2X6XA

Tailspike protein mutant d339n of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
598
structure length
598
Chain Sequence
b'DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
molecule keywords TAILSPIKE PROTEIN HK620
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 235
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6xA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6xA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6xA02
1KTWA 2NSPA 4XNFA 4U49A 1O88A 1O8IA 1O8LA 1DBOA 1K5CA 2VJJA 1X0CA 4XOTA 3GQ7A 1JTAA 4YZ0A 1QCXA 2O1DA 4XN3A 1IB4A 2PYGA 1WMRA 5C1CA 1O8KA 4XMYA 3T9GA 2BSPA 2ODLA 2X6WA 2NT6A 1XG2A 1O8FA 2NTPA 1EE6A 2NZMA 3JURA 4MXNA 4Z06A 3ZSCA 1KCDA 1HG8A 2NT9A 1IDJA 4Z05A 3VSUA 1RWRA 2VBEA 1OGOX 1OFMA 2Z8GA 1PXZA 2NTQA 2VJIA 3UW0A 3VMVA 4XLFA 2O17A 1BHEA 3VMWA 1PLUA 2EWEA 1IA5A 4XLCA 3VSTA 2O0VA 4NK8A 2QY1A 4XLHA 4XORA 2O04A 2O0WA 4OJOA 1OOCA 3FY3A 4YELA 1O8DA 1OFLA 2INVA 1KCCA 2X85A 2X3HA 2INUA 2UVFA 2QX3A 3SUCA 1O8MA 2QXZA 4XKVA 2PYHA 3GQ9A 4XLAA 4I84A 1O8GA 1CZFA 3B4NA 1DBGA 1O8EA 4OJ6A 1RU4A 4YEJA 4YZAA 1IDKA 4Z03A 2IQ7A 1JRGA 1GQ8A 4EW9A 2VBMA 3WWGA 1H80A 3VSVA 1BN8A 4OJLA 5AMVA 4W8TA 3KRGA 2VBKA 3GQ8A 4XM3A 4XR6A 3GQAA 1O8HA 4MR0A 4XOPA 2X6XA 1NHCA 4YZXA 4W8SA 2UVEA 1O8JA 4OZYA 4C2LA 2X6YA 4OJPA 4W8QA 3GRHA 1VBLA 3EQNA 4XKWA 1AIRA 1QJVA 2NSTA 2NTBA 1PE9A 3LMWA 4U4BA 4NK6A 3ZPPA 4XLEA 3EQOA 3B8YA 4OZZA 4XL9A 4YZQA 1OGMX 4XQFA 4HWVA 3B90A 4PMHA 4XONA 4AVZA 5C1EA 4XN0A 1RMGA 4W8RA 4URRA 4OJ5A 2PECA
chains in the Genus database with same CATH superfamily
2OUMA 2V1XA 3RCOA 3W3CA 1NH3A 4X8IA 1XSVA 2CUZA 4KUMA 4P55A 4PC1A 1X1AA 1Z7UA 2V9VA 4A2UA 1MJBA 1VQMB 4MEXF 4E6KG 4YZ0A 3VO1A 3OYDA 3W6VA 4TMTA 2EV6A 3ECHA 2QA4B 4HSTA 1Y56A 3H09A 5FJ8J 4RLFA 2W85A 2OK7A 3JU4A 3PSSA 3DCFA 2M1BA 1W0JA 2JRMA 5C4JJ 3CCQB 4EVIA 1O8FA 1Z21A 2NZMA 3HOYJ 1HW2A 2R4GA 4HG2A 2F4NA 5D6FA 3KL9A 2LD5A 3GW2A 1PXZA 4HNUA 4B44A 3JQQA 2K5CA 3JRHA 5ICCA 3C2HA 4P6VF 4OINF 3C7JA 4MTDA 4QTRA 4C3IJ 4S0HB 3F23A 1ETXA 1T39A 4LLGF 3I53A 1VQNI 3SZTA 4L9TA 4NK8A 4XLHA 4X1EA 2JMWA 2YPRA 1UD4A 2WZPP 2O0WA 2OPTA 2XAGA 2QQAA 5LFAA 2OK8A 3FM5A 1ZK8A 4LG3A 4LD5A 3A2KA 4Y15A 3TW7A 2XC7A 2XC1A 1J0RA 4PC6A 2RC4A 4J0QA 3W2IA 2Z99A 3OJWA 2OZUA 1CF7A 1ORKA 4E4HA 1VQ8B 3EQLF 4RMNA 2KIFA 3VMFA 3ERED 4BBRJ 5L3BA 3FXMA 3TOAA 2JJ7A 1TBXA 4RPDA 1QRYA 3GFMA 5K7FA 2R7FA 2QTZA 1QVGB 2RDPA 3BP8A 1ETYA 1RETA 2HTJA 5ILUA 2EIXA 2KRCA 2XGEA 1COWA 1DP7P 3AVUA 2F6CA 4ZDPA 1VQKI 3HZJA 5L3CA 2QTLA 2V7UA 2HDWA 1POGA 4WZLA 1TYXA 4HX8A 2QSHX 3CC2I 2JDIA 3LWFA 4RGXA 4CCMA 3L09A 5CVVA 3LAPA 2PMUA 1VHOA 1O8HA 4PJNA 3W6JB 3CCEB 2JA5J 3P4GA 4M3BA 1FY7A 4B43A 3ASQA 4M2LA 4L9JA 3G1LA 1O8JA 3G71B 2CRVA 3OZVA 2A5YB 4OJPA 1LEBA 3K4CA 3ZC3A 1Z6RA 5EJCA 2DT7B 1TVCA 4RD4A 4ZCIA 3PSFA 1AIRA 3F8BA 3IAM2 2MSYA 2WAQA 3ZXSA 4FCYA 1AA7A 3F72A 3DEUA 3CF2A 1HQCA 2LNBA 2OTJB 1KZHA 3AL0B 4IHTA 3EUKL 5IYRA 1CF7B 3ZMDA 4B4CA 3VOEA 3OYCA 2D74A 5H5JA 4MQVA 4HV6A 4F55A 4XL9A 2CSOA 2Q0OA 1BI1A 3DBRB 3K1NA 4DYRA 1ZM3A 4OZZA 1QGZA 1LPQA 3BROA 1E3OC 5F4JA 4WZKA 4UV9A 3ELKA 4L9NA 3OP1A 5IOZA 3G73A 2QGGA 1R1VA 1U8RA 2IRFG 4ZCMA 1W2BB 1BC8C 1W7PD 1O8IA 2F4MB 4RDLA 2KJCA 1Z91A 2ZC2A 4LBWA 3LOCA 1XDSA 5HDGA 4ZYGA 4CDGA 3KLOA 4XOTA 2C4TA 2C78A 3FZVA 1TTYA 2XASA 3M8EA 4D7NA 5THXA 4M9ZA 4M3EA 4U88A 2CUFA 2B0LA 6PAXA 3AKZA 1G3SA 2R7OA 1E2XA 2X6WA 1R5NA 2L7MP 4BDYA 1X1PA 4GCVA 1N78A 2X53S 1ODDA 1G3TA 2W25A 4JX6A 3OY9A 4D7MA 3JSPA 1EE6A 1QRCA 2NTPA 3CP2A 3DLAA 2VJ5A 3VYRB 4FHTA 3Q6QA 2IJLA 1FYKA 1OB2A 2UV1A 1UD5A 2FSWA 3LQQA 1WSVA 4G6IA 4Z6YA 1V5EA 5E8IA 2ZZFA 1XGNA 4R8HA 1I7PA 1YLOA 1RR8C 2F43A 4RJLA 3KYDB 1ZKGA 3E6BA 4NC8A 3KP7A 2HYGD 3J80Z 1SEUA 4XLFA 1A36A 2AS5F 3X2QH 4TKOB 3BQYA 4CGZA 5IPAA 2MA3A 2DOAA 4EM1A 3K4MA 4M6YA 1DUXC 2PE3A 4OOSA 2XGJA 2Y9YA 3VSTA 5TY0A 4HE6A 1UB9A 2LYCA 1FJLA 4EJVA 1JTYA 3HKZA 1HC8A 3I71A 4K1XA 4Z4RA 3PO3J 1IG7A 4IOCF 1ZR2A 1VQ9I 3SZGA 5K1YA 1HW1A 1PVEA 5HLHA 1R1TA 4M6XA 2QCOA 2W1OA 3RYPA 1OFLA 2EV0A 4IRHA 1S7EA 3FHZA 3AVVA 3U1DA 2CU7A 1N08A 1QUFA 3E5QA 4HNVA 1T38A 3ULQB 2QQBA 3U6BA 1OKRA 1ZRCA 2OAZA 3RIQA 1GV2A 2GIVA 2IGKA 2QUFA 1FMVA 3OJXA 3CO7C 2DFIA 2O61A 2VNJA 1H88C 1R49A 3JAMK 1YHQB 3I4NJ 1UAAA 1J75A 4U87A 2QN6A 5FA6A 3ONYA 2K3PA 5LD2C 1D8TA 4BY7J 4B09A 4ZZDA 3C2BA 5EG0A 2YWFA 5FD5A 2ZMEA 4DNTB 1MBEA 4W8TA 1JB9A 3CMEB 1H85A 3IC7A 1REPC 4DK0A 1KQSB 2Z3YA 1EA0A 3DPLC 1R5ID 2RQQA 5CQEA 3KZIC 2K9NA 3BG5A 1OCCH 3LFKA 4UZUA 1D0ZA 4RAZA 2Z6BD 1YLFA 4NNJA 4G7XA 4A3LJ 1FNBA 1HKSA 2EINH 2HQAA 4LBZA 4MNUA 3JREA 4IJAA 1JHHA 4XRMA 2FBHA 3HUGA 3L2CA 1VF9A 4KDPA 1GO2A 1HDDC 4ESJA 2VPLA 4DYQA 3M4OJ 2R7QA 5GAGJ 3Q38A 4DQ2A 1U8BA 1J09A 4RB3C 5FFZA 5HVQC 5FKNA 1B59A 2JIZA 1Y1WJ 1K6YA 1H89C 1SANA 1YOVB 4H4KC 1MDMA 3OMYA 1YJNI 2R6HA 4MFEA 2F3LA 1ZARA 4XN0A 3S3NA 2IA1A 2DAOA 3WTZA 3FMRA 2KKOA 4O3MA 4OPVA 1YG2A 4TMWA 3OEEA 1DABA 3SDBA 2STTA 2EZHA 2QWWA 4YHBA 1MMAA 5EG0B 2M30A 1X0CA 1P7JA 2ZMEB 5J40A 2QZ8A 5IT9Z 2QA4I 2NAZA 1S3JA 3ABTA 3DEEA 3EUAA 4EEFG 3ZQGA 1WOPA 2ZBVA 2M0CA 1DDIA 3QP6A 3RKWA 3SY2A 2PYGA 1S4MA 5C1CA 4ASNA 1N77A 5HXBA 1FP2A 4PFPA 2QYUA 2J8IA 3HAGA 5EZGA 1D1BA 1L0OC 4KIGA 3HUGB 3OZUA 2HFHA 3HC7A 1UZCA 4OIRF 2Q1ZB 3U2QA 3F21A 2PIAA 4KIBA 4ANJA 2MH9A 2JN6A 3FBIB 2WWYA 1G2HA 2P3MA 1ERDA 2GBYA 1TYVA 2NXNB 2ZITA 4ABZA 3N4MA 2P5KA 4F92B 4FE4A 4XLCA 4UVBA 1MDMB 5FL7A 1Y0UA 1W4MA 3ECOA 1YW8A 2YR2A 1D5YA 2ZB9A 2P6SA 4K2EA 3TP0A 1EFUA 2KVOA 1LVKA 1X1BA 1VQ8I 3KEWA 2CQNA 4X06A 2BYVE 3W2GA 3FKJA 1ZTRA 2R5YA 4OIPF 3ML3A 1W35A 1J9ZA 4IL6C 3LO8A 5KW9A 3ZZTA 3FXQA 5B5EC 3F9KA 5IP6A 5D5VB 1J7KA 4IOAF 1W5CC 2OQRA 2UWMA 3I64A 3QE2A 1A8PA 1UFMA 2QENA 1FP1D 1KYZA 5DCMA 3K70D 2LTPA 2ACJA 4A3FJ 2PMHA 2Z5UA 3PSZA 1IN7A 2JA2A 1QZYA 2X1DA 5JVTA 5FLXK 5AN9A 1OLTA 1ZLJA 4EM2A 3KZYA 3DPUA 4KISA 3ZMZA 3D0SA 2A61A 1FIPA 2DA2A 2L4AA 1SD6A 3MMYB 2HWVA 5F27A 3CCEI 2HYFA 3FMSA 2KJBA 2QMUA 2AQFA 2VXZA 2K7LA 2WTEA 1EXMA 3G71I 3CC7B 4TN1A 3CCRB 1T98A 2BE5F 2R7DA 3I4PA 3SFIA 3IAS2 3VYTB 1D1AA 3NRVA 3WBKA 3BCFA 4J19A 2V6CA 2EILH 1VBLA 2GK6A 1OGJA 4V2GA 1AU7A 3R6JA 2IAIA 2F4OB 4OAZA 3A1YA 4PC2A 2DMPA 2COMA 1NG7A 1YJ9I 2YX7A 3HBLA 1Q9SA 3I4MJ 4BQQA 5HS8A 3JRDA 3PJRA 2R5YB 2DDBA 4JP0A 3VSKA 3VO2A 3NWTA 2HYJA 3HL2A 1HF0A 1UD3A 4M72A 3LVBA 3A8JA 1G4DA 2ETHA 2KP6A 1K8FA 5J1UA 2WZNA 3F8MA 1EV7A 5A2QK 4URRA 4IZZA 1IXRC 5DCMB 2XTWA 3K10A 1QGPA 2VT3A 2ISYA 5M5WJ 1JJ2B 4J01A 3PFYA 5KSWB 2DTZA 3OYJA 1CNFA 3ASPA 4CICA 1DBOA 3GLLA 2FMLA 4OMZA 2DT6A 3E1YE 3HOSA 3RZDJ 2JVGA 3S1RJ 4HYEA 4PGHA 3CCLB 4I09A 3CO6C 2F5EA 4DYCA 2KT0A 1MH3A 2M0MA 3L9FA 3G6EI 5IYCJ 4M9XA 1VQ7B 3GFLA 3ZQLA 4TMXA 4LMYA 1TTTA 3FXRA 3V7RA 2B63J 3S2DJ 1Q82D 3FXLA 1RUNA 4LG0A 3JQRA 1XS9A 3ZSCA 5E1WA 1KCDA 1JGGA 3T0YA 4DGWB 1MBGA 1IDJA 5BSYA 3WTTC 3U6KA 3SFZA 2E1MB 3WNCA 2CWEA 4BEHA 4UAJA 2F5CA 1YX5A 2LY2A 1TC3C 1GVJA 1XD7A 2A69F 5DDGA 2V31A 3ZMVA 3OV8A 3LSHA 3HTSB 3WE2A 4Y17A 5K5RA 1RIOH 3QP5A 4IRGA 1UD6A 1QA1A 4W1UA 4CYDA 3LSTA 3EUHA 5DNSA 4G7OF 2LY1A 3WHBA 4XICA 3BY2A 2R7WA 4AIDA 5LHGA 4OJOA 2UXXA 4Y3OA 1JA1A 3GO5A 4HW0A 2QLZA 5E3OA 3ZIAA 5JI6A 2JWTA 4FETA 4YELA 2DCEA 4QPQA 1XGOA 2CQQA 1EJ9A 2Q2EA 1K79A 1BA5A 4N4NB 3MKWB 1YITB 2MC4A 3WTWC 3GQ9A 3NARA 3BR2A 5GADJ 3N90A 4N9IA 2IT0A 3BR6A 5CKTA 1QH0A 2CV1A 3OSFA 2R0QC 4RDUA 2DJIA 4YEJA 1PKVA 1VQ6B 2V1UA 4YZAA 1USTA 1X2MA 2XPWA 4F3QA 1NJID 4MTEA 3R6KA 4LG0B 1LLWA 1R5HA 4D5CA 2NOGA 4PCQA 2GXAA 5BPDA 4RB2C 2VLAA 1OFCX 4BJ6C 3K4NA 2M8EA 3CMEI 3GCMA 1BN8A 4JMQA 4BEHB 2CNDA 1SFXA 1YS6A 2XROA 4LOCA 1E63A 4B3FX 4YFOA 1R58A 4Q48A 4HV5A 1QVTA 4IQ4A 4CXFA 1OR7A 1OMIA 2EZLA 4HOBA 3S32A 3OSGA 3I1FA 1M1KD 5HDNA 3BJOA 1LVAA 3AVYA 1QPMA 3GRHA 4CYCA 3O8GA 1BIAA 2VXDA 3TDUC 1SFUA 2M34A 1VFCA 1F60A 1WU8A 1VQ4B 4LJZF 2IBDA 4A3IJ 3EPZA 2XAJA 3B73A 3WY9A 3GZ5A 4S05A 3U2RA 1E43A 3JRGA 1TP4A 2Q2EB 2R7XA 4ON0A 2VE8A 4AVPA 5J47A 3AGPA 2PQ8A 2ZXHA 3PM1A 1JKRC 4BXXJ 1Q86D 3PQJA 2TCTA 1YX2A 4ZCLA 3CTAA 1VQOB 2Y0MA 2M5WA 3FXJA 4Z1MA 3I55B 1B1BA 2PECA 2FF4A 1CLWA 1BBYA 2BHYA 4WF2A 3NQOA 1IRXA 3TO7A 5L3DA 2G9WA 3TO9A 3QWLA 1K61A 4WWCA 1ZRFA 2VBTA 2VFOA 3FBNB 2VQLA 5FO1A 4YCQA 4DZJA 5K5QA 1USSA 1KC8D 3AVXA 5TGTA 3HOWJ 2P7CB 1TL8A 2VKDA 1YIJB 3CESA 1BJAA 3FXUA 2D3NA 1E3ZA 1MZBA 5K7HA 2OCCH 1WORA 4DBQA 3E7LA 3K1PA 2F1LA 4MIMA 2XT2A 1EZGA 1MH4A 3K70C 4D5FA 2JA6J 5E6TA 3WG7H 5DUKA 1T95A 2XF7A 4CYCB 4BPRA 4YAWA 4L5EA 1OPCA 1HBXG 3V8LA 4UNOA 1F36A 3GZNB 2JUGA 3ZQ7A 2B9SA 1IJEA 4OPOA 2H6CA 5EEGA 3TQNA 1GXQA 3ZUGA 3UW0A 2A5WA 1JI8A 3EYIA 1R1UA 1R7JA 3VMWA 1PLUA 3HYIA 2E2IJ 3BTIA 2KDZA 2GWRA 2DA3A 1AHDP 4OOXA 4P9SA 1TWFJ 3PENA 4Z2YA 2HDNB 4II2A 1NDHA 1P9QC 3ZN1A 2L9RA 2WY8Q 3JRFA 2W48A 4Z4VA 2GM4A 2I10A 2QF7A 3WYAA 3IKTA 1KU2A 3MD2A 3V76A 1V5VA 1QNTA 3D1NI 3MZHA 3SDGA 3I56B 2QX3A 3H35A 4AIJA 4JYKA 1D0YA 2NNYA 2H1LA 3LA7A 1IB0A 4X0CA 2YWGA 5CJ9A 3BC9A 3SYJA 2LRDA 4MFDA 4WXCA 1K4ZA 2ID6A 2L7KA 3LJYA 4EMSA 4DZPA 1IV6A 5TJJA 1ETVA 1MBFA 1A35A 3S1NJ 1LE8A 2WV0A 2AO9A 4F91B 1CQTA 2DBBA 3GWZA 4RLQA 4X7CA 1R5GA 4ZV4A 3VPRA 2XRNA 3LA2A 1WOOA 4BS9A 2FE3A 3I5UA 3CCRI 3CC7I 2BVMA 1A5JA 4P3IA 3T51B 2LBFA 1BR4A 1JUSA 3OR2C 5KNLA 2HQRA 3HRSA 2BM5A 1VJSA 5IYNA 2LMDA 2STWA 2A6HF 3BTCA 4AIKA 2NYXA 4C2MJ 2EFPA 5L3FA 4G7ZF 3WGGA 4HZFA 1RUOA 1K83J 4IRIA 2CGPA 2DA5A 2EJRA 2VASA 2WA0A 5JFRA 1CQXA 4AC0A 4QVJA 2NTBA 2FD5A 3ZQHA 3WE3A 3DDYA 1WJAA 4IHXA 2XSJC 3GQBA 4ENNA 3CJQB 3MMPA 3OAAA 2BZTA 3LSIA 2FOKA 1S7AA 1ETWA 1BI2A 2ZKZA 3QPTA 3ABUA 5BS6A 3QSYA 3CJNA 4EV0A 1BR2A 5E18F 1JUMA 3PSIA 4B3AA 4IX7A 2HI3A 4YIRX 2M5SA 4V19K 2LR8A 1JE8A 1DG1G 1VQLB 3BLYA 4ASUA 1Z0XA 3FKSA 1ZG3A 5KHDA 1IC8A 4OP7A 4Q4ZF 1T08B 3MFKA 3Q0UA 4X6AJ 3ZPNA 1TWGJ 1XTAA 1LE8B 2M3AA 2WAFA 2C77A 1AKHA 1A31A 1FNDA 1OJLA 3CUQA 3CCLI 3O8HA 3O6BB 4Y13A 2CW5A 1WSRA 1RNLA 2FMYA 2X8KA 1IXCA 4G1VA 2V7XA 4KH3A 2ZNYA 1WJ5A 2LBFB 2W6JA 4AWXB 3ES9A 2BVLA 4PJMA 5J3OA 5D6EA 1GUUA 4XSXF 2NT6A 4I98B 3BWGA 2PFBA 2ELJA 4L0ZB 4BACA 2CH0A 3JRAA 2AXLA 4AC9A 1SD4A 4NUBA 2MBFA 1ZRDA 2TDXA 4P2NA 4CCOA 1YJWB 2V6EA 3BOQA 3OIOA 1MKMA 3Q3SA 3F22A 1WXRA 4OOVA 2EB7A 3ZZ0A 1VHEA 4ACBA 5JHFA 3WU2C 4L5IA 2ZSIB 1X1CA 4EJWA 3BDDA 1QBJA 2CJJA 3GTKJ 2L9SA 3GTQJ 3OEHA 4QHYA 1FOYA 2FNAA 5M5YJ 4I99C 3I0TA 1WRJA 4XK4A 5EEAA 3WXMA 1P2FA 4JK1X 2HCJB 3WTXC 3HOZJ 1SKQA 1ULYA 2VJ4A 3AFHA 3LSGA 2XF5A 3P9CA 4KT6A 1GXPA 1BL0A 2EFOA 1X3UA 2G7UA 2XAQA 1R6RA 5J1YA 3WGIA 5BMZA 3CD6B 5DEQA 1GJRA 1YITI 3C1DA 3H9GA 5ICFA 3N97A 2H94A 2XB0X 2HDCA 4KKSA 2OTLB 1LEAA 3CMAB 3WQZA 3CUQB 1QPIA 5IY5H 1TYWA 1E64A 1NBMA 2QXZA 4YDTA 1UD2A 4M9SA 5CDFA 3J7ZI 3BZ6A 2ZBKA 2D3LA 1S9HA 1T2KA 3NAWA 2LG4A 1IW7F 2RNJA 2WV1A 4MQ9F 1XGSA 4CCJA 2COBA 2DFEA 3A01A 4E7LA 5FROA 2LKPA 3A1PA 1F9NA 1I39A 3BZKA 2H6BA 2DERA 2IQ7A 1IRZA 2OBPA 5F1JA 2Y9ZA 2P0WA 3RKQA 2X4HA 4HLYA 4B3XA 3DKYA 3H5RA 3BG7A 1MNMC 1H8HA 2VBXA 5HS7A 3DLLF 1D1NA 5JLVC 1T8IA 5HODA 2VBKA 4ZYAA 3CUQC 1G7SA 2MD5A 2VL8A 1SVOA 2W57A 4PFOA 1N07A 1KZLA 4P96A 1Y8RB 3KP4A 1W0KA 1SD5A 5HLTA 4D1QA 3Q5FA 4OZYA 2JTVA 1ETQA 4G6QA 1NK2P 1EFRA 4YC5A 2GA1A 2BGCA 3J7AO 1JNYA 1N05A 3LSRA 2CQXA 1RZ4A 2L7FP 2DYRH 3JAMZ 3ZQCA 1LB2A 3LMWA 4U4BA 2KISA 3PNVA 1STZA 3W2VA 3K2AA 4AM3A 2O03A 4Y52J 2H27A 2HOTA 1V55H 4YZQA 2MD0A 1XX5A 2FX0A 3B90A 3GTPJ 5A89A 3OOCA 1VQOI 3OS0A 1TWCJ 3ONUA 3V7AA 2HNHA 5JLXA 4BH9A 4UZFA 3GBGA 3GYHX 4C3JJ 3A01B 2E1RA 2XAHA 4XNFA 2AHQA 3ZBTA 4F7DA 4YRVA 3GIRA 1WWXA 4DBRA 3K4JA 1MMNA 1NK3P 3S1QJ 2QEXI 2MC3A 2VI6A 3O3KA 2L54A 1A04A 4CCNA 2UZKA 2DN0A 2VJJA 1YIJI 2WADA 1L3LA 2GK7A 3E5UA 3HHGA 4CZZA 3KP2A 2OC6A 4CO8A 1WPCA 1H9GA 3FISA 4Y4RA 1U3EM 2HS5A 3L00A 5DCFA 3H1CA 4RS8A 4IXAA 3BY1A 2IS4A 3L7WA 3CP8A 4Z4YA 2Y0SN 1K7AA 1FRNA 3AG2H 3DPTA 3H3ZA 4ETSA 2VPRA 2CBXA 4M53A 2NT9A 2ZL6A 2VBWA 4TMZA 1BX1A 4LFUA 1P4WA 3MKYB 3VSLA 1T6XA 2Z8GA 1JT6A 3M3YJ 3SJPA 2NTQA 2FJ1A 2VIXA 2XAFA 2DK5A 3ISPA 1LQ1A 1FIAA 4ZGNB 2FXAA 1VLOA 1OFEA 2VONA 3KE2A 4JBAA 5D8LB 1QGAA 1APLC 3E3VA 1HKQA 4RD3A 2XZOA 2M8GX 1K9MD 4G7WA 1MMDA 1OFDA 2XNCA 3GLXA 2R7SA 2DEUA 3CCYA 1QQIA 3J81K 2RVCA 2DMUA 2JRTA 4JQFA 3I56I 1KCCA 3QU3A 1YTYA 3KYLA 3KP5A 2CQKA 5J3LA 3D26A 3F8FA 4RDJA 3GX4X 1KK1A 3SZEA 1JJ8C 5ERIA 2HXOA 2C2WA 3V7CA 1G7TA 3WNBA 2LOOA 5HS9A 2ZTNA 2M7BA 1LDDA 4FISA 1R71A 5HLIA 1F4KA 5CYVA 2E35A 1MABA 2V1NA 2FNPA 1XCVA 3QOEA 5DYMA 1ELOA 2QBYA 2VODA 2X0KA 2Y2ZA 1N06A 2BM1A 4EH1A 3LSKA 3CCJB 1LJ9A 5DTDA 2CYYA 3A0BC 3A02A 2ZJRF 2NS8A 3KRGA 3TH0A 3IP4B 2VBYA 1EA3A 4AYBN 3U1KA 2Y75A 5IT3A 4RA2A 2F2EA 1LFPA 4RGUA 5LEKA 4N0BA 5JVGF 1FTTA 4UVAA 1FX0A 4P6YA 5A8AA 2X9DA 4IHSA 1YW7A 4Q47A 1PYVA 2P4WA 4M6VA 2W82A 2VZLA 3M7GA 2K85A 1IJWC 3ASTA 4ZYEA 2C5BA 2Q8KA 3ZQQA 4KKUA 1LUJB 1R22A 2C6YA 1R00A 1NRKA 3PUBA 5FLXZ 4ZYDA 4BJTA 3BH6B 1ZR4A 1OQYA 2XV4S 2NVYJ 3BPVA 4BHBA 1TLHB 3RZOJ 1W87A 2O6WA 2DFFA 1DQUA 1VQLI 3CCMB 1RI7A 4BQNA 1DGRM 2QSGX 3W5HA 4P25A 4PGOA 1KTWA 4F7ZA 2VBUA 3I9V2 2WBMA 5ILVA 2BW3A 2O8XA 2GOXB 1QFJA 4RD6A 1FX7A 2BM6A 3LSMA 2VOOA 2IP2A 4H0EA 5BPIA 5EF6A 2KHMA 3JRBA 2CK3A 2E1NA 2KIQA 1ZH5A 2DT5A 3Q39A 4HDUA 3KPHA 3FPPA 2HZTA 3BR0A 4EJOA 4E0FA 2NVTJ 3CZ6A 3QYFA 1PDNC 3KETA 1XFOA 5A88A 1SVMA 1FZPB 3B78A 3DU5A 2Z2SB 2XTYA 4P3YA 3IH3A 1QHHD 1XN7A 4G7HF 4PJLA 5E1XA 4M3FA 4MEYF 1W7PA 2XNDA 3JTGA 3DEWA 2VBEA 3CB4A 1ETKA 3PA2A 5LEJA 4UVCA 3FMQA 5FRNA 1W34A 2VJIA 4BGDA 4RB1A 2VB6A 3BR1A 2A07F 1VQMI 2XZLA 3CDLA 3DU6A 3BR3A 3E6CC 1EP1B 3PO2J 1BHEA 2L3DA 1D3YA 3JSOA 3IUOA 2V79A 5CQGA 4Z4WA 2EWEA 3FX3A 3D5LA 5F4MA 2LF8A 3JCUC 5AIPA 1WI3A 2Q6IA 2IGOA 5LGNA 4PC7A 1QA3A 4XORA 5TV2A 1X4OA 3CJTB 3QU6A 2KFDA 4R1HA 3CCQI 2X3UA 1J2XA 5IYWA 2IPQX 2NVQJ 1XE1A 3W2WA 3W5VA 5J1RA 3SJZA 2YUSA 3OPOA 3BTLA 4Y7NJ 2ZCWA 1GVDA 1U5TA 3U21A 3CRZA 1LM1A 2VNHA 3SUCA 4XLAA 1MMGA 2ESHA 5BNGA 1BIBA 2CUEA 4YG2F 1CZFA 1O8GA 1DU0A 2YUHA 1FSEA 3SKBA 4B4DA 3AG3H 2MLGA 1O7LA 1H9TA 4Q5SF 1SM4A 2PMDA 1RU4A 3HG9A 4RM2A 4HF1A 1JA0A 2BSAA 2XF6A 1QA2A 1PJ5A 2NVUB 2C4UA 1W1WE 1JRGA 4EW9A 5HDKA 3WWGA 2HKXA 1UHMA 1W7PB 1Z67A 4XRFA 1BJZA 4O5VA 3F6OA 3V42A 5M3FJ 1HVXA 1M90D 4P1WA 4A3CJ 4ZH4F 1WPKA 4TSFA 2L4MA 2JK3A 2YS9A 2W6IA 3ASSA 1N75A 4G8XA 2L5QA 1D1CA 2QYOA 4UB6C 1X4PA 3T5XA 4V02C 4KITB 2F5FA 1EWYA 4W8SA 3DFGA 4A6DA 3UR3C 3RPUD 5LLQA 3CMMA 1BQEA 1Q1VA 1Z3YA 4LB6B 3SZPA 3ABKH 1QVUA 3HSFA 5GTIC 3EQNA 1UMKA 3QYBA 3R61A 3TP3A 3WTSC 3M8JA 2EA4A 2RC6A 2K40A 5M3MJ 1WH7A 3TL4X 4HF0A 2EPFA 4I76A 2IA2A 3RPQA 2B7CA 4X05A 5H59A 2DCUA 4XIDA 1W0TA 4B3GA 5CVRA 4WX9A 3EQOA 3BC8A 1U5TB 1H42A 1FLIA 2L0KA 3ABLH 3GVLA 2CUJA 5F6FA 5IP7J 1KU9A 2D1HA 2F5DA 2MH2A 2VC0A 3S2WA 1B4AA 2CO5A 2ZTGA 2ZXWH 1YW9A 2OD5A 4BUPA 4XD7A 4CCKA 1X19A 4I02A 3QRFF 4OJ5A 2BY1A 3VSUA 2WC2A 1XSDA 3ZRGA 1N8RD 1HF2A 1R23A 1TT0A 3JTHA 5DD4A 2R7TA 3W2FA 3H36A 3CCVB 1OHHA 3LQ6A 1S72B 3I58A 1O8LA 4GYGA 2K3FA 2FUG2 2HEOA 1KQ9A 1QCXA 2OTJI 3M9AA 1U5TC 4KYWA 2GJRA 4YALA 4ZZLA 1G3YA 1SVLA 2D5VA 2QVOA 3LNQA 3SHFA 1Z3XA 4A5MA 1NHAA 4PSXA 2W84A 2NPFA 1YI2B 1S8NA 2EIJH 2VKVA 3S15J 3A3BA 1FNCA 1WJDA 3HOTA 4I6ZA 3FHNA 5LHIA 1Q81D 5LMZA 3CDIA 1T6SA 4HPQA 2MG4A 2OF7A 5F0CA 3IRRA 2QSFX 1FSHA 1EKEA 1DDGA 4FQGA 2HLDA 1UJ8A 2R7RA 2IS1A 4NCNA 2EV5A 5CVJA 3NAUA 1I6HJ 2V4JC 4E7IA 2Y0SA 2OBSA 1TSPA 3K6GA 3HIFA 2DXIA 4UUTA 4EGZA 1QUEA 4A3GJ 2E2JJ 3H9JA 1JKQC 1D8JA 2MYSA 3WTYC 2JJ1A 1BM9A 4RM0A 1MBKA 2DOEA 1OOCA 5B1BH 3IL2A 5M5XJ 2BGIA 5HNHA 3C2GA 3WBJA 2A68F 1PP8F 2HVRA 2HXIA 4HRIA 4UZEA 1V0EA 2IGNA 3ZN0A 5JHUA 2LREA 4J00A 3EYYA 4BAYA 1IDYA 1H0MA 3SQNA 4OMYA 2R7ZJ 3TMOA 4X7FA 4DJAA 1DBGA 3O2PE 4QIWN 4P9UA 5IT9K 3GFJA 2IW5A 2VYQA 2WR8A 4HE5A 2XPUA 1OCZH 3ASNH 3P7NA 5EMNA 3R0AA 1ZGWA 5GV8A 3CCJI 2FA5A 3S3MA 3B02A 4ESBA 5FD6A 5D4RA 1DPUA 2Q6OA 4NBSA 3K1MA 3L1PA 3HM5A 1TT5B 3OYLA 3AK5A 1IUFA 4CCLA 3QFRA 2Y30A 1R4NB 1M1EB 2D2WA 3IRQA 3SLNA 3TBIA 4P1VA 4MR0A 2VQHA 4BYYA 4A3DJ 5IK2A 3SJMA 1BPLA 3GXOA 3GTMJ 1E3PA 3ZCOA 3S93A 3KYCB 4BE2A 2HPMA 3B6CA 2VFMA 3ONQA 1LDJA 4XKWA 5LHHA 4AD9A 2F1MA 3PVDA 3QOPA 1NTCA 1YHQI 2BX6A 3W2AA 4RCYA 1TQIA 5JR3A 4H9GA 1U9NA 4QFMA 3H9QA 3KEYA 5FGMA 4GRIA 1HCRA 3BH7B 5EDNA 5TR9A 4AYBA 1OYYA 4C2UA 3CJRB 2VNKA 4HIZA 3DTKA 5K7ZA 2H09A 3OYIA 2BBYA 5FKKA 5FLVA 3M1EA 2XEXA 2K4JA 4HLXA 1I18A 3PETA 4CSWA 4BKXA 4A0YA 1U2WA 2DY1A 5DS0A 2V7FA 2DA7A 4DK1A 5J8CA 1O88A 1Z05A 2GQQA 4ZJZA 4RGRA 3SEZA 5FKOA 3CLOA 4IHWA 2LH9A 2CW7A 2WJVA 1IXSB 2ZXJA 3R0JA 1VZ0A 2FU4A 3IHUA 3V8JA 1E79A 1QG0A 3ZZUA 4Y9RA 3A0HC 2ZFWA 2DYIA 1WGXA 4HX4A 4DNCA 1G7RA 1I50J 4L5JA 3WNDA 3HTUA 2BSPA 3FXKA 2E71A 2QE7A 1KK3A 1IF1A 4A3KJ 4YAUA 4AUXA 4KMUX 4MXNA 4W97A 4A6EA 2I1LA 1W9XA 3PIPF 2HR3A 1SFKA 2E7WA 3DF8A 1EFCA 1MNDA 3H5AA 4U7DA 2IS6A 3WTUC 3SYTA 3MVPA 1V3FA 1WOSA 2Z33A 4HBLA 1QFZA 4IQJA 2XRLA 4NBQA 2K9LA 3VMVA 5F04A 1RPWA 3VDXA 4B47A 2M87A 1TW2A 5J35A 4F93B 2JPBA 1SAXA 2WSSA 1FYMA 1E1QA 1OB0A 1IA5A 1TNSA 1SKYB 3E1SA 3VYUB 1ONVA 2BV3A 2E1OA 2GQFA 5ILSA 2EFWA 3LSJA 1VTNC 2GPJA 3H9NA 1ZGAA 4A0ZA 3GF2A 1XSXA 1O7FA 4Z4TA 2IEKA 4FASD 2AXTC 1EH8A 4U0VA 4UUSA 1O8DA 2LDUA 3OYGA 1MW7A 1WH5A 3F0CA 1KYWA 2UVFA 1O8MA 1IJFA 3MWMA 2VT2A 3ZBUA 3MAJA 5C3EJ 1HXDA 4ESFA 1QX4A 2PLFA 4BHCA 1ZM2A 5B6IA 3VB2A 1JKPC 1B2RA 1KQ5A 3FK7A 1BI3A 1OYWA 1XMAA 3A4CA 4L8JA 1I27A 2NNNA 1XDUA 2JSPA 4X7EA 1CGPA 1Y0NA 3AG1H 1ACIA 2DETA 3RTRA 1H80A 4RPBA 2JSCA 2EFNA 3ML6A 3GQ8A 4XR6A 1VQ5B 3BTJA 1VQPB 3A3GA 1T6ZA 2ID3A 2R93J 4U0WA 1KMHA 3E5XA 4XOPA 1X1DA 4EM0B 1W0UA 5HNFA 1FOKA 1E0EA 2V7VA 4P22A 3KCCA 1IUYA 2E5ZA 1T0FC 2MW8A 4C2LA 3OS1A 3HEFA 4MLOA 4RAFA 4OAYA 4LBYA 4MYUA 1BOBA 3QYEA 1XMXA 4ROXA 1QJVA 3DV8A 3M07A 2OBTA 3E6MA 1EH6A 4D0PA 1MNEA 2BV6A 1B9MA 2LF7A 2Y48A 4UUSB 3ZGKA 3A35A 3ZPPA 4XLEA 2DYSH 4YEIA 1BLIA 2GXGA 1W5TA 3NEUA 3F8NA 3RI4A 1LFBA 3KFWX 3MEXA 1FDRA 4Y33A 1JTXA 2GAUA 5C44J 2JUCA 2YWEA 1DGWY 4I0AA 1V54H 3NWSA 3JQPA 2LP0A 5FIUA 3W5UA 3G4SB 1R4MB 4XRSA 3U9GA 4RD2A 2H1KA 2NSPA 4X0GA 2DODA 5DM7F 3AGQA 3CCVI 1PJ6A 1WJBA 1ZQ3P 5BOXA 1F43A 1Q1HA 3DBLB 1UELB 4EATA 9ANTA 1FMWA 2YU3A 3K4KA 5F4OA 1YO5C 4LGWA 4G6DA 2ZJPF 1EP3B 1VF7A 2V7QA 1QA6A 4XMYA 3I54A 5AIQA 3P9KA 5D5XB 1WHUA 2ZXIA 4R79A 1VQ9B 1PJRA 3JURA 2P81A 2QQ8A 1P7IA 2GIZA 4M74A 3QAHA 3CCUB 3HJEA 3V4GA 2BVNA 2VFPA 5B1AH 5HOOA 5FKLA 2CMPA 2YWHA 1OGOX 2EFQA 1QU3A 1OFMA 5E3LA 1BI0A 4DNRB 3CPWB 3OFNA 5GAEJ 3VR6A 2ECCA 4RDKA 3LSPA 2D1VA 4F52A 5F0HA 1B9NA 2RV8A 1ON2A 4BXUA 1LFUP 2DA1A 2Y69H 2B7EA 2V7WA 1N25A 1ZG1A 1VQ7I 3GTGJ 2R5ZA 1QVFB 2N8GA 2ZSHB 4DIQA 4PSWA 5D4SA 5EYRA 4ZDLA 2D9RA 1YQAA 3CUOA 1UHWA 2BOLA 1HZEA 1O4XA 3JW4A 3WGHA 2KL4A 1G8XA 3P9IA 2IVMA 2QQ9A 3L2RA 2DU9A 2WPDA 3GMEA 3K7AJ 2XVCA 4CUGA 2ZL7A 2X3HA 3IWZA 2NS7A 4P5OA 3DWLE 2O3FA 4BJ5C 2PYHA 4QLCU 2JN9A 2EBIA 2LVSA 3FXOA 2IS2A 4OIOF 4QVAA 1I3QJ 4E7SA 3CMYA 3UKGA 4OJ6A 1KA8A 4IHVA 5DS9A 2RGVA 4WK8F 2CRGA 3RY8A 2Q6KA 2JA8J 3T56B 1KTVA 2KPMA 1KU7A 4IEJA 2KIMA 1GQ8A 1FBSA 2ECBA 2F48A 2L2OA 1N0UA 4A3EJ 3WTVC 4OJLA 5E20A 1TWHJ 5AMVA 1U9OA 5CPRB 5GPAA 3TW6A 4XM3A 2K9SA 4FTHA 3J81Z 1YJNB 1P6RA 2HOAA 3KX2A 2M9HA 2X6XA 1XC5A 2Z16A 2K86A 2E7XA 4BXFA 2Z9OA 3P26A 2LKSA 1R9TJ 4XLPF 3DKXA 1AKHB 3ERMA 3BH4A 1WDTA 3HB9A 2R5ZB 2FEZA 1WFXA 1VQ6I 5C4XJ 2V5IA 4UB8C 4IF4A 1I1SA 2MLKA 1HSTA 2LLKA 1X3WB 3ZMUA 2X0LA 4C30A 4PC3A 4ENJA 1O3SA 3FK6A 4G9YA 1MMSA 2X1CA 5B3SH 4KKTA 5HKKA 1D5VA 2DIEA 1F1ZA 3R60A 4B48A 1KONA 4GO1A 4MGRA 4UV8A 4HWVA 4HAMA 4P9FA 3RKXA 3BQZA 3LYCA 1G59A 5JMCB 1FT9A 3R6SA 2K27A 1MBHA 4NC7A 2HPIA 4XKBA 1YS7A 4W8RA 1G7CA 3T8RA 3FJOA 1OCTC 4YXWA 5E79C 2NOJB 4U49A 3BPXA 4A3BJ 3MZ8A 2M45A 1A6IA 2VBVA 2DA6A 2PG4A 4UY8I 2O0YA 1Y0YA 3RJPA 4WQMA 1VQ4I 2V26A 3HOVJ 1GVHA 3QODA 2LY9A 2DPDA 3A8KA 3BT9A 2BM0A 2ZO4A 1UCRA 1ZM4A 4FXUA 2ZL5A 5L3EA 1D2EA 1FPQA 4PAAA 1WMRA 3MKZA 3T9GA 4BHPA 3HGYA 3WODF 2V9KA 3H92A 4G12A 2XKPA 1H8AC 2OJED 2HVQA 4QV2A 2X51A 2D45A 4PZJA 3OYBA 3Q6RA 1SFOJ 2XUBA 3I55I 4XBFA 2RKHA 2ZJQF 3Q0VA 2GLOA 4U9UA 5ICGA 2V1DA 2AQEA 4C43A 2V7TA 3OS2A 1NB9A 1O57A 1G6NA 4CQJA 4KA4A 3BQJA 2XDVA 4FWTA 1W36D 2IGMA 4S04A 2WB1N 2DMQA 5CLSA 4PJJA 5DD8A 2BM4A 2DPUA 2IA0A 5ICEA 5HZBA 2HZDA 3LL7A 3LAJA 1D0XA 5IYBJ 1FOXA 1FBUA 3BG3A 4ENKA 2EZIA 1HDPA 3J7YJ 3A03A 1F5TA 4CZCA 3OZWA 2INVA 1BR1A 3PNYA 2INUA 1YRNA 5H20A 2BHZA 4YFXF 3FDYA 5BQTA 4ZTJA 2RAEA 1LKXA 4D9JA 1RQRA 3B4NA 1I6XA 3GZ6A 1O8EA 2O6GE 3CW2A 3KEQA 3P5JA 4FE7A 3MQ0A 2E2HJ 3KLNA 2X6OA 1K4TA 2H8RA 3BY6A 4RM3A 2PJRA 4UUVA 1TUIA 4C0SA 2W7ZA 2YSRA 1WJFA 5B66C 3J7AY 1N0VC 1BW6A 1Y0RA 1YJ9B 2VBMA 1FEXA 4U0YA 3VNUA 1YIOA 4RGSA 3EETA 1V0FA 4EQQA 1VQ5I 4EJTA 1VQPI 4P26A 1R5BA 1XQBA 3NB2A 2GZWA 2EK5A 3G1OA 5GP9A 2P5VA 5GTHC 2NV4A 2DDAA 1Y39A 3PA1A 1SMYF 4HQMA 5H6RA 2PLYA 4ZC3A 4DOZA 1Y8QB 4FK8A 1ON1A 2PMZN 1XB2A 3FM3A 1OYIA 3HRUA 2KLOA 4JX4A 2J8KA 5J8FA 1MJAA 1L1IA 2AHOA 1GAWA 1T5EA 2LSOA 1RESA 3AL0C 3H3UA 2HQNA 1Z9CA 1MRZA 2NVXJ 2EQRA 3S17J 4KJZA 1KK0A 4E70A 5F1RA 1GHCA 2B0RA 4ENMA 1FNNA 2DTRA 5E3NA 3JRIA 4GDFA 2VFNA 3QQAA 2M2EA 3G6EB 1ZLKA 5IYDJ 5CVUA 3B8YA 1YRNB 2XT4A 4G5GA 4AF6A 1OGMX 3FPKA 3QPLA 2DO7A 3OYAA 1PUFA 1FBQA 1ETOA 3S2HJ 4N3GA 4OM9A 3K0LA 3G4SI 3GTJJ 4AVZA 4C2TA 1XGMA 2E19A 4Q7JB 1Q7YD 5D5WB 2PJRB 4IKFA 4LIUA 5K5OA 3GTLJ 1RKTA 3S16J 4YIFA 2EIMH 1U6GA 2XGXA 1K6OA 2HOEA 5LRRA 4UXNA 1BN5A 3BJAA 1I5ZA 1IRFA 2WYRA 4QPOA 2OV7A 2XGCA 2MFZA 3QFSA 2QDXA 1IO2A 2DOFA 3LFUA 3OWTA 2XHKA 2I5UA 4AIHA 5HZAA 2R3SA 1MSFC 3CF5F 3HDDA 2ZZGA 1HA8A 4YFKF 2EIKH 4YAFA 3CCUI 4OU0A 2V4DA 1WSUA 5F64A 4DW6A 1B8IA 3B8HA 4HNTA 1IN6A 1X2NA 2PI0A 4I2OA 2ESNA 3E6DA 3C3WA 1DP3A 3OIQA 4MHGA 1K73D 3BCAA 4M4SA 2A6EF 1XB4A 2JJ2A 3H0GJ 2FBKA 4NHJA 4I0BA 1LNWA 4C3HJ 4HEA2 4MYTA 2J5PA 3G2BA 1DDNA 2LK2A 2QBYB 4WWVA 2O17A 4RBOA 2ELKA 4AU7A 2VE9A 2ICWG 3GUDA 1SAUA 2KZVA 2DMTA 5IOYA 1Z7LA 4WZEA 1ENHA 2ADUA 4RD1A 3DTEA 3MCZA 3BCDA 3G05A 2KDOA 1TZLA 2L9NA 3LA3A 1K78A 3BG9A 2O04A 4L9VA 5DN6A 4LLNA 3V7SA 1UHSA 3DP7A 5FRMA 5BSXA 2BPOA 4R71A 4PK4A 2R92J 4G94A 4WCGA 5A2QZ 1YJWI 4M3GA 4EJUA 5J4YA 1DU6A 3KP6A 1QHGA 3OYFA 1YX3A 4I7HA 4ACAA 1XCBA 5FB2A 2O7OA 2G0EA 4E7ZA 2HQ5A 1YFHA 3SLDA 2P6TA 4N4OB 1K4SA 1H8EA 3VNVA 3COAC 1B8IB 2TRTA 4LITA 4BQOA 5GAHJ 4ZGQB 3DU1X 5JLWA 1IGNA 1YYVA 3OYMA 1IRGA 3CD6I 2IXSA 1U78A 3GQAA 4CA0A 4IO9F 2BW3B 5AONA 2OTLI 2VKEA 3CMAI 1WP6A 4OPSA 4YZXA 2J5OA 5DUIA 3IV5A 3IH4A 5EGOA 3L2UA 4BNCA 3CC2B 1TYUA 2X6YA 1KRHA 3E97A 2CS3A 3HGGA 5IYPA 1K78B 4XRSG 3FWEA 4DQLA 3CC4B 2ISZA 1BOAA 1J59A 1PE9A 4BQAA 3CCSB 2K9QA 2XKOA 4A12A 1LLZA 4G6TB 4TMVA 2GJKA 4Z4UA 3SEJA 2E5NA 3Q0WA 2XTXA 4O6JA 1PUEE 1W36C 1P4XA 2O8KA 1VNDA 2W00A 1B72A 1BMFA 3HSRA 3TGNA 1S29A 1TW3A 3MCAA 2WY7Q 1ZN2A 2OQGA 4HA8A 2ME6A 1IZ1A 3M8FA 4M0LA 3W2EA 2RNGA 2ZMEC 2EFGA 3OYNA 3J80K 3L2WA 1SMTA 3KEOA 1RR7A 2CF4A 1OB5A 5E8GA 1PP7U 3HPGA 4OWRB 3GQ7A 1JTAA 3OL3A 1XMKA 3V8KA 4GQNA 2RC5A 1SFEA 2BXYA 3L2VA 2YU9J 3ZR8X 3DBHB 1QZZA 1O8KA 3EDPA 2OU2A 2VQGA 2DFHA 4IPAA 2BXZA 5EGOB 5ED4A 1JGSA 3BR5A 4BBSJ 2KRHA 2BGJA 3GEZA 3MZYA 3GFIA 5F0FA 1RQPA 3D5SC 4II3A 3WG9A 1AWCA 3I59A 3BNWA 2O9LA 1IV8A 4OIQF 2HVSA 3C18A 3RIRA 2ELHA 3LMMA 2KRFA 1GR1A 3IKVA 4Y9UA 1OISA 4YAOA 1Y1VJ 3SQVA 1AIPA 1IAWA 4BDZA 5FFXA 2F4IA 2PN6A 3TO6A 2M4KA 5KK1A 4C9YA 5LGUA 3AAFA 1B72B 2XPVA 2QM3A 2QY1A 4HDVA 1ZGJA 3LQRA 2CFXA 4U7BA 4CHUA 2LC2A 5DM6F 3N05A 2Z1DA 2L7ZA 5E1ZB 4E7HA 3I3LA 1MD0A 1HLVA 4CH7A 3GVJA 4FN5A 1ZELA 4RAGA 1F20A 2CFOA 2LKXA 1NB0A 3G3ZA 4BE0A 3TKYA 4WXHA 1E1RA 1TLLA 2LZJA 2VOPA 3ZP5A 4ITVA 5KAIC 2OZ6A 1ZM9A 1MIJA 2DQLA 4RLZA 4KFCA 2WAEA 2WB1A 4NDLA 2DJNA 3S1MJ 4RB0A 4GGGA 3ZQIA 1WTHD 1E62A 2MGQA 2FBIA 2JT1A 1HW5A 4GXOA 3S14J 1IDKA 1RKWA 4XKCA 3K4BA 1RRJA 3A8IA 5CVIA 1K8AD 4M73A 2HKOA 2JPCA 1GAQA 3I59B 2DI3A 2W24A 2ZJ2A 3D5RC 3VSVA 3QPSA 2XB5A 2A3SA 2DK8A 3JR9A 2GA2A 3H5NA 1P4AA 1WQ2A 2PBIA 2W4SA 4WZTA 4XSZF 2I8DA 1QRBA 4M3DA 2QZAA 1OCOH 2KMUA 1GDTA 4GFBA 3R4KA 2NS0A 4M71A 4W8QA 2OBRA 2K02A 3B6AA 1U0JA 3GVAA 2NSTA 5LGTA 2EH3A 4QSHA 3UNGC 2XAUA 3ZQFA 5FNZA 1WJEA 4QUZA 4RAYA 3IWFA 3OOUA 5IP9J 1XG1A 2ZBUA 1UD8A 3VODA 3ABMH 3SXYA 4PGGA 2ZFUA 3GTOJ 2PMZA 3DKWA 4RCZA 3RPUA 1RMGA 1VI0A 5GV7A 3RKYA 2X48A 4E7JA 5EZHA 3HOXJ 3ZOBA 2HMAA 3MHPA 3ASOH 3M1CA 1K5CA 1I3AA 1KD1D 2DQRA 3HRTA 1J9IA 1DARA 2B7BA 1WVRA 3G1MA 3T1BA 2KQRA 4YIIA 4YFNF 2VC1A 3RYRA 2VQCA 1KU3A 5D5UB 4XN3A 3PUNA 3KP3A 3F8CA 1IB4A 1QFYA 4M1KA 1MBJA 5DSZA 4FX4A 5KCMA 3E20A 1W5SA 4I01A 1S6LA 1T6YA 2VBSA 2ODLA 1Z6TA 1XG2A 2E1MC 2VN2A 3MKLA 4PABA 3KZZA 3CQZJ 3CCMI 1C0WA 2QKMB 4Z06A 5E3MA 4FX0A 3OKXA 3AG4H 2LFBA 1R36A 2BY3A 1ZHFA 5FLMJ 1EFTA 4KMFA 4HF2A 3OYEA 2HU9A 4PJ0C 1K28D 4Y7CA 4Z4ZA 3KIOA 5H6QA 4ZDOA 3REOA 2A6TA 1KQ8A 1BX0A 2XZPA 2X1EA 3JX8A 4MO7A 2HGCA 2UUZA 1O3TA 4TV7A 2BY2A 4WXDA 5TRDA 1VQNB 2VFQA 3PFIA 4V2FA 2O0VA 2HTSA 3S8PA 1X58A 2G0YA 3HXLA 1O3QA 4N3NA 1O3RA 3VFZA 2C5HA 1T0FA 2BM7A 2VKHA 2E36A 1DPRA 2EWNA 3J81k 3FY3A 1SD7A 1WCMJ 2FVGA 3HPHA 1AOYA 2O5RA 1JHFA 3SEQA 1HOMA 1JXSA 5J6XA 1BJKA 2X85A 2BMWA 5TISC 2HOSA 1OCRH 1E3HA 2JQ7A 1NG6A 3TEDA 3WU0A 3WHCA 1PUFB 1GV5A 3LNNA 1QO0D 4ZTFA 5D8KB 1UG2A 2DA4A 3OW2B 2VNIA 3F3XA 5F08A 4HX7A 2XOKA 2FOWA 1WKMA 1XPXA 2PJPA 1FNMA 1HA3A 4FT8A 3H3VK 3NE5B 1A6QA 1S5LC 4L18B 3AVWA 1VQKB 2WAQN 2CG4A 1J5YA 2BN4A 1UG0A 1E17A 2DOGA 2K9MA 1OCPA 1I8DA 2JVHA 4BE1A 2XNJA 4B8XA 2E1BA 5H2FC 2FX3A 2L02A 3DTIA 4NC6A 3CDHA 5EEHA 2FQ3A 5JBQA 3EUHC 1NHCA 2WJYA 2ME0A 1VLYA 1IN8A 5E17F 1WI9A 2P7VB 1V5FA 1ZREA 2DMNA 3P27A 3K9TA 1RC9A 4L0YB 2CQ7A 3CC4I 2DLLA 5LRSA 2JA7J 1OGIA 1GLNA 1AMOA 2QEXB 1X3ZB 2PEXA 3FF5A 3QPHA 1V5GA 3RDIA 3CCSI 1P4MA 3ESWB 1BC7C 3T8TA 1FYLA 1WZ2A 4NK6A 1I1GA 4JX5A 1G3WA 3LQEA 4I84A 1LDKB 1T56A 4OPWA 2EZKA 3PQKA 2DW4A 3DXJF 2L01A 4A93J 2M4GA 1QGYA 1B6AA 2F5VA 3ROUA 1ZUNB 2BF4A 4RD0A 4IHYA 2K4BA 3RQIA 3HOUJ 4XONA 2GXBA 2RQPA 1YE9A 5FO5A 3HHHA 4XLNF 2UXNA 3L2QA 2Q6LA 1ZG5A 2NRAC 1IDZA 2XSDC 1KGSA 5FO0A 4BU2A 4LB5A 2H8WA 4JOMA 3T53B 4LK0F 1IN5A 1V4RA 1ITYA 3K69A 4IW3B 2GREA 3ASRA 4NB5A 4EGYA 1OR7C 3HRMA 1Z77A 5KAFC 1MGTA 2A05A 3PIOF 1FTZA 1S0UA 2PX9A 3Q3AA 2O1DA 1KQ0A 3ZPLA 2RREA 1T33A 1QQ1A 2R9VA 5LBQA 5L46A 3PUMA 4KNYA 2R7VA 3B82A 1FC3A 3F6VA 3VYSB 3OYHA 3CXCB 2RN7A 3HKZN 1JUPA 1HG8A 4Z05A 3WU1B 1QZEA 1RWRA 4OOIA 1JT0A 3DQVC 2E60A 3VWBA 4P12A 2OA4A 1FWZA 3W6KB 2IOUG 1KK2A 4TT3A 4LLLA 3W2HA 2HDDA 3PNTA 1S72I 1ZAOA 1MSEC 1HKTA 3OL4A 3TOBA 3Q9VA 2W7NA 4JRAC 5DV5A 3OR1C 2YX4A 4A0XA 1FOWA 1IHMA 3ZMSA 3BZCA 2CV2A 2GJPA 2VBZA 2CV0A 1ZYRF 2XGDA 4A5NA 4HSRA 3CLQA 1WJCA 1CNEA 1U2RA 1PJ7A 3OIPA 1YI2I 3OOPA 4A3MJ 5L3GA 4IVNA 2FRHA 4PDKA 3RQ4A 5IYQA 3PL8A 2G7HA 4KIFA 2KIUA 3E0JB 2FQ4A 4X7DA 3K2ZA 4X07A 2P8TA 4PUSA 2E1CA 1S7OA 3H0DA 2OYNA 4NQWA 5J4VA 4XKVA 4AF7A 4QWQA 4HQEA 4LC0A 2CW0F 3ISXA 2J7KA 3BJ6A 2R7UA 4A69C 1GT0C 2MABA 4KT5C 3HSEA 2JZYA 2XIGA 4GYIA 3AVTA 1MJ9A 3MN2A 1FRQA 1B23P 1P92A 3JRCA 4Z03A 2ZNZA 1JJ6C 3OW7A 3BCBA 2Y31A 3TDZC 4DQKA 4A3JJ 1TQPA 2VUMJ 3OE7A 1SC7A 4LBVA 1KJZA 4KN7X 1BW5A 3OYKA 1IN4A 1Y6IA 2BEOA 2CW8A 3FKIJ 3ZMTA 4Z4SA 2OCEA 4UHTA 5KVRA 3RSNA 4KICA 5HLGA 2ZZEA 4BL0B 1E3XA 2E34A 1TWAJ 2GOMA 2V9PA 4N9HA 5GPCA 2CC2A 2UVEA 2ZZQA 1EP2B 1EH7A 3QFTA 4BY1J 4E7KA 2EA2A 3FIWA 2QGUA 5FKMA 4G1BA 3K4LA 1EF4A 4KN4X 1R5OA 2L9VA 3VEPA 4LK1F 4ZYHA 2KZGA 3S3OA 1Z1DA 3BG6A 1JKOC 2M7AA 1HSJA 1UMQA 2QKLB 2P5LC 3CPXA 4B1RA 3IH2A 3Q9SA 3N6ZA 1D8KA 4LIVA 3PUFA 4NQWB 3H94A 4XQFA 4PMHA 1TQMA 2BY0A 3GVKA 1TNTA 3QFCA 3GSIA 5C1EA 2B5OA
chains in the Genus database with same CATH topology
2OUMA 3ZRGA 3RCOA 1IRXA 3W3CA 1TT0A 2PJRB 4IKFA 3FBNB 2VQLA 4LIUA 2CUZA 2R7TA 1OHHA 1X1AA 1O8LA 5TGTA 2FUG2 4E6KG 2VKDA 4YZ0A 3CESA 4QPOA 3OYDA 1QCXA 2OV7A 2MFZA 2D3NA 1E3ZA 4HSTA 2GJRA 1Y56A 3LFUA 4RLFA 4DBQA 3OWTA 1Z3XA 3JU4A 3K70C 1W0JA 4PSXA 2ZZGA 1HA8A 3A3BA 1O8FA 1Z21A 1T95A 2NZMA 1WJDA 2XF7A 3HOTA 2V4DA 3VSUA 3FHNA 2R4GA 4HNTA 1DP3A 4HG2A 3OIQA 4HPQA 3BCAA 2JUGA 2JJ2A 1PXZA 4HNUA 4B44A 2K5CA 2A5WA 4HEA2 3C2HA 1JI8A 3G2BA 3UW0A 2HLDA 2R7RA 2O17A 4AU7A 2IS1A 3VMWA 1PLUA 1SAUA 2KZVA 1Z7LA 2V4JC 3DTEA 2Y0SA 4E7IA 3G05A 4NK8A 4XLHA 3K6GA 2KDOA 1TZLA 2L9NA 2DXIA 4II2A 2O04A 1UD4A 1P9QC 3H9JA 5DN6A 2MYSA 2WZPP 2O0WA 2JJ1A 5LFAA 2WY8Q 1OOCA 4LG3A 3A2KA 2XC7A 5FRMA 5HNHA 3C2GA 3MD2A 4E4HA 4PK4A 4RMNA 2HVRA 2QX3A 4HRIA 3H35A 1V0EA 2IGNA 3BCDA 4J00A 1D0YA 2LREA 4I84A 3TMOA 4DJAA 3OYFA 1QHGA 1DBGA 1YX3A 3BC9A 2LRDA 2L7KA 2KRCA 4E7ZA 1COWA 2F6CA 4N4OB 4ZDPA 2HDWA 1H8EA 4F91B 4LITA 4BQOA 3S3MA 4RLQA 2JDIA 4CCMA 3OYMA 3OYLA 2IXSA 4BS9A 4CCLA 3GQAA 1O8HA 4PJNA 4CA0A 2BVMA 3TBIA 4MR0A 2VQHA 5IK2A 2BW3B 3T51B 2LBFA 1BPLA 4B43A 1WP6A 1BR4A 3OR2C 5KNLA 4YZXA 1O8JA 3ZCOA 3L2UA 3S93A 1VJSA 2X6YA 4OJPA 4BE2A 2HPMA 2CS3A 3K4CA 3ONQA 2DT7B 4XKWA 2F1MA 3PSFA 1AIRA 3IAM2 2WAQA 3ZXSA 2WA0A 2VASA 1PE9A 1AA7A 3W2AA 2NTBA 3CF2A 3DDYA 1WJAA 2XSJC 4G6TB 3H9QA 3KEYA 2GJKA 3GQBA 3AL0B 4GRIA 3CJQB 3EUKL 2E5NA 3LSIA 3OAAA 3OYCA 4AYBA 4C2UA 4F55A 3CJRB 4XL9A 4HIZA 4OZZA 1W36C 3DTKA 1BR2A 2W00A 3OYIA 1BMFA 3PSIA 4IX7A 2M5SA 1I18A 2WY7Q 3BLYA 4CSWA 4ASUA 2V7FA 3FKSA 5KHDA 4DK1A 1O88A 2RNGA 1O8IA 4ZJZA 3OYNA 3ZPNA 3SEZA 3L2WA 2LH9A 2M3AA 2CW7A 3HPGA 2WJVA 2WAFA 4OWRB 4XOTA 1VZ0A 1E79A 3GQ7A 1JTAA 3OL3A 4GQNA 2X8KA 3L2VA 3ZR8X 3AKZA 1WJ5A 2LBFB 1O8KA 2W6JA 2R7OA 2BSPA 2BVLA 4PJMA 2X6WA 2VQGA 2QE7A 4BDYA 1N78A 2X53S 2NT6A 2KRHA 3OY9A 4OJ5A 2NTPA 1EE6A 3CP2A 3DLAA 2ELJA 4MXNA 2VJ5A 3VYRB 2CH0A 4BACA 3D5SC 4II3A 1W9XA 1SFKA 2UV1A 1MNDA 3H5AA 4NUBA 1UD5A 2HVSA 4G6IA 1V5EA 2IS6A 2ZZFA 3SYTA 4CCOA 2F43A 2V6EA 3LMMA 3VMVA 4IQJA 2K9LA 4NC8A 3VDXA 4XLFA 4B47A 4TKOB 4F93B 5JHFA 2DOAA 4BDZA 2WSSA 3K4MA 2F4IA 2ZSIB 1X1CA 2M4KA 4C9YA 1E1QA 1OB0A 3OEHA 2L9SA 2XGJA 3VSTA 1IA5A 1SKYB 2QY1A 3E1SA 2LYCA 3VYUB 4U7BA 3HKZA 2LC2A 3N05A 2Z1DA 2VJ4A 3LSGA 3AFHA 4E7HA 2XF5A 4KT6A 3SZGA 3I3LA 4CH7A 3GVJA 1ZELA 1R6RA 2CFOA 4FASD 2W1OA 1O8DA 1OFLA 4BE0A 1E1RA 3H9GA 2LZJA 3OYGA 4ITVA 1MW7A 2UVFA 3WQZA 1O8MA 1NBMA 2QXZA 1UD2A 5CDFA 2WAEA 2WB1A 2IGKA 2D3LA 1WTHD 1FMVA 1S9HA 2LG4A 4CCJA 1IDKA 4E7LA 5FROA 4XKCA 1UAAA 3A4CA 4U87A 4L8JA 2IQ7A 3K4BA 2K3PA 5LD2C 2JSPA 2P0WA 3D5RC 3DKYA 3H5RA 3BG7A 3RTRA 4B3XA 1H8HA 4DNTB 1H80A 3VSVA 4W8TA 2VBKA 3GQ8A 4XR6A 4DK0A 3H5NA 4ZYAA 3A3GA 2W4SA 3DPLC 2RQQA 1KMHA 5CQEA 2VL8A 2I8DA 1X1DA 4PFOA 4XOPA 5HNFA 1E0EA 1KZLA 2KMUA 4P22A 4UZUA 1W0KA 1D0ZA 2E5ZA 5HLTA 1T0FC 4D1QA 2Z6BD 4OZYA 4C2LA 3OS1A 4NNJA 4MLOA 1EFRA 4G7XA 2HQAA 4OAYA 4W8QA 1BOBA 3QYEA 1U0JA 1QJVA 2NSTA 3UNGC 2VPLA 2XAUA 3LMWA 1MNEA 4U4BA 1WJEA 3PNVA 2R7QA 3W2VA 3ZGKA 3OOUA 3A35A 3ZPPA 4XLEA 1J09A 1BLIA 1UD8A 5HVQC 4YZQA 2MD0A 2JIZA 4Y33A 1K6YA 3B90A 1DGWY 2ZFUA 4H4KC 2PMZA 3OMYA 3OOCA 3OS0A 3NWSA 4XN0A 1RMGA 2HNHA 3S3NA 3GBGA 2NSPA 4X0GA 4XNFA 4YRVA 1WJBA 4E7JA 4DBRA 3K4JA 1MMNA 3OEEA 3SDBA 4CCNA 1UELB 1MMAA 3M1CA 1FMWA 3K4KA 2VJJA 4EATA 2GK7A 2WADA 1X0CA 1K5CA 3EUAA 2KQRA 2OC6A 3DEEA 1WPCA 2VQCA 4XN3A 1IB4A 2V7QA 1VF7A 4Y4RA 2PYGA 5C1CA 4XMYA 5KCMA 2ODLA 1N77A 2ZXIA 4PFPA 4R79A 2IS4A 3CP8A 1XG2A 2E1MC 3HAGA 1PJRA 3JURA 4Z06A 2QKMB 3DPTA 1D1BA 2NT9A 3HUGB 3HC7A 5HOOA 3MKYB 2CMPA 3VSLA 1OGOX 1QU3A 1OFMA 2Z8GA 2Q1ZB 2NTQA 3OYEA 2HU9A 2VIXA 4DNRB 1K28D 4ANJA 3FBIB 3OFNA 3VR6A 1ERDA 4ZDOA 4F52A 2A6TA 2XZPA 2X1EA 4F92B 2UUZA 2XZOA 4XLCA 5FL7A 2O0VA 3S8PA 1MMDA 4G7WA 3HXLA 2ZSHB 4DIQA 2R7SA 4PSWA 4ZDLA 2VKHA 2KVOA 1LVKA 2BOLA 1X1BA 1HZEA 3FY3A 2KL4A 1G8XA 3KEWA 3HPHA 2O5RA 3SEQA 3L2RA 4JQFA 3FKJA 2WPDA 2X85A 1KCCA 4CUGA 2X3HA 3KYLA 4P5OA 1NG6A 3DWLE 4BJ5C 2PYHA 3LNNA 2IS2A 4ZTFA 3F9KA 4E7SA 2LOOA 2UWMA 4OJ6A 2ZTNA 2M7BA 2XOKA 3K70D 1MABA 3T56B 2V1NA 2KPMA 3NE5B 2JA2A 1GQ8A 3QOEA 2X1DA 1OLTA 2L2OA 1UG0A 3DPUA 3LSKA 4KISA 2K9MA 1I8DA 4OJLA 5AMVA 2JVHA 5CPRB 3MMYB 4BE1A 3KRGA 2E1BA 4XM3A 3IP4B 3DTIA 1EA3A 2AQFA 2VXZA 3KX2A 2X6XA 3EUHC 2Z16A 1NHCA 4BXFA 2WJYA 1LFPA 1VLYA 3DKXA 1FX0A 1V5FA 3IAS2 3VYTB 1D1AA 3BCFA 3BH4A 1PYVA 2W82A 1VBLA 1GLNA 2GK6A 1WFXA 1V5GA 4OAZA 3A1YA 3ZQQA 4C30A 4KKUA 1NG7A 5HKKA 4NK6A 2X1CA 4KKTA 1NRKA 3PUBA 2DIEA 4BQQA 4BJTA 1LDKB 3PJRA 4B48A 3VSKA 1KONA 2M4GA 2F5VA 3NWTA 3HL2A 1UD3A 4HWVA 1DQUA 1G59A 4XONA 2KP6A 4NC7A 1YE9A 2HPIA 4XKBA 1DGRM 4BQNA 5C1EA 4W8RA 4URRA 3L2QA 4IZZA 1KTWA 3K10A 4YXWA 2NOJB 4U49A 3I9V2 2WBMA 4J01A 2BW3A 3PFYA 4BU2A 3OYJA 2GOXB 4JOMA 3T53B 2V26A 1DBOA 2DT6A 3QODA 3HOSA 2JVGA 3LSMA 4FXUA 1OR7C 2KHMA 2O1DA 2CK3A 2M0MA 2RREA 3MKZA 1WMRA 3FPPA 3T9GA 4E0FA 3CZ6A 3QYFA 2R9VA 2V9KA 3DU5A 2Z2SB 2HVQA 2R7VA 2X51A 1QHHD 3VYSB 3OYHA 3OYBA 3ZSCA 1KCDA 4PJLA 4DGWB 1HG8A 1IDJA 4Z05A 1RWRA 2XNDA 2E1MB 2E60A 3DQVC 3VWBA 2VBEA 4BEHA 2AQEA 1YX5A 2LY2A 3OS2A 2VJIA 5FRNA 4BGDA 4TT3A 2VB6A 2XZLA 3PNTA 3DU6A 2V31A 3LSHA 3OL4A 2W7NA 1BHEA 3OR1C 2XDVA 3IUOA 1UD6A 5CQGA 1W36D 2IGMA 2EWEA 3D5LA 4PJJA 2CV2A 2GJPA 2LY1A 2IGOA 2CV0A 4XORA 2R7WA 4HSRA 1X4OA 2HZDA 3LL7A 1WJCA 1D0XA 4Y3OA 4OJOA 3OIPA 3ZIAA 3W2WA 4FETA 3RQ4A 4YELA 3OPOA 2DCEA 3PL8A 4QPQA 4CZCA 2INVA 1BR1A 3E0JB 3PNYA 3U21A 4PUSA 4N4NB 3MKWB 2INUA 3H0DA 3SUCA 2MC4A 4XKVA 3GQ9A 3FDYA 4XLAA 4ZTJA 1MMGA 1LKXA 4D9JA 1CZFA 1O8GA 5CKTA 2R7UA 3B4NA 2MABA 2CV1A 1O8EA 1RU4A 2DJIA 4YEJA 1PKVA 4YZAA 3HG9A 4RM2A 2XF6A 4F3QA 4RM3A 2PJRA 4Z03A 3J7AY 1WJFA 1JRGA 3OW7A 4EW9A 3BCBA 2VBMA 3WWGA 2VLAA 4BJ6C 3K4NA 3OE7A 3V42A 1V0FA 1BN8A 3OYKA 1HVXA 1Y6IA 2CW8A 4BEHB 4JMQA 4P1WA 3RSNA 4TSFA 4B3FX 2ZZEA 2W6IA 1N75A 4BL0B 2L5QA 4IQ4A 1D1CA 1E3XA 1X4PA 2GOMA 4ZC3A 4DOZA 4KITB 3S32A 4W8SA 2UVEA 2ZZQA 3UR3C 3RPUD 3CMMA 1Z3YA 4E7KA 2KLOA 3GRHA 3EQNA 3K4LA 2VXDA 1T5EA 3QYBA 3AL0C 3M8JA 3S3OA 3BG6A 4KJZA 3TL4X 3EPZA 2M7AA 2QKLB 4B3GA 3EQOA 3BC8A 1E43A 2Q2EB 3GVLA 3B8YA 2R7XA 4LIVA 2CUJA 4NQWB 3H94A 1OGMX 3OYAA 4XQFA 2ZXHA 4PMHA 2ZTGA 4BUPA 4AVZA 4C2TA 4XD7A 3GVKA 4CCKA 1X19A 4Z1MA 2PECA 4KKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTW A;  2NSP A;  4XNF A;  4U49 A;  1O88 A;  1O8I A;  1O8L A;  1DBO A;  1K5C A;  2VJJ A;  1X0C A;  4XOT A;  3GQ7 A;  1JTA A;  4YZ0 A;  1QCX A;  2O1D A;  4XN3 A;  1IB4 A;  2PYG A;  1WMR A;  5C1C A;  1O8K A;  4XMY A;  3T9G A;  2BSP A;  2ODL A;  2X6W A;  2NT6 A;  1XG2 A;  1O8F A;  2NTP A;  1EE6 A;  2NZM A;  3JUR A;  4MXN A;  4Z06 A;  3ZSC A;  1KCD A;  1HG8 A;  2NT9 A;  1IDJ A;  4Z05 A;  3VSU A;  1RWR A;  2VBE A;  1OGO X;  1OFM A;  2Z8G A;  1PXZ A;  2NTQ A;  2VJI A;  3UW0 A;  3VMV A;  4XLF A;  2O17 A;  1BHE A;  3VMW A;  1PLU A;  2EWE A;  1IA5 A;  4XLC A;  3VST A;  2O0V A;  4NK8 A;  2QY1 A;  4XLH A;  4XOR A;  2O04 A;  2O0W A;  4OJO A;  1OOC A;  3FY3 A;  4YEL A;  1O8D A;  1OFL A;  2INV A;  1KCC A;  2X85 A;  2X3H A;  2INU A;  2UVF A;  2QX3 A;  3SUC A;  1O8M A;  2QXZ A;  4XKV A;  2PYH A;  3GQ9 A;  4XLA A;  4I84 A;  1O8G A;  1CZF A;  3B4N A;  1DBG A;  1O8E A;  4OJ6 A;  1RU4 A;  4YEJ A;  4YZA A;  1IDK A;  4Z03 A;  2IQ7 A;  1JRG A;  1GQ8 A;  4EW9 A;  2VBM A;  3WWG A;  1H80 A;  3VSV A;  1BN8 A;  4OJL A;  5AMV A;  4W8T A;  3KRG A;  2VBK A;  3GQ8 A;  4XM3 A;  4XR6 A;  3GQA A;  1O8H A;  4MR0 A;  4XOP A;  2X6X A;  1NHC A;  4YZX A;  4W8S A;  2UVE A;  1O8J A;  4OZY A;  4C2L A;  2X6Y A;  4OJP A;  4W8Q A;  3GRH A;  1VBL A;  3EQN A;  4XKW A;  1AIR A;  1QJV A;  2NST A;  2NTB A;  1PE9 A;  3LMW A;  4U4B A;  4NK6 A;  3ZPP A;  4XLE A;  3EQO A;  3B8Y A;  4OZZ A;  4XL9 A;  4YZQ A;  1OGM X;  4XQF A;  4HWV A;  3B90 A;  4PMH A;  4XON A;  4AVZ A;  5C1E A;  4XN0 A;  1RMG A;  4W8R A;  4URR A;  4OJ5 A;  2PEC A; 
#chains in the Genus database with same CATH topology
 2OUM A;  2V1X A;  3RCO A;  3W3C A;  1NH3 A;  4X8I A;  1XSV A;  2CUZ A;  4KUM A;  4P55 A;  4PC1 A;  1X1A A;  1Z7U A;  2V9V A;  4A2U A;  1MJB A;  1VQM B;  4MEX F;  4E6K G;  4YZ0 A;  3VO1 A;  3OYD A;  3W6V A;  4TMT A;  2EV6 A;  3ECH A;  2QA4 B;  4HST A;  1Y56 A;  3H09 A;  5FJ8 J;  4RLF A;  2W85 A;  2OK7 A;  3JU4 A;  3PSS A;  3DCF A;  2M1B A;  1W0J A;  2JRM A;  5C4J J;  3CCQ B;  4EVI A;  1O8F A;  1Z21 A;  2NZM A;  3HOY J;  1HW2 A;  2R4G A;  4HG2 A;  2F4N A;  5D6F A;  3KL9 A;  2LD5 A;  3GW2 A;  1PXZ A;  4HNU A;  4B44 A;  3JQQ A;  2K5C A;  3JRH A;  5ICC A;  3C2H A;  4P6V F;  4OIN F;  3C7J A;  4MTD A;  4QTR A;  4C3I J;  4S0H B;  3F23 A;  1ETX A;  1T39 A;  4LLG F;  3I53 A;  1VQN I;  3SZT A;  4L9T A;  4NK8 A;  4XLH A;  4X1E A;  2JMW A;  2YPR A;  1UD4 A;  2WZP P;  2O0W A;  2OPT A;  2XAG A;  2QQA A;  5LFA A;  2OK8 A;  3FM5 A;  1ZK8 A;  4LG3 A;  4LD5 A;  3A2K A;  4Y15 A;  3TW7 A;  2XC7 A;  2XC1 A;  1J0R A;  4PC6 A;  2RC4 A;  4J0Q A;  3W2I A;  2Z99 A;  3OJW A;  2OZU A;  1CF7 A;  1ORK A;  4E4H A;  1VQ8 B;  3EQL F;  4RMN A;  2KIF A;  3VMF A;  3ERE D;  4BBR J;  5L3B A;  3FXM A;  3TOA A;  2JJ7 A;  1TBX A;  4RPD A;  1QRY A;  3GFM A;  5K7F A;  2R7F A;  2QTZ A;  1QVG B;  2RDP A;  3BP8 A;  1ETY A;  1RET A;  2HTJ A;  5ILU A;  2EIX A;  2KRC A;  2XGE A;  1COW A;  1DP7 P;  3AVU A;  2F6C A;  4ZDP A;  1VQK I;  3HZJ A;  5L3C A;  2QTL A;  2V7U A;  2HDW A;  1POG A;  4WZL A;  1TYX A;  4HX8 A;  2QSH X;  3CC2 I;  2JDI A;  3LWF A;  4RGX A;  4CCM A;  3L09 A;  5CVV A;  3LAP A;  2PMU A;  1VHO A;  1O8H A;  4PJN A;  3W6J B;  3CCE B;  2JA5 J;  3P4G A;  4M3B A;  1FY7 A;  4B43 A;  3ASQ A;  4M2L A;  4L9J A;  3G1L A;  1O8J A;  3G71 B;  2CRV A;  3OZV A;  2A5Y B;  4OJP A;  1LEB A;  3K4C A;  3ZC3 A;  1Z6R A;  5EJC A;  2DT7 B;  1TVC A;  4RD4 A;  4ZCI A;  3PSF A;  1AIR A;  3F8B A;  3IAM 2;  2MSY A;  2WAQ A;  3ZXS A;  4FCY A;  1AA7 A;  3F72 A;  3DEU A;  3CF2 A;  1HQC A;  2LNB A;  2OTJ B;  1KZH A;  3AL0 B;  4IHT A;  3EUK L;  5IYR A;  1CF7 B;  3ZMD A;  4B4C A;  3VOE A;  3OYC A;  2D74 A;  5H5J A;  4MQV A;  4HV6 A;  4F55 A;  4XL9 A;  2CSO A;  2Q0O A;  1BI1 A;  3DBR B;  3K1N A;  4DYR A;  1ZM3 A;  4OZZ A;  1QGZ A;  1LPQ A;  3BRO A;  1E3O C;  5F4J A;  4WZK A;  4UV9 A;  3ELK A;  4L9N A;  3OP1 A;  5IOZ A;  3G73 A;  2QGG A;  1R1V A;  1U8R A;  2IRF G;  4ZCM A;  1W2B B;  1BC8 C;  1W7P D;  1O8I A;  2F4M B;  4RDL A;  2KJC A;  1Z91 A;  2ZC2 A;  4LBW A;  3LOC A;  1XDS A;  5HDG A;  4ZYG A;  4CDG A;  3KLO A;  4XOT A;  2C4T A;  2C78 A;  3FZV A;  1TTY A;  2XAS A;  3M8E A;  4D7N A;  5THX A;  4M9Z A;  4M3E A;  4U88 A;  2CUF A;  2B0L A;  6PAX A;  3AKZ A;  1G3S A;  2R7O A;  1E2X A;  2X6W A;  1R5N A;  2L7M P;  4BDY A;  1X1P A;  4GCV A;  1N78 A;  2X53 S;  1ODD A;  1G3T A;  2W25 A;  4JX6 A;  3OY9 A;  4D7M A;  3JSP A;  1EE6 A;  1QRC A;  2NTP A;  3CP2 A;  3DLA A;  2VJ5 A;  3VYR B;  4FHT A;  3Q6Q A;  2IJL A;  1FYK A;  1OB2 A;  2UV1 A;  1UD5 A;  2FSW A;  3LQQ A;  1WSV A;  4G6I A;  4Z6Y A;  1V5E A;  5E8I A;  2ZZF A;  1XGN A;  4R8H A;  1I7P A;  1YLO A;  1RR8 C;  2F43 A;  4RJL A;  3KYD B;  1ZKG A;  3E6B A;  4NC8 A;  3KP7 A;  2HYG D;  3J80 Z;  1SEU A;  4XLF A;  1A36 A;  2AS5 F;  3X2Q H;  4TKO B;  3BQY A;  4CGZ A;  5IPA A;  2MA3 A;  2DOA A;  4EM1 A;  3K4M A;  4M6Y A;  1DUX C;  2PE3 A;  4OOS A;  2XGJ A;  2Y9Y A;  3VST A;  5TY0 A;  4HE6 A;  1UB9 A;  2LYC A;  1FJL A;  4EJV A;  1JTY A;  3HKZ A;  1HC8 A;  3I71 A;  4K1X A;  4Z4R A;  3PO3 J;  1IG7 A;  4IOC F;  1ZR2 A;  1VQ9 I;  3SZG A;  5K1Y A;  1HW1 A;  1PVE A;  5HLH A;  1R1T A;  4M6X A;  2QCO A;  2W1O A;  3RYP A;  1OFL A;  2EV0 A;  4IRH A;  1S7E A;  3FHZ A;  3AVV A;  3U1D A;  2CU7 A;  1N08 A;  1QUF A;  3E5Q A;  4HNV A;  1T38 A;  3ULQ B;  2QQB A;  3U6B A;  1OKR A;  1ZRC A;  2OAZ A;  3RIQ A;  1GV2 A;  2GIV A;  2IGK A;  2QUF A;  1FMV A;  3OJX A;  3CO7 C;  2DFI A;  2O61 A;  2VNJ A;  1H88 C;  1R49 A;  3JAM K;  1YHQ B;  3I4N J;  1UAA A;  1J75 A;  4U87 A;  2QN6 A;  5FA6 A;  3ONY A;  2K3P A;  5LD2 C;  1D8T A;  4BY7 J;  4B09 A;  4ZZD A;  3C2B A;  5EG0 A;  2YWF A;  5FD5 A;  2ZME A;  4DNT B;  1MBE A;  4W8T A;  1JB9 A;  3CME B;  1H85 A;  3IC7 A;  1REP C;  4DK0 A;  1KQS B;  2Z3Y A;  1EA0 A;  3DPL C;  1R5I D;  2RQQ A;  5CQE A;  3KZI C;  2K9N A;  3BG5 A;  1OCC H;  3LFK A;  4UZU A;  1D0Z A;  4RAZ A;  2Z6B D;  1YLF A;  4NNJ A;  4G7X A;  4A3L J;  1FNB A;  1HKS A;  2EIN H;  2HQA A;  4LBZ A;  4MNU A;  3JRE A;  4IJA A;  1JHH A;  4XRM A;  2FBH A;  3HUG A;  3L2C A;  1VF9 A;  4KDP A;  1GO2 A;  1HDD C;  4ESJ A;  2VPL A;  4DYQ A;  3M4O J;  2R7Q A;  5GAG J;  3Q38 A;  4DQ2 A;  1U8B A;  1J09 A;  4RB3 C;  5FFZ A;  5HVQ C;  5FKN A;  1B59 A;  2JIZ A;  1Y1W J;  1K6Y A;  1H89 C;  1SAN A;  1YOV B;  4H4K C;  1MDM A;  3OMY A;  1YJN I;  2R6H A;  4MFE A;  2F3L A;  1ZAR A;  4XN0 A;  3S3N A;  2IA1 A;  2DAO A;  3WTZ A;  3FMR A;  2KKO A;  4O3M A;  4OPV A;  1YG2 A;  4TMW A;  3OEE A;  1DAB A;  3SDB A;  2STT A;  2EZH A;  2QWW A;  4YHB A;  1MMA A;  5EG0 B;  2M30 A;  1X0C A;  1P7J A;  2ZME B;  5J40 A;  2QZ8 A;  5IT9 Z;  2QA4 I;  2NAZ A;  1S3J A;  3ABT A;  3DEE A;  3EUA A;  4EEF G;  3ZQG A;  1WOP A;  2ZBV A;  2M0C A;  1DDI A;  3QP6 A;  3RKW A;  3SY2 A;  2PYG A;  1S4M A;  5C1C A;  4ASN A;  1N77 A;  5HXB A;  1FP2 A;  4PFP A;  2QYU A;  2J8I A;  3HAG A;  5EZG A;  1D1B A;  1L0O C;  4KIG A;  3HUG B;  3OZU A;  2HFH A;  3HC7 A;  1UZC A;  4OIR F;  2Q1Z B;  3U2Q A;  3F21 A;  2PIA A;  4KIB A;  4ANJ A;  2MH9 A;  2JN6 A;  3FBI B;  2WWY A;  1G2H A;  2P3M A;  1ERD A;  2GBY A;  1TYV A;  2NXN B;  2ZIT A;  4ABZ A;  3N4M A;  2P5K A;  4F92 B;  4FE4 A;  4XLC A;  4UVB A;  1MDM B;  5FL7 A;  1Y0U A;  1W4M A;  3ECO A;  1YW8 A;  2YR2 A;  1D5Y A;  2ZB9 A;  2P6S A;  4K2E A;  3TP0 A;  1EFU A;  2KVO A;  1LVK A;  1X1B A;  1VQ8 I;  3KEW A;  2CQN A;  4X06 A;  2BYV E;  3W2G A;  3FKJ A;  1ZTR A;  2R5Y A;  4OIP F;  3ML3 A;  1W35 A;  1J9Z A;  4IL6 C;  3LO8 A;  5KW9 A;  3ZZT A;  3FXQ A;  5B5E C;  3F9K A;  5IP6 A;  5D5V B;  1J7K A;  4IOA F;  1W5C C;  2OQR A;  2UWM A;  3I64 A;  3QE2 A;  1A8P A;  1UFM A;  2QEN A;  1FP1 D;  1KYZ A;  5DCM A;  3K70 D;  2LTP A;  2ACJ A;  4A3F J;  2PMH A;  2Z5U A;  3PSZ A;  1IN7 A;  2JA2 A;  1QZY A;  2X1D A;  5JVT A;  5FLX K;  5AN9 A;  1OLT A;  1ZLJ A;  4EM2 A;  3KZY A;  3DPU A;  4KIS A;  3ZMZ A;  3D0S A;  2A61 A;  1FIP A;  2DA2 A;  2L4A A;  1SD6 A;  3MMY B;  2HWV A;  5F27 A;  3CCE I;  2HYF A;  3FMS A;  2KJB A;  2QMU A;  2AQF A;  2VXZ A;  2K7L A;  2WTE A;  1EXM A;  3G71 I;  3CC7 B;  4TN1 A;  3CCR B;  1T98 A;  2BE5 F;  2R7D A;  3I4P A;  3SFI A;  3IAS 2;  3VYT B;  1D1A A;  3NRV A;  3WBK A;  3BCF A;  4J19 A;  2V6C A;  2EIL H;  1VBL A;  2GK6 A;  1OGJ A;  4V2G A;  1AU7 A;  3R6J A;  2IAI A;  2F4O B;  4OAZ A;  3A1Y A;  4PC2 A;  2DMP A;  2COM A;  1NG7 A;  1YJ9 I;  2YX7 A;  3HBL A;  1Q9S A;  3I4M J;  4BQQ A;  5HS8 A;  3JRD A;  3PJR A;  2R5Y B;  2DDB A;  4JP0 A;  3VSK A;  3VO2 A;  3NWT A;  2HYJ A;  3HL2 A;  1HF0 A;  1UD3 A;  4M72 A;  3LVB A;  3A8J A;  1G4D A;  2ETH A;  2KP6 A;  1K8F A;  5J1U A;  2WZN A;  3F8M A;  1EV7 A;  5A2Q K;  4URR A;  4IZZ A;  1IXR C;  5DCM B;  2XTW A;  3K10 A;  1QGP A;  2VT3 A;  2ISY A;  5M5W J;  1JJ2 B;  4J01 A;  3PFY A;  5KSW B;  2DTZ A;  3OYJ A;  1CNF A;  3ASP A;  4CIC A;  1DBO A;  3GLL A;  2FML A;  4OMZ A;  2DT6 A;  3E1Y E;  3HOS A;  3RZD J;  2JVG A;  3S1R J;  4HYE A;  4PGH A;  3CCL B;  4I09 A;  3CO6 C;  2F5E A;  4DYC A;  2KT0 A;  1MH3 A;  2M0M A;  3L9F A;  3G6E I;  5IYC J;  4M9X A;  1VQ7 B;  3GFL A;  3ZQL A;  4TMX A;  4LMY A;  1TTT A;  3FXR A;  3V7R A;  2B63 J;  3S2D J;  1Q82 D;  3FXL A;  1RUN A;  4LG0 A;  3JQR A;  1XS9 A;  3ZSC A;  5E1W A;  1KCD A;  1JGG A;  3T0Y A;  4DGW B;  1MBG A;  1IDJ A;  5BSY A;  3WTT C;  3U6K A;  3SFZ A;  2E1M B;  3WNC A;  2CWE A;  4BEH A;  4UAJ A;  2F5C A;  1YX5 A;  2LY2 A;  1TC3 C;  1GVJ A;  1XD7 A;  2A69 F;  5DDG A;  2V31 A;  3ZMV A;  3OV8 A;  3LSH A;  3HTS B;  3WE2 A;  4Y17 A;  5K5R A;  1RIO H;  3QP5 A;  4IRG A;  1UD6 A;  1QA1 A;  4W1U A;  4CYD A;  3LST A;  3EUH A;  5DNS A;  4G7O F;  2LY1 A;  3WHB A;  4XIC A;  3BY2 A;  2R7W A;  4AID A;  5LHG A;  4OJO A;  2UXX A;  4Y3O A;  1JA1 A;  3GO5 A;  4HW0 A;  2QLZ A;  5E3O A;  3ZIA A;  5JI6 A;  2JWT A;  4FET A;  4YEL A;  2DCE A;  4QPQ A;  1XGO A;  2CQQ A;  1EJ9 A;  2Q2E A;  1K79 A;  1BA5 A;  4N4N B;  3MKW B;  1YIT B;  2MC4 A;  3WTW C;  3GQ9 A;  3NAR A;  3BR2 A;  5GAD J;  3N90 A;  4N9I A;  2IT0 A;  3BR6 A;  5CKT A;  1QH0 A;  2CV1 A;  3OSF A;  2R0Q C;  4RDU A;  2DJI A;  4YEJ A;  1PKV A;  1VQ6 B;  2V1U A;  4YZA A;  1UST A;  1X2M A;  2XPW A;  4F3Q A;  1NJI D;  4MTE A;  3R6K A;  4LG0 B;  1LLW A;  1R5H A;  4D5C A;  2NOG A;  4PCQ A;  2GXA A;  5BPD A;  4RB2 C;  2VLA A;  1OFC X;  4BJ6 C;  3K4N A;  2M8E A;  3CME I;  3GCM A;  1BN8 A;  4JMQ A;  4BEH B;  2CND A;  1SFX A;  1YS6 A;  2XRO A;  4LOC A;  1E63 A;  4B3F X;  4YFO A;  1R58 A;  4Q48 A;  4HV5 A;  1QVT A;  4IQ4 A;  4CXF A;  1OR7 A;  1OMI A;  2EZL A;  4HOB A;  3S32 A;  3OSG A;  3I1F A;  1M1K D;  5HDN A;  3BJO A;  1LVA A;  3AVY A;  1QPM A;  3GRH A;  4CYC A;  3O8G A;  1BIA A;  2VXD A;  3TDU C;  1SFU A;  2M34 A;  1VFC A;  1F60 A;  1WU8 A;  1VQ4 B;  4LJZ F;  2IBD A;  4A3I J;  3EPZ A;  2XAJ A;  3B73 A;  3WY9 A;  3GZ5 A;  4S05 A;  3U2R A;  1E43 A;  3JRG A;  1TP4 A;  2Q2E B;  2R7X A;  4ON0 A;  2VE8 A;  4AVP A;  5J47 A;  3AGP A;  2PQ8 A;  2ZXH A;  3PM1 A;  1JKR C;  4BXX J;  1Q86 D;  3PQJ A;  2TCT A;  1YX2 A;  4ZCL A;  3CTA A;  1VQO B;  2Y0M A;  2M5W A;  3FXJ A;  4Z1M A;  3I55 B;  1B1B A;  2PEC A;  2FF4 A;  1CLW A;  1BBY A;  2BHY A;  4WF2 A;  3NQO A;  1IRX A;  3TO7 A;  5L3D A;  2G9W A;  3TO9 A;  3QWL A;  1K61 A;  4WWC A;  1ZRF A;  2VBT A;  2VFO A;  3FBN B;  2VQL A;  5FO1 A;  4YCQ A;  4DZJ A;  5K5Q A;  1USS A;  1KC8 D;  3AVX A;  5TGT A;  3HOW J;  2P7C B;  1TL8 A;  2VKD A;  1YIJ B;  3CES A;  1BJA A;  3FXU A;  2D3N A;  1E3Z A;  1MZB A;  5K7H A;  2OCC H;  1WOR A;  4DBQ A;  3E7L A;  3K1P A;  2F1L A;  4MIM A;  2XT2 A;  1EZG A;  1MH4 A;  3K70 C;  4D5F A;  2JA6 J;  5E6T A;  3WG7 H;  5DUK A;  1T95 A;  2XF7 A;  4CYC B;  4BPR A;  4YAW A;  4L5E A;  1OPC A;  1HBX G;  3V8L A;  4UNO A;  1F36 A;  3GZN B;  2JUG A;  3ZQ7 A;  2B9S A;  1IJE A;  4OPO A;  2H6C A;  5EEG A;  3TQN A;  1GXQ A;  3ZUG A;  3UW0 A;  2A5W A;  1JI8 A;  3EYI A;  1R1U A;  1R7J A;  3VMW A;  1PLU A;  3HYI A;  2E2I J;  3BTI A;  2KDZ A;  2GWR A;  2DA3 A;  1AHD P;  4OOX A;  4P9S A;  1TWF J;  3PEN A;  4Z2Y A;  2HDN B;  4II2 A;  1NDH A;  1P9Q C;  3ZN1 A;  2L9R A;  2WY8 Q;  3JRF A;  2W48 A;  4Z4V A;  2GM4 A;  2I10 A;  2QF7 A;  3WYA A;  3IKT A;  1KU2 A;  3MD2 A;  3V76 A;  1V5V A;  1QNT A;  3D1N I;  3MZH A;  3SDG A;  3I56 B;  2QX3 A;  3H35 A;  4AIJ A;  4JYK A;  1D0Y A;  2NNY A;  2H1L A;  3LA7 A;  1IB0 A;  4X0C A;  2YWG A;  5CJ9 A;  3BC9 A;  3SYJ A;  2LRD A;  4MFD A;  4WXC A;  1K4Z A;  2ID6 A;  2L7K A;  3LJY A;  4EMS A;  4DZP A;  1IV6 A;  5TJJ A;  1ETV A;  1MBF A;  1A35 A;  3S1N J;  1LE8 A;  2WV0 A;  2AO9 A;  4F91 B;  1CQT A;  2DBB A;  3GWZ A;  4RLQ A;  4X7C A;  1R5G A;  4ZV4 A;  3VPR A;  2XRN A;  3LA2 A;  1WOO A;  4BS9 A;  2FE3 A;  3I5U A;  3CCR I;  3CC7 I;  2BVM A;  1A5J A;  4P3I A;  3T51 B;  2LBF A;  1BR4 A;  1JUS A;  3OR2 C;  5KNL A;  2HQR A;  3HRS A;  2BM5 A;  1VJS A;  5IYN A;  2LMD A;  2STW A;  2A6H F;  3BTC A;  4AIK A;  2NYX A;  4C2M J;  2EFP A;  5L3F A;  4G7Z F;  3WGG A;  4HZF A;  1RUO A;  1K83 J;  4IRI A;  2CGP A;  2DA5 A;  2EJR A;  2VAS A;  2WA0 A;  5JFR A;  1CQX A;  4AC0 A;  4QVJ A;  2NTB A;  2FD5 A;  3ZQH A;  3WE3 A;  3DDY A;  1WJA A;  4IHX A;  2XSJ C;  3GQB A;  4ENN A;  3CJQ B;  3MMP A;  3OAA A;  2BZT A;  3LSI A;  2FOK A;  1S7A A;  1ETW A;  1BI2 A;  2ZKZ A;  3QPT A;  3ABU A;  5BS6 A;  3QSY A;  3CJN A;  4EV0 A;  1BR2 A;  5E18 F;  1JUM A;  3PSI A;  4B3A A;  4IX7 A;  2HI3 A;  4YIR X;  2M5S A;  4V19 K;  2LR8 A;  1JE8 A;  1DG1 G;  1VQL B;  3BLY A;  4ASU A;  1Z0X A;  3FKS A;  1ZG3 A;  5KHD A;  1IC8 A;  4OP7 A;  4Q4Z F;  1T08 B;  3MFK A;  3Q0U A;  4X6A J;  3ZPN A;  1TWG J;  1XTA A;  1LE8 B;  2M3A A;  2WAF A;  2C77 A;  1AKH A;  1A31 A;  1FND A;  1OJL A;  3CUQ A;  3CCL I;  3O8H A;  3O6B B;  4Y13 A;  2CW5 A;  1WSR A;  1RNL A;  2FMY A;  2X8K A;  1IXC A;  4G1V A;  2V7X A;  4KH3 A;  2ZNY A;  1WJ5 A;  2LBF B;  2W6J A;  4AWX B;  3ES9 A;  2BVL A;  4PJM A;  5J3O A;  5D6E A;  1GUU A;  4XSX F;  2NT6 A;  4I98 B;  3BWG A;  2PFB A;  2ELJ A;  4L0Z B;  4BAC A;  2CH0 A;  3JRA A;  2AXL A;  4AC9 A;  1SD4 A;  4NUB A;  2MBF A;  1ZRD A;  2TDX A;  4P2N A;  4CCO A;  1YJW B;  2V6E A;  3BOQ A;  3OIO A;  1MKM A;  3Q3S A;  3F22 A;  1WXR A;  4OOV A;  2EB7 A;  3ZZ0 A;  1VHE A;  4ACB A;  5JHF A;  3WU2 C;  4L5I A;  2ZSI B;  1X1C A;  4EJW A;  3BDD A;  1QBJ A;  2CJJ A;  3GTK J;  2L9S A;  3GTQ J;  3OEH A;  4QHY A;  1FOY A;  2FNA A;  5M5Y J;  4I99 C;  3I0T A;  1WRJ A;  4XK4 A;  5EEA A;  3WXM A;  1P2F A;  4JK1 X;  2HCJ B;  3WTX C;  3HOZ J;  1SKQ A;  1ULY A;  2VJ4 A;  3AFH A;  3LSG A;  2XF5 A;  3P9C A;  4KT6 A;  1GXP A;  1BL0 A;  2EFO A;  1X3U A;  2G7U A;  2XAQ A;  1R6R A;  5J1Y A;  3WGI A;  5BMZ A;  3CD6 B;  5DEQ A;  1GJR A;  1YIT I;  3C1D A;  3H9G A;  5ICF A;  3N97 A;  2H94 A;  2XB0 X;  2HDC A;  4KKS A;  2OTL B;  1LEA A;  3CMA B;  3WQZ A;  3CUQ B;  1QPI A;  5IY5 H;  1TYW A;  1E64 A;  1NBM A;  2QXZ A;  4YDT A;  1UD2 A;  4M9S A;  5CDF A;  3J7Z I;  3BZ6 A;  2ZBK A;  2D3L A;  1S9H A;  1T2K A;  3NAW A;  2LG4 A;  1IW7 F;  2RNJ A;  2WV1 A;  4MQ9 F;  1XGS A;  4CCJ A;  2COB A;  2DFE A;  3A01 A;  4E7L A;  5FRO A;  2LKP A;  3A1P A;  1F9N A;  1I39 A;  3BZK A;  2H6B A;  2DER A;  2IQ7 A;  1IRZ A;  2OBP A;  5F1J A;  2Y9Z A;  2P0W A;  3RKQ A;  2X4H A;  4HLY A;  4B3X A;  3DKY A;  3H5R A;  3BG7 A;  1MNM C;  1H8H A;  2VBX A;  5HS7 A;  3DLL F;  1D1N A;  5JLV C;  1T8I A;  5HOD A;  2VBK A;  4ZYA A;  3CUQ C;  1G7S A;  2MD5 A;  2VL8 A;  1SVO A;  2W57 A;  4PFO A;  1N07 A;  1KZL A;  4P96 A;  1Y8R B;  3KP4 A;  1W0K A;  1SD5 A;  5HLT A;  4D1Q A;  3Q5F A;  4OZY A;  2JTV A;  1ETQ A;  4G6Q A;  1NK2 P;  1EFR A;  4YC5 A;  2GA1 A;  2BGC A;  3J7A O;  1JNY A;  1N05 A;  3LSR A;  2CQX A;  1RZ4 A;  2L7F P;  2DYR H;  3JAM Z;  3ZQC A;  1LB2 A;  3LMW A;  4U4B A;  2KIS A;  3PNV A;  1STZ A;  3W2V A;  3K2A A;  4AM3 A;  2O03 A;  4Y52 J;  2H27 A;  2HOT A;  1V55 H;  4YZQ A;  2MD0 A;  1XX5 A;  2FX0 A;  3B90 A;  3GTP J;  5A89 A;  3OOC A;  1VQO I;  3OS0 A;  1TWC J;  3ONU A;  3V7A A;  2HNH A;  5JLX A;  4BH9 A;  4UZF A;  3GBG A;  3GYH X;  4C3J J;  3A01 B;  2E1R A;  2XAH A;  4XNF A;  2AHQ A;  3ZBT A;  4F7D A;  4YRV A;  3GIR A;  1WWX A;  4DBR A;  3K4J A;  1MMN A;  1NK3 P;  3S1Q J;  2QEX I;  2MC3 A;  2VI6 A;  3O3K A;  2L54 A;  1A04 A;  4CCN A;  2UZK A;  2DN0 A;  2VJJ A;  1YIJ I;  2WAD A;  1L3L A;  2GK7 A;  3E5U A;  3HHG A;  4CZZ A;  3KP2 A;  2OC6 A;  4CO8 A;  1WPC A;  1H9G A;  3FIS A;  4Y4R A;  1U3E M;  2HS5 A;  3L00 A;  5DCF A;  3H1C A;  4RS8 A;  4IXA A;  3BY1 A;  2IS4 A;  3L7W A;  3CP8 A;  4Z4Y A;  2Y0S N;  1K7A A;  1FRN A;  3AG2 H;  3DPT A;  3H3Z A;  4ETS A;  2VPR A;  2CBX A;  4M53 A;  2NT9 A;  2ZL6 A;  2VBW A;  4TMZ A;  1BX1 A;  4LFU A;  1P4W A;  3MKY B;  3VSL A;  1T6X A;  2Z8G A;  1JT6 A;  3M3Y J;  3SJP A;  2NTQ A;  2FJ1 A;  2VIX A;  2XAF A;  2DK5 A;  3ISP A;  1LQ1 A;  1FIA A;  4ZGN B;  2FXA A;  1VLO A;  1OFE A;  2VON A;  3KE2 A;  4JBA A;  5D8L B;  1QGA A;  1APL C;  3E3V A;  1HKQ A;  4RD3 A;  2XZO A;  2M8G X;  1K9M D;  4G7W A;  1MMD A;  1OFD A;  2XNC A;  3GLX A;  2R7S A;  2DEU A;  3CCY A;  1QQI A;  3J81 K;  2RVC A;  2DMU A;  2JRT A;  4JQF A;  3I56 I;  1KCC A;  3QU3 A;  1YTY A;  3KYL A;  3KP5 A;  2CQK A;  5J3L A;  3D26 A;  3F8F A;  4RDJ A;  3GX4 X;  1KK1 A;  3SZE A;  1JJ8 C;  5ERI A;  2HXO A;  2C2W A;  3V7C A;  1G7T A;  3WNB A;  2LOO A;  5HS9 A;  2ZTN A;  2M7B A;  1LDD A;  4FIS A;  1R71 A;  5HLI A;  1F4K A;  5CYV A;  2E35 A;  1MAB A;  2V1N A;  2FNP A;  1XCV A;  3QOE A;  5DYM A;  1ELO A;  2QBY A;  2VOD A;  2X0K A;  2Y2Z A;  1N06 A;  2BM1 A;  4EH1 A;  3LSK A;  3CCJ B;  1LJ9 A;  5DTD A;  2CYY A;  3A0B C;  3A02 A;  2ZJR F;  2NS8 A;  3KRG A;  3TH0 A;  3IP4 B;  2VBY A;  1EA3 A;  4AYB N;  3U1K A;  2Y75 A;  5IT3 A;  4RA2 A;  2F2E A;  1LFP A;  4RGU A;  5LEK A;  4N0B A;  5JVG F;  1FTT A;  4UVA A;  1FX0 A;  4P6Y A;  5A8A A;  2X9D A;  4IHS A;  1YW7 A;  4Q47 A;  1PYV A;  2P4W A;  4M6V A;  2W82 A;  2VZL A;  3M7G A;  2K85 A;  1IJW C;  3AST A;  4ZYE A;  2C5B A;  2Q8K A;  3ZQQ A;  4KKU A;  1LUJ B;  1R22 A;  2C6Y A;  1R00 A;  1NRK A;  3PUB A;  5FLX Z;  4ZYD A;  4BJT A;  3BH6 B;  1ZR4 A;  1OQY A;  2XV4 S;  2NVY J;  3BPV A;  4BHB A;  1TLH B;  3RZO J;  1W87 A;  2O6W A;  2DFF A;  1DQU A;  1VQL I;  3CCM B;  1RI7 A;  4BQN A;  1DGR M;  2QSG X;  3W5H A;  4P25 A;  4PGO A;  1KTW A;  4F7Z A;  2VBU A;  3I9V 2;  2WBM A;  5ILV A;  2BW3 A;  2O8X A;  2GOX B;  1QFJ A;  4RD6 A;  1FX7 A;  2BM6 A;  3LSM A;  2VOO A;  2IP2 A;  4H0E A;  5BPI A;  5EF6 A;  2KHM A;  3JRB A;  2CK3 A;  2E1N A;  2KIQ A;  1ZH5 A;  2DT5 A;  3Q39 A;  4HDU A;  3KPH A;  3FPP A;  2HZT A;  3BR0 A;  4EJO A;  4E0F A;  2NVT J;  3CZ6 A;  3QYF A;  1PDN C;  3KET A;  1XFO A;  5A88 A;  1SVM A;  1FZP B;  3B78 A;  3DU5 A;  2Z2S B;  2XTY A;  4P3Y A;  3IH3 A;  1QHH D;  1XN7 A;  4G7H F;  4PJL A;  5E1X A;  4M3F A;  4MEY F;  1W7P A;  2XND A;  3JTG A;  3DEW A;  2VBE A;  3CB4 A;  1ETK A;  3PA2 A;  5LEJ A;  4UVC A;  3FMQ A;  5FRN A;  1W34 A;  2VJI A;  4BGD A;  4RB1 A;  2VB6 A;  3BR1 A;  2A07 F;  1VQM I;  2XZL A;  3CDL A;  3DU6 A;  3BR3 A;  3E6C C;  1EP1 B;  3PO2 J;  1BHE A;  2L3D A;  1D3Y A;  3JSO A;  3IUO A;  2V79 A;  5CQG A;  4Z4W A;  2EWE A;  3FX3 A;  3D5L A;  5F4M A;  2LF8 A;  3JCU C;  5AIP A;  1WI3 A;  2Q6I A;  2IGO A;  5LGN A;  4PC7 A;  1QA3 A;  4XOR A;  5TV2 A;  1X4O A;  3CJT B;  3QU6 A;  2KFD A;  4R1H A;  3CCQ I;  2X3U A;  1J2X A;  5IYW A;  2IPQ X;  2NVQ J;  1XE1 A;  3W2W A;  3W5V A;  5J1R A;  3SJZ A;  2YUS A;  3OPO A;  3BTL A;  4Y7N J;  2ZCW A;  1GVD A;  1U5T A;  3U21 A;  3CRZ A;  1LM1 A;  2VNH A;  3SUC A;  4XLA A;  1MMG A;  2ESH A;  5BNG A;  1BIB A;  2CUE A;  4YG2 F;  1CZF A;  1O8G A;  1DU0 A;  2YUH A;  1FSE A;  3SKB A;  4B4D A;  3AG3 H;  2MLG A;  1O7L A;  1H9T A;  4Q5S F;  1SM4 A;  2PMD A;  1RU4 A;  3HG9 A;  4RM2 A;  4HF1 A;  1JA0 A;  2BSA A;  2XF6 A;  1QA2 A;  1PJ5 A;  2NVU B;  2C4U A;  1W1W E;  1JRG A;  4EW9 A;  5HDK A;  3WWG A;  2HKX A;  1UHM A;  1W7P B;  1Z67 A;  4XRF A;  1BJZ A;  4O5V A;  3F6O A;  3V42 A;  5M3F J;  1HVX A;  1M90 D;  4P1W A;  4A3C J;  4ZH4 F;  1WPK A;  4TSF A;  2L4M A;  2JK3 A;  2YS9 A;  2W6I A;  3ASS A;  1N75 A;  4G8X A;  2L5Q A;  1D1C A;  2QYO A;  4UB6 C;  1X4P A;  3T5X A;  4V02 C;  4KIT B;  2F5F A;  1EWY A;  4W8S A;  3DFG A;  4A6D A;  3UR3 C;  3RPU D;  5LLQ A;  3CMM A;  1BQE A;  1Q1V A;  1Z3Y A;  4LB6 B;  3SZP A;  3ABK H;  1QVU A;  3HSF A;  5GTI C;  3EQN A;  1UMK A;  3QYB A;  3R61 A;  3TP3 A;  3WTS C;  3M8J A;  2EA4 A;  2RC6 A;  2K40 A;  5M3M J;  1WH7 A;  3TL4 X;  4HF0 A;  2EPF A;  4I76 A;  2IA2 A;  3RPQ A;  2B7C A;  4X05 A;  5H59 A;  2DCU A;  4XID A;  1W0T A;  4B3G A;  5CVR A;  4WX9 A;  3EQO A;  3BC8 A;  1U5T B;  1H42 A;  1FLI A;  2L0K A;  3ABL H;  3GVL A;  2CUJ A;  5F6F A;  5IP7 J;  1KU9 A;  2D1H A;  2F5D A;  2MH2 A;  2VC0 A;  3S2W A;  1B4A A;  2CO5 A;  2ZTG A;  2ZXW H;  1YW9 A;  2OD5 A;  4BUP A;  4XD7 A;  4CCK A;  1X19 A;  4I02 A;  3QRF F;  4OJ5 A;  2BY1 A;  3VSU A;  2WC2 A;  1XSD A;  3ZRG A;  1N8R D;  1HF2 A;  1R23 A;  1TT0 A;  3JTH A;  5DD4 A;  2R7T A;  3W2F A;  3H36 A;  3CCV B;  1OHH A;  3LQ6 A;  1S72 B;  3I58 A;  1O8L A;  4GYG A;  2K3F A;  2FUG 2;  2HEO A;  1KQ9 A;  1QCX A;  2OTJ I;  3M9A A;  1U5T C;  4KYW A;  2GJR A;  4YAL A;  4ZZL A;  1G3Y A;  1SVL A;  2D5V A;  2QVO A;  3LNQ A;  3SHF A;  1Z3X A;  4A5M A;  1NHA A;  4PSX A;  2W84 A;  2NPF A;  1YI2 B;  1S8N A;  2EIJ H;  2VKV A;  3S15 J;  3A3B A;  1FNC A;  1WJD A;  3HOT A;  4I6Z A;  3FHN A;  5LHI A;  1Q81 D;  5LMZ A;  3CDI A;  1T6S A;  4HPQ A;  2MG4 A;  2OF7 A;  5F0C A;  3IRR A;  2QSF X;  1FSH A;  1EKE A;  1DDG A;  4FQG A;  2HLD A;  1UJ8 A;  2R7R A;  2IS1 A;  4NCN A;  2EV5 A;  5CVJ A;  3NAU A;  1I6H J;  2V4J C;  4E7I A;  2Y0S A;  2OBS A;  1TSP A;  3K6G A;  3HIF A;  2DXI A;  4UUT A;  4EGZ A;  1QUE A;  4A3G J;  2E2J J;  3H9J A;  1JKQ C;  1D8J A;  2MYS A;  3WTY C;  2JJ1 A;  1BM9 A;  4RM0 A;  1MBK A;  2DOE A;  1OOC A;  5B1B H;  3IL2 A;  5M5X J;  2BGI A;  5HNH A;  3C2G A;  3WBJ A;  2A68 F;  1PP8 F;  2HVR A;  2HXI A;  4HRI A;  4UZE A;  1V0E A;  2IGN A;  3ZN0 A;  5JHU A;  2LRE A;  4J00 A;  3EYY A;  4BAY A;  1IDY A;  1H0M A;  3SQN A;  4OMY A;  2R7Z J;  3TMO A;  4X7F A;  4DJA A;  1DBG A;  3O2P E;  4QIW N;  4P9U A;  5IT9 K;  3GFJ A;  2IW5 A;  2VYQ A;  2WR8 A;  4HE5 A;  2XPU A;  1OCZ H;  3ASN H;  3P7N A;  5EMN A;  3R0A A;  1ZGW A;  5GV8 A;  3CCJ I;  2FA5 A;  3S3M A;  3B02 A;  4ESB A;  5FD6 A;  5D4R A;  1DPU A;  2Q6O A;  4NBS A;  3K1M A;  3L1P A;  3HM5 A;  1TT5 B;  3OYL A;  3AK5 A;  1IUF A;  4CCL A;  3QFR A;  2Y30 A;  1R4N B;  1M1E B;  2D2W A;  3IRQ A;  3SLN A;  3TBI A;  4P1V A;  4MR0 A;  2VQH A;  4BYY A;  4A3D J;  5IK2 A;  3SJM A;  1BPL A;  3GXO A;  3GTM J;  1E3P A;  3ZCO A;  3S93 A;  3KYC B;  4BE2 A;  2HPM A;  3B6C A;  2VFM A;  3ONQ A;  1LDJ A;  4XKW A;  5LHH A;  4AD9 A;  2F1M A;  3PVD A;  3QOP A;  1NTC A;  1YHQ I;  2BX6 A;  3W2A A;  4RCY A;  1TQI A;  5JR3 A;  4H9G A;  1U9N A;  4QFM A;  3H9Q A;  3KEY A;  5FGM A;  4GRI A;  1HCR A;  3BH7 B;  5EDN A;  5TR9 A;  4AYB A;  1OYY A;  4C2U A;  3CJR B;  2VNK A;  4HIZ A;  3DTK A;  5K7Z A;  2H09 A;  3OYI A;  2BBY A;  5FKK A;  5FLV A;  3M1E A;  2XEX A;  2K4J A;  4HLX A;  1I18 A;  3PET A;  4CSW A;  4BKX A;  4A0Y A;  1U2W A;  2DY1 A;  5DS0 A;  2V7F A;  2DA7 A;  4DK1 A;  5J8C A;  1O88 A;  1Z05 A;  2GQQ A;  4ZJZ A;  4RGR A;  3SEZ A;  5FKO A;  3CLO A;  4IHW A;  2LH9 A;  2CW7 A;  2WJV A;  1IXS B;  2ZXJ A;  3R0J A;  1VZ0 A;  2FU4 A;  3IHU A;  3V8J A;  1E79 A;  1QG0 A;  3ZZU A;  4Y9R A;  3A0H C;  2ZFW A;  2DYI A;  1WGX A;  4HX4 A;  4DNC A;  1G7R A;  1I50 J;  4L5J A;  3WND A;  3HTU A;  2BSP A;  3FXK A;  2E71 A;  2QE7 A;  1KK3 A;  1IF1 A;  4A3K J;  4YAU A;  4AUX A;  4KMU X;  4MXN A;  4W97 A;  4A6E A;  2I1L A;  1W9X A;  3PIP F;  2HR3 A;  1SFK A;  2E7W A;  3DF8 A;  1EFC A;  1MND A;  3H5A A;  4U7D A;  2IS6 A;  3WTU C;  3SYT A;  3MVP A;  1V3F A;  1WOS A;  2Z33 A;  4HBL A;  1QFZ A;  4IQJ A;  2XRL A;  4NBQ A;  2K9L A;  3VMV A;  5F04 A;  1RPW A;  3VDX A;  4B47 A;  2M87 A;  1TW2 A;  5J35 A;  4F93 B;  2JPB A;  1SAX A;  2WSS A;  1FYM A;  1E1Q A;  1OB0 A;  1IA5 A;  1TNS A;  1SKY B;  3E1S A;  3VYU B;  1ONV A;  2BV3 A;  2E1O A;  2GQF A;  5ILS A;  2EFW A;  3LSJ A;  1VTN C;  2GPJ A;  3H9N A;  1ZGA A;  4A0Z A;  3GF2 A;  1XSX A;  1O7F A;  4Z4T A;  2IEK A;  4FAS D;  2AXT C;  1EH8 A;  4U0V A;  4UUS A;  1O8D A;  2LDU A;  3OYG A;  1MW7 A;  1WH5 A;  3F0C A;  1KYW A;  2UVF A;  1O8M A;  1IJF A;  3MWM A;  2VT2 A;  3ZBU A;  3MAJ A;  5C3E J;  1HXD A;  4ESF A;  1QX4 A;  2PLF A;  4BHC A;  1ZM2 A;  5B6I A;  3VB2 A;  1JKP C;  1B2R A;  1KQ5 A;  3FK7 A;  1BI3 A;  1OYW A;  1XMA A;  3A4C A;  4L8J A;  1I27 A;  2NNN A;  1XDU A;  2JSP A;  4X7E A;  1CGP A;  1Y0N A;  3AG1 H;  1ACI A;  2DET A;  3RTR A;  1H80 A;  4RPB A;  2JSC A;  2EFN A;  3ML6 A;  3GQ8 A;  4XR6 A;  1VQ5 B;  3BTJ A;  1VQP B;  3A3G A;  1T6Z A;  2ID3 A;  2R93 J;  4U0W A;  1KMH A;  3E5X A;  4XOP A;  1X1D A;  4EM0 B;  1W0U A;  5HNF A;  1FOK A;  1E0E A;  2V7V A;  4P22 A;  3KCC A;  1IUY A;  2E5Z A;  1T0F C;  2MW8 A;  4C2L A;  3OS1 A;  3HEF A;  4MLO A;  4RAF A;  4OAY A;  4LBY A;  4MYU A;  1BOB A;  3QYE A;  1XMX A;  4ROX A;  1QJV A;  3DV8 A;  3M07 A;  2OBT A;  3E6M A;  1EH6 A;  4D0P A;  1MNE A;  2BV6 A;  1B9M A;  2LF7 A;  2Y48 A;  4UUS B;  3ZGK A;  3A35 A;  3ZPP A;  4XLE A;  2DYS H;  4YEI A;  1BLI A;  2GXG A;  1W5T A;  3NEU A;  3F8N A;  3RI4 A;  1LFB A;  3KFW X;  3MEX A;  1FDR A;  4Y33 A;  1JTX A;  2GAU A;  5C44 J;  2JUC A;  2YWE A;  1DGW Y;  4I0A A;  1V54 H;  3NWS A;  3JQP A;  2LP0 A;  5FIU A;  3W5U A;  3G4S B;  1R4M B;  4XRS A;  3U9G A;  4RD2 A;  2H1K A;  2NSP A;  4X0G A;  2DOD A;  5DM7 F;  3AGQ A;  3CCV I;  1PJ6 A;  1WJB A;  1ZQ3 P;  5BOX A;  1F43 A;  1Q1H A;  3DBL B;  1UEL B;  4EAT A;  9ANT A;  1FMW A;  2YU3 A;  3K4K A;  5F4O A;  1YO5 C;  4LGW A;  4G6D A;  2ZJP F;  1EP3 B;  1VF7 A;  2V7Q A;  1QA6 A;  4XMY A;  3I54 A;  5AIQ A;  3P9K A;  5D5X B;  1WHU A;  2ZXI A;  4R79 A;  1VQ9 B;  1PJR A;  3JUR A;  2P81 A;  2QQ8 A;  1P7I A;  2GIZ A;  4M74 A;  3QAH A;  3CCU B;  3HJE A;  3V4G A;  2BVN A;  2VFP A;  5B1A H;  5HOO A;  5FKL A;  2CMP A;  2YWH A;  1OGO X;  2EFQ A;  1QU3 A;  1OFM A;  5E3L A;  1BI0 A;  4DNR B;  3CPW B;  3OFN A;  5GAE J;  3VR6 A;  2ECC A;  4RDK A;  3LSP A;  2D1V A;  4F52 A;  5F0H A;  1B9N A;  2RV8 A;  1ON2 A;  4BXU A;  1LFU P;  2DA1 A;  2Y69 H;  2B7E A;  2V7W A;  1N25 A;  1ZG1 A;  1VQ7 I;  3GTG J;  2R5Z A;  1QVF B;  2N8G A;  2ZSH B;  4DIQ A;  4PSW A;  5D4S A;  5EYR A;  4ZDL A;  2D9R A;  1YQA A;  3CUO A;  1UHW A;  2BOL A;  1HZE A;  1O4X A;  3JW4 A;  3WGH A;  2KL4 A;  1G8X A;  3P9I A;  2IVM A;  2QQ9 A;  3L2R A;  2DU9 A;  2WPD A;  3GME A;  3K7A J;  2XVC A;  4CUG A;  2ZL7 A;  2X3H A;  3IWZ A;  2NS7 A;  4P5O A;  3DWL E;  2O3F A;  4BJ5 C;  2PYH A;  4QLC U;  2JN9 A;  2EBI A;  2LVS A;  3FXO A;  2IS2 A;  4OIO F;  4QVA A;  1I3Q J;  4E7S A;  3CMY A;  3UKG A;  4OJ6 A;  1KA8 A;  4IHV A;  5DS9 A;  2RGV A;  4WK8 F;  2CRG A;  3RY8 A;  2Q6K A;  2JA8 J;  3T56 B;  1KTV A;  2KPM A;  1KU7 A;  4IEJ A;  2KIM A;  1GQ8 A;  1FBS A;  2ECB A;  2F48 A;  2L2O A;  1N0U A;  4A3E J;  3WTV C;  4OJL A;  5E20 A;  1TWH J;  5AMV A;  1U9O A;  5CPR B;  5GPA A;  3TW6 A;  4XM3 A;  2K9S A;  4FTH A;  3J81 Z;  1YJN B;  1P6R A;  2HOA A;  3KX2 A;  2M9H A;  2X6X A;  1XC5 A;  2Z16 A;  2K86 A;  2E7X A;  4BXF A;  2Z9O A;  3P26 A;  2LKS A;  1R9T J;  4XLP F;  3DKX A;  1AKH B;  3ERM A;  3BH4 A;  1WDT A;  3HB9 A;  2R5Z B;  2FEZ A;  1WFX A;  1VQ6 I;  5C4X J;  2V5I A;  4UB8 C;  4IF4 A;  1I1S A;  2MLK A;  1HST A;  2LLK A;  1X3W B;  3ZMU A;  2X0L A;  4C30 A;  4PC3 A;  4ENJ A;  1O3S A;  3FK6 A;  4G9Y A;  1MMS A;  2X1C A;  5B3S H;  4KKT A;  5HKK A;  1D5V A;  2DIE A;  1F1Z A;  3R60 A;  4B48 A;  1KON A;  4GO1 A;  4MGR A;  4UV8 A;  4HWV A;  4HAM A;  4P9F A;  3RKX A;  3BQZ A;  3LYC A;  1G59 A;  5JMC B;  1FT9 A;  3R6S A;  2K27 A;  1MBH A;  4NC7 A;  2HPI A;  4XKB A;  1YS7 A;  4W8R A;  1G7C A;  3T8R A;  3FJO A;  1OCT C;  4YXW A;  5E79 C;  2NOJ B;  4U49 A;  3BPX A;  4A3B J;  3MZ8 A;  2M45 A;  1A6I A;  2VBV A;  2DA6 A;  2PG4 A;  4UY8 I;  2O0Y A;  1Y0Y A;  3RJP A;  4WQM A;  1VQ4 I;  2V26 A;  3HOV J;  1GVH A;  3QOD A;  2LY9 A;  2DPD A;  3A8K A;  3BT9 A;  2BM0 A;  2ZO4 A;  1UCR A;  1ZM4 A;  4FXU A;  2ZL5 A;  5L3E A;  1D2E A;  1FPQ A;  4PAA A;  1WMR A;  3MKZ A;  3T9G A;  4BHP A;  3HGY A;  3WOD F;  2V9K A;  3H92 A;  4G12 A;  2XKP A;  1H8A C;  2OJE D;  2HVQ A;  4QV2 A;  2X51 A;  2D45 A;  4PZJ A;  3OYB A;  3Q6R A;  1SFO J;  2XUB A;  3I55 I;  4XBF A;  2RKH A;  2ZJQ F;  3Q0V A;  2GLO A;  4U9U A;  5ICG A;  2V1D A;  2AQE A;  4C43 A;  2V7T A;  3OS2 A;  1NB9 A;  1O57 A;  1G6N A;  4CQJ A;  4KA4 A;  3BQJ A;  2XDV A;  4FWT A;  1W36 D;  2IGM A;  4S04 A;  2WB1 N;  2DMQ A;  5CLS A;  4PJJ A;  5DD8 A;  2BM4 A;  2DPU A;  2IA0 A;  5ICE A;  5HZB A;  2HZD A;  3LL7 A;  3LAJ A;  1D0X A;  5IYB J;  1FOX A;  1FBU A;  3BG3 A;  4ENK A;  2EZI A;  1HDP A;  3J7Y J;  3A03 A;  1F5T A;  4CZC A;  3OZW A;  2INV A;  1BR1 A;  3PNY A;  2INU A;  1YRN A;  5H20 A;  2BHZ A;  4YFX F;  3FDY A;  5BQT A;  4ZTJ A;  2RAE A;  1LKX A;  4D9J A;  1RQR A;  3B4N A;  1I6X A;  3GZ6 A;  1O8E A;  2O6G E;  3CW2 A;  3KEQ A;  3P5J A;  4FE7 A;  3MQ0 A;  2E2H J;  3KLN A;  2X6O A;  1K4T A;  2H8R A;  3BY6 A;  4RM3 A;  2PJR A;  4UUV A;  1TUI A;  4C0S A;  2W7Z A;  2YSR A;  1WJF A;  5B66 C;  3J7A Y;  1N0V C;  1BW6 A;  1Y0R A;  1YJ9 B;  2VBM A;  1FEX A;  4U0Y A;  3VNU A;  1YIO A;  4RGS A;  3EET A;  1V0F A;  4EQQ A;  1VQ5 I;  4EJT A;  1VQP I;  4P26 A;  1R5B A;  1XQB A;  3NB2 A;  2GZW A;  2EK5 A;  3G1O A;  5GP9 A;  2P5V A;  5GTH C;  2NV4 A;  2DDA A;  1Y39 A;  3PA1 A;  1SMY F;  4HQM A;  5H6R A;  2PLY A;  4ZC3 A;  4DOZ A;  1Y8Q B;  4FK8 A;  1ON1 A;  2PMZ N;  1XB2 A;  3FM3 A;  1OYI A;  3HRU A;  2KLO A;  4JX4 A;  2J8K A;  5J8F A;  1MJA A;  1L1I A;  2AHO A;  1GAW A;  1T5E A;  2LSO A;  1RES A;  3AL0 C;  3H3U A;  2HQN A;  1Z9C A;  1MRZ A;  2NVX J;  2EQR A;  3S17 J;  4KJZ A;  1KK0 A;  4E70 A;  5F1R A;  1GHC A;  2B0R A;  4ENM A;  1FNN A;  2DTR A;  5E3N A;  3JRI A;  4GDF A;  2VFN A;  3QQA A;  2M2E A;  3G6E B;  1ZLK A;  5IYD J;  5CVU A;  3B8Y A;  1YRN B;  2XT4 A;  4G5G A;  4AF6 A;  1OGM X;  3FPK A;  3QPL A;  2DO7 A;  3OYA A;  1PUF A;  1FBQ A;  1ETO A;  3S2H J;  4N3G A;  4OM9 A;  3K0L A;  3G4S I;  3GTJ J;  4AVZ A;  4C2T A;  1XGM A;  2E19 A;  4Q7J B;  1Q7Y D;  5D5W B;  2PJR B;  4IKF A;  4LIU A;  5K5O A;  3GTL J;  1RKT A;  3S16 J;  4YIF A;  2EIM H;  1U6G A;  2XGX A;  1K6O A;  2HOE A;  5LRR A;  4UXN A;  1BN5 A;  3BJA A;  1I5Z A;  1IRF A;  2WYR A;  4QPO A;  2OV7 A;  2XGC A;  2MFZ A;  3QFS A;  2QDX A;  1IO2 A;  2DOF A;  3LFU A;  3OWT A;  2XHK A;  2I5U A;  4AIH A;  5HZA A;  2R3S A;  1MSF C;  3CF5 F;  3HDD A;  2ZZG A;  1HA8 A;  4YFK F;  2EIK H;  4YAF A;  3CCU I;  4OU0 A;  2V4D A;  1WSU A;  5F64 A;  4DW6 A;  1B8I A;  3B8H A;  4HNT A;  1IN6 A;  1X2N A;  2PI0 A;  4I2O A;  2ESN A;  3E6D A;  3C3W A;  1DP3 A;  3OIQ A;  4MHG A;  1K73 D;  3BCA A;  4M4S A;  2A6E F;  1XB4 A;  2JJ2 A;  3H0G J;  2FBK A;  4NHJ A;  4I0B A;  1LNW A;  4C3H J;  4HEA 2;  4MYT A;  2J5P A;  3G2B A;  1DDN A;  2LK2 A;  2QBY B;  4WWV A;  2O17 A;  4RBO A;  2ELK A;  4AU7 A;  2VE9 A;  2ICW G;  3GUD A;  1SAU A;  2KZV A;  2DMT A;  5IOY A;  1Z7L A;  4WZE A;  1ENH A;  2ADU A;  4RD1 A;  3DTE A;  3MCZ A;  3BCD A;  3G05 A;  2KDO A;  1TZL A;  2L9N A;  3LA3 A;  1K78 A;  3BG9 A;  2O04 A;  4L9V A;  5DN6 A;  4LLN A;  3V7S A;  1UHS A;  3DP7 A;  5FRM A;  5BSX A;  2BPO A;  4R71 A;  4PK4 A;  2R92 J;  4G94 A;  4WCG A;  5A2Q Z;  1YJW I;  4M3G A;  4EJU A;  5J4Y A;  1DU6 A;  3KP6 A;  1QHG A;  3OYF A;  1YX3 A;  4I7H A;  4ACA A;  1XCB A;  5FB2 A;  2O7O A;  2G0E A;  4E7Z A;  2HQ5 A;  1YFH A;  3SLD A;  2P6T A;  4N4O B;  1K4S A;  1H8E A;  3VNV A;  3COA C;  1B8I B;  2TRT A;  4LIT A;  4BQO A;  5GAH J;  4ZGQ B;  3DU1 X;  5JLW A;  1IGN A;  1YYV A;  3OYM A;  1IRG A;  3CD6 I;  2IXS A;  1U78 A;  3GQA A;  4CA0 A;  4IO9 F;  2BW3 B;  5AON A;  2OTL I;  2VKE A;  3CMA I;  1WP6 A;  4OPS A;  4YZX A;  2J5O A;  5DUI A;  3IV5 A;  3IH4 A;  5EGO A;  3L2U A;  4BNC A;  3CC2 B;  1TYU A;  2X6Y A;  1KRH A;  3E97 A;  2CS3 A;  3HGG A;  5IYP A;  1K78 B;  4XRS G;  3FWE A;  4DQL A;  3CC4 B;  2ISZ A;  1BOA A;  1J59 A;  1PE9 A;  4BQA A;  3CCS B;  2K9Q A;  2XKO A;  4A12 A;  1LLZ A;  4G6T B;  4TMV A;  2GJK A;  4Z4U A;  3SEJ A;  2E5N A;  3Q0W A;  2XTX A;  4O6J A;  1PUE E;  1W36 C;  1P4X A;  2O8K A;  1VND A;  2W00 A;  1B72 A;  1BMF A;  3HSR A;  3TGN A;  1S29 A;  1TW3 A;  3MCA A;  2WY7 Q;  1ZN2 A;  2OQG A;  4HA8 A;  2ME6 A;  1IZ1 A;  3M8F A;  4M0L A;  3W2E A;  2RNG A;  2ZME C;  2EFG A;  3OYN A;  3J80 K;  3L2W A;  1SMT A;  3KEO A;  1RR7 A;  2CF4 A;  1OB5 A;  5E8G A;  1PP7 U;  3HPG A;  4OWR B;  3GQ7 A;  1JTA A;  3OL3 A;  1XMK A;  3V8K A;  4GQN A;  2RC5 A;  1SFE A;  2BXY A;  3L2V A;  2YU9 J;  3ZR8 X;  3DBH B;  1QZZ A;  1O8K A;  3EDP A;  2OU2 A;  2VQG A;  2DFH A;  4IPA A;  2BXZ A;  5EGO B;  5ED4 A;  1JGS A;  3BR5 A;  4BBS J;  2KRH A;  2BGJ A;  3GEZ A;  3MZY A;  3GFI A;  5F0F A;  1RQP A;  3D5S C;  4II3 A;  3WG9 A;  1AWC A;  3I59 A;  3BNW A;  2O9L A;  1IV8 A;  4OIQ F;  2HVS A;  3C18 A;  3RIR A;  2ELH A;  3LMM A;  2KRF A;  1GR1 A;  3IKV A;  4Y9U A;  1OIS A;  4YAO A;  1Y1V J;  3SQV A;  1AIP A;  1IAW A;  4BDZ A;  5FFX A;  2F4I A;  2PN6 A;  3TO6 A;  2M4K A;  5KK1 A;  4C9Y A;  5LGU A;  3AAF A;  1B72 B;  2XPV A;  2QM3 A;  2QY1 A;  4HDV A;  1ZGJ A;  3LQR A;  2CFX A;  4U7B A;  4CHU A;  2LC2 A;  5DM6 F;  3N05 A;  2Z1D A;  2L7Z A;  5E1Z B;  4E7H A;  3I3L A;  1MD0 A;  1HLV A;  4CH7 A;  3GVJ A;  4FN5 A;  1ZEL A;  4RAG A;  1F20 A;  2CFO A;  2LKX A;  1NB0 A;  3G3Z A;  4BE0 A;  3TKY A;  4WXH A;  1E1R A;  1TLL A;  2LZJ A;  2VOP A;  3ZP5 A;  4ITV A;  5KAI C;  2OZ6 A;  1ZM9 A;  1MIJ A;  2DQL A;  4RLZ A;  4KFC A;  2WAE A;  2WB1 A;  4NDL A;  2DJN A;  3S1M J;  4RB0 A;  4GGG A;  3ZQI A;  1WTH D;  1E62 A;  2MGQ A;  2FBI A;  2JT1 A;  1HW5 A;  4GXO A;  3S14 J;  1IDK A;  1RKW A;  4XKC A;  3K4B A;  1RRJ A;  3A8I A;  5CVI A;  1K8A D;  4M73 A;  2HKO A;  2JPC A;  1GAQ A;  3I59 B;  2DI3 A;  2W24 A;  2ZJ2 A;  3D5R C;  3VSV A;  3QPS A;  2XB5 A;  2A3S A;  2DK8 A;  3JR9 A;  2GA2 A;  3H5N A;  1P4A A;  1WQ2 A;  2PBI A;  2W4S A;  4WZT A;  4XSZ F;  2I8D A;  1QRB A;  4M3D A;  2QZA A;  1OCO H;  2KMU A;  1GDT A;  4GFB A;  3R4K A;  2NS0 A;  4M71 A;  4W8Q A;  2OBR A;  2K02 A;  3B6A A;  1U0J A;  3GVA A;  2NST A;  5LGT A;  2EH3 A;  4QSH A;  3UNG C;  2XAU A;  3ZQF A;  5FNZ A;  1WJE A;  4QUZ A;  4RAY A;  3IWF A;  3OOU A;  5IP9 J;  1XG1 A;  2ZBU A;  1UD8 A;  3VOD A;  3ABM H;  3SXY A;  4PGG A;  2ZFU A;  3GTO J;  2PMZ A;  3DKW A;  4RCZ A;  3RPU A;  1RMG A;  1VI0 A;  5GV7 A;  3RKY A;  2X48 A;  4E7J A;  5EZH A;  3HOX J;  3ZOB A;  2HMA A;  3MHP A;  3ASO H;  3M1C A;  1K5C A;  1I3A A;  1KD1 D;  2DQR A;  3HRT A;  1J9I A;  1DAR A;  2B7B A;  1WVR A;  3G1M A;  3T1B A;  2KQR A;  4YII A;  4YFN F;  2VC1 A;  3RYR A;  2VQC A;  1KU3 A;  5D5U B;  4XN3 A;  3PUN A;  3KP3 A;  3F8C A;  1IB4 A;  1QFY A;  4M1K A;  1MBJ A;  5DSZ A;  4FX4 A;  5KCM A;  3E20 A;  1W5S A;  4I01 A;  1S6L A;  1T6Y A;  2VBS A;  2ODL A;  1Z6T A;  1XG2 A;  2E1M C;  2VN2 A;  3MKL A;  4PAB A;  3KZZ A;  3CQZ J;  3CCM I;  1C0W A;  2QKM B;  4Z06 A;  5E3M A;  4FX0 A;  3OKX A;  3AG4 H;  2LFB A;  1R36 A;  2BY3 A;  1ZHF A;  5FLM J;  1EFT A;  4KMF A;  4HF2 A;  3OYE A;  2HU9 A;  4PJ0 C;  1K28 D;  4Y7C A;  4Z4Z A;  3KIO A;  5H6Q A;  4ZDO A;  3REO A;  2A6T A;  1KQ8 A;  1BX0 A;  2XZP A;  2X1E A;  3JX8 A;  4MO7 A;  2HGC A;  2UUZ A;  1O3T A;  4TV7 A;  2BY2 A;  4WXD A;  5TRD A;  1VQN B;  2VFQ A;  3PFI A;  4V2F A;  2O0V A;  2HTS A;  3S8P A;  1X58 A;  2G0Y A;  3HXL A;  1O3Q A;  4N3N A;  1O3R A;  3VFZ A;  2C5H A;  1T0F A;  2BM7 A;  2VKH A;  2E36 A;  1DPR A;  2EWN A;  3J81 k;  3FY3 A;  1SD7 A;  1WCM J;  2FVG A;  3HPH A;  1AOY A;  2O5R A;  1JHF A;  3SEQ A;  1HOM A;  1JXS A;  5J6X A;  1BJK A;  2X85 A;  2BMW A;  5TIS C;  2HOS A;  1OCR H;  1E3H A;  2JQ7 A;  1NG6 A;  3TED A;  3WU0 A;  3WHC A;  1PUF B;  1GV5 A;  3LNN A;  1QO0 D;  4ZTF A;  5D8K B;  1UG2 A;  2DA4 A;  3OW2 B;  2VNI A;  3F3X A;  5F08 A;  4HX7 A;  2XOK A;  2FOW A;  1WKM A;  1XPX A;  2PJP A;  1FNM A;  1HA3 A;  4FT8 A;  3H3V K;  3NE5 B;  1A6Q A;  1S5L C;  4L18 B;  3AVW A;  1VQK B;  2WAQ N;  2CG4 A;  1J5Y A;  2BN4 A;  1UG0 A;  1E17 A;  2DOG A;  2K9M A;  1OCP A;  1I8D A;  2JVH A;  4BE1 A;  2XNJ A;  4B8X A;  2E1B A;  5H2F C;  2FX3 A;  2L02 A;  3DTI A;  4NC6 A;  3CDH A;  5EEH A;  2FQ3 A;  5JBQ A;  3EUH C;  1NHC A;  2WJY A;  2ME0 A;  1VLY A;  1IN8 A;  5E17 F;  1WI9 A;  2P7V B;  1V5F A;  1ZRE A;  2DMN A;  3P27 A;  3K9T A;  1RC9 A;  4L0Y B;  2CQ7 A;  3CC4 I;  2DLL A;  5LRS A;  2JA7 J;  1OGI A;  1GLN A;  1AMO A;  2QEX B;  1X3Z B;  2PEX A;  3FF5 A;  3QPH A;  1V5G A;  3RDI A;  3CCS I;  1P4M A;  3ESW B;  1BC7 C;  3T8T A;  1FYL A;  1WZ2 A;  4NK6 A;  1I1G A;  4JX5 A;  1G3W A;  3LQE A;  4I84 A;  1LDK B;  1T56 A;  4OPW A;  2EZK A;  3PQK A;  2DW4 A;  3DXJ F;  2L01 A;  4A93 J;  2M4G A;  1QGY A;  1B6A A;  2F5V A;  3ROU A;  1ZUN B;  2BF4 A;  4RD0 A;  4IHY A;  2K4B A;  3RQI A;  3HOU J;  4XON A;  2GXB A;  2RQP A;  1YE9 A;  5FO5 A;  3HHH A;  4XLN F;  2UXN A;  3L2Q A;  2Q6L A;  1ZG5 A;  2NRA C;  1IDZ A;  2XSD C;  1KGS A;  5FO0 A;  4BU2 A;  4LB5 A;  2H8W A;  4JOM A;  3T53 B;  4LK0 F;  1IN5 A;  1V4R A;  1ITY A;  3K69 A;  4IW3 B;  2GRE A;  3ASR A;  4NB5 A;  4EGY A;  1OR7 C;  3HRM A;  1Z77 A;  5KAF C;  1MGT A;  2A05 A;  3PIO F;  1FTZ A;  1S0U A;  2PX9 A;  3Q3A A;  2O1D A;  1KQ0 A;  3ZPL A;  2RRE A;  1T33 A;  1QQ1 A;  2R9V A;  5LBQ A;  5L46 A;  3PUM A;  4KNY A;  2R7V A;  3B82 A;  1FC3 A;  3F6V A;  3VYS B;  3OYH A;  3CXC B;  2RN7 A;  3HKZ N;  1JUP A;  1HG8 A;  4Z05 A;  3WU1 B;  1QZE A;  1RWR A;  4OOI A;  1JT0 A;  3DQV C;  2E60 A;  3VWB A;  4P12 A;  2OA4 A;  1FWZ A;  3W6K B;  2IOU G;  1KK2 A;  4TT3 A;  4LLL A;  3W2H A;  2HDD A;  3PNT A;  1S72 I;  1ZAO A;  1MSE C;  1HKT A;  3OL4 A;  3TOB A;  3Q9V A;  2W7N A;  4JRA C;  5DV5 A;  3OR1 C;  2YX4 A;  4A0X A;  1FOW A;  1IHM A;  3ZMS A;  3BZC A;  2CV2 A;  2GJP A;  2VBZ A;  2CV0 A;  1ZYR F;  2XGD A;  4A5N A;  4HSR A;  3CLQ A;  1WJC A;  1CNE A;  1U2R A;  1PJ7 A;  3OIP A;  1YI2 I;  3OOP A;  4A3M J;  5L3G A;  4IVN A;  2FRH A;  4PDK A;  3RQ4 A;  5IYQ A;  3PL8 A;  2G7H A;  4KIF A;  2KIU A;  3E0J B;  2FQ4 A;  4X7D A;  3K2Z A;  4X07 A;  2P8T A;  4PUS A;  2E1C A;  1S7O A;  3H0D A;  2OYN A;  4NQW A;  5J4V A;  4XKV A;  4AF7 A;  4QWQ A;  4HQE A;  4LC0 A;  2CW0 F;  3ISX A;  2J7K A;  3BJ6 A;  2R7U A;  4A69 C;  1GT0 C;  2MAB A;  4KT5 C;  3HSE A;  2JZY A;  2XIG A;  4GYI A;  3AVT A;  1MJ9 A;  3MN2 A;  1FRQ A;  1B23 P;  1P92 A;  3JRC A;  4Z03 A;  2ZNZ A;  1JJ6 C;  3OW7 A;  3BCB A;  2Y31 A;  3TDZ C;  4DQK A;  4A3J J;  1TQP A;  2VUM J;  3OE7 A;  1SC7 A;  4LBV A;  1KJZ A;  4KN7 X;  1BW5 A;  3OYK A;  1IN4 A;  1Y6I A;  2BEO A;  2CW8 A;  3FKI J;  3ZMT A;  4Z4S A;  2OCE A;  4UHT A;  5KVR A;  3RSN A;  4KIC A;  5HLG A;  2ZZE A;  4BL0 B;  1E3X A;  2E34 A;  1TWA J;  2GOM A;  2V9P A;  4N9H A;  5GPC A;  2CC2 A;  2UVE A;  2ZZQ A;  1EP2 B;  1EH7 A;  3QFT A;  4BY1 J;  4E7K A;  2EA2 A;  3FIW A;  2QGU A;  5FKM A;  4G1B A;  3K4L A;  1EF4 A;  4KN4 X;  1R5O A;  2L9V A;  3VEP A;  4LK1 F;  4ZYH A;  2KZG A;  3S3O A;  1Z1D A;  3BG6 A;  1JKO C;  2M7A A;  1HSJ A;  1UMQ A;  2QKL B;  2P5L C;  3CPX A;  4B1R A;  3IH2 A;  3Q9S A;  3N6Z A;  1D8K A;  4LIV A;  3PUF A;  4NQW B;  3H94 A;  4XQF A;  4PMH A;  1TQM A;  2BY0 A;  3GVK A;  1TNT A;  3QFC A;  3GSI A;  5C1E A;  2B5O A; 
#chains in the Genus database with same CATH homology
 2OUM A;  3ZRG A;  3RCO A;  1IRX A;  3W3C A;  1TT0 A;  2PJR B;  4IKF A;  3FBN B;  2VQL A;  4LIU A;  2CUZ A;  2R7T A;  1OHH A;  1X1A A;  1O8L A;  5TGT A;  2FUG 2;  4E6K G;  2VKD A;  4YZ0 A;  3CES A;  4QPO A;  3OYD A;  1QCX A;  2OV7 A;  2MFZ A;  2D3N A;  1E3Z A;  4HST A;  2GJR A;  1Y56 A;  3LFU A;  4RLF A;  4DBQ A;  3OWT A;  1Z3X A;  3JU4 A;  3K70 C;  1W0J A;  4PSX A;  2ZZG A;  1HA8 A;  3A3B A;  1O8F A;  1Z21 A;  1T95 A;  2NZM A;  1WJD A;  2XF7 A;  3HOT A;  2V4D A;  3VSU A;  3FHN A;  2R4G A;  4HNT A;  1DP3 A;  4HG2 A;  3OIQ A;  4HPQ A;  3BCA A;  2JUG A;  2JJ2 A;  1PXZ A;  4HNU A;  4B44 A;  2K5C A;  2A5W A;  4HEA 2;  3C2H A;  1JI8 A;  3G2B A;  3UW0 A;  2HLD A;  2R7R A;  2O17 A;  4AU7 A;  2IS1 A;  3VMW A;  1PLU A;  1SAU A;  2KZV A;  1Z7L A;  2V4J C;  3DTE A;  2Y0S A;  4E7I A;  3G05 A;  4NK8 A;  4XLH A;  3K6G A;  2KDO A;  1TZL A;  2L9N A;  2DXI A;  4II2 A;  2O04 A;  1UD4 A;  1P9Q C;  3H9J A;  5DN6 A;  2MYS A;  2WZP P;  2O0W A;  2JJ1 A;  5LFA A;  2WY8 Q;  1OOC A;  4LG3 A;  3A2K A;  2XC7 A;  5FRM A;  5HNH A;  3C2G A;  3MD2 A;  4E4H A;  4PK4 A;  4RMN A;  2HVR A;  2QX3 A;  4HRI A;  3H35 A;  1V0E A;  2IGN A;  3BCD A;  4J00 A;  1D0Y A;  2LRE A;  4I84 A;  3TMO A;  4DJA A;  3OYF A;  1QHG A;  1DBG A;  1YX3 A;  3BC9 A;  2LRD A;  2L7K A;  2KRC A;  4E7Z A;  1COW A;  2F6C A;  4N4O B;  4ZDP A;  2HDW A;  1H8E A;  4F91 B;  4LIT A;  4BQO A;  3S3M A;  4RLQ A;  2JDI A;  4CCM A;  3OYM A;  3OYL A;  2IXS A;  4BS9 A;  4CCL A;  3GQA A;  1O8H A;  4PJN A;  4CA0 A;  2BVM A;  3TBI A;  4MR0 A;  2VQH A;  5IK2 A;  2BW3 B;  3T51 B;  2LBF A;  1BPL A;  4B43 A;  1WP6 A;  1BR4 A;  3OR2 C;  5KNL A;  4YZX A;  1O8J A;  3ZCO A;  3L2U A;  3S93 A;  1VJS A;  2X6Y A;  4OJP A;  4BE2 A;  2HPM A;  2CS3 A;  3K4C A;  3ONQ A;  2DT7 B;  4XKW A;  2F1M A;  3PSF A;  1AIR A;  3IAM 2;  2WAQ A;  3ZXS A;  2WA0 A;  2VAS A;  1PE9 A;  1AA7 A;  3W2A A;  2NTB A;  3CF2 A;  3DDY A;  1WJA A;  2XSJ C;  4G6T B;  3H9Q A;  3KEY A;  2GJK A;  3GQB A;  3AL0 B;  4GRI A;  3CJQ B;  3EUK L;  2E5N A;  3LSI A;  3OAA A;  3OYC A;  4AYB A;  4C2U A;  4F55 A;  3CJR B;  4XL9 A;  4HIZ A;  4OZZ A;  1W36 C;  3DTK A;  1BR2 A;  2W00 A;  3OYI A;  1BMF A;  3PSI A;  4IX7 A;  2M5S A;  1I18 A;  2WY7 Q;  3BLY A;  4CSW A;  4ASU A;  2V7F A;  3FKS A;  5KHD A;  4DK1 A;  1O88 A;  2RNG A;  1O8I A;  4ZJZ A;  3OYN A;  3ZPN A;  3SEZ A;  3L2W A;  2LH9 A;  2M3A A;  2CW7 A;  3HPG A;  2WJV A;  2WAF A;  4OWR B;  4XOT A;  1VZ0 A;  1E79 A;  3GQ7 A;  1JTA A;  3OL3 A;  4GQN A;  2X8K A;  3L2V A;  3ZR8 X;  3AKZ A;  1WJ5 A;  2LBF B;  1O8K A;  2W6J A;  2R7O A;  2BSP A;  2BVL A;  4PJM A;  2X6W A;  2VQG A;  2QE7 A;  4BDY A;  1N78 A;  2X53 S;  2NT6 A;  2KRH A;  3OY9 A;  4OJ5 A;  2NTP A;  1EE6 A;  3CP2 A;  3DLA A;  2ELJ A;  4MXN A;  2VJ5 A;  3VYR B;  2CH0 A;  4BAC A;  3D5S C;  4II3 A;  1W9X A;  1SFK A;  2UV1 A;  1MND A;  3H5A A;  4NUB A;  1UD5 A;  2HVS A;  4G6I A;  1V5E A;  2IS6 A;  2ZZF A;  3SYT A;  4CCO A;  2F43 A;  2V6E A;  3LMM A;  3VMV A;  4IQJ A;  2K9L A;  4NC8 A;  3VDX A;  4XLF A;  4B47 A;  4TKO B;  4F93 B;  5JHF A;  2DOA A;  4BDZ A;  2WSS A;  3K4M A;  2F4I A;  2ZSI B;  1X1C A;  2M4K A;  4C9Y A;  1E1Q A;  1OB0 A;  3OEH A;  2L9S A;  2XGJ A;  3VST A;  1IA5 A;  1SKY B;  2QY1 A;  3E1S A;  2LYC A;  3VYU B;  4U7B A;  3HKZ A;  2LC2 A;  3N05 A;  2Z1D A;  2VJ4 A;  3LSG A;  3AFH A;  4E7H A;  2XF5 A;  4KT6 A;  3SZG A;  3I3L A;  4CH7 A;  3GVJ A;  1ZEL A;  1R6R A;  2CFO A;  4FAS D;  2W1O A;  1O8D A;  1OFL A;  4BE0 A;  1E1R A;  3H9G A;  2LZJ A;  3OYG A;  4ITV A;  1MW7 A;  2UVF A;  3WQZ A;  1O8M A;  1NBM A;  2QXZ A;  1UD2 A;  5CDF A;  2WAE A;  2WB1 A;  2IGK A;  2D3L A;  1WTH D;  1FMV A;  1S9H A;  2LG4 A;  4CCJ A;  1IDK A;  4E7L A;  5FRO A;  4XKC A;  1UAA A;  3A4C A;  4U87 A;  4L8J A;  2IQ7 A;  3K4B A;  2K3P A;  5LD2 C;  2JSP A;  2P0W A;  3D5R C;  3DKY A;  3H5R A;  3BG7 A;  3RTR A;  4B3X A;  1H8H A;  4DNT B;  1H80 A;  3VSV A;  4W8T A;  2VBK A;  3GQ8 A;  4XR6 A;  4DK0 A;  3H5N A;  4ZYA A;  3A3G A;  2W4S A;  3DPL C;  2RQQ A;  1KMH A;  5CQE A;  2VL8 A;  2I8D A;  1X1D A;  4PFO A;  4XOP A;  5HNF A;  1E0E A;  1KZL A;  2KMU A;  4P22 A;  4UZU A;  1W0K A;  1D0Z A;  2E5Z A;  5HLT A;  1T0F C;  4D1Q A;  2Z6B D;  4OZY A;  4C2L A;  3OS1 A;  4NNJ A;  4MLO A;  1EFR A;  4G7X A;  2HQA A;  4OAY A;  4W8Q A;  1BOB A;  3QYE A;  1U0J A;  1QJV A;  2NST A;  3UNG C;  2VPL A;  2XAU A;  3LMW A;  1MNE A;  4U4B A;  1WJE A;  3PNV A;  2R7Q A;  3W2V A;  3ZGK A;  3OOU A;  3A35 A;  3ZPP A;  4XLE A;  1J09 A;  1BLI A;  1UD8 A;  5HVQ C;  4YZQ A;  2MD0 A;  2JIZ A;  4Y33 A;  1K6Y A;  3B90 A;  1DGW Y;  2ZFU A;  4H4K C;  2PMZ A;  3OMY A;  3OOC A;  3OS0 A;  3NWS A;  4XN0 A;  1RMG A;  2HNH A;  3S3N A;  3GBG A;  2NSP A;  4X0G A;  4XNF A;  4YRV A;  1WJB A;  4E7J A;  4DBR A;  3K4J A;  1MMN A;  3OEE A;  3SDB A;  4CCN A;  1UEL B;  1MMA A;  3M1C A;  1FMW A;  3K4K A;  2VJJ A;  4EAT A;  2GK7 A;  2WAD A;  1X0C A;  1K5C A;  3EUA A;  2KQR A;  2OC6 A;  3DEE A;  1WPC A;  2VQC A;  4XN3 A;  1IB4 A;  2V7Q A;  1VF7 A;  4Y4R A;  2PYG A;  5C1C A;  4XMY A;  5KCM A;  2ODL A;  1N77 A;  2ZXI A;  4PFP A;  4R79 A;  2IS4 A;  3CP8 A;  1XG2 A;  2E1M C;  3HAG A;  1PJR A;  3JUR A;  4Z06 A;  2QKM B;  3DPT A;  1D1B A;  2NT9 A;  3HUG B;  3HC7 A;  5HOO A;  3MKY B;  2CMP A;  3VSL A;  1OGO X;  1QU3 A;  1OFM A;  2Z8G A;  2Q1Z B;  2NTQ A;  3OYE A;  2HU9 A;  2VIX A;  4DNR B;  1K28 D;  4ANJ A;  3FBI B;  3OFN A;  3VR6 A;  1ERD A;  4ZDO A;  4F52 A;  2A6T A;  2XZP A;  2X1E A;  4F92 B;  2UUZ A;  2XZO A;  4XLC A;  5FL7 A;  2O0V A;  3S8P A;  1MMD A;  4G7W A;  3HXL A;  2ZSH B;  4DIQ A;  2R7S A;  4PSW A;  4ZDL A;  2VKH A;  2KVO A;  1LVK A;  2BOL A;  1X1B A;  1HZE A;  3FY3 A;  2KL4 A;  1G8X A;  3KEW A;  3HPH A;  2O5R A;  3SEQ A;  3L2R A;  4JQF A;  3FKJ A;  2WPD A;  2X85 A;  1KCC A;  4CUG A;  2X3H A;  3KYL A;  4P5O A;  1NG6 A;  3DWL E;  4BJ5 C;  2PYH A;  3LNN A;  2IS2 A;  4ZTF A;  3F9K A;  4E7S A;  2LOO A;  2UWM A;  4OJ6 A;  2ZTN A;  2M7B A;  2XOK A;  3K70 D;  1MAB A;  3T56 B;  2V1N A;  2KPM A;  3NE5 B;  2JA2 A;  1GQ8 A;  3QOE A;  2X1D A;  1OLT A;  2L2O A;  1UG0 A;  3DPU A;  3LSK A;  4KIS A;  2K9M A;  1I8D A;  4OJL A;  5AMV A;  2JVH A;  5CPR B;  3MMY B;  4BE1 A;  3KRG A;  2E1B A;  4XM3 A;  3IP4 B;  3DTI A;  1EA3 A;  2AQF A;  2VXZ A;  3KX2 A;  2X6X A;  3EUH C;  2Z16 A;  1NHC A;  4BXF A;  2WJY A;  1LFP A;  1VLY A;  3DKX A;  1FX0 A;  1V5F A;  3IAS 2;  3VYT B;  1D1A A;  3BCF A;  3BH4 A;  1PYV A;  2W82 A;  1VBL A;  1GLN A;  2GK6 A;  1WFX A;  1V5G A;  4OAZ A;  3A1Y A;  3ZQQ A;  4C30 A;  4KKU A;  1NG7 A;  5HKK A;  4NK6 A;  2X1C A;  4KKT A;  1NRK A;  3PUB A;  2DIE A;  4BQQ A;  4BJT A;  1LDK B;  3PJR A;  4B48 A;  3VSK A;  1KON A;  2M4G A;  2F5V A;  3NWT A;  3HL2 A;  1UD3 A;  4HWV A;  1DQU A;  1G59 A;  4XON A;  2KP6 A;  4NC7 A;  1YE9 A;  2HPI A;  4XKB A;  1DGR M;  4BQN A;  5C1E A;  4W8R A;  4URR A;  3L2Q A;  4IZZ A;  1KTW A;  3K10 A;  4YXW A;  2NOJ B;  4U49 A;  3I9V 2;  2WBM A;  4J01 A;  2BW3 A;  3PFY A;  4BU2 A;  3OYJ A;  2GOX B;  4JOM A;  3T53 B;  2V26 A;  1DBO A;  2DT6 A;  3QOD A;  3HOS A;  2JVG A;  3LSM A;  4FXU A;  1OR7 C;  2KHM A;  2O1D A;  2CK3 A;  2M0M A;  2RRE A;  3MKZ A;  1WMR A;  3FPP A;  3T9G A;  4E0F A;  3CZ6 A;  3QYF A;  2R9V A;  2V9K A;  3DU5 A;  2Z2S B;  2HVQ A;  2R7V A;  2X51 A;  1QHH D;  3VYS B;  3OYH A;  3OYB A;  3ZSC A;  1KCD A;  4PJL A;  4DGW B;  1HG8 A;  1IDJ A;  4Z05 A;  1RWR A;  2XND A;  2E1M B;  2E60 A;  3DQV C;  3VWB A;  2VBE A;  4BEH A;  2AQE A;  1YX5 A;  2LY2 A;  3OS2 A;  2VJI A;  5FRN A;  4BGD A;  4TT3 A;  2VB6 A;  2XZL A;  3PNT A;  3DU6 A;  2V31 A;  3LSH A;  3OL4 A;  2W7N A;  1BHE A;  3OR1 C;  2XDV A;  3IUO A;  1UD6 A;  5CQG A;  1W36 D;  2IGM A;  2EWE A;  3D5L A;  4PJJ A;  2CV2 A;  2GJP A;  2LY1 A;  2IGO A;  2CV0 A;  4XOR A;  2R7W A;  4HSR A;  1X4O A;  2HZD A;  3LL7 A;  1WJC A;  1D0X A;  4Y3O A;  4OJO A;  3OIP A;  3ZIA A;  3W2W A;  4FET A;  3RQ4 A;  4YEL A;  3OPO A;  2DCE A;  3PL8 A;  4QPQ A;  4CZC A;  2INV A;  1BR1 A;  3E0J B;  3PNY A;  3U21 A;  4PUS A;  4N4N B;  3MKW B;  2INU A;  3H0D A;  3SUC A;  2MC4 A;  4XKV A;  3GQ9 A;  3FDY A;  4XLA A;  4ZTJ A;  1MMG A;  1LKX A;  4D9J A;  1CZF A;  1O8G A;  5CKT A;  2R7U A;  3B4N A;  2MAB A;  2CV1 A;  1O8E A;  1RU4 A;  2DJI A;  4YEJ A;  1PKV A;  4YZA A;  3HG9 A;  4RM2 A;  2XF6 A;  4F3Q A;  4RM3 A;  2PJR A;  4Z03 A;  3J7A Y;  1WJF A;  1JRG A;  3OW7 A;  4EW9 A;  3BCB A;  2VBM A;  3WWG A;  2VLA A;  4BJ6 C;  3K4N A;  3OE7 A;  3V42 A;  1V0F A;  1BN8 A;  3OYK A;  1HVX A;  1Y6I A;  2CW8 A;  4BEH B;  4JMQ A;  4P1W A;  3RSN A;  4TSF A;  4B3F X;  2ZZE A;  2W6I A;  1N75 A;  4BL0 B;  2L5Q A;  4IQ4 A;  1D1C A;  1E3X A;  1X4P A;  2GOM A;  4ZC3 A;  4DOZ A;  4KIT B;  3S32 A;  4W8S A;  2UVE A;  2ZZQ A;  3UR3 C;  3RPU D;  3CMM A;  1Z3Y A;  4E7K A;  2KLO A;  3GRH A;  3EQN A;  3K4L A;  2VXD A;  1T5E A;  3QYB A;  3AL0 C;  3M8J A;  3S3O A;  3BG6 A;  4KJZ A;  3TL4 X;  3EPZ A;  2M7A A;  2QKL B;  4B3G A;  3EQO A;  3BC8 A;  1E43 A;  2Q2E B;  3GVL A;  3B8Y A;  2R7X A;  4LIV A;  2CUJ A;  4NQW B;  3H94 A;  1OGM X;  3OYA A;  4XQF A;  2ZXH A;  4PMH A;  2ZTG A;  4BUP A;  4AVZ A;  4C2T A;  4XD7 A;  3GVK A;  4CCK A;  1X19 A;  4Z1M A;  2PEC A;  4KKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...