2X6GA

X-ray structure of macrophage inflammatory protein-1 alpha (d27a)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
b'ADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C MOTIF CHEMOKINE 3
publication title Polymerization of Mip-1 Chemokine (Ccl3 and Ccl4) and Clearance of Mip-1 by Insulin-Degrading Enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2010-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2x6gA00
1A15A 4XT3B 1PFNA 5D14A 2B2VC 2K28A 5EPKA 1ILPA 4U68A 2IL8A 4IUQA 1IKLA 1QG7A 1HUMA 1MGSA 3I91A 4IURA 4X3KA 1WTOA 1QNKA 2NYZD 1F2LA 2L11A 2RSOA 3F2UA 3TN2A 4DN4M 4CJ1B 2L9HA 1B50A 2B2YA 1MI2A 1HUNA 1WTRA 1IKMA 1RHPA 1ESRA 4ZK9B 2HDLA 3D6WA 4IUTA 1PFMA 4X3TA 1U4MA 1F9PA 1G2SA 1NR4A 2B2TC 3H91A 3LWEA 5EKIA 1AZQA 1BO0A 2EE1A 2J7ZA 1BBXC 1KNEA 4NW2A 2B2YC 1SSOA 2EPBA 4ZKCB 1BF4A 4IUUA 4RA8A 4X3SA 4HSVA 4QUCA 3UI2A 3DEPA 1B3AA 2MGSA 2SDFA 2FFKB 5D65A 5T1GA 1LV9A 1SAPA 3ONAB 3HP3A 5AFWA 1ZXTA 1F9QA 2KUMA 4R8IA 3G7LA 1WTPA 3IFDA 1DZ1A 1X3PA 5COYA 1WTQA 1U4PA 1JICA 2KEDA 3Q6SA 4O42A 4XDXA 5CBAE 1VMPA 1GUWA 4ZLTF 1XX8A 2B2WA 5CBEE 1CA5A 1TVXA 3FDTA 1NAPA 2MJ8A 4XT1B 1AP0A 2RSNA 1G91A 1F9RA 3DEOA 4MN3A 3N52A 5E4XA 5EQ0A 3R93A 4ZKBB 3KBXA 5CMDA 1EQTA 2K05A 3GV6A 1X3QA 1HFNA 1ICWA 1HFGA 2RA4A 1PLFA 1O80A 1HA6A 2B2WC 2M2LA 2FINB 1RJTA 2KECA 3SVMA 1Q3LA 1PFBA 4UAIA 1WVLA 2R3ZA 4IUVA 2HUGA 5E4WC 1DONA 1WTWA 4RAUC 2DY7A 4HCSA 1EIHA 1J8IA 2EOTA 2JP1A 1QE6A 2FJ2A 2DY8A 1CA6A 1X32A 1IL8A 1RTNA 2K03A 4QUFA 4HAEA 1BNZA 1CM9A 4IUPA 4R9WA 2FMMA 3I3CA 1SDFA 3TZDA 4OIKA 5JJZA 1ILQA 1C8CA 2N88A 4MHEA 4X3UA 2BDNA 1B53A 1F9SA 1KNAA 1VMCA 2L1BA 5EPJA 1NCVA 3IL8A 1EOTA 1MSHA 2B2UA 3I90A 1E0BA 2MP1A 1RTOA 2L4NA 5EJWA 3I8ZA 4OIJA 5EPLA 2Q8TA 1G2TA 2X69A 5T1IA 2RVLA 1B2TA 1PDQA 2NWGA 2K01A 2B2TA 2KVMA 3GV3A 1AZPA 2X6GA 1MSGA 4LMQD 3MWYW 1M8AA 1EL0A 2CVRA 1RODA 2KEEA 1G6ZA 1JE4A 1EIGA 2X6LA 4CJ2C 1DOLA 4HEDA 1ML0D 2B2UC 1WTVA 2NZ1D 1O7YA 4RWSC 1DOMA 3FPUB 2FHTA 2KOLA 2XIWA 1HHVA 3DM1A 2K04A 3P7JA 1XYIA 1WD1A 4CJ0B 1U4LA 1WTXA 2B2VA 1DOKA 2HCIA 2N55A 1HRJA 1J9OA 1B4OA 5DNFA 1O7ZA 2HCCA 1NR2A 2K1BA 2D9UA 2HDMA 2H1EA 2Q8RE 3QO2A 1WD0A 4ZAIA 2L12A 1U4RA 5CORA 3MTSA 2VXWA 1S4ZA 2MPMA 3KUPA 2JYOA
chains in the Genus database with same CATH superfamily
3S1NB 3Q0AA 4HJ8A 1Y14B 3NSWA 1TY0A 4IURA 4JW0A 2K4KA 3BZDB 1J5EL 3F2UA 2IX0A 1MJEA 1K8OA 1A0IA 4C3HH 3STBD 4DV3L 1JOOA 4LF7Q 1DCZA 5EBCA 3KLSX 2F0IA 4B3TL 4K5VA 1Y1VH 3P75A 1NMFA 3U4ZA 3JAML 1DYQA 5M3FH 4BY7H 5C0XJ 2E5LQ 4OONA 4POGA 5JEAJ 2PNRC 3K6OA 5CV8A 3I56A 4N9PA 2FFKB 4K8IA 3IAYA 3PIO3 4M1UB 3D4WA 1JJ2A 1NE3A 3A0JA 1X3PA 1PH2A 3SK5A 1TU2B 5I9OA 1FYCA 3F1ZA 2IPKD 3FEWX 3R93A 3SGIA 4AIMA 5FLMG 3AFQA 5CGKA 4A3BB 4C1NK 5CV6A 1PZID 1RJTA 1HNZQ 4G4KA 1HZBA 1PFBA 4K8JA 3AYHB 4BBRB 4FF2A 2BE5D 1IXRA 3FPPA 2F0FA 1MIUA 2LY7A 1PA6A 4X6AH 5A35A 3CCRA 2A68D 5CC4A 2UXBQ 4A93G 1H9KA 1I94L 4QMGA 3U4VA 3A55A 1LO5D 5HGTA 1S5CD 4YY3L 1C8CA 3GTOB 1JOQA 1KNAA 4GNXA 3AB9A 2F52A 4LF4L 4R4QA 4RCNA 5FLMH 4P73A 2JQOA 1SROA 3KK7A 2O5JC 5ELBA 5T1IA 1A2TA 4WJ4A 1SNMA 2PZWA 2JA7B 4LMQD 3MFYA 1EL0A 1YNND 4B3RL 1I6HH 4RKLA 3GTQH 3FRPB 4BS9A 1C9OA 4HTHA 3HOVB 3RLFA 2Y0SE 1KAAA 1VQ7A 3TP5A 2EYOA 2B2VA 2N55A 1SYDA 1A62A 1CTMA 2NVQB 4A93H 1Q7YC 2F3WA 1A8VA 2CQOA 4A3IB 1PH6A 3S24A 2JYOA 2JEAI 4JG2A 1H9RA 4QIWB 4G7OC 3BVMA 4IOAA 2CWPA 3CU7A 4A3FG 5EBDA 2R92G 1HR0L 5BN5A 1PTOD 2NZOA 1U4MA 2EZVA 1MD2D 3LWEA 4IFDJ 2K33A 3H09A 2PW7A 4DAMA 2CW0D 4DK0A 3J80E 4NKLA 3A8IE 3E6ZX 3RLOA 4H0LC 4DV5L 4JI8Q 3MXUA 1J6QA 5T1GA 2F4VQ 1YHAA 4GKJQ 3PIPA 1KRTA 3HOXG 3HOYB 1IBLL 4UDUC 4J8QA 1O7LA 4FO2A 1XXGA 1STHA 3R8BA 3VYRA 1OXTA 4A3FH 5BN4A 1AN8A 2F3IA 2R92H 4XT1B 2LS01 1JOKA 4DFAA 3GTKB 2Q2HA 4GKKQ 1BR9A 3G6EA 1SMXA 3V96A 2IHEA 2IHFA 2Z6KC 3CRLC 4J15A 5E7NA 5IIFA 1ZYRC 3GD7A 2A19A 2YTXA 1H9SA 2Q2IA 1QILA 3RMHA 3F2DA 1VQ9A 1EY4A 1XMOL 4BBSB 3SHLA 3HOXH 3OIQA 3S17B 1EQQA 3VA5A 4IUPA 2PNHA 4LK1C 1GUOA 1XJVA 4JI4Q 3S15H 1FGBD 4X3UA 5I4DA 2L1BA 4JI3Q 1JB3A 4NMZA 1LTLA 2L4NA 3E5SA 3I8ZA 5C4ZA 4LF8L 1EFWA 2CVRA 1H9MA 1WTVA 1UEBA 3G71A 1T5EA 1O7ZA 4LFCL 4A3LG 4GLAC 2L55A 4OL7A 3PO3G 3HOUG 3IKJA 1L0XB 1SYEA 2F0NA 4DV7Q 4AYBB 1XNQQ 2OQKA 1PFNA 3TZUA 2ASBA 4FP5D 3WOEA 3D4DA 3GTGB 4EGVA 2H5XA 2B3GA 3TN2A 3AU7A 2L9HA 4K2KA 5A2QE 3NHHA 4OWWB 3QIAA 5FOBB 1PZJD 3GDEA 2E75C 5CBAE 4RGOS 1AZQA 2EE1A 3EVQA 5M9OA 2J7ZA 1N34L 4A3LH 4IUUA 4IJLA 3PO3H 4QUCA 3HOUH 4A3DB 1YHQA 3DEPA 1Q90A 3HFZB 4XTCS 3S16H 3U50C 5KYIA 3PO2B 2CWAA 1VQAA 1GUWA 3PV0A 1PV4A 3L9AX 5FO8B 5C44B 4HMIA 1G91A 2D0PA 2K05A 1IBML 3D31A 5LL6S 4EQNA 1L0YB 2OT2A 1Q46A 1SYBA 4LF9L 3P20A 4A3GB 1CQFA 2QILA 2R3ZA 3PO2H 1YNJC 1PH7A 1DONA 4XQQA 1WCMB 1EIHA 1I4RA 4LF6L 1STAA 2EOTA 5HY6A 5M3MB 5C4JH 1XWEA 4CKEA 2E2IH 3V2TA 1K28A 3VR2A 2KBNA 1SDFA 3ICEA 3B6YA 3U9SA 1TWCH 5JJZA 4DV1Q 1VQLA 1JJGA 4A3MG 5J39A 4KN4C 3OOCA 2JA8G 2I46A 5M5XH 3I4MH 4RGMA 4NXML 1VQJA 1QUQA 2X69A 2P5ZX 3UE1A 1HZAA 3H94A 1PMRA 1Y1WH 3GV3A 3TBIB 4I7ZC 1N33L 4TKOB 1HNXQ 3U9OA 3K5OA 2UXCQ 1HHVA 1Y8PB 3CXCA 1BCPC 4FVMA 2IW3A 4H02A 1IYJB 3HKZE 4N8FA 2DNEA 3DLLA 1BQQT 2J0TD 4F87A 4DR1L 3MC0B 4A3MH 1OO9B 2KHJA 4R4OA 2EJMA 2IL8A 1IKLA 3BDCA 1GUNA 4OO1I 1JMCA 2WV6D 4LJZC 4OX9L 1IL2A 4JYAL 1U0LA 1SMYD 1Q1BA 3VR5A 3H3VI 2ATWA 1SJED 4DR7Q 3D4RA 5IWAQ 2H4OA 1TWGH 1M4VA 2B2YC 2B29A 4CHTB 1VQ4A 4LF5Q 2VQEQ 2RCFA 4A3CG 4DR2Q 1E1OA 2VW9A 3T13A 1UUPA 4L5TA 4EVOA 1I50B 4PMCA 1B8AA 4PZ8A 2WB1G 1KD1C 2I07B 4UP9A 2Z4HA 1EYCA 4GLXA 3PGZA 3A7LA 1VQBA 2XVSA 1NY4A 2AQ1B 1VQFA 2HHHQ 4JBKA 1WJJA 4LW1A 4GOPC 5IP7G 3T4AC 3GV6A 1KQSA 1FNWA 1K8MA 1I50H 1L1OC 3SVMA 3PIOA 1WVLA 4A3CH 3D0FA 2HUGA 2WIIB 2DY7A 4KY6A 2F0SA 2ZM6Q 4FF4A 1SYFA 2DY8A 1TXYA 2J4XA 1VQNA 3KBGA 2AKWB 3JAMc 1NTGA 3BS1A 3ULPA 3RR5A 4PNYA 4XYQA 4DK3C 3I73A 5IP7H 3FVQA 3OTOQ 3M4PA 5GROA 1R9TH 4A3JG 1Q81C 2EJGC 2VB2X 2PQEA 2ZXRA 1QWYA 4DR6Q 2K14A 2QDLA 2B2UC 3BJUA 1O7YA 2F0QA 1LTGD 3LNNA 1CK1A 3A74A 3RUZA 1E1TA 1QZGA 3MTSA 1BCPB 5LMUQ 1EZ6A 3ZJYC 1CHPD 4XT3B 4DV6Q 2AQ3B 1N32Q 2PCFB 3NTKA 2OTJA 3M7GA 3HOWG 1T5XD 3MXGA 1PFSA 4A3JH 3BDLA 2CH4A 4R4IA 3MXPA 4A3KB 2EVBA 3M3YB 2A73B 1XNRL 1U9RA 1RHPA 1UE6A 3CCUA 4BWGB 1KTKA 5C4HA 3MA2B 3PUVA 4X3TA 4DR5Q 1NR4A 4IPCA 1BO0A 3MXNA 3W1BA 2G9DA 2EPBA 2QW7A 1EWCA 3JC66 2Z8LA 1EEFD 4HSVA 4B3ML 3OPOA 2SDFA 3I4OA 3CCEA 4JI5Q 4FXKC 1F9QA 2JN4A 2YTYA 3DHQA 4KHZA 4WORA 3CPFA 1FNUA 1CZGA 4NP5A 4XDXA 1B7YB 3PUZA 1SYCA 1X9NA 2MO1A 3TP6A 1CA5A 5E3FA 2K5HA 2Z4IA 1YZ6A 2VUMB 1AP0A 1HXYD 5CMDA 3CRKC 2YU9H 4HJAA 1QZHA 4WJWA 1E24A 2IX1A 2KECA 4GOPB 3C1EA 2XWJB 4OWXB 4KY7A 3J81j 1EWHA 2NVXB 4RAUC 1L1OB 1RD9D 2ENBA 3VR6A 1CA6A 2E2DC 1L0WA 3J81L 5ELDA 5C4XB 1VQDA 1VQPA 4DAVA 5K36G 3A7AB 3G4SA 2F03A 1XMQQ 1C7YA 1ZEQX 3ER0A 4MHEA 3TDQA 2FXQA 3GTLH 1DD2A 1D8LA 1LLRD 2F0KA 4IZ8A 3H15A 1Q86C 4XXEA 1I4XA 3SE0A 1RTOA 2CKZB 4C1NI 3HOZB 3T16A 4HJ7A 2AWNA 4NPSA 1Z6HA 4OXPA 4DUYL 2XRSD 4GNXC 4X65L 4CJ2C 1WTPA 2FHTA 1PTOH 1WD1A 3QB3A 3L0OA 3S1RH 1VQ6A 1D5ZC 1XTCD 2KA7A 2QEXA 3GO5A 4LFAQ 3GP7A 2M9VA 4KY5A 1ESFA 2B2VC 4DU9A 5DEHA 1WTHA 1MGSA 4ZRZA 5LHY1 1Q8KA 1PH8A 1TWAH 1XPRA 4BXXG 4LUVA 2C35B 4EQ5A 1HZCA 3S14H 2A6HC 3FKIB 1RIPA 1CKNB 4C3HB 1ZKOA 1IW7C 4P71A 1Y1VB 3K57A 1JJCB 1HNWQ 3UDIA 4L6TB 5M3FB 4BY7B 1SN8A 2B63G 4CDEC 3JAMi 4R8IA 3CAMA 4HN7A 3KLRA 3FKIH 4WRDA 2EJFC 1PH1A 1YBYA 2A6EC 4HIOA 4X66L 4RGNA 5IT9E 4E6IA 4BXXH 4DV4L 2MJ8A 5IYCG 4ZKBB 3KBXA 1UE7A 5C3EG 3M4OH 1SNCA 3I2ZA 1LT6D 1NSNS 1OXUA 1JE5A 2RHSB 3RNUA 4FDBA 3TSSA 4DXGA 4FYDA 5FO9B 4IUVA 4K0KQ 5DLQE 2IX3A 3OWEB 5IYDG 3U58A 2JP1A 1QE6A 2B63H 5KEEA 5GQOA 1IL8A 2CCZA 2UUAL 4Z9CB 1G8ZD 2WKDA 1CM9A 3T51B 3T1HL 4R8NA 4POFA 1ILQA 3EIVA 3MFGA 2O2LD 2VY3A 1JQYD 3IL8A 1O78A 5IYCH 4OHJA 2CHBD 5C3EH 5EPLA 5D3IB 4JI0L 5JJLA 4IN3A 1YJNA 3F2CA 1PDQA 1RL2A 3MZ5A 5KNCA 1X3EA 1S5DD 1KHIA 5NUCA 4DR6L 3X3MA 1K83H 2JXMB 1EIGA 2PI2A 3CC4A 2Y0SG 2D2CC 1BOSA 2F0HA 5IYDH 5DAUA 4GNXB 2GVAA 1I6HB 1K0RA 1T9HA 1ENFA 4QF4A 3GTQB 3QOJA 2NZHA 4GLVB 2Q8RE 3Q22A 2PI2E 5EAYA 3M4YA 3HG9A 3KUPA 2KHIA 4DV6L 4A93B 4DK1A 3CMAA 2HD3A 3CF5A 2OF1A 3I72A 1XPOA 1MHWC 1VQEA 2XNAC 3K81C 4CJ1B 4HMJA 3RN2A 1PRTC 5BR8Q 3H6MA 1X56A 1EFID 3A56A 1V1PB 3A5UA 3NP8A 1TWFB 5JPMC 1A3TA 4LUZA 5GAGC 1LV9A 4DNIA 4JI2Q 4X64Q 1GKHA 5COYA 2KEDA 2MO0A 4ZLTF 2NTTA 2DUDA 2K5WA 1JWMD 3S1QB 1MJCA 3DEOA 4N8X1 4B3SL 1EU3A 3EBEA 2F0EA 1TWFH 4A3FB 1HFNA 5KGUA 2RA4A 2R92B 5F2DA 5IGFA 4L5RC 4JBJA 1Q3LA 3QOLA 3M85A 1QNUA 4DV2L 4WJ3M 4LAAA 3KOJA 1SR3A 1WTWA 4O2DA 1RF2D 1I4QA 1J8IA 5M5YH 3S1QH 4RG1A 4MTKA 2M00A 2OEOA 2UUBQ 4YHHL 2Z0SA 4ID6A 1GUGA 3C3LA 5KNDA 2XWBB 1I5FA 4AQYQ 4QIWE 3HOXB 3TRZA 1N36L 1BUVT 5EPJA 2ICEC 2EQSA 4IO9A 4DR3Q 2MP1A 2L15A 3SR1A 5D3DA 5JJKA 1H9JA 3S15B 3D6CA 1V8QA 4ZUIA 2I5HA 3J7ZC 1B2TA 1LTTD 1CHQD 4JI6Q 1BXTA 3CP0A 2KEEA 1E22A 2X6LA 1PH5A 1DOLA 2QEJC 4JV5L 2NVYH 1IZ6A 2KOLA 4HJ9A 1XYIA 1GJXA 1U4LA 3K59A 5CV9A 2HCIA 1STBA 2HQEA 1ASZA 2HCCA 2PQAB 4YWMA 3J80L 3KDFB 4LFAL 4LUOA 1U4RA 5CORA 4JI1L 2EYJA 1PYSB 1SLJA 3QG1A 1IKMA 3FMCA 4Q0FA 2OWOA 3S2DB 3R3OA 4LFBL 4NB3A 4ME5A 1PYBA 5ELCA 2RBMA 1WTOA 4DR4L 2YTVA 2R7ZG 1HUNA 1CKMA 1U5KA 4V190 1KAWA 1ESRA 1S5ED 2F0TA 1TT2A 2B2TC 2NBFA 1M90C 2ZT9C 1PVOA 1AE2A 3S2DH 1SSOA 1PRTB 4YWKA 4DUZL 1FVIA 2F0OA 4JOIA 5GAEC 3PF5A 2KQ3A 4S3SA 1W2BA 1VQKA 3HP3A 4P75A 3PO3B 3G7LA 1SE8A 3VYTA 3HOUB 3K7AH 1X65A 3GQBA 2F0DA 3S16B 1VMPA 4LF7L 2R7ZH 1EYDA 4OO1G 2UU9Q 2R7FA 1IYVA 2K52A 1YHBA 1EQTA 1VQIA 1QVFA 1X3QA 2EY1A 2VQFQ 2E5LL 1GHKA 1D5MC 4K2LA 1KABA 3GTMH 4KN7C 4QQBX 3KF8B 3GTPH 2O4XA 1YITA 2MHVA 2TMPA 3S2HH 1M1KC 4JC0A 4AH6A 1LUZA 1VQMA 4DKAC 4QUFA 4PZ6A 1TQOA 2UUCQ 1IYUA 3OW2A 2GA4B 4AYBE 1WYDA 4R9WA 4ALPA 1ENAA 2ICIA 4PQXA 2XRQD 3T53B 3WDNA 5C4JB 2ZTCA 3RZDH 2E2IB 4L8JA 1F2YA 2N88A 1D2BA 4OO1H 5JPNC 4Y7NB 1TWCB 2NB0A 3H3VH 4KKTA 4RFBA 1OXSC 2Q8TA 1HNZL 4UY8C 1G2TA 2NWGA 1SBBB 2KVMA 5M5XB 2NUCA 3I4MB 3OWFA 1JCKB 4CDFC 5A2QL 3STBC 5IOCA 2JA6G 4FNFA 4RWSC 2R93G 1QOHA 2XIWA 1Y1WB 2VNUD 2K04A 2UXBL 3HKZG 1WTXA 1YEZA 3E0EA 4TQUS 4Y7NH 2D9UA 1QUQB 4A4IA 1VF5C 1EY0A 4DNRB 1AFPA 4A76A 5I9PA 1I3QB 5G3LF 1UEAB 2LFNA 3PCOB 2SEBD 4A3MB 1CQVA 1X3FA 3OW7A 2JA8B 4KMUC 1XTDA 2NVTH 5BN3A 3KLWA 4ZYSA 1Q8IA 2YYZA 2WAQG 1ET6A 3J81c 3EJIA 1GUSA 2JA6H 2R93H 2HDLA 1D1KA 5M5WB 3CC7A 1I3QH 2AMCB 2KJXA 2AHOB 1LTRD 1B9NA 4IPGA 1FJGQ 3BG3A 3M4QA 1K0SA 2HQLA 1B44D 4NXNQ 3HRZC 3UI2A 2BE5C 1A3VA 2JA8H 3KJPA 2I5LX 1TWGB 5AJ3Q 1QJOA 3QR8A 2DJGC 5CV5A 3TEHB 2A68C 5M5WH 1VQHA 1U4PA 1NJIC 1KL9A 1LYLA 4JI7Q 4PMBA 3FDTA 3NENA 1RDPD 1VF7A 4IALA 2JSOA 2E2HH 3VYSA 2WACA 4JI8L 1GOZA 1L2FA 2F4VL 2Q8IB 1YNNC 4GKJL 3ULJA 2ZJRA 3X3NA 1LACA 1HA5A 1CI3M 1UE1A 2UUBL 4GN3B 4HAEA 3QWNA 2NN6I 1ET9A 3I3CA 2QDBA 3OIPA 1G6PA 2WB1B 4CDDC 2BDNA 2DNCA 4C2MH 4GKKL 4IQZA 1YIJA 1QVGA 1YNXA 1IBKQ 3NPPA 3I90A 2QGQA 1O7IA 3R2IA 3WOFA 1EY6A 4KD4A 1K3RA 1PXUA 3VR3A 1B70B 1J5EQ 4F7XA 3DUZA 1R9TB 2OTLA 3H0GG 1Y8OB 3CCVA 4DV3Q 1PTOC 1SFOH 4C56C 3S1MB 3PQIA 1HPCA 4A3EG 2ZJQA 4B3TQ 1V43A 2CW0C 5IGDA 4JI4L 2K1BA 1CKOA 3KFUA 3TQYA 2EY5A 1WD0A 1PH3A 1JB7A 4K6LA 4JI3L 4C3JG 1KC8C 4O0AA 2K28A 3IFTA 3KF6A 4N9TA 5IGGA 1PYWD 1QG7A 1HUMA 3SK6A 1Y69U 3S1MH 2WB1E 4V0BA 4YWLA 1B50A 4C3IG 1MI2A 5IY0A 4K5XA 4JPBW 1S5FD 2B8GA 3MAQA 4A3JB 3H0GH 5J3BA 5CV4A 3K0XA 4DAPA 1BBXC 3RZOB 1EZ8A 2RQXA 4KKSA 4ZKCB 4DV7L 1XNQL 3NBHB 2A5HA 1B3AA 3I7FA 5C6AA 4C3JH 2FMCA 5D65A 3WWVA 1LABA 1SAPA 2D5DA 1ZXTA 5CR3A 2C9OA 5C0XI 5KIXA 4TSSA 4H7BA 4KJNA 4J6HA 5CV7A 5IT9c 3MXNB 3RN5A 3J7YW 1I94Q 3RZOH 4C3IH 4CBVA 3LWUA 3HOWB 4YY3Q 3I4NG 4CKBA 4LF4Q 4DA2A 1BCPF 2E76C 4A75A 2PZUA 4YCWA 1HJPA 4QB4A 3CCQA 2XGTA 2Z1CA 4KV6A 4GS3A 2YU9B 2RDHA 4GN5A 2C5CA 1WI5A 4B3RQ 1II3A 2EYMA 2EYFA 5JVG3 3A5ZB 3S9WA 2A8VA 3HOWH 4FXGC 2F0GA 2K03A 2UUCL 2BA1A 3C2PA 5HURA 3P1HA 1YJ9A 3TZDA 1R4PB 2JK8A 1TS3A 3K0YA 1ASYA 1VMCA 4KJOA 1TY2A 2R7DA 1FNVA 2RKSA 1YVCA 3I4NH 2N8NA 4PV1C 5G3LD 3J81i 2DN8A 4FXDA 4TRDA 3UDGA 3CCJA 3GTLB 1ZYRD 2D0OA 1STGA 1PZKD 1ONLA 5JAVA 4PMWA 2R61A 4JK1C 1D5XC 2Q2UA 5ELFA 1HR0Q 1EWIA 4DAYA 4ZCKA 3AMUA 3NTIA 4RGTA 1VQ5A 1SYGA 3TP8A 1EY8A 4F88A 1TKWB 4DV1L 3BZCA 2XSCA 2H1EA 1PTOB 1WOCA 1F2MA 2MUYA 4DV5Q 3SDZA 4HCEA 1A15A 1VCIA 3S1RB 1W6KA 2F0WA 4JBWA 3L2PA 5JJIA 4HR7B 1LT4D 1IBLQ 1SNOA 2PW5A 5FO7B 1VQOA 1H95A 1F2LA 2L11A 1KRSA 3CHBD 1LTAD 1HNXL 3V05A 4KHPQ 2UXCL 2E2JB 5IP9G 1EYGA 2EY2A 2KENA 2WFWA 3K7UC 4RKBA 3C46A 1PFMA 1B3QA 1Z9FA 1TWAB 2MFIA 5EKIA 4QJFA 4JVZA 4LWCA 5K36H 4NW2A 3S14B 4L5SA 2E74C 4DK6C 4P74A 4MZ9A 4IFDI 2JA5G 2PMZB 1XMOQ 5ELEA 2E2JH 3CW2C 1BVSA 5FK9C 1DZ1A 5FLXE 4BY1G 2KHSA 1SEBD 3KJOA 4ULLA 1NUCA 3L3OC 1EOVA 2VL6A 4O1NA 1HZ9A 3A8JE 1KDCA 4IPHA 4DR7L 1F9RA 3G6JB 5IP9H 1LT5D 5IWAL 2EYLA 3J80c 4ME3A 3CCSA 3J7AF 1S3OA 4LF5L 2VQEL 2N78A 2M2LA 4LF8Q 1E2ZA 2FINB 4HIDA 4XYOA 4DR2L 1V9PA 3TP7A 2ES2A 4UAIA 3M4OB 4BA1I 3NK9A 1I4GA 2N3SA 4P2CB 1N9WA 3OSOA 5FJ8G 4HSPA 5C5MA 3I55A 2CFMA 3D8GA 4DF7A 1RTNA 1Y1VG 2F0MA 1KDBA 2Z6BA 4RCOA 1JWSD 4BY1H 1TWHH 1OXVA 1V1QA 4OIKA 2B63B 4LFCQ 2HHHL 1E3PA 1A6XA 3DM3A 1A3UA 3AQQA 1SRUA 1B53A 2EXDA 2PMZE 3I4LA 2KCCA 4KD3A 5GAHC 4MIUA 5IE8A 1CKNA 1LTBD 1E0BA 1SNDA 2RDFA 2QKIC 2RVLA 1S5BD 3BVZA 2SNMA 1C0AA 2IT1A 2K5QA 1M8AA 1YNJD 5FLXL 5C3EB 1JE4A 1SMYC 3GTJH 4H13C 4HEDA 2ZM6L 3SXHA 2I5MX 5FJ8H 4XIGS 2MNAA 2VB3X 1DOKA 1K83B 4KLKA 5DNFA 3DWQA 4F8MA 3S1NH 2Q2TA 1N34Q 1FL0A 4EQOA 2F0PA 3OTOL 4U68A 2JEBI 1Z7TA 4IUQA 1K8GA 3TS0A 3RD4A 3TREA 4A3BG 1G291 2AWOA 5H1SE 3T1YQ 1EY9A 5IT9L 3J7AV 2HIVA 1X54A 1OXXK 1AEXA 4BBRG 3H91A 2ID0A 5K5PA 1BCPD 1GUTA 1GXDC 3HGBA 1X6OA 1IBMQ 1D7QA 2Y0SB 3BZKA 4MNOA 5KRUA 1B9MA 3AEVA 5LMUL 4LF9Q 1SNPA 1N32L 4ILWA 3G48A 3I70A 1BKBA 3DXJC 3NE5B 3VYUA 3IFDA 4LF6Q 3MEFA 4JOIC 4DV0Q 2B2WA 5CBEE 4A3BH 3VR4A 1AH9A 4DR5L 4IJHA 3W5OA 2JA7G 1TS5A 4BBRH 1HFGA 4QY7A 3NBIA 4NXMQ 3HOVG 2LXJA 5I2XA 3KYHC 3E3XA 1D6EC 3DWAA 4JI5L 4K5WA 1CZWA 3EN2A 1N33Q 4I65A 2F0JA 1K73C 4GZYC 3NUCA 3F2BA 4A3IG 3GTOH 1X32A 1VQCA 3OYYA 2OCEA 2A69D 2K75A 5M5YB 2OXPA 2BOSA 3E9HA 5DM63 1LT3D 1V1OA 1EOTA 4DR1Q 2JA7H 2WP8J 3H3VC 1N8RC 5EJWA 1QB5D 2A74C 4RHRA 3EQLC 2NTSA 1V1PA 3HOVH 3HZXA 5IODA 1RKNA 3N6RA 3K80C 3SEBA 2NVQH 1CSQA 2RCNA 4JYAQ 4OX9Q 4KTAA 1PH9A 3VA7A 3DM1A 1SXTA 4A3IH 3BDOA 3M7NA 2V4DA 4OWTB 3UDFA 5GADC 1XMQL 2NVYB 1SNQA 2HDMA 2B8FA 2G5DA 3HOYG 4J1MA 2F1MA 1Z47A 4ABNA 4ZQ3A 2VXWA 5KNBA 2MPMA 1H9SB 5EPKA 3PF4A 2AQ2B 3NXWA 2F0LA 3T56B 2R6GA 4I7AA 4NDXA 3J80i 2RSOA 4K14A 4P72A 4K6DA 4DN4M 1I6VC 2WINB 4KHPL 5LMNW 3CQZB 4B9XA 5TSSA 3KLSA 1WFQA 1E2WA 3L7ZC 1CFMA 4BBSG 5EKLA 1NMGA 3HOYH 1Q12A 2IWHA 2MGSA 5JOBA 3E0JA 2L5TA 2ZJPA 3LX0A 3ND9A 1QCBD 2YV5A 1VDZA 2ZTEA 5C3XA 4R4TA 2E8GA 4LNQA 3CQZH 4L5QA 3GTKH 4XQNA 1WTQA 1XPUA 1XX8A 3ND8A 3W3AA 3K58A 5EGTA 3K7AB 4B9WA 1TVXA 5I6YA 2IJ0A 1KIXA 2R7ZB 2PQAA 3KDFA 3K5MA 4BBSH 5C5LA 1HNWL 1RCVD 3S17H 3ZYYX 2V1CC 3UE0A 1D1IA 3GTMB 3RLNA 3GTPB 1MKHA 1BBWA 4AYBG 1PHJA 3S2HB 3BYTB 1K9MC 3NQIA 3Q8DA 2GVBA 1BDOA 4APVA 2LXKA 1PRTF 1EY7A 3VDYA 2CH4W 3O13A 3RZDB 4OIJA 5L37A 1EUJA 4L63B 1S40A 2K01A 2B39A 1CT1D 3MWYW 4YCUA 4K0KL 1DJRD 5LMNQ 3CMEA 4CDCC 1XNRQ 4A3DG 3K5LA 4OEMB 4ODGA 1C48A 4G7ZC 1HRJA 3PUXA 1J9OA 1B4OA 2KCMA 5HGQA 4EX5A 2ALYB 2NN6G 4GN4B 1IHZA 3CPWA 3GTGH 4B3MQ 3PO2G 5D14A 2GN5A 1ILPA 3NTHA 3HEJA 5C44G 3A54A 5IGCA 1GHJA 3CD6A 3KF8A 3I91A 4X3KA 3SK8A 2LSSA 3OMGA 4RHSA 1VS0A 1HTPA 2F3VA 3T1YL 2KCTA 1AE3A 2PO4A 3DWPA 1YI2A 2K5VA 4ZK9B 4A3GG 4BA2I 2NVTB 3I4MG 4A3DH 1KLUD 1A63A 1WCMG 1BF4A 4M8AA 2JA6B 2R93B 5M3MG 1X55A 4RA8A 4X3SA 1Y1WG 2NN6H 4OELB 3HKZB 4G57A 4EQPA 1SE2A 5ISRA 5KYLA 1JR0D 5AFWA 2SOBA 4PZ7A 3CCMA 1GO3E 1Q1EA 3PUWA 3PSIA 5C44H 3FHWA 4KK7A 2EIFA 2Z6KA 3MVVA 3K8AA 4U673 2L0CA 1JICA 1F77A 4O42A 4DV0L 3CKIB 2WKCA 2K50A 1HCZA 2F4IA 5BR8L 2A6HD 2UXDQ 4MN3A 3N52A 5EQ0A 1KDAA 4X62Q 4A3GH 4HIMA 1I4HA 4CKCA 1CUKA 1ICWA 1UNSA 2WAQB 4KKUA 1SE4A 1IW7D 1WCMH 2BCOA 2PYKA 4DPGA 1HA6A 4HJ5A 1UWVA 5M3MH 1FGUA 2DGYA 2E2HB 4DUYQ 2JA9A 3BVGA 1G51A 4X65Q 4JI2L 3A8KE 4HCSA 1HTLD 4ZUJA 4X64L 2FJ2A 1JWUD 4QL5A 5C0XG 1BNZA 5JEAG 2LKVA 1NNXA 2A6ED 3FP9A 5ELNA 1NCVA 3NWSA 5I6WA 2KCNA 3C1FA 4CGYB 4C2MB 1UAPA 4MTNA 2B2TA 1TIID 4UPAA 1JORA 1P8LA 3ITPA 1ML0D 2NZ1D 5I2YA 1STNA 4YCVA 2WAQE 4CJ0B 5DM73 5C0XH 4AQYL 2IY5B 5ELOA 5JEAH 3QO2A 4OGQC 1SFOB 2EDGA 1ICFB 4R1JA 3MHBA 4DR3L 2HIXA 3TS2A 4DXFA 1EYAA 3OHXC 5IYBG 1KXLA 4FF1A 1K3BC 4JI6L 3PIP3 2NYZD 3MEHA 4H44C 2A69C 2XTIA 3UDXA 1WTRA 4X66Q 1SJHD 2ZXPA 3D6WA 4DV4Q 4XQJA 2JE6I 1F9PA 2AUKA 1EIFA 2MQHA 2N49A 5J1ZA 3CCLA 4JBMA 3H0GB 3KF6B 1SE3A 1K8AC 1STEA 4A3EB 3TMEA 5C3WA 1X3GA 4DNTB 3PUYA 1HQRD 3F8TA 5FLXc 5IYBH 4C3JB 2UUAQ 3Q6SA 5IGBA 3T1HQ 1PH4A 4B08A 2PPBC 1HR0W 2RDGA 1PRTD 1LM0A 4A3EH 4C3IB 1HH2P 1PLFA 4DGZA 1TS2A 4JI0Q 1E7ZA 1LTID 5J22A 1EU4A 3EFXD 4RMFA 1VQ8A 2VZAA 2G9HD 5FKAC 3Q23A 2D62A 3EA6A 4IFDG 1YJWA 3W1GA 1GD7A 4Q5VA 2FMMA 2UU9L 3M9BA 1FR3A 5IGEA 3ERSX 5LL6X 2VQFL 4A3KG 1DGSA 1B1ZA 2LMCB 5CYUA 2K5NA 3E9IA 4HIKA 3ULLA 3NBHA 1OTCA 2BH2A 3I4NB 2XN9C 1RODA 1ENCA 5LMNL 1E2VA 2F0UA 3BU2A 1C4QA 3HS0C 1DOMA 1DXMA 1S72A 3FPUB 4G7HC 4YIJA 3J81E 2K32A 3P7JA 4R4CA 4IFDH 4JCVE 2O5IC 1MBYA 4TVAB 3URYA 1DM0B 1NR2A 2ZTDA 1F2ZA 2L12A 2K6AA 1STYA 1P16A 1S4ZA 2EXZA 1FD7D 4KI0A 3IRBA 2PZTA 3DMUA 4A3KH 1R4QB 2VUMG 3M3YH 4IUNA 3EROA 4DAYB 2EYHA 1LTSD 1EQRA 1QNKA 3QJYA 1UE5A 3PMFA 2B2YA 1VQGA 4IUTA 3R2TA 1W3SA 1G2SA 2QCPX 3D3RA 1I4PA 2BA0A 4B3SQ 3OMCA 1Y8NB 1KNEA 2K5DA 3W2DA 1Q82C 2EYPA 2OQ0A 5C4XG 2RHQB 4DV2Q 3ONAB 2HT1A 2KUMA 3SK4A 4GOPA 2AUJD 1HQMC 2VUMH 1EEID 4QGUA 1CSPA 3NEMA 4YHHQ 1L1OA 3HOZG 1BBUA 1QVCA 3CC2A 1NAPA 1JC7A 2BDOA 2RSNA 1PTOF 5EKKA 2UXDL 5E4XA 3ERQA 4PG3A 4IPDA 4X62L 1N36Q 4Y52H 2RF4A 4RH6A 2BH8A 1FJGL 2QA4A 1O80A 1TR5A 2EY6A 2NVXH 2B2WC 4NXNL 1W6JA 5AJ3L 5E4WC 5C4XH 3BYYB 4UHVA 4JV5Q 2SNSA 1TS4A 2JJQA 1KLGD 1JT8A 4QCLA 1EIYB 4JI7L 1GM5A 2JA5B 3HOZH 1F9SA 3NQTA 2VS1A 1A2UA 2A1AA 2Z9HA 3JAME 4JI1Q 1MSHA 1TWHB 4BY1B 2B2UA 5E1FA 4FF3A 3HKSA 4WFN3 4LFBQ 2DJFC 3FKIG 1EY5A 3NWTA 1AZPA 3AFPA 2X6GA 1EQVA 1MSGA 4C3HG 1NBWA 1G6ZA 4DR4Q 4UP7A 2I0QA 2QF7A 2TSSA 2JA5H 3NELA 3K5NA 1AW7A 3J7A5 3Q24A 3GTJB 5M3FG 4BY7G 2ZXOA 4IOCA 4UP8A 3LGJA 5JVH3 2F0VA 1GVPA 4KHVA 4DUZQ 2K7VA 1IBKL 2CQAA 4ZAIA
chains in the Genus database with same CATH topology
3S1NB 3Q0AA 3NSWA 1TY0A 4IURA 3BZDB 3F2UA 2IX0A 1K8OA 1JOOA 1DCZA 5EBCA 3KLSX 2F0IA 4K5VA 3P75A 3JAML 1DYQA 5C0XJ 5JEAJ 2PNRC 3K6OA 5CV8A 4N9PA 2FFKB 4K8IA 3IAYA 3PIO3 4M1UB 3D4WA 1X3PA 3SK5A 1TU2B 5I9OA 1FYCA 2IPKD 3FEWX 3R93A 5CGKA 4A3BB 4C1NK 5CV6A 1PZID 1RJTA 4G4KA 1PFBA 4K8JA 4BBRB 4FF2A 2BE5D 3FPPA 2F0FA 2LY7A 5A35A 2A68D 5CC4A 1H9KA 4QMGA 3A55A 1LO5D 5HGTA 1S5CD 1C8CA 3GTOB 1JOQA 1KNAA 3AB9A 4RCNA 3KK7A 2O5JC 5ELBA 5T1IA 1A2TA 1SNMA 2PZWA 2JA7B 4LMQD 3MFYA 1EL0A 1YNND 4RKLA 3FRPB 4BS9A 4HTHA 3HOVB 3RLFA 1KAAA 3TP5A 2EYOA 2B2VA 2N55A 1SYDA 2NVQB 1CTMA 2F3WA 4A3IB 2JYOA 2JEAI 1H9RA 4QIWB 4G7OC 3BVMA 3CU7A 5EBDA 5BN5A 1PTOD 1U4MA 2EZVA 1MD2D 3LWEA 4IFDJ 2K33A 3H09A 2PW7A 2CW0D 4DK0A 3J80E 4NKLA 3A8IE 3E6ZX 4H0LC 3MXUA 5T1GA 3HOYB 4UDUC 4J8QA 1O7LA 4FO2A 1XXGA 1STHA 3R8BA 3VYRA 1OXTA 5BN4A 1AN8A 4XT1B 2LS01 1JOKA 4DFAA 3GTKB 1BR9A 3V96A 3CRLC 5IIFA 1ZYRC 3GD7A 1H9SA 1QILA 3RMHA 1EY4A 4BBSB 3SHLA 3OIQA 3S17B 3VA5A 4IUPA 4LK1C 1GUOA 1FGBD 4X3UA 5I4DA 2L1BA 1JB3A 4NMZA 2L4NA 3E5SA 3I8ZA 5C4ZA 2CVRA 1H9MA 1WTVA 1T5EA 1O7ZA 2L55A 4OL7A 3IKJA 1L0XB 1SYEA 2F0NA 4AYBB 1PFNA 3TZUA 4FP5D 3WOEA 3D4DA 3GTGB 4EGVA 3TN2A 3AU7A 2L9HA 4K2KA 5A2QE 3NHHA 3QIAA 5FOBB 1PZJD 2E75C 5CBAE 4RGOS 1AZQA 2EE1A 3EVQA 5M9OA 2J7ZA 4IUUA 4QUCA 4A3DB 3DEPA 1Q90A 4XTCS 5KYIA 3PO2B 1GUWA 3PV0A 3L9AX 5FO8B 5C44B 4HMIA 1G91A 2K05A 3D31A 5LL6S 4EQNA 1L0YB 2OT2A 1SYBA 3P20A 4A3GB 1CQFA 2QILA 2R3ZA 1YNJC 1DONA 4XQQA 1WCMB 1EIHA 1I4RA 1STAA 2EOTA 5M3MB 1XWEA 4CKEA 3V2TA 3VR2A 1SDFA 5JJZA 3U9SA 5J39A 4KN4C 3OOCA 2I46A 4RGMA 2X69A 3H94A 1PMRA 3GV3A 3TBIB 4I7ZC 4TKOB 3U9OA 3K5OA 1HHVA 1Y8PB 1BCPC 4FVMA 2IW3A 2DNEA 1BQQT 2J0TD 4F87A 3MC0B 1OO9B 2EJMA 2IL8A 1IKLA 3BDCA 1GUNA 4OO1I 2WV6D 4LJZC 1SMYD 1Q1BA 3VR5A 1SJED 3D4RA 2H4OA 1M4VA 2B2YC 4CHTB 3T13A 1UUPA 4EVOA 1I50B 4PMCA 2I07B 2Z4HA 1EYCA 3A7LA 2XVSA 2AQ1B 3T4AC 3GV6A 1FNWA 1K8MA 3SVMA 1WVLA 2HUGA 2WIIB 2DY7A 4KY6A 2F0SA 4FF4A 1SYFA 2DY8A 2J4XA 3KBGA 3BS1A 4PNYA 4XYQA 3I73A 3FVQA 2EJGC 2VB2X 2PQEA 2ZXRA 1QWYA 2B2UC 1O7YA 2F0QA 1LTGD 3LNNA 1CK1A 3RUZA 3MTSA 1BCPB 1EZ6A 1CHPD 4XT3B 2AQ3B 2PCFB 3NTKA 3M7GA 1T5XD 3MXGA 3BDLA 3MXPA 4A3KB 2EVBA 3M3YB 2A73B 1U9RA 1RHPA 4BWGB 1KTKA 5C4HA 3MA2B 3PUVA 4X3TA 1NR4A 1BO0A 3MXNA 2G9DA 2EPBA 1EWCA 2Z8LA 1EEFD 4HSVA 3OPOA 2SDFA 4FXKC 1F9QA 3DHQA 4KHZA 4WORA 1FNUA 1CZGA 4NP5A 4XDXA 3PUZA 1SYCA 3TP6A 1CA5A 5E3FA 2Z4IA 2VUMB 1AP0A 1HXYD 5CMDA 3CRKC 4WJWA 2IX1A 2KECA 3C1EA 2XWJB 4KY7A 1EWHA 2NVXB 4RAUC 1RD9D 2ENBA 3VR6A 1CA6A 2E2DC 3J81L 5ELDA 5C4XB 4DAVA 5K36G 3A7AB 2F03A 1ZEQX 4MHEA 3TDQA 1DD2A 1LLRD 2F0KA 4IZ8A 4XXEA 1I4XA 3SE0A 1RTOA 4C1NI 3HOZB 3T16A 2AWNA 1Z6HA 2XRSD 4CJ2C 1WTPA 2FHTA 1PTOH 1WD1A 3QB3A 1D5ZC 1XTCD 2KA7A 3GO5A 3GP7A 2M9VA 4KY5A 1ESFA 2B2VC 4DU9A 5DEHA 1MGSA 4ZRZA 5LHY1 2A6HC 3FKIB 4C3HB 1ZKOA 1IW7C 1Y1VB 3K57A 4L6TB 5M3FB 4BY7B 4R8IA 4HN7A 3KLRA 4WRDA 2EJFC 2A6EC 4RGNA 5IT9E 4E6IA 2MJ8A 4ZKBB 3KBXA 1SNCA 1LT6D 1NSNS 1OXUA 3TSSA 4DXGA 4FYDA 5FO9B 4IUVA 2IX3A 3OWEB 2JP1A 1QE6A 5KEEA 1IL8A 4Z9CB 1G8ZD 2WKDA 1CM9A 3T51B 4R8NA 1ILQA 3MFGA 2O2LD 1JQYD 3IL8A 1O78A 4OHJA 2CHBD 5EPLA 5D3IB 4IN3A 1PDQA 3MZ5A 5KNCA 1S5DD 5NUCA 3X3MA 2JXMB 1EIGA 2D2CC 1BOSA 2F0HA 5DAUA 1I6HB 1ENFA 4QF4A 3GTQB 3QOJA 2Q8RE 3Q22A 3M4YA 3HG9A 3KUPA 4A93B 4DK1A 2OF1A 3I72A 2XNAC 4CJ1B 4HMJA 1PRTC 3H6MA 1EFID 3A56A 1V1PB 3NP8A 1TWFB 5JPMC 1A3TA 1LV9A 5COYA 2KEDA 4ZLTF 2NTTA 2K5WA 1JWMD 3S1QB 3DEOA 1EU3A 2F0EA 4A3FB 1HFNA 5KGUA 2RA4A 2R92B 5F2DA 5IGFA 1Q3LA 3QOLA 3M85A 1QNUA 4LAAA 1WTWA 1RF2D 1I4QA 1J8IA 2M00A 2OEOA 4ID6A 1GUGA 3C3LA 5KNDA 2XWBB 3HOXB 1BUVT 5EPJA 2ICEC 2MP1A 3SR1A 5D3DA 1H9JA 3S15B 3D6CA 1V8QA 4ZUIA 1B2TA 1LTTD 1CHQD 1BXTA 2KEEA 2X6LA 1DOLA 2QEJC 2KOLA 1XYIA 1GJXA 1U4LA 3K59A 5CV9A 2HCIA 1STBA 2HQEA 2HCCA 3J80L 1U4RA 5CORA 2EYJA 3QG1A 1IKMA 3FMCA 4Q0FA 3S2DB 3R3OA 4ME5A 5ELCA 2RBMA 1WTOA 1HUNA 4V190 1ESRA 1S5ED 2F0TA 1TT2A 2B2TC 2NBFA 2ZT9C 1SSOA 1PRTB 2F0OA 2KQ3A 4S3SA 3HP3A 3PO3B 3G7LA 3HOUB 3VYTA 3GQBA 2F0DA 3S16B 1VMPA 1EYDA 4OO1G 1IYVA 1EQTA 1X3QA 2EY1A 1GHKA 1D5MC 4K2LA 1KABA 4KN7C 2O4XA 2MHVA 2TMPA 4QUFA 1TQOA 1IYUA 2GA4B 4R9WA 1ENAA 2ICIA 4PQXA 2XRQD 3T53B 3WDNA 5C4JB 2E2IB 4L8JA 1F2YA 2N88A 1D2BA 4OO1H 5JPNC 4Y7NB 1TWCB 2NB0A 4KKTA 4RFBA 1OXSC 2Q8TA 1G2TA 2NWGA 1SBBB 2KVMA 5M5XB 2NUCA 3I4MB 3OWFA 1JCKB 5A2QL 5IOCA 4FNFA 4RWSC 1QOHA 2XIWA 1Y1WB 2VNUD 2K04A 1WTXA 4TQUS 2D9UA 1VF5C 1EY0A 4DNRB 1AFPA 5I9PA 1I3QB 5G3LF 1UEAB 2LFNA 2SEBD 4A3MB 1CQVA 3OW7A 2JA8B 4KMUC 5BN3A 4ZYSA 1Q8IA 2YYZA 1ET6A 3EJIA 1GUSA 2HDLA 1D1KA 5M5WB 2KJXA 1LTRD 1B9NA 3BG3A 1B44D 3HRZC 3UI2A 2BE5C 1A3VA 1TWGB 1QJOA 5CV5A 2A68C 1U4PA 4PMBA 3FDTA 1RDPD 1VF7A 4IALA 2JSOA 3VYSA 2WACA 1GOZA 2Q8IB 1YNNC 3X3NA 1LACA 1HA5A 1CI3M 4HAEA 3QWNA 2NN6I 1ET9A 3I3CA 2QDBA 3OIPA 2WB1B 2BDNA 2DNCA 4IQZA 3NPPA 3I90A 3R2IA 3WOFA 1EY6A 4KD4A 1PXUA 3VR3A 4F7XA 3DUZA 1R9TB 1Y8OB 1PTOC 4C56C 3S1MB 1HPCA 1V43A 2CW0C 5IGDA 2K1BA 2EY5A 1WD0A 4K6LA 4C3JG 2K28A 3IFTA 4N9TA 5IGGA 1PYWD 1QG7A 1HUMA 3SK6A 1Y69U 4V0BA 1B50A 4C3IG 1MI2A 4K5XA 1S5FD 2B8GA 3MAQA 4A3JB 5CV4A 4DAPA 1BBXC 3RZOB 1EZ8A 2RQXA 4KKSA 4ZKCB 2A5HA 1B3AA 5C6AA 2FMCA 5D65A 1LABA 1SAPA 2D5DA 1ZXTA 5CR3A 2C9OA 5C0XI 5KIXA 4TSSA 4H7BA 4KJNA 4J6HA 5CV7A 3J7YW 4CBVA 3LWUA 3HOWB 4CKBA 4DA2A 1BCPF 2E76C 2PZUA 4QB4A 2Z1CA 4KV6A 2YU9B 2RDHA 2C5CA 1II3A 2EYMA 2EYFA 5JVG3 3S9WA 4FXGC 2F0GA 2K03A 2BA1A 3C2PA 5HURA 3P1HA 3TZDA 1R4PB 1TS3A 3K0YA 1VMCA 4KJOA 1TY2A 1FNVA 2RKSA 4PV1C 5G3LD 4FXDA 2DN8A 4TRDA 3GTLB 1ZYRD 1STGA 1PZKD 1ONLA 5JAVA 4PMWA 2R61A 4JK1C 1D5XC 5ELFA 4DAYA 3AMUA 3NTIA 4RGTA 1SYGA 3TP8A 1EY8A 4F88A 1TKWB 2XSCA 2H1EA 1PTOB 1F2MA 2MUYA 3SDZA 4HCEA 1A15A 1VCIA 3S1RB 1W6KA 2F0WA 4JBWA 4HR7B 1LT4D 1SNOA 2PW5A 5FO7B 1F2LA 2L11A 3CHBD 1LTAD 3V05A 2E2JB 2EY2A 4RKBA 3C46A 1PFMA 1TWAB 5EKIA 5K36H 4NW2A 3S14B 2E74C 4IFDI 2PMZB 5ELEA 5FK9C 1DZ1A 5FLXE 2KHSA 1SEBD 4ULLA 1NUCA 3L3OC 4O1NA 3A8JE 1KDCA 1F9RA 3G6JB 1LT5D 2EYLA 3J7AF 2M2LA 1E2ZA 2FINB 4XYOA 3TP7A 4UAIA 3M4OB 4BA1I 3NK9A 1I4GA 4P2CB 3OSOA 4HSPA 5C5MA 3D8GA 4DF7A 1RTNA 2F0MA 1KDBA 4RCOA 1JWSD 1OXVA 4OIKA 2B63B 1A6XA 1A3UA 1B53A 3I4LA 2KCCA 4KD3A 4MIUA 1LTBD 1E0BA 1SNDA 2RDFA 2QKIC 2RVLA 1S5BD 3BVZA 2SNMA 2IT1A 2K5QA 1M8AA 1YNJD 5FLXL 5C3EB 1JE4A 1SMYC 4H13C 4HEDA 3SXHA 4XIGS 2VB3X 1DOKA 1K83B 5DNFA 3DWQA 4F8MA 4EQOA 2F0PA 4U68A 2JEBI 1Z7TA 4IUQA 3RD4A 1G291 2AWOA 1EY9A 5IT9L 3J7AV 1OXXK 1AEXA 3H91A 2ID0A 5K5PA 1BCPD 1GUTA 1GXDC 3HGBA 2Y0SB 5KRUA 1B9MA 1SNPA 4ILWA 3I70A 3DXJC 3NE5B 3VYUA 3IFDA 2B2WA 5CBEE 3VR4A 1TS5A 1HFGA 3NBIA 5I2XA 1D6EC 3DWAA 4K5WA 1CZWA 4I65A 2F0JA 4GZYC 3NUCA 1X32A 2A69D 5M5YB 2OXPA 2BOSA 5DM63 1LT3D 1V1OA 1EOTA 2WP8J 3H3VC 5EJWA 1QB5D 2A74C 4RHRA 3EQLC 2NTSA 1V1PA 3HZXA 5IODA 1RKNA 3N6RA 3SEBA 4KTAA 3VA7A 3DM1A 1SXTA 3BDOA 3M7NA 2V4DA 2NVYB 1SNQA 2HDMA 2B8FA 4J1MA 2F1MA 1Z47A 4ABNA 4ZQ3A 2VXWA 5KNBA 2MPMA 1H9SB 5EPKA 2AQ2B 3NXWA 2F0LA 3T56B 2R6GA 4NDXA 2RSOA 4K14A 4K6DA 4DN4M 1I6VC 2WINB 3CQZB 4B9XA 5TSSA 3KLSA 1E2WA 3L7ZC 1CFMA 5EKLA 1Q12A 2IWHA 2MGSA 5JOBA 3E0JA 2L5TA 3LX0A 3ND9A 1QCBD 1VDZA 5C3XA 4XQNA 1WTQA 1XX8A 3ND8A 3W3AA 3K58A 5EGTA 3K7AB 4B9WA 1TVXA 5I6YA 2IJ0A 2R7ZB 3K5MA 5C5LA 1RCVD 3ZYYX 1D1IA 3GTMB 3GTPB 3S2HB 3BYTB 3NQIA 1BDOA 1PRTF 1EY7A 3O13A 3RZDB 4OIJA 4L63B 2K01A 2B39A 1CT1D 3MWYW 1DJRD 3K5LA 4ODGA 1C48A 4G7ZC 1HRJA 3PUXA 1J9OA 1B4OA 2NN6G 1IHZA 5D14A 1ILPA 3NTHA 3HEJA 3A54A 5IGCA 1GHJA 3KF8A 3I91A 4X3KA 3SK8A 3OMGA 4RHSA 1HTPA 2F3VA 2PO4A 3DWPA 4ZK9B 4BA2I 2NVTB 1KLUD 1BF4A 4M8AA 2JA6B 2R93B 4RA8A 4X3SA 2NN6H 3HKZB 4G57A 4EQPA 1SE2A 5ISRA 5KYLA 1JR0D 5AFWA 2SOBA 1Q1EA 3PUWA 4KK7A 3MVVA 4U673 2L0CA 1JICA 1F77A 4O42A 3CKIB 2WKCA 1HCZA 2F4IA 2A6HD 4MN3A 3N52A 5EQ0A 1KDAA 1I4HA 4CKCA 1ICWA 1UNSA 2WAQB 4KKUA 1SE4A 1IW7D 1HA6A 2BCOA 2PYKA 2E2HB 3BVGA 3A8KE 4HCSA 1HTLD 4ZUJA 2FJ2A 1JWUD 5C0XG 1BNZA 5JEAG 2LKVA 2A6ED 1NCVA 3NWSA 5I6WA 2KCNA 3C1FA 4CGYB 4C2MB 1UAPA 2B2TA 1TIID 1JORA 3ITPA 1ML0D 2NZ1D 5I2YA 1STNA 4CJ0B 5DM73 5C0XH 5JEAH 3QO2A 4OGQC 1SFOB 2EDGA 3MHBA 4DXFA 1EYAA 3OHXC 4FF1A 3PIP3 2NYZD 3MEHA 4H44C 2A69C 1WTRA 1SJHD 2ZXPA 3D6WA 4XQJA 2JE6I 1F9PA 2AUKA 5J1ZA 3H0GB 1SE3A 1STEA 4A3EB 3TMEA 5C3WA 4DNTB 3PUYA 1HQRD 4C3JB 3Q6SA 5IGBA 4B08A 2PPBC 2RDGA 1PRTD 4C3IB 1PLFA 4DGZA 1TS2A 1LTID 5J22A 1EU4A 3EFXD 2G9HD 5FKAC 3Q23A 2D62A 3EA6A 4IFDG 4Q5VA 2FMMA 5IGEA 1FR3A 5LL6X 1B1ZA 2LMCB 5CYUA 3NBHA 3I4NB 2XN9C 1RODA 1ENCA 1E2VA 2F0UA 1C4QA 3HS0C 1DOMA 1DXMA 3FPUB 4G7HC 4YIJA 3J81E 2K32A 3P7JA 4IFDH 2O5IC 1MBYA 3URYA 1DM0B 1NR2A 1F2ZA 2L12A 2K6AA 1STYA 1S4ZA 2EXZA 1FD7D 4KI0A 2PZTA 3DMUA 1R4QB 4IUNA 3EROA 2EYHA 1LTSD 1QNKA 3QJYA 3PMFA 2B2YA 4IUTA 3R2TA 1G2SA 2QCPX 3D3RA 1I4PA 2BA0A 3OMCA 1Y8NB 1KNEA 2K5DA 3W2DA 2EYPA 3ONAB 2KUMA 3SK4A 2AUJD 1HQMC 1EEID 1NAPA 1JC7A 2BDOA 2RSNA 1PTOF 5EKKA 5E4XA 3ERQA 4RH6A 1O80A 1TR5A 2EY6A 2B2WC 1W6JA 5E4WC 3BYYB 2SNSA 1TS4A 1KLGD 4QCLA 2JA5B 1F9SA 3NQTA 1A2UA 3JAME 4BY1B 1MSHA 1TWHB 2B2UA 5E1FA 4FF3A 4WFN3 1EY5A 3NWTA 1AZPA 2X6GA 1EQVA 1MSGA 4C3HG 1G6ZA 2QF7A 2TSSA 3K5NA 1AW7A 3Q24A 3GTJB 2ZXOA 5JVH3 2F0VA 4KHVA 2K7VA 2CQAA 4ZAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A15 A;  4XT3 B;  1PFN A;  5D14 A;  2B2V C;  2K28 A;  5EPK A;  1ILP A;  4U68 A;  2IL8 A;  4IUQ A;  1IKL A;  1QG7 A;  1HUM A;  1MGS A;  3I91 A;  4IUR A;  4X3K A;  1WTO A;  1QNK A;  2NYZ D;  1F2L A;  2L11 A;  2RSO A;  3F2U A;  3TN2 A;  4DN4 M;  4CJ1 B;  2L9H A;  1B50 A;  2B2Y A;  1MI2 A;  1HUN A;  1WTR A;  1IKM A;  1RHP A;  1ESR A;  4ZK9 B;  2HDL A;  3D6W A;  4IUT A;  1PFM A;  4X3T A;  1U4M A;  1F9P A;  1G2S A;  1NR4 A;  2B2T C;  3H91 A;  3LWE A;  5EKI A;  1AZQ A;  1BO0 A;  2EE1 A;  2J7Z A;  1BBX C;  1KNE A;  4NW2 A;  2B2Y C;  1SSO A;  2EPB A;  4ZKC B;  1BF4 A;  4IUU A;  4RA8 A;  4X3S A;  4HSV A;  4QUC A;  3UI2 A;  3DEP A;  1B3A A;  2MGS A;  2SDF A;  2FFK B;  5D65 A;  5T1G A;  1LV9 A;  1SAP A;  3ONA B;  3HP3 A;  5AFW A;  1ZXT A;  1F9Q A;  2KUM A;  4R8I A;  3G7L A;  1WTP A;  3IFD A;  1DZ1 A;  1X3P A;  5COY A;  1WTQ A;  1U4P A;  1JIC A;  2KED A;  3Q6S A;  4O42 A;  4XDX A;  5CBA E;  1VMP A;  1GUW A;  4ZLT F;  1XX8 A;  2B2W A;  5CBE E;  1CA5 A;  1TVX A;  3FDT A;  1NAP A;  2MJ8 A;  4XT1 B;  1AP0 A;  2RSN A;  1G91 A;  1F9R A;  3DEO A;  4MN3 A;  3N52 A;  5E4X A;  5EQ0 A;  3R93 A;  4ZKB B;  3KBX A;  5CMD A;  1EQT A;  2K05 A;  3GV6 A;  1X3Q A;  1HFN A;  1ICW A;  1HFG A;  2RA4 A;  1PLF A;  1O80 A;  1HA6 A;  2B2W C;  2M2L A;  2FIN B;  1RJT A;  2KEC A;  3SVM A;  1Q3L A;  1PFB A;  4UAI A;  1WVL A;  2R3Z A;  4IUV A;  2HUG A;  5E4W C;  1DON A;  1WTW A;  4RAU C;  2DY7 A;  4HCS A;  1EIH A;  1J8I A;  2EOT A;  2JP1 A;  1QE6 A;  2FJ2 A;  2DY8 A;  1CA6 A;  1X32 A;  1IL8 A;  1RTN A;  2K03 A;  4QUF A;  4HAE A;  1BNZ A;  1CM9 A;  4IUP A;  4R9W A;  2FMM A;  3I3C A;  1SDF A;  3TZD A;  4OIK A;  5JJZ A;  1ILQ A;  1C8C A;  2N88 A;  4MHE A;  4X3U A;  2BDN A;  1B53 A;  1F9S A;  1KNA A;  1VMC A;  2L1B A;  5EPJ A;  1NCV A;  3IL8 A;  1EOT A;  1MSH A;  2B2U A;  3I90 A;  1E0B A;  2MP1 A;  1RTO A;  2L4N A;  5EJW A;  3I8Z A;  4OIJ A;  5EPL A;  2Q8T A;  1G2T A;  2X69 A;  5T1I A;  2RVL A;  1B2T A;  1PDQ A;  2NWG A;  2K01 A;  2B2T A;  2KVM A;  3GV3 A;  1AZP A;  2X6G A;  1MSG A;  4LMQ D;  3MWY W;  1M8A A;  1EL0 A;  2CVR A;  1ROD A;  2KEE A;  1G6Z A;  1JE4 A;  1EIG A;  2X6L A;  4CJ2 C;  1DOL A;  4HED A;  1ML0 D;  2B2U C;  1WTV A;  2NZ1 D;  1O7Y A;  4RWS C;  1DOM A;  3FPU B;  2FHT A;  2KOL A;  2XIW A;  1HHV A;  3DM1 A;  2K04 A;  3P7J A;  1XYI A;  1WD1 A;  4CJ0 B;  1U4L A;  1WTX A;  2B2V A;  1DOK A;  2HCI A;  2N55 A;  1HRJ A;  1J9O A;  1B4O A;  5DNF A;  1O7Z A;  2HCC A;  1NR2 A;  2K1B A;  2D9U A;  2HDM A;  2H1E A;  2Q8R E;  3QO2 A;  1WD0 A;  4ZAI A;  2L12 A;  1U4R A;  5COR A;  3MTS A;  2VXW A;  1S4Z A;  2MPM A;  3KUP A;  2JYO A; 
#chains in the Genus database with same CATH topology
 3S1N B;  3Q0A A;  4HJ8 A;  1Y14 B;  3NSW A;  1TY0 A;  4IUR A;  4JW0 A;  2K4K A;  3BZD B;  1J5E L;  3F2U A;  2IX0 A;  1MJE A;  1K8O A;  1A0I A;  4C3H H;  3STB D;  4DV3 L;  1JOO A;  4LF7 Q;  1DCZ A;  5EBC A;  3KLS X;  2F0I A;  4B3T L;  4K5V A;  1Y1V H;  3P75 A;  1NMF A;  3U4Z A;  3JAM L;  1DYQ A;  5M3F H;  4BY7 H;  5C0X J;  2E5L Q;  4OON A;  4POG A;  5JEA J;  2PNR C;  3K6O A;  5CV8 A;  3I56 A;  4N9P A;  2FFK B;  4K8I A;  3IAY A;  3PIO 3;  4M1U B;  3D4W A;  1JJ2 A;  1NE3 A;  3A0J A;  1X3P A;  1PH2 A;  3SK5 A;  1TU2 B;  5I9O A;  1FYC A;  3F1Z A;  2IPK D;  3FEW X;  3R93 A;  3SGI A;  4AIM A;  5FLM G;  3AFQ A;  5CGK A;  4A3B B;  4C1N K;  5CV6 A;  1PZI D;  1RJT A;  1HNZ Q;  4G4K A;  1HZB A;  1PFB A;  4K8J A;  3AYH B;  4BBR B;  4FF2 A;  2BE5 D;  1IXR A;  3FPP A;  2F0F A;  1MIU A;  2LY7 A;  1PA6 A;  4X6A H;  5A35 A;  3CCR A;  2A68 D;  5CC4 A;  2UXB Q;  4A93 G;  1H9K A;  1I94 L;  4QMG A;  3U4V A;  3A55 A;  1LO5 D;  5HGT A;  1S5C D;  4YY3 L;  1C8C A;  3GTO B;  1JOQ A;  1KNA A;  4GNX A;  3AB9 A;  2F52 A;  4LF4 L;  4R4Q A;  4RCN A;  5FLM H;  4P73 A;  2JQO A;  1SRO A;  3KK7 A;  2O5J C;  5ELB A;  5T1I A;  1A2T A;  4WJ4 A;  1SNM A;  2PZW A;  2JA7 B;  4LMQ D;  3MFY A;  1EL0 A;  1YNN D;  4B3R L;  1I6H H;  4RKL A;  3GTQ H;  3FRP B;  4BS9 A;  1C9O A;  4HTH A;  3HOV B;  3RLF A;  2Y0S E;  1KAA A;  1VQ7 A;  3TP5 A;  2EYO A;  2B2V A;  2N55 A;  1SYD A;  1A62 A;  1CTM A;  2NVQ B;  4A93 H;  1Q7Y C;  2F3W A;  1A8V A;  2CQO A;  4A3I B;  1PH6 A;  3S24 A;  2JYO A;  2JEA I;  4JG2 A;  1H9R A;  4QIW B;  4G7O C;  3BVM A;  4IOA A;  2CWP A;  3CU7 A;  4A3F G;  5EBD A;  2R92 G;  1HR0 L;  5BN5 A;  1PTO D;  2NZO A;  1U4M A;  2EZV A;  1MD2 D;  3LWE A;  4IFD J;  2K33 A;  3H09 A;  2PW7 A;  4DAM A;  2CW0 D;  4DK0 A;  3J80 E;  4NKL A;  3A8I E;  3E6Z X;  3RLO A;  4H0L C;  4DV5 L;  4JI8 Q;  3MXU A;  1J6Q A;  5T1G A;  2F4V Q;  1YHA A;  4GKJ Q;  3PIP A;  1KRT A;  3HOX G;  3HOY B;  1IBL L;  4UDU C;  4J8Q A;  1O7L A;  4FO2 A;  1XXG A;  1STH A;  3R8B A;  3VYR A;  1OXT A;  4A3F H;  5BN4 A;  1AN8 A;  2F3I A;  2R92 H;  4XT1 B;  2LS0 1;  1JOK A;  4DFA A;  3GTK B;  2Q2H A;  4GKK Q;  1BR9 A;  3G6E A;  1SMX A;  3V96 A;  2IHE A;  2IHF A;  2Z6K C;  3CRL C;  4J15 A;  5E7N A;  5IIF A;  1ZYR C;  3GD7 A;  2A19 A;  2YTX A;  1H9S A;  2Q2I A;  1QIL A;  3RMH A;  3F2D A;  1VQ9 A;  1EY4 A;  1XMO L;  4BBS B;  3SHL A;  3HOX H;  3OIQ A;  3S17 B;  1EQQ A;  3VA5 A;  4IUP A;  2PNH A;  4LK1 C;  1GUO A;  1XJV A;  4JI4 Q;  3S15 H;  1FGB D;  4X3U A;  5I4D A;  2L1B A;  4JI3 Q;  1JB3 A;  4NMZ A;  1LTL A;  2L4N A;  3E5S A;  3I8Z A;  5C4Z A;  4LF8 L;  1EFW A;  2CVR A;  1H9M A;  1WTV A;  1UEB A;  3G71 A;  1T5E A;  1O7Z A;  4LFC L;  4A3L G;  4GLA C;  2L55 A;  4OL7 A;  3PO3 G;  3HOU G;  3IKJ A;  1L0X B;  1SYE A;  2F0N A;  4DV7 Q;  4AYB B;  1XNQ Q;  2OQK A;  1PFN A;  3TZU A;  2ASB A;  4FP5 D;  3WOE A;  3D4D A;  3GTG B;  4EGV A;  2H5X A;  2B3G A;  3TN2 A;  3AU7 A;  2L9H A;  4K2K A;  5A2Q E;  3NHH A;  4OWW B;  3QIA A;  5FOB B;  1PZJ D;  3GDE A;  2E75 C;  5CBA E;  4RGO S;  1AZQ A;  2EE1 A;  3EVQ A;  5M9O A;  2J7Z A;  1N34 L;  4A3L H;  4IUU A;  4IJL A;  3PO3 H;  4QUC A;  3HOU H;  4A3D B;  1YHQ A;  3DEP A;  1Q90 A;  3HFZ B;  4XTC S;  3S16 H;  3U50 C;  5KYI A;  3PO2 B;  2CWA A;  1VQA A;  1GUW A;  3PV0 A;  1PV4 A;  3L9A X;  5FO8 B;  5C44 B;  4HMI A;  1G91 A;  2D0P A;  2K05 A;  1IBM L;  3D31 A;  5LL6 S;  4EQN A;  1L0Y B;  2OT2 A;  1Q46 A;  1SYB A;  4LF9 L;  3P20 A;  4A3G B;  1CQF A;  2QIL A;  2R3Z A;  3PO2 H;  1YNJ C;  1PH7 A;  1DON A;  4XQQ A;  1WCM B;  1EIH A;  1I4R A;  4LF6 L;  1STA A;  2EOT A;  5HY6 A;  5M3M B;  5C4J H;  1XWE A;  4CKE A;  2E2I H;  3V2T A;  1K28 A;  3VR2 A;  2KBN A;  1SDF A;  3ICE A;  3B6Y A;  3U9S A;  1TWC H;  5JJZ A;  4DV1 Q;  1VQL A;  1JJG A;  4A3M G;  5J39 A;  4KN4 C;  3OOC A;  2JA8 G;  2I46 A;  5M5X H;  3I4M H;  4RGM A;  4NXM L;  1VQJ A;  1QUQ A;  2X69 A;  2P5Z X;  3UE1 A;  1HZA A;  3H94 A;  1PMR A;  1Y1W H;  3GV3 A;  3TBI B;  4I7Z C;  1N33 L;  4TKO B;  1HNX Q;  3U9O A;  3K5O A;  2UXC Q;  1HHV A;  1Y8P B;  3CXC A;  1BCP C;  4FVM A;  2IW3 A;  4H02 A;  1IYJ B;  3HKZ E;  4N8F A;  2DNE A;  3DLL A;  1BQQ T;  2J0T D;  4F87 A;  4DR1 L;  3MC0 B;  4A3M H;  1OO9 B;  2KHJ A;  4R4O A;  2EJM A;  2IL8 A;  1IKL A;  3BDC A;  1GUN A;  4OO1 I;  1JMC A;  2WV6 D;  4LJZ C;  4OX9 L;  1IL2 A;  4JYA L;  1U0L A;  1SMY D;  1Q1B A;  3VR5 A;  3H3V I;  2ATW A;  1SJE D;  4DR7 Q;  3D4R A;  5IWA Q;  2H4O A;  1TWG H;  1M4V A;  2B2Y C;  2B29 A;  4CHT B;  1VQ4 A;  4LF5 Q;  2VQE Q;  2RCF A;  4A3C G;  4DR2 Q;  1E1O A;  2VW9 A;  3T13 A;  1UUP A;  4L5T A;  4EVO A;  1I50 B;  4PMC A;  1B8A A;  4PZ8 A;  2WB1 G;  1KD1 C;  2I07 B;  4UP9 A;  2Z4H A;  1EYC A;  4GLX A;  3PGZ A;  3A7L A;  1VQB A;  2XVS A;  1NY4 A;  2AQ1 B;  1VQF A;  2HHH Q;  4JBK A;  1WJJ A;  4LW1 A;  4GOP C;  5IP7 G;  3T4A C;  3GV6 A;  1KQS A;  1FNW A;  1K8M A;  1I50 H;  1L1O C;  3SVM A;  3PIO A;  1WVL A;  4A3C H;  3D0F A;  2HUG A;  2WII B;  2DY7 A;  4KY6 A;  2F0S A;  2ZM6 Q;  4FF4 A;  1SYF A;  2DY8 A;  1TXY A;  2J4X A;  1VQN A;  3KBG A;  2AKW B;  3JAM c;  1NTG A;  3BS1 A;  3ULP A;  3RR5 A;  4PNY A;  4XYQ A;  4DK3 C;  3I73 A;  5IP7 H;  3FVQ A;  3OTO Q;  3M4P A;  5GRO A;  1R9T H;  4A3J G;  1Q81 C;  2EJG C;  2VB2 X;  2PQE A;  2ZXR A;  1QWY A;  4DR6 Q;  2K14 A;  2QDL A;  2B2U C;  3BJU A;  1O7Y A;  2F0Q A;  1LTG D;  3LNN A;  1CK1 A;  3A74 A;  3RUZ A;  1E1T A;  1QZG A;  3MTS A;  1BCP B;  5LMU Q;  1EZ6 A;  3ZJY C;  1CHP D;  4XT3 B;  4DV6 Q;  2AQ3 B;  1N32 Q;  2PCF B;  3NTK A;  2OTJ A;  3M7G A;  3HOW G;  1T5X D;  3MXG A;  1PFS A;  4A3J H;  3BDL A;  2CH4 A;  4R4I A;  3MXP A;  4A3K B;  2EVB A;  3M3Y B;  2A73 B;  1XNR L;  1U9R A;  1RHP A;  1UE6 A;  3CCU A;  4BWG B;  1KTK A;  5C4H A;  3MA2 B;  3PUV A;  4X3T A;  4DR5 Q;  1NR4 A;  4IPC A;  1BO0 A;  3MXN A;  3W1B A;  2G9D A;  2EPB A;  2QW7 A;  1EWC A;  3JC6 6;  2Z8L A;  1EEF D;  4HSV A;  4B3M L;  3OPO A;  2SDF A;  3I4O A;  3CCE A;  4JI5 Q;  4FXK C;  1F9Q A;  2JN4 A;  2YTY A;  3DHQ A;  4KHZ A;  4WOR A;  3CPF A;  1FNU A;  1CZG A;  4NP5 A;  4XDX A;  1B7Y B;  3PUZ A;  1SYC A;  1X9N A;  2MO1 A;  3TP6 A;  1CA5 A;  5E3F A;  2K5H A;  2Z4I A;  1YZ6 A;  2VUM B;  1AP0 A;  1HXY D;  5CMD A;  3CRK C;  2YU9 H;  4HJA A;  1QZH A;  4WJW A;  1E24 A;  2IX1 A;  2KEC A;  4GOP B;  3C1E A;  2XWJ B;  4OWX B;  4KY7 A;  3J81 j;  1EWH A;  2NVX B;  4RAU C;  1L1O B;  1RD9 D;  2ENB A;  3VR6 A;  1CA6 A;  2E2D C;  1L0W A;  3J81 L;  5ELD A;  5C4X B;  1VQD A;  1VQP A;  4DAV A;  5K36 G;  3A7A B;  3G4S A;  2F03 A;  1XMQ Q;  1C7Y A;  1ZEQ X;  3ER0 A;  4MHE A;  3TDQ A;  2FXQ A;  3GTL H;  1DD2 A;  1D8L A;  1LLR D;  2F0K A;  4IZ8 A;  3H15 A;  1Q86 C;  4XXE A;  1I4X A;  3SE0 A;  1RTO A;  2CKZ B;  4C1N I;  3HOZ B;  3T16 A;  4HJ7 A;  2AWN A;  4NPS A;  1Z6H A;  4OXP A;  4DUY L;  2XRS D;  4GNX C;  4X65 L;  4CJ2 C;  1WTP A;  2FHT A;  1PTO H;  1WD1 A;  3QB3 A;  3L0O A;  3S1R H;  1VQ6 A;  1D5Z C;  1XTC D;  2KA7 A;  2QEX A;  3GO5 A;  4LFA Q;  3GP7 A;  2M9V A;  4KY5 A;  1ESF A;  2B2V C;  4DU9 A;  5DEH A;  1WTH A;  1MGS A;  4ZRZ A;  5LHY 1;  1Q8K A;  1PH8 A;  1TWA H;  1XPR A;  4BXX G;  4LUV A;  2C35 B;  4EQ5 A;  1HZC A;  3S14 H;  2A6H C;  3FKI B;  1RIP A;  1CKN B;  4C3H B;  1ZKO A;  1IW7 C;  4P71 A;  1Y1V B;  3K57 A;  1JJC B;  1HNW Q;  3UDI A;  4L6T B;  5M3F B;  4BY7 B;  1SN8 A;  2B63 G;  4CDE C;  3JAM i;  4R8I A;  3CAM A;  4HN7 A;  3KLR A;  3FKI H;  4WRD A;  2EJF C;  1PH1 A;  1YBY A;  2A6E C;  4HIO A;  4X66 L;  4RGN A;  5IT9 E;  4E6I A;  4BXX H;  4DV4 L;  2MJ8 A;  5IYC G;  4ZKB B;  3KBX A;  1UE7 A;  5C3E G;  3M4O H;  1SNC A;  3I2Z A;  1LT6 D;  1NSN S;  1OXU A;  1JE5 A;  2RHS B;  3RNU A;  4FDB A;  3TSS A;  4DXG A;  4FYD A;  5FO9 B;  4IUV A;  4K0K Q;  5DLQ E;  2IX3 A;  3OWE B;  5IYD G;  3U58 A;  2JP1 A;  1QE6 A;  2B63 H;  5KEE A;  5GQO A;  1IL8 A;  2CCZ A;  2UUA L;  4Z9C B;  1G8Z D;  2WKD A;  1CM9 A;  3T51 B;  3T1H L;  4R8N A;  4POF A;  1ILQ A;  3EIV A;  3MFG A;  2O2L D;  2VY3 A;  1JQY D;  3IL8 A;  1O78 A;  5IYC H;  4OHJ A;  2CHB D;  5C3E H;  5EPL A;  5D3I B;  4JI0 L;  5JJL A;  4IN3 A;  1YJN A;  3F2C A;  1PDQ A;  1RL2 A;  3MZ5 A;  5KNC A;  1X3E A;  1S5D D;  1KHI A;  5NUC A;  4DR6 L;  3X3M A;  1K83 H;  2JXM B;  1EIG A;  2PI2 A;  3CC4 A;  2Y0S G;  2D2C C;  1BOS A;  2F0H A;  5IYD H;  5DAU A;  4GNX B;  2GVA A;  1I6H B;  1K0R A;  1T9H A;  1ENF A;  4QF4 A;  3GTQ B;  3QOJ A;  2NZH A;  4GLV B;  2Q8R E;  3Q22 A;  2PI2 E;  5EAY A;  3M4Y A;  3HG9 A;  3KUP A;  2KHI A;  4DV6 L;  4A93 B;  4DK1 A;  3CMA A;  2HD3 A;  3CF5 A;  2OF1 A;  3I72 A;  1XPO A;  1MHW C;  1VQE A;  2XNA C;  3K81 C;  4CJ1 B;  4HMJ A;  3RN2 A;  1PRT C;  5BR8 Q;  3H6M A;  1X56 A;  1EFI D;  3A56 A;  1V1P B;  3A5U A;  3NP8 A;  1TWF B;  5JPM C;  1A3T A;  4LUZ A;  5GAG C;  1LV9 A;  4DNI A;  4JI2 Q;  4X64 Q;  1GKH A;  5COY A;  2KED A;  2MO0 A;  4ZLT F;  2NTT A;  2DUD A;  2K5W A;  1JWM D;  3S1Q B;  1MJC A;  3DEO A;  4N8X 1;  4B3S L;  1EU3 A;  3EBE A;  2F0E A;  1TWF H;  4A3F B;  1HFN A;  5KGU A;  2RA4 A;  2R92 B;  5F2D A;  5IGF A;  4L5R C;  4JBJ A;  1Q3L A;  3QOL A;  3M85 A;  1QNU A;  4DV2 L;  4WJ3 M;  4LAA A;  3KOJ A;  1SR3 A;  1WTW A;  4O2D A;  1RF2 D;  1I4Q A;  1J8I A;  5M5Y H;  3S1Q H;  4RG1 A;  4MTK A;  2M00 A;  2OEO A;  2UUB Q;  4YHH L;  2Z0S A;  4ID6 A;  1GUG A;  3C3L A;  5KND A;  2XWB B;  1I5F A;  4AQY Q;  4QIW E;  3HOX B;  3TRZ A;  1N36 L;  1BUV T;  5EPJ A;  2ICE C;  2EQS A;  4IO9 A;  4DR3 Q;  2MP1 A;  2L15 A;  3SR1 A;  5D3D A;  5JJK A;  1H9J A;  3S15 B;  3D6C A;  1V8Q A;  4ZUI A;  2I5H A;  3J7Z C;  1B2T A;  1LTT D;  1CHQ D;  4JI6 Q;  1BXT A;  3CP0 A;  2KEE A;  1E22 A;  2X6L A;  1PH5 A;  1DOL A;  2QEJ C;  4JV5 L;  2NVY H;  1IZ6 A;  2KOL A;  4HJ9 A;  1XYI A;  1GJX A;  1U4L A;  3K59 A;  5CV9 A;  2HCI A;  1STB A;  2HQE A;  1ASZ A;  2HCC A;  2PQA B;  4YWM A;  3J80 L;  3KDF B;  4LFA L;  4LUO A;  1U4R A;  5COR A;  4JI1 L;  2EYJ A;  1PYS B;  1SLJ A;  3QG1 A;  1IKM A;  3FMC A;  4Q0F A;  2OWO A;  3S2D B;  3R3O A;  4LFB L;  4NB3 A;  4ME5 A;  1PYB A;  5ELC A;  2RBM A;  1WTO A;  4DR4 L;  2YTV A;  2R7Z G;  1HUN A;  1CKM A;  1U5K A;  4V19 0;  1KAW A;  1ESR A;  1S5E D;  2F0T A;  1TT2 A;  2B2T C;  2NBF A;  1M90 C;  2ZT9 C;  1PVO A;  1AE2 A;  3S2D H;  1SSO A;  1PRT B;  4YWK A;  4DUZ L;  1FVI A;  2F0O A;  4JOI A;  5GAE C;  3PF5 A;  2KQ3 A;  4S3S A;  1W2B A;  1VQK A;  3HP3 A;  4P75 A;  3PO3 B;  3G7L A;  1SE8 A;  3VYT A;  3HOU B;  3K7A H;  1X65 A;  3GQB A;  2F0D A;  3S16 B;  1VMP A;  4LF7 L;  2R7Z H;  1EYD A;  4OO1 G;  2UU9 Q;  2R7F A;  1IYV A;  2K52 A;  1YHB A;  1EQT A;  1VQI A;  1QVF A;  1X3Q A;  2EY1 A;  2VQF Q;  2E5L L;  1GHK A;  1D5M C;  4K2L A;  1KAB A;  3GTM H;  4KN7 C;  4QQB X;  3KF8 B;  3GTP H;  2O4X A;  1YIT A;  2MHV A;  2TMP A;  3S2H H;  1M1K C;  4JC0 A;  4AH6 A;  1LUZ A;  1VQM A;  4DKA C;  4QUF A;  4PZ6 A;  1TQO A;  2UUC Q;  1IYU A;  3OW2 A;  2GA4 B;  4AYB E;  1WYD A;  4R9W A;  4ALP A;  1ENA A;  2ICI A;  4PQX A;  2XRQ D;  3T53 B;  3WDN A;  5C4J B;  2ZTC A;  3RZD H;  2E2I B;  4L8J A;  1F2Y A;  2N88 A;  1D2B A;  4OO1 H;  5JPN C;  4Y7N B;  1TWC B;  2NB0 A;  3H3V H;  4KKT A;  4RFB A;  1OXS C;  2Q8T A;  1HNZ L;  4UY8 C;  1G2T A;  2NWG A;  1SBB B;  2KVM A;  5M5X B;  2NUC A;  3I4M B;  3OWF A;  1JCK B;  4CDF C;  5A2Q L;  3STB C;  5IOC A;  2JA6 G;  4FNF A;  4RWS C;  2R93 G;  1QOH A;  2XIW A;  1Y1W B;  2VNU D;  2K04 A;  2UXB L;  3HKZ G;  1WTX A;  1YEZ A;  3E0E A;  4TQU S;  4Y7N H;  2D9U A;  1QUQ B;  4A4I A;  1VF5 C;  1EY0 A;  4DNR B;  1AFP A;  4A76 A;  5I9P A;  1I3Q B;  5G3L F;  1UEA B;  2LFN A;  3PCO B;  2SEB D;  4A3M B;  1CQV A;  1X3F A;  3OW7 A;  2JA8 B;  4KMU C;  1XTD A;  2NVT H;  5BN3 A;  3KLW A;  4ZYS A;  1Q8I A;  2YYZ A;  2WAQ G;  1ET6 A;  3J81 c;  3EJI A;  1GUS A;  2JA6 H;  2R93 H;  2HDL A;  1D1K A;  5M5W B;  3CC7 A;  1I3Q H;  2AMC B;  2KJX A;  2AHO B;  1LTR D;  1B9N A;  4IPG A;  1FJG Q;  3BG3 A;  3M4Q A;  1K0S A;  2HQL A;  1B44 D;  4NXN Q;  3HRZ C;  3UI2 A;  2BE5 C;  1A3V A;  2JA8 H;  3KJP A;  2I5L X;  1TWG B;  5AJ3 Q;  1QJO A;  3QR8 A;  2DJG C;  5CV5 A;  3TEH B;  2A68 C;  5M5W H;  1VQH A;  1U4P A;  1NJI C;  1KL9 A;  1LYL A;  4JI7 Q;  4PMB A;  3FDT A;  3NEN A;  1RDP D;  1VF7 A;  4IAL A;  2JSO A;  2E2H H;  3VYS A;  2WAC A;  4JI8 L;  1GOZ A;  1L2F A;  2F4V L;  2Q8I B;  1YNN C;  4GKJ L;  3ULJ A;  2ZJR A;  3X3N A;  1LAC A;  1HA5 A;  1CI3 M;  1UE1 A;  2UUB L;  4GN3 B;  4HAE A;  3QWN A;  2NN6 I;  1ET9 A;  3I3C A;  2QDB A;  3OIP A;  1G6P A;  2WB1 B;  4CDD C;  2BDN A;  2DNC A;  4C2M H;  4GKK L;  4IQZ A;  1YIJ A;  1QVG A;  1YNX A;  1IBK Q;  3NPP A;  3I90 A;  2QGQ A;  1O7I A;  3R2I A;  3WOF A;  1EY6 A;  4KD4 A;  1K3R A;  1PXU A;  3VR3 A;  1B70 B;  1J5E Q;  4F7X A;  3DUZ A;  1R9T B;  2OTL A;  3H0G G;  1Y8O B;  3CCV A;  4DV3 Q;  1PTO C;  1SFO H;  4C56 C;  3S1M B;  3PQI A;  1HPC A;  4A3E G;  2ZJQ A;  4B3T Q;  1V43 A;  2CW0 C;  5IGD A;  4JI4 L;  2K1B A;  1CKO A;  3KFU A;  3TQY A;  2EY5 A;  1WD0 A;  1PH3 A;  1JB7 A;  4K6L A;  4JI3 L;  4C3J G;  1KC8 C;  4O0A A;  2K28 A;  3IFT A;  3KF6 A;  4N9T A;  5IGG A;  1PYW D;  1QG7 A;  1HUM A;  3SK6 A;  1Y69 U;  3S1M H;  2WB1 E;  4V0B A;  4YWL A;  1B50 A;  4C3I G;  1MI2 A;  5IY0 A;  4K5X A;  4JPB W;  1S5F D;  2B8G A;  3MAQ A;  4A3J B;  3H0G H;  5J3B A;  5CV4 A;  3K0X A;  4DAP A;  1BBX C;  3RZO B;  1EZ8 A;  2RQX A;  4KKS A;  4ZKC B;  4DV7 L;  1XNQ L;  3NBH B;  2A5H A;  1B3A A;  3I7F A;  5C6A A;  4C3J H;  2FMC A;  5D65 A;  3WWV A;  1LAB A;  1SAP A;  2D5D A;  1ZXT A;  5CR3 A;  2C9O A;  5C0X I;  5KIX A;  4TSS A;  4H7B A;  4KJN A;  4J6H A;  5CV7 A;  5IT9 c;  3MXN B;  3RN5 A;  3J7Y W;  1I94 Q;  3RZO H;  4C3I H;  4CBV A;  3LWU A;  3HOW B;  4YY3 Q;  3I4N G;  4CKB A;  4LF4 Q;  4DA2 A;  1BCP F;  2E76 C;  4A75 A;  2PZU A;  4YCW A;  1HJP A;  4QB4 A;  3CCQ A;  2XGT A;  2Z1C A;  4KV6 A;  4GS3 A;  2YU9 B;  2RDH A;  4GN5 A;  2C5C A;  1WI5 A;  4B3R Q;  1II3 A;  2EYM A;  2EYF A;  5JVG 3;  3A5Z B;  3S9W A;  2A8V A;  3HOW H;  4FXG C;  2F0G A;  2K03 A;  2UUC L;  2BA1 A;  3C2P A;  5HUR A;  3P1H A;  1YJ9 A;  3TZD A;  1R4P B;  2JK8 A;  1TS3 A;  3K0Y A;  1ASY A;  1VMC A;  4KJO A;  1TY2 A;  2R7D A;  1FNV A;  2RKS A;  1YVC A;  3I4N H;  2N8N A;  4PV1 C;  5G3L D;  3J81 i;  2DN8 A;  4FXD A;  4TRD A;  3UDG A;  3CCJ A;  3GTL B;  1ZYR D;  2D0O A;  1STG A;  1PZK D;  1ONL A;  5JAV A;  4PMW A;  2R61 A;  4JK1 C;  1D5X C;  2Q2U A;  5ELF A;  1HR0 Q;  1EWI A;  4DAY A;  4ZCK A;  3AMU A;  3NTI A;  4RGT A;  1VQ5 A;  1SYG A;  3TP8 A;  1EY8 A;  4F88 A;  1TKW B;  4DV1 L;  3BZC A;  2XSC A;  2H1E A;  1PTO B;  1WOC A;  1F2M A;  2MUY A;  4DV5 Q;  3SDZ A;  4HCE A;  1A15 A;  1VCI A;  3S1R B;  1W6K A;  2F0W A;  4JBW A;  3L2P A;  5JJI A;  4HR7 B;  1LT4 D;  1IBL Q;  1SNO A;  2PW5 A;  5FO7 B;  1VQO A;  1H95 A;  1F2L A;  2L11 A;  1KRS A;  3CHB D;  1LTA D;  1HNX L;  3V05 A;  4KHP Q;  2UXC L;  2E2J B;  5IP9 G;  1EYG A;  2EY2 A;  2KEN A;  2WFW A;  3K7U C;  4RKB A;  3C46 A;  1PFM A;  1B3Q A;  1Z9F A;  1TWA B;  2MFI A;  5EKI A;  4QJF A;  4JVZ A;  4LWC A;  5K36 H;  4NW2 A;  3S14 B;  4L5S A;  2E74 C;  4DK6 C;  4P74 A;  4MZ9 A;  4IFD I;  2JA5 G;  2PMZ B;  1XMO Q;  5ELE A;  2E2J H;  3CW2 C;  1BVS A;  5FK9 C;  1DZ1 A;  5FLX E;  4BY1 G;  2KHS A;  1SEB D;  3KJO A;  4ULL A;  1NUC A;  3L3O C;  1EOV A;  2VL6 A;  4O1N A;  1HZ9 A;  3A8J E;  1KDC A;  4IPH A;  4DR7 L;  1F9R A;  3G6J B;  5IP9 H;  1LT5 D;  5IWA L;  2EYL A;  3J80 c;  4ME3 A;  3CCS A;  3J7A F;  1S3O A;  4LF5 L;  2VQE L;  2N78 A;  2M2L A;  4LF8 Q;  1E2Z A;  2FIN B;  4HID A;  4XYO A;  4DR2 L;  1V9P A;  3TP7 A;  2ES2 A;  4UAI A;  3M4O B;  4BA1 I;  3NK9 A;  1I4G A;  2N3S A;  4P2C B;  1N9W A;  3OSO A;  5FJ8 G;  4HSP A;  5C5M A;  3I55 A;  2CFM A;  3D8G A;  4DF7 A;  1RTN A;  1Y1V G;  2F0M A;  1KDB A;  2Z6B A;  4RCO A;  1JWS D;  4BY1 H;  1TWH H;  1OXV A;  1V1Q A;  4OIK A;  2B63 B;  4LFC Q;  2HHH L;  1E3P A;  1A6X A;  3DM3 A;  1A3U A;  3AQQ A;  1SRU A;  1B53 A;  2EXD A;  2PMZ E;  3I4L A;  2KCC A;  4KD3 A;  5GAH C;  4MIU A;  5IE8 A;  1CKN A;  1LTB D;  1E0B A;  1SND A;  2RDF A;  2QKI C;  2RVL A;  1S5B D;  3BVZ A;  2SNM A;  1C0A A;  2IT1 A;  2K5Q A;  1M8A A;  1YNJ D;  5FLX L;  5C3E B;  1JE4 A;  1SMY C;  3GTJ H;  4H13 C;  4HED A;  2ZM6 L;  3SXH A;  2I5M X;  5FJ8 H;  4XIG S;  2MNA A;  2VB3 X;  1DOK A;  1K83 B;  4KLK A;  5DNF A;  3DWQ A;  4F8M A;  3S1N H;  2Q2T A;  1N34 Q;  1FL0 A;  4EQO A;  2F0P A;  3OTO L;  4U68 A;  2JEB I;  1Z7T A;  4IUQ A;  1K8G A;  3TS0 A;  3RD4 A;  3TRE A;  4A3B G;  1G29 1;  2AWO A;  5H1S E;  3T1Y Q;  1EY9 A;  5IT9 L;  3J7A V;  2HIV A;  1X54 A;  1OXX K;  1AEX A;  4BBR G;  3H91 A;  2ID0 A;  5K5P A;  1BCP D;  1GUT A;  1GXD C;  3HGB A;  1X6O A;  1IBM Q;  1D7Q A;  2Y0S B;  3BZK A;  4MNO A;  5KRU A;  1B9M A;  3AEV A;  5LMU L;  4LF9 Q;  1SNP A;  1N32 L;  4ILW A;  3G48 A;  3I70 A;  1BKB A;  3DXJ C;  3NE5 B;  3VYU A;  3IFD A;  4LF6 Q;  3MEF A;  4JOI C;  4DV0 Q;  2B2W A;  5CBE E;  4A3B H;  3VR4 A;  1AH9 A;  4DR5 L;  4IJH A;  3W5O A;  2JA7 G;  1TS5 A;  4BBR H;  1HFG A;  4QY7 A;  3NBI A;  4NXM Q;  3HOV G;  2LXJ A;  5I2X A;  3KYH C;  3E3X A;  1D6E C;  3DWA A;  4JI5 L;  4K5W A;  1CZW A;  3EN2 A;  1N33 Q;  4I65 A;  2F0J A;  1K73 C;  4GZY C;  3NUC A;  3F2B A;  4A3I G;  3GTO H;  1X32 A;  1VQC A;  3OYY A;  2OCE A;  2A69 D;  2K75 A;  5M5Y B;  2OXP A;  2BOS A;  3E9H A;  5DM6 3;  1LT3 D;  1V1O A;  1EOT A;  4DR1 Q;  2JA7 H;  2WP8 J;  3H3V C;  1N8R C;  5EJW A;  1QB5 D;  2A74 C;  4RHR A;  3EQL C;  2NTS A;  1V1P A;  3HOV H;  3HZX A;  5IOD A;  1RKN A;  3N6R A;  3K80 C;  3SEB A;  2NVQ H;  1CSQ A;  2RCN A;  4JYA Q;  4OX9 Q;  4KTA A;  1PH9 A;  3VA7 A;  3DM1 A;  1SXT A;  4A3I H;  3BDO A;  3M7N A;  2V4D A;  4OWT B;  3UDF A;  5GAD C;  1XMQ L;  2NVY B;  1SNQ A;  2HDM A;  2B8F A;  2G5D A;  3HOY G;  4J1M A;  2F1M A;  1Z47 A;  4ABN A;  4ZQ3 A;  2VXW A;  5KNB A;  2MPM A;  1H9S B;  5EPK A;  3PF4 A;  2AQ2 B;  3NXW A;  2F0L A;  3T56 B;  2R6G A;  4I7A A;  4NDX A;  3J80 i;  2RSO A;  4K14 A;  4P72 A;  4K6D A;  4DN4 M;  1I6V C;  2WIN B;  4KHP L;  5LMN W;  3CQZ B;  4B9X A;  5TSS A;  3KLS A;  1WFQ A;  1E2W A;  3L7Z C;  1CFM A;  4BBS G;  5EKL A;  1NMG A;  3HOY H;  1Q12 A;  2IWH A;  2MGS A;  5JOB A;  3E0J A;  2L5T A;  2ZJP A;  3LX0 A;  3ND9 A;  1QCB D;  2YV5 A;  1VDZ A;  2ZTE A;  5C3X A;  4R4T A;  2E8G A;  4LNQ A;  3CQZ H;  4L5Q A;  3GTK H;  4XQN A;  1WTQ A;  1XPU A;  1XX8 A;  3ND8 A;  3W3A A;  3K58 A;  5EGT A;  3K7A B;  4B9W A;  1TVX A;  5I6Y A;  2IJ0 A;  1KIX A;  2R7Z B;  2PQA A;  3KDF A;  3K5M A;  4BBS H;  5C5L A;  1HNW L;  1RCV D;  3S17 H;  3ZYY X;  2V1C C;  3UE0 A;  1D1I A;  3GTM B;  3RLN A;  3GTP B;  1MKH A;  1BBW A;  4AYB G;  1PHJ A;  3S2H B;  3BYT B;  1K9M C;  3NQI A;  3Q8D A;  2GVB A;  1BDO A;  4APV A;  2LXK A;  1PRT F;  1EY7 A;  3VDY A;  2CH4 W;  3O13 A;  3RZD B;  4OIJ A;  5L37 A;  1EUJ A;  4L63 B;  1S40 A;  2K01 A;  2B39 A;  1CT1 D;  3MWY W;  4YCU A;  4K0K L;  1DJR D;  5LMN Q;  3CME A;  4CDC C;  1XNR Q;  4A3D G;  3K5L A;  4OEM B;  4ODG A;  1C48 A;  4G7Z C;  1HRJ A;  3PUX A;  1J9O A;  1B4O A;  2KCM A;  5HGQ A;  4EX5 A;  2ALY B;  2NN6 G;  4GN4 B;  1IHZ A;  3CPW A;  3GTG H;  4B3M Q;  3PO2 G;  5D14 A;  2GN5 A;  1ILP A;  3NTH A;  3HEJ A;  5C44 G;  3A54 A;  5IGC A;  1GHJ A;  3CD6 A;  3KF8 A;  3I91 A;  4X3K A;  3SK8 A;  2LSS A;  3OMG A;  4RHS A;  1VS0 A;  1HTP A;  2F3V A;  3T1Y L;  2KCT A;  1AE3 A;  2PO4 A;  3DWP A;  1YI2 A;  2K5V A;  4ZK9 B;  4A3G G;  4BA2 I;  2NVT B;  3I4M G;  4A3D H;  1KLU D;  1A63 A;  1WCM G;  1BF4 A;  4M8A A;  2JA6 B;  2R93 B;  5M3M G;  1X55 A;  4RA8 A;  4X3S A;  1Y1W G;  2NN6 H;  4OEL B;  3HKZ B;  4G57 A;  4EQP A;  1SE2 A;  5ISR A;  5KYL A;  1JR0 D;  5AFW A;  2SOB A;  4PZ7 A;  3CCM A;  1GO3 E;  1Q1E A;  3PUW A;  3PSI A;  5C44 H;  3FHW A;  4KK7 A;  2EIF A;  2Z6K A;  3MVV A;  3K8A A;  4U67 3;  2L0C A;  1JIC A;  1F77 A;  4O42 A;  4DV0 L;  3CKI B;  2WKC A;  2K50 A;  1HCZ A;  2F4I A;  5BR8 L;  2A6H D;  2UXD Q;  4MN3 A;  3N52 A;  5EQ0 A;  1KDA A;  4X62 Q;  4A3G H;  4HIM A;  1I4H A;  4CKC A;  1CUK A;  1ICW A;  1UNS A;  2WAQ B;  4KKU A;  1SE4 A;  1IW7 D;  1WCM H;  2BCO A;  2PYK A;  4DPG A;  1HA6 A;  4HJ5 A;  1UWV A;  5M3M H;  1FGU A;  2DGY A;  2E2H B;  4DUY Q;  2JA9 A;  3BVG A;  1G51 A;  4X65 Q;  4JI2 L;  3A8K E;  4HCS A;  1HTL D;  4ZUJ A;  4X64 L;  2FJ2 A;  1JWU D;  4QL5 A;  5C0X G;  1BNZ A;  5JEA G;  2LKV A;  1NNX A;  2A6E D;  3FP9 A;  5ELN A;  1NCV A;  3NWS A;  5I6W A;  2KCN A;  3C1F A;  4CGY B;  4C2M B;  1UAP A;  4MTN A;  2B2T A;  1TII D;  4UPA A;  1JOR A;  1P8L A;  3ITP A;  1ML0 D;  2NZ1 D;  5I2Y A;  1STN A;  4YCV A;  2WAQ E;  4CJ0 B;  5DM7 3;  5C0X H;  4AQY L;  2IY5 B;  5ELO A;  5JEA H;  3QO2 A;  4OGQ C;  1SFO B;  2EDG A;  1ICF B;  4R1J A;  3MHB A;  4DR3 L;  2HIX A;  3TS2 A;  4DXF A;  1EYA A;  3OHX C;  5IYB G;  1KXL A;  4FF1 A;  1K3B C;  4JI6 L;  3PIP 3;  2NYZ D;  3MEH A;  4H44 C;  2A69 C;  2XTI A;  3UDX A;  1WTR A;  4X66 Q;  1SJH D;  2ZXP A;  3D6W A;  4DV4 Q;  4XQJ A;  2JE6 I;  1F9P A;  2AUK A;  1EIF A;  2MQH A;  2N49 A;  5J1Z A;  3CCL A;  4JBM A;  3H0G B;  3KF6 B;  1SE3 A;  1K8A C;  1STE A;  4A3E B;  3TME A;  5C3W A;  1X3G A;  4DNT B;  3PUY A;  1HQR D;  3F8T A;  5FLX c;  5IYB H;  4C3J B;  2UUA Q;  3Q6S A;  5IGB A;  3T1H Q;  1PH4 A;  4B08 A;  2PPB C;  1HR0 W;  2RDG A;  1PRT D;  1LM0 A;  4A3E H;  4C3I B;  1HH2 P;  1PLF A;  4DGZ A;  1TS2 A;  4JI0 Q;  1E7Z A;  1LTI D;  5J22 A;  1EU4 A;  3EFX D;  4RMF A;  1VQ8 A;  2VZA A;  2G9H D;  5FKA C;  3Q23 A;  2D62 A;  3EA6 A;  4IFD G;  1YJW A;  3W1G A;  1GD7 A;  4Q5V A;  2FMM A;  2UU9 L;  3M9B A;  1FR3 A;  5IGE A;  3ERS X;  5LL6 X;  2VQF L;  4A3K G;  1DGS A;  1B1Z A;  2LMC B;  5CYU A;  2K5N A;  3E9I A;  4HIK A;  3ULL A;  3NBH A;  1OTC A;  2BH2 A;  3I4N B;  2XN9 C;  1ROD A;  1ENC A;  5LMN L;  1E2V A;  2F0U A;  3BU2 A;  1C4Q A;  3HS0 C;  1DOM A;  1DXM A;  1S72 A;  3FPU B;  4G7H C;  4YIJ A;  3J81 E;  2K32 A;  3P7J A;  4R4C A;  4IFD H;  4JCV E;  2O5I C;  1MBY A;  4TVA B;  3URY A;  1DM0 B;  1NR2 A;  2ZTD A;  1F2Z A;  2L12 A;  2K6A A;  1STY A;  1P16 A;  1S4Z A;  2EXZ A;  1FD7 D;  4KI0 A;  3IRB A;  2PZT A;  3DMU A;  4A3K H;  1R4Q B;  2VUM G;  3M3Y H;  4IUN A;  3ERO A;  4DAY B;  2EYH A;  1LTS D;  1EQR A;  1QNK A;  3QJY A;  1UE5 A;  3PMF A;  2B2Y A;  1VQG A;  4IUT A;  3R2T A;  1W3S A;  1G2S A;  2QCP X;  3D3R A;  1I4P A;  2BA0 A;  4B3S Q;  3OMC A;  1Y8N B;  1KNE A;  2K5D A;  3W2D A;  1Q82 C;  2EYP A;  2OQ0 A;  5C4X G;  2RHQ B;  4DV2 Q;  3ONA B;  2HT1 A;  2KUM A;  3SK4 A;  4GOP A;  2AUJ D;  1HQM C;  2VUM H;  1EEI D;  4QGU A;  1CSP A;  3NEM A;  4YHH Q;  1L1O A;  3HOZ G;  1BBU A;  1QVC A;  3CC2 A;  1NAP A;  1JC7 A;  2BDO A;  2RSN A;  1PTO F;  5EKK A;  2UXD L;  5E4X A;  3ERQ A;  4PG3 A;  4IPD A;  4X62 L;  1N36 Q;  4Y52 H;  2RF4 A;  4RH6 A;  2BH8 A;  1FJG L;  2QA4 A;  1O80 A;  1TR5 A;  2EY6 A;  2NVX H;  2B2W C;  4NXN L;  1W6J A;  5AJ3 L;  5E4W C;  5C4X H;  3BYY B;  4UHV A;  4JV5 Q;  2SNS A;  1TS4 A;  2JJQ A;  1KLG D;  1JT8 A;  4QCL A;  1EIY B;  4JI7 L;  1GM5 A;  2JA5 B;  3HOZ H;  1F9S A;  3NQT A;  2VS1 A;  1A2U A;  2A1A A;  2Z9H A;  3JAM E;  4JI1 Q;  1MSH A;  1TWH B;  4BY1 B;  2B2U A;  5E1F A;  4FF3 A;  3HKS A;  4WFN 3;  4LFB Q;  2DJF C;  3FKI G;  1EY5 A;  3NWT A;  1AZP A;  3AFP A;  2X6G A;  1EQV A;  1MSG A;  4C3H G;  1NBW A;  1G6Z A;  4DR4 Q;  4UP7 A;  2I0Q A;  2QF7 A;  2TSS A;  2JA5 H;  3NEL A;  3K5N A;  1AW7 A;  3J7A 5;  3Q24 A;  3GTJ B;  5M3F G;  4BY7 G;  2ZXO A;  4IOC A;  4UP8 A;  3LGJ A;  5JVH 3;  2F0V A;  1GVP A;  4KHV A;  4DUZ Q;  2K7V A;  1IBK L;  2CQA A;  4ZAI A; 
#chains in the Genus database with same CATH homology
 3S1N B;  3Q0A A;  3NSW A;  1TY0 A;  4IUR A;  3BZD B;  3F2U A;  2IX0 A;  1K8O A;  1JOO A;  1DCZ A;  5EBC A;  3KLS X;  2F0I A;  4K5V A;  3P75 A;  3JAM L;  1DYQ A;  5C0X J;  5JEA J;  2PNR C;  3K6O A;  5CV8 A;  4N9P A;  2FFK B;  4K8I A;  3IAY A;  3PIO 3;  4M1U B;  3D4W A;  1X3P A;  3SK5 A;  1TU2 B;  5I9O A;  1FYC A;  2IPK D;  3FEW X;  3R93 A;  5CGK A;  4A3B B;  4C1N K;  5CV6 A;  1PZI D;  1RJT A;  4G4K A;  1PFB A;  4K8J A;  4BBR B;  4FF2 A;  2BE5 D;  3FPP A;  2F0F A;  2LY7 A;  5A35 A;  2A68 D;  5CC4 A;  1H9K A;  4QMG A;  3A55 A;  1LO5 D;  5HGT A;  1S5C D;  1C8C A;  3GTO B;  1JOQ A;  1KNA A;  3AB9 A;  4RCN A;  3KK7 A;  2O5J C;  5ELB A;  5T1I A;  1A2T A;  1SNM A;  2PZW A;  2JA7 B;  4LMQ D;  3MFY A;  1EL0 A;  1YNN D;  4RKL A;  3FRP B;  4BS9 A;  4HTH A;  3HOV B;  3RLF A;  1KAA A;  3TP5 A;  2EYO A;  2B2V A;  2N55 A;  1SYD A;  2NVQ B;  1CTM A;  2F3W A;  4A3I B;  2JYO A;  2JEA I;  1H9R A;  4QIW B;  4G7O C;  3BVM A;  3CU7 A;  5EBD A;  5BN5 A;  1PTO D;  1U4M A;  2EZV A;  1MD2 D;  3LWE A;  4IFD J;  2K33 A;  3H09 A;  2PW7 A;  2CW0 D;  4DK0 A;  3J80 E;  4NKL A;  3A8I E;  3E6Z X;  4H0L C;  3MXU A;  5T1G A;  3HOY B;  4UDU C;  4J8Q A;  1O7L A;  4FO2 A;  1XXG A;  1STH A;  3R8B A;  3VYR A;  1OXT A;  5BN4 A;  1AN8 A;  4XT1 B;  2LS0 1;  1JOK A;  4DFA A;  3GTK B;  1BR9 A;  3V96 A;  3CRL C;  5IIF A;  1ZYR C;  3GD7 A;  1H9S A;  1QIL A;  3RMH A;  1EY4 A;  4BBS B;  3SHL A;  3OIQ A;  3S17 B;  3VA5 A;  4IUP A;  4LK1 C;  1GUO A;  1FGB D;  4X3U A;  5I4D A;  2L1B A;  1JB3 A;  4NMZ A;  2L4N A;  3E5S A;  3I8Z A;  5C4Z A;  2CVR A;  1H9M A;  1WTV A;  1T5E A;  1O7Z A;  2L55 A;  4OL7 A;  3IKJ A;  1L0X B;  1SYE A;  2F0N A;  4AYB B;  1PFN A;  3TZU A;  4FP5 D;  3WOE A;  3D4D A;  3GTG B;  4EGV A;  3TN2 A;  3AU7 A;  2L9H A;  4K2K A;  5A2Q E;  3NHH A;  3QIA A;  5FOB B;  1PZJ D;  2E75 C;  5CBA E;  4RGO S;  1AZQ A;  2EE1 A;  3EVQ A;  5M9O A;  2J7Z A;  4IUU A;  4QUC A;  4A3D B;  3DEP A;  1Q90 A;  4XTC S;  5KYI A;  3PO2 B;  1GUW A;  3PV0 A;  3L9A X;  5FO8 B;  5C44 B;  4HMI A;  1G91 A;  2K05 A;  3D31 A;  5LL6 S;  4EQN A;  1L0Y B;  2OT2 A;  1SYB A;  3P20 A;  4A3G B;  1CQF A;  2QIL A;  2R3Z A;  1YNJ C;  1DON A;  4XQQ A;  1WCM B;  1EIH A;  1I4R A;  1STA A;  2EOT A;  5M3M B;  1XWE A;  4CKE A;  3V2T A;  3VR2 A;  1SDF A;  5JJZ A;  3U9S A;  5J39 A;  4KN4 C;  3OOC A;  2I46 A;  4RGM A;  2X69 A;  3H94 A;  1PMR A;  3GV3 A;  3TBI B;  4I7Z C;  4TKO B;  3U9O A;  3K5O A;  1HHV A;  1Y8P B;  1BCP C;  4FVM A;  2IW3 A;  2DNE A;  1BQQ T;  2J0T D;  4F87 A;  3MC0 B;  1OO9 B;  2EJM A;  2IL8 A;  1IKL A;  3BDC A;  1GUN A;  4OO1 I;  2WV6 D;  4LJZ C;  1SMY D;  1Q1B A;  3VR5 A;  1SJE D;  3D4R A;  2H4O A;  1M4V A;  2B2Y C;  4CHT B;  3T13 A;  1UUP A;  4EVO A;  1I50 B;  4PMC A;  2I07 B;  2Z4H A;  1EYC A;  3A7L A;  2XVS A;  2AQ1 B;  3T4A C;  3GV6 A;  1FNW A;  1K8M A;  3SVM A;  1WVL A;  2HUG A;  2WII B;  2DY7 A;  4KY6 A;  2F0S A;  4FF4 A;  1SYF A;  2DY8 A;  2J4X A;  3KBG A;  3BS1 A;  4PNY A;  4XYQ A;  3I73 A;  3FVQ A;  2EJG C;  2VB2 X;  2PQE A;  2ZXR A;  1QWY A;  2B2U C;  1O7Y A;  2F0Q A;  1LTG D;  3LNN A;  1CK1 A;  3RUZ A;  3MTS A;  1BCP B;  1EZ6 A;  1CHP D;  4XT3 B;  2AQ3 B;  2PCF B;  3NTK A;  3M7G A;  1T5X D;  3MXG A;  3BDL A;  3MXP A;  4A3K B;  2EVB A;  3M3Y B;  2A73 B;  1U9R A;  1RHP A;  4BWG B;  1KTK A;  5C4H A;  3MA2 B;  3PUV A;  4X3T A;  1NR4 A;  1BO0 A;  3MXN A;  2G9D A;  2EPB A;  1EWC A;  2Z8L A;  1EEF D;  4HSV A;  3OPO A;  2SDF A;  4FXK C;  1F9Q A;  3DHQ A;  4KHZ A;  4WOR A;  1FNU A;  1CZG A;  4NP5 A;  4XDX A;  3PUZ A;  1SYC A;  3TP6 A;  1CA5 A;  5E3F A;  2Z4I A;  2VUM B;  1AP0 A;  1HXY D;  5CMD A;  3CRK C;  4WJW A;  2IX1 A;  2KEC A;  3C1E A;  2XWJ B;  4KY7 A;  1EWH A;  2NVX B;  4RAU C;  1RD9 D;  2ENB A;  3VR6 A;  1CA6 A;  2E2D C;  3J81 L;  5ELD A;  5C4X B;  4DAV A;  5K36 G;  3A7A B;  2F03 A;  1ZEQ X;  4MHE A;  3TDQ A;  1DD2 A;  1LLR D;  2F0K A;  4IZ8 A;  4XXE A;  1I4X A;  3SE0 A;  1RTO A;  4C1N I;  3HOZ B;  3T16 A;  2AWN A;  1Z6H A;  2XRS D;  4CJ2 C;  1WTP A;  2FHT A;  1PTO H;  1WD1 A;  3QB3 A;  1D5Z C;  1XTC D;  2KA7 A;  3GO5 A;  3GP7 A;  2M9V A;  4KY5 A;  1ESF A;  2B2V C;  4DU9 A;  5DEH A;  1MGS A;  4ZRZ A;  5LHY 1;  2A6H C;  3FKI B;  4C3H B;  1ZKO A;  1IW7 C;  1Y1V B;  3K57 A;  4L6T B;  5M3F B;  4BY7 B;  4R8I A;  4HN7 A;  3KLR A;  4WRD A;  2EJF C;  2A6E C;  4RGN A;  5IT9 E;  4E6I A;  2MJ8 A;  4ZKB B;  3KBX A;  1SNC A;  1LT6 D;  1NSN S;  1OXU A;  3TSS A;  4DXG A;  4FYD A;  5FO9 B;  4IUV A;  2IX3 A;  3OWE B;  2JP1 A;  1QE6 A;  5KEE A;  1IL8 A;  4Z9C B;  1G8Z D;  2WKD A;  1CM9 A;  3T51 B;  4R8N A;  1ILQ A;  3MFG A;  2O2L D;  1JQY D;  3IL8 A;  1O78 A;  4OHJ A;  2CHB D;  5EPL A;  5D3I B;  4IN3 A;  1PDQ A;  3MZ5 A;  5KNC A;  1S5D D;  5NUC A;  3X3M A;  2JXM B;  1EIG A;  2D2C C;  1BOS A;  2F0H A;  5DAU A;  1I6H B;  1ENF A;  4QF4 A;  3GTQ B;  3QOJ A;  2Q8R E;  3Q22 A;  3M4Y A;  3HG9 A;  3KUP A;  4A93 B;  4DK1 A;  2OF1 A;  3I72 A;  2XNA C;  4CJ1 B;  4HMJ A;  1PRT C;  3H6M A;  1EFI D;  3A56 A;  1V1P B;  3NP8 A;  1TWF B;  5JPM C;  1A3T A;  1LV9 A;  5COY A;  2KED A;  4ZLT F;  2NTT A;  2K5W A;  1JWM D;  3S1Q B;  3DEO A;  1EU3 A;  2F0E A;  4A3F B;  1HFN A;  5KGU A;  2RA4 A;  2R92 B;  5F2D A;  5IGF A;  1Q3L A;  3QOL A;  3M85 A;  1QNU A;  4LAA A;  1WTW A;  1RF2 D;  1I4Q A;  1J8I A;  2M00 A;  2OEO A;  4ID6 A;  1GUG A;  3C3L A;  5KND A;  2XWB B;  3HOX B;  1BUV T;  5EPJ A;  2ICE C;  2MP1 A;  3SR1 A;  5D3D A;  1H9J A;  3S15 B;  3D6C A;  1V8Q A;  4ZUI A;  1B2T A;  1LTT D;  1CHQ D;  1BXT A;  2KEE A;  2X6L A;  1DOL A;  2QEJ C;  2KOL A;  1XYI A;  1GJX A;  1U4L A;  3K59 A;  5CV9 A;  2HCI A;  1STB A;  2HQE A;  2HCC A;  3J80 L;  1U4R A;  5COR A;  2EYJ A;  3QG1 A;  1IKM A;  3FMC A;  4Q0F A;  3S2D B;  3R3O A;  4ME5 A;  5ELC A;  2RBM A;  1WTO A;  1HUN A;  4V19 0;  1ESR A;  1S5E D;  2F0T A;  1TT2 A;  2B2T C;  2NBF A;  2ZT9 C;  1SSO A;  1PRT B;  2F0O A;  2KQ3 A;  4S3S A;  3HP3 A;  3PO3 B;  3G7L A;  3HOU B;  3VYT A;  3GQB A;  2F0D A;  3S16 B;  1VMP A;  1EYD A;  4OO1 G;  1IYV A;  1EQT A;  1X3Q A;  2EY1 A;  1GHK A;  1D5M C;  4K2L A;  1KAB A;  4KN7 C;  2O4X A;  2MHV A;  2TMP A;  4QUF A;  1TQO A;  1IYU A;  2GA4 B;  4R9W A;  1ENA A;  2ICI A;  4PQX A;  2XRQ D;  3T53 B;  3WDN A;  5C4J B;  2E2I B;  4L8J A;  1F2Y A;  2N88 A;  1D2B A;  4OO1 H;  5JPN C;  4Y7N B;  1TWC B;  2NB0 A;  4KKT A;  4RFB A;  1OXS C;  2Q8T A;  1G2T A;  2NWG A;  1SBB B;  2KVM A;  5M5X B;  2NUC A;  3I4M B;  3OWF A;  1JCK B;  5A2Q L;  5IOC A;  4FNF A;  4RWS C;  1QOH A;  2XIW A;  1Y1W B;  2VNU D;  2K04 A;  1WTX A;  4TQU S;  2D9U A;  1VF5 C;  1EY0 A;  4DNR B;  1AFP A;  5I9P A;  1I3Q B;  5G3L F;  1UEA B;  2LFN A;  2SEB D;  4A3M B;  1CQV A;  3OW7 A;  2JA8 B;  4KMU C;  5BN3 A;  4ZYS A;  1Q8I A;  2YYZ A;  1ET6 A;  3EJI A;  1GUS A;  2HDL A;  1D1K A;  5M5W B;  2KJX A;  1LTR D;  1B9N A;  3BG3 A;  1B44 D;  3HRZ C;  3UI2 A;  2BE5 C;  1A3V A;  1TWG B;  1QJO A;  5CV5 A;  2A68 C;  1U4P A;  4PMB A;  3FDT A;  1RDP D;  1VF7 A;  4IAL A;  2JSO A;  3VYS A;  2WAC A;  1GOZ A;  2Q8I B;  1YNN C;  3X3N A;  1LAC A;  1HA5 A;  1CI3 M;  4HAE A;  3QWN A;  2NN6 I;  1ET9 A;  3I3C A;  2QDB A;  3OIP A;  2WB1 B;  2BDN A;  2DNC A;  4IQZ A;  3NPP A;  3I90 A;  3R2I A;  3WOF A;  1EY6 A;  4KD4 A;  1PXU A;  3VR3 A;  4F7X A;  3DUZ A;  1R9T B;  1Y8O B;  1PTO C;  4C56 C;  3S1M B;  1HPC A;  1V43 A;  2CW0 C;  5IGD A;  2K1B A;  2EY5 A;  1WD0 A;  4K6L A;  4C3J G;  2K28 A;  3IFT A;  4N9T A;  5IGG A;  1PYW D;  1QG7 A;  1HUM A;  3SK6 A;  1Y69 U;  4V0B A;  1B50 A;  4C3I G;  1MI2 A;  4K5X A;  1S5F D;  2B8G A;  3MAQ A;  4A3J B;  5CV4 A;  4DAP A;  1BBX C;  3RZO B;  1EZ8 A;  2RQX A;  4KKS A;  4ZKC B;  2A5H A;  1B3A A;  5C6A A;  2FMC A;  5D65 A;  1LAB A;  1SAP A;  2D5D A;  1ZXT A;  5CR3 A;  2C9O A;  5C0X I;  5KIX A;  4TSS A;  4H7B A;  4KJN A;  4J6H A;  5CV7 A;  3J7Y W;  4CBV A;  3LWU A;  3HOW B;  4CKB A;  4DA2 A;  1BCP F;  2E76 C;  2PZU A;  4QB4 A;  2Z1C A;  4KV6 A;  2YU9 B;  2RDH A;  2C5C A;  1II3 A;  2EYM A;  2EYF A;  5JVG 3;  3S9W A;  4FXG C;  2F0G A;  2K03 A;  2BA1 A;  3C2P A;  5HUR A;  3P1H A;  3TZD A;  1R4P B;  1TS3 A;  3K0Y A;  1VMC A;  4KJO A;  1TY2 A;  1FNV A;  2RKS A;  4PV1 C;  5G3L D;  4FXD A;  2DN8 A;  4TRD A;  3GTL B;  1ZYR D;  1STG A;  1PZK D;  1ONL A;  5JAV A;  4PMW A;  2R61 A;  4JK1 C;  1D5X C;  5ELF A;  4DAY A;  3AMU A;  3NTI A;  4RGT A;  1SYG A;  3TP8 A;  1EY8 A;  4F88 A;  1TKW B;  2XSC A;  2H1E A;  1PTO B;  1F2M A;  2MUY A;  3SDZ A;  4HCE A;  1A15 A;  1VCI A;  3S1R B;  1W6K A;  2F0W A;  4JBW A;  4HR7 B;  1LT4 D;  1SNO A;  2PW5 A;  5FO7 B;  1F2L A;  2L11 A;  3CHB D;  1LTA D;  3V05 A;  2E2J B;  2EY2 A;  4RKB A;  3C46 A;  1PFM A;  1TWA B;  5EKI A;  5K36 H;  4NW2 A;  3S14 B;  2E74 C;  4IFD I;  2PMZ B;  5ELE A;  5FK9 C;  1DZ1 A;  5FLX E;  2KHS A;  1SEB D;  4ULL A;  1NUC A;  3L3O C;  4O1N A;  3A8J E;  1KDC A;  1F9R A;  3G6J B;  1LT5 D;  2EYL A;  3J7A F;  2M2L A;  1E2Z A;  2FIN B;  4XYO A;  3TP7 A;  4UAI A;  3M4O B;  4BA1 I;  3NK9 A;  1I4G A;  4P2C B;  3OSO A;  4HSP A;  5C5M A;  3D8G A;  4DF7 A;  1RTN A;  2F0M A;  1KDB A;  4RCO A;  1JWS D;  1OXV A;  4OIK A;  2B63 B;  1A6X A;  1A3U A;  1B53 A;  3I4L A;  2KCC A;  4KD3 A;  4MIU A;  1LTB D;  1E0B A;  1SND A;  2RDF A;  2QKI C;  2RVL A;  1S5B D;  3BVZ A;  2SNM A;  2IT1 A;  2K5Q A;  1M8A A;  1YNJ D;  5FLX L;  5C3E B;  1JE4 A;  1SMY C;  4H13 C;  4HED A;  3SXH A;  4XIG S;  2VB3 X;  1DOK A;  1K83 B;  5DNF A;  3DWQ A;  4F8M A;  4EQO A;  2F0P A;  4U68 A;  2JEB I;  1Z7T A;  4IUQ A;  3RD4 A;  1G29 1;  2AWO A;  1EY9 A;  5IT9 L;  3J7A V;  1OXX K;  1AEX A;  3H91 A;  2ID0 A;  5K5P A;  1BCP D;  1GUT A;  1GXD C;  3HGB A;  2Y0S B;  5KRU A;  1B9M A;  1SNP A;  4ILW A;  3I70 A;  3DXJ C;  3NE5 B;  3VYU A;  3IFD A;  2B2W A;  5CBE E;  3VR4 A;  1TS5 A;  1HFG A;  3NBI A;  5I2X A;  1D6E C;  3DWA A;  4K5W A;  1CZW A;  4I65 A;  2F0J A;  4GZY C;  3NUC A;  1X32 A;  2A69 D;  5M5Y B;  2OXP A;  2BOS A;  5DM6 3;  1LT3 D;  1V1O A;  1EOT A;  2WP8 J;  3H3V C;  5EJW A;  1QB5 D;  2A74 C;  4RHR A;  3EQL C;  2NTS A;  1V1P A;  3HZX A;  5IOD A;  1RKN A;  3N6R A;  3SEB A;  4KTA A;  3VA7 A;  3DM1 A;  1SXT A;  3BDO A;  3M7N A;  2V4D A;  2NVY B;  1SNQ A;  2HDM A;  2B8F A;  4J1M A;  2F1M A;  1Z47 A;  4ABN A;  4ZQ3 A;  2VXW A;  5KNB A;  2MPM A;  1H9S B;  5EPK A;  2AQ2 B;  3NXW A;  2F0L A;  3T56 B;  2R6G A;  4NDX A;  2RSO A;  4K14 A;  4K6D A;  4DN4 M;  1I6V C;  2WIN B;  3CQZ B;  4B9X A;  5TSS A;  3KLS A;  1E2W A;  3L7Z C;  1CFM A;  5EKL A;  1Q12 A;  2IWH A;  2MGS A;  5JOB A;  3E0J A;  2L5T A;  3LX0 A;  3ND9 A;  1QCB D;  1VDZ A;  5C3X A;  4XQN A;  1WTQ A;  1XX8 A;  3ND8 A;  3W3A A;  3K58 A;  5EGT A;  3K7A B;  4B9W A;  1TVX A;  5I6Y A;  2IJ0 A;  2R7Z B;  3K5M A;  5C5L A;  1RCV D;  3ZYY X;  1D1I A;  3GTM B;  3GTP B;  3S2H B;  3BYT B;  3NQI A;  1BDO A;  1PRT F;  1EY7 A;  3O13 A;  3RZD B;  4OIJ A;  4L63 B;  2K01 A;  2B39 A;  1CT1 D;  3MWY W;  1DJR D;  3K5L A;  4ODG A;  1C48 A;  4G7Z C;  1HRJ A;  3PUX A;  1J9O A;  1B4O A;  2NN6 G;  1IHZ A;  5D14 A;  1ILP A;  3NTH A;  3HEJ A;  3A54 A;  5IGC A;  1GHJ A;  3KF8 A;  3I91 A;  4X3K A;  3SK8 A;  3OMG A;  4RHS A;  1HTP A;  2F3V A;  2PO4 A;  3DWP A;  4ZK9 B;  4BA2 I;  2NVT B;  1KLU D;  1BF4 A;  4M8A A;  2JA6 B;  2R93 B;  4RA8 A;  4X3S A;  2NN6 H;  3HKZ B;  4G57 A;  4EQP A;  1SE2 A;  5ISR A;  5KYL A;  1JR0 D;  5AFW A;  2SOB A;  1Q1E A;  3PUW A;  4KK7 A;  3MVV A;  4U67 3;  2L0C A;  1JIC A;  1F77 A;  4O42 A;  3CKI B;  2WKC A;  1HCZ A;  2F4I A;  2A6H D;  4MN3 A;  3N52 A;  5EQ0 A;  1KDA A;  1I4H A;  4CKC A;  1ICW A;  1UNS A;  2WAQ B;  4KKU A;  1SE4 A;  1IW7 D;  1HA6 A;  2BCO A;  2PYK A;  2E2H B;  3BVG A;  3A8K E;  4HCS A;  1HTL D;  4ZUJ A;  2FJ2 A;  1JWU D;  5C0X G;  1BNZ A;  5JEA G;  2LKV A;  2A6E D;  1NCV A;  3NWS A;  5I6W A;  2KCN A;  3C1F A;  4CGY B;  4C2M B;  1UAP A;  2B2T A;  1TII D;  1JOR A;  3ITP A;  1ML0 D;  2NZ1 D;  5I2Y A;  1STN A;  4CJ0 B;  5DM7 3;  5C0X H;  5JEA H;  3QO2 A;  4OGQ C;  1SFO B;  2EDG A;  3MHB A;  4DXF A;  1EYA A;  3OHX C;  4FF1 A;  3PIP 3;  2NYZ D;  3MEH A;  4H44 C;  2A69 C;  1WTR A;  1SJH D;  2ZXP A;  3D6W A;  4XQJ A;  2JE6 I;  1F9P A;  2AUK A;  5J1Z A;  3H0G B;  1SE3 A;  1STE A;  4A3E B;  3TME A;  5C3W A;  4DNT B;  3PUY A;  1HQR D;  4C3J B;  3Q6S A;  5IGB A;  4B08 A;  2PPB C;  2RDG A;  1PRT D;  4C3I B;  1PLF A;  4DGZ A;  1TS2 A;  1LTI D;  5J22 A;  1EU4 A;  3EFX D;  2G9H D;  5FKA C;  3Q23 A;  2D62 A;  3EA6 A;  4IFD G;  4Q5V A;  2FMM A;  5IGE A;  1FR3 A;  5LL6 X;  1B1Z A;  2LMC B;  5CYU A;  3NBH A;  3I4N B;  2XN9 C;  1ROD A;  1ENC A;  1E2V A;  2F0U A;  1C4Q A;  3HS0 C;  1DOM A;  1DXM A;  3FPU B;  4G7H C;  4YIJ A;  3J81 E;  2K32 A;  3P7J A;  4IFD H;  2O5I C;  1MBY A;  3URY A;  1DM0 B;  1NR2 A;  1F2Z A;  2L12 A;  2K6A A;  1STY A;  1S4Z A;  2EXZ A;  1FD7 D;  4KI0 A;  2PZT A;  3DMU A;  1R4Q B;  4IUN A;  3ERO A;  2EYH A;  1LTS D;  1QNK A;  3QJY A;  3PMF A;  2B2Y A;  4IUT A;  3R2T A;  1G2S A;  2QCP X;  3D3R A;  1I4P A;  2BA0 A;  3OMC A;  1Y8N B;  1KNE A;  2K5D A;  3W2D A;  2EYP A;  3ONA B;  2KUM A;  3SK4 A;  2AUJ D;  1HQM C;  1EEI D;  1NAP A;  1JC7 A;  2BDO A;  2RSN A;  1PTO F;  5EKK A;  5E4X A;  3ERQ A;  4RH6 A;  1O80 A;  1TR5 A;  2EY6 A;  2B2W C;  1W6J A;  5E4W C;  3BYY B;  2SNS A;  1TS4 A;  1KLG D;  4QCL A;  2JA5 B;  1F9S A;  3NQT A;  1A2U A;  3JAM E;  4BY1 B;  1MSH A;  1TWH B;  2B2U A;  5E1F A;  4FF3 A;  4WFN 3;  1EY5 A;  3NWT A;  1AZP A;  2X6G A;  1EQV A;  1MSG A;  4C3H G;  1G6Z A;  2QF7 A;  2TSS A;  3K5N A;  1AW7 A;  3Q24 A;  3GTJ B;  2ZXO A;  5JVH 3;  2F0V A;  4KHV A;  2K7V A;  2CQA A;  4ZAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...