2B2T C;  2RSN A;  1JIC A;  4QUF A;  1B4O A;  3QO2 A;  4XT3 B;  2B2T A;  2B2Y A;  1NCV A;  1XX8 A;  2X6L A;  2MGS A;  1IL8 A;  3MTS A;  3TN2 A;  2N55 A;  1SDF A;  4XDX A;  3IL8 A;  1IKL A;  3TZD A;  2K01 A;  1WD0 A;  4RWS C;  3D6W A;  3N52 A;  3MWY W;  1F9P A;  1ZXT A;  2L4N A;  4HSV A;  4OIJ A;  4MN3 A;  1WVL A;  3KBX A;  2FHT A;  2H1E A;  1X32 A;  3GV6 A;  1AZP A;  2DY8 A;  1X3P A;  2B2V C;  1BF4 A;  2D9U A;  2JP1 A;  1ICW A;  1HFN A;  3IFD A;  1WD1 A;  2HCC A;  5T1I A;  2KED A;  2RA4 A;  2HDM A;  1IKM A;  5CBA E;  1MSG A;  2KVM A;  1WTO A;  4X3K A;  1HA6 A;  3HP3 A;  5EPJ A;  4DN4 M;  4ZKB B;  5COR A;  1RTN A;  4ZKC B;  4RA8 A;  1CA6 A;  1G6Z A;  1NR4 A;  5AFW A;  4CJ1 B;  1F2L A;  1RHP A;  4IUT A;  2KUM A;  4X3S A;  5CMD A;  1U4P A;  1O80 A;  1B50 A;  2RSO A;  2VXW A;  1F9S A;  1SSO A;  3P7J A;  4HAE A;  5D14 A;  1DOK A;  1WTR A;  1JE4 A;  2M2L A;  1C8C A;  5EPK A;  3R93 A;  1PFM A;  1ML0 D;  1BBX C;  2FIN B;  1B2T A;  1KNA A;  1QG7 A;  1KNE A;  4UAI A;  1HFG A;  4NW2 A;  3I90 A;  2HDL A;  2NYZ D;  1DOL A;  1DOM A;  2MP1 A;  1CA5 A;  1PFN A;  5JJZ A;  3Q6S A;  2L11 A;  1EOT A;  4X3T A;  2Q8R E;  5E4X A;  1M8A A;  2J7Z A;  3KUP A;  3F2U A;  1AP0 A;  2K04 A;  4ZLT F;  1PFB A;  1RTO A;  2HCI A;  1LV9 A;  1MGS A;  1HHV A;  2K05 A;  1B3A A;  1WTQ A;  5EQ0 A;  1U4L A;  2IL8 A;  1ILQ A;  3DEP A;  2X69 A;  1WTV A;  2DY7 A;  2L9H A;  5EPL A;  4R8I A;  5COY A;  1SAP A;  4IUQ A;  1MI2 A;  1XYI A;  2FJ2 A;  1J8I A;  2R3Z A;  1E0B A;  1RJT A;  1VMC A;  1S4Z A;  3I91 A;  3LWE A;  5DNF A;  1F9R A;  4HED A;  1TVX A;  3FPU B;  4QUC A;  5E4W C;  1A15 A;  4OIK A;  3G7L A;  1BNZ A;  1WTW A;  1EL0 A;  2JYO A;  1EIH A;  4IUP A;  1WTP A;  5D65 A;  3FDT A;  3GV3 A;  1O7Z A;  2L12 A;  2Q8T A;  2HUG A;  4MHE A;  1G91 A;  1EIG A;  2NZ1 D;  3ONA B;  1AZQ A;  4CJ2 C;  2FFK B;  2MPM A;  2BDN A;  2CVR A;  2K03 A;  2X6G A;  4O42 A;  1GUW A;  1HUN A;  3DM1 A;  1QNK A;  1ILP A;  1ESR A;  1B53 A;  2N88 A;  5EKI A;  1QE6 A;  4IUU A;  1Q3L A;  4X3U A;  2KEE A;  1HUM A;  1DON A;  2K1B A;  2B2U C;  2SDF A;  3H91 A;  4R9W A;  1NAP A;  4CJ0 B;  1U4R A;  3SVM A;  2B2U A;  4RAU C;  1EQT A;  1HRJ A;  4ZAI A;  5T1G A;  1G2T A;  3UI2 A;  2RVL A;  4HCS A;  1F9Q A;  4IUV A;  1VMP A; 
#chains in the Genus database with same CATH topology
 2DNC A;  4RH6 A;  2HIV A;  1VQO A;  3CCM A;  3F1Z A;  4LFB Q;  5I2X A;  3V05 A;  3A5Z B;  3E3X A;  3T16 A;  2G9D A;  1EY0 A;  5ELB A;  4XIG S;  4ME3 A;  4LF6 Q;  2VQE Q;  1EIY B;  2XIW A;  5DM7 3;  5EJW A;  3HOW B;  2R7D A;  2WII B;  4R4C A;  2B2T A;  2G9H D;  1NCV A;  4L5T A;  1S40 A;  1KXL A;  3CW2 C;  4XDX A;  4DUY L;  4A3K G;  1SYB A;  3T1Y Q;  3HFZ B;  1V1Q A;  4XQN A;  4LF8 Q;  3CCR A;  1EY7 A;  5JJL A;  2E74 C;  3LGJ A;  3EN2 A;  3D0F A;  1BVS A;  2JXM B;  2RCN A;  4X3K A;  1SYD A;  1CA6 A;  1Z6H A;  4P72 A;  1XMQ L;  2VXW A;  3BDC A;  3JAM i;  1HTP A;  2PZU A;  3CCV A;  3MAQ A;  3HOU B;  3K7U C;  3U9O A;  2IHF A;  1HFG A;  3I72 A;  1GUN A;  5C0X G;  2NN6 G;  1SJH D;  1VQF A;  1K0R A;  3PGZ A;  1Q12 A;  5HGQ A;  4DR3 L;  3HOU H;  1WCM B;  1UE7 A;  1VQN A;  1HHV A;  3VR2 A;  4DV4 L;  2JEA I;  3VA7 A;  4NXM Q;  1WTQ A;  2IL8 A;  5LL6 S;  2L9H A;  2XGT A;  4R8I A;  4LW1 A;  3EQL C;  1SNP A;  5COY A;  5G3L F;  1I4R A;  4X66 L;  1WCM H;  4YHH Q;  1E0B A;  2KCM A;  1VQK A;  2IPK D;  1TVX A;  4RG1 A;  5IGE A;  1PRT F;  1IHZ A;  4GOP A;  2I0Q A;  3FDT A;  3GV3 A;  3G6J B;  1JB3 A;  1IBM L;  4GLA C;  3IKJ A;  3S1R B;  3G6E A;  1Q3L A;  1XNR Q;  3STB D;  1XTC D;  2PMZ B;  3OTO L;  1VQ6 A;  4BY1 B;  3HOY G;  4HJA A;  2A6E D;  1YVC A;  4U67 3;  3VDY A;  4DV0 Q;  4A3C H;  3S1R H;  1IYV A;  3GQB A;  3RUZ A;  1PFN A;  2R6G A;  1BOS A;  2JA5 B;  4A3D B;  5ELO A;  3TDQ A;  2F0U A;  4DPG A;  4UHV A;  3GO5 A;  3J80 L;  1PYW D;  1F2Z A;  4C2M H;  1VQ7 A;  1MIU A;  3DHQ A;  5ELE A;  4A3E G;  4XT1 B;  2CKZ B;  2JA5 H;  4A3D H;  3KLW A;  1GXD C;  1Y1V G;  5J1Z A;  2B63 H;  2RKS A;  4C3J B;  3PIO 3;  1PH4 A;  2K5D A;  1PTO D;  2QDB A;  1CSP A;  1HNW Q;  1UEA B;  3PIP A;  2IX1 A;  1J6Q A;  4C3J H;  1V1P B;  3HOU G;  1LO5 D;  1SYE A;  2GN5 A;  3SHL A;  2ATW A;  1BXT A;  4EQO A;  3QOJ A;  2RHS B;  4NP5 A;  4LF9 L;  1Y8P B;  4GN5 A;  4LF4 Q;  3C3L A;  1Q82 C;  2OWO A;  1RTN A;  3QR8 A;  2CHB D;  1SNM A;  1ASZ A;  2WV6 D;  4KJO A;  1BCP F;  1V1O A;  5CMD A;  2CCZ A;  4DR6 Q;  4WOR A;  4RGM A;  4YCV A;  2B39 A;  1WTR A;  5M3M B;  2F4V Q;  1C8C A;  1JWM D;  4B3R Q;  5EPK A;  3ERS X;  2G5D A;  2KQ3 A;  1Y1W B;  1EWC A;  1EYD A;  5C5M A;  4DV3 L;  5M3M H;  1TS3 A;  3I4N B;  2IJ0 A;  4IPC A;  5K36 H;  1ZYR C;  1EZ8 A;  1Y1W H;  4OX9 Q;  5IGD A;  1JE5 A;  1N32 L;  1YZ6 A;  5K5P A;  1S3O A;  2JN4 A;  3CCJ A;  1E1T A;  5DM6 3;  4BA1 I;  1QZG A;  3I4N H;  1AH9 A;  2HQE A;  3P75 A;  3EVQ A;  1ASY A;  4Y52 H;  5FLX c;  3I91 A;  2F0M A;  2OF1 A;  5DEH A;  2QCP X;  1I6V C;  3KFU A;  2XN9 C;  4DV1 Q;  4AQY Q;  3KLS X;  4DK0 A;  2BDO A;  3W1B A;  5CYU A;  5C44 B;  2JA5 G;  3I55 A;  4A3D G;  1W6J A;  3S2H B;  1PH6 A;  1B9M A;  2B63 G;  4PMB A;  5JOB A;  3NP8 A;  4RKL A;  1DON A;  2ZTD A;  2B2U C;  2NVY H;  4CJ0 B;  5C44 H;  4RGT A;  3Q0A A;  1I5F A;  3S2H H;  3U50 C;  2N49 A;  2KOL A;  2B2W C;  4IPH A;  5M5X B;  2UUA Q;  1VQG A;  5C3X A;  3HOZ B;  1S5B D;  1UNS A;  4C1N K;  2EE1 A;  5GQO A;  3C2P A;  3PO3 B;  3PO2 B;  4CDE C;  1XNQ Q;  4CGY B;  1LTS D;  4QCL A;  1M90 C;  5M5X H;  4B3T L;  3AFP A;  3L3O C;  5NUC A;  4QGU A;  3NUC A;  4XT3 B;  3HOZ H;  3LNN A;  5BR8 Q;  3PO2 H;  2BA1 A;  2N55 A;  4TKO B;  1J5E L;  4A3G H;  1XPO A;  4PG3 A;  5E3F A;  2PI2 A;  4FP5 D;  1F9P A;  4JI5 L;  3KBX A;  1HCZ A;  2F0T A;  2QIL A;  3OWE B;  4LNQ A;  1X3P A;  3M4Q A;  1BF4 A;  1HFN A;  3S1N B;  1Y1W G;  5KNC A;  4KHP Q;  2AUK A;  3A7A B;  3Q24 A;  4QJF A;  3AB9 A;  3SDZ A;  1G6Z A;  3J81 E;  3HOV H;  5FKA C;  3M85 A;  1NR4 A;  3L7Z C;  4N8X 1;  1F2L A;  2KUM A;  4X62 Q;  1QUQ A;  2F0O A;  3S1N H;  4FVM A;  3BDL A;  2EYH A;  1CTM A;  5IYD H;  1EQV A;  3HRZ C;  1SRU A;  2EYO A;  1C0A A;  1KNE A;  2F3V A;  3DM3 A;  4JOI A;  3ZYY X;  4WRD A;  1PFS A;  2KCT A;  2PMZ E;  1HZC A;  1K8G A;  4LFA Q;  2C5C A;  3NBH B;  3A74 A;  4DA2 A;  1ONL A;  2K04 A;  4ZLT F;  1LTG D;  1LV9 A;  4K6L A;  3KDF B;  1KD1 C;  3SK8 A;  3BZC A;  2PW7 A;  4X6A H;  2DJF C;  1N34 L;  3PF4 A;  1V43 A;  1R9T B;  4HED A;  3CC2 A;  3OW7 A;  1HNX Q;  4BBR G;  5ISR A;  3NPP A;  1Q7Y C;  1GHJ A;  2ZM6 Q;  1PZJ D;  3TQY A;  5EAY A;  4DR4 L;  4QIW B;  1F2Y A;  1KAA A;  4L5R C;  1QZH A;  2PYK A;  4KMU C;  3S16 B;  5KYI A;  5CV4 A;  2N88 A;  5EKI A;  4X64 Q;  1EY6 A;  5IYC H;  1IBL Q;  2YU9 H;  1HUM A;  3BS1 A;  1JJ2 A;  4A3G G;  3BVG A;  3BVM A;  2ZT9 C;  4ZRZ A;  1LT4 D;  1KDA A;  4ZUJ A;  3ULJ A;  2OQK A;  5IT9 c;  5I9O A;  2KA7 A;  5IOD A;  1LT5 D;  2WAQ B;  1WTX A;  1CM9 A;  2PQA A;  4IUR A;  5C4Z A;  1VQJ A;  1VF7 A;  3TP6 A;  3GTO B;  4LMQ D;  3L2P A;  5AJ3 Q;  3HOV G;  1BO0 A;  4JI4 L;  1YNJ D;  2EYF A;  4GNX C;  2GVB A;  4ODG A;  2J0T D;  4QUF A;  4OO1 H;  2B2Y A;  1YNX A;  2O2L D;  4BBS B;  5IYD G;  3GTO H;  1CK1 A;  1L0Y B;  4RCO A;  4DUY Q;  4NPS A;  3BVZ A;  2K5N A;  3H3V I;  2F3W A;  1XTD A;  2L4N A;  1CHQ D;  4MN3 A;  1A2T A;  2PNH A;  1VQE A;  1YJW A;  4OXP A;  3EIV A;  4BBS H;  2VW9 A;  1IZ6 A;  4DAY B;  1MD2 D;  5ELC A;  2RA4 A;  1L0W A;  1Q90 A;  4L8J A;  3L0O A;  4R4Q A;  2ES2 A;  5AFW A;  1S5C D;  4PZ6 A;  5KNB A;  3DLL A;  1STN A;  1SSO A;  4JI6 L;  1F2M A;  1NBW A;  4A3J G;  1WJJ A;  2LKV A;  3CCU A;  3IAY A;  4FF4 A;  4JV5 L;  1DM0 B;  1EUJ A;  4UAI A;  4XXE A;  4Q0F A;  1D1K A;  5JJZ A;  2WKD A;  4N9P A;  4DNI A;  4DV4 Q;  3PSI A;  1MJC A;  1U0L A;  1A6X A;  1BBW A;  1LTA D;  4FNF A;  4HID A;  2Z4H A;  4X66 Q;  1YI2 A;  3HG9 A;  4DAM A;  3R3O A;  2WIN B;  3NK9 A;  5DNF A;  4KHV A;  5GAG C;  1I4G A;  1SE8 A;  2F0P A;  3S1M B;  3KJO A;  3MEF A;  5D65 A;  5IGF A;  4IUN A;  4IAL A;  2KEN A;  4ILW A;  1OXX K;  2HUG A;  1H95 A;  2PO4 A;  4KN4 C;  2MPM A;  4QQB X;  5EBC A;  1VCI A;  2M00 A;  1QNK A;  1I6H H;  1O7I A;  3T13 A;  4A3L G;  4NB3 A;  3OTO Q;  1M1K C;  2K1B A;  2PZT A;  3A0J A;  1TS5 A;  5L37 A;  2UXC L;  1EQT A;  4X65 L;  1CZG A;  5KGU A;  5H1S E;  3CCE A;  1K83 B;  4BBS G;  4R4I A;  3NBI A;  3PUX A;  5J39 A;  2BA0 A;  1J9O A;  5IWA L;  2E2H B;  5CGK A;  2R7Z B;  3CQZ B;  2EY6 A;  3D8G A;  2JJQ A;  1OXV A;  4KY5 A;  5JAV A;  4DR2 L;  2B2T C;  3RZD B;  1YHA A;  1X3F A;  1C9O A;  1IL2 A;  2OQ0 A;  3MXN A;  2I5H A;  2E2H H;  3QOL A;  2R7Z H;  1TT2 A;  3CQZ H;  3H0G B;  4ULL A;  3IL8 A;  3MEH A;  4B3S L;  1SMY C;  1KRT A;  1WVL A;  5D3I B;  1SN8 A;  3TP8 A;  2H1E A;  5C3E B;  4O2D A;  3K6O A;  3TEH B;  2DY8 A;  4NXN L;  3K5M A;  2PI2 E;  1NNX A;  1WD1 A;  4LF9 Q;  1FNW A;  1MSG A;  5ELD A;  5C3E H;  2ZJR A;  4ZKB B;  4ZKC B;  1ICF B;  1U5K A;  2XRS D;  5COR A;  2UXB L;  2UUB L;  2YTX A;  4K8J A;  4YWM A;  1RD9 D;  1DOK A;  4QIW E;  1BQQ T;  3BJU A;  1DYQ A;  4GZY C;  4CDC C;  1EU3 A;  4KKU A;  3GTJ B;  2B8G A;  4R4O A;  3U4Z A;  4K5V A;  1YIT A;  4DV3 Q;  3M4O B;  3J80 c;  1K73 C;  2QGQ A;  4JI7 L;  1C48 A;  4RHR A;  4ZQ3 A;  4X3T A;  4DV7 L;  3KBG A;  1UWV A;  3F2U A;  1HJP A;  4JBW A;  1JMC A;  1N32 Q;  1B3A A;  4FYD A;  4HJ5 A;  3M4O H;  3GTP B;  3DEP A;  1LTT D;  4KTA A;  4IUQ A;  4K5W A;  5FO8 B;  1L2F A;  2KHJ A;  4P2C B;  4GOP C;  4DUZ L;  3FPU B;  2CH4 W;  1BNZ A;  4JG2 A;  4IUP A;  1FL0 A;  3C46 A;  1CUK A;  3KF8 A;  3K59 A;  5IIF A;  2OCE A;  5FOB B;  3ONA B;  1YJ9 A;  1ZYR D;  2JQO A;  1B9N A;  4GNX B;  3BYT B;  1SNC A;  3J7Y W;  2AMC B;  4GKJ L;  1NAP A;  2ENB A;  5IP7 H;  1FR3 A;  1HRJ A;  1CKN A;  3PIP 3;  1LT3 D;  2K05 A;  3DMU A;  5CBE E;  2MQH A;  3VR3 A;  1RCV D;  2EOT A;  2PW5 A;  2EPB A;  3UE0 A;  1EZ6 A;  2I46 A;  1N33 L;  2DNE A;  1DGS A;  5C0X H;  3R2T A;  2NN6 H;  5EKL A;  4EGV A;  3FEW X;  5GAE C;  1VQH A;  3PCO B;  2L1B A;  4IO9 A;  3VYT A;  2N8N A;  1Z9F A;  5KYL A;  1JB7 A;  1ROD A;  1EY5 A;  3UDI A;  1VQ9 A;  2BCO A;  1B4O A;  3QO2 A;  3GP7 A;  1XX8 A;  1J5E Q;  3G4S A;  2X6L A;  1IL8 A;  5CV7 A;  3WWV A;  1EFW A;  1SDF A;  2AWO A;  1H9S B;  1XPU A;  4JI5 Q;  2EVB A;  1ZKO A;  4YWK A;  3PV0 A;  4EQN A;  3KOJ A;  3OYY A;  4C3H H;  5JJI A;  3LX0 A;  4KD4 A;  2O5I C;  4A3B G;  4IFD H;  4M8A A;  2V1C C;  4DR1 L;  4DAV A;  4BWG B;  3C1F A;  2ASB A;  2KED A;  4GN4 B;  5CBA E;  4B9W A;  3Q22 A;  3HOY B;  2LXK A;  2K52 A;  5LMN L;  4EQP A;  5I6W A;  4X3S A;  1B44 D;  4HAE A;  1KAB A;  1D8L A;  1MHW C;  3J81 L;  3HOY H;  2ZXP A;  3ND9 A;  3I90 A;  5CV8 A;  2F0V A;  4A3E B;  1BKB A;  2A68 C;  2J7Z A;  3KUP A;  4YCW A;  1VQC A;  5LHY 1;  3AYH B;  1Y1V B;  2VL6 A;  2LFN A;  2NVX H;  2RCF A;  1KHI A;  3T1H Q;  2X69 A;  3ER0 A;  2E76 C;  4A3E H;  2RBM A;  5BN5 A;  2F0G A;  4K14 A;  1N34 Q;  3CPF A;  2QKI C;  4LUO A;  2FJ2 A;  1Y1V H;  5IP7 G;  3I56 A;  1X3E A;  2RQX A;  5E4W C;  1O78 A;  3G7L A;  4F8M A;  2EJM A;  4DR4 Q;  2HT1 A;  1EIG A;  2AKW B;  1S5F D;  3UDG A;  2JEB I;  2K03 A;  2LXJ A;  3W2D A;  4FF1 A;  3RN2 A;  1FVI A;  2VB2 X;  4GKK L;  4GS3 A;  4AYB B;  2MUY A;  4LF7 L;  1PRT C;  4R9W A;  3RLN A;  2D2C C;  4DF7 A;  4C3H G;  3GTG H;  1KDB A;  4RGO S;  4IFD G;  2E2J B;  1VQ5 A;  3I8Z A;  1P16 A;  3K5L A;  3V96 A;  3NSW A;  4ALP A;  1DD2 A;  1G6P A;  2B2V A;  3PF5 A;  1YBY A;  5A2Q L;  2F0W A;  2O4X A;  1PDQ A;  4A93 G;  4JI4 Q;  3QG1 A;  2E2J H;  3ULP A;  1D1I A;  2WB1 B;  1DXM A;  4CHT B;  1I4P A;  2J4X A;  2Q2I A;  3FMC A;  2K33 A;  4DKA C;  3JAM L;  1GOZ A;  1STA A;  3D6W A;  2KHI A;  4C2M B;  4HSV A;  1TWG B;  2CH4 A;  5FO7 B;  3T56 B;  1ENF A;  1OTC A;  1NTG A;  1KL9 A;  3MXU A;  1ICW A;  2B63 B;  2HDM A;  1K3R A;  3F8T A;  1I4Q A;  1TWG H;  1HA6 A;  3OOC A;  4V0B A;  1LTR D;  4DN4 M;  1IBK L;  2F0F A;  3TME A;  4JI6 Q;  1U4P A;  3S14 B;  3MA2 B;  3OWF A;  4PZ8 A;  4JV5 Q;  4LK1 C;  3O13 A;  3IFT A;  4JOI C;  3QJY A;  4GOP B;  2BH8 A;  4E6I A;  1V9P A;  3CRL C;  5I9P A;  3S14 H;  1ESF A;  5FLM H;  4ABN A;  2L11 A;  3NQT A;  2XWB B;  4CDF C;  5J22 A;  1A8V A;  3L9A X;  1MGS A;  4K6D A;  1BCP C;  2MO1 A;  3HZX A;  4JW0 A;  4DNT B;  3NTI A;  4K5X A;  1A0I A;  3FPP A;  1JJG A;  2F0J A;  2HIX A;  3A54 A;  5JEA J;  1UE1 A;  2Q8I B;  1KDC A;  3LWE A;  3J81 j;  4YWL A;  4OL7 A;  4LAA A;  4AYB G;  1Q1E A;  5KIX A;  1EIH A;  5HGT A;  1EQR A;  4FXG C;  3NXW A;  4PQX A;  4CJ2 C;  3T51 B;  1GVP A;  3CU7 A;  3FRP B;  1G8Z D;  1QE6 A;  1D2B A;  3OHX C;  1YHQ A;  4HSP A;  2UXC Q;  4X65 Q;  4UP7 A;  4P75 A;  1XMO L;  2WB1 G;  1G2T A;  4HCS A;  4G7O C;  2HQL A;  4HMI A;  2KCC A;  5I2Y A;  3BYY B;  1VQ4 A;  1SMX A;  4WJ3 M;  4G7H C;  3DEO A;  3WOF A;  4DV2 L;  2HHH L;  1LUZ A;  2NVY B;  1VQM A;  1NR2 A;  4DR2 Q;  5IGC A;  2MJ8 A;  1PV4 A;  1I94 L;  2VNU D;  1TWF B;  2B2Y C;  1YIJ A;  2RHQ B;  1VQP A;  3CPW A;  1X54 A;  1TXY A;  4BBR B;  2D62 A;  2F0E A;  1JQY D;  1JCK B;  1TU2 B;  1TWF H;  3MWY W;  3E0J A;  1SFO B;  2FHT A;  5FLM G;  2M9V A;  1STY A;  1GJX A;  1STE A;  2VUM B;  4F7X A;  1T5E A;  4BBR H;  4B3M L;  5KND A;  4DR5 L;  3KF6 A;  1SFO H;  2UXB Q;  4A3G B;  4FO2 A;  3K81 C;  4CJ1 B;  2VUM H;  2EJG C;  1B1Z A;  1L1O A;  4YY3 L;  1B50 A;  3OMG A;  2DUD A;  1SJE D;  4H0L C;  1I3Q B;  2EZV A;  3X3N A;  1KNA A;  1QG7 A;  1RKN A;  2A6H D;  2E2D C;  1DOL A;  4JI7 Q;  2Z0S A;  1H9R A;  4ZYS A;  4DV7 Q;  1UEB A;  1SMY D;  4AYB E;  4KKS A;  3HOV B;  2Q8R E;  2LMC B;  1M8A A;  2SNS A;  1I3Q H;  3GTQ B;  3PUV A;  4DXF A;  5D3D A;  4DXG A;  1SE4 A;  1ENA A;  5EQ0 A;  2F3I A;  3C1E A;  3NEM A;  5EBD A;  3GTQ H;  1GD7 A;  1YEZ A;  4HR7 B;  4DUZ Q;  1PRT B;  2KHS A;  1NJI C;  3OIQ A;  4KLK A;  2F0S A;  1EQQ A;  2UXD L;  3CMA A;  2WB1 E;  1EL0 A;  2B3G A;  1WTP A;  3K80 C;  4IQZ A;  1FNU A;  4JBJ A;  1Q86 C;  4HMJ A;  3CF5 A;  5F2D A;  3ICE A;  4G57 A;  2O5J C;  2N3S A;  4IZ8 A;  5IP9 G;  3DM1 A;  2EY2 A;  2VQE L;  4A3J B;  3NE5 B;  4H7B A;  1GHK A;  2IHE A;  2R92 H;  4GKJ Q;  3MXG A;  4RCN A;  1H9M A;  2K5V A;  4I7Z C;  4HIM A;  1KC8 C;  2LSS A;  3CRK C;  5T1G A;  1K28 A;  4A3J H;  2R3Z A;  5E1F A;  4DU9 A;  3T1Y L;  3AFQ A;  2CQO A;  1LTI D;  1N33 Q;  1D6E C;  4RHS A;  5C3W A;  1IW7 C;  4TVA B;  1SNQ A;  3RLO A;  2YU9 B;  2EYL A;  1A63 A;  4U68 A;  4JI1 L;  2VUM G;  4GLX A;  1QUQ B;  5GAH C;  1YJN A;  4WJ4 A;  3I4L A;  1HPC A;  3RR5 A;  4OWX B;  4JK1 C;  2EY1 A;  4RWS C;  1TQO A;  4JCV E;  4PZ7 A;  4APV A;  4MIU A;  1WYD A;  2A8V A;  5A2Q E;  4QL5 A;  3U4V A;  2NUC A;  1D5Z C;  1IYJ B;  4QMG A;  2PNR C;  4DR1 Q;  4NKL A;  2D9U A;  1P8L A;  1ET9 A;  2EIF A;  5T1I A;  3OIP A;  2EYM A;  4DV6 L;  1BCP B;  2R61 A;  5LMN Q;  4KKT A;  2E2I B;  4RA8 A;  2A19 A;  3JAM E;  1O80 A;  4A3L H;  2JE6 I;  1F9S A;  3F2B A;  4R8N A;  3EJI A;  1PFM A;  2DJG C;  2FIN B;  1HR0 L;  1SRO A;  3MFY A;  4XQJ A;  5IGB A;  2E2I H;  3R8B A;  5M5W H;  4K0K L;  1AFP A;  2K32 A;  1H9K A;  3NEN A;  3Q6S A;  4J15 A;  5IE8 A;  2VY3 A;  1FJG L;  2A74 C;  2R92 G;  1U4L A;  5EPL A;  1F77 A;  1XMQ Q;  5JEA G;  4KN7 C;  4IPG A;  4LJZ C;  1PTO F;  2ICI A;  3GTL B;  4J8Q A;  4DK6 C;  4DV0 L;  4DV5 L;  1F9R A;  4A3I B;  1RIP A;  1HNZ L;  1A15 A;  1M4V A;  1E2W A;  3SR1 A;  2PQA B;  4B08 A;  4FXD A;  4CBV A;  1K8M A;  2QA4 A;  1O7Z A;  2Q8T A;  4HJ8 A;  4DR3 Q;  3GTL H;  4J6H A;  2NZ1 D;  1HZ9 A;  4A3I H;  1E1O A;  2A68 D;  3T4A C;  1VQD A;  4WJW A;  3BDO A;  3RZO H;  3HOX G;  4GKK Q;  3E9I A;  5GAD C;  3H3V C;  4NMZ A;  3A55 A;  1TII D;  2I07 B;  3KYH C;  2MFI A;  3J81 c;  4LF7 Q;  1WOC A;  2SDF A;  2A73 B;  4MNO A;  2LY7 A;  3P1H A;  1I50 B;  1PZK D;  1HNW L;  4I65 A;  1I6H B;  2Z6K A;  4K2L A;  3RNU A;  4DAP A;  1IBM Q;  4ME5 A;  1EYA A;  1G29 1;  1I50 H;  1SYF A;  1FNV A;  4L6T B;  3HS0 C;  2L55 A;  1UAP A;  3MXP A;  5G3L D;  2SNM A;  1K8A C;  4FXK C;  1Q81 C;  4RMF A;  4LFC L;  5BN3 A;  3TS0 A;  4B3R L;  4IJH A;  3QWN A;  3N52 A;  1KRS A;  1PRT D;  1STB A;  3FKI H;  3MZ5 A;  1CSQ A;  5DLQ E;  3TRZ A;  2K5H A;  1TWH B;  4C3I G;  1QWY A;  3M4Y A;  1GUG A;  3VR5 A;  4G7Z C;  4N9T A;  3U9S A;  3DWP A;  3TS2 A;  3J7A F;  1IBK Q;  2NBF A;  3HP3 A;  3SXH A;  1TWH H;  2JA9 A;  4B9X A;  3PQI A;  4DK1 A;  1PH3 A;  1Y8O B;  1IXR A;  5C6A A;  1D7Q A;  5LMN W;  1OO9 B;  1ML0 D;  2ZTC A;  2AUJ D;  2A6H C;  1B8A A;  4FF2 A;  1B2T A;  1FYC A;  4RFB A;  3CCS A;  1UE5 A;  4JI0 L;  1N8R C;  2NVQ H;  4HJ7 A;  3F2D A;  1EOT A;  4UPA A;  4C1N I;  4A3I G;  3DUZ A;  2Y0S G;  1OXU A;  5GRO A;  1SE2 A;  2N78 A;  3CCQ A;  1W2B A;  1ILQ A;  2CWA A;  2UUC L;  1HZB A;  3JAM c;  1QVC A;  3A56 A;  4BY7 H;  2JA7 H;  1VMC A;  1S4Z A;  4A3B B;  1CI3 M;  1C4Q A;  2JA8 G;  3DWQ A;  1D5X C;  5JVG 3;  1TR5 A;  4AH6 A;  2XRQ D;  1LAC A;  4JI2 L;  3EBE A;  4A3B H;  3TBI B;  2CVR A;  2X6G A;  2ZTE A;  3KJP A;  1RF2 D;  4O42 A;  4M1U B;  3Q23 A;  3MXN B;  4JBK A;  1JOO A;  1BCP D;  3URY A;  4XYQ A;  4OWW B;  1XMO Q;  4DGZ A;  5BR8 L;  5CV6 A;  3WOE A;  4L63 B;  4A3F B;  3FKI G;  1KAW A;  2BE5 C;  2E5L L;  1X6O A;  1T5X D;  1MSH A;  2L5T A;  3J7A 5;  5M9O A;  1G2S A;  1QIL A;  2HHH Q;  4A3F H;  2FMM A;  2RDF A;  1SR3 A;  1I94 Q;  4UP8 A;  4G4K A;  3S24 A;  1TY0 A;  1S5E D;  1O7L A;  3TSS A;  1JIC A;  3I73 A;  4I7A A;  4S3S A;  2JA6 G;  1BBU A;  1PYS B;  3E9H A;  3K7A B;  4KK7 A;  2K01 A;  1ZXT A;  2D5D A;  3ITP A;  1I4H A;  2OTL A;  4B3M Q;  4OEL B;  5IT9 L;  4DR5 Q;  2D0P A;  3K7A H;  3ULL A;  4P71 A;  1STH A;  3M3Y B;  3SK6 A;  1D5M C;  3JC6 6;  3CAM A;  3A5U A;  1W6K A;  2Y0S E;  4B3T Q;  1EIF A;  1JOR A;  1RHP A;  4IUT A;  2OXP A;  2A69 C;  1E24 A;  1PZI D;  1R4Q B;  4C3H B;  5D14 A;  3M3Y H;  2JA7 G;  4BY7 G;  3BG3 A;  1E2V A;  1KIX A;  4JPB W;  3D4W A;  3VYS A;  5M3F H;  4NW2 A;  2HDL A;  5JPM C;  2F0K A;  3I7F A;  2EJF C;  1CKM A;  1HQR D;  4A93 B;  3SK5 A;  1JJC B;  3M9B A;  4JBM A;  4PNY A;  1EWI A;  1AP0 A;  3T53 B;  1QJO A;  2R93 G;  1EY8 A;  1EOV A;  1XJV A;  2EYJ A;  4A93 H;  3LWU A;  1PH8 A;  1N9W A;  3K58 A;  4WFN 3;  3DXJ C;  2OT2 A;  1AE3 A;  1FGB D;  4HIO A;  1CKN B;  2CFM A;  4MZ9 A;  4P73 A;  3UE1 A;  2MO0 A;  5IY0 A;  5KEE A;  2NVT B;  3E5S A;  3H3V H;  1A3V A;  2NVX B;  1NUC A;  4HJ9 A;  2FMC A;  2ICE C;  4A3F G;  3J7Z C;  4DFA A;  3GTM B;  4KY6 A;  4AIM A;  4K8I A;  2NVT H;  3VR4 A;  4UY8 C;  5AJ3 L;  4Y7N B;  2K14 A;  3PUZ A;  1K9M C;  5C4X G;  3HEJ A;  5EKK A;  1VQ8 A;  3GTM H;  1XWE A;  4MTN A;  2WAC A;  2KCN A;  4Y7N H;  3HOW H;  2F0I A;  1JT8 A;  1F9Q A;  2CW0 D;  4JVZ A;  1ZEQ X;  1X3Q A;  4FDB A;  1HTL D;  2H4O A;  3WDN A;  1SLJ A;  1LLR D;  4F87 A;  3AEV A;  5EGT A;  1HXY D;  4JI1 Q;  1LT6 D;  1YHB A;  1PYB A;  1YNN C;  2NZO A;  4P74 A;  1X3G A;  3GTG B;  5FLX E;  2SOB A;  5FJ8 H;  1Y8N B;  2F0Q A;  3H94 A;  5M3F G;  3W3A A;  4EQ5 A;  2B8F A;  1X32 A;  3GV6 A;  2Z9H A;  3OPO A;  4JYA L;  1G51 A;  2VQF L;  2Q2U A;  3J80 i;  1JOK A;  2XNA C;  3U58 A;  2EDG A;  2Z6B A;  2Z4I A;  2F0H A;  4DV6 Q;  1LTB D;  2KVM A;  1EFI D;  1IW7 D;  4L5Q A;  1L1O C;  1KLU D;  4A75 A;  3HKZ G;  1BUV T;  3VA5 A;  2Q2H A;  3S2D B;  3BZK A;  5FK9 C;  1NMG A;  2RDH A;  2LS0 1;  4HTH A;  4OGQ C;  4R4T A;  5KRU A;  1CFM A;  1HR0 Q;  2OEO A;  4PMC A;  1EWH A;  4K0K Q;  2V4D A;  2GVA A;  3S2D H;  1DOM A;  3A8I E;  2QEX A;  2H5X A;  1V1P A;  1VQB A;  4BS9 A;  2UU9 L;  1FJG Q;  1PFB A;  2HCI A;  4OON A;  3I4M B;  1K0S A;  1WTV A;  4F88 A;  3RN5 A;  3DWA A;  4OO1 I;  2VS1 A;  3VR6 A;  1NY4 A;  4CKC A;  4DV5 Q;  2A1A A;  3HOW G;  2HD3 A;  1TWA B;  3I4M H;  5JPN C;  1HNZ Q;  1N36 L;  2XSC A;  1AEX A;  3R2I A;  4EX5 A;  2QDL A;  4BY1 H;  5ELN A;  1G91 A;  1TWA H;  2CQA A;  3CP0 A;  1Z47 A;  1TWC B;  2BDN A;  1CHP D;  3A7L A;  4ZUI A;  1SNO A;  2F1M A;  3PUW A;  4V19 0;  4JI8 L;  5FJ8 G;  1U9R A;  4A3M B;  1TWC H;  3H91 A;  1KLG D;  4R1J A;  3RD4 A;  3TP5 A;  2ID0 A;  3B6Y A;  5FO9 B;  1V8Q A;  5BN4 A;  1NMF A;  2L15 A;  4ZAI A;  2RVL A;  3FVQ A;  1T9H A;  4HCE A;  4IOA A;  2NZH A;  3CCL A;  1UE6 A;  3I3C A;  2AHO B;  1S72 A;  3CD6 A;  2PQE A;  4A3M H;  2NWG A;  1PLF A;  2PZW A;  1S5D D;  2EXD A;  1SXT A;  1GUO A;  2K6A A;  1U4M A;  2RF4 A;  4QB4 A;  1RL2 A;  3PMF A;  1EEF D;  1HQM C;  1NSN S;  1K8O A;  1WCM G;  2BOS A;  5LMU L;  2SEB D;  3HKZ E;  4LFC Q;  3MTS A;  4LUV A;  3H15 A;  1IKL A;  3CKI B;  1VF5 C;  1TS2 A;  3QB3 A;  4CDD C;  2PPB C;  1QCB D;  5IWA Q;  2CWP A;  1Q1B A;  1PXU A;  2HCC A;  2K5Q A;  2I5L X;  3M4P A;  5IP9 H;  2IY5 B;  4YCU A;  1EY9 A;  4A3C G;  2RSO A;  3MVV A;  3I4M G;  3J7A V;  3HKS A;  2M2L A;  3W5O A;  1PH2 A;  3FHW A;  3S1Q B;  1B3Q A;  1II3 A;  5CV5 A;  4DNR B;  1PH7 A;  4B3S Q;  5IT9 E;  2E8G A;  2IX0 A;  4JI0 Q;  4BY1 G;  1PH9 A;  1HR0 W;  2MP1 A;  4NXN Q;  3MC0 B;  3K0X A;  3PUY A;  5E4X A;  3S1Q H;  1TS4 A;  4JI3 L;  1Z7T A;  2ALY B;  1R4P B;  2L0C A;  2WP8 J;  4DK3 C;  2P5Z X;  2UUC Q;  5I4D A;  2AQ2 B;  2UUB Q;  1FGU A;  3V2T A;  2IX3 A;  1SAP A;  4DR7 L;  4ZCK A;  1CKO A;  2DGY A;  4ID6 A;  3QIA A;  1ENC A;  1BR9 A;  4QUC A;  4C3J G;  4A3M G;  5CR3 A;  1MBY A;  3MFG A;  4JI2 Q;  4LWC A;  1X65 A;  3NBH A;  1X56 A;  5A35 A;  3KDF A;  5IGG A;  1JWU D;  2KEE A;  3PO3 H;  3KLR A;  2RDG A;  1TKW B;  2TSS A;  1Q8K A;  3NQI A;  1JR0 D;  2CW0 C;  4RAU C;  4Q5V A;  2E5L Q;  5CC4 A;  2C9O A;  3RLF A;  4LF5 L;  4IUV A;  4TSS A;  5M3M G;  4X3U A;  1A3U A;  2Z6K C;  1O7Y A;  1STG A;  1SE3 A;  5K36 G;  5M5Y B;  2VZA A;  4LFB L;  2R92 B;  1FD7 D;  1VQA A;  1A2U A;  2KEC A;  3KF6 B;  2K28 A;  2MNA A;  3I4N G;  4LF6 L;  1L1O B;  2KJX A;  4UDU C;  2EY5 A;  2F0N A;  5M5Y H;  1X55 A;  2AQ3 B;  1SND A;  2NB0 A;  3UDF A;  4A4I A;  5JEA H;  3UDX A;  1EY4 A;  1WD0 A;  4GN3 B;  2BE5 D;  1AZP A;  4FF3 A;  3HOX B;  4LF8 L;  4KY7 A;  3IFD A;  1HZA A;  2NTT A;  3GDE A;  1JWS D;  1IKM A;  4QY7 A;  1PHJ A;  4CKE A;  5EPJ A;  3T1H L;  4A76 A;  5C5L A;  5I6Y A;  3HOX H;  1Q8I A;  5C44 G;  2EXZ A;  2JSO A;  1Y14 B;  4JC0 A;  3PIO A;  2EQS A;  2C35 B;  3HGB A;  3M7G A;  3AQQ A;  2DN8 A;  3KLS A;  1TY2 A;  1CA5 A;  3S17 B;  1R9T H;  5C0X I;  2NN6 I;  1RTO A;  3K8A A;  4DAY A;  3K5N A;  3S9W A;  2BH2 A;  3STB C;  2AQ1 B;  3HOZ G;  4KV6 A;  4NXM L;  1QVG A;  3I2Z A;  2A6E C;  3S17 H;  3PO3 G;  3PO2 G;  3CHB D;  5M5W B;  2PCF B;  4RGN A;  3ERQ A;  4UP9 A;  3BU2 A;  3G48 A;  3SGI A;  4YHH L;  1J8I A;  3S16 H;  5LL6 X;  2A69 D;  4C3I B;  3TRE A;  3VYR A;  1WTW A;  3Q8D A;  4IFD I;  1PA6 A;  3F2C A;  3I70 A;  2IW3 A;  2L12 A;  3K5O A;  4MHE A;  4TQU S;  4C3I H;  1GO3 E;  1SYC A;  1W3S A;  3X3M A;  2NTS A;  1E7Z A;  1PTO C;  1QVF A;  1SEB D;  1LTL A;  2ZXO A;  2QF7 A;  4POF A;  1XNR L;  3BZD B;  1KQS A;  2B2U A;  1MKH A;  1LAB A;  3J80 E;  3UI2 A;  4HN7 A;  3E0E A;  5C4H A;  4BA2 I;  2Y0S B;  3RZO B;  1LM0 A;  4IOC A;  4ZK9 B;  2E75 C;  2B2W A;  1DZ1 A;  1EEI D;  3EA6 A;  4KJN A;  4L5S A;  3NHH A;  1CQF A;  1PH5 A;  4KHZ A;  1PH1 A;  4H02 A;  1BDO A;  2RSN A;  3TZU A;  1QNU A;  2YTV A;  1VQL A;  4KD3 A;  2EYP A;  2K7V A;  5JVH 3;  4O0A A;  2JA8 B;  1VDZ A;  1VQI A;  3SE0 A;  3TN2 A;  1PVO A;  4KI0 A;  4OEM B;  2R7F A;  2GA4 B;  5CV9 A;  3NTH A;  3D4R A;  4JYA Q;  4XTC S;  1B70 B;  1CQV A;  1LYL A;  1SYG A;  4QF4 A;  5FLX L;  2VQF Q;  4J1M A;  2JA8 H;  4RKB A;  2JP1 A;  4POG A;  3A8J E;  1GUT A;  4IN3 A;  5IYC G;  4GLV B;  1HH2 P;  1QOH A;  1VS0 A;  1E2Z A;  4LF4 L;  3GD7 A;  3S15 B;  3FKI B;  1JC7 A;  3NEL A;  5TSS A;  2QW7 A;  4DR6 L;  3P7J A;  1YNN D;  1OXS C;  1JE4 A;  3R93 A;  4HIK A;  1Y69 U;  1BBX C;  2F4V L;  2K50 A;  1DJR D;  2IWH A;  3H09 A;  3S15 H;  2FXQ A;  1RDP D;  3K0Y A;  2ZXR A;  4IJL A;  1KTK A;  2UU9 Q;  5C0X J;  3A8K E;  2F03 A;  3S1M H;  1E3P A;  2Z8L A;  2YYZ A;  5ELF A;  3E6Z X;  1EU4 A;  2K5W A;  5IYB H;  2K4K A;  2WAQ G;  2JA6 B;  4OX9 L;  4OO1 G;  4TRD A;  2QEJ C;  1B7Y B;  2F0D A;  3N6R A;  3K57 A;  1MI2 A;  3D3R A;  1XYI A;  2NVQ B;  4BXX H;  1N36 Q;  1RJT A;  2JA6 H;  3KK7 A;  1Q46 A;  2JYO A;  5C4J B;  4C56 C;  4DV1 L;  4AQY L;  4IFD J;  3VYU A;  3OMC A;  1WFQ A;  1L0X B;  5IOC A;  1K83 H;  1OXT A;  1GUW A;  1HUN A;  4O1N A;  5HUR A;  4BY7 B;  2JA7 B;  5C4J H;  3MHB A;  4JI8 Q;  2A5H A;  3ND8 A;  3D4D A;  4EVO A;  4CKB A;  3G71 A;  1U4R A;  4K2K A;  1CZW A;  3RZD H;  1HA5 A;  2ZJP A;  1K3B C;  5JJK A;  1WI5 A;  2I5M X;  3H0G H;  3OSO A;  2VB3 X;  2D0O A;  1NE3 A;  2R93 B;  2UUA L;  1A62 A;  4H13 C;  1WTH A;  1AE2 A;  3CXC A;  1I4X A;  3H6M A;  1XNQ L;  5LMU Q;  3SK4 A;  2MHV A;  2R93 H;  1XXG A;  1PMR A;  2F4I A;  3EFX D;  4GNX A;  1DCZ A;  2MGS A;  1MJE A;  3NWS A;  3TZD A;  2KBN A;  3NTK A;  3FP9 A;  3W1G A;  2XWJ B;  4OIJ A;  4XYO A;  1E22 A;  5E7N A;  1AW7 A;  2B2V C;  4IPD A;  4XQQ A;  2OTJ A;  4DV2 Q;  4PMW A;  3GTJ H;  4Z9C B;  1UUP A;  5IYB G;  2JK8 A;  5DAU A;  3I4O A;  1WTO A;  1GKH A;  4KHP L;  5C4X B;  1EYG A;  3M7N A;  3CC4 A;  3SEB A;  3CC7 A;  2WAQ E;  1EYC A;  3AU7 A;  4A3K B;  4BXX G;  3P20 A;  4X62 L;  1GM5 A;  2B29 A;  1C7Y A;  4OHJ A;  1IYU A;  2XTI A;  5C4X H;  3GTP H;  3GTK B;  1H9S A;  2NYZ D;  4H44 C;  4A3K H;  3ERO A;  3RMH A;  4PV1 C;  1GUS A;  4JI3 Q;  2YTY A;  3IRB A;  1ET6 A;  2F52 A;  4LFA L;  3GTK H;  2TMP A;  1XPR A;  2ZJQ A;  1JOQ A;  2XVS A;  3D6C A;  2F0L A;  3ZJY C;  2R7Z G;  2DY7 A;  5M3F B;  4YY3 Q;  3D31 A;  4DR7 Q;  1PTO B;  4OWT B;  2WKC A;  1QB5 D;  3OW2 A;  3J81 i;  1AN8 A;  3AMU A;  2YV5 A;  2WFW A;  1A3T A;  3H0G G;  4OIK A;  2K75 A;  1PTO H;  3KF8 B;  3CME A;  2IT1 A;  1HNX L;  2AWN A;  2ZM6 L;  2Q2T A;  3HKZ B;  4LUZ A;  5C3E G;  1AZQ A;  1SBB B;  2FFK B;  1YNJ C;  4YIJ A;  3TP7 A;  1ILP A;  1B53 A;  1ESR A;  4IUU A;  4X64 L;  1CT1 D;  1X9N A;  4MTK A;  1IBL L;  3SVM A;  3NWT A;  2Z1C A;  1H9J A;  4N8F A;  5J3B A;  4LF5 Q;  2UXD Q;  4NDX A;  5HY6 A;  1VMP A; 
#chains in the Genus database with same CATH homology
 2DNC A;  4RH6 A;  5I2X A;  3V05 A;  3T16 A;  2G9D A;  1EY0 A;  5ELB A;  4XIG S;  2XIW A;  5DM7 3;  5EJW A;  3HOW B;  2WII B;  2B2T A;  2G9H D;  1NCV A;  4XDX A;  1SYB A;  4XQN A;  1EY7 A;  2E74 C;  2JXM B;  4X3K A;  1SYD A;  1CA6 A;  1Z6H A;  2VXW A;  3BDC A;  1HTP A;  2PZU A;  3MAQ A;  3HOU B;  3U9O A;  1HFG A;  3I72 A;  1GUN A;  5C0X G;  2NN6 G;  1SJH D;  1Q12 A;  1WCM B;  1HHV A;  3VR2 A;  2JEA I;  3VA7 A;  1WTQ A;  2IL8 A;  5LL6 S;  2L9H A;  4R8I A;  3EQL C;  1SNP A;  5COY A;  5G3L F;  1I4R A;  1E0B A;  2IPK D;  1TVX A;  5IGE A;  1PRT F;  1IHZ A;  3FDT A;  3GV3 A;  3G6J B;  1JB3 A;  3IKJ A;  3S1R B;  1Q3L A;  1XTC D;  2PMZ B;  4BY1 B;  2A6E D;  4U67 3;  1IYV A;  3GQB A;  3RUZ A;  1PFN A;  2R6G A;  1BOS A;  2JA5 B;  4A3D B;  3TDQ A;  2F0U A;  3GO5 A;  3J80 L;  1PYW D;  1F2Z A;  3DHQ A;  5ELE A;  4XT1 B;  1GXD C;  5J1Z A;  2RKS A;  4C3J B;  3PIO 3;  2K5D A;  1PTO D;  2QDB A;  1UEA B;  2IX1 A;  1V1P B;  1LO5 D;  1SYE A;  3SHL A;  1BXT A;  4EQO A;  3QOJ A;  4NP5 A;  1Y8P B;  3C3L A;  1RTN A;  2CHB D;  1SNM A;  2WV6 D;  4KJO A;  1BCP F;  1V1O A;  5CMD A;  4WOR A;  4RGM A;  2B39 A;  1WTR A;  5M3M B;  1C8C A;  1JWM D;  5EPK A;  2KQ3 A;  1Y1W B;  1EWC A;  1EYD A;  5C5M A;  1TS3 A;  3I4N B;  2IJ0 A;  5K36 H;  1ZYR C;  1EZ8 A;  5IGD A;  5K5P A;  5DM6 3;  4BA1 I;  2HQE A;  3P75 A;  3EVQ A;  3I91 A;  2F0M A;  2OF1 A;  5DEH A;  2QCP X;  1I6V C;  2XN9 C;  3KLS X;  4DK0 A;  2BDO A;  5CYU A;  5C44 B;  1W6J A;  3S2H B;  1B9M A;  4PMB A;  5JOB A;  3NP8 A;  4RKL A;  1DON A;  2B2U C;  4CJ0 B;  4RGT A;  3Q0A A;  2KOL A;  2B2W C;  5M5X B;  5C3X A;  3HOZ B;  1S5B D;  1UNS A;  4C1N K;  2EE1 A;  3C2P A;  3PO3 B;  3PO2 B;  4CGY B;  1LTS D;  4QCL A;  3L3O C;  5NUC A;  3NUC A;  4XT3 B;  3LNN A;  2BA1 A;  2N55 A;  4TKO B;  5E3F A;  4FP5 D;  1F9P A;  3KBX A;  1HCZ A;  2F0T A;  2QIL A;  3OWE B;  1X3P A;  1BF4 A;  1HFN A;  3S1N B;  5KNC A;  2AUK A;  3A7A B;  3Q24 A;  3AB9 A;  3SDZ A;  1G6Z A;  3J81 E;  5FKA C;  3M85 A;  1NR4 A;  3L7Z C;  1F2L A;  2KUM A;  2F0O A;  4FVM A;  3BDL A;  2EYH A;  1CTM A;  1EQV A;  3HRZ C;  2EYO A;  1KNE A;  2F3V A;  3ZYY X;  4WRD A;  2C5C A;  4DA2 A;  1ONL A;  2K04 A;  4ZLT F;  1LTG D;  1LV9 A;  4K6L A;  3SK8 A;  2PW7 A;  1V43 A;  1R9T B;  4HED A;  3OW7 A;  5ISR A;  3NPP A;  1GHJ A;  1PZJ D;  4QIW B;  1F2Y A;  1KAA A;  2PYK A;  4KMU C;  3S16 B;  5KYI A;  5CV4 A;  2N88 A;  5EKI A;  1EY6 A;  1HUM A;  3BS1 A;  3BVG A;  3BVM A;  2ZT9 C;  4ZRZ A;  1LT4 D;  1KDA A;  4ZUJ A;  5I9O A;  2KA7 A;  5IOD A;  1LT5 D;  2WAQ B;  1WTX A;  1CM9 A;  4IUR A;  5C4Z A;  1VF7 A;  3TP6 A;  3GTO B;  4LMQ D;  1BO0 A;  1YNJ D;  2EYF A;  4ODG A;  2J0T D;  4QUF A;  4OO1 H;  2B2Y A;  2O2L D;  4BBS B;  1CK1 A;  1L0Y B;  4RCO A;  3BVZ A;  2F3W A;  2L4N A;  1CHQ D;  4MN3 A;  1A2T A;  1MD2 D;  5ELC A;  2RA4 A;  1Q90 A;  4L8J A;  5AFW A;  1S5C D;  5KNB A;  1STN A;  1SSO A;  1F2M A;  2LKV A;  3IAY A;  4FF4 A;  1DM0 B;  4UAI A;  4XXE A;  4Q0F A;  1D1K A;  5JJZ A;  2WKD A;  4N9P A;  1A6X A;  1LTA D;  4FNF A;  2Z4H A;  3HG9 A;  3R3O A;  2WIN B;  3NK9 A;  5DNF A;  4KHV A;  1I4G A;  2F0P A;  3S1M B;  5D65 A;  5IGF A;  4IUN A;  4IAL A;  4ILW A;  1OXX K;  2HUG A;  2PO4 A;  4KN4 C;  2MPM A;  5EBC A;  1VCI A;  2M00 A;  1QNK A;  3T13 A;  2K1B A;  2PZT A;  1TS5 A;  1EQT A;  1CZG A;  5KGU A;  1K83 B;  3NBI A;  3PUX A;  5J39 A;  2BA0 A;  1J9O A;  2E2H B;  5CGK A;  2R7Z B;  3CQZ B;  2EY6 A;  3D8G A;  1OXV A;  4KY5 A;  5JAV A;  3RZD B;  2B2T C;  3MXN A;  3QOL A;  1TT2 A;  3H0G B;  4ULL A;  3IL8 A;  3MEH A;  1SMY C;  1WVL A;  5D3I B;  3TP8 A;  5C3E B;  2H1E A;  3K6O A;  2DY8 A;  3K5M A;  1WD1 A;  1FNW A;  1MSG A;  5ELD A;  4ZKB B;  4ZKC B;  2XRS D;  5COR A;  4K8J A;  1RD9 D;  1DOK A;  1BQQ T;  1DYQ A;  4GZY C;  1EU3 A;  4KKU A;  3GTJ B;  2B8G A;  4K5V A;  3M4O B;  1C48 A;  4RHR A;  4ZQ3 A;  4X3T A;  3KBG A;  3F2U A;  4JBW A;  1B3A A;  4FYD A;  3GTP B;  3DEP A;  1LTT D;  4KTA A;  4IUQ A;  4K5W A;  5FO8 B;  4P2C B;  3FPU B;  1BNZ A;  4IUP A;  3C46 A;  3KF8 A;  3K59 A;  5IIF A;  5FOB B;  3ONA B;  1ZYR D;  1B9N A;  3BYT B;  1SNC A;  3J7Y W;  1NAP A;  2ENB A;  1FR3 A;  1HRJ A;  3PIP 3;  1LT3 D;  2K05 A;  3DMU A;  5CBE E;  3VR3 A;  1RCV D;  2EOT A;  2PW5 A;  2EPB A;  1EZ6 A;  2I46 A;  2DNE A;  5C0X H;  3R2T A;  2NN6 H;  5EKL A;  4EGV A;  3FEW X;  2L1B A;  3VYT A;  5KYL A;  1ROD A;  1EY5 A;  2BCO A;  1B4O A;  3QO2 A;  3GP7 A;  1XX8 A;  2X6L A;  1IL8 A;  5CV7 A;  1SDF A;  2AWO A;  1H9S B;  2EVB A;  1ZKO A;  3PV0 A;  4EQN A;  3LX0 A;  4KD4 A;  2O5I C;  4IFD H;  4M8A A;  4DAV A;  4BWG B;  3C1F A;  2KED A;  5CBA E;  4B9W A;  3Q22 A;  3HOY B;  4EQP A;  5I6W A;  4X3S A;  1B44 D;  4HAE A;  1KAB A;  3J81 L;  2ZXP A;  3ND9 A;  3I90 A;  5CV8 A;  2F0V A;  4A3E B;  2A68 C;  2J7Z A;  3KUP A;  5LHY 1;  1Y1V B;  2LFN A;  2X69 A;  2E76 C;  2RBM A;  5BN5 A;  2F0G A;  4K14 A;  2QKI C;  2FJ2 A;  2RQX A;  5E4W C;  1O78 A;  3G7L A;  4F8M A;  2EJM A;  1EIG A;  1S5F D;  2JEB I;  2K03 A;  3W2D A;  4FF1 A;  2VB2 X;  4AYB B;  2MUY A;  1PRT C;  4R9W A;  2D2C C;  4DF7 A;  4C3H G;  1KDB A;  4RGO S;  4IFD G;  2E2J B;  3I8Z A;  3K5L A;  3V96 A;  3NSW A;  1DD2 A;  2B2V A;  5A2Q L;  2F0W A;  2O4X A;  1PDQ A;  3QG1 A;  1D1I A;  2WB1 B;  1DXM A;  4CHT B;  1I4P A;  2J4X A;  3FMC A;  2K33 A;  3JAM L;  1GOZ A;  1STA A;  3D6W A;  4C2M B;  4HSV A;  1TWG B;  5FO7 B;  3T56 B;  1ENF A;  3MXU A;  1ICW A;  2B63 B;  2HDM A;  1I4Q A;  1HA6 A;  3OOC A;  4V0B A;  1LTR D;  4DN4 M;  2F0F A;  3TME A;  1U4P A;  3S14 B;  3MA2 B;  3OWF A;  4LK1 C;  3O13 A;  3IFT A;  3QJY A;  4E6I A;  3CRL C;  5I9P A;  1ESF A;  4ABN A;  2L11 A;  3NQT A;  2XWB B;  5J22 A;  3L9A X;  1MGS A;  4K6D A;  1BCP C;  3HZX A;  4DNT B;  3NTI A;  4K5X A;  3FPP A;  2F0J A;  3A54 A;  5JEA J;  2Q8I B;  1KDC A;  3LWE A;  4OL7 A;  4LAA A;  1Q1E A;  5KIX A;  1EIH A;  5HGT A;  4FXG C;  3NXW A;  4PQX A;  4CJ2 C;  3T51 B;  3CU7 A;  3FRP B;  1G8Z D;  1QE6 A;  1D2B A;  3OHX C;  4HSP A;  1G2T A;  4HCS A;  4G7O C;  4HMI A;  2KCC A;  5I2Y A;  3BYY B;  4G7H C;  3DEO A;  3WOF A;  2NVY B;  1NR2 A;  5IGC A;  2MJ8 A;  2VNU D;  1TWF B;  2B2Y C;  4BBR B;  2D62 A;  2F0E A;  1JQY D;  1JCK B;  1TU2 B;  3MWY W;  3E0J A;  1SFO B;  2FHT A;  2M9V A;  1STY A;  1GJX A;  1STE A;  2VUM B;  4F7X A;  1T5E A;  5KND A;  4A3G B;  4FO2 A;  4CJ1 B;  2EJG C;  1B1Z A;  1B50 A;  3OMG A;  1SJE D;  4H0L C;  1I3Q B;  2EZV A;  3X3N A;  1KNA A;  1QG7 A;  1RKN A;  2A6H D;  2E2D C;  1DOL A;  1H9R A;  4ZYS A;  1SMY D;  4KKS A;  3HOV B;  2Q8R E;  2LMC B;  1M8A A;  2SNS A;  3GTQ B;  3PUV A;  4DXF A;  5D3D A;  4DXG A;  1SE4 A;  1ENA A;  5EQ0 A;  3C1E A;  5EBD A;  4HR7 B;  1PRT B;  2KHS A;  3OIQ A;  2F0S A;  1EL0 A;  1WTP A;  4IQZ A;  1FNU A;  4HMJ A;  5F2D A;  4G57 A;  2O5J C;  4IZ8 A;  3DM1 A;  2EY2 A;  4A3J B;  3NE5 B;  4H7B A;  1GHK A;  3MXG A;  4RCN A;  1H9M A;  4I7Z C;  3CRK C;  5T1G A;  2R3Z A;  5E1F A;  4DU9 A;  1LTI D;  1D6E C;  4RHS A;  5C3W A;  1IW7 C;  1SNQ A;  2YU9 B;  2EYL A;  4U68 A;  3I4L A;  1HPC A;  4JK1 C;  2EY1 A;  4RWS C;  1TQO A;  4MIU A;  5A2Q E;  2NUC A;  1D5Z C;  4QMG A;  2PNR C;  4NKL A;  2D9U A;  1ET9 A;  5T1I A;  3OIP A;  2EYM A;  1BCP B;  2R61 A;  2E2I B;  4KKT A;  4RA8 A;  3JAM E;  1O80 A;  2JE6 I;  1F9S A;  4R8N A;  3EJI A;  1PFM A;  2FIN B;  3MFY A;  4XQJ A;  5IGB A;  3R8B A;  1AFP A;  2K32 A;  1H9K A;  3Q6S A;  2A74 C;  1U4L A;  5EPL A;  1F77 A;  5JEA G;  4KN7 C;  4LJZ C;  1PTO F;  2ICI A;  3GTL B;  4J8Q A;  1F9R A;  4A3I B;  1A15 A;  1M4V A;  1E2W A;  3SR1 A;  4B08 A;  4FXD A;  4CBV A;  1K8M A;  1O7Z A;  2Q8T A;  4J6H A;  2NZ1 D;  2A68 D;  3T4A C;  4WJW A;  3BDO A;  3H3V C;  4NMZ A;  3A55 A;  1TII D;  2I07 B;  2SDF A;  2A73 B;  2LY7 A;  3P1H A;  1I50 B;  1PZK D;  4I65 A;  1I6H B;  4K2L A;  4DAP A;  4ME5 A;  1EYA A;  1G29 1;  1SYF A;  1FNV A;  4L6T B;  3HS0 C;  2L55 A;  1UAP A;  3MXP A;  5G3L D;  2SNM A;  4FXK C;  5BN3 A;  3QWN A;  3N52 A;  1PRT D;  1STB A;  3MZ5 A;  1TWH B;  4C3I G;  1QWY A;  3M4Y A;  1GUG A;  3VR5 A;  4G7Z C;  4N9T A;  3U9S A;  3DWP A;  3J7A F;  2NBF A;  3HP3 A;  3SXH A;  4B9X A;  4DK1 A;  1Y8O B;  5C6A A;  1OO9 B;  1ML0 D;  2AUJ D;  2A6H C;  4FF2 A;  1B2T A;  1FYC A;  4RFB A;  1EOT A;  4C1N I;  3DUZ A;  1OXU A;  1SE2 A;  1ILQ A;  3A56 A;  1VMC A;  1S4Z A;  4A3B B;  1CI3 M;  1C4Q A;  3DWQ A;  1D5X C;  5JVG 3;  1TR5 A;  2XRQ D;  1LAC A;  3TBI B;  2CVR A;  2X6G A;  1RF2 D;  4O42 A;  4M1U B;  3Q23 A;  1JOO A;  1BCP D;  3URY A;  4XYQ A;  4DGZ A;  5CV6 A;  3WOE A;  4L63 B;  4A3F B;  2BE5 C;  1T5X D;  1MSH A;  2L5T A;  5M9O A;  1G2S A;  1QIL A;  2FMM A;  2RDF A;  4G4K A;  1TY0 A;  1S5E D;  1O7L A;  3TSS A;  1JIC A;  3I73 A;  4S3S A;  4KK7 A;  3K7A B;  2K01 A;  1ZXT A;  2D5D A;  3ITP A;  1I4H A;  5IT9 L;  3M3Y B;  1STH A;  3SK6 A;  1D5M C;  1W6K A;  1JOR A;  1RHP A;  4IUT A;  2OXP A;  2A69 C;  1PZI D;  1R4Q B;  4C3H B;  5D14 A;  3BG3 A;  1E2V A;  3D4W A;  3VYS A;  4NW2 A;  2HDL A;  5JPM C;  2F0K A;  2EJF C;  1HQR D;  4A93 B;  3SK5 A;  4PNY A;  1AP0 A;  3T53 B;  1QJO A;  1EY8 A;  2EYJ A;  3LWU A;  3K58 A;  4WFN 3;  3DXJ C;  2OT2 A;  1FGB D;  5KEE A;  2NVT B;  3E5S A;  1A3V A;  2NVX B;  1NUC A;  2FMC A;  2ICE C;  4DFA A;  3GTM B;  4KY6 A;  4K8I A;  3VR4 A;  4Y7N B;  3PUZ A;  3HEJ A;  5EKK A;  1XWE A;  2WAC A;  2KCN A;  2F0I A;  1F9Q A;  2CW0 D;  1ZEQ X;  1X3Q A;  1HTL D;  2H4O A;  3WDN A;  1LLR D;  4F87 A;  5EGT A;  1HXY D;  1LT6 D;  1YNN C;  3GTG B;  5FLX E;  2SOB A;  1Y8N B;  2F0Q A;  3H94 A;  3W3A A;  2B8F A;  1X32 A;  3GV6 A;  3OPO A;  1JOK A;  2XNA C;  2EDG A;  2Z4I A;  2F0H A;  1LTB D;  2KVM A;  1EFI D;  1IW7 D;  1KLU D;  1BUV T;  3VA5 A;  3S2D B;  5FK9 C;  2RDH A;  2LS0 1;  4HTH A;  4OGQ C;  5KRU A;  1CFM A;  2OEO A;  4PMC A;  1EWH A;  2V4D A;  1DOM A;  3A8I E;  1V1P A;  4BS9 A;  1PFB A;  2HCI A;  3I4M B;  1WTV A;  4F88 A;  3DWA A;  4OO1 I;  3VR6 A;  4CKC A;  1TWA B;  5JPN C;  2XSC A;  1AEX A;  3R2I A;  1G91 A;  2CQA A;  1Z47 A;  1TWC B;  2BDN A;  1CHP D;  3A7L A;  4ZUI A;  1SNO A;  2F1M A;  3PUW A;  4V19 0;  1U9R A;  4A3M B;  3H91 A;  1KLG D;  3RD4 A;  3TP5 A;  2ID0 A;  5FO9 B;  1V8Q A;  5BN4 A;  4ZAI A;  2RVL A;  3FVQ A;  4HCE A;  3I3C A;  2PQE A;  2NWG A;  1PLF A;  2PZW A;  1S5D D;  1SXT A;  1GUO A;  2K6A A;  1U4M A;  4QB4 A;  3PMF A;  1EEF D;  1HQM C;  1NSN S;  1K8O A;  2BOS A;  2SEB D;  3MTS A;  1IKL A;  3CKI B;  1VF5 C;  1TS2 A;  3QB3 A;  2PPB C;  1QCB D;  1Q1B A;  1PXU A;  2HCC A;  2K5Q A;  1EY9 A;  2RSO A;  3MVV A;  3J7A V;  2M2L A;  3S1Q B;  1II3 A;  5CV5 A;  4DNR B;  5IT9 E;  2IX0 A;  2MP1 A;  3MC0 B;  3PUY A;  5E4X A;  1TS4 A;  1Z7T A;  1R4P B;  2L0C A;  2WP8 J;  5I4D A;  2AQ2 B;  3V2T A;  2IX3 A;  1SAP A;  4ID6 A;  3QIA A;  1ENC A;  1BR9 A;  4QUC A;  4C3J G;  5CR3 A;  1MBY A;  3MFG A;  3NBH A;  5A35 A;  5IGG A;  1JWU D;  2KEE A;  3KLR A;  2RDG A;  1TKW B;  2TSS A;  3NQI A;  1JR0 D;  2CW0 C;  4RAU C;  4Q5V A;  5CC4 A;  2C9O A;  3RLF A;  4IUV A;  4TSS A;  4X3U A;  1A3U A;  1O7Y A;  1STG A;  1SE3 A;  5K36 G;  5M5Y B;  2R92 B;  1FD7 D;  1A2U A;  2KEC A;  2K28 A;  2KJX A;  4UDU C;  2EY5 A;  2F0N A;  2AQ3 B;  1SND A;  2NB0 A;  5JEA H;  1EY4 A;  1WD0 A;  2BE5 D;  1AZP A;  4FF3 A;  3HOX B;  4KY7 A;  3IFD A;  2NTT A;  1JWS D;  1IKM A;  4CKE A;  5EPJ A;  5C5L A;  5I6Y A;  1Q8I A;  2EXZ A;  2JSO A;  3HGB A;  3M7G A;  3KLS A;  2DN8 A;  1TY2 A;  1CA5 A;  3S17 B;  5C0X I;  2NN6 I;  1RTO A;  4DAY A;  3K5N A;  3S9W A;  2AQ1 B;  4KV6 A;  2A6E C;  3CHB D;  5M5W B;  2PCF B;  4RGN A;  3ERQ A;  1J8I A;  5LL6 X;  2A69 D;  4C3I B;  3VYR A;  1WTW A;  4IFD I;  3I70 A;  2IW3 A;  2L12 A;  3K5O A;  4MHE A;  4TQU S;  1SYC A;  3X3M A;  2NTS A;  1PTO C;  1SEB D;  2ZXO A;  2QF7 A;  3BZD B;  2B2U A;  1LAB A;  3J80 E;  3UI2 A;  4HN7 A;  5C4H A;  4BA2 I;  2Y0S B;  3RZO B;  4ZK9 B;  2E75 C;  2B2W A;  1DZ1 A;  1EEI D;  3EA6 A;  4KJN A;  3NHH A;  1CQF A;  4KHZ A;  1BDO A;  2RSN A;  3TZU A;  1QNU A;  4KD3 A;  2EYP A;  2K7V A;  5JVH 3;  2JA8 B;  1VDZ A;  3SE0 A;  3TN2 A;  4KI0 A;  2GA4 B;  5CV9 A;  3NTH A;  3D4R A;  4XTC S;  1CQV A;  1SYG A;  4QF4 A;  5FLX L;  4J1M A;  4RKB A;  2JP1 A;  3A8J E;  1GUT A;  4IN3 A;  1QOH A;  1E2Z A;  3GD7 A;  3S15 B;  3FKI B;  1JC7 A;  5TSS A;  3P7J A;  1YNN D;  1OXS C;  1JE4 A;  3R93 A;  1Y69 U;  1BBX C;  1DJR D;  2IWH A;  3H09 A;  1RDP D;  3K0Y A;  2ZXR A;  1KTK A;  5C0X J;  3A8K E;  2F03 A;  5ELF A;  2Z8L A;  2YYZ A;  3E6Z X;  1EU4 A;  2K5W A;  2JA6 B;  4OO1 G;  4TRD A;  2QEJ C;  2F0D A;  3N6R A;  3K57 A;  1MI2 A;  3D3R A;  1XYI A;  2NVQ B;  1RJT A;  3KK7 A;  2JYO A;  5C4J B;  4C56 C;  4IFD J;  3VYU A;  3OMC A;  1L0X B;  5IOC A;  1OXT A;  1GUW A;  1HUN A;  4O1N A;  5HUR A;  4BY7 B;  2JA7 B;  3MHB A;  2A5H A;  3ND8 A;  3D4D A;  4EVO A;  4CKB A;  1U4R A;  4K2K A;  1CZW A;  1HA5 A;  3OSO A;  2VB3 X;  2R93 B;  4H13 C;  1I4X A;  3H6M A;  3SK4 A;  2MHV A;  1XXG A;  1PMR A;  2F4I A;  3EFX D;  1DCZ A;  2MGS A;  3NWS A;  3TZD A;  3NTK A;  2XWJ B;  4XYO A;  4OIJ A;  1AW7 A;  2B2V C;  4XQQ A;  4PMW A;  4Z9C B;  1UUP A;  5DAU A;  1WTO A;  5C4X B;  3M7N A;  3SEB A;  1EYC A;  3AU7 A;  4A3K B;  3P20 A;  4OHJ A;  1IYU A;  3GTK B;  1H9S A;  2NYZ D;  4H44 C;  3ERO A;  3RMH A;  4PV1 C;  1GUS A;  1ET6 A;  2TMP A;  1JOQ A;  2XVS A;  3D6C A;  2F0L A;  2DY7 A;  5M3F B;  3D31 A;  1PTO B;  2WKC A;  1QB5 D;  1AN8 A;  3AMU A;  1A3T A;  4OIK A;  1PTO H;  2IT1 A;  2AWN A;  3HKZ B;  1AZQ A;  4YIJ A;  1SBB B;  1YNJ C;  2FFK B;  3TP7 A;  1ILP A;  1B53 A;  1ESR A;  4IUU A;  1CT1 D;  3SVM A;  3NWT A;  2Z1C A;  1H9J A;  4NDX A;  1VMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...