2X6SA

Human foamy virus integrase - catalytic core. magnesium-bound structure.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
188
structure length
188
Chain Sequence
PQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein
molecule keywords INTEGRASE
total genus 62
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x6sA00
1HQEA 1FXXA 3IRXA 3F9KA 4CF0A 1WNSA 2BANA 3NFAA 4BACA 1WLJA 4C8NA 1KLNA 3HYFA 4Z4IA 4AHCA 3H08A 4OKEA 4CJPA 3QINA 5FROA 4E1NA 1DLOA 1BCMA 1GOBA 3LPTA 2G8HA 1EETA 3VQCA 1L3SA 4KHWA 3AVMA 4MQ3A 4E19A 2JGUA 4N5SA 1LWFA 3RTVA 4FCYA 3DLBA 1WAJA 2D0BA 3A2FA 1RILA 3SYZA 3TR8A 1WSFA 3SPZA 1L3UA 4BDPA 4PQUA 4G1QA 3VQEA 1VSFA 3NH1A 4DSJA 2X74A 2OYQA 3SUPA 4M3XA 4C8MA 3FFIA 4CEFA 2IDOA 4CGDA 3KLHA 1Q9XA 4K8ZA 4KB1A 3NH0A 3HPOA 2D5RA 4DFJA 1JLAA 3OYJA 3PO4A 2G8WA 1NJYA 2PYJA 4FLZA 2HHVA 3LDSA 1RT2A 4I2QA 5FRNA 4CEQA 3E01A 4JRQA 1D8YA 4J2AA 4CJLA 5KGXA 3KJVA 2F96A 1BQMA 4PY5A 1HPZA 3KLGA 4E7KA 3AO2A 1ZBUA 1C1AA 1BGXT 3TWHA 4DSKA 1ZBFA 4DFKA 1YVUA 3C94A 3P5JA 3VQ7A 3JSMA 4DQRA 3TARA 1SL2A 4FJ9A 2DY4A 5JS2A 4CK1A 4R5PA 4FJLA 4CERA 5CZ2A 3ULDA 5HRNA 1X9SA 2OZSA 5D3GA 4Z4FA 1LWEA 1UA0A 4GMJB 1LW0A 4FLTA 1XHZA 3AVHA 4ID5A 1XC9A 4Z4EA 3LP3A 3L2VA 2HMIA 1RBSA 4FM0A 4Z4HA 4UQGA 3KTQA 5CZ1A 4CEBA 3NAEA 3NGIA 1CZBA 2QKKA 5HRRA 2VG5A 4TSXA 3LP2A 5CY4A 4FLWA 5FDLA 3MXJA 1N6QA 4B9SA 5HBMA 3QEPA 1IH7A 2B6AA 1LAWA 1QSLA 2G8VA 1UWBA 3DLHA 1QSYA 4LH4A 4CHQA 3OS2A 3OS1A 3QEWA 4CJQA 3RMCA 4J2EA 1HQUA 1WAFA 4F4KA 1NK4A 2OA8A 2YNFA 4IG0A 3V1OA 3THVA 4DS4A 4B3OA 1Q8IA 2YKMA 4Z0UA 4KFBA 3ZSXA 3V6DA 3SQ2A 2O4IA 2IGIA 4DTPA 1BI4A 2Z1GA 3DYAA 3KKSA 4CCHA 2YKNA 3AO1A 1SKWA 1ASWA 4DWIA 3VQBA 3HXMA 3VQ5A 3TAQA 3AVAA 3G10A 4KB0A 4M42A 2XRIA 1CXQA 2F8TA 4CEDA 3U3GA 3WNHA 3QESA 2PZSA 2GV9A 3TAPA 1IKYA 3HPGA 2E4LA 4FW1A 2B4JA 4CEEA 3HP9A 1L3TA 3L3VA 2G8KA 4KHSA 4I9QA 4JS5A 3WNFA 1NK8A 2G8FA 1RTIA 4CJWA 3AVCA 2KZMA 3K59A 3QERA 1R0AA 1NJWA 3QIOA 4JRPA 3MEGA 4EZ9A 2HHQA 3VA3A 4OPKA 1KTQA 3EYZA 3L8BA 2D0CA 3K5NA 5KTQA 2E6LA 1RBTA 4KAZA 1FKOA 2OPSA 1SKSA 2OPPA 5DK5A 3VA0A 3ALYA 1Z25A 3ASMA 3ISNC 1Y97A 4DU4A 5HP1A 1TL1A 3ZSWA 3L2RA 3ZSVA 3EZ5A 2EHGA 3IS9A 1SV5A 4Z4CA 3V1RA 3S3MA 1ZBIA 3QNNA 4QCLA 1S9EA 2VWKA 1QQCA 3LZJA 3CFPA 4DG1A 3ZSRA 3KLFA 4K8XA 5DMRA 4WE1A 2FBYA 4DSFA 3SUNA 3B6PA 1CZ9A 4LH5A 4ZTFA 4F8RA 1IO2A 1TL3A 4RW8A 2XY7A 3SNNA 4L8RB 5CYMA 4KTZA 3O3HA 4I7FA 4AHVA 5HROA 2YHBA 3DOKA 1YTAA 2G8UA 1I3AA 1RDBA 4DLEA 2OPRA 3S3OA 3OYGA 3HP6A 4AILC 1VSEA 4B9NA 2P5GA 4LSLA 4CJSA 1DTTA 2G8IA 2HW3A 2IS3A 3HM9A 4DFPA 4M3UA 4N47A 4DQSA 2IAJA 2BDPA 3KK2A 5J2NA 4B9VA 3K5MA 4M41A 5HRSA 1JKHA 2HVIA 2A1SA 1U45A 4FK4A 4CHZA 3BDPA 1TAUA 1BL3A 4DSEA 4KHUA 4Y1CA 4CHPA 3TAFA 2P1JA 2EX3A 4CGIA 3M8SA 1NKCA 2YNHA 3AVNA 3K5LA 1U49A 1NK6A 3RWUA 1S1WA 3DI6A 1KCFA 3LPUA 4ZTJA 4FJMA 1RBRA 1TKZA 4MFBA 3K2PA 3RMDA 4IKFA 3ZSQA 1GOAA 4CEZA 4FLUA 1D9DA 4F2SA 1QE1A 5C42A 4YFUA 2X78A 4B8AB 1C1CA 2ZQBA 3V4IA 1J5OA 3OJUA 4W5OA 1D5AA 3RR7A 3BGRA 1LAVA 4OGEA 3WNEA 4FJ7A 2E6MA 1KFDA 1LWCA 4AHTA 4W5QA 5KI6A 3IAYA 1BIZA 1JLBA 2JLEA 1JXEA 4FJHA 4KI4A 1SKRA 2B5JA 1LV5A 1NK5A 3CFRA 3S9HA 4FLVA 2HHUA 1NOZA 1HYSA 4KHQA 2KW4A 1S1TA 3AA2A 3P1GA 4CJ5A 2KQ2A 3VQDA 5J2QA 4ICLA 1U47A 3HVRA 1C0UA 4O44A 4E7JA 4FK2A 4CJ4A 2BE2A 3C95A 2I5JA 1L3VA 2VG6A 4I9LA 1CXUA 4LSNA 3LAKA 4CJ3A 3NHGA 4IFVA 2Q3SA 3CM5A 3DM2A 1HNVA 4I2PA 3NH2A 4OVLA 3AVJA 4FYDA 1KFSA 4CFBA 2A1RA 1UOCA 1JLQA 3DRPA 4CJTA 1TKXA 4OPJA 3NGZA 4BWJA 3K57A 3QO9A 4YNQA 4CHYA 3SJJA 4FLXA 4FM2A 4LY7A 4CFDA 3NF7A 5HRPA 1U4BA 4OKKA 1J53A 5E41A 4AHSA 4N41A 2RPIA 4OGCA 3CM6A 1S9GA 3NGYA 4DTUA 3KK1A 4GW6A 3CG7A 3QLHA 4H4MA 4HHTA 1ZYQA 1JLGA 1W0HA 1NKBA 3DLEA 3I0RA 4IBNA 4E1MA 5J1EA 3RRHA 3PO5A 3PY8A 4FJJA 1IKVA 3ZT4A 4CJKA 1ZBHA 1ITGA 1F21A 1BISA 2XO7A 3DLGA 3NCIA 3TAEA 4E89A 1HJRA 3UIQA 3B6OA 1TK5A 4Q5VA 2OPQA 1UAXA 3LP0A 1YT3A 4NCAA 4FJNA 3G0ZA 4DU3A 2PYLA 3RRGA 4DSIA 1NK0A 1BIUA 2ATQA 4N56A 3OYDA 2QXFA 1FKPA 3ITHA 1Q9YA 3T1AA 2KFZA 4B9MA 1RTHA 3VQAA 1EP4A 4RW9A 3V9UA 3SUOA 2QKBA 1S1UA 1T05A 3ZT1A 3VQ6A 4EP5A 4DTOA 1NK9A 1RT5A 4W5NA 2DFEA 1GOCA 1KVAA 1BCOA 4F3OA 4NCGA 3D0PA 4BE2A 5J2MA 3VQ4A 3QEIA 4RW7A 3SQ4A 1WSGA 2ZD1A 1T7PA 3OS0A 4F3TA 4M45A 4FJ5A 2FC0A 2KZZA 1JLCA 2HB5A 1RDDA 4AHRA 4DQQA 2XY5A 2KTQA 2LSNA 1NOYA 4H8KA 4KHNA 1WSHA 4HUEA 2DFHA 1BI4B 1JXBA 1B9FA 1VSMA 4CE9A 5JS1A 3TABA 4IFYA 1S6PA 1C6VA 3OYAA 3DLRA 2BGGA 1TVRA 5T7BA 4BDYA 2RF2A 4CJRA 1UA1A 3AVBA 4HCBA 4CF8A 2HVHA 3KLIA 3V9SA 3TANA 3SV3A 1TAQA 1VK0A 4CGGA 4E7LA 3VQQA 2ITGA 3AV9A 3QEVA 4DS5A 3JYTA 4BDZA 1VSDA 4EP4A 3V1QA 3K5OA 3AVFA 4GVMA 3ZSOA 1BHLA 4CF1A 1BQNA 3OYLA 3KD5E 1J9AA 1RT3A 4FJKA 5FRMA 1RDAA 3KK3A 5I42A 2W42A 4IG3A 4ZHRA 4FZXC 2Y1IA 1T03A 4CJUA 2YV0X 5KRSA 3MXMA 3KKRA 3RMAA 1LW2A 4H4OA 1NJZA 1WSEA 2PY5A 3HJFA 1RTJA 4RG8A 3ZCMA 2GUIA 2Z1HA 4RW6A 1L5UA 4E7HA 1TK0A 3OJSA 2GBZA 3KD1E 2KFNA 1KVCA 3AVLA 3OVNA 3PV8A 5KRTA 1XWLA 3C6TA 1X1PA 4OKJA 1S1VA 2RN2A 2Y1JA 3SUQA 4FZYA 1RDCA 4HVJA 3LWMA 1W9HA 4DTRA 4B9LA 1JLFA 1JL1A 4EZ6A 1EKEA 3NF9A 3O4QA 2Z1JA 1RT7A 4DTMA 3WNGA 4B9UA 4KRFA 1TV6A 4JLHA 4CEAA 2DTUA 1D9FA 1C0MA 1HMVA 2IOCA 3KIOA 3S3NA 2OZMA 4CECA 3T3FA 1FK9A 3PX4A 4PWDA 1K6YA 3L2UA 3EY1A 2AJQA 1ASVA 2FBTA 3O4NA 1SL1A 2HNZA 5SWMA 4HCCA 4J2DA 2F8SA 3HT3A 4M3YA 2YHAA 1HRHA 2YNGA 3DMJA 3P83D 4CJEA 3OY9A 1KVBA 3SPYA 4E0DA 4FJ8A 1EX4A 1RBUA 3QIPA 4PA1A 4DMNA 1ZBLA 3NE6A 4DF8A 4ELTA 4FJXA 2X6NA 4KV8A 3NF8A 1S6QA 5K14A 4AH9A 4CIGA 4KREA 4CGJA 3AVGA 4CGHA 4J2BA 3DLKA 1YTUA 2QK9A 2FBVA 1DTQA 1RT6A 4CF9A 4B9TA 4FJGA 4OJRA 4LD0A 2R7YA 4DQPA 1C0TA 3RR8A 5HLFA 3AVIA 3D45A 4ID1A 1WSJA 1I39A 2Z1IA 4QOZB 3DRRA 5KGWA 3NF6A 4CFAA 5J2PA 1VRUA 4DF4A 4ELVA 3L2WA 1NK7A 3HPHA 4W5RA 3LAMA 1TGOA 4CGFA 3ZSYA 2XHBA 4DLGA 4CEOA 3IG1A 4FM1A 1NKEA 1VSKA 4E7IA 4FJIA 1IKWA 1A5XA 3LALA 1HNIA 1VSIA 4O0IA 1XHXA 1TKTA 3V81A 5I3UA 4HUGA 4KHYA 3M8RA 4CK3A 3AA4A 3OYCA 2HHTA 4KTQA 1T8EA 4CJVA 1TK8A 4Z4GA 3OYHA 1RNHA 2WOMA 3ZSZA 4QAGA 3K58A 3ZT3A 1HYVA 3AVKA 3MAQA 3SZ2A 3AO3A 3TI0A 1RTDA 3DOLA 1TKDA 1B9DA 1C1BA 4F2RA 4DTXA 3KLEA 5C25A 4M3WA 1S1XA 3C6UA 1G15A 4CHNA 4CK2A 3HL8A 4M3TA 2X6SA 4B8CA 4BE0A 2ZE2A 4KO0A 3LZIA 1SUQA 1X9MA 5SZTA 4E3SA 1SL0A 4DU1A 1A5WA 4DTSA 4DSLA 3ZT0A 1QSSA 5EU7A 4DTJA 4C8LA 3CFOA 1RT4A 4FLYA 4FK0A 4BE1A 1VSHA 1QHTA 3V9XA 3SV4A 4M3ZA 5CYQA 4O55A 4RW4A 2FBXA 4KKOA 4CIEA 4C8OA 2HHXA 1Z26A 3U3YA 3QETA 3HVTA 4OLAA 3OYFA 4O5BA 4Y1DA 4FVMA 3OYBA 3M8QA 3O3GA 3L2QA 4FZZA 2HNDA 3AO4A 4B08A 1ASUA 1KSPA 4XIUA 4ELUA 3CQ8A 1WSIA 3HSTB 4BWMA 5C24A 3LANA 2HNYA 1JL2A 4M3RA 3DRSA 4KTWA 2RKIA 3ZT2A 4DQIA 3SCXA 4Q0BA 3VN5A 2ETJA 1U04A 4CESA 1VSLA 2O4GA 3OYKA 1U48A 4N76A 2VG7A 4CHOA 3U6FA 1RBVA 3O3FA 4IDKA 3TAMA 1JLEA 4CIFA 3M8PA 3MEEA 3VQPA 1S5JA 2IC3A 3V9ZA 1O1WA 2XY8A 2NUBA 3SQ1A 1KRPA 2WONA 4AHUA 1REVA 3AO5A 4HUFA 3MEDA 3OYMA 2P5OA 3QEXA 1HYZA 3SI6A 2YNIA 3CYMA 3MXIA 4KPYA 1VSJA 3NBPA 1A5VA 3AA5X 3MECA 4DTNA 4OLBA 1J54A 1NJXA 1WN7A 3PX6A 3NDKA 2DFFA 1VRTA 3OYEA 1RT1A 2VWJA 1IG9A 4FXDA 4O0JA 3I0SA 3SQ0A 4CFCA 1N5YA 3I8DA 3V9WA 1XI1A 4PUOA 4NYFA 3OYNA 3VQ8A 3RMBA 2P51A 4JS4A 1X9WA 1KLMA 3F73A 1RCHA 4CJFA 3PX0A 1B92A 3T19A 1CLQA 4KI6A 3PUFA 1QS4A 4DFMA 3AA3A 3QNOA 1EXQA 4W5TA 3VQ9A 2D0AA 2XY6A 4HTUA 3L3UA 4FW2A 3OYIA 3LWLA 3HK2A 2HHWA 4CF2A 3TAGA 4C8KA 4O4GA 2HHSA 4NCBA 4NYNA 1IKXA 1MU2A 1QTMA 3HO1A 3LP1A
chains in the Genus database with same CATH superfamily
3CHWA 3IRXA 4A62A 3NFAA 1GLLO 1D4XA 4CBXA 1KLNA 3HYFA 3OHRA 1GOBA 1L3SA 4DB3A 4N5SA 3LL3A 4WFNL 1KC8O 3VEZA 3DLBA 2D0BA 2WTUA 4BR0A 4BDPA 4PHTX 3DLLL 4C8MA 4CEFA 5GAGP 5C10A 3NH0A 3TTDA 4DFJA 2PYJA 2E8AA 4WQ4C 5KQDA 4FLZA 2E20A 2P9PB 3FFKB 4FWKA 4CEQA 3E01A 4DQ8A 1JJ2M 4JI2K 2P9PA 5KGXA 3C0BA 3DXKB 4KH6A 4PY5A 1ZBUA 4CZKA 1C1AA 4DFKA 3VQ7A 4FJ9A 5H1SQ 4FJLA 3QB0A 4YOYA 3ULDA 2YJEA 4PKGA 3RSEB 4Z4FA 1N32K 4MO4A 4ID5A 1RBSA 4FM0A 5CZ1A 4CEBA 2WUSA 3NAEA 3O80A 4TSXA 4FLWA 2ZGZA 3BUZB 5FDLA 2P9NB 2B6AA 4B1WB 1QSYA 4LH4A 4CHQA 3OS1A 4U7BA 1YHQN 1NK4A 3V1OA 4H0VB 4KFBA 3ZSXA 3SQ2A 2O4IA 2O8EB 2IGIA 4DTPA 1BI4A 1OVQA 3KKSA 3AO1A 1HPMA 3VQBA 4BC5A 1Q18A 3G10A 3VESA 4CEDA 4KBOA 1FJGK 3QESA 3WNHA 2ZGYA 4I6MA 1SAZA 1IKYA 4FW1A 2YHWA 4CEEA 4I9QA 1NGGA 3VPZA 2RHKA 5C0YA 2O8FB 4CJWA 3K59A 5KPTA 3MEGA 2HHQA 3EYZA 3SJHA 3THXA 3K5NA 3WUHA 4X64K 4KAZA 1SKSA 4JEPA 3ALYA 1Z25A 3ISNC 4DR3K 1TL1A 3L2RA 4H0YB 3THYB 3V1RA 4A57A 1ZBIA 4X62K 4DUZK 3WQTA 3LZJA 3CFPA 3KLFA 5DMRA 3A5LC 4FOEA 3SUNA 4LF8K 2NRZA 1CZ9A 1H1VA 5M1PA 1NG9A 3SNNA 5CYMA 4FSVA 4YOTA 4OO1J 1I3AA 3K9KA 1WOQA 3S3OA 2BH1A 3OYGA 3HP6A 2P5GA 1X3NA 4CJSA 4K0KK 4FWQA 4BR9A 3MWPA 2IAJA 3PIPL 2GUPA 5J2NA 1KQSM 4B9VA 3FE1A 3K5MA 4M63C 5ELZA 1JKHA 4M41A 3CJCA 3E66A 4AM6A 2A1SA 3J8AA 1U45A 4FK4A 3RVCA 1TAUA 1VAZA 1BL3A 1HJOA 4KHUA 4Y1CA 4CHPA 5EXWA 3TAFA 4LFAK 5AR0A 1NKCA 3AVNA 4IDHA 3K5LA 1U49A 3RWUA 1S1WA 1KCFA 4ZTJA 1VQKN 4MFBA 3F5TA 3ZSQA 1D9DA 2QWPA 3VEXA 1VQ9N 4C23A 4W5OA 1D5AA 5BPLA 4BR7A 4OGEA 3WNEA 4FJ7A 3K0SA 1KFDA 1K9MO 5KI6A 2F9WA 1JLBA 2JLEA 4JK7A 2ZWHA 1SKRA 2P9UB 1LV5A 1YJNN 5FPDA 3O9QA 3SBGA 4LFCK 2KQ2A 4ICLA 4BRDA 2NRRA 1C0UA 4O44A 4FK2A 1VQLN 2I5JA 4I9LA 1C0FA 3O9RA 2VGNA 1HNVA 4Z94A 3D2EA 1KFSA 4CZFA 3Q7BA 1TKXA 3NGZA 4YNQA 4CHYA 4BGAA 2V7YA 1Q86O 4JI0K 1N34K 1EO1A 3OA9A 4OGCA 1S9GA 4DTUA 3DLEA 3I0RA 4IBNA 5J1EA 3RRHA 1X3MA 4DR2K 3DLGA 3NCIA 3M3ZA 3EKUA 4LF5K 1HJRA 1TK5A 1YT3A 3RRGA 4A2AA 3WEEB 5BN8A 2ATQA 1FKPA 1NLVA 5BPMA 3IUCA 1GLCG 4WFBL 4B9MA 3U4LA 3SUOA 4JKEA 1LOTB 4EP5A 4DTOA 4M7XA 1KVAA 3VQ4A 3QEIA 1WSGA 2ITMA 1W97L 5AZJA 4M45A 1U2VA 1JLCA 1WBBA 1OH6A 4DQQA 2KTQA 4H8KA 1WSHA 4HUEA 2DFHA 5JS1A 1T6CA 4IFYA 2BGGA 3DLRA 4QS9A 3KLIA 3MK6A 3MCAB 3W0LA 3VGMA 4CGGA 3CCMN 1U6ZA 2ITGA 3QEVA 3ZETB 3KVGA 3CJ7A 2NNWA 1X9JA 2A41A 3KD5E 5FRMA 3L4QA 4IOAL 4MDAA 2ZJPL 3PSFA 2Y1IA 3VMFB 1WSEA 1RTJA 2VGMA 4IXCA 3KHYA 1KVCA 3I56N 3PV8A 1X1PA 3CERA 4DV1K 1GLDG 2ZM6K 5FPEA 1EKEA 3T7ZA 2Z1JA 4KRFA 2DTUA 1D9FA 1HMVA 2IOCA 4OPHA 3S3NA 3H6EA 1FK9A 4PWDA 2AJQA 3L2UA 4DV5K 3VF4A 3OY9A 4PA1A 3NE6A 2P9UA 3TTCA 4XH1A 2E2OA 4KV8A 3I8BA 4KREA 4A59A 3DLKA 1YTUA 2FBVA 1DKGD 1RT6A 4B9TA 1C0TA 3AVIA 1I39A 4DF4A 5IT9O 3CQYA 1NWKA 4B3MK 2HOEA 4JKGA 1RDWX 3LAMA 2XHBA 3H1QA 2IIRA 4CEOA 3G71N 4FM1A 3F2KA 4FJIA 1IKWA 1HNIA 1VSIA 4WQ5C 5DM6L 5I3UA 3V81A 4KHYA 5TKWA 3AA4A 4IO9L 3RSEA 1S3XA 4YY3K 3LDPA 4BVOA 4K42A 1C1BA 3KLEA 4CD1A 4MDBA 1G15A 3H45C 1SUQA 4DU1A 4DTSA 4IEIA 4DSLA 2HBMA 4BE1A 1QHTA 5BPNA 5CYQA 1TYQA 4O55A 4RW4A 2FBXA 4KKOA 3A8YA 4CIEA 1HNWK 2HHXA 3U3YA 2GTDA 3ZX3A 3OYFA 2OANA 4FVMA 3M8QA 3L2QA 1ASUA 4JI1K 1WSIA 2Q0UA 4LC9B 3DRSA 3ZT2A 2RKIA 3SCXA 4BC4A 2VG7A 1VQMN 3UKUB 1JLEA 1KAYA 4JI7K 1N36K 2IC3A 4PKIA 1J6ZA 3M5RA 1REVA 2VQEK 4KPYA 1A5VA 3AA5X 3MECA 4BRNA 4BRIA 3HSCA 4X65K 2GWJA 1IG9A 1NGEA 4B3RK 4CZGA 4YOWA 1XI1A 3RMBA 3VQ8A 4BREA 1RCHA 4CJFA 4J8FA 3T19A 3DWLA 1QS4A 4B1ZA 1KXPA 2JWKA 2GWKA 5AQQA 3HK2A 1XNQK 2BTFA 3I33A 3CCQN 1MU2A 3F9KA 1WNSA 4DR1K 1WLJA 4C8NA 1NU0A 4AHCA 4Z4IA 4PL8A 3QINA 5AQPA 5FROA 1EQYA 1DLOA 3VTHA 1IBKK 1S72N 1T3VA 2G8HA 1EETA 2E2NA 3N4QA 2JGUA 3VF2A 1LWFA 3A2FA 3SYZA 1RILA 4PQUA 5LJVA 4DSJA 1VSFA 4BRCA 3D7EO 2OYQA 4M3XA 3PLAA 4K8ZA 2IDOA 3KLHA 1Q9XA 3MMVA 3Q7CA 3G25A 1JLAA 4H5NA 1YXQA 4FWOA 3OYJA 3GOIA 1W2BM 3PO4A 1RT2A 4JRQA 2UXBK 1D8YA 1YI2N 5FPMA 2F96A 4E7KA 3TWHA 4DSKA 1SL2A 4DQRA 3TARA 5D3GA 4FPBA 1UA0A 5FRNA 1LW0A 3SMPA 1XC9A 1YAGA 5CE3A 3LP3A 3L2VA 3NGIA 5HRRA 4ILHA 5AQHA 3LP2A 1N6QA 3QEPA 1LAWA 2P9NA 3G6EN 1UWBA 2FF6A 3RMCA 4J2EA 1HQUA 3EE8A 2YNFA 2ASOA 3THVA 2O8DA 4JI6K 2HBJA 4CCHA 2YKNA 1NJIO 5AQWA 1SKWA 4GKKK 3MN7A 3VQ5A 3TAQA 3IKMA 1CXQA 2GEMA 3U3GA 2PZSA 2GV9A 3TAPA 5A2QO 4ISGA 2I7NA 2E4LA 3LDLA 3L3VA 3C7NA 3OBWA 2O8FA 3KWIA 5AQIA 4G9ZA 3QERA 1R0AA 4U67L 1NJWA 4LF6K 3THWB 2YJFA 3L8BA 2D0CA 1XC3A 5KTQA 1FKOA 2DPNA 5DK5A 5F0XA 2D1KA 1LCUA 4DU4A 5HP1A 5JLFA 3O1BA 4DV4K 3ZSVA 1SV5A 3S3MA 4XEIA 3QNNA 2VWKA 3ZSRA 4WYBA 2FBYA 4LH5A 1IO2A 1TL3A 4H5TA 4L8RB 1E4FT 3F9MA 3DOKA 5AZIB 2G8UA 5F2RA 1RDBA 4AILC 4LSLA 1DTTA 4JK9A 4OPAA 2P9IB 2IS3A 2P9IA 4DFPA 3H3NO 5JLHA 4DQSA 2W41A 3EE9A 3KK2A 2BDPA 2HVIA 2E1ZA 4DR4K 4GVEA 3FLCO 4CHZA 3BDPA 3EO3A 1Y64A 4A61A 1YF5L 1K8KA 3UB5A 5FLXO 2O8BA 1P90A 2YNHA 2KKZA 3DI6A 3LPUA 3TSUA 2CGKA 2NRVA 4KH4A 1GOAA 4CEZA 3H3OB 2VQFK 1ZXOA 3KK7A 4H0PA 4H0XB 1QE1A 3K9JA 4B8AB 2ZQBA 1BUPA 3U9DA 3BGRA 4M7YA 3FZHA 5EVZA 1LWCA 4AHTA 4W5QA 3IAYA 1V4TA 5M1QA 1JXEA 1BO5O 3LDNA 1NK5A 3CFRA 5AQNA 3S9HA 2HHUA 1NOZA 1HYSA 3BP8A 3CCEN 2FSJA 2QEXN 4CJ5A 4IWVA 3VQDA 2EWSA 3HVRA 2QW9A 5AQRA 4CJ4A 4DUYK 3AAPA 2VG6A 3CIPA 4FWNA 4IFVA 4JKGB 3CM5A 2AP1A 3OW2M 3AVJA 3THXB 2YX6A 3WXJA 1JLQA 3K57A 3SJJA 3QO9A 2QM1A 4FLXA 4MLHA 2J4RA 1U4BA 4PL7A 1J53A 4B1YB 4MLEA 3KK1A 3CG7A 1JLGA 3PY8A 1IKVA 4ILGB 3O4WA 1F21A 1BISA 4FWRA 2XO7A 3TAEA 1SQKA 4E89A 3B6OA 2OPQA 1O13A 3G0ZA 4YDUC 4DU3A 3ZETA 1QQMA 3ITHA 1ATNA 3C7NB 4JKBA 3T1AA 4CBWA 1VQ6N 1WB9A 3V9UA 1EP4A 2NLXA 4RW9A 1T05A 2ZJQL 1NK9A 5GADP 3E1YA 4W5NA 1GOCA 4F3OA 1BCOA 5TKYA 4BE2A 2ASMA 1RFQA 3LDQA 5J2MA 4CI6A 3SQ4A 4DCHA 5CR4A 3EN9A 3OS0A 2HB5A 1V4SA 4B1UB 4GKJK 3AARA 1IV0A 5T7BA 4BDYA 4CJRA 1ESVA 4LF4K 3SV3A 5GIOA 4AF1A 3TTFA 1VK0A 3VQQA 1OH8A 3JYTA 1VSDA 3V1QA 3ZSOA 3HOTA 1BQNA 1NGAA 3OYLA 1DT9A 4KH5A 3ATUA 1QZ5A 4ZHRA 4FZXC 2YV0X 5KRSA 3MXMA 4YHHK 3ID8A 3KKRA 2CGJA 4JD2A 4H4OA 1NJZA 4RG8A 2GUIA 4NXMK 3OJSA 1TK0A 4F9OA 3AVLA 5AQVA 2O8EA 1XWLA 3C6TA 1RDUA 3H46O 4H0TB 1S1VA 2Y1JA 3J7YP 1RDCA 2O8CA 5C15A 1JLFA 1JL1A 5BRFA 4JAXA 1RT7A 1NGDA 4CEAA 3J7ZO 2Q0RA 3MWTA 2FBTA 3BF3A 3HT3A 2YHAA 3DMJA 3P83D 4CJEA 4FPAA 1RBUA 4ELTA 5K14A 3NF8A 1S6QA 4AH9A 3MN5A 4CIGA 4GV9A 3A5OC 4OJRA 2R7YA 3SAFA 4KHPK 4ELVA 2A5XA 3NF6A 4GV6A 1VRUA 4A5BA 1MWKA 3MDQA 1NKEA 3C6AA 4E7IA 5BRHA 2W6KA 4JKCA 1EWQA 1XHXA 3CJ1A 1OVYA 1VQ7N 3CC2N 4CK3A 2E1YA 4ILJA 4PKHA 4BVPA 4KTQA 1TK8A 4RCHA 2WOMA 5BRDA 3MAQA 3BEXA 3SZ2A 2FF3B 1G99A 2CH5A 3DOLA 1TKDA 4M3WA 4CHNA 3HL8A 4M3TA 2PAVA 4BE0A 1XNRK 1SL0A 5SZTA 1A5WA 2QWMA 3EEQA 4JKHA 5FPNA 3CI5A 4FLYA 3JAMO 1VSHA 3V9XA 2UYTA 3D6RA 4C8OA 3R3LA 4O5BA 2HNDA 3AO4A 3ATVA 2ASPA 4XIUA 3CQ8A 4BWMA 3HSTB 1HLUA 3LANA 3MX2A 2ETJA 4N76A 3MCPA 3QFPA 1U48A 3KZBA 4DR5K 4R79A 3U6FA 4BGBA 3WXIA 1ATSA 3M8PA 3O9UA 1VQ5N 1Q7YO 4EIAA 4BR5A 3V9ZA 5M1FA 1O1WA 1VQPN 3GBTA 2WONA 1N33K 3CD6N 3AO5A 5MLCQ 3SI6A 3D2FA 2E88A 4CBUA 5AQOA 1NMDA 2O8BB 1NJXA 3NDKA 2V52B 1N8RO 2VWJA 4FXDA 4CFCA 1NGBA 4PUOA 4NYFA 2P51A 1KLMA 4CZIA 3PSIA 3R9PA 3J81O 3PUFA 4DFMA 3QNOA 1EXQA 2A6AA 2D0AA 2XY6A 3LM2A 4HTUA 1WBDA 3OYIA 2HHWA 3I55N 3R1XA 4O4GA 4NYNA 2P9LA 3LP1A 4BRLA 1FXXA 4EHTA 4CF0A 3ENBA 2WFBA 4BACA 4H5WA 4OKEA 4IFEA 4CJPA 3VETA 4E1NA 3R6MA 3CJ9A 4JN4A 3VQCA 4KHWA 4MQ3A 4E19A 3RTVA 1WAJA 3TR8A 1L3UA 4BRKA 4G1QA 4EHUA 3VQEA 3NH1A 4LF7K 3B8AX 4CGDA 5IWAK 2D5RA 5HOOA 2G8WA 1NJYA 1Z6RA 3LDSA 4JV5K 2NRTA 3JXUA 4J2AA 4FWMA 4CJLA 4CJ7A 1BQMA 1HPZA 3VEVA 4IOXA 3GG4A 3AO2A 1BGXT 1YVUA 3P5JA 3FZMA 4I6MB 4IZ9A 2DY4A 5AFUH 4CK1A 2Q97A 4R5PA 4CERA 1X9SA 2OZSA 1XHZA 3AVHA 4Z4EA 4Z4HA 4HTLA 4UQGA 2QKKA 3CCLN 4ISFA 5CY4A 3L6QA 3MXJA 4B9SA 5HBMA 3DLHA 3OS2A 3WXMB 3QEWA 4CJQA 2IVPA 4F4KA 4IG0A 4B3OA 4DS4A 4Z0UA 4DR7K 2Z1GA 3DYAA 2HHHK 5AQLA 3HXMA 4LF9K 4CZJA 3AVAA 4KB0A 4M42A 2F8TA 2XRIA 3J7AP 4EAHD 2YHXA 4JI8K 1L3TA 4JS5A 3ID6A 3WNFA 1RTIA 2KZMA 3CCRN 4BRQA 4JRPA 4EZ9A 3VA3A 2Q2RA 1JCEA 2E6LA 2Q31A 2OPSA 2OPPA 2KLAA 4JD2B 3SAHA 3ZSWA 1ATRA 3EZ5A 5F1XA 4Z4CA 1Q82O 4Y0WA 1QQCA 1VHXA 4CZLA 5AQFA 2QA4N 4DSFA 4ZTFA 4F8RA 5LMNK 4RW8A 5JICA 2XY7A 5HROA 4I7FA 3DJCA 1YITN 4BR2A 3O5BA 2G8IA 3HM9A 4B9QA 4N47A 1VQ4N 5HRSA 1MA9B 1QQNA 4NLCA 2Q36A 3EKSA 4FOIA 3M1FA 2ZF5O 2P1JA 1TYQB 3EL2A 2EX3A 1Q81O 1NK6A 4QS7A 1BA1A 4FJMA 1TKZA 3RMDA 1QVFM 3O8MA 4IEEA 4JYAK 4FLUA 4F2SA 5C42A 2X78A 1C1CA 3VGLA 3RR7A 2KHOA 5BN9A 2IVOA 3OBYA 4BROA 1BIZA 4KI4A 4FJHA 3MN9A 4V19S 4BRMA 3ZEUA 2KW4A 3AA2A 1M90O 3P1GA 5LY3A 5J2QA 2VYPA 3C95A 3VENA 1L3VA 1CXUA 4LSNA 4CJ3A 3NHGA 3DM2A 3NH2A 4I2PA 4OVLA 3CC7N 3ENOA 3N4PA 1BDGA 4CFBA 2A1RA 1UOCA 3DRPA 4OPJA 4BWJA 3QFUA 4FM2A 4IJNA 4B3TK 3NF7A 5GIPA 3WXKA 4OKKA 5E41A 4AHSA 1U2VB 4O8KA 2RPIA 3CM6A 3SAGA 4GW6A 4HHTA 4H4MA 5BREA 5C2FA 3PO5A 3ZT4A 4DV6K 1ITGA 1ZBHA 3LDOA 3THWA 3UIQA 1NGCA 1UAXA 5C2DA 4FJNA 4N56A 3OYDA 2QXFA 1YJWN 4CZMA 1Q9YA 2UU9K 2KFZA 3ZX0A 4JKAA 3SLCA 3VQAA 1R59O 3J80O 3BY5A 5B8HA 1S1UA 1VQNN 4WF9L 4UY8O 1RT5A 3C65A 2DFEA 5KPRA 3D0PA 2W6LA 2ZD1A 1T7PA 4F3TA 4FL9A 3VEOA 2FC0A 4FJ5A 3S41A 3HBTA 5EY4A 5M1NA 1JXBA 4CE9A 1S6PA 3IDHA 1C6VA 3DXKA 3OYAA 3A0IX 1TVRA 5LMUK 3CCVN 2RF2A 1UA1A 4CF8A 1DEJA 2HVHA 3V9SA 3QMLA 3TANA 3WEEA 4E7LA 1HNXK 3CF5L 4EFHA 3AV9A 1XMQK 1NGHA 4BDZA 3E9PA 4EP4A 3K5OA 3AVFA 1BHLA 4CF1A 1J9AA 1RT3A 4FJKA 1Z05A 2YI1A 1T03A 4CJUA 1FW6A 4CVNE 3RMAA 4XH4A 3HJFA 3ZCMA 4N41A 2Z1HA 4RW6A 2KFNA 4E7HA 3QBXA 2GBZA 3KD1E 4OKJA 4JI5K 2WBNA 2HMPA 4FZYA 3LWMA 1W9HA 4DTRA 4B9LA 4EZ6A 3NF9A 3CMAN 4B9UA 4JLHA 2OZMA 3UKRA 4CECA 3T3FA 5KQ8A 2FXUA 3PX4A 3EY1A 5BR8K 3O4NA 2HNZA 2F4VK 4J2DA 5AQJA 4M3YA 4CW7B 1KVBA 2H3GX 3SPYA 4DMNA 1I94K 3IFRA 3A5MC 1ZBLA 4DF8A 4CGJA 4J2BA 1DTQA 3CC4N 5JMVA 4BG9A 4FJGA 4DQPA 2QWQA 3SMSA 3RR8A 1QQOA 3D45A 1WSJA 1ZBSA 4ID1A 1ILYA 2Z1IA 2I7PA 4QOZB 4CFAA 5KGWA 4YDUA 3L2WA 1NGJA 1NK7A 1HX1A 4W5RA 4H0OA 4DV7K 4DLGA 3CQXA 3M6GA 1A5XA 1TUUA 3LALA 5GINA 4O0IA 4CD3A 3CCUN 1TKTA 4YORA 3AAQA 3M8RA 5M1OA 2HHTA 5AQKA 3OYHA 3ZSZA 4QAGA 1RTDA 3AVKA 2VWBA 4F2RA 4DTXA 4BC2A 4CK2A 2X6SA 4KO0A 3LZIA 1X9MA 4FWPA 4E3SA 4IJAA 3QBWA 4NB4A 1QSSA 4NLBA 4DV0K 2E5LK 4DTJA 3ZLJA 3CFOA 1RT4A 3ZX2A 5EX5A 4FK0A 5JVHL 4HWIA 3SV4A 2A42A 3WT0A 2O8CB 2IVNA 3HVTA 3OYBA 2A3ZA 4FZZA 4AM7A 2HF4A 5C24A 4E1JA 2HNYA 5GAHP 3VN5A 3VF6A 2O4GA 3OYKA 3O3FA 4CIFA 5AQMA 3MEEA 3L0QA 3VQPA 2QWNA 3DAWA 3FGUA 3GE1A 4AHUA 4HUFA 2F9TA 3UKRB 4CZEA 2P5OA 3QEXA 3MXIA 3CYMA 2JWLA 1VSJA 3NBPA 3MN6A 3FR0A 2WC9A 1J54A 4OLBA 2DFFA 5AQGA 3OYEA 2UXCK 4O0JA 3O08A 3P38A 4NO7A 1N5YA 3I8DA 3ZYYX 1X9WA 3FZFA 1RGIA 1T44A 4JS4A 1B92A 1CLQA 4KI6A 4GNIA 3THYA 3KWGA 3VQ9A 3AGKA 3LWLA 4CF2A 2HHSA 4NCBA 5AQZA 1QTMA 1IKXA 4FO0A 3HO1A 2CH6A 2P9KA 1HQEA 2BANA 2P9SB 4QS8A 1TUYA 3H08A 3LM9A 2OTLN 1BU6O 1BCMA 1XQSC 4IO8A 3LPTA 3AVMA 4BRAA 2CGLA 4A5AA 4FCYA 3SPZA 1WSFA 5DM7L 1HR0K 2X74A 3C6HA 2BUPA 3SUPA 1W7AA 3FFIA 2W40A 4JK8A 4KB1A 2FSKA 3HPOA 3H1VX 2HHVA 4I2QA 4WQ5A 5AQYA 2FLOA 5HL7L 3KJVA 2FSNA 1S22A 4B3SK 3KLGA 3UE5A 1KAZA 4B1VA 1ZBFA 1QHAA 3C94A 3JSMA 5LJWA 5JS2A 1NM1A 5CZ2A 5HRNA 3FZKA 1LWEA 4GMJB 4FLTA 1NMNA 2HMIA 4IOCL 3KTQA 1CZBA 5C12A 3P31A 2VG5A 4JI4K 1IH7A 4JKFA 1QSLA 3EZWA 2G8VA 3NMUA 1WAFA 2OA8A 4JHDA 4C1NK 3G4SN 1Q8IA 2YKMA 5AQXA 3V6DA 4RWTA 5E84A 1ASWA 3HZ6A 4DWIA 3IMXA 1NGFA 3NVKA 1K73O 1M1KO 3HPGA 4KHSA 2B4JA 3HP9A 2G8KA 2V51B 4JKDA 3VOVA 1NK8A 2QWLA 2G8FA 1IG8A 3AVCA 5EOYA 2NZTA 3QIOA 2E2QA 4OPKA 1KTQA 3CCSN 3HTVA 1RBTA 1ZC6A 3TSQA 3VA0A 3ASMA 1OKJA 1Y97A 3QICA 2EHGA 1IJJA 3IS9A 4QCLA 1S9EA 4A2BA 2HF3A 3O9SA 3DXMB 4DG1A 4K8XA 4WE1A 3WQUA 2UXDK 3L4IA 3U8XA 3B6PA 3QDKA 4BRPA 4KTZA 3O3HA 1WUAA 2GX9A 4AHVA 2YHBA 1YTAA 5ADXA 3HM8A 2HSTA 2P9SA 3NVMA 4DLEA 2OPRA 2OTJN 4B9NA 1VSEA 2HW3A 3WXLA 4XH5A 4M3UA 2QTDA 3CPEA 1YIJN 1KAXA 2OCEA 1QVGM 3T69A 4AQYK 4BG8A 3ZEUB 3W3DA 3TPQA 1XUPO 3O1WA 4DSEA 4BC3A 2QWOA 3HRGA 4BQZA 4RTFD 4CGIA 3M8SA 2Q1NA 3BZKA 1BA0A 1RBRA 4FWLA 3K2PA 4IKFA 3SBTA 3V4IA 4YFUA 5M1KA 2AA4A 1J5OA 1YVNA 3OJUA 3TU5A 1HUXA 3OTOK 1LAVA 4H5VA 2E6MA 4BRHA 3VEWA 3UKUA 2B5JA 4H03B 2D0PA 1JCFA 3ENHA 4FLVA 1VQON 1YUWA 4KHQA 2D0OA 2E2PA 2NRXA 1S1TA 3CPWM 1U47A 1HKBA 5CHIA 4E7JA 3D2FB 2BE2A 2YCHA 4O8UA 2VCPA 3LAKA 4FVUA 3D2EB 2Q3SA 3MX5A 1EWRA 2PBDA 4YOXA 1GLAG 4FYDA 4CJTA 3VTIA 4WQ4A 4LY7A 4CFDA 3FZLA 5AZIA 5HRPA 1GLEG 3CXCM 1YJ9N 1NNEA 3NGYA 3QLHA 1ZYQA 1W0HA 5AFUA 1NKBA 4E1MA 4FJJA 4CJKA 3VGKA 2P9LB 3CJBA 1SS6A 3TSPA 5JVGL 4Q5VA 3LP0A 5LL6Z 4NCAA 2PYLA 1VQ8N 4DSIA 4DKWA 1NK0A 1GLBG 1BIUA 5AQUA 4BR4A 5I9EB 4OX9K 1RTHA 2QKBA 3ZT1A 3VQ6A 4FWSA 4K41A 4NCGA 3U9ZA 3AGRA 4DV2K 4RW7A 5AJ3K 2KZZA 1RDDA 4AHRA 2XY5A 2LSNA 1NOYA 4KHNA 1BI4B 1VSMA 1B9FA 3TABA 4DHYA 3R8EA 3JS6A 3AVBA 4HCBA 3SK3A 1BOTO 4YOVA 1TAQA 3HI0A 1NBWA 4DS5A 2A40A 4GVMA 3CJAA 1RDAA 3KK3A 5I42A 3P39A 2W42A 4IG3A 4K43A 4CZHA 1E4GT 4MO5A 3E9LA 1LW2A 2PY5A 5AZJB 1L5UA 1MWMA 4K25A 3OVNA 4DR6K 5KRTA 4X66K 3VEYA 2RN2A 3SUQA 4H5RA 5ADXH 4HVJA 1K8AO 4B1XB 1BWFO 3O6WA 3O4QA 4DTMA 1E3MA 3WNGA 1OH7A 1TV6A 1P8ZA 1JCGA 2UUAK 1HNZK 1C0MA 4GY2B 3KIOA 5AQSA 1K6YA 3CMEN 1ASVA 1SL1A 4HCCA 5SWMA 5E26A 2F8SA 3T1YK 1HRHA 2YNGA 4FJ8A 4E0DA 2QI2A 4WCEL 1EX4A 3QIPA 1IBLK 4DV3K 2YHYA 4FJXA 2X6NA 2F7TA 3ULEB 3AVGA 3ULEA 4CGHA 2QK9A 1DGKN 4CF9A 1HKGA 4LD0A 5HLFA 4WFAL 1HKCA 1CZAN 3DRRA 5J2PA 1J5EK 2HBKA 5AQTA 3O9TA 3HPHA 1GLFO 4CGFA 1TGOA 3ZSYA 3IG1A 1GLJO 4JI3K 1VSKA 2UUBK 3CCJN 5KPZA 4O5FA 4HUGA 3OYCA 3VERA 1T8EA 4CJVA 4Z4GA 1RNHA 3TI0A 3K58A 3ZT3A 1HYVA 1NGIA 3AO3A 1B9DA 5C25A 1S1XA 3C6UA 4LFBK 1QZ6A 4B8CA 1MDUB 3E9OA 2ZE2A 3AY9A 3ZT0A 2QWRA 5EU7A 4C8LA 3P4IA 4JHDB 1KD1O 2RE2A 4M3ZA 1K8KB 2PFUA 2HBLA 1Z26A 3DXMA 3QETA 4OLAA 4JNEA 4Y1DA 3O3GA 1C0GA 4B08A 1KSPA 4ELUA 3BF1A 1JL2A 4M3RA 4KTWA 4DQIA 3BZCA 1T6DA 2O8DB 4Q0BA 1U04A 4CESA 1VSLA 4CHOA 1RBVA 2D4WA 4IDKA 3TAMA 3GDQA 1S5JA 3SQ1A 2XY8A 2NUBA 1KRPA 2P9KB 3PIOL 3MEDA 3OYMA 3GL1A 1HYZA 5GAEP 2YNIA 1XMOK 5BR9A 2NRHA 2QXLA 4BRGA 4DTNA 4L3QA 1WN7A 3PX6A 4GV3A 4NXNK 1VRTA 1RT1A 2GELA 2UUCK 4BRFA 3I0SA 1SZ2A 3SQ0A 1IBMK 4C1NI 3T1HK 3V9WA 4BY9C 3A5NC 3OYNA 1OH5A 3CETA 3F73A 2NRWA 3PX0A 2ZJRL 3AA3A 4W5TA 3L3UA 1BG3A 4FW2A 2V7ZA 4BQLA 4ISEA 3TAGA 4C8KA 4YOUA 3HOSA
chains in the Genus database with same CATH topology
1HQEA 1FXXA 3IRXA 3F9KA 4CF0A 1WNSA 2BANA 3NFAA 4BACA 1WLJA 4C8NA 1KLNA 3HYFA 4Z4IA 4AHCA 3H08A 4OKEA 4CJPA 3QINA 5FROA 4E1NA 1DLOA 1BCMA 1GOBA 3LPTA 2G8HA 1EETA 3VQCA 1L3SA 4KHWA 3AVMA 4MQ3A 4E19A 2JGUA 4N5SA 1LWFA 3RTVA 4FCYA 3DLBA 1WAJA 2D0BA 3A2FA 1RILA 3SYZA 3TR8A 1WSFA 3SPZA 1L3UA 4BDPA 4PQUA 4G1QA 3VQEA 1VSFA 3NH1A 4DSJA 2X74A 2OYQA 3SUPA 4M3XA 4C8MA 3FFIA 4CEFA 2IDOA 4CGDA 3KLHA 1Q9XA 4K8ZA 4KB1A 3NH0A 3HPOA 2D5RA 4DFJA 1JLAA 3OYJA 3PO4A 2G8WA 1NJYA 2PYJA 4FLZA 2HHVA 3LDSA 1RT2A 4I2QA 5FRNA 4CEQA 3E01A 4JRQA 1D8YA 4J2AA 4CJLA 5KGXA 3KJVA 2F96A 1BQMA 4PY5A 1HPZA 3KLGA 4E7KA 3AO2A 1ZBUA 1C1AA 1BGXT 3TWHA 4DSKA 1ZBFA 4DFKA 1YVUA 3C94A 3P5JA 3VQ7A 3JSMA 4DQRA 3TARA 1SL2A 4FJ9A 2DY4A 5JS2A 4CK1A 4R5PA 4FJLA 4CERA 5CZ2A 3ULDA 5HRNA 1X9SA 2OZSA 5D3GA 4Z4FA 1LWEA 1UA0A 4GMJB 1LW0A 4FLTA 1XHZA 3AVHA 4ID5A 1XC9A 4Z4EA 3LP3A 3L2VA 2HMIA 1RBSA 4FM0A 4Z4HA 4UQGA 3KTQA 5CZ1A 4CEBA 3NAEA 3NGIA 1CZBA 2QKKA 5HRRA 2VG5A 4TSXA 3LP2A 5CY4A 4FLWA 5FDLA 3MXJA 1N6QA 4B9SA 5HBMA 3QEPA 1IH7A 2B6AA 1LAWA 1QSLA 2G8VA 1UWBA 3DLHA 1QSYA 4LH4A 4CHQA 3OS2A 3OS1A 3QEWA 4CJQA 3RMCA 4J2EA 1HQUA 1WAFA 4F4KA 1NK4A 2OA8A 2YNFA 4IG0A 3V1OA 3THVA 4DS4A 4B3OA 1Q8IA 2YKMA 4Z0UA 4KFBA 3ZSXA 3V6DA 3SQ2A 2O4IA 2IGIA 4DTPA 1BI4A 2Z1GA 3DYAA 3KKSA 4CCHA 2YKNA 3AO1A 1SKWA 1ASWA 4DWIA 3VQBA 3HXMA 3VQ5A 3TAQA 3AVAA 3G10A 4KB0A 4M42A 2XRIA 1CXQA 2F8TA 4CEDA 3U3GA 3WNHA 3QESA 2PZSA 2GV9A 3TAPA 1IKYA 3HPGA 2E4LA 4FW1A 2B4JA 4CEEA 3HP9A 1L3TA 3L3VA 2G8KA 4KHSA 4I9QA 4JS5A 3WNFA 1NK8A 2G8FA 1RTIA 4CJWA 3AVCA 2KZMA 3K59A 3QERA 1R0AA 1NJWA 3QIOA 4JRPA 3MEGA 4EZ9A 2HHQA 3VA3A 4OPKA 1KTQA 3EYZA 3L8BA 2D0CA 3K5NA 5KTQA 2E6LA 1RBTA 4KAZA 1FKOA 2OPSA 1SKSA 2OPPA 5DK5A 3VA0A 3ALYA 1Z25A 3ASMA 3ISNC 1Y97A 4DU4A 5HP1A 1TL1A 3ZSWA 3L2RA 3ZSVA 3EZ5A 2EHGA 3IS9A 1SV5A 4Z4CA 3V1RA 3S3MA 1ZBIA 3QNNA 4QCLA 1S9EA 2VWKA 1QQCA 3LZJA 3CFPA 4DG1A 3ZSRA 3KLFA 4K8XA 5DMRA 4WE1A 2FBYA 4DSFA 3SUNA 3B6PA 1CZ9A 4LH5A 4ZTFA 4F8RA 1IO2A 1TL3A 4RW8A 2XY7A 3SNNA 4L8RB 5CYMA 4KTZA 3O3HA 4I7FA 4AHVA 5HROA 2YHBA 3DOKA 1YTAA 2G8UA 1I3AA 1RDBA 4DLEA 2OPRA 3S3OA 3OYGA 3HP6A 4AILC 1VSEA 4B9NA 2P5GA 4LSLA 4CJSA 1DTTA 2G8IA 2HW3A 2IS3A 3HM9A 4DFPA 4M3UA 4N47A 4DQSA 2IAJA 2BDPA 3KK2A 5J2NA 4B9VA 3K5MA 4M41A 5HRSA 1JKHA 2HVIA 2A1SA 1U45A 4FK4A 4CHZA 3BDPA 1TAUA 1BL3A 4DSEA 4KHUA 4Y1CA 4CHPA 3TAFA 2P1JA 2EX3A 4CGIA 3M8SA 1NKCA 2YNHA 3AVNA 3K5LA 1U49A 1NK6A 3RWUA 1S1WA 3DI6A 1KCFA 3LPUA 4ZTJA 4FJMA 1RBRA 1TKZA 4MFBA 3K2PA 3RMDA 4IKFA 3ZSQA 1GOAA 4CEZA 4FLUA 1D9DA 4F2SA 1QE1A 5C42A 4YFUA 2X78A 4B8AB 1C1CA 2ZQBA 3V4IA 1J5OA 3OJUA 4W5OA 1D5AA 3RR7A 3BGRA 1LAVA 4OGEA 3WNEA 4FJ7A 2E6MA 1KFDA 1LWCA 4AHTA 4W5QA 5KI6A 3IAYA 1BIZA 1JLBA 2JLEA 1JXEA 4FJHA 4KI4A 1SKRA 2B5JA 1LV5A 1NK5A 3CFRA 3S9HA 4FLVA 2HHUA 1NOZA 1HYSA 4KHQA 2KW4A 1S1TA 3AA2A 3P1GA 4CJ5A 2KQ2A 3VQDA 5J2QA 4ICLA 1U47A 3HVRA 1C0UA 4O44A 4E7JA 4FK2A 4CJ4A 2BE2A 3C95A 2I5JA 1L3VA 2VG6A 4I9LA 1CXUA 4LSNA 3LAKA 4CJ3A 3NHGA 4IFVA 2Q3SA 3CM5A 3DM2A 1HNVA 4I2PA 3NH2A 4OVLA 3AVJA 4FYDA 1KFSA 4CFBA 2A1RA 1UOCA 1JLQA 3DRPA 4CJTA 1TKXA 4OPJA 3NGZA 4BWJA 3K57A 3QO9A 4YNQA 4CHYA 3SJJA 4FLXA 4FM2A 4LY7A 4CFDA 3NF7A 5HRPA 1U4BA 4OKKA 1J53A 5E41A 4AHSA 4N41A 2RPIA 4OGCA 3CM6A 1S9GA 3NGYA 4DTUA 3KK1A 4GW6A 3CG7A 3QLHA 4H4MA 4HHTA 1ZYQA 1JLGA 1W0HA 1NKBA 3DLEA 3I0RA 4IBNA 4E1MA 5J1EA 3RRHA 3PO5A 3PY8A 4FJJA 1IKVA 3ZT4A 4CJKA 1ZBHA 1ITGA 1F21A 1BISA 2XO7A 3DLGA 3NCIA 3TAEA 4E89A 1HJRA 3UIQA 3B6OA 1TK5A 4Q5VA 2OPQA 1UAXA 3LP0A 1YT3A 4NCAA 4FJNA 3G0ZA 4DU3A 2PYLA 3RRGA 4DSIA 1NK0A 1BIUA 2ATQA 4N56A 3OYDA 2QXFA 1FKPA 3ITHA 1Q9YA 3T1AA 2KFZA 4B9MA 1RTHA 3VQAA 1EP4A 4RW9A 3V9UA 3SUOA 2QKBA 1S1UA 1T05A 3ZT1A 3VQ6A 4EP5A 4DTOA 1NK9A 1RT5A 4W5NA 2DFEA 1GOCA 1KVAA 1BCOA 4F3OA 4NCGA 3D0PA 4BE2A 5J2MA 3VQ4A 3QEIA 4RW7A 3SQ4A 1WSGA 2ZD1A 1T7PA 3OS0A 4F3TA 4M45A 4FJ5A 2FC0A 2KZZA 1JLCA 2HB5A 1RDDA 4AHRA 4DQQA 2XY5A 2KTQA 2LSNA 1NOYA 4H8KA 4KHNA 1WSHA 4HUEA 2DFHA 1BI4B 1JXBA 1B9FA 1VSMA 4CE9A 5JS1A 3TABA 4IFYA 1S6PA 1C6VA 3OYAA 3DLRA 2BGGA 1TVRA 5T7BA 4BDYA 2RF2A 4CJRA 1UA1A 3AVBA 4HCBA 4CF8A 2HVHA 3KLIA 3V9SA 3TANA 3SV3A 1TAQA 1VK0A 4CGGA 4E7LA 3VQQA 2ITGA 3AV9A 3QEVA 4DS5A 3JYTA 4BDZA 1VSDA 4EP4A 3V1QA 3K5OA 3AVFA 4GVMA 3ZSOA 1BHLA 4CF1A 1BQNA 3OYLA 3KD5E 1J9AA 1RT3A 4FJKA 5FRMA 1RDAA 3KK3A 5I42A 2W42A 4IG3A 4ZHRA 4FZXC 2Y1IA 1T03A 4CJUA 2YV0X 5KRSA 3MXMA 3KKRA 3RMAA 1LW2A 4H4OA 1NJZA 1WSEA 2PY5A 3HJFA 1RTJA 4RG8A 3ZCMA 2GUIA 2Z1HA 4RW6A 1L5UA 4E7HA 1TK0A 3OJSA 2GBZA 3KD1E 2KFNA 1KVCA 3AVLA 3OVNA 3PV8A 5KRTA 1XWLA 3C6TA 1X1PA 4OKJA 1S1VA 2RN2A 2Y1JA 3SUQA 4FZYA 1RDCA 4HVJA 3LWMA 1W9HA 4DTRA 4B9LA 1JLFA 1JL1A 4EZ6A 1EKEA 3NF9A 3O4QA 2Z1JA 1RT7A 4DTMA 3WNGA 4B9UA 4KRFA 1TV6A 4JLHA 4CEAA 2DTUA 1D9FA 1C0MA 1HMVA 2IOCA 3KIOA 3S3NA 2OZMA 4CECA 3T3FA 1FK9A 3PX4A 4PWDA 1K6YA 3L2UA 3EY1A 2AJQA 1ASVA 2FBTA 3O4NA 1SL1A 2HNZA 5SWMA 4HCCA 4J2DA 2F8SA 3HT3A 4M3YA 2YHAA 1HRHA 2YNGA 3DMJA 3P83D 4CJEA 3OY9A 1KVBA 3SPYA 4E0DA 4FJ8A 1EX4A 1RBUA 3QIPA 4PA1A 4DMNA 1ZBLA 3NE6A 4DF8A 4ELTA 4FJXA 2X6NA 4KV8A 3NF8A 1S6QA 5K14A 4AH9A 4CIGA 4KREA 4CGJA 3AVGA 4CGHA 4J2BA 3DLKA 1YTUA 2QK9A 2FBVA 1DTQA 1RT6A 4CF9A 4B9TA 4FJGA 4OJRA 4LD0A 2R7YA 4DQPA 1C0TA 3RR8A 5HLFA 3AVIA 3D45A 4ID1A 1WSJA 1I39A 2Z1IA 4QOZB 3DRRA 5KGWA 3NF6A 4CFAA 5J2PA 1VRUA 4DF4A 4ELVA 3L2WA 1NK7A 3HPHA 4W5RA 3LAMA 1TGOA 4CGFA 3ZSYA 2XHBA 4DLGA 4CEOA 3IG1A 4FM1A 1NKEA 1VSKA 4E7IA 4FJIA 1IKWA 1A5XA 3LALA 1HNIA 1VSIA 4O0IA 1XHXA 1TKTA 3V81A 5I3UA 4HUGA 4KHYA 3M8RA 4CK3A 3AA4A 3OYCA 2HHTA 4KTQA 1T8EA 4CJVA 1TK8A 4Z4GA 3OYHA 1RNHA 2WOMA 3ZSZA 4QAGA 3K58A 3ZT3A 1HYVA 3AVKA 3MAQA 3SZ2A 3AO3A 3TI0A 1RTDA 3DOLA 1TKDA 1B9DA 1C1BA 4F2RA 4DTXA 3KLEA 5C25A 4M3WA 1S1XA 3C6UA 1G15A 4CHNA 4CK2A 3HL8A 4M3TA 2X6SA 4B8CA 4BE0A 2ZE2A 4KO0A 3LZIA 1SUQA 1X9MA 5SZTA 4E3SA 1SL0A 4DU1A 1A5WA 4DTSA 4DSLA 3ZT0A 1QSSA 5EU7A 4DTJA 4C8LA 3CFOA 1RT4A 4FLYA 4FK0A 4BE1A 1VSHA 1QHTA 3V9XA 3SV4A 4M3ZA 5CYQA 4O55A 4RW4A 2FBXA 4KKOA 4CIEA 4C8OA 2HHXA 1Z26A 3U3YA 3QETA 3HVTA 4OLAA 3OYFA 4O5BA 4Y1DA 4FVMA 3OYBA 3M8QA 3O3GA 3L2QA 4FZZA 2HNDA 3AO4A 4B08A 1ASUA 1KSPA 4XIUA 4ELUA 3CQ8A 1WSIA 3HSTB 4BWMA 5C24A 3LANA 2HNYA 1JL2A 4M3RA 3DRSA 4KTWA 2RKIA 3ZT2A 4DQIA 3SCXA 4Q0BA 3VN5A 2ETJA 1U04A 4CESA 1VSLA 2O4GA 3OYKA 1U48A 4N76A 2VG7A 4CHOA 3U6FA 1RBVA 3O3FA 4IDKA 3TAMA 1JLEA 4CIFA 3M8PA 3MEEA 3VQPA 1S5JA 2IC3A 3V9ZA 1O1WA 2XY8A 2NUBA 3SQ1A 1KRPA 2WONA 4AHUA 1REVA 3AO5A 4HUFA 3MEDA 3OYMA 2P5OA 3QEXA 1HYZA 3SI6A 2YNIA 3CYMA 3MXIA 4KPYA 1VSJA 3NBPA 1A5VA 3AA5X 3MECA 4DTNA 4OLBA 1J54A 1NJXA 1WN7A 3PX6A 3NDKA 2DFFA 1VRTA 3OYEA 1RT1A 2VWJA 1IG9A 4FXDA 4O0JA 3I0SA 3SQ0A 4CFCA 1N5YA 3I8DA 3V9WA 1XI1A 4PUOA 4NYFA 3OYNA 3VQ8A 3RMBA 2P51A 4JS4A 1X9WA 1KLMA 3F73A 1RCHA 4CJFA 3PX0A 1B92A 3T19A 1CLQA 4KI6A 3PUFA 1QS4A 4DFMA 3AA3A 3QNOA 1EXQA 4W5TA 3VQ9A 2D0AA 2XY6A 4HTUA 3L3UA 4FW2A 3OYIA 3LWLA 3HK2A 2HHWA 4CF2A 3TAGA 4C8KA 4O4GA 2HHSA 4NCBA 4NYNA 1IKXA 1MU2A 1QTMA 3HO1A 3LP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQE A;  1FXX A;  3IRX A;  3F9K A;  4CF0 A;  1WNS A;  2BAN A;  3NFA A;  4BAC A;  1WLJ A;  4C8N A;  1KLN A;  3HYF A;  4Z4I A;  4AHC A;  3H08 A;  4OKE A;  4CJP A;  3QIN A;  5FRO A;  4E1N A;  1DLO A;  1BCM A;  1GOB A;  3LPT A;  2G8H A;  1EET A;  3VQC A;  1L3S A;  4KHW A;  3AVM A;  4MQ3 A;  4E19 A;  2JGU A;  4N5S A;  1LWF A;  3RTV A;  4FCY A;  3DLB A;  1WAJ A;  2D0B A;  3A2F A;  1RIL A;  3SYZ A;  3TR8 A;  1WSF A;  3SPZ A;  1L3U A;  4BDP A;  4PQU A;  4G1Q A;  3VQE A;  1VSF A;  3NH1 A;  4DSJ A;  2X74 A;  2OYQ A;  3SUP A;  4M3X A;  4C8M A;  3FFI A;  4CEF A;  2IDO A;  4CGD A;  3KLH A;  1Q9X A;  4K8Z A;  4KB1 A;  3NH0 A;  3HPO A;  2D5R A;  4DFJ A;  1JLA A;  3OYJ A;  3PO4 A;  2G8W A;  1NJY A;  2PYJ A;  4FLZ A;  2HHV A;  3LDS A;  1RT2 A;  4I2Q A;  5FRN A;  4CEQ A;  3E01 A;  4JRQ A;  1D8Y A;  4J2A A;  4CJL A;  5KGX A;  3KJV A;  2F96 A;  1BQM A;  4PY5 A;  1HPZ A;  3KLG A;  4E7K A;  3AO2 A;  1ZBU A;  1C1A A;  1BGX T;  3TWH A;  4DSK A;  1ZBF A;  4DFK A;  1YVU A;  3C94 A;  3P5J A;  3VQ7 A;  3JSM A;  4DQR A;  3TAR A;  1SL2 A;  4FJ9 A;  2DY4 A;  5JS2 A;  4CK1 A;  4R5P A;  4FJL A;  4CER A;  5CZ2 A;  3ULD A;  5HRN A;  1X9S A;  2OZS A;  5D3G A;  4Z4F A;  1LWE A;  1UA0 A;  4GMJ B;  1LW0 A;  4FLT A;  1XHZ A;  3AVH A;  4ID5 A;  1XC9 A;  4Z4E A;  3LP3 A;  3L2V A;  2HMI A;  1RBS A;  4FM0 A;  4Z4H A;  4UQG A;  3KTQ A;  5CZ1 A;  4CEB A;  3NAE A;  3NGI A;  1CZB A;  2QKK A;  5HRR A;  2VG5 A;  4TSX A;  3LP2 A;  5CY4 A;  4FLW A;  5FDL A;  3MXJ A;  1N6Q A;  4B9S A;  5HBM A;  3QEP A;  1IH7 A;  2B6A A;  1LAW A;  1QSL A;  2G8V A;  1UWB A;  3DLH A;  1QSY A;  4LH4 A;  4CHQ A;  3OS2 A;  3OS1 A;  3QEW A;  4CJQ A;  3RMC A;  4J2E A;  1HQU A;  1WAF A;  4F4K A;  1NK4 A;  2OA8 A;  2YNF A;  4IG0 A;  3V1O A;  3THV A;  4DS4 A;  4B3O A;  1Q8I A;  2YKM A;  4Z0U A;  4KFB A;  3ZSX A;  3V6D A;  3SQ2 A;  2O4I A;  2IGI A;  4DTP A;  1BI4 A;  2Z1G A;  3DYA A;  3KKS A;  4CCH A;  2YKN A;  3AO1 A;  1SKW A;  1ASW A;  4DWI A;  3VQB A;  3HXM A;  3VQ5 A;  3TAQ A;  3AVA A;  3G10 A;  4KB0 A;  4M42 A;  2XRI A;  1CXQ A;  2F8T A;  4CED A;  3U3G A;  3WNH A;  3QES A;  2PZS A;  2GV9 A;  3TAP A;  1IKY A;  3HPG A;  2E4L A;  4FW1 A;  2B4J A;  4CEE A;  3HP9 A;  1L3T A;  3L3V A;  2G8K A;  4KHS A;  4I9Q A;  4JS5 A;  3WNF A;  1NK8 A;  2G8F A;  1RTI A;  4CJW A;  3AVC A;  2KZM A;  3K59 A;  3QER A;  1R0A A;  1NJW A;  3QIO A;  4JRP A;  3MEG A;  4EZ9 A;  2HHQ A;  3VA3 A;  4OPK A;  1KTQ A;  3EYZ A;  3L8B A;  2D0C A;  3K5N A;  5KTQ A;  2E6L A;  1RBT A;  4KAZ A;  1FKO A;  2OPS A;  1SKS A;  2OPP A;  5DK5 A;  3VA0 A;  3ALY A;  1Z25 A;  3ASM A;  3ISN C;  1Y97 A;  4DU4 A;  5HP1 A;  1TL1 A;  3ZSW A;  3L2R A;  3ZSV A;  3EZ5 A;  2EHG A;  3IS9 A;  1SV5 A;  4Z4C A;  3V1R A;  3S3M A;  1ZBI A;  3QNN A;  4QCL A;  1S9E A;  2VWK A;  1QQC A;  3LZJ A;  3CFP A;  4DG1 A;  3ZSR A;  3KLF A;  4K8X A;  5DMR A;  4WE1 A;  2FBY A;  4DSF A;  3SUN A;  3B6P A;  1CZ9 A;  4LH5 A;  4ZTF A;  4F8R A;  1IO2 A;  1TL3 A;  4RW8 A;  2XY7 A;  3SNN A;  4L8R B;  5CYM A;  4KTZ A;  3O3H A;  4I7F A;  4AHV A;  5HRO A;  2YHB A;  3DOK A;  1YTA A;  2G8U A;  1I3A A;  1RDB A;  4DLE A;  2OPR A;  3S3O A;  3OYG A;  3HP6 A;  4AIL C;  1VSE A;  4B9N A;  2P5G A;  4LSL A;  4CJS A;  1DTT A;  2G8I A;  2HW3 A;  2IS3 A;  3HM9 A;  4DFP A;  4M3U A;  4N47 A;  4DQS A;  2IAJ A;  2BDP A;  3KK2 A;  5J2N A;  4B9V A;  3K5M A;  4M41 A;  5HRS A;  1JKH A;  2HVI A;  2A1S A;  1U45 A;  4FK4 A;  4CHZ A;  3BDP A;  1TAU A;  1BL3 A;  4DSE A;  4KHU A;  4Y1C A;  4CHP A;  3TAF A;  2P1J A;  2EX3 A;  4CGI A;  3M8S A;  1NKC A;  2YNH A;  3AVN A;  3K5L A;  1U49 A;  1NK6 A;  3RWU A;  1S1W A;  3DI6 A;  1KCF A;  3LPU A;  4ZTJ A;  4FJM A;  1RBR A;  1TKZ A;  4MFB A;  3K2P A;  3RMD A;  4IKF A;  3ZSQ A;  1GOA A;  4CEZ A;  4FLU A;  1D9D A;  4F2S A;  1QE1 A;  5C42 A;  4YFU A;  2X78 A;  4B8A B;  1C1C A;  2ZQB A;  3V4I A;  1J5O A;  3OJU A;  4W5O A;  1D5A A;  3RR7 A;  3BGR A;  1LAV A;  4OGE A;  3WNE A;  4FJ7 A;  2E6M A;  1KFD A;  1LWC A;  4AHT A;  4W5Q A;  5KI6 A;  3IAY A;  1BIZ A;  1JLB A;  2JLE A;  1JXE A;  4FJH A;  4KI4 A;  1SKR A;  2B5J A;  1LV5 A;  1NK5 A;  3CFR A;  3S9H A;  4FLV A;  2HHU A;  1NOZ A;  1HYS A;  4KHQ A;  2KW4 A;  1S1T A;  3AA2 A;  3P1G A;  4CJ5 A;  2KQ2 A;  3VQD A;  5J2Q A;  4ICL A;  1U47 A;  3HVR A;  1C0U A;  4O44 A;  4E7J A;  4FK2 A;  4CJ4 A;  2BE2 A;  3C95 A;  2I5J A;  1L3V A;  2VG6 A;  4I9L A;  1CXU A;  4LSN A;  3LAK A;  4CJ3 A;  3NHG A;  4IFV A;  2Q3S A;  3CM5 A;  3DM2 A;  1HNV A;  4I2P A;  3NH2 A;  4OVL A;  3AVJ A;  4FYD A;  1KFS A;  4CFB A;  2A1R A;  1UOC A;  1JLQ A;  3DRP A;  4CJT A;  1TKX A;  4OPJ A;  3NGZ A;  4BWJ A;  3K57 A;  3QO9 A;  4YNQ A;  4CHY A;  3SJJ A;  4FLX A;  4FM2 A;  4LY7 A;  4CFD A;  3NF7 A;  5HRP A;  1U4B A;  4OKK A;  1J53 A;  5E41 A;  4AHS A;  4N41 A;  2RPI A;  4OGC A;  3CM6 A;  1S9G A;  3NGY A;  4DTU A;  3KK1 A;  4GW6 A;  3CG7 A;  3QLH A;  4H4M A;  4HHT A;  1ZYQ A;  1JLG A;  1W0H A;  1NKB A;  3DLE A;  3I0R A;  4IBN A;  4E1M A;  5J1E A;  3RRH A;  3PO5 A;  3PY8 A;  4FJJ A;  1IKV A;  3ZT4 A;  4CJK A;  1ZBH A;  1ITG A;  1F21 A;  1BIS A;  2XO7 A;  3DLG A;  3NCI A;  3TAE A;  4E89 A;  1HJR A;  3UIQ A;  3B6O A;  1TK5 A;  4Q5V A;  2OPQ A;  1UAX A;  3LP0 A;  1YT3 A;  4NCA A;  4FJN A;  3G0Z A;  4DU3 A;  2PYL A;  3RRG A;  4DSI A;  1NK0 A;  1BIU A;  2ATQ A;  4N56 A;  3OYD A;  2QXF A;  1FKP A;  3ITH A;  1Q9Y A;  3T1A A;  2KFZ A;  4B9M A;  1RTH A;  3VQA A;  1EP4 A;  4RW9 A;  3V9U A;  3SUO A;  2QKB A;  1S1U A;  1T05 A;  3ZT1 A;  3VQ6 A;  4EP5 A;  4DTO A;  1NK9 A;  1RT5 A;  4W5N A;  2DFE A;  1GOC A;  1KVA A;  1BCO A;  4F3O A;  4NCG A;  3D0P A;  4BE2 A;  5J2M A;  3VQ4 A;  3QEI A;  4RW7 A;  3SQ4 A;  1WSG A;  2ZD1 A;  1T7P A;  3OS0 A;  4F3T A;  4M45 A;  4FJ5 A;  2FC0 A;  2KZZ A;  1JLC A;  2HB5 A;  1RDD A;  4AHR A;  4DQQ A;  2XY5 A;  2KTQ A;  2LSN A;  1NOY A;  4H8K A;  4KHN A;  1WSH A;  4HUE A;  2DFH A;  1BI4 B;  1JXB A;  1B9F A;  1VSM A;  4CE9 A;  5JS1 A;  3TAB A;  4IFY A;  1S6P A;  1C6V A;  3OYA A;  3DLR A;  2BGG A;  1TVR A;  5T7B A;  4BDY A;  2RF2 A;  4CJR A;  1UA1 A;  3AVB A;  4HCB A;  4CF8 A;  2HVH A;  3KLI A;  3V9S A;  3TAN A;  3SV3 A;  1TAQ A;  1VK0 A;  4CGG A;  4E7L A;  3VQQ A;  2ITG A;  3AV9 A;  3QEV A;  4DS5 A;  3JYT A;  4BDZ A;  1VSD A;  4EP4 A;  3V1Q A;  3K5O A;  3AVF A;  4GVM A;  3ZSO A;  1BHL A;  4CF1 A;  1BQN A;  3OYL A;  3KD5 E;  1J9A A;  1RT3 A;  4FJK A;  5FRM A;  1RDA A;  3KK3 A;  5I42 A;  2W42 A;  4IG3 A;  4ZHR A;  4FZX C;  2Y1I A;  1T03 A;  4CJU A;  2YV0 X;  5KRS A;  3MXM A;  3KKR A;  3RMA A;  1LW2 A;  4H4O A;  1NJZ A;  1WSE A;  2PY5 A;  3HJF A;  1RTJ A;  4RG8 A;  3ZCM A;  2GUI A;  2Z1H A;  4RW6 A;  1L5U A;  4E7H A;  1TK0 A;  3OJS A;  2GBZ A;  3KD1 E;  2KFN A;  1KVC A;  3AVL A;  3OVN A;  3PV8 A;  5KRT A;  1XWL A;  3C6T A;  1X1P A;  4OKJ A;  1S1V A;  2RN2 A;  2Y1J A;  3SUQ A;  4FZY A;  1RDC A;  4HVJ A;  3LWM A;  1W9H A;  4DTR A;  4B9L A;  1JLF A;  1JL1 A;  4EZ6 A;  1EKE A;  3NF9 A;  3O4Q A;  2Z1J A;  1RT7 A;  4DTM A;  3WNG A;  4B9U A;  4KRF A;  1TV6 A;  4JLH A;  4CEA A;  2DTU A;  1D9F A;  1C0M A;  1HMV A;  2IOC A;  3KIO A;  3S3N A;  2OZM A;  4CEC A;  3T3F A;  1FK9 A;  3PX4 A;  4PWD A;  1K6Y A;  3L2U A;  3EY1 A;  2AJQ A;  1ASV A;  2FBT A;  3O4N A;  1SL1 A;  2HNZ A;  5SWM A;  4HCC A;  4J2D A;  2F8S A;  3HT3 A;  4M3Y A;  2YHA A;  1HRH A;  2YNG A;  3DMJ A;  3P83 D;  4CJE A;  3OY9 A;  1KVB A;  3SPY A;  4E0D A;  4FJ8 A;  1EX4 A;  1RBU A;  3QIP A;  4PA1 A;  4DMN A;  1ZBL A;  3NE6 A;  4DF8 A;  4ELT A;  4FJX A;  2X6N A;  4KV8 A;  3NF8 A;  1S6Q A;  5K14 A;  4AH9 A;  4CIG A;  4KRE A;  4CGJ A;  3AVG A;  4CGH A;  4J2B A;  3DLK A;  1YTU A;  2QK9 A;  2FBV A;  1DTQ A;  1RT6 A;  4CF9 A;  4B9T A;  4FJG A;  4OJR A;  4LD0 A;  2R7Y A;  4DQP A;  1C0T A;  3RR8 A;  5HLF A;  3AVI A;  3D45 A;  4ID1 A;  1WSJ A;  1I39 A;  2Z1I A;  4QOZ B;  3DRR A;  5KGW A;  3NF6 A;  4CFA A;  5J2P A;  1VRU A;  4DF4 A;  4ELV A;  3L2W A;  1NK7 A;  3HPH A;  4W5R A;  3LAM A;  1TGO A;  4CGF A;  3ZSY A;  2XHB A;  4DLG A;  4CEO A;  3IG1 A;  4FM1 A;  1NKE A;  1VSK A;  4E7I A;  4FJI A;  1IKW A;  1A5X A;  3LAL A;  1HNI A;  1VSI A;  4O0I A;  1XHX A;  1TKT A;  3V81 A;  5I3U A;  4HUG A;  4KHY A;  3M8R A;  4CK3 A;  3AA4 A;  3OYC A;  2HHT A;  4KTQ A;  1T8E A;  4CJV A;  1TK8 A;  4Z4G A;  3OYH A;  1RNH A;  2WOM A;  3ZSZ A;  4QAG A;  3K58 A;  3ZT3 A;  1HYV A;  3AVK A;  3MAQ A;  3SZ2 A;  3AO3 A;  3TI0 A;  1RTD A;  3DOL A;  1TKD A;  1B9D A;  1C1B A;  4F2R A;  4DTX A;  3KLE A;  5C25 A;  4M3W A;  1S1X A;  3C6U A;  1G15 A;  4CHN A;  4CK2 A;  3HL8 A;  4M3T A;  2X6S A;  4B8C A;  4BE0 A;  2ZE2 A;  4KO0 A;  3LZI A;  1SUQ A;  1X9M A;  5SZT A;  4E3S A;  1SL0 A;  4DU1 A;  1A5W A;  4DTS A;  4DSL A;  3ZT0 A;  1QSS A;  5EU7 A;  4DTJ A;  4C8L A;  3CFO A;  1RT4 A;  4FLY A;  4FK0 A;  4BE1 A;  1VSH A;  1QHT A;  3V9X A;  3SV4 A;  4M3Z A;  5CYQ A;  4O55 A;  4RW4 A;  2FBX A;  4KKO A;  4CIE A;  4C8O A;  2HHX A;  1Z26 A;  3U3Y A;  3QET A;  3HVT A;  4OLA A;  3OYF A;  4O5B A;  4Y1D A;  4FVM A;  3OYB A;  3M8Q A;  3O3G A;  3L2Q A;  4FZZ A;  2HND A;  3AO4 A;  4B08 A;  1ASU A;  1KSP A;  4XIU A;  4ELU A;  3CQ8 A;  1WSI A;  3HST B;  4BWM A;  5C24 A;  3LAN A;  2HNY A;  1JL2 A;  4M3R A;  3DRS A;  4KTW A;  2RKI A;  3ZT2 A;  4DQI A;  3SCX A;  4Q0B A;  3VN5 A;  2ETJ A;  1U04 A;  4CES A;  1VSL A;  2O4G A;  3OYK A;  1U48 A;  4N76 A;  2VG7 A;  4CHO A;  3U6F A;  1RBV A;  3O3F A;  4IDK A;  3TAM A;  1JLE A;  4CIF A;  3M8P A;  3MEE A;  3VQP A;  1S5J A;  2IC3 A;  3V9Z A;  1O1W A;  2XY8 A;  2NUB A;  3SQ1 A;  1KRP A;  2WON A;  4AHU A;  1REV A;  3AO5 A;  4HUF A;  3MED A;  3OYM A;  2P5O A;  3QEX A;  1HYZ A;  3SI6 A;  2YNI A;  3CYM A;  3MXI A;  4KPY A;  1VSJ A;  3NBP A;  1A5V A;  3AA5 X;  3MEC A;  4DTN A;  4OLB A;  1J54 A;  1NJX A;  1WN7 A;  3PX6 A;  3NDK A;  2DFF A;  1VRT A;  3OYE A;  1RT1 A;  2VWJ A;  1IG9 A;  4FXD A;  4O0J A;  3I0S A;  3SQ0 A;  4CFC A;  1N5Y A;  3I8D A;  3V9W A;  1XI1 A;  4PUO A;  4NYF A;  3OYN A;  3VQ8 A;  3RMB A;  2P51 A;  4JS4 A;  1X9W A;  1KLM A;  3F73 A;  1RCH A;  4CJF A;  3PX0 A;  1B92 A;  3T19 A;  1CLQ A;  4KI6 A;  3PUF A;  1QS4 A;  4DFM A;  3AA3 A;  3QNO A;  1EXQ A;  4W5T A;  3VQ9 A;  2D0A A;  2XY6 A;  4HTU A;  3L3U A;  4FW2 A;  3OYI A;  3LWL A;  3HK2 A;  2HHW A;  4CF2 A;  3TAG A;  4C8K A;  4O4G A;  2HHS A;  4NCB A;  4NYN A;  1IKX A;  1MU2 A;  1QTM A;  3HO1 A;  3LP1 A; 
#chains in the Genus database with same CATH topology
 3CHW A;  3IRX A;  4A62 A;  3NFA A;  1GLL O;  1D4X A;  4CBX A;  1KLN A;  3HYF A;  3OHR A;  1GOB A;  1L3S A;  4DB3 A;  4N5S A;  3LL3 A;  4WFN L;  1KC8 O;  3VEZ A;  3DLB A;  2D0B A;  2WTU A;  4BR0 A;  4BDP A;  4PHT X;  3DLL L;  4C8M A;  4CEF A;  5GAG P;  5C10 A;  3NH0 A;  3TTD A;  4DFJ A;  2PYJ A;  2E8A A;  4WQ4 C;  5KQD A;  4FLZ A;  2E20 A;  2P9P B;  3FFK B;  4FWK A;  4CEQ A;  3E01 A;  4DQ8 A;  1JJ2 M;  4JI2 K;  2P9P A;  5KGX A;  3C0B A;  3DXK B;  4KH6 A;  4PY5 A;  1ZBU A;  4CZK A;  1C1A A;  4DFK A;  3VQ7 A;  4FJ9 A;  5H1S Q;  4FJL A;  3QB0 A;  4YOY A;  3ULD A;  2YJE A;  4PKG A;  3RSE B;  4Z4F A;  1N32 K;  4MO4 A;  4ID5 A;  1RBS A;  4FM0 A;  5CZ1 A;  4CEB A;  2WUS A;  3NAE A;  3O80 A;  4TSX A;  4FLW A;  2ZGZ A;  3BUZ B;  5FDL A;  2P9N B;  2B6A A;  4B1W B;  1QSY A;  4LH4 A;  4CHQ A;  3OS1 A;  4U7B A;  1YHQ N;  1NK4 A;  3V1O A;  4H0V B;  4KFB A;  3ZSX A;  3SQ2 A;  2O4I A;  2O8E B;  2IGI A;  4DTP A;  1BI4 A;  1OVQ A;  3KKS A;  3AO1 A;  1HPM A;  3VQB A;  4BC5 A;  1Q18 A;  3G10 A;  3VES A;  4CED A;  4KBO A;  1FJG K;  3QES A;  3WNH A;  2ZGY A;  4I6M A;  1SAZ A;  1IKY A;  4FW1 A;  2YHW A;  4CEE A;  4I9Q A;  1NGG A;  3VPZ A;  2RHK A;  5C0Y A;  2O8F B;  4CJW A;  3K59 A;  5KPT A;  3MEG A;  2HHQ A;  3EYZ A;  3SJH A;  3THX A;  3K5N A;  3WUH A;  4X64 K;  4KAZ A;  1SKS A;  4JEP A;  3ALY A;  1Z25 A;  3ISN C;  4DR3 K;  1TL1 A;  3L2R A;  4H0Y B;  3THY B;  3V1R A;  4A57 A;  1ZBI A;  4X62 K;  4DUZ K;  3WQT A;  3LZJ A;  3CFP A;  3KLF A;  5DMR A;  3A5L C;  4FOE A;  3SUN A;  4LF8 K;  2NRZ A;  1CZ9 A;  1H1V A;  5M1P A;  1NG9 A;  3SNN A;  5CYM A;  4FSV A;  4YOT A;  4OO1 J;  1I3A A;  3K9K A;  1WOQ A;  3S3O A;  2BH1 A;  3OYG A;  3HP6 A;  2P5G A;  1X3N A;  4CJS A;  4K0K K;  4FWQ A;  4BR9 A;  3MWP A;  2IAJ A;  3PIP L;  2GUP A;  5J2N A;  1KQS M;  4B9V A;  3FE1 A;  3K5M A;  4M63 C;  5ELZ A;  1JKH A;  4M41 A;  3CJC A;  3E66 A;  4AM6 A;  2A1S A;  3J8A A;  1U45 A;  4FK4 A;  3RVC A;  1TAU A;  1VAZ A;  1BL3 A;  1HJO A;  4KHU A;  4Y1C A;  4CHP A;  5EXW A;  3TAF A;  4LFA K;  5AR0 A;  1NKC A;  3AVN A;  4IDH A;  3K5L A;  1U49 A;  3RWU A;  1S1W A;  1KCF A;  4ZTJ A;  1VQK N;  4MFB A;  3F5T A;  3ZSQ A;  1D9D A;  2QWP A;  3VEX A;  1VQ9 N;  4C23 A;  4W5O A;  1D5A A;  5BPL A;  4BR7 A;  4OGE A;  3WNE A;  4FJ7 A;  3K0S A;  1KFD A;  1K9M O;  5KI6 A;  2F9W A;  1JLB A;  2JLE A;  4JK7 A;  2ZWH A;  1SKR A;  2P9U B;  1LV5 A;  1YJN N;  5FPD A;  3O9Q A;  3SBG A;  4LFC K;  2KQ2 A;  4ICL A;  4BRD A;  2NRR A;  1C0U A;  4O44 A;  4FK2 A;  1VQL N;  2I5J A;  4I9L A;  1C0F A;  3O9R A;  2VGN A;  1HNV A;  4Z94 A;  3D2E A;  1KFS A;  4CZF A;  3Q7B A;  1TKX A;  3NGZ A;  4YNQ A;  4CHY A;  4BGA A;  2V7Y A;  1Q86 O;  4JI0 K;  1N34 K;  1EO1 A;  3OA9 A;  4OGC A;  1S9G A;  4DTU A;  3DLE A;  3I0R A;  4IBN A;  5J1E A;  3RRH A;  1X3M A;  4DR2 K;  3DLG A;  3NCI A;  3M3Z A;  3EKU A;  4LF5 K;  1HJR A;  1TK5 A;  1YT3 A;  3RRG A;  4A2A A;  3WEE B;  5BN8 A;  2ATQ A;  1FKP A;  1NLV A;  5BPM A;  3IUC A;  1GLC G;  4WFB L;  4B9M A;  3U4L A;  3SUO A;  4JKE A;  1LOT B;  4EP5 A;  4DTO A;  4M7X A;  1KVA A;  3VQ4 A;  3QEI A;  1WSG A;  2ITM A;  1W97 L;  5AZJ A;  4M45 A;  1U2V A;  1JLC A;  1WBB A;  1OH6 A;  4DQQ A;  2KTQ A;  4H8K A;  1WSH A;  4HUE A;  2DFH A;  5JS1 A;  1T6C A;  4IFY A;  2BGG A;  3DLR A;  4QS9 A;  3KLI A;  3MK6 A;  3MCA B;  3W0L A;  3VGM A;  4CGG A;  3CCM N;  1U6Z A;  2ITG A;  3QEV A;  3ZET B;  3KVG A;  3CJ7 A;  2NNW A;  1X9J A;  2A41 A;  3KD5 E;  5FRM A;  3L4Q A;  4IOA L;  4MDA A;  2ZJP L;  3PSF A;  2Y1I A;  3VMF B;  1WSE A;  1RTJ A;  2VGM A;  4IXC A;  3KHY A;  1KVC A;  3I56 N;  3PV8 A;  1X1P A;  3CER A;  4DV1 K;  1GLD G;  2ZM6 K;  5FPE A;  1EKE A;  3T7Z A;  2Z1J A;  4KRF A;  2DTU A;  1D9F A;  1HMV A;  2IOC A;  4OPH A;  3S3N A;  3H6E A;  1FK9 A;  4PWD A;  2AJQ A;  3L2U A;  4DV5 K;  3VF4 A;  3OY9 A;  4PA1 A;  3NE6 A;  2P9U A;  3TTC A;  4XH1 A;  2E2O A;  4KV8 A;  3I8B A;  4KRE A;  4A59 A;  3DLK A;  1YTU A;  2FBV A;  1DKG D;  1RT6 A;  4B9T A;  1C0T A;  3AVI A;  1I39 A;  4DF4 A;  5IT9 O;  3CQY A;  1NWK A;  4B3M K;  2HOE A;  4JKG A;  1RDW X;  3LAM A;  2XHB A;  3H1Q A;  2IIR A;  4CEO A;  3G71 N;  4FM1 A;  3F2K A;  4FJI A;  1IKW A;  1HNI A;  1VSI A;  4WQ5 C;  5DM6 L;  5I3U A;  3V81 A;  4KHY A;  5TKW A;  3AA4 A;  4IO9 L;  3RSE A;  1S3X A;  4YY3 K;  3LDP A;  4BVO A;  4K42 A;  1C1B A;  3KLE A;  4CD1 A;  4MDB A;  1G15 A;  3H45 C;  1SUQ A;  4DU1 A;  4DTS A;  4IEI A;  4DSL A;  2HBM A;  4BE1 A;  1QHT A;  5BPN A;  5CYQ A;  1TYQ A;  4O55 A;  4RW4 A;  2FBX A;  4KKO A;  3A8Y A;  4CIE A;  1HNW K;  2HHX A;  3U3Y A;  2GTD A;  3ZX3 A;  3OYF A;  2OAN A;  4FVM A;  3M8Q A;  3L2Q A;  1ASU A;  4JI1 K;  1WSI A;  2Q0U A;  4LC9 B;  3DRS A;  3ZT2 A;  2RKI A;  3SCX A;  4BC4 A;  2VG7 A;  1VQM N;  3UKU B;  1JLE A;  1KAY A;  4JI7 K;  1N36 K;  2IC3 A;  4PKI A;  1J6Z A;  3M5R A;  1REV A;  2VQE K;  4KPY A;  1A5V A;  3AA5 X;  3MEC A;  4BRN A;  4BRI A;  3HSC A;  4X65 K;  2GWJ A;  1IG9 A;  1NGE A;  4B3R K;  4CZG A;  4YOW A;  1XI1 A;  3RMB A;  3VQ8 A;  4BRE A;  1RCH A;  4CJF A;  4J8F A;  3T19 A;  3DWL A;  1QS4 A;  4B1Z A;  1KXP A;  2JWK A;  2GWK A;  5AQQ A;  3HK2 A;  1XNQ K;  2BTF A;  3I33 A;  3CCQ N;  1MU2 A;  3F9K A;  1WNS A;  4DR1 K;  1WLJ A;  4C8N A;  1NU0 A;  4AHC A;  4Z4I A;  4PL8 A;  3QIN A;  5AQP A;  5FRO A;  1EQY A;  1DLO A;  3VTH A;  1IBK K;  1S72 N;  1T3V A;  2G8H A;  1EET A;  2E2N A;  3N4Q A;  2JGU A;  3VF2 A;  1LWF A;  3A2F A;  3SYZ A;  1RIL A;  4PQU A;  5LJV A;  4DSJ A;  1VSF A;  4BRC A;  3D7E O;  2OYQ A;  4M3X A;  3PLA A;  4K8Z A;  2IDO A;  3KLH A;  1Q9X A;  3MMV A;  3Q7C A;  3G25 A;  1JLA A;  4H5N A;  1YXQ A;  4FWO A;  3OYJ A;  3GOI A;  1W2B M;  3PO4 A;  1RT2 A;  4JRQ A;  2UXB K;  1D8Y A;  1YI2 N;  5FPM A;  2F96 A;  4E7K A;  3TWH A;  4DSK A;  1SL2 A;  4DQR A;  3TAR A;  5D3G A;  4FPB A;  1UA0 A;  5FRN A;  1LW0 A;  3SMP A;  1XC9 A;  1YAG A;  5CE3 A;  3LP3 A;  3L2V A;  3NGI A;  5HRR A;  4ILH A;  5AQH A;  3LP2 A;  1N6Q A;  3QEP A;  1LAW A;  2P9N A;  3G6E N;  1UWB A;  2FF6 A;  3RMC A;  4J2E A;  1HQU A;  3EE8 A;  2YNF A;  2ASO A;  3THV A;  2O8D A;  4JI6 K;  2HBJ A;  4CCH A;  2YKN A;  1NJI O;  5AQW A;  1SKW A;  4GKK K;  3MN7 A;  3VQ5 A;  3TAQ A;  3IKM A;  1CXQ A;  2GEM A;  3U3G A;  2PZS A;  2GV9 A;  3TAP A;  5A2Q O;  4ISG A;  2I7N A;  2E4L A;  3LDL A;  3L3V A;  3C7N A;  3OBW A;  2O8F A;  3KWI A;  5AQI A;  4G9Z A;  3QER A;  1R0A A;  4U67 L;  1NJW A;  4LF6 K;  3THW B;  2YJF A;  3L8B A;  2D0C A;  1XC3 A;  5KTQ A;  1FKO A;  2DPN A;  5DK5 A;  5F0X A;  2D1K A;  1LCU A;  4DU4 A;  5HP1 A;  5JLF A;  3O1B A;  4DV4 K;  3ZSV A;  1SV5 A;  3S3M A;  4XEI A;  3QNN A;  2VWK A;  3ZSR A;  4WYB A;  2FBY A;  4LH5 A;  1IO2 A;  1TL3 A;  4H5T A;  4L8R B;  1E4F T;  3F9M A;  3DOK A;  5AZI B;  2G8U A;  5F2R A;  1RDB A;  4AIL C;  4LSL A;  1DTT A;  4JK9 A;  4OPA A;  2P9I B;  2IS3 A;  2P9I A;  4DFP A;  3H3N O;  5JLH A;  4DQS A;  2W41 A;  3EE9 A;  3KK2 A;  2BDP A;  2HVI A;  2E1Z A;  4DR4 K;  4GVE A;  3FLC O;  4CHZ A;  3BDP A;  3EO3 A;  1Y64 A;  4A61 A;  1YF5 L;  1K8K A;  3UB5 A;  5FLX O;  2O8B A;  1P90 A;  2YNH A;  2KKZ A;  3DI6 A;  3LPU A;  3TSU A;  2CGK A;  2NRV A;  4KH4 A;  1GOA A;  4CEZ A;  3H3O B;  2VQF K;  1ZXO A;  3KK7 A;  4H0P A;  4H0X B;  1QE1 A;  3K9J A;  4B8A B;  2ZQB A;  1BUP A;  3U9D A;  3BGR A;  4M7Y A;  3FZH A;  5EVZ A;  1LWC A;  4AHT A;  4W5Q A;  3IAY A;  1V4T A;  5M1Q A;  1JXE A;  1BO5 O;  3LDN A;  1NK5 A;  3CFR A;  5AQN A;  3S9H A;  2HHU A;  1NOZ A;  1HYS A;  3BP8 A;  3CCE N;  2FSJ A;  2QEX N;  4CJ5 A;  4IWV A;  3VQD A;  2EWS A;  3HVR A;  2QW9 A;  5AQR A;  4CJ4 A;  4DUY K;  3AAP A;  2VG6 A;  3CIP A;  4FWN A;  4IFV A;  4JKG B;  3CM5 A;  2AP1 A;  3OW2 M;  3AVJ A;  3THX B;  2YX6 A;  3WXJ A;  1JLQ A;  3K57 A;  3SJJ A;  3QO9 A;  2QM1 A;  4FLX A;  4MLH A;  2J4R A;  1U4B A;  4PL7 A;  1J53 A;  4B1Y B;  4MLE A;  3KK1 A;  3CG7 A;  1JLG A;  3PY8 A;  1IKV A;  4ILG B;  3O4W A;  1F21 A;  1BIS A;  4FWR A;  2XO7 A;  3TAE A;  1SQK A;  4E89 A;  3B6O A;  2OPQ A;  1O13 A;  3G0Z A;  4YDU C;  4DU3 A;  3ZET A;  1QQM A;  3ITH A;  1ATN A;  3C7N B;  4JKB A;  3T1A A;  4CBW A;  1VQ6 N;  1WB9 A;  3V9U A;  1EP4 A;  2NLX A;  4RW9 A;  1T05 A;  2ZJQ L;  1NK9 A;  5GAD P;  3E1Y A;  4W5N A;  1GOC A;  4F3O A;  1BCO A;  5TKY A;  4BE2 A;  2ASM A;  1RFQ A;  3LDQ A;  5J2M A;  4CI6 A;  3SQ4 A;  4DCH A;  5CR4 A;  3EN9 A;  3OS0 A;  2HB5 A;  1V4S A;  4B1U B;  4GKJ K;  3AAR A;  1IV0 A;  5T7B A;  4BDY A;  4CJR A;  1ESV A;  4LF4 K;  3SV3 A;  5GIO A;  4AF1 A;  3TTF A;  1VK0 A;  3VQQ A;  1OH8 A;  3JYT A;  1VSD A;  3V1Q A;  3ZSO A;  3HOT A;  1BQN A;  1NGA A;  3OYL A;  1DT9 A;  4KH5 A;  3ATU A;  1QZ5 A;  4ZHR A;  4FZX C;  2YV0 X;  5KRS A;  3MXM A;  4YHH K;  3ID8 A;  3KKR A;  2CGJ A;  4JD2 A;  4H4O A;  1NJZ A;  4RG8 A;  2GUI A;  4NXM K;  3OJS A;  1TK0 A;  4F9O A;  3AVL A;  5AQV A;  2O8E A;  1XWL A;  3C6T A;  1RDU A;  3H46 O;  4H0T B;  1S1V A;  2Y1J A;  3J7Y P;  1RDC A;  2O8C A;  5C15 A;  1JLF A;  1JL1 A;  5BRF A;  4JAX A;  1RT7 A;  1NGD A;  4CEA A;  3J7Z O;  2Q0R A;  3MWT A;  2FBT A;  3BF3 A;  3HT3 A;  2YHA A;  3DMJ A;  3P83 D;  4CJE A;  4FPA A;  1RBU A;  4ELT A;  5K14 A;  3NF8 A;  1S6Q A;  4AH9 A;  3MN5 A;  4CIG A;  4GV9 A;  3A5O C;  4OJR A;  2R7Y A;  3SAF A;  4KHP K;  4ELV A;  2A5X A;  3NF6 A;  4GV6 A;  1VRU A;  4A5B A;  1MWK A;  3MDQ A;  1NKE A;  3C6A A;  4E7I A;  5BRH A;  2W6K A;  4JKC A;  1EWQ A;  1XHX A;  3CJ1 A;  1OVY A;  1VQ7 N;  3CC2 N;  4CK3 A;  2E1Y A;  4ILJ A;  4PKH A;  4BVP A;  4KTQ A;  1TK8 A;  4RCH A;  2WOM A;  5BRD A;  3MAQ A;  3BEX A;  3SZ2 A;  2FF3 B;  1G99 A;  2CH5 A;  3DOL A;  1TKD A;  4M3W A;  4CHN A;  3HL8 A;  4M3T A;  2PAV A;  4BE0 A;  1XNR K;  1SL0 A;  5SZT A;  1A5W A;  2QWM A;  3EEQ A;  4JKH A;  5FPN A;  3CI5 A;  4FLY A;  3JAM O;  1VSH A;  3V9X A;  2UYT A;  3D6R A;  4C8O A;  3R3L A;  4O5B A;  2HND A;  3AO4 A;  3ATV A;  2ASP A;  4XIU A;  3CQ8 A;  4BWM A;  3HST B;  1HLU A;  3LAN A;  3MX2 A;  2ETJ A;  4N76 A;  3MCP A;  3QFP A;  1U48 A;  3KZB A;  4DR5 K;  4R79 A;  3U6F A;  4BGB A;  3WXI A;  1ATS A;  3M8P A;  3O9U A;  1VQ5 N;  1Q7Y O;  4EIA A;  4BR5 A;  3V9Z A;  5M1F A;  1O1W A;  1VQP N;  3GBT A;  2WON A;  1N33 K;  3CD6 N;  3AO5 A;  5MLC Q;  3SI6 A;  3D2F A;  2E88 A;  4CBU A;  5AQO A;  1NMD A;  2O8B B;  1NJX A;  3NDK A;  2V52 B;  1N8R O;  2VWJ A;  4FXD A;  4CFC A;  1NGB A;  4PUO A;  4NYF A;  2P51 A;  1KLM A;  4CZI A;  3PSI A;  3R9P A;  3J81 O;  3PUF A;  4DFM A;  3QNO A;  1EXQ A;  2A6A A;  2D0A A;  2XY6 A;  3LM2 A;  4HTU A;  1WBD A;  3OYI A;  2HHW A;  3I55 N;  3R1X A;  4O4G A;  4NYN A;  2P9L A;  3LP1 A;  4BRL A;  1FXX A;  4EHT A;  4CF0 A;  3ENB A;  2WFB A;  4BAC A;  4H5W A;  4OKE A;  4IFE A;  4CJP A;  3VET A;  4E1N A;  3R6M A;  3CJ9 A;  4JN4 A;  3VQC A;  4KHW A;  4MQ3 A;  4E19 A;  3RTV A;  1WAJ A;  3TR8 A;  1L3U A;  4BRK A;  4G1Q A;  4EHU A;  3VQE A;  3NH1 A;  4LF7 K;  3B8A X;  4CGD A;  5IWA K;  2D5R A;  5HOO A;  2G8W A;  1NJY A;  1Z6R A;  3LDS A;  4JV5 K;  2NRT A;  3JXU A;  4J2A A;  4FWM A;  4CJL A;  4CJ7 A;  1BQM A;  1HPZ A;  3VEV A;  4IOX A;  3GG4 A;  3AO2 A;  1BGX T;  1YVU A;  3P5J A;  3FZM A;  4I6M B;  4IZ9 A;  2DY4 A;  5AFU H;  4CK1 A;  2Q97 A;  4R5P A;  4CER A;  1X9S A;  2OZS A;  1XHZ A;  3AVH A;  4Z4E A;  4Z4H A;  4HTL A;  4UQG A;  2QKK A;  3CCL N;  4ISF A;  5CY4 A;  3L6Q A;  3MXJ A;  4B9S A;  5HBM A;  3DLH A;  3OS2 A;  3WXM B;  3QEW A;  4CJQ A;  2IVP A;  4F4K A;  4IG0 A;  4B3O A;  4DS4 A;  4Z0U A;  4DR7 K;  2Z1G A;  3DYA A;  2HHH K;  5AQL A;  3HXM A;  4LF9 K;  4CZJ A;  3AVA A;  4KB0 A;  4M42 A;  2F8T A;  2XRI A;  3J7A P;  4EAH D;  2YHX A;  4JI8 K;  1L3T A;  4JS5 A;  3ID6 A;  3WNF A;  1RTI A;  2KZM A;  3CCR N;  4BRQ A;  4JRP A;  4EZ9 A;  3VA3 A;  2Q2R A;  1JCE A;  2E6L A;  2Q31 A;  2OPS A;  2OPP A;  2KLA A;  4JD2 B;  3SAH A;  3ZSW A;  1ATR A;  3EZ5 A;  5F1X A;  4Z4C A;  1Q82 O;  4Y0W A;  1QQC A;  1VHX A;  4CZL A;  5AQF A;  2QA4 N;  4DSF A;  4ZTF A;  4F8R A;  5LMN K;  4RW8 A;  5JIC A;  2XY7 A;  5HRO A;  4I7F A;  3DJC A;  1YIT N;  4BR2 A;  3O5B A;  2G8I A;  3HM9 A;  4B9Q A;  4N47 A;  1VQ4 N;  5HRS A;  1MA9 B;  1QQN A;  4NLC A;  2Q36 A;  3EKS A;  4FOI A;  3M1F A;  2ZF5 O;  2P1J A;  1TYQ B;  3EL2 A;  2EX3 A;  1Q81 O;  1NK6 A;  4QS7 A;  1BA1 A;  4FJM A;  1TKZ A;  3RMD A;  1QVF M;  3O8M A;  4IEE A;  4JYA K;  4FLU A;  4F2S A;  5C42 A;  2X78 A;  1C1C A;  3VGL A;  3RR7 A;  2KHO A;  5BN9 A;  2IVO A;  3OBY A;  4BRO A;  1BIZ A;  4KI4 A;  4FJH A;  3MN9 A;  4V19 S;  4BRM A;  3ZEU A;  2KW4 A;  3AA2 A;  1M90 O;  3P1G A;  5LY3 A;  5J2Q A;  2VYP A;  3C95 A;  3VEN A;  1L3V A;  1CXU A;  4LSN A;  4CJ3 A;  3NHG A;  3DM2 A;  3NH2 A;  4I2P A;  4OVL A;  3CC7 N;  3ENO A;  3N4P A;  1BDG A;  4CFB A;  2A1R A;  1UOC A;  3DRP A;  4OPJ A;  4BWJ A;  3QFU A;  4FM2 A;  4IJN A;  4B3T K;  3NF7 A;  5GIP A;  3WXK A;  4OKK A;  5E41 A;  4AHS A;  1U2V B;  4O8K A;  2RPI A;  3CM6 A;  3SAG A;  4GW6 A;  4HHT A;  4H4M A;  5BRE A;  5C2F A;  3PO5 A;  3ZT4 A;  4DV6 K;  1ITG A;  1ZBH A;  3LDO A;  3THW A;  3UIQ A;  1NGC A;  1UAX A;  5C2D A;  4FJN A;  4N56 A;  3OYD A;  2QXF A;  1YJW N;  4CZM A;  1Q9Y A;  2UU9 K;  2KFZ A;  3ZX0 A;  4JKA A;  3SLC A;  3VQA A;  1R59 O;  3J80 O;  3BY5 A;  5B8H A;  1S1U A;  1VQN N;  4WF9 L;  4UY8 O;  1RT5 A;  3C65 A;  2DFE A;  5KPR A;  3D0P A;  2W6L A;  2ZD1 A;  1T7P A;  4F3T A;  4FL9 A;  3VEO A;  2FC0 A;  4FJ5 A;  3S41 A;  3HBT A;  5EY4 A;  5M1N A;  1JXB A;  4CE9 A;  1S6P A;  3IDH A;  1C6V A;  3DXK A;  3OYA A;  3A0I X;  1TVR A;  5LMU K;  3CCV N;  2RF2 A;  1UA1 A;  4CF8 A;  1DEJ A;  2HVH A;  3V9S A;  3QML A;  3TAN A;  3WEE A;  4E7L A;  1HNX K;  3CF5 L;  4EFH A;  3AV9 A;  1XMQ K;  1NGH A;  4BDZ A;  3E9P A;  4EP4 A;  3K5O A;  3AVF A;  1BHL A;  4CF1 A;  1J9A A;  1RT3 A;  4FJK A;  1Z05 A;  2YI1 A;  1T03 A;  4CJU A;  1FW6 A;  4CVN E;  3RMA A;  4XH4 A;  3HJF A;  3ZCM A;  4N41 A;  2Z1H A;  4RW6 A;  2KFN A;  4E7H A;  3QBX A;  2GBZ A;  3KD1 E;  4OKJ A;  4JI5 K;  2WBN A;  2HMP A;  4FZY A;  3LWM A;  1W9H A;  4DTR A;  4B9L A;  4EZ6 A;  3NF9 A;  3CMA N;  4B9U A;  4JLH A;  2OZM A;  3UKR A;  4CEC A;  3T3F A;  5KQ8 A;  2FXU A;  3PX4 A;  3EY1 A;  5BR8 K;  3O4N A;  2HNZ A;  2F4V K;  4J2D A;  5AQJ A;  4M3Y A;  4CW7 B;  1KVB A;  2H3G X;  3SPY A;  4DMN A;  1I94 K;  3IFR A;  3A5M C;  1ZBL A;  4DF8 A;  4CGJ A;  4J2B A;  1DTQ A;  3CC4 N;  5JMV A;  4BG9 A;  4FJG A;  4DQP A;  2QWQ A;  3SMS A;  3RR8 A;  1QQO A;  3D45 A;  1WSJ A;  1ZBS A;  4ID1 A;  1ILY A;  2Z1I A;  2I7P A;  4QOZ B;  4CFA A;  5KGW A;  4YDU A;  3L2W A;  1NGJ A;  1NK7 A;  1HX1 A;  4W5R A;  4H0O A;  4DV7 K;  4DLG A;  3CQX A;  3M6G A;  1A5X A;  1TUU A;  3LAL A;  5GIN A;  4O0I A;  4CD3 A;  3CCU N;  1TKT A;  4YOR A;  3AAQ A;  3M8R A;  5M1O A;  2HHT A;  5AQK A;  3OYH A;  3ZSZ A;  4QAG A;  1RTD A;  3AVK A;  2VWB A;  4F2R A;  4DTX A;  4BC2 A;  4CK2 A;  2X6S A;  4KO0 A;  3LZI A;  1X9M A;  4FWP A;  4E3S A;  4IJA A;  3QBW A;  4NB4 A;  1QSS A;  4NLB A;  4DV0 K;  2E5L K;  4DTJ A;  3ZLJ A;  3CFO A;  1RT4 A;  3ZX2 A;  5EX5 A;  4FK0 A;  5JVH L;  4HWI A;  3SV4 A;  2A42 A;  3WT0 A;  2O8C B;  2IVN A;  3HVT A;  3OYB A;  2A3Z A;  4FZZ A;  4AM7 A;  2HF4 A;  5C24 A;  4E1J A;  2HNY A;  5GAH P;  3VN5 A;  3VF6 A;  2O4G A;  3OYK A;  3O3F A;  4CIF A;  5AQM A;  3MEE A;  3L0Q A;  3VQP A;  2QWN A;  3DAW A;  3FGU A;  3GE1 A;  4AHU A;  4HUF A;  2F9T A;  3UKR B;  4CZE A;  2P5O A;  3QEX A;  3MXI A;  3CYM A;  2JWL A;  1VSJ A;  3NBP A;  3MN6 A;  3FR0 A;  2WC9 A;  1J54 A;  4OLB A;  2DFF A;  5AQG A;  3OYE A;  2UXC K;  4O0J A;  3O08 A;  3P38 A;  4NO7 A;  1N5Y A;  3I8D A;  3ZYY X;  1X9W A;  3FZF A;  1RGI A;  1T44 A;  4JS4 A;  1B92 A;  1CLQ A;  4KI6 A;  4GNI A;  3THY A;  3KWG A;  3VQ9 A;  3AGK A;  3LWL A;  4CF2 A;  2HHS A;  4NCB A;  5AQZ A;  1QTM A;  1IKX A;  4FO0 A;  3HO1 A;  2CH6 A;  2P9K A;  1HQE A;  2BAN A;  2P9S B;  4QS8 A;  1TUY A;  3H08 A;  3LM9 A;  2OTL N;  1BU6 O;  1BCM A;  1XQS C;  4IO8 A;  3LPT A;  3AVM A;  4BRA A;  2CGL A;  4A5A A;  4FCY A;  3SPZ A;  1WSF A;  5DM7 L;  1HR0 K;  2X74 A;  3C6H A;  2BUP A;  3SUP A;  1W7A A;  3FFI A;  2W40 A;  4JK8 A;  4KB1 A;  2FSK A;  3HPO A;  3H1V X;  2HHV A;  4I2Q A;  4WQ5 A;  5AQY A;  2FLO A;  5HL7 L;  3KJV A;  2FSN A;  1S22 A;  4B3S K;  3KLG A;  3UE5 A;  1KAZ A;  4B1V A;  1ZBF A;  1QHA A;  3C94 A;  3JSM A;  5LJW A;  5JS2 A;  1NM1 A;  5CZ2 A;  5HRN A;  3FZK A;  1LWE A;  4GMJ B;  4FLT A;  1NMN A;  2HMI A;  4IOC L;  3KTQ A;  1CZB A;  5C12 A;  3P31 A;  2VG5 A;  4JI4 K;  1IH7 A;  4JKF A;  1QSL A;  3EZW A;  2G8V A;  3NMU A;  1WAF A;  2OA8 A;  4JHD A;  4C1N K;  3G4S N;  1Q8I A;  2YKM A;  5AQX A;  3V6D A;  4RWT A;  5E84 A;  1ASW A;  3HZ6 A;  4DWI A;  3IMX A;  1NGF A;  3NVK A;  1K73 O;  1M1K O;  3HPG A;  4KHS A;  2B4J A;  3HP9 A;  2G8K A;  2V51 B;  4JKD A;  3VOV A;  1NK8 A;  2QWL A;  2G8F A;  1IG8 A;  3AVC A;  5EOY A;  2NZT A;  3QIO A;  2E2Q A;  4OPK A;  1KTQ A;  3CCS N;  3HTV A;  1RBT A;  1ZC6 A;  3TSQ A;  3VA0 A;  3ASM A;  1OKJ A;  1Y97 A;  3QIC A;  2EHG A;  1IJJ A;  3IS9 A;  4QCL A;  1S9E A;  4A2B A;  2HF3 A;  3O9S A;  3DXM B;  4DG1 A;  4K8X A;  4WE1 A;  3WQU A;  2UXD K;  3L4I A;  3U8X A;  3B6P A;  3QDK A;  4BRP A;  4KTZ A;  3O3H A;  1WUA A;  2GX9 A;  4AHV A;  2YHB A;  1YTA A;  5ADX A;  3HM8 A;  2HST A;  2P9S A;  3NVM A;  4DLE A;  2OPR A;  2OTJ N;  4B9N A;  1VSE A;  2HW3 A;  3WXL A;  4XH5 A;  4M3U A;  2QTD A;  3CPE A;  1YIJ N;  1KAX A;  2OCE A;  1QVG M;  3T69 A;  4AQY K;  4BG8 A;  3ZEU B;  3W3D A;  3TPQ A;  1XUP O;  3O1W A;  4DSE A;  4BC3 A;  2QWO A;  3HRG A;  4BQZ A;  4RTF D;  4CGI A;  3M8S A;  2Q1N A;  3BZK A;  1BA0 A;  1RBR A;  4FWL A;  3K2P A;  4IKF A;  3SBT A;  3V4I A;  4YFU A;  5M1K A;  2AA4 A;  1J5O A;  1YVN A;  3OJU A;  3TU5 A;  1HUX A;  3OTO K;  1LAV A;  4H5V A;  2E6M A;  4BRH A;  3VEW A;  3UKU A;  2B5J A;  4H03 B;  2D0P A;  1JCF A;  3ENH A;  4FLV A;  1VQO N;  1YUW A;  4KHQ A;  2D0O A;  2E2P A;  2NRX A;  1S1T A;  3CPW M;  1U47 A;  1HKB A;  5CHI A;  4E7J A;  3D2F B;  2BE2 A;  2YCH A;  4O8U A;  2VCP A;  3LAK A;  4FVU A;  3D2E B;  2Q3S A;  3MX5 A;  1EWR A;  2PBD A;  4YOX A;  1GLA G;  4FYD A;  4CJT A;  3VTI A;  4WQ4 A;  4LY7 A;  4CFD A;  3FZL A;  5AZI A;  5HRP A;  1GLE G;  3CXC M;  1YJ9 N;  1NNE A;  3NGY A;  3QLH A;  1ZYQ A;  1W0H A;  5AFU A;  1NKB A;  4E1M A;  4FJJ A;  4CJK A;  3VGK A;  2P9L B;  3CJB A;  1SS6 A;  3TSP A;  5JVG L;  4Q5V A;  3LP0 A;  5LL6 Z;  4NCA A;  2PYL A;  1VQ8 N;  4DSI A;  4DKW A;  1NK0 A;  1GLB G;  1BIU A;  5AQU A;  4BR4 A;  5I9E B;  4OX9 K;  1RTH A;  2QKB A;  3ZT1 A;  3VQ6 A;  4FWS A;  4K41 A;  4NCG A;  3U9Z A;  3AGR A;  4DV2 K;  4RW7 A;  5AJ3 K;  2KZZ A;  1RDD A;  4AHR A;  2XY5 A;  2LSN A;  1NOY A;  4KHN A;  1BI4 B;  1VSM A;  1B9F A;  3TAB A;  4DHY A;  3R8E A;  3JS6 A;  3AVB A;  4HCB A;  3SK3 A;  1BOT O;  4YOV A;  1TAQ A;  3HI0 A;  1NBW A;  4DS5 A;  2A40 A;  4GVM A;  3CJA A;  1RDA A;  3KK3 A;  5I42 A;  3P39 A;  2W42 A;  4IG3 A;  4K43 A;  4CZH A;  1E4G T;  4MO5 A;  3E9L A;  1LW2 A;  2PY5 A;  5AZJ B;  1L5U A;  1MWM A;  4K25 A;  3OVN A;  4DR6 K;  5KRT A;  4X66 K;  3VEY A;  2RN2 A;  3SUQ A;  4H5R A;  5ADX H;  4HVJ A;  1K8A O;  4B1X B;  1BWF O;  3O6W A;  3O4Q A;  4DTM A;  1E3M A;  3WNG A;  1OH7 A;  1TV6 A;  1P8Z A;  1JCG A;  2UUA K;  1HNZ K;  1C0M A;  4GY2 B;  3KIO A;  5AQS A;  1K6Y A;  3CME N;  1ASV A;  1SL1 A;  4HCC A;  5SWM A;  5E26 A;  2F8S A;  3T1Y K;  1HRH A;  2YNG A;  4FJ8 A;  4E0D A;  2QI2 A;  4WCE L;  1EX4 A;  3QIP A;  1IBL K;  4DV3 K;  2YHY A;  4FJX A;  2X6N A;  2F7T A;  3ULE B;  3AVG A;  3ULE A;  4CGH A;  2QK9 A;  1DGK N;  4CF9 A;  1HKG A;  4LD0 A;  5HLF A;  4WFA L;  1HKC A;  1CZA N;  3DRR A;  5J2P A;  1J5E K;  2HBK A;  5AQT A;  3O9T A;  3HPH A;  1GLF O;  4CGF A;  1TGO A;  3ZSY A;  3IG1 A;  1GLJ O;  4JI3 K;  1VSK A;  2UUB K;  3CCJ N;  5KPZ A;  4O5F A;  4HUG A;  3OYC A;  3VER A;  1T8E A;  4CJV A;  4Z4G A;  1RNH A;  3TI0 A;  3K58 A;  3ZT3 A;  1HYV A;  1NGI A;  3AO3 A;  1B9D A;  5C25 A;  1S1X A;  3C6U A;  4LFB K;  1QZ6 A;  4B8C A;  1MDU B;  3E9O A;  2ZE2 A;  3AY9 A;  3ZT0 A;  2QWR A;  5EU7 A;  4C8L A;  3P4I A;  4JHD B;  1KD1 O;  2RE2 A;  4M3Z A;  1K8K B;  2PFU A;  2HBL A;  1Z26 A;  3DXM A;  3QET A;  4OLA A;  4JNE A;  4Y1D A;  3O3G A;  1C0G A;  4B08 A;  1KSP A;  4ELU A;  3BF1 A;  1JL2 A;  4M3R A;  4KTW A;  4DQI A;  3BZC A;  1T6D A;  2O8D B;  4Q0B A;  1U04 A;  4CES A;  1VSL A;  4CHO A;  1RBV A;  2D4W A;  4IDK A;  3TAM A;  3GDQ A;  1S5J A;  3SQ1 A;  2XY8 A;  2NUB A;  1KRP A;  2P9K B;  3PIO L;  3MED A;  3OYM A;  3GL1 A;  1HYZ A;  5GAE P;  2YNI A;  1XMO K;  5BR9 A;  2NRH A;  2QXL A;  4BRG A;  4DTN A;  4L3Q A;  1WN7 A;  3PX6 A;  4GV3 A;  4NXN K;  1VRT A;  1RT1 A;  2GEL A;  2UUC K;  4BRF A;  3I0S A;  1SZ2 A;  3SQ0 A;  1IBM K;  4C1N I;  3T1H K;  3V9W A;  4BY9 C;  3A5N C;  3OYN A;  1OH5 A;  3CET A;  3F73 A;  2NRW A;  3PX0 A;  2ZJR L;  3AA3 A;  4W5T A;  3L3U A;  1BG3 A;  4FW2 A;  2V7Z A;  4BQL A;  4ISE A;  3TAG A;  4C8K A;  4YOU A;  3HOS A; 
#chains in the Genus database with same CATH homology
 1HQE A;  1FXX A;  3IRX A;  3F9K A;  4CF0 A;  1WNS A;  2BAN A;  3NFA A;  4BAC A;  1WLJ A;  4C8N A;  1KLN A;  3HYF A;  4Z4I A;  4AHC A;  3H08 A;  4OKE A;  4CJP A;  3QIN A;  5FRO A;  4E1N A;  1DLO A;  1BCM A;  1GOB A;  3LPT A;  2G8H A;  1EET A;  3VQC A;  1L3S A;  4KHW A;  3AVM A;  4MQ3 A;  4E19 A;  2JGU A;  4N5S A;  1LWF A;  3RTV A;  4FCY A;  3DLB A;  1WAJ A;  2D0B A;  3A2F A;  1RIL A;  3SYZ A;  3TR8 A;  1WSF A;  3SPZ A;  1L3U A;  4BDP A;  4PQU A;  4G1Q A;  3VQE A;  1VSF A;  3NH1 A;  4DSJ A;  2X74 A;  2OYQ A;  3SUP A;  4M3X A;  4C8M A;  3FFI A;  4CEF A;  2IDO A;  4CGD A;  3KLH A;  1Q9X A;  4K8Z A;  4KB1 A;  3NH0 A;  3HPO A;  2D5R A;  4DFJ A;  1JLA A;  3OYJ A;  3PO4 A;  2G8W A;  1NJY A;  2PYJ A;  4FLZ A;  2HHV A;  3LDS A;  1RT2 A;  4I2Q A;  5FRN A;  4CEQ A;  3E01 A;  4JRQ A;  1D8Y A;  4J2A A;  4CJL A;  5KGX A;  3KJV A;  2F96 A;  1BQM A;  4PY5 A;  1HPZ A;  3KLG A;  4E7K A;  3AO2 A;  1ZBU A;  1C1A A;  1BGX T;  3TWH A;  4DSK A;  1ZBF A;  4DFK A;  1YVU A;  3C94 A;  3P5J A;  3VQ7 A;  3JSM A;  4DQR A;  3TAR A;  1SL2 A;  4FJ9 A;  2DY4 A;  5JS2 A;  4CK1 A;  4R5P A;  4FJL A;  4CER A;  5CZ2 A;  3ULD A;  5HRN A;  1X9S A;  2OZS A;  5D3G A;  4Z4F A;  1LWE A;  1UA0 A;  4GMJ B;  1LW0 A;  4FLT A;  1XHZ A;  3AVH A;  4ID5 A;  1XC9 A;  4Z4E A;  3LP3 A;  3L2V A;  2HMI A;  1RBS A;  4FM0 A;  4Z4H A;  4UQG A;  3KTQ A;  5CZ1 A;  4CEB A;  3NAE A;  3NGI A;  1CZB A;  2QKK A;  5HRR A;  2VG5 A;  4TSX A;  3LP2 A;  5CY4 A;  4FLW A;  5FDL A;  3MXJ A;  1N6Q A;  4B9S A;  5HBM A;  3QEP A;  1IH7 A;  2B6A A;  1LAW A;  1QSL A;  2G8V A;  1UWB A;  3DLH A;  1QSY A;  4LH4 A;  4CHQ A;  3OS2 A;  3OS1 A;  3QEW A;  4CJQ A;  3RMC A;  4J2E A;  1HQU A;  1WAF A;  4F4K A;  1NK4 A;  2OA8 A;  2YNF A;  4IG0 A;  3V1O A;  3THV A;  4DS4 A;  4B3O A;  1Q8I A;  2YKM A;  4Z0U A;  4KFB A;  3ZSX A;  3V6D A;  3SQ2 A;  2O4I A;  2IGI A;  4DTP A;  1BI4 A;  2Z1G A;  3DYA A;  3KKS A;  4CCH A;  2YKN A;  3AO1 A;  1SKW A;  1ASW A;  4DWI A;  3VQB A;  3HXM A;  3VQ5 A;  3TAQ A;  3AVA A;  3G10 A;  4KB0 A;  4M42 A;  2XRI A;  1CXQ A;  2F8T A;  4CED A;  3U3G A;  3WNH A;  3QES A;  2PZS A;  2GV9 A;  3TAP A;  1IKY A;  3HPG A;  2E4L A;  4FW1 A;  2B4J A;  4CEE A;  3HP9 A;  1L3T A;  3L3V A;  2G8K A;  4KHS A;  4I9Q A;  4JS5 A;  3WNF A;  1NK8 A;  2G8F A;  1RTI A;  4CJW A;  3AVC A;  2KZM A;  3K59 A;  3QER A;  1R0A A;  1NJW A;  3QIO A;  4JRP A;  3MEG A;  4EZ9 A;  2HHQ A;  3VA3 A;  4OPK A;  1KTQ A;  3EYZ A;  3L8B A;  2D0C A;  3K5N A;  5KTQ A;  2E6L A;  1RBT A;  4KAZ A;  1FKO A;  2OPS A;  1SKS A;  2OPP A;  5DK5 A;  3VA0 A;  3ALY A;  1Z25 A;  3ASM A;  3ISN C;  1Y97 A;  4DU4 A;  5HP1 A;  1TL1 A;  3ZSW A;  3L2R A;  3ZSV A;  3EZ5 A;  2EHG A;  3IS9 A;  1SV5 A;  4Z4C A;  3V1R A;  3S3M A;  1ZBI A;  3QNN A;  4QCL A;  1S9E A;  2VWK A;  1QQC A;  3LZJ A;  3CFP A;  4DG1 A;  3ZSR A;  3KLF A;  4K8X A;  5DMR A;  4WE1 A;  2FBY A;  4DSF A;  3SUN A;  3B6P A;  1CZ9 A;  4LH5 A;  4ZTF A;  4F8R A;  1IO2 A;  1TL3 A;  4RW8 A;  2XY7 A;  3SNN A;  4L8R B;  5CYM A;  4KTZ A;  3O3H A;  4I7F A;  4AHV A;  5HRO A;  2YHB A;  3DOK A;  1YTA A;  2G8U A;  1I3A A;  1RDB A;  4DLE A;  2OPR A;  3S3O A;  3OYG A;  3HP6 A;  4AIL C;  1VSE A;  4B9N A;  2P5G A;  4LSL A;  4CJS A;  1DTT A;  2G8I A;  2HW3 A;  2IS3 A;  3HM9 A;  4DFP A;  4M3U A;  4N47 A;  4DQS A;  2IAJ A;  2BDP A;  3KK2 A;  5J2N A;  4B9V A;  3K5M A;  4M41 A;  5HRS A;  1JKH A;  2HVI A;  2A1S A;  1U45 A;  4FK4 A;  4CHZ A;  3BDP A;  1TAU A;  1BL3 A;  4DSE A;  4KHU A;  4Y1C A;  4CHP A;  3TAF A;  2P1J A;  2EX3 A;  4CGI A;  3M8S A;  1NKC A;  2YNH A;  3AVN A;  3K5L A;  1U49 A;  1NK6 A;  3RWU A;  1S1W A;  3DI6 A;  1KCF A;  3LPU A;  4ZTJ A;  4FJM A;  1RBR A;  1TKZ A;  4MFB A;  3K2P A;  3RMD A;  4IKF A;  3ZSQ A;  1GOA A;  4CEZ A;  4FLU A;  1D9D A;  4F2S A;  1QE1 A;  5C42 A;  4YFU A;  2X78 A;  4B8A B;  1C1C A;  2ZQB A;  3V4I A;  1J5O A;  3OJU A;  4W5O A;  1D5A A;  3RR7 A;  3BGR A;  1LAV A;  4OGE A;  3WNE A;  4FJ7 A;  2E6M A;  1KFD A;  1LWC A;  4AHT A;  4W5Q A;  5KI6 A;  3IAY A;  1BIZ A;  1JLB A;  2JLE A;  1JXE A;  4FJH A;  4KI4 A;  1SKR A;  2B5J A;  1LV5 A;  1NK5 A;  3CFR A;  3S9H A;  4FLV A;  2HHU A;  1NOZ A;  1HYS A;  4KHQ A;  2KW4 A;  1S1T A;  3AA2 A;  3P1G A;  4CJ5 A;  2KQ2 A;  3VQD A;  5J2Q A;  4ICL A;  1U47 A;  3HVR A;  1C0U A;  4O44 A;  4E7J A;  4FK2 A;  4CJ4 A;  2BE2 A;  3C95 A;  2I5J A;  1L3V A;  2VG6 A;  4I9L A;  1CXU A;  4LSN A;  3LAK A;  4CJ3 A;  3NHG A;  4IFV A;  2Q3S A;  3CM5 A;  3DM2 A;  1HNV A;  4I2P A;  3NH2 A;  4OVL A;  3AVJ A;  4FYD A;  1KFS A;  4CFB A;  2A1R A;  1UOC A;  1JLQ A;  3DRP A;  4CJT A;  1TKX A;  4OPJ A;  3NGZ A;  4BWJ A;  3K57 A;  3QO9 A;  4YNQ A;  4CHY A;  3SJJ A;  4FLX A;  4FM2 A;  4LY7 A;  4CFD A;  3NF7 A;  5HRP A;  1U4B A;  4OKK A;  1J53 A;  5E41 A;  4AHS A;  4N41 A;  2RPI A;  4OGC A;  3CM6 A;  1S9G A;  3NGY A;  4DTU A;  3KK1 A;  4GW6 A;  3CG7 A;  3QLH A;  4H4M A;  4HHT A;  1ZYQ A;  1JLG A;  1W0H A;  1NKB A;  3DLE A;  3I0R A;  4IBN A;  4E1M A;  5J1E A;  3RRH A;  3PO5 A;  3PY8 A;  4FJJ A;  1IKV A;  3ZT4 A;  4CJK A;  1ZBH A;  1ITG A;  1F21 A;  1BIS A;  2XO7 A;  3DLG A;  3NCI A;  3TAE A;  4E89 A;  1HJR A;  3UIQ A;  3B6O A;  1TK5 A;  4Q5V A;  2OPQ A;  1UAX A;  3LP0 A;  1YT3 A;  4NCA A;  4FJN A;  3G0Z A;  4DU3 A;  2PYL A;  3RRG A;  4DSI A;  1NK0 A;  1BIU A;  2ATQ A;  4N56 A;  3OYD A;  2QXF A;  1FKP A;  3ITH A;  1Q9Y A;  3T1A A;  2KFZ A;  4B9M A;  1RTH A;  3VQA A;  1EP4 A;  4RW9 A;  3V9U A;  3SUO A;  2QKB A;  1S1U A;  1T05 A;  3ZT1 A;  3VQ6 A;  4EP5 A;  4DTO A;  1NK9 A;  1RT5 A;  4W5N A;  2DFE A;  1GOC A;  1KVA A;  1BCO A;  4F3O A;  4NCG A;  3D0P A;  4BE2 A;  5J2M A;  3VQ4 A;  3QEI A;  4RW7 A;  3SQ4 A;  1WSG A;  2ZD1 A;  1T7P A;  3OS0 A;  4F3T A;  4M45 A;  4FJ5 A;  2FC0 A;  2KZZ A;  1JLC A;  2HB5 A;  1RDD A;  4AHR A;  4DQQ A;  2XY5 A;  2KTQ A;  2LSN A;  1NOY A;  4H8K A;  4KHN A;  1WSH A;  4HUE A;  2DFH A;  1BI4 B;  1JXB A;  1B9F A;  1VSM A;  4CE9 A;  5JS1 A;  3TAB A;  4IFY A;  1S6P A;  1C6V A;  3OYA A;  3DLR A;  2BGG A;  1TVR A;  5T7B A;  4BDY A;  2RF2 A;  4CJR A;  1UA1 A;  3AVB A;  4HCB A;  4CF8 A;  2HVH A;  3KLI A;  3V9S A;  3TAN A;  3SV3 A;  1TAQ A;  1VK0 A;  4CGG A;  4E7L A;  3VQQ A;  2ITG A;  3AV9 A;  3QEV A;  4DS5 A;  3JYT A;  4BDZ A;  1VSD A;  4EP4 A;  3V1Q A;  3K5O A;  3AVF A;  4GVM A;  3ZSO A;  1BHL A;  4CF1 A;  1BQN A;  3OYL A;  3KD5 E;  1J9A A;  1RT3 A;  4FJK A;  5FRM A;  1RDA A;  3KK3 A;  5I42 A;  2W42 A;  4IG3 A;  4ZHR A;  4FZX C;  2Y1I A;  1T03 A;  4CJU A;  2YV0 X;  5KRS A;  3MXM A;  3KKR A;  3RMA A;  1LW2 A;  4H4O A;  1NJZ A;  1WSE A;  2PY5 A;  3HJF A;  1RTJ A;  4RG8 A;  3ZCM A;  2GUI A;  2Z1H A;  4RW6 A;  1L5U A;  4E7H A;  1TK0 A;  3OJS A;  2GBZ A;  3KD1 E;  2KFN A;  1KVC A;  3AVL A;  3OVN A;  3PV8 A;  5KRT A;  1XWL A;  3C6T A;  1X1P A;  4OKJ A;  1S1V A;  2RN2 A;  2Y1J A;  3SUQ A;  4FZY A;  1RDC A;  4HVJ A;  3LWM A;  1W9H A;  4DTR A;  4B9L A;  1JLF A;  1JL1 A;  4EZ6 A;  1EKE A;  3NF9 A;  3O4Q A;  2Z1J A;  1RT7 A;  4DTM A;  3WNG A;  4B9U A;  4KRF A;  1TV6 A;  4JLH A;  4CEA A;  2DTU A;  1D9F A;  1C0M A;  1HMV A;  2IOC A;  3KIO A;  3S3N A;  2OZM A;  4CEC A;  3T3F A;  1FK9 A;  3PX4 A;  4PWD A;  1K6Y A;  3L2U A;  3EY1 A;  2AJQ A;  1ASV A;  2FBT A;  3O4N A;  1SL1 A;  2HNZ A;  5SWM A;  4HCC A;  4J2D A;  2F8S A;  3HT3 A;  4M3Y A;  2YHA A;  1HRH A;  2YNG A;  3DMJ A;  3P83 D;  4CJE A;  3OY9 A;  1KVB A;  3SPY A;  4E0D A;  4FJ8 A;  1EX4 A;  1RBU A;  3QIP A;  4PA1 A;  4DMN A;  1ZBL A;  3NE6 A;  4DF8 A;  4ELT A;  4FJX A;  2X6N A;  4KV8 A;  3NF8 A;  1S6Q A;  5K14 A;  4AH9 A;  4CIG A;  4KRE A;  4CGJ A;  3AVG A;  4CGH A;  4J2B A;  3DLK A;  1YTU A;  2QK9 A;  2FBV A;  1DTQ A;  1RT6 A;  4CF9 A;  4B9T A;  4FJG A;  4OJR A;  4LD0 A;  2R7Y A;  4DQP A;  1C0T A;  3RR8 A;  5HLF A;  3AVI A;  3D45 A;  4ID1 A;  1WSJ A;  1I39 A;  2Z1I A;  4QOZ B;  3DRR A;  5KGW A;  3NF6 A;  4CFA A;  5J2P A;  1VRU A;  4DF4 A;  4ELV A;  3L2W A;  1NK7 A;  3HPH A;  4W5R A;  3LAM A;  1TGO A;  4CGF A;  3ZSY A;  2XHB A;  4DLG A;  4CEO A;  3IG1 A;  4FM1 A;  1NKE A;  1VSK A;  4E7I A;  4FJI A;  1IKW A;  1A5X A;  3LAL A;  1HNI A;  1VSI A;  4O0I A;  1XHX A;  1TKT A;  3V81 A;  5I3U A;  4HUG A;  4KHY A;  3M8R A;  4CK3 A;  3AA4 A;  3OYC A;  2HHT A;  4KTQ A;  1T8E A;  4CJV A;  1TK8 A;  4Z4G A;  3OYH A;  1RNH A;  2WOM A;  3ZSZ A;  4QAG A;  3K58 A;  3ZT3 A;  1HYV A;  3AVK A;  3MAQ A;  3SZ2 A;  3AO3 A;  3TI0 A;  1RTD A;  3DOL A;  1TKD A;  1B9D A;  1C1B A;  4F2R A;  4DTX A;  3KLE A;  5C25 A;  4M3W A;  1S1X A;  3C6U A;  1G15 A;  4CHN A;  4CK2 A;  3HL8 A;  4M3T A;  2X6S A;  4B8C A;  4BE0 A;  2ZE2 A;  4KO0 A;  3LZI A;  1SUQ A;  1X9M A;  5SZT A;  4E3S A;  1SL0 A;  4DU1 A;  1A5W A;  4DTS A;  4DSL A;  3ZT0 A;  1QSS A;  5EU7 A;  4DTJ A;  4C8L A;  3CFO A;  1RT4 A;  4FLY A;  4FK0 A;  4BE1 A;  1VSH A;  1QHT A;  3V9X A;  3SV4 A;  4M3Z A;  5CYQ A;  4O55 A;  4RW4 A;  2FBX A;  4KKO A;  4CIE A;  4C8O A;  2HHX A;  1Z26 A;  3U3Y A;  3QET A;  3HVT A;  4OLA A;  3OYF A;  4O5B A;  4Y1D A;  4FVM A;  3OYB A;  3M8Q A;  3O3G A;  3L2Q A;  4FZZ A;  2HND A;  3AO4 A;  4B08 A;  1ASU A;  1KSP A;  4XIU A;  4ELU A;  3CQ8 A;  1WSI A;  3HST B;  4BWM A;  5C24 A;  3LAN A;  2HNY A;  1JL2 A;  4M3R A;  3DRS A;  4KTW A;  2RKI A;  3ZT2 A;  4DQI A;  3SCX A;  4Q0B A;  3VN5 A;  2ETJ A;  1U04 A;  4CES A;  1VSL A;  2O4G A;  3OYK A;  1U48 A;  4N76 A;  2VG7 A;  4CHO A;  3U6F A;  1RBV A;  3O3F A;  4IDK A;  3TAM A;  1JLE A;  4CIF A;  3M8P A;  3MEE A;  3VQP A;  1S5J A;  2IC3 A;  3V9Z A;  1O1W A;  2XY8 A;  2NUB A;  3SQ1 A;  1KRP A;  2WON A;  4AHU A;  1REV A;  3AO5 A;  4HUF A;  3MED A;  3OYM A;  2P5O A;  3QEX A;  1HYZ A;  3SI6 A;  2YNI A;  3CYM A;  3MXI A;  4KPY A;  1VSJ A;  3NBP A;  1A5V A;  3AA5 X;  3MEC A;  4DTN A;  4OLB A;  1J54 A;  1NJX A;  1WN7 A;  3PX6 A;  3NDK A;  2DFF A;  1VRT A;  3OYE A;  1RT1 A;  2VWJ A;  1IG9 A;  4FXD A;  4O0J A;  3I0S A;  3SQ0 A;  4CFC A;  1N5Y A;  3I8D A;  3V9W A;  1XI1 A;  4PUO A;  4NYF A;  3OYN A;  3VQ8 A;  3RMB A;  2P51 A;  4JS4 A;  1X9W A;  1KLM A;  3F73 A;  1RCH A;  4CJF A;  3PX0 A;  1B92 A;  3T19 A;  1CLQ A;  4KI6 A;  3PUF A;  1QS4 A;  4DFM A;  3AA3 A;  3QNO A;  1EXQ A;  4W5T A;  3VQ9 A;  2D0A A;  2XY6 A;  4HTU A;  3L3U A;  4FW2 A;  3OYI A;  3LWL A;  3HK2 A;  2HHW A;  4CF2 A;  3TAG A;  4C8K A;  4O4G A;  2HHS A;  4NCB A;  4NYN A;  1IKX A;  1MU2 A;  1QTM A;  3HO1 A;  3LP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...