2X6XA

Tailspike protein mutant d339n of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN HK620
total genus 235
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6xA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6xA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6xA02
2X3HA 2O04A 1O8KA 4AVZA 1PE9A 4XORA 1IA5A 3FY3A 1X0CA 2NT9A 1O8DA 4Z05A 2X6YA 5AMVA 4MXNA 4XN0A 2VBKA 2NZMA 4Z06A 4YZAA 3EQOA 1AIRA 1O8JA 1PLUA 2O17A 2X6XA 2NSTA 1QCXA 1IDKA 4Z03A 3WWGA 1JRGA 2EWEA 1KTWA 1JTAA 3KRGA 3UW0A 1KCCA 4YELA 4NK8A 1O88A 1EE6A 4XLEA 5C1EA 1WMRA 4XQFA 4PMHA 3JURA 4OJ5A 2Z8GA 2PECA 1OOCA 3VSUA 3GQ9A 4EW9A 4XLCA 1O8MA 2PYGA 3EQNA 3SUCA 4XOPA 1BHEA 4OJOA 1OGOX 4C2LA 1K5CA 1IDJA 4XNFA 4OJ6A 1IB4A 1OGMX 1O8FA 1DBGA 2NT6A 2QXZA 2BSPA 4OJPA 4XM3A 1CZFA 4XOTA 3B8YA 1DBOA 2X85A 3GQ7A 4YEJA 2QX3A 4XR6A 2VJJA 3LMWA 4XLAA 1PXZA 1XG2A 2X6WA 1GQ8A 1RMGA 2PYHA 2O0VA 2UVEA 2O1DA 4I84A 5C1CA 1H80A 4XLFA 4MR0A 1BN8A 3GQ8A 4OZYA 4YZ0A 3VSTA 4OJLA 3B90A 4YZXA 4XKWA 1RWRA 3GQAA 4W8RA 2NTPA 4XMYA 4OZZA 3VSVA 2QY1A 4URRA 4XLHA 2INVA 2NTBA 3ZSCA 4XL9A 4W8QA 3VMVA 2VBEA 3T9GA 4W8TA 1KCDA 3ZPPA 2INUA 1OFLA 1O8LA 4U4BA 4XONA 2ODLA 1O8IA 1O8GA 1NHCA 1VBLA 2IQ7A 4HWVA 1O8EA 2O0WA 2VBMA 4XKVA 1O8HA 2UVFA 4XN3A 4YZQA 3GRHA 1QJVA 4U49A 1RU4A 2NTQA 2VJIA 4NK6A 3VMWA 2NSPA 4W8SA 1OFMA 3B4NA 1HG8A
chains in the Genus database with same CATH superfamily
2X3HA 2ZCWA 1ETKA 1E63A 2C78A 2RDPA 3J81K 4CA0A 2DA5A 3HRMA 2E2HJ 3FMSA 3CJQB 3E6MA 4N9HA 2F5VA 5IT9K 3H0DA 1OGIA 2CK3A 3D26A 5JBQA 3Q6QA 1UHWA 3QFSA 4M9XA 1A31A 2ZITA 5GPCA 3VEPA 2GLOA 3M9AA 1UAAA 3W3CA 3EUHC 2LY9A 2L0KA 2EZKA 5ILVA 5A2QK 4RDUA 2ZTNA 2ZZFA 2VQCA 2FA5A 2PG4A 1TW3A 3HPGA 1Z77A 2HOAA 4ZYDA 3VYUB 1RPWA 3G6EB 3K2AA 3BG3A 3BQYA 4UUVA 3OKXA 1Y8QB 5JVTA 2D1HA 2UWMA 1UMQA 1WMRA 2KQRA 1K83J 3K6GA 4L5EA 4DIQA 4B3FX 1EH8A 2VQLA 2Z2SB 3FPPA 4RD2A 4DZPA 1R4NB 1B9NA 4L9VA 3S8PA 1JKPC 3QE2A 2ZXWH 4OJ5A 1WI3A 2K4BA 4RPBA 3BT9A 1IUFA 4C3HJ 1OCRH 2Y69H 4P9UA 1ZGWA 5D5VB 2J7KA 4EW9A 3OFNA 3DTKA 4KN7X 1DARA 1IN4A 4RA2A 5F08A 5H6RA 3QU6A 2LRDA 2DFEA 1VQOB 1BOAA 3NAWA 3AG3H 5DV5A 3H9NA 1PJ7A 2HFHA 1K73D 3BG6A 2HXOA 3OAAA 4C2LA 4HX4A 1HQCA 2FSWA 1Z21A 2K9LA 1BIBA 1UG2A 2HR3A 4DZJA 5IY5H 1N77A 1K79A 2DQRA 1D1BA 4N4NB 2QA4I 1D5VA 4Y15A 1WJCA 2V9PA 4AIKA 2BVNA 2Z16A 2Z6BD 4OIQF 1OLTA 2DT6A 2JA7J 4ABZA 3PL8A 5HZBA 4YHBA 3D1NI 2YU3A 2C2WA 2ZJQF 2X85A 5K5QA 1N78A 2XTXA 2QX3A 4Y7NJ 3MKWB 5M3FJ 5F1RA 3WE2A 1BC8C 1QH0A 3TP3A 5GTIC 2GXGA 4YFOA 3LO8A 1HW5A 5TR9A 1N0VC 3G1LA 2X6WA 2H8WA 2IEKA 4E4HA 1A8PA 4F55A 2CMPA 2XAUA 4G6DA 2YX7A 3H1CA 4B43A 4OIOF 1WTHD 3SYJA 1TWCJ 3BG5A 4YXWA 1HDDC 3K4CA 2ISYA 2JK3A 2K7LA 3ZMVA 2HQNA 2X1DA 3PQKA 4DJAA 2HKOA 2JN6A 1VQ5B 1I6HJ 1Z05A 4MNUA 4W8RA 3IWFA 5KSWB 4XMYA 4X7FA 4OOIA 3S3OA 1KZLA 3VSVA 1AKHA 4AWXB 2NTBA 1LDJA 1H85A 4G5GA 4OOXA 2HDWA 4PJLA 2FQ3A 2NYXA 3QPSA 3BOQA 2D74A 1KU3A 3CCJI 3TO6A 4RM2A 3I55I 3T8TA 1TQIA 2W1OA 4OINF 4ENKA 4Q5SF 4U4BA 3V4GA 1JKRC 4I2OA 2A68F 4CH7A 1O8IA 2A3SA 2EPFA 3S32A 2XRNA 1WH7A 3TDUC 1RZ4A 3CZ6A 5ILUA 2HDNB 1YJWB 3HSFA 3CF5F 2BX6A 1OYIA 1ONVA 3SZGA 2R5ZA 3K0LA 2VOOA 3L2QA 2VFMA 1BIAA 2A5YB 2NS0A 3QYBA 3JQQA 4IL6C 2A6TA 2XAHA 4RGRA 2PQ8A 3F21A 1JKQC 3H3VK 3JRIA 2ZL7A 2WY7Q 3RIQA 3G4SI 1DPUA 4PGOA 2GA2A 3BC9A 3FBIB 4TMTA 1AOYA 3FPKA 4IO9F 1UELB 3CCEI 4H0EA 1MNEA 3D0SA 3QFTA 1IRFA 4LLNA 1IDYA 3MCZA 4IEJA 2V7TA 1YFHA 4BHPA 2EV0A 1ETWA 4D0PA 2NZMA 3I64A 4P25A 1VHOA 1FDRA 1QGAA 4FASD 2K9SA 3E6CC 2M4GA 3SHFA 3BG9A 5LBQA 4FCYA 2GQQA 2O8KA 5LLQA 3RSNA 2DY1A 3ZZTA 5GPAA 3J81k 1KCCA 1ETYA 4A69C 4BBSJ 1KGSA 4GYIA 3DTEA 5M3MJ 2WJYA 4A3FJ 2NVYJ 3T51B 3GSIA 4I7HA 4CSWA 2K02A 2UUZA 2M30A 3TEDA 5J6XA 4UZUA 4UY8I 3R61A 1I1GA 4KIGA 2IT0A 2ACJA 4X05A 3H9QA 1QVFB 4JK1X 5CVUA 1J09A 2G7UA 2DCUA 3AVWA 4BE2A 1XGMA 3WQZA 4W1UA 1DDNA 3C7JA 3QAHA 1YI2I 1W36D 2LKXA 1S72B 3IWZA 3LSPA 1KQ9A 1EA0A 2F4IA 3GFJA 1FNCA 1N06A 1OGOX 1IXCA 2CU7A 4Z6YA 1M90D 3RTRA 3FIWA 4KT5C 5HNHA 1BPLA 4CXFA 2Z5UA 4JX4A 2VC0A 2K9NA 2LKPA 1PP7U 2IA1A 1TT0A 5F0CA 3ZPLA 2BSPA 1F1ZA 1FJLA 3ZQCA 5FKOA 1WJEA 3JQPA 2KRFA 2XAQA 3ISPA 3GTMJ 1YI2B 4KKUA 3GQ7A 4KFCA 3FKJA 2VJJA 1LLZA 1R1UA 4NUBA 1XSVA 1YX2A 2HPMA 2XSJC 2J5PA 3MEXA 1TZLA 5GAGJ 1QHHD 2V6EA 5GTHC 1E43A 2ZFWA 3TMOA 3B82A 4CGZA 3TGNA 3CCRB 4EATA 1QRBA 1NHAA 1RC9A 5FKKA 5GADJ 3W2EA 4BQNA 1XX5A 4P26A 2CQ7A 4HNUA 3F8FA 2VXZA 4M3DA 2EV5A 1HKQA 3CC2I 2ZBUA 3QRFF 4TMXA 1Q7YD 4A2UA 2XB5A 4R8HA 2J5OA 2AHOA 3LA7A 3A1PA 4URRA 5J1YA 4DQLA 3CDLA 3ESWB 4NBSA 4BS9A 1R1VA 2XV4S 2GK7A 1TBXA 2E60A 4HV6A 3QYFA 1KC8D 3LQEA 5GAEJ 4ESJA 3CJRB 1RESA 5DTDA 3HOVJ 3ZIAA 2IVMA 3ZPNA 1EFUA 2QBYA 4X0GA 4Z4ZA 1BW5A 4QFMA 1U2WA 3W6VA 1WXRA 5TY0A 1N25A 1YTYA 3RDIA 3WTWC 2ODLA 3FK7A 2Q2EA 4F93B 2XRLA 3T1BA 1FYLA 2IQ7A 1YRNA 5ICFA 2O0WA 1Z3XA 3OP1A 2HZDA 2EFOA 1P4AA 1QJVA 5BNGA 3S16J 3KYCB 4KICA 2DETA 1Z7UA 3K4BA 3WNBA 4BU2A 4L5IA 4A3CJ 3HOZJ 4A3GJ 4UZEA 3WBKA 1TNSA 4P12A 4NC7A 4L18B 3CCMB 2M87A 2DW4A 3BR0A 4D7MA 5E1WA 4ZZDA 1UD4A 3G1MA 3FY3A 2EIKH 4WZEA 2G7HA 4A3IJ 2X0LA 4HQEA 2PEXA 2Z3YA 4AC0A 5TRDA 3T5XA 2W4SA 1QFJA 2BBYA 3R6JA 3EUKL 3DTIA 4PUSA 3B78A 1MNDA 1NDHA 3ZMSA 1F20A 2BMWA 4RM3A 5EG0B 4FQGA 4LOCA 4L0ZB 2QEXI 3TOAA 3GVKA 1KTWA 1X1CA 2L7KA 1S29A 3N4MA 2QA4B 1OYYA 3GTJJ 2A05A 4BJ6C 4IHXA 2O6GE 1OB0A 3E6BA 1MH4A 1V0EA 3SJZA 1E3ZA 2XUBA 3BTCA 2KHMA 3AAFA 4DYCA 2E71A 1B9MA 1HW2A 3FXQA 5GP9A 4LLGF 4HOBA 1QHGA 4HSRA 3S1RJ 3JAMK 1QUFA 4G7WA 3LSHA 3HG9A 1YJNB 2OV7A 2JUGA 3J81Z 2L02A 2LF7A 4A3KJ 5IOYA 4NQWB 2XGCA 3MQ0A 1OGJA 4EJUA 3P9KA 3Q39A 2PMDA 4XNFA 1IV6A 2P5LC 1VQ5I 3ZQ7A 1REPC 3IH2A 1ERDA 4IF4A 2XROA 4WX9A 3OYAA 2CH0A 1PDNC 1QG0A 2B7CA 3TKYA 2CSOA 3K4JA 1VQNI 2DMTA 2HI3A 2IBDA 4KJZA 2EBIA 1BM9A 1XFOA 4EMSA 5DCMB 5TISC 3RCOA 2GWRA 3HPHA 1TNTA 3TQNA 1WDTA 3CMEB 2K3PA 3T53B 1AA7A 4BE0A 2BEOA 1Y0UA 3I58A 3ZMTA 2FF4A 1VQMI 1QA1A 2LOOA 2AO9A 5B5EC 1IN8A 2ZKZA 2DOEA 3GCMA 1UD6A 4OZYA 2V79A 3QPTA 3LOCA 3GEZA 1A36A 5AN9A 3HRUA 4P6YA 4RLZA 4Z4SA 3EYIA 1LVKA 4BDYA 4PJNA 4G7HF 1B2RA 4ZJZA 1F43A 5IYPA 4A3MJ 4XLNF 4U9UA 1COWA 3FISA 3S1QJ 5BSYA 2QCOA 1LEAA 1P6RA 2AQFA 3QODA 4LJZF 3RIRA 5JI6A 3K70C 1TTTA 1TYXA 1ZM9A 1FYMA 1YRNB 3N05A 1T6XA 2BM7A 2W00A 4C30A 2DT5A 1SAUA 4C9YA 2X53S 2QUFA 2ZMEB 3LAPA 1ZGAA 4F3QA 1X1AA 2QBYB 2EIJH 1UFMA 2Y30A 2B9SA 2XC1A 2VBYA 1ZHFA 2OA4A 4BKXA 1EJ9A 1Y8RB 2PMZN 2V9KA 5K7ZA 3W5UA 1FBQA 4DQ2A 2EV6A 2L9SA 4U0YA 4UUSA 2BV6A 2W25A 2ESHA 3KZIC 1FTZA 3ECOA 2FX0A 1FBSA 3QOEA 3GFIA 2IRFG 4AIJA 2L4MA 3ZUGA 5FD6A 4G7XA 3F8BA 4YAFA 1PJ6A 1X1DA 1U5TC 2A69F 4FTHA 4NDLA 1MD0A 2EA4A 2LFBA 3CCYA 1MDMB 1P2FA 4EEFG 4IHVA 3WBJA 3TDZC 1A6QA 1RQRA 4JOMA 2HQRA 4FN5A 3BH4A 3PA1A 1JRGA 1FSEA 3QPHA 5F4JA 4IHWA 2JN9A 1O88A 4M3EA 5KCMA 3DU1X 4MEXF 2FD5A 3CCQB 1VQ6I 2LREA 3ASNH 1TLLA 4AF7A 1R9TJ 4E7LA 2EJRA 5LD2C 2Q6IA 3JURA 4MHGA 1GXQA 5E1ZB 3LA2A 4XKCA 4M3BA 2OBSA 1MMDA 1R00A 2IW5A 3DU5A 2Q6LA 1D0YA 3GLLA 4HBLA 3A2KA 1FRQA 3MZYA 3BY6A 3GFMA 3GXOA 2FNAA 3LAJA 2CUZA 4UZFA 2E2IJ 4ASUA 4OPSA 2MSYA 3OEEA 1U3EM 2OBRA 3N90A 3NWTA 4UVBA 4WWVA 2HYFA 2VJ4A 3H92A 4P3IA 2D2WA 1RR7A 1UD3A 2O6WA 1K6YA 2CJJA 4E7KA 1TYUA 1KK3A 3FKSA 4BJ5C 4YEJA 4TSFA 4DBQA 4HIZA 4PC7A 3CTAA 4KIBA 2VC1A 3CESA 4RDLA 4DK0A 3GTLJ 3HXLA 4IVNA 3FXMA 2ECCA 3C1DA 1V5FA 3BPXA 2EB7A 2NAZA 2RNJA 3HYIA 2DDBA 5HLGA 1GQ8A 2GREA 3OJWA 4E7SA 5ILSA 2COMA 4RD4A 4I84A 4C2MJ 5DUIA 1QNTA 2LYCA 1ETOA 3G3ZA 3SEQA 2ZXJA 4Z2YA 2D1VA 3G71B 4YZXA 5HOOA 1W87A 2ZMEC 3GZ6A 2O61A 2VB6A 4ACAA 1WHUA 3BZKA 1GAQA 2EFGA 2ELJA 4NC8A 4PFPA 2JJ2A 2QY1A 3KP4A 3CD6I 1KQ8A 3L00A 1P92A 4X6AJ 5E3NA 3ZZ0A 4IOAF 1SVLA 2GJKA 2STTA 3OSGA 2IJLA 1ORKA 4YCQA 2W57A 3H3ZA 1SFEA 5ERIA 5JVGF 1TTYA 3R4KA 4ETSA 1T2KA 2INUA 2W84A 1G3SA 1ZARA 4LB5A 3I5UA 1VI0A 2KLOA 5DNSA 2XTYA 4HLYA 4I76A 3JRFA 2CQNA 3R6SA 1PUFA 1K7AA 2F48A 3CMYA 5DDGA 1VQ9I 5GV8A 1LDDA 1JHFA 4BY7J 2F5DA 3A0HC 1ZUNB 2F5EA 3GIRA 4QTRA 3Q38A 1W7PA 2N8GA 5A2QZ 1SD4A 3OYCA 3DFGA 1ZG1A 1ETQA 3S2WA 4S04A 5DYMA 4WK8F 3U1KA 4IW3B 2CQKA 2HOSA 1X3UA 3AFHA 1PE9A 3A1YA 1YJ9I 2KVOA 2ZMEA 2HQAA 4MFEA 3AK5A 1ODDA 1G4DA 3DKWA 4EV0A 1VTNC 3LYCA 3GZ5A 4WZKA 4MXNA 4ZDPA 4FXUA 1U0JA 1MMGA 3ZRGA 1Y1VJ 1HC8A 4YZAA 5IPAA 2L5QA 2JVHA 1MBGA 4ZCLA 1QZEA 3CP2A 3EQOA 5EJCA 1SD5A 3AGQA 3PM1A 3BY1A 2HQ5A 3F72A 5E6TA 4GO1A 1Y0NA 3DLAA 1P4XA 3DV8A 4I02A 5J4YA 2FMYA 1D0ZA 1P9QC 1XSXA 4QPQA 3I1FA 4K1XA 4XSZF 5C1EA 4D5FA 1CQXA 1ZM2A 4OPOA 4Z4UA 3C2HA 4J01A 2R4GA 4GFBA 3FHNA 1Y0RA 4RDKA 4X1EA 1O3SA 1KK1A 4TMZA 5BPIA 5J35A 2M45A 4PC6A 3GWZA 2D9RA 2DEUA 5JMCB 1WRJA 2QENA 1SMTA 2JDIA 1G6NA 1S0UA 1N05A 4HE5A 1S3JA 1N8RD 1UD2A 2DYIA 2IGOA 1LUJB 2QM3A 3H36A 3ASOH 1X2NA 4MQVA 2BGIA 5LRRA 3U6KA 1Y1WJ 3I0TA 3OIOA 3BJ6A 1XPXA 2RC5A 4OJOA 1K5CA 2G0YA 1ENHA 3H9JA 1Z91A 2DIEA 2QLZA 3ML6A 3CJTB 3WYAA 2NOGA 1RIOH 3BDDA 3HOYJ 2Y9YA 2LP0A 4PABA 1VF7A 2NT6A 3VYTB 2W6IA 2W85A 2ID6A 3O2PE 2R5ZB 2QMUA 1MSFC 1I27A 3JTHA 1FNBA 5DD4A 4HE6A 2RGVA 1J9ZA 4U7DA 4OIRF 3KEOA 3CC7I 4M9SA 4XLAA 2R9VA 1OCTC 4PJJA 1ZREA 1XG2A 3LQRA 3AG4H 2WR8A 1YE9A 3MCAA 1OB2A 1FNNA 5AONA 5HVQC 3ZCOA 4MFDA 4P1WA 1MBHA 5DS0A 4ZV4A 1WWXA 1ZTRA 4HDUA 1YX3A 2BYVE 1QVGB 1BN8A 3GQ8A 5HDGA 1F5TA 4OJLA 5D4RA 2CFXA 4PSWA 3PIOF 4M74A 1HLVA 5HS8A 1ZH5A 1W9XA 3A35A 3ROUA 2NTPA 4J00A 1K78A 5DD8A 1IN7A 2OZUA 3M4OJ 2LVSA 5EZHA 4V19K 3F23A 2XT2A 1A6IA 2DMNA 2L01A 4BJTA 4ZCMA 4YG2F 3J7ZI 1TUIA 1HDPA 2H09A 4II3A 1MSEC 1DGRM 2M7BA 3NB2A 3PSZA 5F04A 2UZKA 2QSFX 5C3EJ 1HF0A 1ZRFA 2ZJPF 2HZTA 1G7TA 4YIIA 1WGXA 2QVOA 2F5CA 1E17A 1YIOA 1X4PA 5CKTA 1RKTA 4JRAC 1O8GA 2O0YA 3E5UA 3SFIA 3CCUI 1H8HA 5FLVA 3Q0WA 3HBLA 4LGWA 2XC7A 2GAUA 5IYBJ 1I6XA 3I59A 4DOZA 2VNJA 1U8RA 1TWGJ 2ZXIA 1IJWC 4YAWA 3V8LA 3ONUA 3GRHA 1WSRA 2NTQA 1O7LA 2KDOA 2XKPA 1UB9A 2Q0OA 4LBVA 3R0AA 3VNVA 1EP1B 3MWMA 3OYBA 1W0KA 2F2EA 2VE8A 4AYBA 3KLOA 2WJVA 4V02C 4QLCU 4A3DJ 3SQNA 2QQAA 4NC6A 4XORA 4RD6A 4UHTA 5KW9A 1FIPA 4LK0F 1QVTA 3FBNB 2VBTA 3OR1C 1SEUA 3PUMA 2DFHA 1W34A 3TL4X 1D1AA 2TCTA 1R58A 3CUQA 4BYYA 1IUYA 2R5YA 1QBJA 3ES9A 4Z03A 2XKOA 2NVUB 1K6OA 3BJOA 1ZRCA 1RETA 4ESFA 4PC2A 2QSHX 2Y48A 4P22A 1EFTA 4GQNA 3BTJA 3PNYA 1JXSA 3OZVA 5L3BA 1OCZH 2PMHA 2VPRA 2LTPA 4NCNA 4ZDLA 1B72B 2HCJB 1N07A 3I4PA 1GAWA 4UVAA 2JPBA 4A0YA 1JGGA 4ZYHA 2A61A 1TQPA 5DS9A 3D5RC 1IAWA 3L2RA 2ELKA 1HVXA 2R3SA 3J7AY 3CPXA 2ADUA 1A35A 5HXBA 1T8IA 3MD2A 3P26A 3SUCA 1D1NA 4DW6A 3ZQFA 1VZ0A 3CCLB 1QFZA 1IB0A 1KTVA 1WOOA 1WU8A 1Z67A 2EZLA 3OJXA 1DGWY 4LIVA 1EFCA 4B09A 1IXSB 1JHHA 1F9NA 1XMKA 4LFUA 3SJPA 3E6DA 5CVIA 1LJ9A 2X4HA 3KETA 2VFQA 2KRHA 4XR6A 2JMWA 1R49A 2JZYA 3TO7A 1SFXA 1HSJA 1LVAA 2E36A 2MA3A 2L7ZA 3K4NA 2M0CA 5EEGA 3DLLF 2BM6A 3OZWA 3SDGA 2DERA 4CO8A 1V54H 1JTYA 2DCEA 1T0FA 4M4SA 1E1RA 3M07A 1W35A 4XLFA 2H1KA 1YIJI 1PKVA 1GUUA 3H3UA 2X1EA 1DU6A 2RREA 3FXUA 1H8EA 1U6GA 2MH9A 4JBAA 1BI3A 3D5LA 4OZZA 2XTWA 2P81A 5HODA 2LH9A 4XLHA 2JRTA 2VXDA 3HKZN 2Z1DA 1EA3A 4DYQA 4W8QA 2YS9A 3L2VA 1EFRA 3VPRA 5J47A 5LGUA 2KISA 1BQEA 2LY1A 2OJED 2P8TA 4HZFA 2VBVA 2HOTA 1NB0A 3M8EA 3ZPPA 1USSA 1R5OA 1WJAA 3ASQA 1SKQA 2WZNA 3OOPA 4B48A 2KKOA 4XONA 1KU9A 1Y0YA 1YG2A 2HVSA 1R5HA 4G94A 2K27A 3KCCA 4LB6B 1BR1A 1ELOA 1VBLA 2PX9A 1JI8A 1G7CA 5HKKA 1YLFA 2UVFA 5IOZA 2TDXA 1OJLA 4AUXA 3ZQLA 1TC3C 3QYEA 2FQ4A 5JHFA 1BR4A 4RB1A 3A8JA 3CP8A 3I59B 2VN2A 1V0FA 4KMFA 3ZZUA 1OFMA 3OOUA 3K9TA 2EIXA 2ZJ2A 4OPWA 4OMZA 3RYRA 4H9GA 4DNRB 4CCKA 1POGA 2P7VB 1SD6A 2IS2A 4HX8A 2VFNA 2JPCA 3SEZA 4I09A 3OV8A 1XB2A 1R5ID 2NOJB 2OQRA 3QU3A 1FNMA 3KX2A 3OEHA 1J5YA 2XOKA 1QGYA 5FKLA 2ZBVA 1CF7B 3IKVA 5C4XJ 5J8CA 1XC5A 4UVCA 4YELA 2DK8A 3JAMZ 3NAUA 3G73A 3F22A 1MMNA 3QOPA 5KK1A 2V26A 4IHTA 2QSGX 3OZUA 1T95A 3OYMA 3M8FA 3RPUA 4E70A 3LSKA 4QSHA 5B66C 1WH5A 1UCRA 3SYTA 3DEWA 4OOVA 5B3SH 4QVAA 1FP2A 2DN0A 1DUXC 4GRIA 4BEHB 3WU1B 2X48A 1DU0A 4BY1J 3KL9A 1T6YA 3CLQA 5ICGA 4Y7CA 1V5EA 3P27A 2JUCA 2BM4A 2DA6A 3PSFA 4M3FA 1G2HA 1D5YA 3IAS2 3E0JB 5FL7A 1O8MA 1F36A 4U87A 3IKTA 3TOBA 3CCRI 3ABTA 3WTYC 1JTXA 2ISZA 4NBQA 4U88A 3PO2J 3B8HA 5DM6F 5EDNA 3JRHA 1GO2A 1WZ2A 1LNWA 1SD7A 3KP6A 4M6YA 5JLXA 1W5CC 4DYRA 3CMAI 3IP4B 2ZZQA 5TV2A 1M1KD 3MN2A 3S2HJ 2R7VA 4UUSB 3CCVI 2VUMJ 3F8CA 1JA0A 2BM5A 5L3GA 3BZ6A 1JGSA 4IZZA 5FLMJ 2FRHA 1I8DA 1R5NA 3S93A 1XN7A 1QFYA 2C4TA 5DEQA 5IP7J 4QV2A 4KNYA 2XF6A 1B59A 3CF2A 1SAXA 5D5WB 1YHQB 1YW7A 2WB1A 3AL0C 1FRNA 3KFWX 3RI4A 4M1KA 4PC1A 4QVJA 4XICA 2YWEA 1VQ7B 2HWVA 1IC8A 3COAC 3S3NA 1W0UA 1BI2A 2GOMA 2EA2A 3ZN1A 1EZGA 1MMSA 1FX0A 2R7OA 2NPFA 1KONA 2LBFB 5E3LA 3LSRA 3W2HA 3PETA 2Q1ZB 4X7DA 3M1EA 4DQKA 2QYUA 5HS9A 2GQFA 3Q3SA 3E7LA 3PO3J 4PK4A 3HJEA 5KAIC 3A3BA 2M5SA 3REOA 5IYCJ 1UHMA 2FNPA 2K9MA 3DPUA 2AQEA 1BX0A 3PJRA 4W8TA 2PJRB 3FZVA 3OYLA 3JR9A 5IYWA 1V4RA 3CDIA 2E1MB 1TW2A 2VQHA 5E20A 2XT4A 3HRSA 2OTLB 1MBFA 3ABUA 4N9IA 3VODA 2CBXA 2CQQA 2X6OA 5HS7A 4FX4A 5KVRA 2GJRA 2OK8A 2LF8A 4RCZA 5CVRA 3A8KA 1HA3A 5IYNA 4YRVA 1PUEE 1UD8A 2DOGA 4YC5A 1NJID 5ED4A 3FMRA 2HYGD 2O03A 4B44A 2FBIA 5D4SA 4WXDA 3GMEA 4AIHA 5D8LB 1D8JA 1Z7LA 2V7VA 3SLDA 1DDGA 1BN5A 2COBA 4LG0A 3ONQA 2ZO4A 3OMYA 4HF1A 2NXNB 3E5XA 2Z9OA 2UXNA 3BPVA 1QGZA 4L8JA 3OYKA 2AXTC 4RMNA 1NH3A 1ZM4A 1A04A 3BH7B 2JVGA 4HLXA 5FFZA 4UNOA 1TSPA 4UXNA 2XNCA 2X6XA 2J8IA 4C0SA 1QCXA 2V1UA 3H5RA 2ZL5A 1FMWA 2K3FA 2YX4A 4M72A 2ELHA 2KPMA 3I55B 2LDUA 1RKWA 4B47A 5JLVC 5HLHA 3WHCA 2QGGA 1EE6A 5FO5A 2F4OB 1G8XA 2JRMA 2IP2A 2CUJA 3WGIA 4RBOA 2E5NA 4BXXJ 1X3ZB 4PMHA 3FMQA 4XRSG 1XMXA 4S05A 1HKSA 3CLOA 3IAM2 3GBGA 3DBHB 4QHYA 3ELKA 1W4MA 3LSIA 4MIMA 3CMEI 3FWEA 3LSMA 4KKTA 3K4LA 2XEXA 3JQRA 2EQRA 4PJMA 1NG6A 4D9JA 4LC0A 2V1DA 2VFPA 1R71A 3CJNA 5EGOB 2V4DA 3CCEB 1IDJA 1ZG5A 4ESBA 1SKYB 4OJ6A 1XDUA 1OGMX 2OAZA 4Q48A 4P6VF 2WYRA 3F6OA 1OFDA 1EV7A 3LWFA 3L2UA 3CPWB 3F9KA 3E5QA 2CW7A 3CRZA 4CYCB 5HDKA 1IJFA 4A0XA 1QQ1A 1WJBA 3GTKJ 4YIFA 1MZBA 1U78A 3A01A 1IRZA 3H9GA 3FDYA 1E64A 2PJPA 2WPDA 1G3TA 3PFIA 2Y2ZA 3B6CA 3S17J 2XZOA 2PYHA 1R1TA 3R6KA 3K1PA 4WXCA 2HLDA 3CDHA 3BCBA 4BPRA 2EFPA 3G4SB 3PFYA 4PSXA 2M5WA 2MABA 5FKMA 4AD9A 1QZZA 1OFCX 3VSTA 5EEAA 5LHHA 3H94A 4TV7A 3PUNA 3CO6C 2QZAA 3PNTA 2XHKA 2VNHA 1R36A 1AWCA 2QGUA 1LB2A 4OIPF 5GAHJ 2NNYA 3PNVA 2OF7A 1Z6RA 2VPLA 2V31A 3HC7A 1WQ2A 2DDAA 3GFLA 2C4UA 4RD0A 1LKXA 2XPVA 3RKWA 5JLWA 2CV0A 3T9GA 3WTUC 5FNZA 5BQTA 3DPTA 2LZJA 2QTZA 1OCCH 1XSDA 3SDBA 4MQ9F 1X19A 1KMHA 3FJOA 5JHUA 2HVRA 2WA0A 2XZPA 4G9YA 3SEJA 3WE3A 1T5EA 2VYQA 1K28D 4AIDA 3GTGJ 1O8HA 2GK6A 4Q4ZF 4X7EA 5J8FA 1BMFA 2E1MC 2HXIA 2JTVA 4HA8A 2MLGA 2M8GX 3Q5FA 2W82A 3Q0UA 3C2BA 2DODA 2V6CA 5HZAA 2BGJA 2K4JA 2Z99A 4GXOA 5FD5A 4HNVA 1J59A 3PVDA 1OKRA 4E0FA 5J1UA 4LITA 4IX7A 2L9VA 2H6CA 1J0RA 1E3PA 4L9JA 1PJ5A 2XF5A 1TVCA 1PLUA 4UV9A 3F0CA 1MNMC 4CDGA 3RY8A 3N97A 2FE3A 1D3YA 3ISXA 2R7SA 1V5GA 3DF8A 5E3OA 2CUEA 4IJAA 5BOXA 3P7NA 2ZNZA 1IO2A 3HEFA 4XQFA 3IRQA 1I1SA 1WCMJ 3DCFA 2DK5A 4I99C 3JX8A 1YYVA 1FSHA 2KDZA 1D2EA 4CYDA 2F6CA 3Q0VA 3GTPJ 3LNNA 4PGHA 5F1JA 2KIFA 1X2MA 4II2A 3ZN0A 1HBXG 1YHQI 2HOEA 1JE8A 1C0WA 3DXJF 2V7FA 3DQVC 3CCMI 3HHHA 2OYNA 1Y39A 4CCMA 3DPLC 1H88C 4OAYA 1LFBA 2DJNA 5FA6A 1IB4A 5EF6A 1L3LA 4UAJA 3K1NA 3P4GA 2EWNA 3WHBA 1GDTA 3LMMA 2QXZA 2HKXA 2CUFA 3GF2A 1O3TA 1FEXA 3K70D 3LSTA 1OCPA 3M8JA 4XOTA 4LLLA 4C3IJ 4LBZA 2TRTA 2PIAA 3I54A 3BH6B 2YWFA 2WWYA 4Y52J 3GVJA 2QEXB 1O3RA 1W1WE 5IP6A 1FT9A 4OM9A 2ME0A 4ZTFA 3I9V2 4KN4X 5AIPA 3X2QH 1RMGA 2IXSA 2R7ZJ 1FNDA 2O0VA 4RLQA 3IC7A 1DG1G 2B5OA 1GXPA 1MABA 3KP5A 4TN1A 2EFQA 2ZSHB 4RPDA 4X07A 5LEKA 2IA2A 4YZ0A 4Z4TA 3BG7A 2VBSA 2O8XA 4CCOA 3OS1A 1BI1A 4PC3A 3ASRA 3K1MA 3AGPA 2JSCA 2OC6A 2PFBA 2ZSIB 3A03A 3LFKA 4O6JA 1VQLI 1WOPA 3ASPA 3OOCA 4JQFA 3C2GA 4XL9A 2DO7A 2RNGA 2R0QC 1UZCA 1K78B 1J9IA 2VI6A 1D8TA 1I39A 3LL7A 1A5JA 4B1RA 3OW2B 3DDYA 4KT6A 1DP7P 4EH1A 1O8LA 4P1VA 1HW1A 2LY2A 1QVUA 2MFZA 4QPOA 4AVPA 4D7NA 1APLC 1IGNA 2FMLA 2FEZA 5FLXK 1KZHA 2KJBA 1KK2A 4Z4VA 4A3EJ 2D5VA 3UR3C 4RAGA 3WTZA 2A6HF 1OFEA 2IPQX 3HZJA 4P9FA 4KITB 1VQMB 2WZPP 4QIWN 3L2CA 6PAXA 1DP3A 4IKFA 4LK1F 3FXKA 3MKLA 2GZWA 4HF0A 4V2GA 1O8KA 4LBWA 2F4MB 2KP6A 3W2GA 1KU2A 4XK4A 4WXHA 1ZELA 3G2BA 5E18F 1JT0A 1JJ8C 2Y9ZA 2EZHA 1VQPI 3VDXA 2CV2A 2XNDA 1AIRA 1JUMA 2AS5F 2PJRA 2NSTA 2DT7B 1JUPA 4J0QA 2GJPA 3RQ4A 1LQ1A 1T08B 1NRKA 1R22A 5C44J 3QPLA 4IXAA 3BR3A 4ZYEA 5LRSA 1JA1A 4X7CA 4A5NA 3ASTA 4X0CA 3ULQB 3OYEA 2L3DA 3OR2C 1MJBA 1U5TA 5C4JJ 3OIQA 1KYWA 1MIJA 2BY2A 5EYRA 2K86A 2E1BA 1H9GA 1WKMA 5BSXA 4ITVA 1K61A 3RJPA 4HW0A 5BS6A 4A3BJ 3ZQGA 2NVXJ 2E7XA 3W5VA 2DFFA 2WAQN 1MBKA 2Y0MA 4XLCA 5DCMA 5FRMA 1D8KA 1BHEA 3SLNA 4A0ZA 1HOMA 1SMYF 1QUEA 2W7NA 5TJJA 4G1VA 3K2ZA 3LFUA 4UUTA 4Y17A 4I01A 1S7OA 4C2TA 2D3LA 5F0FA 1R23A 2HGCA 2IS1A 4U0WA 4XM3A 4IHYA 1CZFA 2PE3A 3OSFA 2BY1A 1H8AC 2M34A 1YO5C 2X3UA 4RM0A 1B1BA 1MBEA 1W7PB 4CCLA 3IL2A 3J7AO 4IOCF 4A3LJ 4M2LA 3B6AA 2X1CA 1Q1HA 2ZBKA 4NQWA 4IQ4A 3GX4X 3M7GA 3DU6A 3WG7H 4RGXA 2F1MA 3E1YE 2VOPA 3OYIA 4A12A 2DBBA 2DA3A 1I3AA 3CW2A 4YAOA 1TLHB 3QWLA 4CZZA 3DEEA 3LA3A 5EMNA 1RWRA 4N0BA 1HF2A 1ZKGA 2W24A 1XQBA 3KP2A 5F4OA 1IF1A 3GVLA 3I56I 2DPDA 4F52A 1VHEA 2JJ7A 4ZZLA 3PSIA 3ZMDA 2GXAA 1GVJA 2XGDA 3U2RA 1WORA 2LD5A 1IN5A 3VFZA 3CC4I 5L46A 2VL8A 1JJ2B 4A3JJ 4YFNF 3MKYB 1WJ5A 2VASA 1ON2A 2OU2A 3CCQI 1CNEA 2ZB9A 1EP3B 9ANTA 1TT5B 1ZLJA 4P2NA 4HWVA 3QFRA 3FF5A 2ZC2A 1MJ9A 3AG2H 3VYSB 2VBMA 4M0LA 3ML3A 2FOKA 1KQSB 4P3YA 3PA2A 3K7AJ 1FTTA 2RAEA 4FHTA 4F91B 1YS6A 4P96A 5LGNA 5DM7F 2XAFA 4FT8A 3V7SA 5D8KB 2VNIA 5HLTA 2CNDA 2QQBA 2FJ1A 2GIVA 3SY2A 3KEYA 2PMZA 2KL4A 3IRRA 1ZN2A 3F3XA 3BCAA 3FK6A 5ICCA 2NNNA 1O8DA 2DAOA 3MMYB 4X8IA 4WZTA 2HVQA 3IHUA 4XN0A 3RKXA 3KYLA 1B8IB 2K9QA 4W97A 3CXCB 5D5UB 2WAQA 2KFDA 2R7FA 5DSZA 3WWGA 2R6HA 4Z4WA 4XSXF 2EWEA 3DP7A 3H0GJ 2PLFA 1JTAA 4B3XA 1F4KA 1HKTA 2Y31A 5FGMA 1K8AD 1XDSA 2G9WA 1FP1D 4XLEA 3AKZA 4I0AA 2A07F 1ZRDA 2WAEA 3PSSA 3CO7C 3K69A 5E8IA 1VQ9B 4QUZA 3IH3A 4HRIA 1DQUA 1OOCA 4OMYA 3VYRB 1NTCA 4ZCIA 4A6DA 1GT0C 3GQ9A 5EGOA 5E1XA 3GUDA 3WTSC 1G59A 2FOWA 1T39A 3P9CA 2CRVA 3SXYA 4ZYGA 1DABA 3WNCA 2VNKA 4XBFA 3JRGA 1YJ9B 3SQVA 4BE1A 3EYYA 2OBTA 3FM3A 1X1BA 2CC2A 3VNUA 2W48A 1B72A 2L7FP 4N4OB 4FK8A 2H94A 2C5BA 3P9IA 2HNHA 3UNGC 2ECBA 4OJPA 2BOLA 2P5VA 1N08A 1VQLB 2OZ6A 1X1PA 1D1CA 3NQOA 2FVGA 2OUMA 5J3OA 3B8YA 1TP4A 4AU7A 3QP5A 1U9NA 2CF4A 1PP8F 5B1BH 4BACA 4F7DA 2KZGA 3ZOBA 3AVTA 4GGGA 2G0EA 2CFOA 2M7AA 1KQ0A 3CUOA 1TWHJ 3KP7A 1Q9SA 3ZC3A 1YS7A 1BJAA 3TH0A 2VJ5A 1YJWI 1JT6A 4YFXF 3HM5A 2HDDA 1XE1A 2UVEA 4RB2C 1P4WA 2XNJA 1I3QJ 1R6RA 4CYCA 1GV5A 5LHGA 4B4CA 1OR7C 1QQIA 1CLWA 5FFXA 4WQMA 3VR6A 3HDDA 4BDZA 3JW4A 1BW6A 4CICA 1RNLA 3AG1H 4LD5A 3JRBA 2OD5A 3HTSB 2XASA 1FOKA 2OK7A 3ZR8X 3CQZJ 1U9OA 2W6JA 3O3KA 3ZBTA 5IYQA 3GVAA 3H5AA 1HCRA 2R7UA 3ASSA 1ZK8A 4BHCA 2B63J 2OBPA 2B7EA 3E3VA 4RB3C 1GVHA 3BROA 4ASNA 1LPQA 2FUG2 3QQAA 1J7KA 2I5UA 4GDFA 1T6ZA 2J8KA 1E0EA 1KD1D 1R5BA 1BA5A 2Q6KA 1YITB 5F6FA 2IA0A 4RS8A 2RC4A 1K4SA 3U2QA 1VQKB 3NARA 4Y4RA 1GV2A 2VJIA 3GTQJ 4EJWA 5LFAA 2L9RA 1XGSA 4GCVA 3V8JA 3J80Z 2R7RA 4C2UA 4Z4RA 4EJOA 2BE5F 4N3NA 1IG7A 1YQAA 2BVMA 4WF2A 3HRTA 2V7QA 1B23P 2GOXB 4DBRA 4KA4A 3LSJA 1WOSA 3CC2B 3C18A 1ACIA 1X0CA 4Q47A 2V4JC 5AMVA 1KYZA 2DMQA 3WG9A 2GM4A 3V8KA 2JA8J 3I4MJ 2EK5A 1T6SA 1ZR4A 4WZLA 2O17A 2JWTA 5FKNA 4B8XA 1QX4A 1SVMA 1S7EA 2BHYA 2WSSA 2VKVA 3UW0A 1QA3A 1K4TA 1LE8A 2E1CA 4L0YB 2QWWA 2DYRH 3WY9A 1VNDA 5FLXZ 2WBMA 3CMMA 3CCUB 3W2WA 4EM0B 5CQEA 1Y56A 4E7HA 1FLIA 5H59A 3FXOA 2PECA 3K10A 4UV8A 2BY3A 2BM1A 3A8IA 2R7QA 4ENJA 3A3GA 1W2BB 3FXJA 2ICWG 2LLKA 4CCNA 3OE7A 2VZLA 3LQ6A 3WTTC 2XGJA 2Y0SA 1I50J 2PYGA 1VQ7I 2ZJRF 5HDNA 4F7ZA 3JSPA 2MH2A 1MMAA 4G8XA 3KEWA 5A8AA 2QF7A 2M3AA 4BEHA 5IYRA 3W2FA 3G6EI 1Q82D 4PFOA 4HX7A 3A02A 1V55H 4MYUA 3Q9SA 3MZHA 4ACBA 3CB4A 5FB2A 2YWHA 2VIXA 2IGKA 4A6EA 4JYKA 5F27A 1GR1A 2XF7A 2XAJA 1W5SA 3ABMH 1N0UA 4O3MA 3CC4B 2Q6OA 3WXMA 3ZBUA 3FX3A 4M9ZA 4JX6A 4R71A 2MW8A 1VQOI 2QQ9A 2E35A 4B3GA 5E17F 4OPVA 1J2XA 4TT3A 4HG2A 4MEYF 3OS2A 4F92B 4HPQA 5CYVA 2MBFA 2CWEA 1SFUA 1S4MA 5IP9J 3VMFA 1TQMA 2O3FA 1P7JA 2KRCA 2MC4A 3EETA 3W6KB 1UMKA 5M5XJ 1AMOA 3DEUA 4FISA 5EEHA 1IXRC 1XMAA 4B4DA 5B6IA 4HDVA 1LM1A 4L5JA 1E2XA 2VONA 1B6AA 1WSUA 1W5TA 1Z1DA 4JP0A 3VMVA 1WPKA 4E7JA 2V5IA 2DMUA 2BSAA 4YFKF 1Q81D 2VBXA 1HXDA 2GBYA 2O5RA 3SZTA 3J80K 2NRAC 1G3WA 2NS7A 4MGRA 3BR5A 5LMZA 2BM0A 2W7ZA 3H09A 3A4CA 2YR2A 3QP6A 1Q1VA 1NHCA 1IW7F 2L54A 2UV1A 2E34A 2WTEA 4PCQA 4LG3A 2CV1A 3I4NJ 4G1BA 3VO2A 4ON0A 4WCGA 1H89C 2GPJA 4FX0A 1YX5A 1WI9A 3O6BB 2M4KA 3TO9A 5K7HA 1BI0A 4XIDA 1YJNI 1UG0A 2WV1A 5CJ9A 1O57A 3HGYA 3S3MA 4G6TB 5J3LA 1S7AA 3OYFA 2NVTJ 4HNTA 2DA1A 2NT9A 4MYTA 2B0LA 2X6YA 1XGOA 3WTVC 4M6VA 1S9HA 4V2FA 1AU7A 1KK0A 4OOSA 3F6VA 3A0BC 1FOYA 1JUSA 1OCOH 2XAGA 3W2AA 5L3CA 4L9NA 1LDKB 3S2DJ 3OYJA 4I6ZA 2BF4A 1YLOA 2X9DA 4IPAA 4ENNA 4LG0B 4BXUA 2V1XA 3KZZA 2A6EF 1LEBA 1OHHA 1CQTA 3S1MJ 4S0HB 2DOAA 1W7PD 3HGGA 2BHZA 2BY0A 2LKSA 3JCUC 4ZDOA 4YALA 3K4KA 4O5VA 4J19A 1LLWA 1WFXA 1IN6A 1SFOJ 3HOXJ 3ABLH 2NS8A 4E7IA 1H9TA 4E6KG 3H35A 1NK2P 4ZTJA 2IS4A 2A5WA 5K7FA 4PAAA 2V7XA 2WADA 5CQGA 5M5WJ 3T56B 4M73A 4X06A 1HA8A 3ZQHA 3E97A 2QKLB 4KUMA 3BNWA 2DA4A 1ZM3A 1MJAA 5JR3A 2VE9A 1YOVB 3BR2A 5CVJA 4EQQA 2F43A 4M6XA 5DUKA 1PJRA 2OQGA 2EINH 1MH3A 1STZA 1MW7A 1ULYA 2KIQA 2ID3A 3HHGA 4BQOA 5LHIA 1RR8C 1KU7A 3U21A 1J75A 1SANA 3V42A 3LVBA 2V9VA 2CW0F 3F8MA 3OL3A 3E20A 2CG4A 3JU4A 2VBZA 3JRDA 1DBOA 1USTA 2FU4A 3LSGA 1OQYA 1ZLKA 2PMUA 2LBFA 5GV7A 5H2FC 3HTUA 1F60A 2HTSA 3LMWA 3PUFA 5KHDA 1PXZA 1EKEA 2STWA 3Q6RA 2P4WA 2DTZA 1VQ6B 3WGHA 2HPIA 5IT3A 2YPRA 5J40A 1LFUP 2P6TA 3NE5B 1MGTA 3KPHA 5CVVA 4UB8C 4D5CA 3KEQA 4TKOB 1S72I 3VOEA 4B3AA 2QN6A 3AVYA 2DU9A 3BP8A 4JMQA 5B1AH 1VQKI 1ITYA 1ON1A 2OPTA 2VQGA 5H5JA 3IH4A 1H42A 1TYVA 3F8NA 4BXFA 1PVEA 4YAUA 1Z0XA 3DBLB 2IS6A 1IHMA 1E62A 4Y13A 4BUPA 2QYOA 1VQ8B 2WB1N 2CRGA 3L09A 1JB9A 5E3MA 4MTDA 4RAYA 1EH6A 2DFIA 2MG4A 2VKHA 2D3NA 3CCVB 1AHDP 1NB9A 3CCSI 3VO1A 3OYHA 5A88A 1XCBA 4A5MA 1QZYA 4NNJA 1ETVA 4AYBN 3BCDA 1MBJA 1S5LC 2OCEA 3HOSA 2DTRA 2Q8KA 4XLPF 2NV4A 2JSPA 3NEUA 4MTEA 2JIZA 4IRHA 2LC2A 4XKVA 1IV8A 2I8DA 4YZQA 3ZMUA 2X0KA 5JFRA 3VMWA 1BL0A 2XB0X 4CUGA 2E7WA 2CYYA 4RLFA 2NSPA 1P7IA 1YW9A 4EGYA 1BC7C 3OPOA 5K1YA 5IK2A 1PYVA 3GTOJ 2Y0SN 2VT2A 1IZ1A 2L2OA 5CLSA 3L2WA 2F3LA 1T33A 4FE7A 4BGDA 1RQPA 1SC7A 4P5OA 3CMAB 5ICEA 2L7MP 3OW7A 1TWFJ 1CF7A 2VBKA 2ETHA 1PUFB 3ERED 4LMYA 2FBKA 3VSLA 1QPMA 4BQAA 1MRZA 2R7WA 4RJLA 1Z9CA 3T8RA 1CNFA 1NK3P 1E3OC 1QPIA 2E5ZA 2KZVA 3L9FA 2ESNA 2MYSA 4HEA2 3JRAA 2EFWA 5KAFC 2OTLI 3BR6A 1UHSA 1U8BA 2H6BA 1LFPA 3ZGKA 4XRSA 2I1LA 3HOUJ 3HUGB 2K85A 3G1OA 5THXA 2R7XA 5K5OA 5AIQA 3V7AA 2KIUA 2Z8GA 1X4OA 3EPZA 3JREA 1O3QA 4IRIA 5M5YJ 4KDPA 2FX3A 3VSUA 1QA2A 1YW8A 3M1CA 4EGZA 5KNLA 3AVUA 2QDXA 2IGMA 2I10A 3OS0A 2KMUA 5H6QA 3WGGA 1K4ZA 2X51A 2RVCA 2BW3A 1MKMA 1E79A 2MC3A 4Y33A 2R92J 4BQQA 2R7TA 5LEJA 3CD6B 2AXLA 3ZMZA 1FIAA 2DA2A 5EZGA 4RD3A 3DKYA 3AVXA 2QQ8A 2MLKA 4RAZA 3LJYA 2MGQA 4FWTA 1O8FA 2VODA 2JQ7A 1FBUA 2VBUA 2P0WA 1VJSA 2C6YA 4ZGNB 4DGWB 2OCCH 3OIPA 3EUHA 4YEIA 2PN6A 5D5XB 3PENA 3H5NA 1IRGA 3B90A 4RGUA 3J7YJ 4N3GA 2FXAA 4EM2A 3RKQA 4M71A 1M1EB 4EJVA 2DYSH 1VLOA 3BR1A 4KYWA 3VB2A 1SFKA 1UJ8A 2E1NA 2M0MA 5DN6A 2GA1A 2LG4A 1CGPA 2O1DA 1QRCA 2EILH 3WU0A 1MDMA 2E2JJ 4MR0A 3VWBA 3GZNB 2K5CA 2XPWA 3MAJA 1ZGJA 2K40A 3RKYA 1O4XA 1BLIA 4IQJA 3HUGA 4XKWA 3LNQA 5E79C 4TMVA 4XD7A 4AF6A 2BN4A 3MFKA 3K4MA 4XRMA 4M3GA 4G7OF 5IT9Z 1IJEA 3HKZA 1OB5A 1FWZA 3M3YJ 3R0JA 1WP6A 1VQNB 3OY9A 3KP3A 1AIPA 1UD5A 3FHZA 3JRCA 4U0VA 2UXXA 5H20A 2F5FA 1DDIA 5F4MA 1VF9A 3ZXSA 3PQJA 4DNTB 1E1QA 3I53A 2Q2EB 2YUSA 4G7ZF 2YU9J 2GXBA 3V7RA 1T98A 5EG0A 3MMPA 5E8GA 3TW7A 1HSTA 2LNBA 3EQLF 1FMVA 1G3YA 1D0XA 3DBRB 3T0YA 1JJ6C 2ZTGA 3V7CA 3CC7B 4U7BA 3EDPA 4K2EA 3B73A 5FIUA 4XN3A 2XGXA 4R79A 1KJZA 4M53A 2DQLA 4NK6A 1WJDA 4CZCA 2H1LA 4TMWA 4LBYA 3RPUD 3HOTA 1VQ4I 4W8SA 1FPQA 4HYEA 4PJ0C 1W0TA 1XD7A 1FOWA 3IUOA 1E3XA 4XRFA 4D1QA 4RCYA 2XIGA 4AVZA 1I7PA 2OTJB 2BXYA 2R7DA 1FOXA 1OR7A 4ROXA 4BAYA 3U6BA 4Z05A 3ZQIA 1VLYA 5A89A 1BJKA 1I18A 2KJCA 1BOBA 2HDCA 4KH3A 3JSOA 3KYDB 2ZL6A 1ZR2A 5IYDJ 3ONYA 1O8JA 1ETXA 3RPQA 1IDKA 3SZEA 4HF2A 4YIRX 1X3WB 1R4MB 4C3JJ 3KRGA 2V7WA 1VFCA 4ZYAA 4YDTA 2X8KA 1QRYA 3RYPA 2E1OA 2O7OA 4CCJA 3W5HA 1EXMA 3OYNA 3O8GA 3BQZA 2H8RA 3FXRA 1QGPA 3AVVA 1FY7A 2JT1A 3FKIJ 2P6SA 3ABKH 3DWLE 3OL4A 2H27A 4P55A 2M9HA 5BPDA 5D6EA 3GO5A 4Z4YA 2F1LA 2F4NA 2BGCA 3VSKA 2B0RA 2BZTA 4IRGA 4GYGA 2VT3A 2PBIA 2BXZA 4LIUA 2XSDC 3EQNA 2ME6A 3S1NJ 1FC3A 3HL2A 1ZAOA 3R60A 1OPCA 1U2RA 2P5KA 1WPCA 1DBGA 3RQIA 1IDZA 5FROA 4QWQA 4RDJA 1BJZA 5FO1A 2DJIA 3LQQA 2EH3A 4CHUA 2LK2A 3PIPF 1T0FC 3EUAA 2NVQJ 3BTLA 3I56B 2HMAA 1HZEA 2BW3B 1R7JA 1VQ8I 3BY2A 5D6FA 1R5GA 1EF4A 2DI3A 3W6JB 1TYWA 4ZC3A 2HU9A 5FO0A 1K9MD 4EVIA 2LR8A 5CPRB 2QKMB 1G7SA 4PDKA 2LMDA 3Q9VA 3BWGA 3A01B 4C43A 3CCSB 1L1IA 1XG1A 3U9GA 1WVRA 2HYJA 2GIZA 2JA5J 3NWSA 4WWCA 3MKZA 3ERMA 4G6QA 1I5ZA 3E1SA 3BCFA 1EH7A 5CDFA 2IOUG 2R93J 3GQAA 2ZZEA 2QZ8A 5L3DA 4Z1MA 1KA8A 1U5TB 4OWRB 4G6IA 2M1BA 4AC9A 3D5SC 3SFZA 4AM3A 3HB9A 1E3HA 3CCLI 3KLNA 4JX5A 2XZLA 3RZOJ 2Y75A 2VBWA 1EP2B 4OP7A 5J1RA 2KIMA 3KIOA 3WTXC 1KCDA 3FM5A 2XDVA 3UKGA 2YSRA 4KISA 1OFLA 4Y9UA 3U1DA 4G12A 1RUOA 4DK1A 2DXIA 2QTLA 3S14J 5HNFA 1XS9A 3OWTA 1QU3A 1Z3YA 3HSEA 3BJAA 1RUNA 2V1NA 1O8EA 1BBYA 4PGGA 3FXLA 5L3EA 4MLOA 1GJRA 5HLIA 3G71I 4U49A 1RU4A 2HS5A 4ZH4F 1T56A 3CUQC 3TBIA 5FRNA 4ENMA 5LGTA 1TL8A 2ZNYA 3DKXA 3B4NA 1HG8A 3RZDJ 3G05A 2WV0A 3W2VA 1GLNA 2O04A 1GVDA 2E19A 2RQQA 3BQJA 2XPUA 1SVOA 3PUBA 1V3FA 2ZFUA 1IA5A 2EIMH 5FJ8J 1XB4A 2DPUA 1WJFA 1JNYA 4P9SA 4EM1A 2EZIA 2BPOA 2P7CB 4HV5A 3CCJB 4Z06A 4OU0A 1OISA 1ZYRF 5J4VA 1FYKA 1L0OC 4RD1A 5F64A 3KE2A 1EWYA 2M8EA 2C5HA 4RB0A 2PLYA 4PZJA 2QE7A 3HOWJ 3IV5A 4NK8A 4BNCA 4E7ZA 3I3LA 1Z6TA 1X58A 2XVCA 2CGPA 2P3MA 2V7UA 3QSYA 1S8NA 2LSOA 2L9NA 4IHSA 3BTIA 1LE8B 1S6LA 3P5JA 3Q3AA 1NBMA 2WC2A 3L1PA 1XGNA 2FBHA 3MZ8A 1YIJB 3BC8A 4HSTA 1G7RA 4NHJA 1GHCA 5DCFA 4L9TA 2M2EA 5K5RA 1BR2A 3WNDA 1O7FA 3NRVA 1QO0D 4I0BA 4XOPA 1SM4A 3HIFA 4MO7A 2RV8A 1JKOC 1B8IA 2E1RA 3QFCA 1P4MA 1WSVA 4FETA 1XTAA 2EFNA 4BL0B 1FZPB 3SJMA 2O9LA 2JA2A 2CW5A 3O8HA 3V76A 2MD0A 4DNCA 2RN7A 4BBRJ 3WODF 4Y3OA 3OYDA 3B02A 1BX1A 2BV3A 4H4KC 2PI0A 3I71A 1KRHA 3JTGA 2VLAA 1RI7A 1W36C 2RQPA 2JJ1A 1H0MA 3GW2A 4Q7JB 4HQMA 2CW8A 1QA6A 2DA7A 1Y6IA 3GQBA 1N75A 2VKDA 2WY8Q 3WU2C 2R5YB 3CUQB 2JA6J 4ZGQB 4KMUX 5C1CA 4ANJA 3KZYA 3HAGA 2YWGA 2ZXHA 4A93J 1H80A 3HSRA 2AHQA 1YITI 4OAZA 5L3FA 4R1HA 2CO5A 4HAMA 1TWAJ 2DMPA 2IGNA 4I98B 3OYGA 3ZP5A 1W0JA 4FE4A 3ZQQA 3MHPA 4CQJA 1VQ4B 4RAFA 4UB6C 2Z33A 2HEOA 3GYHX 2XGEA 3L7WA 3C3WA 1VQPB 2INVA 3ZSCA 1XCVA 2WAFA 3BLYA 2L4AA 3ECHA 1IRXA 5F0HA 2OTJI 2CQXA 1OMIA 2VBEA 3N6ZA 2VKEA 2DOFA 3S15J 1NG7A 3MVPA 4KIFA 1ZQ3P 1KQ5A 1FX7A 1T38A 1B4AA 2C77A 1K8FA 2YUHA 4RGSA 2HTJA 5TGTA 4BH9A 2D45A 4Y9RA 4NB5A 4EJTA 4XKBA 1V5VA 1AKHB 2RKHA 2BVLA 2RC6A 1OYWA 3SKBA 3SZPA 1RRJA 1ZG3A 3TP0A 3TW6A 3BZCA 4BHBA 4KKSA 3W2IA 5BMZA 2MD5A 2B7BA 2KT0A 2VFOA 1Q86D 2DLLA 3AL0B 2IAIA 2CS3A 2ZZGA 1DPRA 3GLXA
chains in the Genus database with same CATH topology
2X3HA 3S3MA 4G6TB 4CA0A 3AFHA 1PE9A 3OYFA 3A1YA 4HNTA 2KVOA 2HQAA 3CJQB 4E0FA 2NT9A 2F5VA 2CK3A 3H0DA 2X6YA 4LITA 4IX7A 4MXNA 4ZDPA 4FXUA 1MMGA 1S9HA 1U0JA 3ZRGA 4YZAA 2L5QA 1UAAA 2JVHA 2XF5A 3W3CA 3W2AA 3EQOA 3CP2A 3EUHC 2ZTNA 2ZZFA 1PLUA 1LDKB 3OYJA 2VQCA 4B3FX 3HPGA 3VYUB 3DLAA 1OHHA 1D0ZA 1P9QC 4QPQA 2R7SA 2UWMA 5C1EA 1V5GA 2DOAA 1WMRA 3C2HA 4J01A 2KQRA 2R4GA 3FHNA 3K6GA 3K4KA 4DIQA 4XQFA 2VQLA 2Z2SB 4ZDOA 3FPPA 1WFXA 3S8PA 4OJ5A 4E7IA 2IS4A 4E6KG 3H35A 4ZTJA 2A5WA 2JDIA 2F6CA 3LNNA 2WADA 5CQGA 1UD2A 4II2A 3T56B 4EW9A 2IGOA 1HA8A 3OFNA 3DTKA 2V7FA 2QKLB 3DQVC 2LRDA 3BG6A 4CCMA 3OAAA 4OJOA 3DPLC 4C2LA 2F43A 1K5CA 1PJRA 4OAYA 1MW7A 1Z21A 2K9LA 3H9JA 4BQOA 1IB4A 1N77A 2DIEA 1D1BA 4N4NB 3U21A 1WJCA 3V42A 2NT6A 3LMMA 2QXZA 2Z16A 2Z6BD 1VF7A 1OLTA 2DT6A 3VYTB 3K70D 3OL3A 2W6IA 3PL8A 3JU4A 3M8JA 4XOTA 1DBOA 1N78A 2X85A 3GVJA 2QX3A 3LSGA 3MKWB 2LBFA 3LMWA 4XLAA 5KHDA 2R9VA 4PJJA 1PXZA 1XG2A 2X6WA 4E4HA 1YE9A 4ZTFA 3I9V2 1RMGA 2HPIA 3NE5B 2IXSA 4F55A 2CMPA 2XAUA 4RLQA 5HVQC 3ZCOA 2O0VA 4P1WA 1WTHD 4B43A 4TKOB 1MABA 4YXWA 3K4CA 1YX3A 2ZSHB 1BN8A 3GQ8A 4JMQA 2X1DA 4YZ0A 4DJAA 4OJLA 3B90A 4PSWA 3A35A 1W9XA 3BG7A 2VQGA 4W8RA 4CCOA 2NTPA 3OS1A 4J00A 4XMYA 3S3OA 1KZLA 2OC6A 2ZSIB 4BXFA 3VSVA 3OOCA 2NTBA 4JQFA 3C2GA 4XL9A 2IS6A 4BUPA 2RNGA 4BJTA 2HDWA 4PJLA 4II3A 1DGRM 2M7BA 3LL7A 2VKHA 4RM2A 4KT6A 2D3NA 3DDYA 1O8LA 2LY2A 2W1OA 2MFZA 4QPOA 4U4BA 1UG0A 5CKTA 1X4PA 3OYHA 4CH7A 1O8IA 4NNJA 1O8GA 3BCDA 3HOSA 1H8HA 2JSPA 3S32A 2XC7A 2JIZA 2LC2A 3CZ6A 4XKVA 2I8DA 4DOZA 3UR3C 4YZQA 2ZXIA 3GRHA 3SZGA 3VMWA 2NTQA 2KDOA 3L2QA 4CUGA 4KITB 3QYBA 4RLFA 2A6TA 2NSPA 2WZPP 2WY7Q 3OYBA 1DP3A 1W0KA 4IKFA 3OPOA 5IK2A 4AYBA 3FBIB 1PYVA 3BC9A 2WJVA 1O8KA 2KP6A 3L2WA 2L2OA 1UELB 1MNEA 4XORA 4BGDA 1ZELA 3G2BA 4P5OA 3OW7A 2VBKA 3FBNB 2NZMA 3VDXA 3OR1C 2CV2A 2XNDA 3VSLA 4FASD 1AIRA 2R7WA 2PJRA 3TL4X 2NSTA 1D1AA 4Z03A 2DT7B 2M4GA 3RSNA 2E5ZA 2KZVA 2GJPA 3RQ4A 2MYSA 4HEA2 1KCCA 4P22A 4GQNA 1NRKA 3PNYA 3DTEA 2WJYA 3T51B 1LFPA 3ZGKA 4CSWA 2UUZA 3HUGB 4UZUA 4ZDLA 2R7XA 3OYEA 3OR2C 2Z8GA 3OIQA 1X4OA 3EPZA 3H9QA 2E1BA 3VSUA 3M1CA 1J09A 5KNLA 4ITVA 4BE2A 2IGMA 3OS0A 1HVXA 3WQZA 3D5RC 2KMUA 3L2RA 3J7AY 2X51A 1W36D 4XLCA 2BW3A 1E79A 5FRMA 3MD2A 4Y33A 3SUCA 4BQQA 2R7TA 1BHEA 2F4IA 1OGOX 1VZ0A 2W7NA 3LFUA 3DKYA 3RTRA 5HNHA 1BPLA 1O8FA 4C2TA 2D3LA 1TT0A 1DGWY 4LIVA 2IS1A 2BSPA 4XM3A 1CZFA 2P0WA 1VJSA 4DGWB 1WJEA 3OIPA 3GQ7A 4KKUA 4CCLA 3H5NA 2KRHA 3FKJA 4XR6A 2VJJA 2X1CA 4NUBA 4IQ4A 2HPMA 3K4NA 3DU6A 2XSJC 2F1MA 1SFKA 1TZLA 1QHHD 2V6EA 2M0MA 1E43A 5DN6A 2DCEA 3TMOA 2LG4A 3OYIA 2O1DA 1E1RA 4EATA 4XLFA 4BQNA 1PKVA 2X1EA 3VWBA 4HNUA 1BLIA 2K5CA 2VXZA 3DEEA 4IQJA 2RREA 4XKWA 4XD7A 1RWRA 1H8EA 3D5LA 3K4MA 4OZZA 3HKZA 1WP6A 4URRA 2LH9A 4XLHA 2VXDA 3OY9A 2Z1DA 1EA3A 1UD5A 3GVLA 4BS9A 4W8QA 3L2VA 4F52A 1EFRA 2GK7A 2E60A 3QYFA 3ZXSA 3PSIA 4DNTB 1E1QA 2LY1A 2Q2EB 3CJRB 3ZPPA 3ZIAA 3ZPNA 1WJAA 2VL8A 4X0GA 4B48A 3MKYB 4XONA 1WJ5A 2VASA 2HVSA 2ODLA 4F93B 1FMVA 1VBLA 1D0XA 2ZTGA 1BR1A 2IQ7A 4HWVA 4U7BA 2O0WA 1JI8A 3VYSB 1Z3XA 5HKKA 2HZDA 2VBMA 2UVFA 4XN3A 4R79A 1QJVA 4NK6A 1WJDA 4CZCA 3QYEA 4F91B 3K4BA 4BU2A 3RPUD 3HOTA 4W8SA 5JHFA 1BR4A 1OFMA 3CP8A 5HLTA 4MR0A 3IUOA 3OOUA 3KEYA 4NC7A 1E3XA 4D1QA 2PMZA 2KL4A 4AVZA 3BCAA 1UD4A 4DNRB 4CCKA 3FY3A 1O8DA 2IS2A 4Z05A 3MMYB 1VLYA 1I18A 2HVQA 4XN0A 2W4SA 3SEZA 3KYLA 3EUKL 1BOBA 3DTIA 4PUSA 1MNDA 2NOJB 1O8JA 2WAQA 4RM3A 3WWGA 3KX2A 3OEHA 2XOKA 1IDKA 2EWEA 3GVKA 1KTWA 1JTAA 4B3XA 3KRGA 4YELA 1X1CA 2L7KA 4ZYAA 1MMNA 2V26A 2X8KA 1T95A 4CCJA 4XLEA 4BJ6C 3AKZA 3OYMA 3LSKA 2WAEA 1OB0A 3OYNA 1V0EA 3SYTA 1E3ZA 4GRIA 4BEHB 2KHMA 4HRIA 1DQUA 1OOCA 3VYRB 3DWLE 3OL4A 3GQ9A 1V5EA 1QHGA 3PSFA 4HSRA 1G59A 3IAS2 4G7WA 3LSHA 3VSKA 3HG9A 3E0JB 2OV7A 2JUGA 4U87A 5FL7A 4LIUA 1O8MA 3EQNA 4NQWB 3HL2A 4BE1A 1X1BA 4XNFA 4N4OB 1WPCA 3IP4B 2ZZQA 1DBGA 1ERDA 5FROA 2HNHA 3UNGC 2R7VA 2DJIA 4OJPA 2BOLA 2CH0A 3OYAA 1D1CA 3K4JA 3B8YA 1T0FC 2OUMA 3EUAA 4IZZA 4AU7A 4KJZA 4BACA 1HZEA 2BW3B 1I8DA 2M7AA 2CFOA 3S93A 3RCOA 2XF6A 3HPHA 2HU9A 3CF2A 4ZC3A 2VJ5A 2K3PA 3T53B 1AA7A 2QKMB 5CPRB 4BE0A 3AL0C 2WB1A 2UVEA 2LOOA 1R6RA 3NWSA 3MKZA 1UD6A 1OR7C 3S3NA 4OZYA 3E1SA 3BCFA 2GOMA 5CDFA 3VR6A 3GQAA 4BDZA 1FX0A 2R7OA 2ZZEA 1KONA 2LBFB 4Z1MA 1LVKA 2Q1ZB 4BDYA 4PJNA 4OWRB 4G6IA 3D5SC 3ZR8X 4ZJZA 4PK4A 3A3BA 2M5SA 2XZLA 2W6JA 1COWA 2K9MA 2AQFA 2AQEA 3DPUA 3H5AA 3QODA 3K70C 3PJRA 2R7UA 4W8TA 1KCDA 2PJRB 2XDVA 3OYLA 4KISA 1OFLA 2E1MB 2VQHA 3N05A 4DK1A 2DXIA 2W00A 2FUG2 4C30A 5HNFA 1SAUA 4C9YA 2X53S 1E0EA 2GJRA 3OWTA 1QU3A 1Z3YA 4F3QA 1X1AA 2V1NA 1O8EA 4YRVA 1UD8A 4MLOA 4U49A 4Y4RA 1RU4A 2VJIA 2V9KA 4B44A 5LFAA 3TBIA 5FRNA 2R7RA 4C2UA 3DKXA 2L9SA 1HG8A 3B4NA 1Z7LA 3G05A 3W2VA 1GLNA 2O04A 2RQQA 2BVMA 3ONQA 3OMYA 2V7QA 2GOXB 3QOEA 3PUBA 2ZFUA 4DBRA 1IA5A 1X0CA 4G7XA 1WJFA 2V4JC 5AMVA 1X1DA 1V0FA 4Z06A 4L8JA 3OYKA 4RMNA 2JVGA 2O17A 2X6XA 4JOMA 1QCXA 3H5RA 3BH4A 1FMWA 1JRGA 2QE7A 2KPMA 2WSSA 3UW0A 4NK8A 4B47A 1O88A 4E7ZA 1EE6A 3I3LA 5KCMA 1G8XA 2CUJA 2LREA 2WBMA 2E5NA 2L9NA 3CMMA 3W2WA 4PMHA 5CQEA 1Y56A 4E7HA 4E7LA 5LD2C 3JURA 3IAM2 1NBMA 3GBGA 4XKCA 2PECA 3K10A 4KKTA 3BC8A 1MMDA 2R7QA 3LSIA 4HSTA 3DU5A 3LSMA 3A3GA 1D0YA 3K4LA 4CCNA 3OE7A 4PJMA 3A2KA 1BR2A 1NG6A 2XGJA 4D9JA 2Y0SA 2PYGA 2CUZA 4ASUA 4XOPA 2V4DA 3OEEA 1IDJA 1MMAA 3NWTA 3KEWA 1SKYB 4OJ6A 2M3AA 4FETA 2VJ4A 4BEHA 4BL0B 1OGMX 2JA2A 2MD0A 4PFOA 1UD3A 3L2UA 3OYDA 3F9KA 4Y3OA 1K6YA 2CW7A 4H4KC 4E7KA 3FKSA 2VLAA 1WJBA 4BJ5C 4YEJA 4TSFA 1W36C 4DBQA 4HIZA 2JJ1A 2VIXA 2IGKA 3CESA 3FDYA 3H9GA 4DK0A 2WPDA 3HXLA 2XF7A 2CW8A 1V5FA 2XZOA 1Y6IA 3GQBA 1GQ8A 1N75A 2VKDA 2WY8Q 2PYHA 4E7SA 2HLDA 4B3GA 3BCBA 4I84A 4ANJA 5C1CA 3HAGA 4TT3A 2ZXHA 4HG2A 2LYCA 1H80A 3OS2A 3PFYA 4HPQA 4PSXA 4F92B 2MABA 4OAZA 3SEQA 3VSTA 2IGNA 3OYGA 4YZXA 5HOOA 3H94A 1W0JA 3ZQQA 2KRCA 2MC4A 2VB6A 3PNTA 2ELJA 4NC8A 4PFPA 2JJ2A 2QY1A 2INVA 3PNVA 3ZSCA 2WAFA 3BLYA 2VPLA 2V31A 3HC7A 3VMVA 1IRXA 4E7JA 2GJKA 1LKXA 2CV0A 2VBEA 3T9GA 2O5RA 1NG7A 2INUA 3DPTA 2LZJA 2KLOA 3A4CA 5TGTA 3SDBA 1X19A 1KMHA 2HVRA 2WA0A 1NHCA 2XZPA 2UV1A 4XKBA 1T5EA 2BVLA 1K28D 4LG3A 2CV1A 1O8HA 2GK6A 4KKSA 1BMFA 1YX5A 2M4KA 2E1MC 3OYCA 3AL0B 2CS3A 2ZZGA 2W82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3H A;  2O04 A;  1O8K A;  4AVZ A;  1PE9 A;  4XOR A;  1IA5 A;  3FY3 A;  1X0C A;  2NT9 A;  1O8D A;  4Z05 A;  2X6Y A;  5AMV A;  4MXN A;  4XN0 A;  2VBK A;  2NZM A;  4Z06 A;  4YZA A;  3EQO A;  1AIR A;  1O8J A;  1PLU A;  2O17 A;  2X6X A;  2NST A;  1QCX A;  1IDK A;  4Z03 A;  3WWG A;  1JRG A;  2EWE A;  1KTW A;  1JTA A;  3KRG A;  3UW0 A;  1KCC A;  4YEL A;  4NK8 A;  1O88 A;  1EE6 A;  4XLE A;  5C1E A;  1WMR A;  4XQF A;  4PMH A;  3JUR A;  4OJ5 A;  2Z8G A;  2PEC A;  1OOC A;  3VSU A;  3GQ9 A;  4EW9 A;  4XLC A;  1O8M A;  2PYG A;  3EQN A;  3SUC A;  4XOP A;  1BHE A;  4OJO A;  1OGO X;  4C2L A;  1K5C A;  1IDJ A;  4XNF A;  4OJ6 A;  1IB4 A;  1OGM X;  1O8F A;  1DBG A;  2NT6 A;  2QXZ A;  2BSP A;  4OJP A;  4XM3 A;  1CZF A;  4XOT A;  3B8Y A;  1DBO A;  2X85 A;  3GQ7 A;  4YEJ A;  2QX3 A;  4XR6 A;  2VJJ A;  3LMW A;  4XLA A;  1PXZ A;  1XG2 A;  2X6W A;  1GQ8 A;  1RMG A;  2PYH A;  2O0V A;  2UVE A;  2O1D A;  4I84 A;  5C1C A;  1H80 A;  4XLF A;  4MR0 A;  1BN8 A;  3GQ8 A;  4OZY A;  4YZ0 A;  3VST A;  4OJL A;  3B90 A;  4YZX A;  4XKW A;  1RWR A;  3GQA A;  4W8R A;  2NTP A;  4XMY A;  4OZZ A;  3VSV A;  2QY1 A;  4URR A;  4XLH A;  2INV A;  2NTB A;  3ZSC A;  4XL9 A;  4W8Q A;  3VMV A;  2VBE A;  3T9G A;  4W8T A;  1KCD A;  3ZPP A;  2INU A;  1OFL A;  1O8L A;  4U4B A;  4XON A;  2ODL A;  1O8I A;  1O8G A;  1NHC A;  1VBL A;  2IQ7 A;  4HWV A;  1O8E A;  2O0W A;  2VBM A;  4XKV A;  1O8H A;  2UVF A;  4XN3 A;  4YZQ A;  3GRH A;  1QJV A;  4U49 A;  1RU4 A;  2NTQ A;  2VJI A;  4NK6 A;  3VMW A;  2NSP A;  4W8S A;  1OFM A;  3B4N A;  1HG8 A; 
#chains in the Genus database with same CATH topology
 2X3H A;  2ZCW A;  1ETK A;  1E63 A;  2C78 A;  2RDP A;  3J81 K;  4CA0 A;  2DA5 A;  3HRM A;  2E2H J;  3FMS A;  3CJQ B;  3E6M A;  4N9H A;  2F5V A;  5IT9 K;  3H0D A;  1OGI A;  2CK3 A;  3D26 A;  5JBQ A;  3Q6Q A;  1UHW A;  3QFS A;  4M9X A;  1A31 A;  2ZIT A;  5GPC A;  3VEP A;  2GLO A;  3M9A A;  1UAA A;  3W3C A;  3EUH C;  2LY9 A;  2L0K A;  2EZK A;  5ILV A;  5A2Q K;  4RDU A;  2ZTN A;  2ZZF A;  2VQC A;  2FA5 A;  2PG4 A;  1TW3 A;  3HPG A;  1Z77 A;  2HOA A;  4ZYD A;  3VYU B;  1RPW A;  3G6E B;  3K2A A;  3BG3 A;  3BQY A;  4UUV A;  3OKX A;  1Y8Q B;  5JVT A;  2D1H A;  2UWM A;  1UMQ A;  1WMR A;  2KQR A;  1K83 J;  3K6G A;  4L5E A;  4DIQ A;  4B3F X;  1EH8 A;  2VQL A;  2Z2S B;  3FPP A;  4RD2 A;  4DZP A;  1R4N B;  1B9N A;  4L9V A;  3S8P A;  1JKP C;  3QE2 A;  2ZXW H;  4OJ5 A;  1WI3 A;  2K4B A;  4RPB A;  3BT9 A;  1IUF A;  4C3H J;  1OCR H;  2Y69 H;  4P9U A;  1ZGW A;  5D5V B;  2J7K A;  4EW9 A;  3OFN A;  3DTK A;  4KN7 X;  1DAR A;  1IN4 A;  4RA2 A;  5F08 A;  5H6R A;  3QU6 A;  2LRD A;  2DFE A;  1VQO B;  1BOA A;  3NAW A;  3AG3 H;  5DV5 A;  3H9N A;  1PJ7 A;  2HFH A;  1K73 D;  3BG6 A;  2HXO A;  3OAA A;  4C2L A;  4HX4 A;  1HQC A;  2FSW A;  1Z21 A;  2K9L A;  1BIB A;  1UG2 A;  2HR3 A;  4DZJ A;  5IY5 H;  1N77 A;  1K79 A;  2DQR A;  1D1B A;  4N4N B;  2QA4 I;  1D5V A;  4Y15 A;  1WJC A;  2V9P A;  4AIK A;  2BVN A;  2Z16 A;  2Z6B D;  4OIQ F;  1OLT A;  2DT6 A;  2JA7 J;  4ABZ A;  3PL8 A;  5HZB A;  4YHB A;  3D1N I;  2YU3 A;  2C2W A;  2ZJQ F;  2X85 A;  5K5Q A;  1N78 A;  2XTX A;  2QX3 A;  4Y7N J;  3MKW B;  5M3F J;  5F1R A;  3WE2 A;  1BC8 C;  1QH0 A;  3TP3 A;  5GTI C;  2GXG A;  4YFO A;  3LO8 A;  1HW5 A;  5TR9 A;  1N0V C;  3G1L A;  2X6W A;  2H8W A;  2IEK A;  4E4H A;  1A8P A;  4F55 A;  2CMP A;  2XAU A;  4G6D A;  2YX7 A;  3H1C A;  4B43 A;  4OIO F;  1WTH D;  3SYJ A;  1TWC J;  3BG5 A;  4YXW A;  1HDD C;  3K4C A;  2ISY A;  2JK3 A;  2K7L A;  3ZMV A;  2HQN A;  2X1D A;  3PQK A;  4DJA A;  2HKO A;  2JN6 A;  1VQ5 B;  1I6H J;  1Z05 A;  4MNU A;  4W8R A;  3IWF A;  5KSW B;  4XMY A;  4X7F A;  4OOI A;  3S3O A;  1KZL A;  3VSV A;  1AKH A;  4AWX B;  2NTB A;  1LDJ A;  1H85 A;  4G5G A;  4OOX A;  2HDW A;  4PJL A;  2FQ3 A;  2NYX A;  3QPS A;  3BOQ A;  2D74 A;  1KU3 A;  3CCJ I;  3TO6 A;  4RM2 A;  3I55 I;  3T8T A;  1TQI A;  2W1O A;  4OIN F;  4ENK A;  4Q5S F;  4U4B A;  3V4G A;  1JKR C;  4I2O A;  2A68 F;  4CH7 A;  1O8I A;  2A3S A;  2EPF A;  3S32 A;  2XRN A;  1WH7 A;  3TDU C;  1RZ4 A;  3CZ6 A;  5ILU A;  2HDN B;  1YJW B;  3HSF A;  3CF5 F;  2BX6 A;  1OYI A;  1ONV A;  3SZG A;  2R5Z A;  3K0L A;  2VOO A;  3L2Q A;  2VFM A;  1BIA A;  2A5Y B;  2NS0 A;  3QYB A;  3JQQ A;  4IL6 C;  2A6T A;  2XAH A;  4RGR A;  2PQ8 A;  3F21 A;  1JKQ C;  3H3V K;  3JRI A;  2ZL7 A;  2WY7 Q;  3RIQ A;  3G4S I;  1DPU A;  4PGO A;  2GA2 A;  3BC9 A;  3FBI B;  4TMT A;  1AOY A;  3FPK A;  4IO9 F;  1UEL B;  3CCE I;  4H0E A;  1MNE A;  3D0S A;  3QFT A;  1IRF A;  4LLN A;  1IDY A;  3MCZ A;  4IEJ A;  2V7T A;  1YFH A;  4BHP A;  2EV0 A;  1ETW A;  4D0P A;  2NZM A;  3I64 A;  4P25 A;  1VHO A;  1FDR A;  1QGA A;  4FAS D;  2K9S A;  3E6C C;  2M4G A;  3SHF A;  3BG9 A;  5LBQ A;  4FCY A;  2GQQ A;  2O8K A;  5LLQ A;  3RSN A;  2DY1 A;  3ZZT A;  5GPA A;  3J81 k;  1KCC A;  1ETY A;  4A69 C;  4BBS J;  1KGS A;  4GYI A;  3DTE A;  5M3M J;  2WJY A;  4A3F J;  2NVY J;  3T51 B;  3GSI A;  4I7H A;  4CSW A;  2K02 A;  2UUZ A;  2M30 A;  3TED A;  5J6X A;  4UZU A;  4UY8 I;  3R61 A;  1I1G A;  4KIG A;  2IT0 A;  2ACJ A;  4X05 A;  3H9Q A;  1QVF B;  4JK1 X;  5CVU A;  1J09 A;  2G7U A;  2DCU A;  3AVW A;  4BE2 A;  1XGM A;  3WQZ A;  4W1U A;  1DDN A;  3C7J A;  3QAH A;  1YI2 I;  1W36 D;  2LKX A;  1S72 B;  3IWZ A;  3LSP A;  1KQ9 A;  1EA0 A;  2F4I A;  3GFJ A;  1FNC A;  1N06 A;  1OGO X;  1IXC A;  2CU7 A;  4Z6Y A;  1M90 D;  3RTR A;  3FIW A;  4KT5 C;  5HNH A;  1BPL A;  4CXF A;  2Z5U A;  4JX4 A;  2VC0 A;  2K9N A;  2LKP A;  1PP7 U;  2IA1 A;  1TT0 A;  5F0C A;  3ZPL A;  2BSP A;  1F1Z A;  1FJL A;  3ZQC A;  5FKO A;  1WJE A;  3JQP A;  2KRF A;  2XAQ A;  3ISP A;  3GTM J;  1YI2 B;  4KKU A;  3GQ7 A;  4KFC A;  3FKJ A;  2VJJ A;  1LLZ A;  1R1U A;  4NUB A;  1XSV A;  1YX2 A;  2HPM A;  2XSJ C;  2J5P A;  3MEX A;  1TZL A;  5GAG J;  1QHH D;  2V6E A;  5GTH C;  1E43 A;  2ZFW A;  3TMO A;  3B82 A;  4CGZ A;  3TGN A;  3CCR B;  4EAT A;  1QRB A;  1NHA A;  1RC9 A;  5FKK A;  5GAD J;  3W2E A;  4BQN A;  1XX5 A;  4P26 A;  2CQ7 A;  4HNU A;  3F8F A;  2VXZ A;  4M3D A;  2EV5 A;  1HKQ A;  3CC2 I;  2ZBU A;  3QRF F;  4TMX A;  1Q7Y D;  4A2U A;  2XB5 A;  4R8H A;  2J5O A;  2AHO A;  3LA7 A;  3A1P A;  4URR A;  5J1Y A;  4DQL A;  3CDL A;  3ESW B;  4NBS A;  4BS9 A;  1R1V A;  2XV4 S;  2GK7 A;  1TBX A;  2E60 A;  4HV6 A;  3QYF A;  1KC8 D;  3LQE A;  5GAE J;  4ESJ A;  3CJR B;  1RES A;  5DTD A;  3HOV J;  3ZIA A;  2IVM A;  3ZPN A;  1EFU A;  2QBY A;  4X0G A;  4Z4Z A;  1BW5 A;  4QFM A;  1U2W A;  3W6V A;  1WXR A;  5TY0 A;  1N25 A;  1YTY A;  3RDI A;  3WTW C;  2ODL A;  3FK7 A;  2Q2E A;  4F93 B;  2XRL A;  3T1B A;  1FYL A;  2IQ7 A;  1YRN A;  5ICF A;  2O0W A;  1Z3X A;  3OP1 A;  2HZD A;  2EFO A;  1P4A A;  1QJV A;  5BNG A;  3S16 J;  3KYC B;  4KIC A;  2DET A;  1Z7U A;  3K4B A;  3WNB A;  4BU2 A;  4L5I A;  4A3C J;  3HOZ J;  4A3G J;  4UZE A;  3WBK A;  1TNS A;  4P12 A;  4NC7 A;  4L18 B;  3CCM B;  2M87 A;  2DW4 A;  3BR0 A;  4D7M A;  5E1W A;  4ZZD A;  1UD4 A;  3G1M A;  3FY3 A;  2EIK H;  4WZE A;  2G7H A;  4A3I J;  2X0L A;  4HQE A;  2PEX A;  2Z3Y A;  4AC0 A;  5TRD A;  3T5X A;  2W4S A;  1QFJ A;  2BBY A;  3R6J A;  3EUK L;  3DTI A;  4PUS A;  3B78 A;  1MND A;  1NDH A;  3ZMS A;  1F20 A;  2BMW A;  4RM3 A;  5EG0 B;  4FQG A;  4LOC A;  4L0Z B;  2QEX I;  3TOA A;  3GVK A;  1KTW A;  1X1C A;  2L7K A;  1S29 A;  3N4M A;  2QA4 B;  1OYY A;  3GTJ J;  2A05 A;  4BJ6 C;  4IHX A;  2O6G E;  1OB0 A;  3E6B A;  1MH4 A;  1V0E A;  3SJZ A;  1E3Z A;  2XUB A;  3BTC A;  2KHM A;  3AAF A;  4DYC A;  2E71 A;  1B9M A;  1HW2 A;  3FXQ A;  5GP9 A;  4LLG F;  4HOB A;  1QHG A;  4HSR A;  3S1R J;  3JAM K;  1QUF A;  4G7W A;  3LSH A;  3HG9 A;  1YJN B;  2OV7 A;  2JUG A;  3J81 Z;  2L02 A;  2LF7 A;  4A3K J;  5IOY A;  4NQW B;  2XGC A;  3MQ0 A;  1OGJ A;  4EJU A;  3P9K A;  3Q39 A;  2PMD A;  4XNF A;  1IV6 A;  2P5L C;  1VQ5 I;  3ZQ7 A;  1REP C;  3IH2 A;  1ERD A;  4IF4 A;  2XRO A;  4WX9 A;  3OYA A;  2CH0 A;  1PDN C;  1QG0 A;  2B7C A;  3TKY A;  2CSO A;  3K4J A;  1VQN I;  2DMT A;  2HI3 A;  2IBD A;  4KJZ A;  2EBI A;  1BM9 A;  1XFO A;  4EMS A;  5DCM B;  5TIS C;  3RCO A;  2GWR A;  3HPH A;  1TNT A;  3TQN A;  1WDT A;  3CME B;  2K3P A;  3T53 B;  1AA7 A;  4BE0 A;  2BEO A;  1Y0U A;  3I58 A;  3ZMT A;  2FF4 A;  1VQM I;  1QA1 A;  2LOO A;  2AO9 A;  5B5E C;  1IN8 A;  2ZKZ A;  2DOE A;  3GCM A;  1UD6 A;  4OZY A;  2V79 A;  3QPT A;  3LOC A;  3GEZ A;  1A36 A;  5AN9 A;  3HRU A;  4P6Y A;  4RLZ A;  4Z4S A;  3EYI A;  1LVK A;  4BDY A;  4PJN A;  4G7H F;  1B2R A;  4ZJZ A;  1F43 A;  5IYP A;  4A3M J;  4XLN F;  4U9U A;  1COW A;  3FIS A;  3S1Q J;  5BSY A;  2QCO A;  1LEA A;  1P6R A;  2AQF A;  3QOD A;  4LJZ F;  3RIR A;  5JI6 A;  3K70 C;  1TTT A;  1TYX A;  1ZM9 A;  1FYM A;  1YRN B;  3N05 A;  1T6X A;  2BM7 A;  2W00 A;  4C30 A;  2DT5 A;  1SAU A;  4C9Y A;  2X53 S;  2QUF A;  2ZME B;  3LAP A;  1ZGA A;  4F3Q A;  1X1A A;  2QBY B;  2EIJ H;  1UFM A;  2Y30 A;  2B9S A;  2XC1 A;  2VBY A;  1ZHF A;  2OA4 A;  4BKX A;  1EJ9 A;  1Y8R B;  2PMZ N;  2V9K A;  5K7Z A;  3W5U A;  1FBQ A;  4DQ2 A;  2EV6 A;  2L9S A;  4U0Y A;  4UUS A;  2BV6 A;  2W25 A;  2ESH A;  3KZI C;  1FTZ A;  3ECO A;  2FX0 A;  1FBS A;  3QOE A;  3GFI A;  2IRF G;  4AIJ A;  2L4M A;  3ZUG A;  5FD6 A;  4G7X A;  3F8B A;  4YAF A;  1PJ6 A;  1X1D A;  1U5T C;  2A69 F;  4FTH A;  4NDL A;  1MD0 A;  2EA4 A;  2LFB A;  3CCY A;  1MDM B;  1P2F A;  4EEF G;  4IHV A;  3WBJ A;  3TDZ C;  1A6Q A;  1RQR A;  4JOM A;  2HQR A;  4FN5 A;  3BH4 A;  3PA1 A;  1JRG A;  1FSE A;  3QPH A;  5F4J A;  4IHW A;  2JN9 A;  1O88 A;  4M3E A;  5KCM A;  3DU1 X;  4MEX F;  2FD5 A;  3CCQ B;  1VQ6 I;  2LRE A;  3ASN H;  1TLL A;  4AF7 A;  1R9T J;  4E7L A;  2EJR A;  5LD2 C;  2Q6I A;  3JUR A;  4MHG A;  1GXQ A;  5E1Z B;  3LA2 A;  4XKC A;  4M3B A;  2OBS A;  1MMD A;  1R00 A;  2IW5 A;  3DU5 A;  2Q6L A;  1D0Y A;  3GLL A;  4HBL A;  3A2K A;  1FRQ A;  3MZY A;  3BY6 A;  3GFM A;  3GXO A;  2FNA A;  3LAJ A;  2CUZ A;  4UZF A;  2E2I J;  4ASU A;  4OPS A;  2MSY A;  3OEE A;  1U3E M;  2OBR A;  3N90 A;  3NWT A;  4UVB A;  4WWV A;  2HYF A;  2VJ4 A;  3H92 A;  4P3I A;  2D2W A;  1RR7 A;  1UD3 A;  2O6W A;  1K6Y A;  2CJJ A;  4E7K A;  1TYU A;  1KK3 A;  3FKS A;  4BJ5 C;  4YEJ A;  4TSF A;  4DBQ A;  4HIZ A;  4PC7 A;  3CTA A;  4KIB A;  2VC1 A;  3CES A;  4RDL A;  4DK0 A;  3GTL J;  3HXL A;  4IVN A;  3FXM A;  2ECC A;  3C1D A;  1V5F A;  3BPX A;  2EB7 A;  2NAZ A;  2RNJ A;  3HYI A;  2DDB A;  5HLG A;  1GQ8 A;  2GRE A;  3OJW A;  4E7S A;  5ILS A;  2COM A;  4RD4 A;  4I84 A;  4C2M J;  5DUI A;  1QNT A;  2LYC A;  1ETO A;  3G3Z A;  3SEQ A;  2ZXJ A;  4Z2Y A;  2D1V A;  3G71 B;  4YZX A;  5HOO A;  1W87 A;  2ZME C;  3GZ6 A;  2O61 A;  2VB6 A;  4ACA A;  1WHU A;  3BZK A;  1GAQ A;  2EFG A;  2ELJ A;  4NC8 A;  4PFP A;  2JJ2 A;  2QY1 A;  3KP4 A;  3CD6 I;  1KQ8 A;  3L00 A;  1P92 A;  4X6A J;  5E3N A;  3ZZ0 A;  4IOA F;  1SVL A;  2GJK A;  2STT A;  3OSG A;  2IJL A;  1ORK A;  4YCQ A;  2W57 A;  3H3Z A;  1SFE A;  5ERI A;  5JVG F;  1TTY A;  3R4K A;  4ETS A;  1T2K A;  2INU A;  2W84 A;  1G3S A;  1ZAR A;  4LB5 A;  3I5U A;  1VI0 A;  2KLO A;  5DNS A;  2XTY A;  4HLY A;  4I76 A;  3JRF A;  2CQN A;  3R6S A;  1PUF A;  1K7A A;  2F48 A;  3CMY A;  5DDG A;  1VQ9 I;  5GV8 A;  1LDD A;  1JHF A;  4BY7 J;  2F5D A;  3A0H C;  1ZUN B;  2F5E A;  3GIR A;  4QTR A;  3Q38 A;  1W7P A;  2N8G A;  5A2Q Z;  1SD4 A;  3OYC A;  3DFG A;  1ZG1 A;  1ETQ A;  3S2W A;  4S04 A;  5DYM A;  4WK8 F;  3U1K A;  4IW3 B;  2CQK A;  2HOS A;  1X3U A;  3AFH A;  1PE9 A;  3A1Y A;  1YJ9 I;  2KVO A;  2ZME A;  2HQA A;  4MFE A;  3AK5 A;  1ODD A;  1G4D A;  3DKW A;  4EV0 A;  1VTN C;  3LYC A;  3GZ5 A;  4WZK A;  4MXN A;  4ZDP A;  4FXU A;  1U0J A;  1MMG A;  3ZRG A;  1Y1V J;  1HC8 A;  4YZA A;  5IPA A;  2L5Q A;  2JVH A;  1MBG A;  4ZCL A;  1QZE A;  3CP2 A;  3EQO A;  5EJC A;  1SD5 A;  3AGQ A;  3PM1 A;  3BY1 A;  2HQ5 A;  3F72 A;  5E6T A;  4GO1 A;  1Y0N A;  3DLA A;  1P4X A;  3DV8 A;  4I02 A;  5J4Y A;  2FMY A;  1D0Z A;  1P9Q C;  1XSX A;  4QPQ A;  3I1F A;  4K1X A;  4XSZ F;  5C1E A;  4D5F A;  1CQX A;  1ZM2 A;  4OPO A;  4Z4U A;  3C2H A;  4J01 A;  2R4G A;  4GFB A;  3FHN A;  1Y0R A;  4RDK A;  4X1E A;  1O3S A;  1KK1 A;  4TMZ A;  5BPI A;  5J35 A;  2M45 A;  4PC6 A;  3GWZ A;  2D9R A;  2DEU A;  5JMC B;  1WRJ A;  2QEN A;  1SMT A;  2JDI A;  1G6N A;  1S0U A;  1N05 A;  4HE5 A;  1S3J A;  1N8R D;  1UD2 A;  2DYI A;  2IGO A;  1LUJ B;  2QM3 A;  3H36 A;  3ASO H;  1X2N A;  4MQV A;  2BGI A;  5LRR A;  3U6K A;  1Y1W J;  3I0T A;  3OIO A;  3BJ6 A;  1XPX A;  2RC5 A;  4OJO A;  1K5C A;  2G0Y A;  1ENH A;  3H9J A;  1Z91 A;  2DIE A;  2QLZ A;  3ML6 A;  3CJT B;  3WYA A;  2NOG A;  1RIO H;  3BDD A;  3HOY J;  2Y9Y A;  2LP0 A;  4PAB A;  1VF7 A;  2NT6 A;  3VYT B;  2W6I A;  2W85 A;  2ID6 A;  3O2P E;  2R5Z B;  2QMU A;  1MSF C;  1I27 A;  3JTH A;  1FNB A;  5DD4 A;  4HE6 A;  2RGV A;  1J9Z A;  4U7D A;  4OIR F;  3KEO A;  3CC7 I;  4M9S A;  4XLA A;  2R9V A;  1OCT C;  4PJJ A;  1ZRE A;  1XG2 A;  3LQR A;  3AG4 H;  2WR8 A;  1YE9 A;  3MCA A;  1OB2 A;  1FNN A;  5AON A;  5HVQ C;  3ZCO A;  4MFD A;  4P1W A;  1MBH A;  5DS0 A;  4ZV4 A;  1WWX A;  1ZTR A;  4HDU A;  1YX3 A;  2BYV E;  1QVG B;  1BN8 A;  3GQ8 A;  5HDG A;  1F5T A;  4OJL A;  5D4R A;  2CFX A;  4PSW A;  3PIO F;  4M74 A;  1HLV A;  5HS8 A;  1ZH5 A;  1W9X A;  3A35 A;  3ROU A;  2NTP A;  4J00 A;  1K78 A;  5DD8 A;  1IN7 A;  2OZU A;  3M4O J;  2LVS A;  5EZH A;  4V19 K;  3F23 A;  2XT2 A;  1A6I A;  2DMN A;  2L01 A;  4BJT A;  4ZCM A;  4YG2 F;  3J7Z I;  1TUI A;  1HDP A;  2H09 A;  4II3 A;  1MSE C;  1DGR M;  2M7B A;  3NB2 A;  3PSZ A;  5F04 A;  2UZK A;  2QSF X;  5C3E J;  1HF0 A;  1ZRF A;  2ZJP F;  2HZT A;  1G7T A;  4YII A;  1WGX A;  2QVO A;  2F5C A;  1E17 A;  1YIO A;  1X4P A;  5CKT A;  1RKT A;  4JRA C;  1O8G A;  2O0Y A;  3E5U A;  3SFI A;  3CCU I;  1H8H A;  5FLV A;  3Q0W A;  3HBL A;  4LGW A;  2XC7 A;  2GAU A;  5IYB J;  1I6X A;  3I59 A;  4DOZ A;  2VNJ A;  1U8R A;  1TWG J;  2ZXI A;  1IJW C;  4YAW A;  3V8L A;  3ONU A;  3GRH A;  1WSR A;  2NTQ A;  1O7L A;  2KDO A;  2XKP A;  1UB9 A;  2Q0O A;  4LBV A;  3R0A A;  3VNV A;  1EP1 B;  3MWM A;  3OYB A;  1W0K A;  2F2E A;  2VE8 A;  4AYB A;  3KLO A;  2WJV A;  4V02 C;  4QLC U;  4A3D J;  3SQN A;  2QQA A;  4NC6 A;  4XOR A;  4RD6 A;  4UHT A;  5KW9 A;  1FIP A;  4LK0 F;  1QVT A;  3FBN B;  2VBT A;  3OR1 C;  1SEU A;  3PUM A;  2DFH A;  1W34 A;  3TL4 X;  1D1A A;  2TCT A;  1R58 A;  3CUQ A;  4BYY A;  1IUY A;  2R5Y A;  1QBJ A;  3ES9 A;  4Z03 A;  2XKO A;  2NVU B;  1K6O A;  3BJO A;  1ZRC A;  1RET A;  4ESF A;  4PC2 A;  2QSH X;  2Y48 A;  4P22 A;  1EFT A;  4GQN A;  3BTJ A;  3PNY A;  1JXS A;  3OZV A;  5L3B A;  1OCZ H;  2PMH A;  2VPR A;  2LTP A;  4NCN A;  4ZDL A;  1B72 B;  2HCJ B;  1N07 A;  3I4P A;  1GAW A;  4UVA A;  2JPB A;  4A0Y A;  1JGG A;  4ZYH A;  2A61 A;  1TQP A;  5DS9 A;  3D5R C;  1IAW A;  3L2R A;  2ELK A;  1HVX A;  2R3S A;  3J7A Y;  3CPX A;  2ADU A;  1A35 A;  5HXB A;  1T8I A;  3MD2 A;  3P26 A;  3SUC A;  1D1N A;  4DW6 A;  3ZQF A;  1VZ0 A;  3CCL B;  1QFZ A;  1IB0 A;  1KTV A;  1WOO A;  1WU8 A;  1Z67 A;  2EZL A;  3OJX A;  1DGW Y;  4LIV A;  1EFC A;  4B09 A;  1IXS B;  1JHH A;  1F9N A;  1XMK A;  4LFU A;  3SJP A;  3E6D A;  5CVI A;  1LJ9 A;  2X4H A;  3KET A;  2VFQ A;  2KRH A;  4XR6 A;  2JMW A;  1R49 A;  2JZY A;  3TO7 A;  1SFX A;  1HSJ A;  1LVA A;  2E36 A;  2MA3 A;  2L7Z A;  3K4N A;  2M0C A;  5EEG A;  3DLL F;  2BM6 A;  3OZW A;  3SDG A;  2DER A;  4CO8 A;  1V54 H;  1JTY A;  2DCE A;  1T0F A;  4M4S A;  1E1R A;  3M07 A;  1W35 A;  4XLF A;  2H1K A;  1YIJ I;  1PKV A;  1GUU A;  3H3U A;  2X1E A;  1DU6 A;  2RRE A;  3FXU A;  1H8E A;  1U6G A;  2MH9 A;  4JBA A;  1BI3 A;  3D5L A;  4OZZ A;  2XTW A;  2P81 A;  5HOD A;  2LH9 A;  4XLH A;  2JRT A;  2VXD A;  3HKZ N;  2Z1D A;  1EA3 A;  4DYQ A;  4W8Q A;  2YS9 A;  3L2V A;  1EFR A;  3VPR A;  5J47 A;  5LGU A;  2KIS A;  1BQE A;  2LY1 A;  2OJE D;  2P8T A;  4HZF A;  2VBV A;  2HOT A;  1NB0 A;  3M8E A;  3ZPP A;  1USS A;  1R5O A;  1WJA A;  3ASQ A;  1SKQ A;  2WZN A;  3OOP A;  4B48 A;  2KKO A;  4XON A;  1KU9 A;  1Y0Y A;  1YG2 A;  2HVS A;  1R5H A;  4G94 A;  2K27 A;  3KCC A;  4LB6 B;  1BR1 A;  1ELO A;  1VBL A;  2PX9 A;  1JI8 A;  1G7C A;  5HKK A;  1YLF A;  2UVF A;  5IOZ A;  2TDX A;  1OJL A;  4AUX A;  3ZQL A;  1TC3 C;  3QYE A;  2FQ4 A;  5JHF A;  1BR4 A;  4RB1 A;  3A8J A;  3CP8 A;  3I59 B;  2VN2 A;  1V0F A;  4KMF A;  3ZZU A;  1OFM A;  3OOU A;  3K9T A;  2EIX A;  2ZJ2 A;  4OPW A;  4OMZ A;  3RYR A;  4H9G A;  4DNR B;  4CCK A;  1POG A;  2P7V B;  1SD6 A;  2IS2 A;  4HX8 A;  2VFN A;  2JPC A;  3SEZ A;  4I09 A;  3OV8 A;  1XB2 A;  1R5I D;  2NOJ B;  2OQR A;  3QU3 A;  1FNM A;  3KX2 A;  3OEH A;  1J5Y A;  2XOK A;  1QGY A;  5FKL A;  2ZBV A;  1CF7 B;  3IKV A;  5C4X J;  5J8C A;  1XC5 A;  4UVC A;  4YEL A;  2DK8 A;  3JAM Z;  3NAU A;  3G73 A;  3F22 A;  1MMN A;  3QOP A;  5KK1 A;  2V26 A;  4IHT A;  2QSG X;  3OZU A;  1T95 A;  3OYM A;  3M8F A;  3RPU A;  4E70 A;  3LSK A;  4QSH A;  5B66 C;  1WH5 A;  1UCR A;  3SYT A;  3DEW A;  4OOV A;  5B3S H;  4QVA A;  1FP2 A;  2DN0 A;  1DUX C;  4GRI A;  4BEH B;  3WU1 B;  2X48 A;  1DU0 A;  4BY1 J;  3KL9 A;  1T6Y A;  3CLQ A;  5ICG A;  4Y7C A;  1V5E A;  3P27 A;  2JUC A;  2BM4 A;  2DA6 A;  3PSF A;  4M3F A;  1G2H A;  1D5Y A;  3IAS 2;  3E0J B;  5FL7 A;  1O8M A;  1F36 A;  4U87 A;  3IKT A;  3TOB A;  3CCR I;  3ABT A;  3WTY C;  1JTX A;  2ISZ A;  4NBQ A;  4U88 A;  3PO2 J;  3B8H A;  5DM6 F;  5EDN A;  3JRH A;  1GO2 A;  1WZ2 A;  1LNW A;  1SD7 A;  3KP6 A;  4M6Y A;  5JLX A;  1W5C C;  4DYR A;  3CMA I;  3IP4 B;  2ZZQ A;  5TV2 A;  1M1K D;  3MN2 A;  3S2H J;  2R7V A;  4UUS B;  3CCV I;  2VUM J;  3F8C A;  1JA0 A;  2BM5 A;  5L3G A;  3BZ6 A;  1JGS A;  4IZZ A;  5FLM J;  2FRH A;  1I8D A;  1R5N A;  3S93 A;  1XN7 A;  1QFY A;  2C4T A;  5DEQ A;  5IP7 J;  4QV2 A;  4KNY A;  2XF6 A;  1B59 A;  3CF2 A;  1SAX A;  5D5W B;  1YHQ B;  1YW7 A;  2WB1 A;  3AL0 C;  1FRN A;  3KFW X;  3RI4 A;  4M1K A;  4PC1 A;  4QVJ A;  4XIC A;  2YWE A;  1VQ7 B;  2HWV A;  1IC8 A;  3COA C;  3S3N A;  1W0U A;  1BI2 A;  2GOM A;  2EA2 A;  3ZN1 A;  1EZG A;  1MMS A;  1FX0 A;  2R7O A;  2NPF A;  1KON A;  2LBF B;  5E3L A;  3LSR A;  3W2H A;  3PET A;  2Q1Z B;  4X7D A;  3M1E A;  4DQK A;  2QYU A;  5HS9 A;  2GQF A;  3Q3S A;  3E7L A;  3PO3 J;  4PK4 A;  3HJE A;  5KAI C;  3A3B A;  2M5S A;  3REO A;  5IYC J;  1UHM A;  2FNP A;  2K9M A;  3DPU A;  2AQE A;  1BX0 A;  3PJR A;  4W8T A;  2PJR B;  3FZV A;  3OYL A;  3JR9 A;  5IYW A;  1V4R A;  3CDI A;  2E1M B;  1TW2 A;  2VQH A;  5E20 A;  2XT4 A;  3HRS A;  2OTL B;  1MBF A;  3ABU A;  4N9I A;  3VOD A;  2CBX A;  2CQQ A;  2X6O A;  5HS7 A;  4FX4 A;  5KVR A;  2GJR A;  2OK8 A;  2LF8 A;  4RCZ A;  5CVR A;  3A8K A;  1HA3 A;  5IYN A;  4YRV A;  1PUE E;  1UD8 A;  2DOG A;  4YC5 A;  1NJI D;  5ED4 A;  3FMR A;  2HYG D;  2O03 A;  4B44 A;  2FBI A;  5D4S A;  4WXD A;  3GME A;  4AIH A;  5D8L B;  1D8J A;  1Z7L A;  2V7V A;  3SLD A;  1DDG A;  1BN5 A;  2COB A;  4LG0 A;  3ONQ A;  2ZO4 A;  3OMY A;  4HF1 A;  2NXN B;  3E5X A;  2Z9O A;  2UXN A;  3BPV A;  1QGZ A;  4L8J A;  3OYK A;  2AXT C;  4RMN A;  1NH3 A;  1ZM4 A;  1A04 A;  3BH7 B;  2JVG A;  4HLX A;  5FFZ A;  4UNO A;  1TSP A;  4UXN A;  2XNC A;  2X6X A;  2J8I A;  4C0S A;  1QCX A;  2V1U A;  3H5R A;  2ZL5 A;  1FMW A;  2K3F A;  2YX4 A;  4M72 A;  2ELH A;  2KPM A;  3I55 B;  2LDU A;  1RKW A;  4B47 A;  5JLV C;  5HLH A;  3WHC A;  2QGG A;  1EE6 A;  5FO5 A;  2F4O B;  1G8X A;  2JRM A;  2IP2 A;  2CUJ A;  3WGI A;  4RBO A;  2E5N A;  4BXX J;  1X3Z B;  4PMH A;  3FMQ A;  4XRS G;  1XMX A;  4S05 A;  1HKS A;  3CLO A;  3IAM 2;  3GBG A;  3DBH B;  4QHY A;  3ELK A;  1W4M A;  3LSI A;  4MIM A;  3CME I;  3FWE A;  3LSM A;  4KKT A;  3K4L A;  2XEX A;  3JQR A;  2EQR A;  4PJM A;  1NG6 A;  4D9J A;  4LC0 A;  2V1D A;  2VFP A;  1R71 A;  3CJN A;  5EGO B;  2V4D A;  3CCE B;  1IDJ A;  1ZG5 A;  4ESB A;  1SKY B;  4OJ6 A;  1XDU A;  1OGM X;  2OAZ A;  4Q48 A;  4P6V F;  2WYR A;  3F6O A;  1OFD A;  1EV7 A;  3LWF A;  3L2U A;  3CPW B;  3F9K A;  3E5Q A;  2CW7 A;  3CRZ A;  4CYC B;  5HDK A;  1IJF A;  4A0X A;  1QQ1 A;  1WJB A;  3GTK J;  4YIF A;  1MZB A;  1U78 A;  3A01 A;  1IRZ A;  3H9G A;  3FDY A;  1E64 A;  2PJP A;  2WPD A;  1G3T A;  3PFI A;  2Y2Z A;  3B6C A;  3S17 J;  2XZO A;  2PYH A;  1R1T A;  3R6K A;  3K1P A;  4WXC A;  2HLD A;  3CDH A;  3BCB A;  4BPR A;  2EFP A;  3G4S B;  3PFY A;  4PSX A;  2M5W A;  2MAB A;  5FKM A;  4AD9 A;  1QZZ A;  1OFC X;  3VST A;  5EEA A;  5LHH A;  3H94 A;  4TV7 A;  3PUN A;  3CO6 C;  2QZA A;  3PNT A;  2XHK A;  2VNH A;  1R36 A;  1AWC A;  2QGU A;  1LB2 A;  4OIP F;  5GAH J;  2NNY A;  3PNV A;  2OF7 A;  1Z6R A;  2VPL A;  2V31 A;  3HC7 A;  1WQ2 A;  2DDA A;  3GFL A;  2C4U A;  4RD0 A;  1LKX A;  2XPV A;  3RKW A;  5JLW A;  2CV0 A;  3T9G A;  3WTU C;  5FNZ A;  5BQT A;  3DPT A;  2LZJ A;  2QTZ A;  1OCC H;  1XSD A;  3SDB A;  4MQ9 F;  1X19 A;  1KMH A;  3FJO A;  5JHU A;  2HVR A;  2WA0 A;  2XZP A;  4G9Y A;  3SEJ A;  3WE3 A;  1T5E A;  2VYQ A;  1K28 D;  4AID A;  3GTG J;  1O8H A;  2GK6 A;  4Q4Z F;  4X7E A;  5J8F A;  1BMF A;  2E1M C;  2HXI A;  2JTV A;  4HA8 A;  2MLG A;  2M8G X;  3Q5F A;  2W82 A;  3Q0U A;  3C2B A;  2DOD A;  2V6C A;  5HZA A;  2BGJ A;  2K4J A;  2Z99 A;  4GXO A;  5FD5 A;  4HNV A;  1J59 A;  3PVD A;  1OKR A;  4E0F A;  5J1U A;  4LIT A;  4IX7 A;  2L9V A;  2H6C A;  1J0R A;  1E3P A;  4L9J A;  1PJ5 A;  2XF5 A;  1TVC A;  1PLU A;  4UV9 A;  3F0C A;  1MNM C;  4CDG A;  3RY8 A;  3N97 A;  2FE3 A;  1D3Y A;  3ISX A;  2R7S A;  1V5G A;  3DF8 A;  5E3O A;  2CUE A;  4IJA A;  5BOX A;  3P7N A;  2ZNZ A;  1IO2 A;  3HEF A;  4XQF A;  3IRQ A;  1I1S A;  1WCM J;  3DCF A;  2DK5 A;  4I99 C;  3JX8 A;  1YYV A;  1FSH A;  2KDZ A;  1D2E A;  4CYD A;  2F6C A;  3Q0V A;  3GTP J;  3LNN A;  4PGH A;  5F1J A;  2KIF A;  1X2M A;  4II2 A;  3ZN0 A;  1HBX G;  1YHQ I;  2HOE A;  1JE8 A;  1C0W A;  3DXJ F;  2V7F A;  3DQV C;  3CCM I;  3HHH A;  2OYN A;  1Y39 A;  4CCM A;  3DPL C;  1H88 C;  4OAY A;  1LFB A;  2DJN A;  5FA6 A;  1IB4 A;  5EF6 A;  1L3L A;  4UAJ A;  3K1N A;  3P4G A;  2EWN A;  3WHB A;  1GDT A;  3LMM A;  2QXZ A;  2HKX A;  2CUF A;  3GF2 A;  1O3T A;  1FEX A;  3K70 D;  3LST A;  1OCP A;  3M8J A;  4XOT A;  4LLL A;  4C3I J;  4LBZ A;  2TRT A;  2PIA A;  3I54 A;  3BH6 B;  2YWF A;  2WWY A;  4Y52 J;  3GVJ A;  2QEX B;  1O3R A;  1W1W E;  5IP6 A;  1FT9 A;  4OM9 A;  2ME0 A;  4ZTF A;  3I9V 2;  4KN4 X;  5AIP A;  3X2Q H;  1RMG A;  2IXS A;  2R7Z J;  1FND A;  2O0V A;  4RLQ A;  3IC7 A;  1DG1 G;  2B5O A;  1GXP A;  1MAB A;  3KP5 A;  4TN1 A;  2EFQ A;  2ZSH B;  4RPD A;  4X07 A;  5LEK A;  2IA2 A;  4YZ0 A;  4Z4T A;  3BG7 A;  2VBS A;  2O8X A;  4CCO A;  3OS1 A;  1BI1 A;  4PC3 A;  3ASR A;  3K1M A;  3AGP A;  2JSC A;  2OC6 A;  2PFB A;  2ZSI B;  3A03 A;  3LFK A;  4O6J A;  1VQL I;  1WOP A;  3ASP A;  3OOC A;  4JQF A;  3C2G A;  4XL9 A;  2DO7 A;  2RNG A;  2R0Q C;  1UZC A;  1K78 B;  1J9I A;  2VI6 A;  1D8T A;  1I39 A;  3LL7 A;  1A5J A;  4B1R A;  3OW2 B;  3DDY A;  4KT6 A;  1DP7 P;  4EH1 A;  1O8L A;  4P1V A;  1HW1 A;  2LY2 A;  1QVU A;  2MFZ A;  4QPO A;  4AVP A;  4D7N A;  1APL C;  1IGN A;  2FML A;  2FEZ A;  5FLX K;  1KZH A;  2KJB A;  1KK2 A;  4Z4V A;  4A3E J;  2D5V A;  3UR3 C;  4RAG A;  3WTZ A;  2A6H F;  1OFE A;  2IPQ X;  3HZJ A;  4P9F A;  4KIT B;  1VQM B;  2WZP P;  4QIW N;  3L2C A;  6PAX A;  1DP3 A;  4IKF A;  4LK1 F;  3FXK A;  3MKL A;  2GZW A;  4HF0 A;  4V2G A;  1O8K A;  4LBW A;  2F4M B;  2KP6 A;  3W2G A;  1KU2 A;  4XK4 A;  4WXH A;  1ZEL A;  3G2B A;  5E18 F;  1JT0 A;  1JJ8 C;  2Y9Z A;  2EZH A;  1VQP I;  3VDX A;  2CV2 A;  2XND A;  1AIR A;  1JUM A;  2AS5 F;  2PJR A;  2NST A;  2DT7 B;  1JUP A;  4J0Q A;  2GJP A;  3RQ4 A;  1LQ1 A;  1T08 B;  1NRK A;  1R22 A;  5C44 J;  3QPL A;  4IXA A;  3BR3 A;  4ZYE A;  5LRS A;  1JA1 A;  4X7C A;  4A5N A;  3AST A;  4X0C A;  3ULQ B;  3OYE A;  2L3D A;  3OR2 C;  1MJB A;  1U5T A;  5C4J J;  3OIQ A;  1KYW A;  1MIJ A;  2BY2 A;  5EYR A;  2K86 A;  2E1B A;  1H9G A;  1WKM A;  5BSX A;  4ITV A;  1K61 A;  3RJP A;  4HW0 A;  5BS6 A;  4A3B J;  3ZQG A;  2NVX J;  2E7X A;  3W5V A;  2DFF A;  2WAQ N;  1MBK A;  2Y0M A;  4XLC A;  5DCM A;  5FRM A;  1D8K A;  1BHE A;  3SLN A;  4A0Z A;  1HOM A;  1SMY F;  1QUE A;  2W7N A;  5TJJ A;  4G1V A;  3K2Z A;  3LFU A;  4UUT A;  4Y17 A;  4I01 A;  1S7O A;  4C2T A;  2D3L A;  5F0F A;  1R23 A;  2HGC A;  2IS1 A;  4U0W A;  4XM3 A;  4IHY A;  1CZF A;  2PE3 A;  3OSF A;  2BY1 A;  1H8A C;  2M34 A;  1YO5 C;  2X3U A;  4RM0 A;  1B1B A;  1MBE A;  1W7P B;  4CCL A;  3IL2 A;  3J7A O;  4IOC F;  4A3L J;  4M2L A;  3B6A A;  2X1C A;  1Q1H A;  2ZBK A;  4NQW A;  4IQ4 A;  3GX4 X;  3M7G A;  3DU6 A;  3WG7 H;  4RGX A;  2F1M A;  3E1Y E;  2VOP A;  3OYI A;  4A12 A;  2DBB A;  2DA3 A;  1I3A A;  3CW2 A;  4YAO A;  1TLH B;  3QWL A;  4CZZ A;  3DEE A;  3LA3 A;  5EMN A;  1RWR A;  4N0B A;  1HF2 A;  1ZKG A;  2W24 A;  1XQB A;  3KP2 A;  5F4O A;  1IF1 A;  3GVL A;  3I56 I;  2DPD A;  4F52 A;  1VHE A;  2JJ7 A;  4ZZL A;  3PSI A;  3ZMD A;  2GXA A;  1GVJ A;  2XGD A;  3U2R A;  1WOR A;  2LD5 A;  1IN5 A;  3VFZ A;  3CC4 I;  5L46 A;  2VL8 A;  1JJ2 B;  4A3J J;  4YFN F;  3MKY B;  1WJ5 A;  2VAS A;  1ON2 A;  2OU2 A;  3CCQ I;  1CNE A;  2ZB9 A;  1EP3 B;  9ANT A;  1TT5 B;  1ZLJ A;  4P2N A;  4HWV A;  3QFR A;  3FF5 A;  2ZC2 A;  1MJ9 A;  3AG2 H;  3VYS B;  2VBM A;  4M0L A;  3ML3 A;  2FOK A;  1KQS B;  4P3Y A;  3PA2 A;  3K7A J;  1FTT A;  2RAE A;  4FHT A;  4F91 B;  1YS6 A;  4P96 A;  5LGN A;  5DM7 F;  2XAF A;  4FT8 A;  3V7S A;  5D8K B;  2VNI A;  5HLT A;  2CND A;  2QQB A;  2FJ1 A;  2GIV A;  3SY2 A;  3KEY A;  2PMZ A;  2KL4 A;  3IRR A;  1ZN2 A;  3F3X A;  3BCA A;  3FK6 A;  5ICC A;  2NNN A;  1O8D A;  2DAO A;  3MMY B;  4X8I A;  4WZT A;  2HVQ A;  3IHU A;  4XN0 A;  3RKX A;  3KYL A;  1B8I B;  2K9Q A;  4W97 A;  3CXC B;  5D5U B;  2WAQ A;  2KFD A;  2R7F A;  5DSZ A;  3WWG A;  2R6H A;  4Z4W A;  4XSX F;  2EWE A;  3DP7 A;  3H0G J;  2PLF A;  1JTA A;  4B3X A;  1F4K A;  1HKT A;  2Y31 A;  5FGM A;  1K8A D;  1XDS A;  2G9W A;  1FP1 D;  4XLE A;  3AKZ A;  4I0A A;  2A07 F;  1ZRD A;  2WAE A;  3PSS A;  3CO7 C;  3K69 A;  5E8I A;  1VQ9 B;  4QUZ A;  3IH3 A;  4HRI A;  1DQU A;  1OOC A;  4OMY A;  3VYR B;  1NTC A;  4ZCI A;  4A6D A;  1GT0 C;  3GQ9 A;  5EGO A;  5E1X A;  3GUD A;  3WTS C;  1G59 A;  2FOW A;  1T39 A;  3P9C A;  2CRV A;  3SXY A;  4ZYG A;  1DAB A;  3WNC A;  2VNK A;  4XBF A;  3JRG A;  1YJ9 B;  3SQV A;  4BE1 A;  3EYY A;  2OBT A;  3FM3 A;  1X1B A;  2CC2 A;  3VNU A;  2W48 A;  1B72 A;  2L7F P;  4N4O B;  4FK8 A;  2H94 A;  2C5B A;  3P9I A;  2HNH A;  3UNG C;  2ECB A;  4OJP A;  2BOL A;  2P5V A;  1N08 A;  1VQL B;  2OZ6 A;  1X1P A;  1D1C A;  3NQO A;  2FVG A;  2OUM A;  5J3O A;  3B8Y A;  1TP4 A;  4AU7 A;  3QP5 A;  1U9N A;  2CF4 A;  1PP8 F;  5B1B H;  4BAC A;  4F7D A;  2KZG A;  3ZOB A;  3AVT A;  4GGG A;  2G0E A;  2CFO A;  2M7A A;  1KQ0 A;  3CUO A;  1TWH J;  3KP7 A;  1Q9S A;  3ZC3 A;  1YS7 A;  1BJA A;  3TH0 A;  2VJ5 A;  1YJW I;  1JT6 A;  4YFX F;  3HM5 A;  2HDD A;  1XE1 A;  2UVE A;  4RB2 C;  1P4W A;  2XNJ A;  1I3Q J;  1R6R A;  4CYC A;  1GV5 A;  5LHG A;  4B4C A;  1OR7 C;  1QQI A;  1CLW A;  5FFX A;  4WQM A;  3VR6 A;  3HDD A;  4BDZ A;  3JW4 A;  1BW6 A;  4CIC A;  1RNL A;  3AG1 H;  4LD5 A;  3JRB A;  2OD5 A;  3HTS B;  2XAS A;  1FOK A;  2OK7 A;  3ZR8 X;  3CQZ J;  1U9O A;  2W6J A;  3O3K A;  3ZBT A;  5IYQ A;  3GVA A;  3H5A A;  1HCR A;  2R7U A;  3ASS A;  1ZK8 A;  4BHC A;  2B63 J;  2OBP A;  2B7E A;  3E3V A;  4RB3 C;  1GVH A;  3BRO A;  4ASN A;  1LPQ A;  2FUG 2;  3QQA A;  1J7K A;  2I5U A;  4GDF A;  1T6Z A;  2J8K A;  1E0E A;  1KD1 D;  1R5B A;  1BA5 A;  2Q6K A;  1YIT B;  5F6F A;  2IA0 A;  4RS8 A;  2RC4 A;  1K4S A;  3U2Q A;  1VQK B;  3NAR A;  4Y4R A;  1GV2 A;  2VJI A;  3GTQ J;  4EJW A;  5LFA A;  2L9R A;  1XGS A;  4GCV A;  3V8J A;  3J80 Z;  2R7R A;  4C2U A;  4Z4R A;  4EJO A;  2BE5 F;  4N3N A;  1IG7 A;  1YQA A;  2BVM A;  4WF2 A;  3HRT A;  2V7Q A;  1B23 P;  2GOX B;  4DBR A;  4KA4 A;  3LSJ A;  1WOS A;  3CC2 B;  3C18 A;  1ACI A;  1X0C A;  4Q47 A;  2V4J C;  5AMV A;  1KYZ A;  2DMQ A;  3WG9 A;  2GM4 A;  3V8K A;  2JA8 J;  3I4M J;  2EK5 A;  1T6S A;  1ZR4 A;  4WZL A;  2O17 A;  2JWT A;  5FKN A;  4B8X A;  1QX4 A;  1SVM A;  1S7E A;  2BHY A;  2WSS A;  2VKV A;  3UW0 A;  1QA3 A;  1K4T A;  1LE8 A;  2E1C A;  4L0Y B;  2QWW A;  2DYR H;  3WY9 A;  1VND A;  5FLX Z;  2WBM A;  3CMM A;  3CCU B;  3W2W A;  4EM0 B;  5CQE A;  1Y56 A;  4E7H A;  1FLI A;  5H59 A;  3FXO A;  2PEC A;  3K10 A;  4UV8 A;  2BY3 A;  2BM1 A;  3A8I A;  2R7Q A;  4ENJ A;  3A3G A;  1W2B B;  3FXJ A;  2ICW G;  2LLK A;  4CCN A;  3OE7 A;  2VZL A;  3LQ6 A;  3WTT C;  2XGJ A;  2Y0S A;  1I50 J;  2PYG A;  1VQ7 I;  2ZJR F;  5HDN A;  4F7Z A;  3JSP A;  2MH2 A;  1MMA A;  4G8X A;  3KEW A;  5A8A A;  2QF7 A;  2M3A A;  4BEH A;  5IYR A;  3W2F A;  3G6E I;  1Q82 D;  4PFO A;  4HX7 A;  3A02 A;  1V55 H;  4MYU A;  3Q9S A;  3MZH A;  4ACB A;  3CB4 A;  5FB2 A;  2YWH A;  2VIX A;  2IGK A;  4A6E A;  4JYK A;  5F27 A;  1GR1 A;  2XF7 A;  2XAJ A;  1W5S A;  3ABM H;  1N0U A;  4O3M A;  3CC4 B;  2Q6O A;  3WXM A;  3ZBU A;  3FX3 A;  4M9Z A;  4JX6 A;  4R71 A;  2MW8 A;  1VQO I;  2QQ9 A;  2E35 A;  4B3G A;  5E17 F;  4OPV A;  1J2X A;  4TT3 A;  4HG2 A;  4MEY F;  3OS2 A;  4F92 B;  4HPQ A;  5CYV A;  2MBF A;  2CWE A;  1SFU A;  1S4M A;  5IP9 J;  3VMF A;  1TQM A;  2O3F A;  1P7J A;  2KRC A;  2MC4 A;  3EET A;  3W6K B;  1UMK A;  5M5X J;  1AMO A;  3DEU A;  4FIS A;  5EEH A;  1IXR C;  1XMA A;  4B4D A;  5B6I A;  4HDV A;  1LM1 A;  4L5J A;  1E2X A;  2VON A;  1B6A A;  1WSU A;  1W5T A;  1Z1D A;  4JP0 A;  3VMV A;  1WPK A;  4E7J A;  2V5I A;  2DMU A;  2BSA A;  4YFK F;  1Q81 D;  2VBX A;  1HXD A;  2GBY A;  2O5R A;  3SZT A;  3J80 K;  2NRA C;  1G3W A;  2NS7 A;  4MGR A;  3BR5 A;  5LMZ A;  2BM0 A;  2W7Z A;  3H09 A;  3A4C A;  2YR2 A;  3QP6 A;  1Q1V A;  1NHC A;  1IW7 F;  2L54 A;  2UV1 A;  2E34 A;  2WTE A;  4PCQ A;  4LG3 A;  2CV1 A;  3I4N J;  4G1B A;  3VO2 A;  4ON0 A;  4WCG A;  1H89 C;  2GPJ A;  4FX0 A;  1YX5 A;  1WI9 A;  3O6B B;  2M4K A;  3TO9 A;  5K7H A;  1BI0 A;  4XID A;  1YJN I;  1UG0 A;  2WV1 A;  5CJ9 A;  1O57 A;  3HGY A;  3S3M A;  4G6T B;  5J3L A;  1S7A A;  3OYF A;  2NVT J;  4HNT A;  2DA1 A;  2NT9 A;  4MYT A;  2B0L A;  2X6Y A;  1XGO A;  3WTV C;  4M6V A;  1S9H A;  4V2F A;  1AU7 A;  1KK0 A;  4OOS A;  3F6V A;  3A0B C;  1FOY A;  1JUS A;  1OCO H;  2XAG A;  3W2A A;  5L3C A;  4L9N A;  1LDK B;  3S2D J;  3OYJ A;  4I6Z A;  2BF4 A;  1YLO A;  2X9D A;  4IPA A;  4ENN A;  4LG0 B;  4BXU A;  2V1X A;  3KZZ A;  2A6E F;  1LEB A;  1OHH A;  1CQT A;  3S1M J;  4S0H B;  2DOA A;  1W7P D;  3HGG A;  2BHZ A;  2BY0 A;  2LKS A;  3JCU C;  4ZDO A;  4YAL A;  3K4K A;  4O5V A;  4J19 A;  1LLW A;  1WFX A;  1IN6 A;  1SFO J;  3HOX J;  3ABL H;  2NS8 A;  4E7I A;  1H9T A;  4E6K G;  3H35 A;  1NK2 P;  4ZTJ A;  2IS4 A;  2A5W A;  5K7F A;  4PAA A;  2V7X A;  2WAD A;  5CQG A;  5M5W J;  3T56 B;  4M73 A;  4X06 A;  1HA8 A;  3ZQH A;  3E97 A;  2QKL B;  4KUM A;  3BNW A;  2DA4 A;  1ZM3 A;  1MJA A;  5JR3 A;  2VE9 A;  1YOV B;  3BR2 A;  5CVJ A;  4EQQ A;  2F43 A;  4M6X A;  5DUK A;  1PJR A;  2OQG A;  2EIN H;  1MH3 A;  1STZ A;  1MW7 A;  1ULY A;  2KIQ A;  2ID3 A;  3HHG A;  4BQO A;  5LHI A;  1RR8 C;  1KU7 A;  3U21 A;  1J75 A;  1SAN A;  3V42 A;  3LVB A;  2V9V A;  2CW0 F;  3F8M A;  3OL3 A;  3E20 A;  2CG4 A;  3JU4 A;  2VBZ A;  3JRD A;  1DBO A;  1UST A;  2FU4 A;  3LSG A;  1OQY A;  1ZLK A;  2PMU A;  2LBF A;  5GV7 A;  5H2F C;  3HTU A;  1F60 A;  2HTS A;  3LMW A;  3PUF A;  5KHD A;  1PXZ A;  1EKE A;  2STW A;  3Q6R A;  2P4W A;  2DTZ A;  1VQ6 B;  3WGH A;  2HPI A;  5IT3 A;  2YPR A;  5J40 A;  1LFU P;  2P6T A;  3NE5 B;  1MGT A;  3KPH A;  5CVV A;  4UB8 C;  4D5C A;  3KEQ A;  4TKO B;  1S72 I;  3VOE A;  4B3A A;  2QN6 A;  3AVY A;  2DU9 A;  3BP8 A;  4JMQ A;  5B1A H;  1VQK I;  1ITY A;  1ON1 A;  2OPT A;  2VQG A;  5H5J A;  3IH4 A;  1H42 A;  1TYV A;  3F8N A;  4BXF A;  1PVE A;  4YAU A;  1Z0X A;  3DBL B;  2IS6 A;  1IHM A;  1E62 A;  4Y13 A;  4BUP A;  2QYO A;  1VQ8 B;  2WB1 N;  2CRG A;  3L09 A;  1JB9 A;  5E3M A;  4MTD A;  4RAY A;  1EH6 A;  2DFI A;  2MG4 A;  2VKH A;  2D3N A;  3CCV B;  1AHD P;  1NB9 A;  3CCS I;  3VO1 A;  3OYH A;  5A88 A;  1XCB A;  4A5M A;  1QZY A;  4NNJ A;  1ETV A;  4AYB N;  3BCD A;  1MBJ A;  1S5L C;  2OCE A;  3HOS A;  2DTR A;  2Q8K A;  4XLP F;  2NV4 A;  2JSP A;  3NEU A;  4MTE A;  2JIZ A;  4IRH A;  2LC2 A;  4XKV A;  1IV8 A;  2I8D A;  4YZQ A;  3ZMU A;  2X0K A;  5JFR A;  3VMW A;  1BL0 A;  2XB0 X;  4CUG A;  2E7W A;  2CYY A;  4RLF A;  2NSP A;  1P7I A;  1YW9 A;  4EGY A;  1BC7 C;  3OPO A;  5K1Y A;  5IK2 A;  1PYV A;  3GTO J;  2Y0S N;  2VT2 A;  1IZ1 A;  2L2O A;  5CLS A;  3L2W A;  2F3L A;  1T33 A;  4FE7 A;  4BGD A;  1RQP A;  1SC7 A;  4P5O A;  3CMA B;  5ICE A;  2L7M P;  3OW7 A;  1TWF J;  1CF7 A;  2VBK A;  2ETH A;  1PUF B;  3ERE D;  4LMY A;  2FBK A;  3VSL A;  1QPM A;  4BQA A;  1MRZ A;  2R7W A;  4RJL A;  1Z9C A;  3T8R A;  1CNF A;  1NK3 P;  1E3O C;  1QPI A;  2E5Z A;  2KZV A;  3L9F A;  2ESN A;  2MYS A;  4HEA 2;  3JRA A;  2EFW A;  5KAF C;  2OTL I;  3BR6 A;  1UHS A;  1U8B A;  2H6B A;  1LFP A;  3ZGK A;  4XRS A;  2I1L A;  3HOU J;  3HUG B;  2K85 A;  3G1O A;  5THX A;  2R7X A;  5K5O A;  5AIQ A;  3V7A A;  2KIU A;  2Z8G A;  1X4O A;  3EPZ A;  3JRE A;  1O3Q A;  4IRI A;  5M5Y J;  4KDP A;  2FX3 A;  3VSU A;  1QA2 A;  1YW8 A;  3M1C A;  4EGZ A;  5KNL A;  3AVU A;  2QDX A;  2IGM A;  2I10 A;  3OS0 A;  2KMU A;  5H6Q A;  3WGG A;  1K4Z A;  2X51 A;  2RVC A;  2BW3 A;  1MKM A;  1E79 A;  2MC3 A;  4Y33 A;  2R92 J;  4BQQ A;  2R7T A;  5LEJ A;  3CD6 B;  2AXL A;  3ZMZ A;  1FIA A;  2DA2 A;  5EZG A;  4RD3 A;  3DKY A;  3AVX A;  2QQ8 A;  2MLK A;  4RAZ A;  3LJY A;  2MGQ A;  4FWT A;  1O8F A;  2VOD A;  2JQ7 A;  1FBU A;  2VBU A;  2P0W A;  1VJS A;  2C6Y A;  4ZGN B;  4DGW B;  2OCC H;  3OIP A;  3EUH A;  4YEI A;  2PN6 A;  5D5X B;  3PEN A;  3H5N A;  1IRG A;  3B90 A;  4RGU A;  3J7Y J;  4N3G A;  2FXA A;  4EM2 A;  3RKQ A;  4M71 A;  1M1E B;  4EJV A;  2DYS H;  1VLO A;  3BR1 A;  4KYW A;  3VB2 A;  1SFK A;  1UJ8 A;  2E1N A;  2M0M A;  5DN6 A;  2GA1 A;  2LG4 A;  1CGP A;  2O1D A;  1QRC A;  2EIL H;  3WU0 A;  1MDM A;  2E2J J;  4MR0 A;  3VWB A;  3GZN B;  2K5C A;  2XPW A;  3MAJ A;  1ZGJ A;  2K40 A;  3RKY A;  1O4X A;  1BLI A;  4IQJ A;  3HUG A;  4XKW A;  3LNQ A;  5E79 C;  4TMV A;  4XD7 A;  4AF6 A;  2BN4 A;  3MFK A;  3K4M A;  4XRM A;  4M3G A;  4G7O F;  5IT9 Z;  1IJE A;  3HKZ A;  1OB5 A;  1FWZ A;  3M3Y J;  3R0J A;  1WP6 A;  1VQN B;  3OY9 A;  3KP3 A;  1AIP A;  1UD5 A;  3FHZ A;  3JRC A;  4U0V A;  2UXX A;  5H20 A;  2F5F A;  1DDI A;  5F4M A;  1VF9 A;  3ZXS A;  3PQJ A;  4DNT B;  1E1Q A;  3I53 A;  2Q2E B;  2YUS A;  4G7Z F;  2YU9 J;  2GXB A;  3V7R A;  1T98 A;  5EG0 A;  3MMP A;  5E8G A;  3TW7 A;  1HST A;  2LNB A;  3EQL F;  1FMV A;  1G3Y A;  1D0X A;  3DBR B;  3T0Y A;  1JJ6 C;  2ZTG A;  3V7C A;  3CC7 B;  4U7B A;  3EDP A;  4K2E A;  3B73 A;  5FIU A;  4XN3 A;  2XGX A;  4R79 A;  1KJZ A;  4M53 A;  2DQL A;  4NK6 A;  1WJD A;  4CZC A;  2H1L A;  4TMW A;  4LBY A;  3RPU D;  3HOT A;  1VQ4 I;  4W8S A;  1FPQ A;  4HYE A;  4PJ0 C;  1W0T A;  1XD7 A;  1FOW A;  3IUO A;  1E3X A;  4XRF A;  4D1Q A;  4RCY A;  2XIG A;  4AVZ A;  1I7P A;  2OTJ B;  2BXY A;  2R7D A;  1FOX A;  1OR7 A;  4ROX A;  4BAY A;  3U6B A;  4Z05 A;  3ZQI A;  1VLY A;  5A89 A;  1BJK A;  1I18 A;  2KJC A;  1BOB A;  2HDC A;  4KH3 A;  3JSO A;  3KYD B;  2ZL6 A;  1ZR2 A;  5IYD J;  3ONY A;  1O8J A;  1ETX A;  3RPQ A;  1IDK A;  3SZE A;  4HF2 A;  4YIR X;  1X3W B;  1R4M B;  4C3J J;  3KRG A;  2V7W A;  1VFC A;  4ZYA A;  4YDT A;  2X8K A;  1QRY A;  3RYP A;  2E1O A;  2O7O A;  4CCJ A;  3W5H A;  1EXM A;  3OYN A;  3O8G A;  3BQZ A;  2H8R A;  3FXR A;  1QGP A;  3AVV A;  1FY7 A;  2JT1 A;  3FKI J;  2P6S A;  3ABK H;  3DWL E;  3OL4 A;  2H27 A;  4P55 A;  2M9H A;  5BPD A;  5D6E A;  3GO5 A;  4Z4Y A;  2F1L A;  2F4N A;  2BGC A;  3VSK A;  2B0R A;  2BZT A;  4IRG A;  4GYG A;  2VT3 A;  2PBI A;  2BXZ A;  4LIU A;  2XSD C;  3EQN A;  2ME6 A;  3S1N J;  1FC3 A;  3HL2 A;  1ZAO A;  3R60 A;  1OPC A;  1U2R A;  2P5K A;  1WPC A;  1DBG A;  3RQI A;  1IDZ A;  5FRO A;  4QWQ A;  4RDJ A;  1BJZ A;  5FO1 A;  2DJI A;  3LQQ A;  2EH3 A;  4CHU A;  2LK2 A;  3PIP F;  1T0F C;  3EUA A;  2NVQ J;  3BTL A;  3I56 B;  2HMA A;  1HZE A;  2BW3 B;  1R7J A;  1VQ8 I;  3BY2 A;  5D6F A;  1R5G A;  1EF4 A;  2DI3 A;  3W6J B;  1TYW A;  4ZC3 A;  2HU9 A;  5FO0 A;  1K9M D;  4EVI A;  2LR8 A;  5CPR B;  2QKM B;  1G7S A;  4PDK A;  2LMD A;  3Q9V A;  3BWG A;  3A01 B;  4C43 A;  3CCS B;  1L1I A;  1XG1 A;  3U9G A;  1WVR A;  2HYJ A;  2GIZ A;  2JA5 J;  3NWS A;  4WWC A;  3MKZ A;  3ERM A;  4G6Q A;  1I5Z A;  3E1S A;  3BCF A;  1EH7 A;  5CDF A;  2IOU G;  2R93 J;  3GQA A;  2ZZE A;  2QZ8 A;  5L3D A;  4Z1M A;  1KA8 A;  1U5T B;  4OWR B;  4G6I A;  2M1B A;  4AC9 A;  3D5S C;  3SFZ A;  4AM3 A;  3HB9 A;  1E3H A;  3CCL I;  3KLN A;  4JX5 A;  2XZL A;  3RZO J;  2Y75 A;  2VBW A;  1EP2 B;  4OP7 A;  5J1R A;  2KIM A;  3KIO A;  3WTX C;  1KCD A;  3FM5 A;  2XDV A;  3UKG A;  2YSR A;  4KIS A;  1OFL A;  4Y9U A;  3U1D A;  4G12 A;  1RUO A;  4DK1 A;  2DXI A;  2QTL A;  3S14 J;  5HNF A;  1XS9 A;  3OWT A;  1QU3 A;  1Z3Y A;  3HSE A;  3BJA A;  1RUN A;  2V1N A;  1O8E A;  1BBY A;  4PGG A;  3FXL A;  5L3E A;  4MLO A;  1GJR A;  5HLI A;  3G71 I;  4U49 A;  1RU4 A;  2HS5 A;  4ZH4 F;  1T56 A;  3CUQ C;  3TBI A;  5FRN A;  4ENM A;  5LGT A;  1TL8 A;  2ZNY A;  3DKX A;  3B4N A;  1HG8 A;  3RZD J;  3G05 A;  2WV0 A;  3W2V A;  1GLN A;  2O04 A;  1GVD A;  2E19 A;  2RQQ A;  3BQJ A;  2XPU A;  1SVO A;  3PUB A;  1V3F A;  2ZFU A;  1IA5 A;  2EIM H;  5FJ8 J;  1XB4 A;  2DPU A;  1WJF A;  1JNY A;  4P9S A;  4EM1 A;  2EZI A;  2BPO A;  2P7C B;  4HV5 A;  3CCJ B;  4Z06 A;  4OU0 A;  1OIS A;  1ZYR F;  5J4V A;  1FYK A;  1L0O C;  4RD1 A;  5F64 A;  3KE2 A;  1EWY A;  2M8E A;  2C5H A;  4RB0 A;  2PLY A;  4PZJ A;  2QE7 A;  3HOW J;  3IV5 A;  4NK8 A;  4BNC A;  4E7Z A;  3I3L A;  1Z6T A;  1X58 A;  2XVC A;  2CGP A;  2P3M A;  2V7U A;  3QSY A;  1S8N A;  2LSO A;  2L9N A;  4IHS A;  3BTI A;  1LE8 B;  1S6L A;  3P5J A;  3Q3A A;  1NBM A;  2WC2 A;  3L1P A;  1XGN A;  2FBH A;  3MZ8 A;  1YIJ B;  3BC8 A;  4HST A;  1G7R A;  4NHJ A;  1GHC A;  5DCF A;  4L9T A;  2M2E A;  5K5R A;  1BR2 A;  3WND A;  1O7F A;  3NRV A;  1QO0 D;  4I0B A;  4XOP A;  1SM4 A;  3HIF A;  4MO7 A;  2RV8 A;  1JKO C;  1B8I A;  2E1R A;  3QFC A;  1P4M A;  1WSV A;  4FET A;  1XTA A;  2EFN A;  4BL0 B;  1FZP B;  3SJM A;  2O9L A;  2JA2 A;  2CW5 A;  3O8H A;  3V76 A;  2MD0 A;  4DNC A;  2RN7 A;  4BBR J;  3WOD F;  4Y3O A;  3OYD A;  3B02 A;  1BX1 A;  2BV3 A;  4H4K C;  2PI0 A;  3I71 A;  1KRH A;  3JTG A;  2VLA A;  1RI7 A;  1W36 C;  2RQP A;  2JJ1 A;  1H0M A;  3GW2 A;  4Q7J B;  4HQM A;  2CW8 A;  1QA6 A;  2DA7 A;  1Y6I A;  3GQB A;  1N75 A;  2VKD A;  2WY8 Q;  3WU2 C;  2R5Y B;  3CUQ B;  2JA6 J;  4ZGQ B;  4KMU X;  5C1C A;  4ANJ A;  3KZY A;  3HAG A;  2YWG A;  2ZXH A;  4A93 J;  1H80 A;  3HSR A;  2AHQ A;  1YIT I;  4OAZ A;  5L3F A;  4R1H A;  2CO5 A;  4HAM A;  1TWA J;  2DMP A;  2IGN A;  4I98 B;  3OYG A;  3ZP5 A;  1W0J A;  4FE4 A;  3ZQQ A;  3MHP A;  4CQJ A;  1VQ4 B;  4RAF A;  4UB6 C;  2Z33 A;  2HEO A;  3GYH X;  2XGE A;  3L7W A;  3C3W A;  1VQP B;  2INV A;  3ZSC A;  1XCV A;  2WAF A;  3BLY A;  2L4A A;  3ECH A;  1IRX A;  5F0H A;  2OTJ I;  2CQX A;  1OMI A;  2VBE A;  3N6Z A;  2VKE A;  2DOF A;  3S15 J;  1NG7 A;  3MVP A;  4KIF A;  1ZQ3 P;  1KQ5 A;  1FX7 A;  1T38 A;  1B4A A;  2C77 A;  1K8F A;  2YUH A;  4RGS A;  2HTJ A;  5TGT A;  4BH9 A;  2D45 A;  4Y9R A;  4NB5 A;  4EJT A;  4XKB A;  1V5V A;  1AKH B;  2RKH A;  2BVL A;  2RC6 A;  1OYW A;  3SKB A;  3SZP A;  1RRJ A;  1ZG3 A;  3TP0 A;  3TW6 A;  3BZC A;  4BHB A;  4KKS A;  3W2I A;  5BMZ A;  2MD5 A;  2B7B A;  2KT0 A;  2VFO A;  1Q86 D;  2DLL A;  3AL0 B;  2IAI A;  2CS3 A;  2ZZG A;  1DPR A;  3GLX A; 
#chains in the Genus database with same CATH homology
 2X3H A;  3S3M A;  4G6T B;  4CA0 A;  3AFH A;  1PE9 A;  3OYF A;  3A1Y A;  4HNT A;  2KVO A;  2HQA A;  3CJQ B;  4E0F A;  2NT9 A;  2F5V A;  2CK3 A;  3H0D A;  2X6Y A;  4LIT A;  4IX7 A;  4MXN A;  4ZDP A;  4FXU A;  1MMG A;  1S9H A;  1U0J A;  3ZRG A;  4YZA A;  2L5Q A;  1UAA A;  2JVH A;  2XF5 A;  3W3C A;  3W2A A;  3EQO A;  3CP2 A;  3EUH C;  2ZTN A;  2ZZF A;  1PLU A;  1LDK B;  3OYJ A;  2VQC A;  4B3F X;  3HPG A;  3VYU B;  3DLA A;  1OHH A;  1D0Z A;  1P9Q C;  4QPQ A;  2R7S A;  2UWM A;  5C1E A;  1V5G A;  2DOA A;  1WMR A;  3C2H A;  4J01 A;  2KQR A;  2R4G A;  3FHN A;  3K6G A;  3K4K A;  4DIQ A;  4XQF A;  2VQL A;  2Z2S B;  4ZDO A;  3FPP A;  1WFX A;  3S8P A;  4OJ5 A;  4E7I A;  2IS4 A;  4E6K G;  3H35 A;  4ZTJ A;  2A5W A;  2JDI A;  2F6C A;  3LNN A;  2WAD A;  5CQG A;  1UD2 A;  4II2 A;  3T56 B;  4EW9 A;  2IGO A;  1HA8 A;  3OFN A;  3DTK A;  2V7F A;  2QKL B;  3DQV C;  2LRD A;  3BG6 A;  4CCM A;  3OAA A;  4OJO A;  3DPL C;  4C2L A;  2F43 A;  1K5C A;  1PJR A;  4OAY A;  1MW7 A;  1Z21 A;  2K9L A;  3H9J A;  4BQO A;  1IB4 A;  1N77 A;  2DIE A;  1D1B A;  4N4N B;  3U21 A;  1WJC A;  3V42 A;  2NT6 A;  3LMM A;  2QXZ A;  2Z16 A;  2Z6B D;  1VF7 A;  1OLT A;  2DT6 A;  3VYT B;  3K70 D;  3OL3 A;  2W6I A;  3PL8 A;  3JU4 A;  3M8J A;  4XOT A;  1DBO A;  1N78 A;  2X85 A;  3GVJ A;  2QX3 A;  3LSG A;  3MKW B;  2LBF A;  3LMW A;  4XLA A;  5KHD A;  2R9V A;  4PJJ A;  1PXZ A;  1XG2 A;  2X6W A;  4E4H A;  1YE9 A;  4ZTF A;  3I9V 2;  1RMG A;  2HPI A;  3NE5 B;  2IXS A;  4F55 A;  2CMP A;  2XAU A;  4RLQ A;  5HVQ C;  3ZCO A;  2O0V A;  4P1W A;  1WTH D;  4B43 A;  4TKO B;  1MAB A;  4YXW A;  3K4C A;  1YX3 A;  2ZSH B;  1BN8 A;  3GQ8 A;  4JMQ A;  2X1D A;  4YZ0 A;  4DJA A;  4OJL A;  3B90 A;  4PSW A;  3A35 A;  1W9X A;  3BG7 A;  2VQG A;  4W8R A;  4CCO A;  2NTP A;  3OS1 A;  4J00 A;  4XMY A;  3S3O A;  1KZL A;  2OC6 A;  2ZSI B;  4BXF A;  3VSV A;  3OOC A;  2NTB A;  4JQF A;  3C2G A;  4XL9 A;  2IS6 A;  4BUP A;  2RNG A;  4BJT A;  2HDW A;  4PJL A;  4II3 A;  1DGR M;  2M7B A;  3LL7 A;  2VKH A;  4RM2 A;  4KT6 A;  2D3N A;  3DDY A;  1O8L A;  2LY2 A;  2W1O A;  2MFZ A;  4QPO A;  4U4B A;  1UG0 A;  5CKT A;  1X4P A;  3OYH A;  4CH7 A;  1O8I A;  4NNJ A;  1O8G A;  3BCD A;  3HOS A;  1H8H A;  2JSP A;  3S32 A;  2XC7 A;  2JIZ A;  2LC2 A;  3CZ6 A;  4XKV A;  2I8D A;  4DOZ A;  3UR3 C;  4YZQ A;  2ZXI A;  3GRH A;  3SZG A;  3VMW A;  2NTQ A;  2KDO A;  3L2Q A;  4CUG A;  4KIT B;  3QYB A;  4RLF A;  2A6T A;  2NSP A;  2WZP P;  2WY7 Q;  3OYB A;  1DP3 A;  1W0K A;  4IKF A;  3OPO A;  5IK2 A;  4AYB A;  3FBI B;  1PYV A;  3BC9 A;  2WJV A;  1O8K A;  2KP6 A;  3L2W A;  2L2O A;  1UEL B;  1MNE A;  4XOR A;  4BGD A;  1ZEL A;  3G2B A;  4P5O A;  3OW7 A;  2VBK A;  3FBN B;  2NZM A;  3VDX A;  3OR1 C;  2CV2 A;  2XND A;  3VSL A;  4FAS D;  1AIR A;  2R7W A;  2PJR A;  3TL4 X;  2NST A;  1D1A A;  4Z03 A;  2DT7 B;  2M4G A;  3RSN A;  2E5Z A;  2KZV A;  2GJP A;  3RQ4 A;  2MYS A;  4HEA 2;  1KCC A;  4P22 A;  4GQN A;  1NRK A;  3PNY A;  3DTE A;  2WJY A;  3T51 B;  1LFP A;  3ZGK A;  4CSW A;  2UUZ A;  3HUG B;  4UZU A;  4ZDL A;  2R7X A;  3OYE A;  3OR2 C;  2Z8G A;  3OIQ A;  1X4O A;  3EPZ A;  3H9Q A;  2E1B A;  3VSU A;  3M1C A;  1J09 A;  5KNL A;  4ITV A;  4BE2 A;  2IGM A;  3OS0 A;  1HVX A;  3WQZ A;  3D5R C;  2KMU A;  3L2R A;  3J7A Y;  2X51 A;  1W36 D;  4XLC A;  2BW3 A;  1E79 A;  5FRM A;  3MD2 A;  4Y33 A;  3SUC A;  4BQQ A;  2R7T A;  1BHE A;  2F4I A;  1OGO X;  1VZ0 A;  2W7N A;  3LFU A;  3DKY A;  3RTR A;  5HNH A;  1BPL A;  1O8F A;  4C2T A;  2D3L A;  1TT0 A;  1DGW Y;  4LIV A;  2IS1 A;  2BSP A;  4XM3 A;  1CZF A;  2P0W A;  1VJS A;  4DGW B;  1WJE A;  3OIP A;  3GQ7 A;  4KKU A;  4CCL A;  3H5N A;  2KRH A;  3FKJ A;  4XR6 A;  2VJJ A;  2X1C A;  4NUB A;  4IQ4 A;  2HPM A;  3K4N A;  3DU6 A;  2XSJ C;  2F1M A;  1SFK A;  1TZL A;  1QHH D;  2V6E A;  2M0M A;  1E43 A;  5DN6 A;  2DCE A;  3TMO A;  2LG4 A;  3OYI A;  2O1D A;  1E1R A;  4EAT A;  4XLF A;  4BQN A;  1PKV A;  2X1E A;  3VWB A;  4HNU A;  1BLI A;  2K5C A;  2VXZ A;  3DEE A;  4IQJ A;  2RRE A;  4XKW A;  4XD7 A;  1RWR A;  1H8E A;  3D5L A;  3K4M A;  4OZZ A;  3HKZ A;  1WP6 A;  4URR A;  2LH9 A;  4XLH A;  2VXD A;  3OY9 A;  2Z1D A;  1EA3 A;  1UD5 A;  3GVL A;  4BS9 A;  4W8Q A;  3L2V A;  4F52 A;  1EFR A;  2GK7 A;  2E60 A;  3QYF A;  3ZXS A;  3PSI A;  4DNT B;  1E1Q A;  2LY1 A;  2Q2E B;  3CJR B;  3ZPP A;  3ZIA A;  3ZPN A;  1WJA A;  2VL8 A;  4X0G A;  4B48 A;  3MKY B;  4XON A;  1WJ5 A;  2VAS A;  2HVS A;  2ODL A;  4F93 B;  1FMV A;  1VBL A;  1D0X A;  2ZTG A;  1BR1 A;  2IQ7 A;  4HWV A;  4U7B A;  2O0W A;  1JI8 A;  3VYS B;  1Z3X A;  5HKK A;  2HZD A;  2VBM A;  2UVF A;  4XN3 A;  4R79 A;  1QJV A;  4NK6 A;  1WJD A;  4CZC A;  3QYE A;  4F91 B;  3K4B A;  4BU2 A;  3RPU D;  3HOT A;  4W8S A;  5JHF A;  1BR4 A;  1OFM A;  3CP8 A;  5HLT A;  4MR0 A;  3IUO A;  3OOU A;  3KEY A;  4NC7 A;  1E3X A;  4D1Q A;  2PMZ A;  2KL4 A;  4AVZ A;  3BCA A;  1UD4 A;  4DNR B;  4CCK A;  3FY3 A;  1O8D A;  2IS2 A;  4Z05 A;  3MMY B;  1VLY A;  1I18 A;  2HVQ A;  4XN0 A;  2W4S A;  3SEZ A;  3KYL A;  3EUK L;  1BOB A;  3DTI A;  4PUS A;  1MND A;  2NOJ B;  1O8J A;  2WAQ A;  4RM3 A;  3WWG A;  3KX2 A;  3OEH A;  2XOK A;  1IDK A;  2EWE A;  3GVK A;  1KTW A;  1JTA A;  4B3X A;  3KRG A;  4YEL A;  1X1C A;  2L7K A;  4ZYA A;  1MMN A;  2V26 A;  2X8K A;  1T95 A;  4CCJ A;  4XLE A;  4BJ6 C;  3AKZ A;  3OYM A;  3LSK A;  2WAE A;  1OB0 A;  3OYN A;  1V0E A;  3SYT A;  1E3Z A;  4GRI A;  4BEH B;  2KHM A;  4HRI A;  1DQU A;  1OOC A;  3VYR B;  3DWL E;  3OL4 A;  3GQ9 A;  1V5E A;  1QHG A;  3PSF A;  4HSR A;  1G59 A;  3IAS 2;  4G7W A;  3LSH A;  3VSK A;  3HG9 A;  3E0J B;  2OV7 A;  2JUG A;  4U87 A;  5FL7 A;  4LIU A;  1O8M A;  3EQN A;  4NQW B;  3HL2 A;  4BE1 A;  1X1B A;  4XNF A;  4N4O B;  1WPC A;  3IP4 B;  2ZZQ A;  1DBG A;  1ERD A;  5FRO A;  2HNH A;  3UNG C;  2R7V A;  2DJI A;  4OJP A;  2BOL A;  2CH0 A;  3OYA A;  1D1C A;  3K4J A;  3B8Y A;  1T0F C;  2OUM A;  3EUA A;  4IZZ A;  4AU7 A;  4KJZ A;  4BAC A;  1HZE A;  2BW3 B;  1I8D A;  2M7A A;  2CFO A;  3S93 A;  3RCO A;  2XF6 A;  3HPH A;  2HU9 A;  3CF2 A;  4ZC3 A;  2VJ5 A;  2K3P A;  3T53 B;  1AA7 A;  2QKM B;  5CPR B;  4BE0 A;  3AL0 C;  2WB1 A;  2UVE A;  2LOO A;  1R6R A;  3NWS A;  3MKZ A;  1UD6 A;  1OR7 C;  3S3N A;  4OZY A;  3E1S A;  3BCF A;  2GOM A;  5CDF A;  3VR6 A;  3GQA A;  4BDZ A;  1FX0 A;  2R7O A;  2ZZE A;  1KON A;  2LBF B;  4Z1M A;  1LVK A;  2Q1Z B;  4BDY A;  4PJN A;  4OWR B;  4G6I A;  3D5S C;  3ZR8 X;  4ZJZ A;  4PK4 A;  3A3B A;  2M5S A;  2XZL A;  2W6J A;  1COW A;  2K9M A;  2AQF A;  2AQE A;  3DPU A;  3H5A A;  3QOD A;  3K70 C;  3PJR A;  2R7U A;  4W8T A;  1KCD A;  2PJR B;  2XDV A;  3OYL A;  4KIS A;  1OFL A;  2E1M B;  2VQH A;  3N05 A;  4DK1 A;  2DXI A;  2W00 A;  2FUG 2;  4C30 A;  5HNF A;  1SAU A;  4C9Y A;  2X53 S;  1E0E A;  2GJR A;  3OWT A;  1QU3 A;  1Z3Y A;  4F3Q A;  1X1A A;  2V1N A;  1O8E A;  4YRV A;  1UD8 A;  4MLO A;  4U49 A;  4Y4R A;  1RU4 A;  2VJI A;  2V9K A;  4B44 A;  5LFA A;  3TBI A;  5FRN A;  2R7R A;  4C2U A;  3DKX A;  2L9S A;  1HG8 A;  3B4N A;  1Z7L A;  3G05 A;  3W2V A;  1GLN A;  2O04 A;  2RQQ A;  2BVM A;  3ONQ A;  3OMY A;  2V7Q A;  2GOX B;  3QOE A;  3PUB A;  2ZFU A;  4DBR A;  1IA5 A;  1X0C A;  4G7X A;  1WJF A;  2V4J C;  5AMV A;  1X1D A;  1V0F A;  4Z06 A;  4L8J A;  3OYK A;  4RMN A;  2JVG A;  2O17 A;  2X6X A;  4JOM A;  1QCX A;  3H5R A;  3BH4 A;  1FMW A;  1JRG A;  2QE7 A;  2KPM A;  2WSS A;  3UW0 A;  4NK8 A;  4B47 A;  1O88 A;  4E7Z A;  1EE6 A;  3I3L A;  5KCM A;  1G8X A;  2CUJ A;  2LRE A;  2WBM A;  2E5N A;  2L9N A;  3CMM A;  3W2W A;  4PMH A;  5CQE A;  1Y56 A;  4E7H A;  4E7L A;  5LD2 C;  3JUR A;  3IAM 2;  1NBM A;  3GBG A;  4XKC A;  2PEC A;  3K10 A;  4KKT A;  3BC8 A;  1MMD A;  2R7Q A;  3LSI A;  4HST A;  3DU5 A;  3LSM A;  3A3G A;  1D0Y A;  3K4L A;  4CCN A;  3OE7 A;  4PJM A;  3A2K A;  1BR2 A;  1NG6 A;  2XGJ A;  4D9J A;  2Y0S A;  2PYG A;  2CUZ A;  4ASU A;  4XOP A;  2V4D A;  3OEE A;  1IDJ A;  1MMA A;  3NWT A;  3KEW A;  1SKY B;  4OJ6 A;  2M3A A;  4FET A;  2VJ4 A;  4BEH A;  4BL0 B;  1OGM X;  2JA2 A;  2MD0 A;  4PFO A;  1UD3 A;  3L2U A;  3OYD A;  3F9K A;  4Y3O A;  1K6Y A;  2CW7 A;  4H4K C;  4E7K A;  3FKS A;  2VLA A;  1WJB A;  4BJ5 C;  4YEJ A;  4TSF A;  1W36 C;  4DBQ A;  4HIZ A;  2JJ1 A;  2VIX A;  2IGK A;  3CES A;  3FDY A;  3H9G A;  4DK0 A;  2WPD A;  3HXL A;  2XF7 A;  2CW8 A;  1V5F A;  2XZO A;  1Y6I A;  3GQB A;  1GQ8 A;  1N75 A;  2VKD A;  2WY8 Q;  2PYH A;  4E7S A;  2HLD A;  4B3G A;  3BCB A;  4I84 A;  4ANJ A;  5C1C A;  3HAG A;  4TT3 A;  2ZXH A;  4HG2 A;  2LYC A;  1H80 A;  3OS2 A;  3PFY A;  4HPQ A;  4PSX A;  4F92 B;  2MAB A;  4OAZ A;  3SEQ A;  3VST A;  2IGN A;  3OYG A;  4YZX A;  5HOO A;  3H94 A;  1W0J A;  3ZQQ A;  2KRC A;  2MC4 A;  2VB6 A;  3PNT A;  2ELJ A;  4NC8 A;  4PFP A;  2JJ2 A;  2QY1 A;  2INV A;  3PNV A;  3ZSC A;  2WAF A;  3BLY A;  2VPL A;  2V31 A;  3HC7 A;  3VMV A;  1IRX A;  4E7J A;  2GJK A;  1LKX A;  2CV0 A;  2VBE A;  3T9G A;  2O5R A;  1NG7 A;  2INU A;  3DPT A;  2LZJ A;  2KLO A;  3A4C A;  5TGT A;  3SDB A;  1X19 A;  1KMH A;  2HVR A;  2WA0 A;  1NHC A;  2XZP A;  2UV1 A;  4XKB A;  1T5E A;  2BVL A;  1K28 D;  4LG3 A;  2CV1 A;  1O8H A;  2GK6 A;  4KKS A;  1BMF A;  1YX5 A;  2M4K A;  2E1M C;  3OYC A;  3AL0 B;  2CS3 A;  2ZZG A;  2W82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...