2X6XA

Tailspike protein mutant d339n of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN HK620
total genus 235
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6xA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6xA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6xA02
2X6WA 1QJVA 1BN8A 4XM3A 4Z03A 3UW0A 2Z8GA 1OGMX 4W8QA 4YZQA 4XOPA 3EQOA 1IB4A 4MXNA 1O8DA 1KCDA 3GQ7A 1GQ8A 4XNFA 2QY1A 4YZAA 3VSUA 1EE6A 3LMWA 2VBMA 2O0WA 4XLEA 3B4NA 2NTPA 4OJLA 1IA5A 5C1EA 1X0CA 2NZMA 4W8SA 4XKVA 1RWRA 3VSTA 2NSTA 3EQNA 1NHCA 1OFLA 1OOCA 2QXZA 1O8LA 2BSPA 1PLUA 2PECA 2NTQA 1O8HA 4W8RA 4XLCA 1PE9A 2PYGA 4NK6A 1RMGA 4XKWA 4EW9A 4YELA 2PYHA 3VMWA 1O8MA 2X3HA 4XORA 1WMRA 4HWVA 1OFMA 1O8FA 1VBLA 4XR6A 4XOTA 2NT6A 3GRHA 4W8TA 3VSVA 3SUCA 1O8JA 1XG2A 1KTWA 4XN3A 4YEJA 4U4BA 3B90A 4YZ0A 4XONA 3ZSCA 3ZPPA 5C1CA 4YZXA 2EWEA 1DBOA 3B8YA 2QX3A 1HG8A 3GQ9A 4Z05A 2VBKA 4XN0A 1O8IA 3WWGA 3KRGA 4XQFA 1RU4A 1OGOX 2VBEA 1BHEA 4NK8A 2X6YA 1IDJA 2ODLA 4URRA 1O88A 2X85A 4XL9A 2INVA 2UVFA 5AMVA 4U49A 1O8EA 2X6XA 2UVEA 1K5CA 1IDKA 2O1DA 2O0VA 4XLHA 2VJIA 1DBGA 3GQAA 4MR0A 1H80A 1KCCA 2NT9A 2O04A 2VJJA 4OJOA 3T9GA 1JRGA 1PXZA 1O8KA 4OJ5A 4PMHA 1JTAA 4C2LA 4Z06A 2IQ7A 4OZYA 2O17A 4OJ6A 3FY3A 4XLFA 2NSPA 4XLAA 2INUA 4AVZA 4XMYA 3JURA 1O8GA 4OZZA 2NTBA 3VMVA 4OJPA 1QCXA 4I84A 1CZFA 3GQ8A 1AIRA
chains in the Genus database with same CATH superfamily
1MRZA 2JMWA 4MTEA 2DT7B 3HPGA 1FIPA 5L3DA 2MD5A 1BX0A 1OPCA 4II3A 1E43A 1ZELA 4Z4RA 3FX3A 5J40A 2YPRA 4ZDLA 4D9JA 3PUMA 4PGGA 5B5EC 2ZXHA 3WTSC 3Q0VA 5F27A 3JR9A 3EUAA 3LA3A 2GOXB 4FQGA 2HFHA 3MKZA 3PUNA 3BY6A 4PC3A 3ZBTA 3GQ7A 3GLLA 3TW6A 2CW8A 3FM3A 5DUIA 2DA4A 1IN8A 2ECBA 2OTJI 2JJ1A 3K6GA 1YS6A 4M53A 2WY7Q 3H92A 3CP2A 1TQIA 3MHPA 5BPIA 2DK5A 2DMPA 2W1OA 5DCMA 2DAOA 4X7DA 4PFPA 3TKYA 1KC8D 2WV1A 3UR3C 5JHUA 1EKEA 2VYQA 1TT5B 2QQBA 2LTPA 2N8GA 4ZTJA 4IKFA 1GV2A 4QPOA 4CZCA 4S04A 1R23A 4CO8A 3MWMA 1OFLA 1VTNC 5GP9A 2BN4A 4ESJA 1A31A 2ZNYA 4IEJA 1QO0D 4AYBN 2NVTJ 1AWCA 1IUYA 2C6YA 2XNJA 4M0LA 4G6TB 1B59A 2ZTNA 2KL4A 3TOAA 4XKWA 3M3YJ 4LBZA 2IGOA 2W84A 1OR7C 3JQPA 1ZLJA 5L3CA 4XK4A 3BZKA 1PKVA 2K27A 2V9KA 4UUVA 2FF4A 5E18F 3B82A 3CCVB 1TLHB 3I5UA 3BZ6A 5E1XA 4MLOA 5JFRA 3L2UA 2EB7A 1QA1A 3P9CA 2WR8A 2LFBA 2LY2A 4YIIA 4W8TA 1YIOA 3HUGB 3RIQA 5JBQA 2DU9A 1SAUA 3T8TA 2EIMH 4X8IA 3HKZN 1D1CA 5D5VB 3FWEA 2A07F 3IV5A 4ZH4F 1G8XA 4N9HA 1XGNA 2V7WA 2X53S 4UV9A 2YR2A 4BEHA 1TUIA 3CB4A 2XAGA 4BE0A 1VF9A 3LNNA 5CJ9A 4B43A 1O8IA 5ICEA 3M07A 4X07A 5FLXK 4YXWA 1S72I 1W5CC 4YEIA 1X1PA 4HAMA 4BQOA 9ANTA 1B9NA 3H9GA 1O88A 1MBKA 1OB5A 1JE8A 3OSFA 2M4KA 1PJRA 5F0CA 2E2JJ 5DSZA 3K1MA 4DNCA 2DJNA 3A0HC 1BJZA 3IRRA 1ZAOA 3QWLA 3K2ZA 1FX7A 3NARA 2V1DA 1H85A 2I10A 2XPUA 2IGMA 4M9XA 1O8KA 1H8EA 4OP7A 4C2LA 4OZYA 2STWA 1OCRH 1YJ9I 2FXAA 4D5CA 4BQQA 1QHGA 3ABUA 1T6ZA 1U0JA 4G8XA 1UG2A 4OPWA 4AVZA 3ZMTA 4EV0A 2AHQA 1SD5A 4CCNA 2LF8A 2X6OA 2Y31A 1AA7A 5E3OA 1WJDA 4QTRA 4FX4A 2IS6A 4P6VF 3K9TA 1KK3A 1TWFJ 4MYUA 2XSDC 3IP4B 3A01B 4KDPA 4ZC3A 1ZLKA 2GREA 4DZPA 4RB2C 1HQCA 2Z2SB 2VC0A 4L5JA 4B4CA 1YW7A 4FISA 3NRVA 4B48A 4G1BA 2DFEA 2QCOA 4JX6A 3F9KA 5J1UA 3OFNA 2EZKA 1LNWA 2RN7A 3U6BA 3CC2I 2C4TA 2JIZA 1ZTRA 3LNQA 4YFXF 5EGOA 3TGNA 3DDYA 1E79A 1EA3A 1MMSA 2LBFA 4AVPA 1DPUA 1W34A 1GXPA 3CD6I 1TYXA 2E60A 3GIRA 4UVCA 4FE7A 1OGIA 2EV6A 2W82A 3RKQA 2Y30A 1E1QA 2KJCA 2W00A 2QZAA 4NB5A 4XRSG 4L9NA 3TDZC 3C2BA 1D8KA 3WU1B 1T38A 1WOSA 4HLXA 4BYYA 3BJAA 3CMAB 1Y0UA 4L5IA 5C4XJ 1OOCA 3ZMUA 4RB3C 3W5HA 1QH0A 1IDZA 3WGHA 2QSFX 1V54H 5FROA 3BCDA 2DEUA 3TMOA 3QYBA 2UXXA 4NBQA 3DCFA 1WTHD 1VQKB 1Z9CA 2L7FP 4EW9A 2NOJB 2VE8A 2EZLA 4YIFA 2P8TA 3OZWA 2A61A 1W7PD 1WVRA 4OWRB 2XGXA 4WWVA 3CMEB 3LJYA 1XD7A 3BC8A 3FXOA 3NWSA 4M74A 2MLKA 2VNHA 3A8KA 2NS8A 1VBLA 2OTLB 4M4SA 3SFZA 1BR2A 2BXZA 3CC4B 3CCQI 2DDBA 3IC7A 3DKYA 1OJLA 3CMEI 3LQEA 4LBYA 5LEJA 2HOSA 1ZUNB 3B90A 4V02C 4OM9A 2CQQA 5IP7J 2F3LA 4FX0A 4DNRB 3AGQA 2LR8A 2XV4S 4M3FA 3K70C 3JTGA 4P3IA 1TQPA 1A6IA 3E6CC 1ZREA 1IV6A 1BIAA 3FXKA 3WWGA 4OMZA 1BR1A 1OHHA 4XQFA 4WZTA 2CRGA 3GTGJ 1KQ0A 4YHBA 4NK8A 1XDUA 2UZKA 1LDJA 1GLNA 3P4GA 1V4RA 2GXGA 2X85A 5IYBJ 2Z5UA 5BOXA 1X2NA 4BL0B 2X6XA 1YX5A 2XGEA 2PI0A 1D0XA 1JUMA 3BJOA 1N78A 5KAIC 4YC5A 3W2HA 2EFOA 2DCEA 1AKHA 3LSTA 3I53A 3Q0WA 4LBWA 3BQYA 4E7KA 2W85A 3SLNA 1X1CA 3BR2A 3V7AA 1KTVA 3S2WA 3VSLA 3I54A 4G7OF 1WJCA 2M0MA 2QEXB 2HPMA 3U9GA 2F4MB 3G6EI 2NSPA 4FK8A 3NB2A 1YJWB 4DJAA 3HKZA 2KPMA 3PFIA 2J5PA 2NTBA 2M8GX 4C3JJ 1FNDA 1F1ZA 3S2HJ 1WRJA 3CCUB 4JRAC 5FLMJ 3H36A 3TL4X 3G6EB 4FN5A 4PZJA 5TJJA 1P4XA 2XRLA 4YFKF 3BC9A 5D4SA 1QPIA 1G7CA 4M71A 2FE3A 4DBQA 4K2EA 5CLSA 4HE5A 1K8FA 1QA2A 5TRDA 1QG0A 1WH7A 1KZLA 2FNAA 2OBRA 2BM0A 4Z1MA 2BVMA 4IQJA 2WJVA 4ZDPA 3MCZA 4CDGA 3KZIC 4L9TA 3CCMB 4N4OB 1KCDA 1LE8A 5IT9K 2XSJC 3K70D 1KYWA 3TEDA 4Y7NJ 2JA7J 1YOVB 4NQWA 1K4SA 4A3BJ 3ASOH 4PGOA 4D7MA 3X2QH 1HKTA 4JOMA 1R5OA 3QRFF 2QE7A 4OJLA 1IW7F 1U2WA 1P7IA 4RAYA 4G5GA 2BM6A 4P2NA 1NBMA 2V7FA 1K9MD 2B7EA 3ASTA 1VQKI 3GF2A 3JAMK 1FSHA 1MJ9A 2F5FA 2HYJA 4G12A 5J6XA 3PJRA 1LM1A 1S6LA 2LLKA 2DMUA 3C2GA 2QM3A 1Z7LA 2VQLA 3OZUA 5DN6A 1I6XA 2XHKA 2E5NA 2BOLA 2QN6A 1KYZA 4EGYA 4J0QA 1ZKGA 3DFGA 3G71B 3K7AJ 2VE9A 1IGNA 2JRMA 4U0WA 2JN9A 3OAAA 4RPBA 4KUMA 4BQNA 2Y2ZA 2R7TA 3H9NA 2CUJA 4Z6YA 1Z7UA 5L46A 3HXLA 2XROA 4JX5A 3LSKA 3VNVA 4GGGA 1VQLB 1RPWA 2XNDA 1OCZH 4OMYA 1BPLA 3OL3A 4WF2A 1GVJA 3PM1A 1OGJA 1LFPA 3V4GA 3FKIJ 3KEYA 4CCOA 3JRHA 4V2GA 2EZIA 3WNCA 3BG6A 3VSVA 2ZSHB 1ETWA 1M1EB 4RM3A 3CCLB 1SD6A 4CCKA 3PENA 3BJ6A 2VT2A 2VPLA 1QVFB 1ELOA 2QA4I 1SD4A 2F48A 4UUSB 1ZARA 3PO3J 2OD5A 3LSIA 1A35A 5J4YA 1D8JA 2IA2A 4M3EA 1Y1WJ 4ON0A 3CCLI 1W0KA 3MCAA 3OYNA 2Q2EB 4RGRA 5D5WB 2VFMA 2YS9A 1FTZA 4CZZA 1S3JA 3RQIA 1BI1A 2EFNA 4LD5A 4Y9UA 3WTUC 1W7PA 3KYDB 2NVYJ 3LQQA 3N05A 5FRNA 3CUQB 2V31A 2H1KA 1MJAA 3ASQA 1R22A 1QVUA 2VNIA 3BNWA 1WU8A 4FETA 4CUGA 4PK4A 1WGXA 4PSWA 3J81k 3G73A 4YCQA 2PMZN 1J59A 3VYUB 4WXHA 1LEAA 3ZMZA 4D5FA 1KU3A 1ETQA 2ZTGA 3ONUA 3W2IA 4OJ6A 2BF4A 3HSRA 3CPWB 1KU7A 3OJXA 5FD5A 4LIUA 2A05A 3FBIB 2GPJA 1HW5A 3KX2A 2YWFA 1HDPA 2YSRA 2XB0X 1JHHA 3ERMA 1W1WE 3WTYC 3WY9A 5JLVC 2NV4A 3H35A 3A0BC 2E34A 4UUTA 4RBOA 2NVQJ 1HW1A 1RUNA 3VMVA 2OC6A 3ZCOA 2V5IA 3PSSA 4BQAA 3I3LA 1XCVA 4I84A 3BR6A 5HLTA 1NG7A 1APLC 5DS0A 4KFCA 3A4CA 1N06A 1DABA 1UAAA 2GQFA 1V5FA 1USTA 1L0OC 1QVTA 3VMFA 2FMLA 4Q5SF 2ELHA 2VZLA 2DCUA 1S9HA 1TL8A 1YITB 5EEHA 4BE2A 1AOYA 2JJ2A 4ZV4A 1E1RA 4QWQA 5HS7A 4MXNA 4RD3A 3DWLE 1IN4A 2R7VA 1S7OA 1ZQ3P 3CRZA 1W4MA 2MD0A 3DP7A 3GTJJ 2XPWA 3HIFA 1OR7A 3BTIA 3U1DA 2NTPA 1LVKA 4PJ0C 3P26A 2FBIA 2D3NA 1N0UA 2V6EA 3CJTB 5FKMA 1NH3A 5J4VA 2LMDA 2Y0SN 4A3MJ 1MBFA 2LDUA 1MKMA 2Q6IA 5FFZA 2WADA 4ZYGA 2H94A 1BX1A 4IJAA 1X2MA 4KH3A 1YRNA 3ZPNA 2XPVA 3OYMA 1E62A 4PFOA 2BSPA 3BY1A 2RV8A 5IK2A 2FVGA 1X3UA 1HA3A 4XLCA 3CESA 4WQMA 1LKXA 1TYWA 3BTCA 1KD1D 1D1AA 2E1CA 1FMVA 4X6AJ 1J9IA 1XFOA 3TO6A 2PYHA 3BH6B 4RS8A 4L9VA 2K02A 4RB0A 3GTMJ 1YX2A 3VOEA 1RRJA 1FBQA 3HGYA 3WG7H 4DIQA 4XORA 1XB2A 5BMZA 2VBZA 3PFYA 1R71A 1OFMA 3OOUA 4EM0B 1LFUP 2KMUA 2OJED 1R00A 1PUFA 1I1SA 3K4MA 4KITB 2NS0A 1FRQA 3GXOA 3VDXA 4G7HF 5J47A 3PO2J 4RCZA 2M0CA 4ZCIA 3CCSB 1XG2A 4YAWA 3FKJA 3LSHA 1YQAA 3LMMA 3BCBA 2VFNA 3SLDA 5B1AH 3CMAI 4E7LA 1I3QJ 3M8FA 2EWEA 2ID3A 3V7SA 5CVRA 4FTHA 1HOMA 1NRKA 3PUBA 2XAQA 5E20A 1PJ6A 5A2QK 2MG4A 1Y56A 3HRMA 2E36A 3F8MA 2X6YA 3SDGA 4HYEA 1T0FC 1ZH5A 3TBIA 1RQPA 3GVJA 2ZBKA 5KHDA 3H9QA 2BEOA 3DV8A 1SANA 2E7XA 5IP6A 6PAXA 1V0FA 2LKSA 2YWEA 1LUJB 1VI0A 4BHCA 2HVQA 3H9JA 3TDUC 4DYCA 3CC4I 1R4NB 4ZYHA 4OJOA 1JRGA 4OJ5A 3OYJA 4B3XA 2V1XA 5LGTA 5CKTA 1PYVA 2K5CA 4A93J 4RD6A 3J81K 4XD7A 4Z2YA 1IXCA 3MZYA 5J3LA 3CCRB 1IJWC 2HZDA 1SVMA 3LSRA 3KEQA 1PVEA 4F3QA 4BUPA 3ZC3A 4O5VA 3ROUA 1QGYA 4GYIA 4UNOA 1LFBA 1S29A 5D4RA 1K83J 1DU6A 3HSFA 4BJ5C 5GADJ 2DFHA 4M3GA 2KDZA 1QX4A 2D9RA 2J8IA 3ECHA 3SZEA 1VQPI 1WZ2A 3SJZA 3PA1A 5E3MA 3DEUA 3H5NA 4JMQA 1KMHA 2JT1A 1COWA 3J80K 3S93A 3ERED 3R0JA 4BGDA 4YZQA 5EYRA 2EFWA 3HOSA 1MMDA 2KJBA 2L7MP 2ESHA 2EINH 3I0TA 2HEOA 3QYFA 3S17J 1SKYB 2WYRA 1MZBA 1SFEA 3O6BB 4QIWN 5EDNA 2WTEA 2VOPA 1QRBA 1O3TA 1RKTA 2Z3YA 3CJQB 4N0BA 1B6AA 5FKOA 5E79C 4F92B 4YZAA 2QEXI 3S16J 3SEJA 2O0WA 2QMUA 3FM5A 1QGAA 1ZM2A 1M1KD 4IZZA 5FL7A 5A89A 1WPCA 2ZXIA 3HDDA 1I7PA 2ZMEB 3K4BA 2BBYA 2F1MA 2UUZA 3CJRB 1DPRA 3VSKA 2NZMA 1UB9A 4LJZF 5E1ZB 3SZPA 1KK0A 2CBXA 5CVVA 2W7NA 1Y8QB 3HB9A 3BR1A 4OIRF 3U2RA 3DLLF 1H0MA 2ELJA 3R60A 1YJNI 1T2KA 3RYRA 4S0HB 3DTKA 4J01A 4BDZA 1GAQA 2QXZA 3N90A 3P5JA 4AU7A 5IP9J 4TMXA 4HIZA 2V7QA 4HX7A 2VB6A 4RLQA 5L3FA 3B02A 2K4JA 4F55A 1FRNA 2YX4A 3EQLF 2D1VA 4F93B 1OB0A 2B0RA 3QPSA 1WSUA 4PCQA 2CV0A 1WMRA 1MNEA 1IO2A 1IRGA 2E1RA 2NT6A 2VKEA 3IHUA 3J7YJ 3RY8A 2JQ7A 2IA1A 5E3NA 4XN3A 4U4BA 3ZGKA 4I01A 4B1RA 1JKRC 1FOWA 2GLOA 3QU6A 1OMIA 2BGCA 3RDIA 3ZPPA 2K9LA 5JI6A 3V8LA 1TLLA 2VXZA 5KVRA 3HAGA 2K85A 3EDPA 1MSFC 3K4LA 3R6JA 3IH3A 1KK2A 3BH4A 4FHTA 1E3PA 2CQNA 1ON1A 1XX5A 3F0CA 2P81A 2K40A 2XT4A 1XGOA 3CUQC 2JVHA 4C2MJ 2INVA 5AN9A 1WPKA 4EQQA 5KAFC 2K3FA 5EZHA 5LBQA 4HSRA 1W7PB 1OCTC 4X0GA 3JRGA 2CW7A 2ZB9A 2Q0OA 4ABZA 2I1LA 3EYYA 1K73D 1RI7A 1Z3XA 3KP2A 1SC7A 2PE3A 4G7ZF 2LREA 3E20A 2VT3A 3IKVA 4RAFA 4IX7A 3JU4A 1WWXA 2VBYA 1VQ7B 5F1RA 5FNZA 4LG3A 2F4NA 1VQPB 3ZN0A 1KONA 3CCEI 2KVOA 1WCMJ 3L1PA 1HDDC 4AYBA 3RKWA 2AXLA 2OBSA 2KRHA 2VJ4A 2HKXA 4BHPA 4WZEA 3K10A 3RPUD 2FA5A 3RTRA 3CCVI 5GAEJ 3T0YA 2QLZA 2YWGA 5FO1A 4B3GA 5D5XB 4P6YA 4XM3A 2EIKH 3TP3A 3LA7A 4IHWA 3KL9A 1IRXA 1K78A 1JJ2B 1TWGJ 4ZJZA 2EK5A 1R5GA 4JK1X 2IT0A 1E3XA 1ETYA 1BW5A 3W5UA 4HZFA 1HA8A 2XVCA 2HI3A 5C44J 5HOOA 3NAWA 1TP4A 2E71A 5LFAA 4DYRA 1RETA 2QY1A 3J81Z 2IBDA 4A3CJ 2IXSA 2FNPA 3QYEA 4OU0A 3A35A 1YIJI 1IN6A 2K3PA 3CCJI 4L0ZB 2ELKA 1CNFA 1LVAA 2ETHA 3OYHA 1IA5A 2HLDA 3MMYB 2HOTA 2KIFA 4X7CA 4BJ6C 1LJ9A 3WE3A 1B72B 2XC7A 5FD6A 1UD4A 3DPLC 1WSVA 2XZOA 3Q3AA 1Z67A 4HNTA 1LE8B 4KIBA 2Q6OA 4TMTA 2NTQA 3HSEA 3MD2A 2MC4A 2JRTA 4KMFA 1W0JA 4RPDA 1D1NA 1P92A 2QF7A 2IS4A 2A6HF 1T56A 4R71A 3ZQCA 2KISA 2ZKZA 2ZZQA 5F4JA 4I09A 3ZR8X 4BDYA 5DNSA 2WZNA 1F36A 2P5VA 4A3DJ 2GXAA 1T8IA 1F60A 1FEXA 1B1BA 3OL4A 3PNYA 1IF1A 2XASA 3GZ6A 2HZTA 2BGIA 1VQOB 1D0ZA 4BAYA 4U0VA 2VN2A 3CJNA 1XPXA 2Y48A 5J8CA 2MC3A 3DU5A 2BM4A 2NYXA 4AIJA 1QGZA 3ONYA 2VFOA 3ISPA 1ERDA 3BCAA 3E7LA 3ABMH 3GFJA 1E3OC 1FBSA 1YRNB 2R7UA 3P9KA 2HDNB 2WPDA 4E4HA 5IT3A 2XF7A 4EJTA 3ABLH 4Y52J 4HF2A 1I5ZA 3CD6B 2O6WA 1N77A 1D5VA 5IY5H 2PFBA 1WH5A 4RAGA 3IL2A 1XB4A 1DP7P 3S15J 4HX8A 1KQ5A 4ESBA 3PVDA 3W2FA 5K5QA 4GDFA 3PA2A 2BSAA 1A5JA 1H80A 4YFOA 5C3EJ 1SMTA 2R7ZJ 5L3GA 5K5OA 4CYDA 1JA0A 5M3MJ 5F4MA 2HXOA 2IEKA 5GV7A 3T1BA 3QPHA 4KA4A 3FZVA 2TDXA 2FX0A 3EPZA 4RD2A 3BQZA 5EG0A 1NDHA 2Y75A 3QPLA 2R5YB 3KIOA 4C0SA 3T8RA 3PIPF 4CYCA 2A6TA 2AHOA 1T6YA 3FXLA 2D2WA 2QENA 3ZMDA 4HE6A 3ASSA 4HNUA 1HC8A 1FC3A 2V1UA 3WYAA 1WJBA 4RM2A 1SEUA 1JA1A 5ILUA 1OCPA 2KKOA 4LLGF 2ACJA 2QQ8A 1FZPB 3HOYJ 3WQZA 2XUBA 4NDLA 2GIZA 1Y39A 4QV2A 1UJ8A 2OTJB 4KNYA 2DPDA 3G1MA 1CLWA 5H5JA 2KDOA 3K2AA 1X1AA 1XE1A 1MSEC 2OV7A 2OCEA 2ZNZA 4LMYA 3S8PA 3IWFA 2HNHA 3MFKA 2AO9A 2DN0A 4RGUA 1UD6A 2GM4A 1Y0RA 1A36A 4UAJA 3A8IA 2YWHA 1Y0NA 4OIQF 3CCRI 1VQ9I 2VJ5A 1X58A 5DV5A 3T5XA 1C0WA 3G05A 3QODA 2QYUA 4HSTA 3SYTA 3ZN1A 1KA8A 1VQLI 5ILSA 3HOVJ 3L2VA 1X4PA 3B6AA 2X9DA 3RKYA 3LA2A 2QKMB 4HDUA 1MBGA 4F7DA 1YYVA 4ZTFA 4KIFA 2DTRA 3LO8A 1CF7A 2CGPA 3EYIA 1YI2B 2Q2EA 5KW9A 4PSXA 1JB9A 3ZRGA 2E1BA 2FEZA 3CZ6A 3RPQA 4RD0A 2NXNB 1T08B 2ZC2A 2HYFA 1O8LA 3TP0A 4BBSJ 2HS5A 4DQ2A 3H3ZA 2CV1A 3HOZJ 1PE9A 5CDFA 2IOUG 2ZITA 1N07A 3GQBA 5LD2C 3KE2A 2H09A 2STTA 3ASNH 2XAHA 4LITA 3KLNA 4G1VA 2CS3A 2IRFG 4HRIA 1VQ5I 3OS0A 1U2RA 3WHCA 4BU2A 3BG7A 4OPOA 1R1UA 3IH4A 2FX3A 1HKSA 4WWCA 1O7FA 4KISA 1IJFA 4ZGNB 1LPQA 4Q7JB 1BQEA 1FBUA 1VQ4B 4KICA 5DM6F 3CCYA 3KETA 4YRVA 5A88A 1WOPA 1SM4A 1HG8A 4Z05A 1VQNB 3WTXC 3MMPA 3CCMI 4E7JA 2VBKA 4Y15A 2ZMEA 2R7OA 3R6SA 1D3YA 1BR4A 3OW2B 3OWTA 1BIBA 2D5VA 4M6VA 3R4KA 1P4WA 4ZCMA 2ODLA 1QPMA 1YE9A 2HQNA 4NUBA 1MMGA 2XF5A 2R3SA 3Q6RA 1VQNI 1O8EA 2OBTA 2EILH 2M8EA 4IXAA 1JXSA 4WZKA 1YJ9B 1LLZA 4WXDA 4XLHA 2ME6A 4G6IA 1ZM9A 4NQWB 2EIXA 3ZBUA 4MTDA 3L2RA 3RSNA 5CVUA 5BPDA 2GK7A 1VQMI 2WA0A 1EH6A 1YLFA 4JX4A 2NPFA 4O6JA 2H8RA 4Y13A 1BLIA 2CUFA 3OMYA 3FY3A 2E7WA 1Z0XA 4RLZA 4XLFA 4AUXA 4BXFA 1SAXA 2AQEA 3I4PA 3G71I 3BOQA 4C3HJ 2VQGA 2BY3A 1MH4A 4UV8A 5GPCA 1E64A 2GIVA 4BXUA 1ZR2A 1R6RA 2OQGA 2WWYA 1IG7A 4M2LA 5F4OA 3WODF 1CZFA 1U9NA 3FHNA 1YG2A 4X05A 1IC8A 5EF6A 1WP6A 2FRHA 2R6HA 4EJWA 1ODDA 5HZAA 3QU3A 4ACBA 2X1CA 3UW0A 5AIPA 3E6DA 1VFCA 4WZLA 3VO1A 4WX9A 2F2EA 4Z4WA 1FNMA 4MO7A 4WCGA 1RZ4A 2LH9A 3SHFA 5LEKA 1B72A 3ISXA 4K1XA 3V7CA 3LFUA 2EQRA 2BPOA 4XNFA 2E35A 3A03A 1FNBA 3LVBA 4TKOB 3ZMVA 4C2TA 2H27A 2VBVA 2E1NA 4YDTA 1YI2I 1QRYA 3OYEA 1UHWA 1QUFA 3O8GA 3MEXA 4B3FX 2F4IA 3TQNA 1K6OA 2J8KA 1X1DA 3E6BA 1VQ8I 2VXDA 3L7WA 1R5NA 4ASUA 4BPRA 2KZGA 4AD9A 4IO9F 1F9NA 2CUEA 1P4AA 3K4KA 1MH3A 3BG5A 1KQ8A 4TMVA 5H2FC 1BN5A 3JRAA 3A3GA 2PECA 2YUSA 3CPXA 4W8RA 3HYIA 2FBHA 1A04A 4PABA 1KZHA 3OKXA 1HBXG 2YU3A 3O3KA 2AS5F 1NB0A 1DUXC 4LIVA 4U88A 2DMNA 1B2RA 4RGXA 5LRSA 1KQ9A 3F22A 2M4GA 4I76A 1IN7A 4YELA 2PX9A 2O5RA 3Q6QA 3ZQHA 1UMKA 1YJWI 2V9VA 3ZZ0A 1Z05A 2BVLA 2PLYA 1RQRA 4HWVA 2M7BA 2DBBA 1QNTA 2XOKA 1O8FA 1EWYA 4HDVA 4E70A 1DDNA 4RM0A 3JSOA 2QUFA 3BTLA 2HDCA 2LSOA 3PUFA 1SFKA 3W2AA 1H9GA 5LLQA 3QPTA 4YEJA 2F6CA 3F8NA 2W7ZA 4YZ0A 2P5LC 5TISC 1JNYA 1QHHD 2JTVA 3LSMA 3NAUA 3K4CA 3VR6A 2NNYA 1DBOA 3OYBA 2XNCA 1TC3C 5FKKA 2RQQA 4A3IJ 2QX3A 5D8KB 1MMNA 3SXYA 1XC5A 3I55I 4XN0A 5HXBA 4G94A 3KYCB 5LHHA 1YTYA 3L2QA 2WAQA 3A1YA 1M90D 1T33A 1XMXA 3WU0A 3OS2A 1G7SA 1Z6TA 1VQ6I 2WY8Q 4O3MA 1OFDA 5AMVA 1VNDA 1FP2A 3K69A 4C9YA 2XTXA 4BE1A 4Z4YA 4DK0A 1MNMC 3OW7A 4I02A 1J9ZA 4DW6A 3GW2A 1SFOJ 1T98A 1B23P 3AL0B 2O9LA 3ESWB 1S8NA 4PJNA 3GVAA 3OR1C 5K1YA 1BC8C 1D2EA 2VNKA 2GJPA 3W2VA 4PC1A 1ITYA 2JUGA 1HZEA 2HKOA 5K7FA 2R7XA 2L9RA 4OPVA 2ESNA 3DBHB 3GSIA 4JYKA 3LYCA 1T6XA 2EZHA 4MYTA 2XKPA 1R1VA 5EZGA 1Z91A 4PDKA 2D45A 3RYPA 1QJVA 4L0YB 5CQEA 4NC8A 4YALA 3W5VA 3VEPA 1UD3A 3ECOA 1Y0YA 3DU6A 1K4TA 2DT6A 3A3BA 2Z8GA 3EQOA 4IHYA 2JJ7A 1IB4A 3RKXA 1O8DA 4C30A 2W24A 3CUQA 3K0LA 3MVPA 1I27A 4TV7A 3H0DA 1J75A 1MGTA 3CC7I 1EE6A 2DT5A 1SVLA 2PN6A 2RREA 5IT9Z 2HCJB 3AKZA 2O7OA 1KU2A 2RGVA 4ENMA 2ISZA 3PSZA 1GUUA 1YW9A 2F5DA 3I4MJ 3R0AA 2X1EA 1QRCA 3Q3SA 1RWRA 3VSTA 4LFUA 1ZR4A 2R7DA 1Q9SA 2DOGA 3CF2A 3F8CA 4A6DA 2TRTA 1ENHA 4IHTA 2M30A 1SVOA 4HV6A 1BL0A 2R0QC 4U87A 1UCRA 2KIMA 5TR9A 3P9IA 1E0EA 3V7RA 4B4DA 1TWHJ 4A0ZA 4A69C 1PP8F 2NOGA 5HS9A 3MAJA 2IS2A 5DUKA 2Z33A 1O8MA 5LMZA 3ZQLA 3MZ8A 3AVVA 4HW0A 5LGUA 3JTHA 3OIQA 3G1OA 2LKPA 4MQ9F 3RQ4A 4CCMA 1Z77A 1WSRA 3FMQA 5B66C 3V76A 3RJPA 4ZYAA 2B0LA 3IH2A 2BW3B 1S7AA 4HF0A 4MEYF 4M72A 5LHIA 5FKNA 4Y9RA 5ILVA 1USSA 2KHMA 3HBLA 4LB6B 5KSWB 1UHSA 2BYVE 1JKQC 4LLLA 4EH1A 2VFPA 2HMAA 2W48A 1PUEE 4YZXA 3DKXA 2DQLA 5E3LA 1W5SA 3OIOA 1I8DA 5IYNA 3KRGA 2XAUA 2PG4A 1WJ5A 2VBEA 2CQXA 2HPIA 3BROA 3KLOA 4R8HA 3GZNB 2G9WA 3I64A 3CW2A 2ZXWH 1VHEA 5TY0A 1K5CA 5DCMB 5JR3A 5DM7F 4E7SA 4PAAA 1FDRA 2JPCA 2O1DA 2OA4A 3S1QJ 1DBGA 3PETA 4AF6A 3K1PA 3HOUJ 3GFMA 2Y9YA 2WC2A 1Q7YD 1HLVA 3TO7A 2EJRA 3ZMSA 1B8IB 2DQRA 3O8HA 1K78B 3QFTA 2UWMA 4PMHA 3CUOA 3LQ6A 4QUZA 2IQ7A 1E17A 2O17A 3HOTA 2L02A 1GVHA 3CCUI 3I9V2 3T56B 1BI3A 3ABTA 1YIJB 3G1LA 4AIDA 1D1BA 3OS1A 1YLOA 3CCJB 1BOAA 1XMAA 1GR1A 4OZZA 1XTAA 1ZGWA 4I7HA 1EJ9A 2DOEA 2NRAC 2VBSA 3QOEA 3WTTC 1O3RA 2X6WA 1XCBA 3F21A 3CC7B 3FDYA 3WTZA 3KP4A 3JRIA 5F0FA 1XSDA 4B47A 1OYYA 4JBAA 3WTVC 3H5AA 1SMYF 4A0YA 4B3AA 3EUHC 4LC0A 2WJYA 3CLQA 1J7KA 2UXNA 2KQRA 3U21A 2G0YA 1ZGAA 2F5CA 2B7CA 4HNVA 3S1MJ 2BM7A 3CP8A 4IF4A 5JVGF 2JUCA 2OZUA 3LMWA 3V8JA 3SZGA 2CG4A 4Z4VA 2H6CA 2JZYA 2VIXA 2XZPA 4XLEA 4Y17A 1UZCA 2HXIA 3HRUA 4EM2A 4RD4A 4BY1J 3JRCA 2HQ5A 1MBJA 2DYRH 4ENKA 2V7VA 4P1VA 3DBRB 1H89C 1YFHA 4BACA 3KEWA 4ZDOA 4IRHA 5EEAA 3CQZJ 2OPTA 5HLIA 3JRDA 4JP0A 3BCFA 2C4UA 4V2FA 1NHCA 4RDUA 1BOBA 1R5ID 5CYVA 2JPBA 2PEXA 3LAPA 5GAGJ 3I56B 3AVUA 3SKBA 1EH7A 2NNNA 4ZYDA 1ON2A 3R6KA 3OYCA 1S5LC 1VQ7I 2HGCA 2WB1A 1W87A 4NK6A 2IGKA 1TSPA 2COBA 4RGSA 1ZG3A 5LHGA 3EUKL 3VMWA 1QA6A 1I3AA 2LY1A 4E7IA 2GBYA 3KP7A 2XAJA 4A5NA 1HVXA 2X3HA 4CYCB 2VBUA 1MD0A 1IN5A 2R5YA 5EG0B 3LAJA 1U78A 4XSZF 1GXQA 2YX7A 5FO0A 3BZCA 5IYDJ 4TMZA 3HTSB 1ZN2A 2D1HA 3OIPA 5FIUA 4FCYA 2DA7A 1TT0A 3M7GA 1T39A 2EFPA 3AAFA 2OBPA 3LSGA 4A12A 4OOVA 3BR0A 2PJPA 2R92J 3E3VA 4F91B 1Y6IA 1BJAA 1KK1A 3JQQA 1X3ZB 4L8JA 4UB8C 4KKUA 2QTLA 4IQ4A 4IHVA 3PSIA 3IAM2 1DARA 2FOKA 2CSOA 2XAFA 4E7HA 2UVFA 2KIQA 5F04A 2OYNA 4WXCA 3P7NA 2CFOA 1HF0A 3HL2A 1HXDA 3GTKJ 2VJIA 4I2OA 1FTTA 5IYWA 2Q8KA 3FHZA 3GO5A 4KKSA 4Q47A 1REPC 2IW5A 2EH3A 4A6EA 2Y9ZA 3T9GA 4QHYA 1FPQA 3COAC 1V5VA 2DIEA 1PXZA 5EMNA 4P25A 2XGDA 3OP1A 4UZUA 4Z06A 1GVDA 2IGNA 3HGGA 1ZYRF 3SY2A 3VODA 1X3WB 3ZQQA 2R93J 2DJIA 3KP3A 3S3MA 2QBYB 1MIJA 4YG2F 2HR3A 2WBMA 3L2CA 1I18A 3G4SB 4D0PA 1UMQA 2DK8A 2L0KA 5JMCB 5HKKA 1W36D 2XGJA 2XGCA 4NCNA 1XSXA 1NK3P 1P9QC 1VQ6B 2FUG2 2KFDA 1QCXA 1STZA 2VKDA 4BS9A 1QQ1A 1KQSB 5CVIA 1BC7C 2V7TA 2WZPP 3U2QA 3N6ZA 3J80Z 3ML6A 3J7ZI 3GVLA 2MFZA 4MHGA 2V7XA 3OEHA 3HG9A 1K8AD 2M87A 1TW3A 3FK6A 2EA4A 2L2OA 2LOOA 3AG2H 4DZJA 1EP1B 5FJ8J 5ED4A 4DQLA 4ZGQB 2BHYA 1XGMA 2K4BA 2VFQA 2HYGD 1GQ8A 1GJRA 2HU9A 2X3UA 2L5QA 3FJOA 1ORKA 2HQAA 2PQ8A 3SZTA 2K7LA 2P0WA 1XG1A 3GTQJ 3J7AO 3FPPA 3Q39A 3HJEA 1TTYA 2HOAA 4RMNA 5J8FA 3C18A 1S0UA 2RVCA 4CICA 3OEEA 3DF8A 5HZBA 4UY8I 4AIKA 3OOCA 2M1BA 2PMZA 3TOBA 2JA6J 2CK3A 3ASRA 1V3FA 3BWGA 1BW6A 3K1NA 5D6FA 2DI3A 2DO7A 2E5ZA 4BKXA 4L9JA 5C4JJ 3PNVA 4M73A 4ENJA 1VQ4I 2Y0MA 4HG2A 2Q6LA 1U8BA 4OAYA 2EV5A 2BE5F 1LDKB 5AIQA 1XSVA 3OPOA 4RJLA 2MH2A 1QA3A 2C77A 3FXJA 2D74A 4FXUA 3CO6C 3SEZA 4OIPF 3AVTA 3TO9A 1F5TA 3S1NJ 2CQ7A 2ICWG 2CMPA 1FT9A 5HVQC 3TW7A 4XLNF 4HA8A 2UV1A 1VLOA 2EWNA 2GWRA 4A2UA 3F3XA 2R7RA 1O4XA 3SUCA 4OOXA 3KEOA 1ETOA 3ZPLA 2QYOA 3W6KB 2GJRA 1K4ZA 2VASA 1R1TA 3I58A 5E6TA 1K6YA 5JLWA 2QSGX 1ZRCA 4M9ZA 1G7RA 3OZVA 1IZ1A 3OYGA 5DEQA 1QFYA 2X0KA 3VWBA 4YAOA 4TMWA 1G2HA 1SFXA 3HHHA 1ETXA 3FMRA 4I0AA 3GMEA 3MQ0A 3WGGA 2ZJRF 5HNHA 4R79A 1OGOX 1Z6RA 3JX8A 5L3BA 2MA3A 2A3SA 4CHUA 2A6EF 1V0EA 1NTCA 3E0JB 3W2WA 3CTAA 2CF4A 4CCJA 4PC6A 4U49A 1DGWY 2F4OB 1FYLA 2RAEA 4G6DA 2O0VA 4P1WA 4BY7J 1KU9A 1Z3YA 3FXQA 2BGJA 2E1OA 2CWEA 5JHFA 3G4SI 2NAZA 2FU4A 4RB1A 1EFUA 3W2EA 3H1CA 3I59B 2X51A 4OAZA 4TSFA 2R9VA 2PIAA 2W57A 2JA5J 2A5WA 1FLIA 2H8WA 3M9AA 3A02A 3AVXA 4GXOA 1XN7A 1I50J 5EJCA 4UVBA 3H09A 3JURA 1O8GA 3GZ5A 3DTEA 4E7ZA 3ASPA 1H42A 1IDYA 4HOBA 4F52A 1ZHFA 2FJ1A 2L4AA 1AIPA 1FOXA 1Q86D 1WI3A 3SJPA 3WNBA 2CYYA 4W97A 2KT0A 1I6HJ 4H4KC 1FWZA 2H6BA 2L9VA 3L00A 3NQOA 5KK1A 2QSHX 2Q6KA 3ELKA 1PDNC 2MW8A 5IYCJ 3OR2C 2VPRA 1W36C 5HDKA 5IYRA 5BSYA 3ONQA 4V19K 3E97A 4UHTA 2JDIA 2C5BA 4XSXF 4RD1A 1GO2A 1PJ5A 3WG9A 1H8AC 2HVRA 3H3VK 1G7TA 4CA0A 4DNTB 4HQEA 2VKHA 5J35A 1WXRA 2Z99A 4F7ZA 2O03A 1WHUA 2V4JC 1S72B 1EP2B 4LGWA 3TH0A 1P2FA 2PMDA 1XS9A 3F6OA 5FRMA 2QGGA 2XDVA 2OZ6A 1POGA 2ZL6A 2NSTA 5JVTA 1JGSA 2VQHA 1TTTA 2R7SA 1EFRA 4EJOA 1J0RA 4HV5A 4MFDA 1O7LA 1G3YA 2IP2A 1VQMB 3ZIAA 3R61A 1L1IA 1O8HA 3AK5A 2EFQA 2X4HA 5HNFA 4HQMA 4KIGA 2VL8A 3S3NA 4FE4A 4MGRA 3IKTA 2RKHA 3G2BA 5THXA 3MN2A 2V26A 5CVJA 3VYSB 2MGQA 4M6XA 2WAFA 2PJRB 4R1HA 1WOOA 2LZJA 1UD5A 1DDGA 3A8JA 5H20A 2GK6A 3SYJA 1E3ZA 1LDDA 2PMHA 2L01A 4UVAA 3CDHA 4XR6A 4D7NA 3ZOBA 3D5SC 4Z4ZA 1O3QA 3ZQFA 3M8EA 3RZDJ 1O8JA 3WHBA 2Z16A 2R7FA 4U7BA 3H3UA 1PP7U 4Y33A 5F1JA 1IB0A 2WB1N 2B5OA 2LG4A 1HF2A 5C1CA 4IL6C 3V8KA 1Z21A 3CC2B 4Y3OA 3B8YA 1I39A 4QLCU 3W3CA 2ZJQF 1X1BA 3OSGA 1MDMB 2IJLA 4M3BA 4P55A 1WDTA 2W25A 4MNUA 3UKGA 5BNGA 4KJZA 1R9TJ 3AGPA 1N8RD 3AVWA 1RU4A 5IYQA 3HEFA 2WAQN 3D0SA 3Q5FA 4GO1A 2ZJPF 1IDJA 4URRA 4GCVA 3PNTA 1EF4A 3GUDA 2GA2A 3BY2A 4ETSA 1AMOA 3W6VA 1V5EA 2X1DA 2Z9OA 3DBLB 3PQKA 4XBFA 1DP3A 3L9FA 1VF7A 3O2PE 3BQJA 1O57A 1V55H 1FNCA 2XC1A 1MDMA 5ICFA 3BT9A 2CC2A 2B63J 1EV7A 1ZM3A 1FYMA 1J09A 4NNJA 4HLYA 4A3GJ 1N0VC 4QFMA 2HWVA 2L7ZA 5FB2A 1EXMA 3FMSA 3CF5F 2NS7A 1PUFB 2VONA 3BPXA 1QFZA 1EZGA 2BXYA 2ME0A 1D5YA 1T6SA 4XMYA 3Q9VA 4IRGA 3S1RJ 3CXCB 4OPSA 2VC1A 1XDSA 3MKWB 3E1YE 2TCTA 2ZO4A 3HOXJ 4XRSA 1RC9A 4A3FJ 3ZZUA 2F1LA 1N75A 1DG1G 2M7AA 1FJLA 2CW5A 1X4OA 1YHQB 3AG1H 4Z03A 2ZXJA 3D5RC 3CCQB 5M3FJ 2RQPA 1TYVA 2VUMJ 4RCYA 2MH9A 2FD5A 1AKHB 2IS1A 4Z4TA 4E0FA 1E63A 1XMKA 3WXMA 3BG9A 1RUOA 1BI2A 3EETA 2G7HA 4ASNA 4Q4ZF 2ZFWA 1WJEA 5ICCA 5E1WA 2DERA 2R7WA 2GXBA 4ROXA 1T5EA 1YO5C 1FY7A 2I5UA 2E1MC 4XIDA 1X19A 1BA5A 2COMA 1KGSA 3WE2A 3ZP5A 2GOMA 1GHCA 1BI0A 4G6QA 4C3IJ 2M34A 5F08A 1A6QA 1KRHA 1YX3A 3SJMA 2XTYA 2Y0SA 5E8GA 4LG0B 1RR7A 2AQFA 2O8XA 2BV6A 2LC2A 2R4GA 3RI4A 1AU7A 5FLVA 3J7AY 3ZQIA 1WI9A 1OB2A 5F6FA 1WFXA 2NVXJ 1V5GA 2LF7A 4U0YA 4KKTA 4P9FA 1WJAA 3OYLA 2VOOA 3L2WA 2F5VA 4Y4RA 1PLUA 3KZYA 4LOCA 1IAWA 4L5EA 3GEZA 4UXNA 2DOAA 2OAZA 3BR3A 4KN4X 5M5XJ 4II2A 3WU2C 2WAEA 3VNUA 1MABA 1FNNA 2JVGA 2FSWA 2QKLB 3WGIA 1GT0C 1IXSB 2CUZA 2QDXA 3LOCA 4MIMA 2L9SA 3NE5B 2EFGA 1R4MB 3SDBA 4OIOF 2LD5A 2CNDA 4UB6C 2GAUA 3DU1X 3JREA 1Q81D 2DDAA 3HRTA 3E1SA 1VZ0A 4DYQA 1EA0A 4LLNA 1QU3A 4H0EA 4EATA 1UG0A 1ZK8A 3BTJA 4ZZDA 2ZL7A 4ITVA 4X7FA 3VO2A 1OFEA 3H0GJ 3ZUGA 1U5TC 2DY1A 2XEXA 1Q1HA 1MW7A 5GTIC 1Y1VJ 1DDIA 2G0EA 2HDWA 2K9QA 3I59A 3FXUA 2QWWA 3OV8A 2OK8A 2FBKA 2E2IJ 4A3JJ 1IRZA 1JI8A 3CCSI 1QBJA 1E3HA 1K7AA 1DQUA 1BBYA 2CU7A 1TYUA 2KZVA 1BHEA 4UZEA 3DQVC 1ACIA 2LBFB 4BH9A 3I1FA 4P26A 3EUHA 3GX4X 1L3LA 3LL7A 2DA1A 1TBXA 3RCOA 3WTWC 3NEUA 4PGHA 1VQ8B 2XZLA 4GFBA 2M3AA 3OYAA 3HRSA 3CO7C 2DMTA 1IJEA 3B8HA 1IDKA 3S2DJ 1JUSA 4UUSA 2O3FA 3GQAA 4G7WA 3BP8A 4CQJA 3PL8A 4YFNF 1W2BB 2MABA 1WORA 4ACAA 4G7XA 3KCCA 4C43A 1QGPA 2ZSIB 3GVKA 2A5YB 4N9IA 1S7EA 3S3OA 1NK2P 3KP6A 3C3WA 3SEQA 3OYKA 4E6KG 3A01A 3FKSA 3T51B 2P6TA 2NVUB 3LSJA 5FLXZ 5FO5A 1YHQI 5LGNA 2INUA 2VLAA 4YIRX 3FF5A 4A3KJ 2KRFA 3DLAA 4FT8A 2CH0A 5HS8A 4P12A 2OTLI 2YUHA 3GBGA 4GQNA 1IHMA 1SKQA 1RKWA 4U7DA 3B78A 3ML3A 2DOFA 4LB5A 3UNGC 4EGZA 2LRDA 1VQ9B 1OGMX 4W8QA 3K4NA 5FKLA 1U5TB 1GAWA 4DK1A 1Q82D 2ID6A 3DEWA 4EJUA 1TNTA 2KP6A 2P4WA 4CCLA 5HLGA 1ZM4A 2VKVA 3FPKA 1FOKA 2M2EA 3CLOA 3ZZTA 3BR5A 4TN1A 2BVNA 2V9PA 1EP3B 2Z1DA 1FYKA 3FBNB 1OFCX 2VBMA 1JJ6C 1SFUA 4IPAA 1JTYA 3GCMA 2DPUA 2CFXA 1ETKA 1BJKA 3JCUC 1ZRDA 4A3EJ 3VB2A 2L54A 4TT3A 4GRIA 2BV3A 4S05A 4W8SA 1MNDA 5HDGA 3DTIA 1VHOA 5L3EA 3BPVA 2GQQA 3BH7B 4EVIA 5F0HA 1HW2A 1B9MA 1CQTA 2DYSH 2A69F 2MBFA 2OUMA 2XF6A 5DCFA 2BY1A 3HPHA 2VBXA 4BXXJ 1OYWA 3HUGA 3ZXSA 1UD8A 2BM1A 2L4MA 1NJID 4ZYEA 1TZLA 5DYMA 3LWFA 1CGPA 4Z4UA 1ONVA 2P3MA 2CRVA 2OCCH 3ZQGA 2JWTA 4PC2A 4WK8F 2M45A 2PYGA 1G3SA 3MZHA 4W1UA 4I0BA 2LY9A 2ADUA 1N08A 4G9YA 4AC0A 5M5YJ 2BW3A 1U8RA 4A0XA 4KMUX 4IRIA 4XOTA 1LQ1A 5H6QA 4DOZA 4XKBA 3GRHA 1IRFA 4M3DA 2RC6A 2X48A 3FISA 4AC9A 5DTDA 2QBYA 2FQ3A 4B09A 3QSYA 4XKCA 3NWTA 4EJVA 2L3DA 3W2GA 1G4DA 2DA5A 3ULQB 2D3LA 2V4DA 5H59A 3VFZA 2M9HA 1TNSA 2LNBA 3U1KA 3OY9A 3I4NJ 3ABKH 1S4MA 1JUPA 2DW4A 2LYCA 4NC6A 3JQRA 1JJ8C 1FP1D 2DETA 4M9SA 5E17F 3JRBA 1CNEA 2UVEA 1T0FA 3PQJA 1XGSA 1Z1DA 2CJJA 2HTSA 3OYIA 2PBIA 1NB9A 4MR0A 2IA0A 1EH8A 4PC7A 4LBVA 1TWCJ 5B3SH 3JW4A 1U5TA 4XLPF 3I56I 5AONA 2CV2A 4A3LJ 3ES9A 1FMWA 5ERIA 1JTAA 3L09A 1FOYA 1HSJA 3OOPA 3OYFA 2ZBUA 4EMSA 2FMYA 3A1PA 4KYWA 2CO5A 3A2KA 3OJWA 2O8KA 3IUOA 4HBLA 2WSSA 2X8KA 3QP5A 4XLAA 2XIGA 2HVSA 2ZZGA 3IRQA 2VNJA 3KFWX 5DDGA 1XQBA 1D0YA 1I1GA 4P9SA 3D1NI 4OJPA 3M1EA 2R5ZA 2CQKA 1J2XA 3GQ8A 2RC5A 1HCRA 2J7KA 3QFCA 1WJFA 4KT6A 1VLYA 1JT6A 1BN8A 5D5UB 5J1RA 4CGZA 3H5RA 3CCEB 1K28D 5HLHA 3QP6A 5HODA 2JK3A 1FSEA 4LK0F 3GTLJ 1R49A 5B6IA 1O3SA 4DQKA 2QA4B 3E6MA 2W6IA 3QFRA 3F72A 2EBIA 1WKMA 2HQRA 4QSHA 2RC4A 1BMFA 1FIAA 1G3WA 4ENNA 3DXJF 2IPQX 3IAS2 3VSUA 4N3NA 2IVMA 3S14J 1R5BA 4H9GA 3AFHA 2GZWA 2JSPA 4P5OA 4HF1A 5IOYA 1H88C 2BMWA 1TVCA 4FWTA 1TWAJ 2P5KA 4DGWB 5EGOB 4DBRA 3SFIA 1G3TA 2O6GE 3BG3A 1W0TA 2CW0F 4RDKA 5GV8A 4HX4A 2W6JA 3PIOF 3D26A 1W9XA 2L9NA 2OF7A 1N05A 1R58A 3EQNA 3BLYA 5K5RA 2XT2A 2J5OA 3G3ZA 1MBEA 1EFCA 2EA2A 3W6JB 1LLWA 4P9UA 3Q9SA 2ZZEA 5GPAA 1NHAA 1VJSA 1NG6A 5CPRB 4C2UA 4OINF 5ICGA 1DU0A 4OOIA 1RMGA 1D8TA 1QZZA 2QQAA 2R5ZB 4I6ZA 4RDJA 1RR8C 4J00A 3DEEA 3F8BA 2WV0A 2EV0A 3K4JA 4ANJA 5HDNA 4Z4SA 4RA2A 2DA2A 4HEA2 1F43A 1B4AA 2DA3A 2XKOA 5KCMA 5E8IA 2DXIA 1LB2A 2YU9J 2HOEA 2P7VB 2ZZFA 4IW3B 2BZTA 1H8HA 3HC7A 2B7BA 1G6NA 2ECCA 2XTWA 3FIWA 1JTXA 1UHMA 2Z6BD 2K9SA 3I55B 2FOWA 3M1CA 3ZQ7A 2JA8J 2IAIA 3HM5A 1W35A 3DKWA 5B1BH 3PSFA 3B6CA 3M8JA 4XRFA 1OQYA 1IUFA 1JKPC 4I98B 1UFMA 1YS7A 2HDDA 4P3YA 4LG0A 2GJKA 3B73A 1R5HA 5FFXA 3GQ9A 1BM9A 2OQRA 5BS6A 4IVNA 1B8IA 3P27A 4XICA 2C78A 3C1DA 3CDLA 4RLFA 5IYPA 3GLXA 3RIRA 2M5WA 1K79A 2V1NA 2QZ8A 4B44A 1MMAA 4M1KA 3GTPJ 1U6GA 4QVAA 4NC7A 1JKOC 1OCOH 3DPTA 3VPRA 2BY2A 1QFJA 4BEHB 2P6SA 2H1LA 3VYRB 3JRFA 4N3GA 2DYIA 2QTZA 3C2HA 3KPHA 5GAHJ 2O04A 2VJJA 1SD7A 4D1QA 5A2QZ 2MYSA 3FK7A 4HPQA 1YJNB 1PJ7A 2ZJ2A 1CQXA 3HOWJ 2EIJH 2DA6A 5K7HA 2ISYA 3GTOJ 4NHJA 4IOAF 4X7EA 1JGGA 1DGRM 1TW2A 4UZFA 2Q1ZB 1JT0A 5M5WJ 5DS9A 1P7JA 5TV2A 4QPQA 1ZGJA 1IV8A 4XRMA 4BNCA 5D8LB 4MQVA 2RNGA 2FQ4A 4AWXB 1IXRC 2DTZA 4PJMA 3WBKA 2ZFUA 3C7JA 1AHDP 2JN6A 4PUSA 1AIRA 4X1EA 1G59A 2MLGA 3JSPA 1K61A 1RIOH 4RAZA 3S32A 5LRRA 1ZRFA 3KP5A 1KJZA 4XOPA 4NBSA 4I99C 3QE2A 2DFIA 1Y8RB 5F64A 4P22A 3Q0UA 2E1MB 2K9MA 4MFEA 3T53B 1R36A 4KT5C 2XB5A 4X06A 4FASD 4ESFA 4ZCLA 3CMYA 1QZYA 2OU2A 3WBJA 1HSTA 4EM1A 1EFTA 1OYIA 2K86A 2OK7A 4AF7A 1MBHA 2EPFA 1QUEA 3E5XA 3B4NA 4N4NB 4Q48A 1R7JA 3VYTB 4B8XA 5C1EA 4U9UA 1X0CA 1U9OA 5H6RA 2E2HJ 2DFFA 4XKVA 1RESA 4IOCF 2BX6A 3CDIA 4CH7A 2C2WA 3E5UA 3SQNA 1GDTA 3D5LA 3QOPA 2W4SA 4AIHA 1U3EM 2KLOA 2O0YA 4A5MA 4KN7X 2DLLA 5A8AA 2ZCWA 2DODA 2VODA 2Y69H 3LQRA 1OISA 2KRCA 3IWZA 4PJLA 3MKYB 2RNJA 1YITI 4RDLA 4MEXF 1ETVA 2DMQA 1ULYA 5DD4A 4JQFA 5DD8A 2LK2A 3OYDA 1ZG1A 3BDDA 1TQMA 5D6EA 2E19A 3DPUA 2PLFA 5BSXA 3FXMA 2ZMEC 2F43A 2VBWA 3QAHA 3F6VA 2I8DA 3I71A 4CSWA 5TGTA 1RNLA 5CQGA 5KNLA 3GFIA 3LFKA 2L7KA 3N97A 1ZG5A 3HZJA 2PJRA 5J1YA 4GYGA 2QGUA 1JHFA 1UD2A 1W5TA 4IHSA 2VBTA 1J5YA 5FGMA 4EEFG 3JAMZ 4PJJA 5JLXA 1FX0A 1MJBA 1QZEA 3V42A 1KTWA 3F23A 2V7UA 2G7UA 2X0LA 3QQAA 4M6YA 4LK1F 4XONA 5FA6A 2LVSA 1E2XA 3RZOJ 2M5SA 2BM5A 2KIUA 2QVOA 3ZSCA 1VQ5B 1F4KA 3H94A 2XRNA 5IOZA 4YAFA 2GA1A 2JA2A 2B9SA 1W0UA 4AM3A 3AG4H 3OE7A 1QQIA 2BHZA 1VQOI 2LKXA 2PMUA 1YW8A 3REOA 4BBRJ 3GWZA 3AG3H 3LSPA 1UELB 2QQ9A 1CF7B 4OOSA 2R7QA 1H9TA 3WNDA 2HTJA 3AL0C 4BJTA 4XL9A 1HKQA 3U6KA 4BHBA 4CXFA 1LEBA 1WQ2A 1OLTA 2LP0A 1Q1VA 3GFLA 4J19A 4X0CA 3E5QA 2VQCA 3RPUA 1F20A 1KCCA 2AXTC 3HHGA 2O61A 1OCCH 2A68F 1T95A 3N4MA 2MSYA 2C5HA 2NT9A 3QFSA 2BY0A 2V79A 3GYHX 3M4OJ 5K7ZA 3Q38A 3HTUA 5GTHC 3SQVA 1QVGB 1OKRA 1P6RA 2F5EA 5BQTA 1GV5A 3MKLA 1A8PA 2ZL5A 2P7CB 2VI6A 3F8FA 3CMMA 3KYLA 4L18B 2ZBVA 2JSCA 3KZZA 4IHXA 5IPAA 5EEGA 4QVJA 2RDPA 4P96A 5J3OA 1N25A 3FXRA 4Y7CA 1P4MA 4ZZLA 4YAUA 3AVYA 2V6CA 2K9NA
chains in the Genus database with same CATH topology
1N75A 1QJVA 2M7AA 1X4OA 5CQEA 3H5NA 4NC8A 2DT7B 3HPGA 1COWA 1KMHA 4JMQA 1UD3A 3D5RC 3S93A 3DU6A 3A3BA 2DT6A 4Z03A 4BGDA 2Z8GA 4YZQA 3HOSA 1E43A 3EQOA 4II3A 2IS1A 1MMDA 1ZELA 4E0FA 4ZDLA 1IB4A 4D9JA 3QYFA 1SKYB 2ZXHA 1O8DA 3MKZA 3EUAA 4C30A 2GOXB 3GQ7A 1KCDA 3H0DA 1WJEA 3CJQB 4YZAA 4F92B 2CW8A 1EE6A 2R7WA 2JJ1A 3K6GA 2WY7Q 2O0WA 2RREA 3CP2A 1T5EA 4IZZA 3AKZA 5FL7A 1WPCA 2E1MC 2ZXIA 1X19A 1PKVA 1UD2A 3K4BA 2GOMA 2W1OA 2F1MA 2UUZA 3CJRB 4PFPA 3VSKA 2NZMA 1YX3A 3UR3C 2Y0SA 2X1EA 2AQFA 4ZTJA 4IKFA 2LC2A 2R4GA 2W7NA 3J7AY 4QPOA 4CZCA 1RWRA 3VSTA 1WFXA 3CF2A 1V5GA 2ELJA 1OFLA 4KKTA 4J01A 2QXZA 3DTKA 1WJAA 3OYLA 4BDZA 4AU7A 2F5VA 4Y4RA 3L2WA 1PLUA 4U87A 4HIZA 2V7QA 2VB6A 4RLQA 2DOAA 1E0EA 4F55A 4G6TB 4II2A 4F93B 2KL4A 2WAEA 4XKWA 1OB0A 2ZTNA 2IS2A 1MABA 2JVGA 2IGOA 1O8MA 2QKLB 1OR7C 2CUZA 2CV0A 2L9SA 3NE5B 1WMRA 2V9KA 1MNEA 3SDBA 3OIQA 3RQ4A 4CCMA 4MLOA 3L2UA 2NT6A 4ZYAA 2BW3B 3E1SA 1VZ0A 2LY2A 4W8TA 3HUGB 1QU3A 2KHMA 4XN3A 1UG0A 4EATA 3ZGKA 1SAUA 4U4BA 4ITVA 1D1CA 3ZPPA 1MW7A 2K9LA 1G8XA 4YZXA 2VXZA 2X53S 2HDWA 3HAGA 3DKXA 4BEHA 4BE0A 1I8DA 3K4LA 4B43A 1O8IA 1JI8A 3BH4A 3KRGA 2XAUA 1DQUA 4YXWA 1WJ5A 2KZVA 2VBEA 1BHEA 3DQVC 2HPIA 2LBFB 4BQOA 3LL7A 3H9GA 1O88A 2JVHA 3RCOA 2INVA 1K5CA 2XZLA 2M3AA 4HSRA 4E7SA 3OYAA 1IDKA 2M4KA 2O1DA 1PJRA 4X0GA 2CW7A 1DBGA 3GQAA 4G7WA 3PL8A 1Z3XA 2MABA 4G7XA 2ZSIB 2LREA 3GVKA 4PMHA 4IX7A 2IGMA 2UWMA 3JU4A 3S3OA 1H8EA 1O8KA 2IQ7A 4OZYA 4C2LA 2O17A 3SEQA 3HOTA 3OYKA 4E6KG 3FKSA 4BQQA 4LG3A 3T51B 3I9V2 1QHGA 3T56B 1U0JA 1KONA 1D1BA 4AVZA 3OS1A 2VLAA 2KVOA 4AYBA 2INUA 3DLAA 2CH0A 4OZZA 4CCNA 2KRHA 2VJ4A 2IS6A 1AA7A 1WJDA 3K10A 3RPUD 3RTRA 3QOEA 3GBGA 4GQNA 2X6WA 3IP4B 4ZC3A 4B3GA 3FDYA 4XM3A 2Z2SB 1IRXA 3UNGC 2LRDA 4B47A 1OGMX 4W8QA 3H5AA 3K4NA 4B48A 4ZJZA 4DK1A 1E3XA 3EUHC 3F9KA 2WJYA 3OFNA 4CCLA 2KP6A 1HA8A 5HOOA 2JIZA 2KQRA 3U21A 5LFAA 2QY1A 3CP8A 3DDYA 2IXSA 3QYEA 2Z1DA 3A35A 3LMWA 3FBNB 3SZGA 2PYHA 2VBMA 1E79A 1EA3A 2VIXA 2K3PA 2XZPA 2LBFA 4XLEA 2E60A 3OYHA 2W82A 1IA5A 4TT3A 4GRIA 2HLDA 1E1QA 4W8SA 1MNDA 2W00A 3MMYB 4BACA 3KEWA 4ZDOA 4BJ6C 3DTIA 2XC7A 1UD4A 3DPLC 3BCFA 2XZOA 1NHCA 2OUMA 1BOBA 2XF6A 4HNTA 1OOCA 3HPHA 1UD8A 3ZXSA 2NTQA 1TZLA 3MD2A 5FROA 2MC4A 3OYCA 1W0JA 3BCDA 3TMOA 3QYBA 2PYGA 2WB1A 1WTHD 4NK6A 2IGKA 2IS4A 4EW9A 3EUKL 2NOJB 3VMWA 2LY1A 4OWRB 4E7IA 2ZZQA 3ZR8X 4BDYA 2BW3A 3BC8A 1HVXA 2X3HA 3NWSA 1VBLA 3OL4A 3PNYA 4XOTA 4DOZA 1BR2A 4XKBA 3GRHA 1D0ZA 3OIPA 3DKYA 3B90A 1TT0A 3DU5A 4XKCA 3NWTA 3LSGA 4DNRB 3K70C 1ERDA 4F91B 1Y6IA 3BCAA 2D3LA 4L8JA 2V4DA 3WWGA 2R7UA 1BR1A 1OHHA 4XQFA 4KKUA 4IQ4A 3OY9A 3PSIA 2WPDA 4NK8A 3IAM2 4E4HA 2LYCA 2XF7A 1GLNA 4E7HA 2UVFA 2X85A 1N77A 4BL0B 2X6XA 2UVEA 1YX5A 2CFOA 1D0XA 3HL2A 3OYIA 2VJIA 4MR0A 1H80A 1N78A 4KKSA 2DCEA 3T9GA 2CV2A 1FMWA 4E7KA 1PXZA 2DIEA 1JTAA 4UZUA 4Z06A 1X1CA 3OYFA 2IGNA 3EPZA 3ZQQA 3VSLA 2DJIA 3S3MA 3A2KA 1WJCA 2M0MA 3IUOA 2HPMA 2WSSA 2X8KA 2WBMA 2A6TA 2NSPA 4XLAA 1I18A 2HVSA 2ZZGA 4DJAA 3HKZA 2KPMA 4HNUA 5HKKA 1D0YA 1W36D 1WJBA 2XGJA 2NTBA 4RM2A 1P9QC 4OJPA 1QCXA 2FUG2 3GQ8A 2VKDA 1WJFA 4KT6A 3TL4X 4BS9A 1VLYA 1BN8A 3WQZA 3H5RA 3BC9A 1K28D 2WZPP 4DBQA 3GVLA 2KDOA 2MFZA 1X1AA 3OEHA 3HG9A 2W6IA 2OV7A 2L2OA 1KZLA 2LOOA 3S8PA 4Z1MA 2BVMA 4IQJA 2HNHA 1BMFA 2WJVA 4ZDPA 3IAS2 4N4OB 1UD6A 1GQ8A 2HU9A 3VSUA 2L5QA 2XSJC 2HQAA 3K70D 2P0WA 3AFHA 3FPPA 4P5OA 2JSPA 2VJ5A 4RMNA 3G05A 3QODA 3OEEA 4HSTA 3SYTA 4JOMA 2QE7A 4OJLA 4DGWB 4DBRA 3OOCA 3L2VA 1X4PA 2PMZA 2CK3A 2QKMB 1NBMA 2V7FA 2W6JA 4ZTFA 1W9XA 2L9NA 3EQNA 2E5ZA 4PSXA 2E1BA 3ZRGA 3BLYA 3CZ6A 3PJRA 3PNVA 1O8LA 4HG2A 3C2GA 2VQLA 1Z7LA 2CV1A 5DN6A 4OAYA 2ZZEA 1VJSA 1PE9A 2E5NA 5CDFA 2BOLA 1NG6A 5CPRB 4C2UA 1LDKB 3OPOA 1RMGA 3GQBA 4J00A 5LD2C 3DEEA 3OAAA 4FXUA 3K4JA 4ANJA 4LITA 3SEZA 4BQNA 2R7TA 2CUJA 4HEA2 2CS3A 3HXLA 2CMPA 5KCMA 3LSKA 5HVQC 2DXIA 4HRIA 2ZZFA 1H8HA 2XNDA 3HC7A 3OS0A 4BU2A 1BPLA 2UV1A 3OL3A 3BG7A 1LFPA 2Z6BD 2R7RA 3KEYA 4CCOA 3VSVA 3M1CA 3SUCA 3BG6A 2GJRA 2ZSHB 4RM3A 4KISA 4CCKA 2VASA 3PSFA 2VPLA 3M8JA 1K6YA 3OYGA 4YRVA 2GJKA 3VWBA 1HG8A 3GQ9A 4Z05A 3LSIA 4E7JA 2VBKA 2R7OA 4RLFA 1W0KA 5HNHA 4R79A 2Q2EB 3OYNA 1OGOX 1BR4A 2V1NA 3OWTA 2ODLA 4B44A 1MMAA 1YE9A 1V0EA 4NC7A 3E0JB 3W2WA 4NUBA 1MMGA 2XF5A 4CCJA 5FRNA 1DGWY 3N05A 1O8EA 4U49A 3DPTA 4BEHB 2V31A 2O0VA 4P1WA 3VYRB 4XLHA 4G6IA 1Z3YA 5JHFA 4NQWB 3C2HA 4FETA 4CUGA 2O04A 2VJJA 4D1QA 4PK4A 3L2RA 3RSNA 2MYSA 4HPQA 4PSWA 2GK7A 2WA0A 3VYUB 2ZTGA 2X51A 1BLIA 4OAZA 3OMYA 4OJ6A 4TSFA 3FY3A 2R9VA 1DGRM 4LIUA 4XLFA 2A5WA 2Q1ZB 3FBIB 4BXFA 3KX2A 2AQEA 4QPQA 2VQGA 3JURA 3H35A 1O8GA 2RNGA 3DTEA 4E7ZA 3VMVA 1R6RA 2OC6A 4PJMA 3ZCOA 4I84A 1CZFA 3I3LA 2ZFUA 3FHNA 4PUSA 1AIRA 4F52A 5HLTA 1NG7A 1G59A 3A4CA 1WP6A 1UAAA 1V5FA 3S32A 2X1CA 3UW0A 4H4KC 4XOPA 1S9HA 4BE2A 2JJ2A 1W36C 3OR2C 1E1RA 4P22A 2LH9A 4MXNA 2E1MB 2K9MA 3DWLE 3ONQA 3T53B 3LFUA 2R7VA 2JDIA 4XNFA 4FASD 2HVRA 4TKOB 2MD0A 4C2TA 4CA0A 4DNTB 2VKHA 3OYEA 2V4JC 3B4NA 4N4NB 2NTPA 1LVKA 4B3FX 2F4IA 2D3NA 3VYTB 5C1EA 2V6EA 1X0CA 1X1DA 5FRMA 2VXDA 4ASUA 4XKVA 2XDVA 2NSTA 2VQHA 4CH7A 2R7SA 2WADA 1EFRA 3K4KA 3D5LA 2W4SA 2KLOA 3ZPNA 3OYMA 4PFOA 2BSPA 3A3GA 3ZIAA 2PECA 5IK2A 2KRCA 1O8HA 4PJLA 3MKYB 4W8RA 4XLCA 3CESA 5HNFA 1LKXA 2VL8A 3S3NA 3OYDA 4JQFA 4LIVA 1D1AA 1FMVA 3G2BA 2M4GA 2V26A 3DPUA 4YELA 3VYSB 2PJRB 2O5RA 2WAFA 2F43A 4CSWA 3LNNA 2I8DA 2LZJA 1UD5A 2BVLA 5CQGA 5TGTA 5KNLA 4DIQA 2GK6A 2L7KA 4XORA 4HWVA 2PJRA 3PFYA 1E3ZA 2M7BA 3OOUA 1OFMA 2XOKA 2KMUA 1O8FA 4XR6A 3K4MA 4KITB 3D5SC 4PJJA 1FX0A 3VDXA 1SFKA 3W2AA 3V42A 1O8JA 1XG2A 1KTWA 3FKJA 3LSHA 4YEJA 2F6CA 4YZ0A 3LMMA 3BCBA 4XONA 2Z16A 2M5SA 4U7BA 4E7LA 4Y33A 1QHHD 3ZSCA 3LSMA 5C1CA 2LG4A 3K4CA 3H94A 3VR6A 2EWEA 1DBOA 3OYBA 1Z21A 3B8YA 2JA2A 4Y3OA 2QX3A 2RQQA 3OE7A 1NRKA 1MMNA 3PUBA 3W3CA 4XN0A 1X1BA 1Y56A 1RU4A 3L2QA 2WAQA 4KJZA 1UELB 3A1YA 2R7QA 2X6YA 3OS2A 1IDJA 1T0FC 4URRA 3AL0C 3TBIA 4BJTA 4XL9A 2WY8Q 3PNTA 3GVJA 5KHDA 3H9QA 5AMVA 4C9YA 1OLTA 1V5EA 2X1DA 4BE1A 4DK0A 3OW7A 2VQCA 1V0FA 1KCCA 1DP3A 1VF7A 1T95A 2NT9A 2HVQA 3H9JA 4OJOA 3AL0B 1JRGA 4OJ5A 3OYJA 4B3XA 1J09A 4NNJA 4PJNA 5CKTA 1PYVA 2K5CA 3OR1C 4XD7A 3CMMA 3KYLA 2GJPA 2HZDA 3W2VA 2JUGA 4F3QA 4XMYA 2R7XA 1HZEA 4BUPA 3MKWB 4BJ5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6W A;  1QJV A;  1BN8 A;  4XM3 A;  4Z03 A;  3UW0 A;  2Z8G A;  1OGM X;  4W8Q A;  4YZQ A;  4XOP A;  3EQO A;  1IB4 A;  4MXN A;  1O8D A;  1KCD A;  3GQ7 A;  1GQ8 A;  4XNF A;  2QY1 A;  4YZA A;  3VSU A;  1EE6 A;  3LMW A;  2VBM A;  2O0W A;  4XLE A;  3B4N A;  2NTP A;  4OJL A;  1IA5 A;  5C1E A;  1X0C A;  2NZM A;  4W8S A;  4XKV A;  1RWR A;  3VST A;  2NST A;  3EQN A;  1NHC A;  1OFL A;  1OOC A;  2QXZ A;  1O8L A;  2BSP A;  1PLU A;  2PEC A;  2NTQ A;  1O8H A;  4W8R A;  4XLC A;  1PE9 A;  2PYG A;  4NK6 A;  1RMG A;  4XKW A;  4EW9 A;  4YEL A;  2PYH A;  3VMW A;  1O8M A;  2X3H A;  4XOR A;  1WMR A;  4HWV A;  1OFM A;  1O8F A;  1VBL A;  4XR6 A;  4XOT A;  2NT6 A;  3GRH A;  4W8T A;  3VSV A;  3SUC A;  1O8J A;  1XG2 A;  1KTW A;  4XN3 A;  4YEJ A;  4U4B A;  3B90 A;  4YZ0 A;  4XON A;  3ZSC A;  3ZPP A;  5C1C A;  4YZX A;  2EWE A;  1DBO A;  3B8Y A;  2QX3 A;  1HG8 A;  3GQ9 A;  4Z05 A;  2VBK A;  4XN0 A;  1O8I A;  3WWG A;  3KRG A;  4XQF A;  1RU4 A;  1OGO X;  2VBE A;  1BHE A;  4NK8 A;  2X6Y A;  1IDJ A;  2ODL A;  4URR A;  1O88 A;  2X85 A;  4XL9 A;  2INV A;  2UVF A;  5AMV A;  4U49 A;  1O8E A;  2X6X A;  2UVE A;  1K5C A;  1IDK A;  2O1D A;  2O0V A;  4XLH A;  2VJI A;  1DBG A;  3GQA A;  4MR0 A;  1H80 A;  1KCC A;  2NT9 A;  2O04 A;  2VJJ A;  4OJO A;  3T9G A;  1JRG A;  1PXZ A;  1O8K A;  4OJ5 A;  4PMH A;  1JTA A;  4C2L A;  4Z06 A;  2IQ7 A;  4OZY A;  2O17 A;  4OJ6 A;  3FY3 A;  4XLF A;  2NSP A;  4XLA A;  2INU A;  4AVZ A;  4XMY A;  3JUR A;  1O8G A;  4OZZ A;  2NTB A;  3VMV A;  4OJP A;  1QCX A;  4I84 A;  1CZF A;  3GQ8 A;  1AIR A; 
#chains in the Genus database with same CATH topology
 1MRZ A;  2JMW A;  4MTE A;  2DT7 B;  3HPG A;  1FIP A;  5L3D A;  2MD5 A;  1BX0 A;  1OPC A;  4II3 A;  1E43 A;  1ZEL A;  4Z4R A;  3FX3 A;  5J40 A;  2YPR A;  4ZDL A;  4D9J A;  3PUM A;  4PGG A;  5B5E C;  2ZXH A;  3WTS C;  3Q0V A;  5F27 A;  3JR9 A;  3EUA A;  3LA3 A;  2GOX B;  4FQG A;  2HFH A;  3MKZ A;  3PUN A;  3BY6 A;  4PC3 A;  3ZBT A;  3GQ7 A;  3GLL A;  3TW6 A;  2CW8 A;  3FM3 A;  5DUI A;  2DA4 A;  1IN8 A;  2ECB A;  2OTJ I;  2JJ1 A;  3K6G A;  1YS6 A;  4M53 A;  2WY7 Q;  3H92 A;  3CP2 A;  1TQI A;  3MHP A;  5BPI A;  2DK5 A;  2DMP A;  2W1O A;  5DCM A;  2DAO A;  4X7D A;  4PFP A;  3TKY A;  1KC8 D;  2WV1 A;  3UR3 C;  5JHU A;  1EKE A;  2VYQ A;  1TT5 B;  2QQB A;  2LTP A;  2N8G A;  4ZTJ A;  4IKF A;  1GV2 A;  4QPO A;  4CZC A;  4S04 A;  1R23 A;  4CO8 A;  3MWM A;  1OFL A;  1VTN C;  5GP9 A;  2BN4 A;  4ESJ A;  1A31 A;  2ZNY A;  4IEJ A;  1QO0 D;  4AYB N;  2NVT J;  1AWC A;  1IUY A;  2C6Y A;  2XNJ A;  4M0L A;  4G6T B;  1B59 A;  2ZTN A;  2KL4 A;  3TOA A;  4XKW A;  3M3Y J;  4LBZ A;  2IGO A;  2W84 A;  1OR7 C;  3JQP A;  1ZLJ A;  5L3C A;  4XK4 A;  3BZK A;  1PKV A;  2K27 A;  2V9K A;  4UUV A;  2FF4 A;  5E18 F;  3B82 A;  3CCV B;  1TLH B;  3I5U A;  3BZ6 A;  5E1X A;  4MLO A;  5JFR A;  3L2U A;  2EB7 A;  1QA1 A;  3P9C A;  2WR8 A;  2LFB A;  2LY2 A;  4YII A;  4W8T A;  1YIO A;  3HUG B;  3RIQ A;  5JBQ A;  2DU9 A;  1SAU A;  3T8T A;  2EIM H;  4X8I A;  3HKZ N;  1D1C A;  5D5V B;  3FWE A;  2A07 F;  3IV5 A;  4ZH4 F;  1G8X A;  4N9H A;  1XGN A;  2V7W A;  2X53 S;  4UV9 A;  2YR2 A;  4BEH A;  1TUI A;  3CB4 A;  2XAG A;  4BE0 A;  1VF9 A;  3LNN A;  5CJ9 A;  4B43 A;  1O8I A;  5ICE A;  3M07 A;  4X07 A;  5FLX K;  4YXW A;  1S72 I;  1W5C C;  4YEI A;  1X1P A;  4HAM A;  4BQO A;  9ANT A;  1B9N A;  3H9G A;  1O88 A;  1MBK A;  1OB5 A;  1JE8 A;  3OSF A;  2M4K A;  1PJR A;  5F0C A;  2E2J J;  5DSZ A;  3K1M A;  4DNC A;  2DJN A;  3A0H C;  1BJZ A;  3IRR A;  1ZAO A;  3QWL A;  3K2Z A;  1FX7 A;  3NAR A;  2V1D A;  1H85 A;  2I10 A;  2XPU A;  2IGM A;  4M9X A;  1O8K A;  1H8E A;  4OP7 A;  4C2L A;  4OZY A;  2STW A;  1OCR H;  1YJ9 I;  2FXA A;  4D5C A;  4BQQ A;  1QHG A;  3ABU A;  1T6Z A;  1U0J A;  4G8X A;  1UG2 A;  4OPW A;  4AVZ A;  3ZMT A;  4EV0 A;  2AHQ A;  1SD5 A;  4CCN A;  2LF8 A;  2X6O A;  2Y31 A;  1AA7 A;  5E3O A;  1WJD A;  4QTR A;  4FX4 A;  2IS6 A;  4P6V F;  3K9T A;  1KK3 A;  1TWF J;  4MYU A;  2XSD C;  3IP4 B;  3A01 B;  4KDP A;  4ZC3 A;  1ZLK A;  2GRE A;  4DZP A;  4RB2 C;  1HQC A;  2Z2S B;  2VC0 A;  4L5J A;  4B4C A;  1YW7 A;  4FIS A;  3NRV A;  4B48 A;  4G1B A;  2DFE A;  2QCO A;  4JX6 A;  3F9K A;  5J1U A;  3OFN A;  2EZK A;  1LNW A;  2RN7 A;  3U6B A;  3CC2 I;  2C4T A;  2JIZ A;  1ZTR A;  3LNQ A;  4YFX F;  5EGO A;  3TGN A;  3DDY A;  1E79 A;  1EA3 A;  1MMS A;  2LBF A;  4AVP A;  1DPU A;  1W34 A;  1GXP A;  3CD6 I;  1TYX A;  2E60 A;  3GIR A;  4UVC A;  4FE7 A;  1OGI A;  2EV6 A;  2W82 A;  3RKQ A;  2Y30 A;  1E1Q A;  2KJC A;  2W00 A;  2QZA A;  4NB5 A;  4XRS G;  4L9N A;  3TDZ C;  3C2B A;  1D8K A;  3WU1 B;  1T38 A;  1WOS A;  4HLX A;  4BYY A;  3BJA A;  3CMA B;  1Y0U A;  4L5I A;  5C4X J;  1OOC A;  3ZMU A;  4RB3 C;  3W5H A;  1QH0 A;  1IDZ A;  3WGH A;  2QSF X;  1V54 H;  5FRO A;  3BCD A;  2DEU A;  3TMO A;  3QYB A;  2UXX A;  4NBQ A;  3DCF A;  1WTH D;  1VQK B;  1Z9C A;  2L7F P;  4EW9 A;  2NOJ B;  2VE8 A;  2EZL A;  4YIF A;  2P8T A;  3OZW A;  2A61 A;  1W7P D;  1WVR A;  4OWR B;  2XGX A;  4WWV A;  3CME B;  3LJY A;  1XD7 A;  3BC8 A;  3FXO A;  3NWS A;  4M74 A;  2MLK A;  2VNH A;  3A8K A;  2NS8 A;  1VBL A;  2OTL B;  4M4S A;  3SFZ A;  1BR2 A;  2BXZ A;  3CC4 B;  3CCQ I;  2DDB A;  3IC7 A;  3DKY A;  1OJL A;  3CME I;  3LQE A;  4LBY A;  5LEJ A;  2HOS A;  1ZUN B;  3B90 A;  4V02 C;  4OM9 A;  2CQQ A;  5IP7 J;  2F3L A;  4FX0 A;  4DNR B;  3AGQ A;  2LR8 A;  2XV4 S;  4M3F A;  3K70 C;  3JTG A;  4P3I A;  1TQP A;  1A6I A;  3E6C C;  1ZRE A;  1IV6 A;  1BIA A;  3FXK A;  3WWG A;  4OMZ A;  1BR1 A;  1OHH A;  4XQF A;  4WZT A;  2CRG A;  3GTG J;  1KQ0 A;  4YHB A;  4NK8 A;  1XDU A;  2UZK A;  1LDJ A;  1GLN A;  3P4G A;  1V4R A;  2GXG A;  2X85 A;  5IYB J;  2Z5U A;  5BOX A;  1X2N A;  4BL0 B;  2X6X A;  1YX5 A;  2XGE A;  2PI0 A;  1D0X A;  1JUM A;  3BJO A;  1N78 A;  5KAI C;  4YC5 A;  3W2H A;  2EFO A;  2DCE A;  1AKH A;  3LST A;  3I53 A;  3Q0W A;  4LBW A;  3BQY A;  4E7K A;  2W85 A;  3SLN A;  1X1C A;  3BR2 A;  3V7A A;  1KTV A;  3S2W A;  3VSL A;  3I54 A;  4G7O F;  1WJC A;  2M0M A;  2QEX B;  2HPM A;  3U9G A;  2F4M B;  3G6E I;  2NSP A;  4FK8 A;  3NB2 A;  1YJW B;  4DJA A;  3HKZ A;  2KPM A;  3PFI A;  2J5P A;  2NTB A;  2M8G X;  4C3J J;  1FND A;  1F1Z A;  3S2H J;  1WRJ A;  3CCU B;  4JRA C;  5FLM J;  3H36 A;  3TL4 X;  3G6E B;  4FN5 A;  4PZJ A;  5TJJ A;  1P4X A;  2XRL A;  4YFK F;  3BC9 A;  5D4S A;  1QPI A;  1G7C A;  4M71 A;  2FE3 A;  4DBQ A;  4K2E A;  5CLS A;  4HE5 A;  1K8F A;  1QA2 A;  5TRD A;  1QG0 A;  1WH7 A;  1KZL A;  2FNA A;  2OBR A;  2BM0 A;  4Z1M A;  2BVM A;  4IQJ A;  2WJV A;  4ZDP A;  3MCZ A;  4CDG A;  3KZI C;  4L9T A;  3CCM B;  4N4O B;  1KCD A;  1LE8 A;  5IT9 K;  2XSJ C;  3K70 D;  1KYW A;  3TED A;  4Y7N J;  2JA7 J;  1YOV B;  4NQW A;  1K4S A;  4A3B J;  3ASO H;  4PGO A;  4D7M A;  3X2Q H;  1HKT A;  4JOM A;  1R5O A;  3QRF F;  2QE7 A;  4OJL A;  1IW7 F;  1U2W A;  1P7I A;  4RAY A;  4G5G A;  2BM6 A;  4P2N A;  1NBM A;  2V7F A;  1K9M D;  2B7E A;  3AST A;  1VQK I;  3GF2 A;  3JAM K;  1FSH A;  1MJ9 A;  2F5F A;  2HYJ A;  4G12 A;  5J6X A;  3PJR A;  1LM1 A;  1S6L A;  2LLK A;  2DMU A;  3C2G A;  2QM3 A;  1Z7L A;  2VQL A;  3OZU A;  5DN6 A;  1I6X A;  2XHK A;  2E5N A;  2BOL A;  2QN6 A;  1KYZ A;  4EGY A;  4J0Q A;  1ZKG A;  3DFG A;  3G71 B;  3K7A J;  2VE9 A;  1IGN A;  2JRM A;  4U0W A;  2JN9 A;  3OAA A;  4RPB A;  4KUM A;  4BQN A;  2Y2Z A;  2R7T A;  3H9N A;  2CUJ A;  4Z6Y A;  1Z7U A;  5L46 A;  3HXL A;  2XRO A;  4JX5 A;  3LSK A;  3VNV A;  4GGG A;  1VQL B;  1RPW A;  2XND A;  1OCZ H;  4OMY A;  1BPL A;  3OL3 A;  4WF2 A;  1GVJ A;  3PM1 A;  1OGJ A;  1LFP A;  3V4G A;  3FKI J;  3KEY A;  4CCO A;  3JRH A;  4V2G A;  2EZI A;  3WNC A;  3BG6 A;  3VSV A;  2ZSH B;  1ETW A;  1M1E B;  4RM3 A;  3CCL B;  1SD6 A;  4CCK A;  3PEN A;  3BJ6 A;  2VT2 A;  2VPL A;  1QVF B;  1ELO A;  2QA4 I;  1SD4 A;  2F48 A;  4UUS B;  1ZAR A;  3PO3 J;  2OD5 A;  3LSI A;  1A35 A;  5J4Y A;  1D8J A;  2IA2 A;  4M3E A;  1Y1W J;  4ON0 A;  3CCL I;  1W0K A;  3MCA A;  3OYN A;  2Q2E B;  4RGR A;  5D5W B;  2VFM A;  2YS9 A;  1FTZ A;  4CZZ A;  1S3J A;  3RQI A;  1BI1 A;  2EFN A;  4LD5 A;  4Y9U A;  3WTU C;  1W7P A;  3KYD B;  2NVY J;  3LQQ A;  3N05 A;  5FRN A;  3CUQ B;  2V31 A;  2H1K A;  1MJA A;  3ASQ A;  1R22 A;  1QVU A;  2VNI A;  3BNW A;  1WU8 A;  4FET A;  4CUG A;  4PK4 A;  1WGX A;  4PSW A;  3J81 k;  3G73 A;  4YCQ A;  2PMZ N;  1J59 A;  3VYU B;  4WXH A;  1LEA A;  3ZMZ A;  4D5F A;  1KU3 A;  1ETQ A;  2ZTG A;  3ONU A;  3W2I A;  4OJ6 A;  2BF4 A;  3HSR A;  3CPW B;  1KU7 A;  3OJX A;  5FD5 A;  4LIU A;  2A05 A;  3FBI B;  2GPJ A;  1HW5 A;  3KX2 A;  2YWF A;  1HDP A;  2YSR A;  2XB0 X;  1JHH A;  3ERM A;  1W1W E;  3WTY C;  3WY9 A;  5JLV C;  2NV4 A;  3H35 A;  3A0B C;  2E34 A;  4UUT A;  4RBO A;  2NVQ J;  1HW1 A;  1RUN A;  3VMV A;  2OC6 A;  3ZCO A;  2V5I A;  3PSS A;  4BQA A;  3I3L A;  1XCV A;  4I84 A;  3BR6 A;  5HLT A;  1NG7 A;  1APL C;  5DS0 A;  4KFC A;  3A4C A;  1N06 A;  1DAB A;  1UAA A;  2GQF A;  1V5F A;  1UST A;  1L0O C;  1QVT A;  3VMF A;  2FML A;  4Q5S F;  2ELH A;  2VZL A;  2DCU A;  1S9H A;  1TL8 A;  1YIT B;  5EEH A;  4BE2 A;  1AOY A;  2JJ2 A;  4ZV4 A;  1E1R A;  4QWQ A;  5HS7 A;  4MXN A;  4RD3 A;  3DWL E;  1IN4 A;  2R7V A;  1S7O A;  1ZQ3 P;  3CRZ A;  1W4M A;  2MD0 A;  3DP7 A;  3GTJ J;  2XPW A;  3HIF A;  1OR7 A;  3BTI A;  3U1D A;  2NTP A;  1LVK A;  4PJ0 C;  3P26 A;  2FBI A;  2D3N A;  1N0U A;  2V6E A;  3CJT B;  5FKM A;  1NH3 A;  5J4V A;  2LMD A;  2Y0S N;  4A3M J;  1MBF A;  2LDU A;  1MKM A;  2Q6I A;  5FFZ A;  2WAD A;  4ZYG A;  2H94 A;  1BX1 A;  4IJA A;  1X2M A;  4KH3 A;  1YRN A;  3ZPN A;  2XPV A;  3OYM A;  1E62 A;  4PFO A;  2BSP A;  3BY1 A;  2RV8 A;  5IK2 A;  2FVG A;  1X3U A;  1HA3 A;  4XLC A;  3CES A;  4WQM A;  1LKX A;  1TYW A;  3BTC A;  1KD1 D;  1D1A A;  2E1C A;  1FMV A;  4X6A J;  1J9I A;  1XFO A;  3TO6 A;  2PYH A;  3BH6 B;  4RS8 A;  4L9V A;  2K02 A;  4RB0 A;  3GTM J;  1YX2 A;  3VOE A;  1RRJ A;  1FBQ A;  3HGY A;  3WG7 H;  4DIQ A;  4XOR A;  1XB2 A;  5BMZ A;  2VBZ A;  3PFY A;  1R71 A;  1OFM A;  3OOU A;  4EM0 B;  1LFU P;  2KMU A;  2OJE D;  1R00 A;  1PUF A;  1I1S A;  3K4M A;  4KIT B;  2NS0 A;  1FRQ A;  3GXO A;  3VDX A;  4G7H F;  5J47 A;  3PO2 J;  4RCZ A;  2M0C A;  4ZCI A;  3CCS B;  1XG2 A;  4YAW A;  3FKJ A;  3LSH A;  1YQA A;  3LMM A;  3BCB A;  2VFN A;  3SLD A;  5B1A H;  3CMA I;  4E7L A;  1I3Q J;  3M8F A;  2EWE A;  2ID3 A;  3V7S A;  5CVR A;  4FTH A;  1HOM A;  1NRK A;  3PUB A;  2XAQ A;  5E20 A;  1PJ6 A;  5A2Q K;  2MG4 A;  1Y56 A;  3HRM A;  2E36 A;  3F8M A;  2X6Y A;  3SDG A;  4HYE A;  1T0F C;  1ZH5 A;  3TBI A;  1RQP A;  3GVJ A;  2ZBK A;  5KHD A;  3H9Q A;  2BEO A;  3DV8 A;  1SAN A;  2E7X A;  5IP6 A;  6PAX A;  1V0F A;  2LKS A;  2YWE A;  1LUJ B;  1VI0 A;  4BHC A;  2HVQ A;  3H9J A;  3TDU C;  4DYC A;  3CC4 I;  1R4N B;  4ZYH A;  4OJO A;  1JRG A;  4OJ5 A;  3OYJ A;  4B3X A;  2V1X A;  5LGT A;  5CKT A;  1PYV A;  2K5C A;  4A93 J;  4RD6 A;  3J81 K;  4XD7 A;  4Z2Y A;  1IXC A;  3MZY A;  5J3L A;  3CCR B;  1IJW C;  2HZD A;  1SVM A;  3LSR A;  3KEQ A;  1PVE A;  4F3Q A;  4BUP A;  3ZC3 A;  4O5V A;  3ROU A;  1QGY A;  4GYI A;  4UNO A;  1LFB A;  1S29 A;  5D4R A;  1K83 J;  1DU6 A;  3HSF A;  4BJ5 C;  5GAD J;  2DFH A;  4M3G A;  2KDZ A;  1QX4 A;  2D9R A;  2J8I A;  3ECH A;  3SZE A;  1VQP I;  1WZ2 A;  3SJZ A;  3PA1 A;  5E3M A;  3DEU A;  3H5N A;  4JMQ A;  1KMH A;  2JT1 A;  1COW A;  3J80 K;  3S93 A;  3ERE D;  3R0J A;  4BGD A;  4YZQ A;  5EYR A;  2EFW A;  3HOS A;  1MMD A;  2KJB A;  2L7M P;  2ESH A;  2EIN H;  3I0T A;  2HEO A;  3QYF A;  3S17 J;  1SKY B;  2WYR A;  1MZB A;  1SFE A;  3O6B B;  4QIW N;  5EDN A;  2WTE A;  2VOP A;  1QRB A;  1O3T A;  1RKT A;  2Z3Y A;  3CJQ B;  4N0B A;  1B6A A;  5FKO A;  5E79 C;  4F92 B;  4YZA A;  2QEX I;  3S16 J;  3SEJ A;  2O0W A;  2QMU A;  3FM5 A;  1QGA A;  1ZM2 A;  1M1K D;  4IZZ A;  5FL7 A;  5A89 A;  1WPC A;  2ZXI A;  3HDD A;  1I7P A;  2ZME B;  3K4B A;  2BBY A;  2F1M A;  2UUZ A;  3CJR B;  1DPR A;  3VSK A;  2NZM A;  1UB9 A;  4LJZ F;  5E1Z B;  3SZP A;  1KK0 A;  2CBX A;  5CVV A;  2W7N A;  1Y8Q B;  3HB9 A;  3BR1 A;  4OIR F;  3U2R A;  3DLL F;  1H0M A;  2ELJ A;  3R60 A;  1YJN I;  1T2K A;  3RYR A;  4S0H B;  3DTK A;  4J01 A;  4BDZ A;  1GAQ A;  2QXZ A;  3N90 A;  3P5J A;  4AU7 A;  5IP9 J;  4TMX A;  4HIZ A;  2V7Q A;  4HX7 A;  2VB6 A;  4RLQ A;  5L3F A;  3B02 A;  2K4J A;  4F55 A;  1FRN A;  2YX4 A;  3EQL F;  2D1V A;  4F93 B;  1OB0 A;  2B0R A;  3QPS A;  1WSU A;  4PCQ A;  2CV0 A;  1WMR A;  1MNE A;  1IO2 A;  1IRG A;  2E1R A;  2NT6 A;  2VKE A;  3IHU A;  3J7Y J;  3RY8 A;  2JQ7 A;  2IA1 A;  5E3N A;  4XN3 A;  4U4B A;  3ZGK A;  4I01 A;  4B1R A;  1JKR C;  1FOW A;  2GLO A;  3QU6 A;  1OMI A;  2BGC A;  3RDI A;  3ZPP A;  2K9L A;  5JI6 A;  3V8L A;  1TLL A;  2VXZ A;  5KVR A;  3HAG A;  2K85 A;  3EDP A;  1MSF C;  3K4L A;  3R6J A;  3IH3 A;  1KK2 A;  3BH4 A;  4FHT A;  1E3P A;  2CQN A;  1ON1 A;  1XX5 A;  3F0C A;  2P81 A;  2K40 A;  2XT4 A;  1XGO A;  3CUQ C;  2JVH A;  4C2M J;  2INV A;  5AN9 A;  1WPK A;  4EQQ A;  5KAF C;  2K3F A;  5EZH A;  5LBQ A;  4HSR A;  1W7P B;  1OCT C;  4X0G A;  3JRG A;  2CW7 A;  2ZB9 A;  2Q0O A;  4ABZ A;  2I1L A;  3EYY A;  1K73 D;  1RI7 A;  1Z3X A;  3KP2 A;  1SC7 A;  2PE3 A;  4G7Z F;  2LRE A;  3E20 A;  2VT3 A;  3IKV A;  4RAF A;  4IX7 A;  3JU4 A;  1WWX A;  2VBY A;  1VQ7 B;  5F1R A;  5FNZ A;  4LG3 A;  2F4N A;  1VQP B;  3ZN0 A;  1KON A;  3CCE I;  2KVO A;  1WCM J;  3L1P A;  1HDD C;  4AYB A;  3RKW A;  2AXL A;  2OBS A;  2KRH A;  2VJ4 A;  2HKX A;  4BHP A;  4WZE A;  3K10 A;  3RPU D;  2FA5 A;  3RTR A;  3CCV I;  5GAE J;  3T0Y A;  2QLZ A;  2YWG A;  5FO1 A;  4B3G A;  5D5X B;  4P6Y A;  4XM3 A;  2EIK H;  3TP3 A;  3LA7 A;  4IHW A;  3KL9 A;  1IRX A;  1K78 A;  1JJ2 B;  1TWG J;  4ZJZ A;  2EK5 A;  1R5G A;  4JK1 X;  2IT0 A;  1E3X A;  1ETY A;  1BW5 A;  3W5U A;  4HZF A;  1HA8 A;  2XVC A;  2HI3 A;  5C44 J;  5HOO A;  3NAW A;  1TP4 A;  2E71 A;  5LFA A;  4DYR A;  1RET A;  2QY1 A;  3J81 Z;  2IBD A;  4A3C J;  2IXS A;  2FNP A;  3QYE A;  4OU0 A;  3A35 A;  1YIJ I;  1IN6 A;  2K3P A;  3CCJ I;  4L0Z B;  2ELK A;  1CNF A;  1LVA A;  2ETH A;  3OYH A;  1IA5 A;  2HLD A;  3MMY B;  2HOT A;  2KIF A;  4X7C A;  4BJ6 C;  1LJ9 A;  3WE3 A;  1B72 B;  2XC7 A;  5FD6 A;  1UD4 A;  3DPL C;  1WSV A;  2XZO A;  3Q3A A;  1Z67 A;  4HNT A;  1LE8 B;  4KIB A;  2Q6O A;  4TMT A;  2NTQ A;  3HSE A;  3MD2 A;  2MC4 A;  2JRT A;  4KMF A;  1W0J A;  4RPD A;  1D1N A;  1P92 A;  2QF7 A;  2IS4 A;  2A6H F;  1T56 A;  4R71 A;  3ZQC A;  2KIS A;  2ZKZ A;  2ZZQ A;  5F4J A;  4I09 A;  3ZR8 X;  4BDY A;  5DNS A;  2WZN A;  1F36 A;  2P5V A;  4A3D J;  2GXA A;  1T8I A;  1F60 A;  1FEX A;  1B1B A;  3OL4 A;  3PNY A;  1IF1 A;  2XAS A;  3GZ6 A;  2HZT A;  2BGI A;  1VQO B;  1D0Z A;  4BAY A;  4U0V A;  2VN2 A;  3CJN A;  1XPX A;  2Y48 A;  5J8C A;  2MC3 A;  3DU5 A;  2BM4 A;  2NYX A;  4AIJ A;  1QGZ A;  3ONY A;  2VFO A;  3ISP A;  1ERD A;  3BCA A;  3E7L A;  3ABM H;  3GFJ A;  1E3O C;  1FBS A;  1YRN B;  2R7U A;  3P9K A;  2HDN B;  2WPD A;  4E4H A;  5IT3 A;  2XF7 A;  4EJT A;  3ABL H;  4Y52 J;  4HF2 A;  1I5Z A;  3CD6 B;  2O6W A;  1N77 A;  1D5V A;  5IY5 H;  2PFB A;  1WH5 A;  4RAG A;  3IL2 A;  1XB4 A;  1DP7 P;  3S15 J;  4HX8 A;  1KQ5 A;  4ESB A;  3PVD A;  3W2F A;  5K5Q A;  4GDF A;  3PA2 A;  2BSA A;  1A5J A;  1H80 A;  4YFO A;  5C3E J;  1SMT A;  2R7Z J;  5L3G A;  5K5O A;  4CYD A;  1JA0 A;  5M3M J;  5F4M A;  2HXO A;  2IEK A;  5GV7 A;  3T1B A;  3QPH A;  4KA4 A;  3FZV A;  2TDX A;  2FX0 A;  3EPZ A;  4RD2 A;  3BQZ A;  5EG0 A;  1NDH A;  2Y75 A;  3QPL A;  2R5Y B;  3KIO A;  4C0S A;  3T8R A;  3PIP F;  4CYC A;  2A6T A;  2AHO A;  1T6Y A;  3FXL A;  2D2W A;  2QEN A;  3ZMD A;  4HE6 A;  3ASS A;  4HNU A;  1HC8 A;  1FC3 A;  2V1U A;  3WYA A;  1WJB A;  4RM2 A;  1SEU A;  1JA1 A;  5ILU A;  1OCP A;  2KKO A;  4LLG F;  2ACJ A;  2QQ8 A;  1FZP B;  3HOY J;  3WQZ A;  2XUB A;  4NDL A;  2GIZ A;  1Y39 A;  4QV2 A;  1UJ8 A;  2OTJ B;  4KNY A;  2DPD A;  3G1M A;  1CLW A;  5H5J A;  2KDO A;  3K2A A;  1X1A A;  1XE1 A;  1MSE C;  2OV7 A;  2OCE A;  2ZNZ A;  4LMY A;  3S8P A;  3IWF A;  2HNH A;  3MFK A;  2AO9 A;  2DN0 A;  4RGU A;  1UD6 A;  2GM4 A;  1Y0R A;  1A36 A;  4UAJ A;  3A8I A;  2YWH A;  1Y0N A;  4OIQ F;  3CCR I;  1VQ9 I;  2VJ5 A;  1X58 A;  5DV5 A;  3T5X A;  1C0W A;  3G05 A;  3QOD A;  2QYU A;  4HST A;  3SYT A;  3ZN1 A;  1KA8 A;  1VQL I;  5ILS A;  3HOV J;  3L2V A;  1X4P A;  3B6A A;  2X9D A;  3RKY A;  3LA2 A;  2QKM B;  4HDU A;  1MBG A;  4F7D A;  1YYV A;  4ZTF A;  4KIF A;  2DTR A;  3LO8 A;  1CF7 A;  2CGP A;  3EYI A;  1YI2 B;  2Q2E A;  5KW9 A;  4PSX A;  1JB9 A;  3ZRG A;  2E1B A;  2FEZ A;  3CZ6 A;  3RPQ A;  4RD0 A;  2NXN B;  1T08 B;  2ZC2 A;  2HYF A;  1O8L A;  3TP0 A;  4BBS J;  2HS5 A;  4DQ2 A;  3H3Z A;  2CV1 A;  3HOZ J;  1PE9 A;  5CDF A;  2IOU G;  2ZIT A;  1N07 A;  3GQB A;  5LD2 C;  3KE2 A;  2H09 A;  2STT A;  3ASN H;  2XAH A;  4LIT A;  3KLN A;  4G1V A;  2CS3 A;  2IRF G;  4HRI A;  1VQ5 I;  3OS0 A;  1U2R A;  3WHC A;  4BU2 A;  3BG7 A;  4OPO A;  1R1U A;  3IH4 A;  2FX3 A;  1HKS A;  4WWC A;  1O7F A;  4KIS A;  1IJF A;  4ZGN B;  1LPQ A;  4Q7J B;  1BQE A;  1FBU A;  1VQ4 B;  4KIC A;  5DM6 F;  3CCY A;  3KET A;  4YRV A;  5A88 A;  1WOP A;  1SM4 A;  1HG8 A;  4Z05 A;  1VQN B;  3WTX C;  3MMP A;  3CCM I;  4E7J A;  2VBK A;  4Y15 A;  2ZME A;  2R7O A;  3R6S A;  1D3Y A;  1BR4 A;  3OW2 B;  3OWT A;  1BIB A;  2D5V A;  4M6V A;  3R4K A;  1P4W A;  4ZCM A;  2ODL A;  1QPM A;  1YE9 A;  2HQN A;  4NUB A;  1MMG A;  2XF5 A;  2R3S A;  3Q6R A;  1VQN I;  1O8E A;  2OBT A;  2EIL H;  2M8E A;  4IXA A;  1JXS A;  4WZK A;  1YJ9 B;  1LLZ A;  4WXD A;  4XLH A;  2ME6 A;  4G6I A;  1ZM9 A;  4NQW B;  2EIX A;  3ZBU A;  4MTD A;  3L2R A;  3RSN A;  5CVU A;  5BPD A;  2GK7 A;  1VQM I;  2WA0 A;  1EH6 A;  1YLF A;  4JX4 A;  2NPF A;  4O6J A;  2H8R A;  4Y13 A;  1BLI A;  2CUF A;  3OMY A;  3FY3 A;  2E7W A;  1Z0X A;  4RLZ A;  4XLF A;  4AUX A;  4BXF A;  1SAX A;  2AQE A;  3I4P A;  3G71 I;  3BOQ A;  4C3H J;  2VQG A;  2BY3 A;  1MH4 A;  4UV8 A;  5GPC A;  1E64 A;  2GIV A;  4BXU A;  1ZR2 A;  1R6R A;  2OQG A;  2WWY A;  1IG7 A;  4M2L A;  5F4O A;  3WOD F;  1CZF A;  1U9N A;  3FHN A;  1YG2 A;  4X05 A;  1IC8 A;  5EF6 A;  1WP6 A;  2FRH A;  2R6H A;  4EJW A;  1ODD A;  5HZA A;  3QU3 A;  4ACB A;  2X1C A;  3UW0 A;  5AIP A;  3E6D A;  1VFC A;  4WZL A;  3VO1 A;  4WX9 A;  2F2E A;  4Z4W A;  1FNM A;  4MO7 A;  4WCG A;  1RZ4 A;  2LH9 A;  3SHF A;  5LEK A;  1B72 A;  3ISX A;  4K1X A;  3V7C A;  3LFU A;  2EQR A;  2BPO A;  4XNF A;  2E35 A;  3A03 A;  1FNB A;  3LVB A;  4TKO B;  3ZMV A;  4C2T A;  2H27 A;  2VBV A;  2E1N A;  4YDT A;  1YI2 I;  1QRY A;  3OYE A;  1UHW A;  1QUF A;  3O8G A;  3MEX A;  4B3F X;  2F4I A;  3TQN A;  1K6O A;  2J8K A;  1X1D A;  3E6B A;  1VQ8 I;  2VXD A;  3L7W A;  1R5N A;  4ASU A;  4BPR A;  2KZG A;  4AD9 A;  4IO9 F;  1F9N A;  2CUE A;  1P4A A;  3K4K A;  1MH3 A;  3BG5 A;  1KQ8 A;  4TMV A;  5H2F C;  1BN5 A;  3JRA A;  3A3G A;  2PEC A;  2YUS A;  3CPX A;  4W8R A;  3HYI A;  2FBH A;  1A04 A;  4PAB A;  1KZH A;  3OKX A;  1HBX G;  2YU3 A;  3O3K A;  2AS5 F;  1NB0 A;  1DUX C;  4LIV A;  4U88 A;  2DMN A;  1B2R A;  4RGX A;  5LRS A;  1KQ9 A;  3F22 A;  2M4G A;  4I76 A;  1IN7 A;  4YEL A;  2PX9 A;  2O5R A;  3Q6Q A;  3ZQH A;  1UMK A;  1YJW I;  2V9V A;  3ZZ0 A;  1Z05 A;  2BVL A;  2PLY A;  1RQR A;  4HWV A;  2M7B A;  2DBB A;  1QNT A;  2XOK A;  1O8F A;  1EWY A;  4HDV A;  4E70 A;  1DDN A;  4RM0 A;  3JSO A;  2QUF A;  3BTL A;  2HDC A;  2LSO A;  3PUF A;  1SFK A;  3W2A A;  1H9G A;  5LLQ A;  3QPT A;  4YEJ A;  2F6C A;  3F8N A;  2W7Z A;  4YZ0 A;  2P5L C;  5TIS C;  1JNY A;  1QHH D;  2JTV A;  3LSM A;  3NAU A;  3K4C A;  3VR6 A;  2NNY A;  1DBO A;  3OYB A;  2XNC A;  1TC3 C;  5FKK A;  2RQQ A;  4A3I J;  2QX3 A;  5D8K B;  1MMN A;  3SXY A;  1XC5 A;  3I55 I;  4XN0 A;  5HXB A;  4G94 A;  3KYC B;  5LHH A;  1YTY A;  3L2Q A;  2WAQ A;  3A1Y A;  1M90 D;  1T33 A;  1XMX A;  3WU0 A;  3OS2 A;  1G7S A;  1Z6T A;  1VQ6 I;  2WY8 Q;  4O3M A;  1OFD A;  5AMV A;  1VND A;  1FP2 A;  3K69 A;  4C9Y A;  2XTX A;  4BE1 A;  4Z4Y A;  4DK0 A;  1MNM C;  3OW7 A;  4I02 A;  1J9Z A;  4DW6 A;  3GW2 A;  1SFO J;  1T98 A;  1B23 P;  3AL0 B;  2O9L A;  3ESW B;  1S8N A;  4PJN A;  3GVA A;  3OR1 C;  5K1Y A;  1BC8 C;  1D2E A;  2VNK A;  2GJP A;  3W2V A;  4PC1 A;  1ITY A;  2JUG A;  1HZE A;  2HKO A;  5K7F A;  2R7X A;  2L9R A;  4OPV A;  2ESN A;  3DBH B;  3GSI A;  4JYK A;  3LYC A;  1T6X A;  2EZH A;  4MYT A;  2XKP A;  1R1V A;  5EZG A;  1Z91 A;  4PDK A;  2D45 A;  3RYP A;  1QJV A;  4L0Y B;  5CQE A;  4NC8 A;  4YAL A;  3W5V A;  3VEP A;  1UD3 A;  3ECO A;  1Y0Y A;  3DU6 A;  1K4T A;  2DT6 A;  3A3B A;  2Z8G A;  3EQO A;  4IHY A;  2JJ7 A;  1IB4 A;  3RKX A;  1O8D A;  4C30 A;  2W24 A;  3CUQ A;  3K0L A;  3MVP A;  1I27 A;  4TV7 A;  3H0D A;  1J75 A;  1MGT A;  3CC7 I;  1EE6 A;  2DT5 A;  1SVL A;  2PN6 A;  2RRE A;  5IT9 Z;  2HCJ B;  3AKZ A;  2O7O A;  1KU2 A;  2RGV A;  4ENM A;  2ISZ A;  3PSZ A;  1GUU A;  1YW9 A;  2F5D A;  3I4M J;  3R0A A;  2X1E A;  1QRC A;  3Q3S A;  1RWR A;  3VST A;  4LFU A;  1ZR4 A;  2R7D A;  1Q9S A;  2DOG A;  3CF2 A;  3F8C A;  4A6D A;  2TRT A;  1ENH A;  4IHT A;  2M30 A;  1SVO A;  4HV6 A;  1BL0 A;  2R0Q C;  4U87 A;  1UCR A;  2KIM A;  5TR9 A;  3P9I A;  1E0E A;  3V7R A;  4B4D A;  1TWH J;  4A0Z A;  4A69 C;  1PP8 F;  2NOG A;  5HS9 A;  3MAJ A;  2IS2 A;  5DUK A;  2Z33 A;  1O8M A;  5LMZ A;  3ZQL A;  3MZ8 A;  3AVV A;  4HW0 A;  5LGU A;  3JTH A;  3OIQ A;  3G1O A;  2LKP A;  4MQ9 F;  3RQ4 A;  4CCM A;  1Z77 A;  1WSR A;  3FMQ A;  5B66 C;  3V76 A;  3RJP A;  4ZYA A;  2B0L A;  3IH2 A;  2BW3 B;  1S7A A;  4HF0 A;  4MEY F;  4M72 A;  5LHI A;  5FKN A;  4Y9R A;  5ILV A;  1USS A;  2KHM A;  3HBL A;  4LB6 B;  5KSW B;  1UHS A;  2BYV E;  1JKQ C;  4LLL A;  4EH1 A;  2VFP A;  2HMA A;  2W48 A;  1PUE E;  4YZX A;  3DKX A;  2DQL A;  5E3L A;  1W5S A;  3OIO A;  1I8D A;  5IYN A;  3KRG A;  2XAU A;  2PG4 A;  1WJ5 A;  2VBE A;  2CQX A;  2HPI A;  3BRO A;  3KLO A;  4R8H A;  3GZN B;  2G9W A;  3I64 A;  3CW2 A;  2ZXW H;  1VHE A;  5TY0 A;  1K5C A;  5DCM B;  5JR3 A;  5DM7 F;  4E7S A;  4PAA A;  1FDR A;  2JPC A;  2O1D A;  2OA4 A;  3S1Q J;  1DBG A;  3PET A;  4AF6 A;  3K1P A;  3HOU J;  3GFM A;  2Y9Y A;  2WC2 A;  1Q7Y D;  1HLV A;  3TO7 A;  2EJR A;  3ZMS A;  1B8I B;  2DQR A;  3O8H A;  1K78 B;  3QFT A;  2UWM A;  4PMH A;  3CUO A;  3LQ6 A;  4QUZ A;  2IQ7 A;  1E17 A;  2O17 A;  3HOT A;  2L02 A;  1GVH A;  3CCU I;  3I9V 2;  3T56 B;  1BI3 A;  3ABT A;  1YIJ B;  3G1L A;  4AID A;  1D1B A;  3OS1 A;  1YLO A;  3CCJ B;  1BOA A;  1XMA A;  1GR1 A;  4OZZ A;  1XTA A;  1ZGW A;  4I7H A;  1EJ9 A;  2DOE A;  2NRA C;  2VBS A;  3QOE A;  3WTT C;  1O3R A;  2X6W A;  1XCB A;  3F21 A;  3CC7 B;  3FDY A;  3WTZ A;  3KP4 A;  3JRI A;  5F0F A;  1XSD A;  4B47 A;  1OYY A;  4JBA A;  3WTV C;  3H5A A;  1SMY F;  4A0Y A;  4B3A A;  3EUH C;  4LC0 A;  2WJY A;  3CLQ A;  1J7K A;  2UXN A;  2KQR A;  3U21 A;  2G0Y A;  1ZGA A;  2F5C A;  2B7C A;  4HNV A;  3S1M J;  2BM7 A;  3CP8 A;  4IF4 A;  5JVG F;  2JUC A;  2OZU A;  3LMW A;  3V8J A;  3SZG A;  2CG4 A;  4Z4V A;  2H6C A;  2JZY A;  2VIX A;  2XZP A;  4XLE A;  4Y17 A;  1UZC A;  2HXI A;  3HRU A;  4EM2 A;  4RD4 A;  4BY1 J;  3JRC A;  2HQ5 A;  1MBJ A;  2DYR H;  4ENK A;  2V7V A;  4P1V A;  3DBR B;  1H89 C;  1YFH A;  4BAC A;  3KEW A;  4ZDO A;  4IRH A;  5EEA A;  3CQZ J;  2OPT A;  5HLI A;  3JRD A;  4JP0 A;  3BCF A;  2C4U A;  4V2F A;  1NHC A;  4RDU A;  1BOB A;  1R5I D;  5CYV A;  2JPB A;  2PEX A;  3LAP A;  5GAG J;  3I56 B;  3AVU A;  3SKB A;  1EH7 A;  2NNN A;  4ZYD A;  1ON2 A;  3R6K A;  3OYC A;  1S5L C;  1VQ7 I;  2HGC A;  2WB1 A;  1W87 A;  4NK6 A;  2IGK A;  1TSP A;  2COB A;  4RGS A;  1ZG3 A;  5LHG A;  3EUK L;  3VMW A;  1QA6 A;  1I3A A;  2LY1 A;  4E7I A;  2GBY A;  3KP7 A;  2XAJ A;  4A5N A;  1HVX A;  2X3H A;  4CYC B;  2VBU A;  1MD0 A;  1IN5 A;  2R5Y A;  5EG0 B;  3LAJ A;  1U78 A;  4XSZ F;  1GXQ A;  2YX7 A;  5FO0 A;  3BZC A;  5IYD J;  4TMZ A;  3HTS B;  1ZN2 A;  2D1H A;  3OIP A;  5FIU A;  4FCY A;  2DA7 A;  1TT0 A;  3M7G A;  1T39 A;  2EFP A;  3AAF A;  2OBP A;  3LSG A;  4A12 A;  4OOV A;  3BR0 A;  2PJP A;  2R92 J;  3E3V A;  4F91 B;  1Y6I A;  1BJA A;  1KK1 A;  3JQQ A;  1X3Z B;  4L8J A;  4UB8 C;  4KKU A;  2QTL A;  4IQ4 A;  4IHV A;  3PSI A;  3IAM 2;  1DAR A;  2FOK A;  2CSO A;  2XAF A;  4E7H A;  2UVF A;  2KIQ A;  5F04 A;  2OYN A;  4WXC A;  3P7N A;  2CFO A;  1HF0 A;  3HL2 A;  1HXD A;  3GTK J;  2VJI A;  4I2O A;  1FTT A;  5IYW A;  2Q8K A;  3FHZ A;  3GO5 A;  4KKS A;  4Q47 A;  1REP C;  2IW5 A;  2EH3 A;  4A6E A;  2Y9Z A;  3T9G A;  4QHY A;  1FPQ A;  3COA C;  1V5V A;  2DIE A;  1PXZ A;  5EMN A;  4P25 A;  2XGD A;  3OP1 A;  4UZU A;  4Z06 A;  1GVD A;  2IGN A;  3HGG A;  1ZYR F;  3SY2 A;  3VOD A;  1X3W B;  3ZQQ A;  2R93 J;  2DJI A;  3KP3 A;  3S3M A;  2QBY B;  1MIJ A;  4YG2 F;  2HR3 A;  2WBM A;  3L2C A;  1I18 A;  3G4S B;  4D0P A;  1UMQ A;  2DK8 A;  2L0K A;  5JMC B;  5HKK A;  1W36 D;  2XGJ A;  2XGC A;  4NCN A;  1XSX A;  1NK3 P;  1P9Q C;  1VQ6 B;  2FUG 2;  2KFD A;  1QCX A;  1STZ A;  2VKD A;  4BS9 A;  1QQ1 A;  1KQS B;  5CVI A;  1BC7 C;  2V7T A;  2WZP P;  3U2Q A;  3N6Z A;  3J80 Z;  3ML6 A;  3J7Z I;  3GVL A;  2MFZ A;  4MHG A;  2V7X A;  3OEH A;  3HG9 A;  1K8A D;  2M87 A;  1TW3 A;  3FK6 A;  2EA4 A;  2L2O A;  2LOO A;  3AG2 H;  4DZJ A;  1EP1 B;  5FJ8 J;  5ED4 A;  4DQL A;  4ZGQ B;  2BHY A;  1XGM A;  2K4B A;  2VFQ A;  2HYG D;  1GQ8 A;  1GJR A;  2HU9 A;  2X3U A;  2L5Q A;  3FJO A;  1ORK A;  2HQA A;  2PQ8 A;  3SZT A;  2K7L A;  2P0W A;  1XG1 A;  3GTQ J;  3J7A O;  3FPP A;  3Q39 A;  3HJE A;  1TTY A;  2HOA A;  4RMN A;  5J8F A;  3C18 A;  1S0U A;  2RVC A;  4CIC A;  3OEE A;  3DF8 A;  5HZB A;  4UY8 I;  4AIK A;  3OOC A;  2M1B A;  2PMZ A;  3TOB A;  2JA6 J;  2CK3 A;  3ASR A;  1V3F A;  3BWG A;  1BW6 A;  3K1N A;  5D6F A;  2DI3 A;  2DO7 A;  2E5Z A;  4BKX A;  4L9J A;  5C4J J;  3PNV A;  4M73 A;  4ENJ A;  1VQ4 I;  2Y0M A;  4HG2 A;  2Q6L A;  1U8B A;  4OAY A;  2EV5 A;  2BE5 F;  1LDK B;  5AIQ A;  1XSV A;  3OPO A;  4RJL A;  2MH2 A;  1QA3 A;  2C77 A;  3FXJ A;  2D74 A;  4FXU A;  3CO6 C;  3SEZ A;  4OIP F;  3AVT A;  3TO9 A;  1F5T A;  3S1N J;  2CQ7 A;  2ICW G;  2CMP A;  1FT9 A;  5HVQ C;  3TW7 A;  4XLN F;  4HA8 A;  2UV1 A;  1VLO A;  2EWN A;  2GWR A;  4A2U A;  3F3X A;  2R7R A;  1O4X A;  3SUC A;  4OOX A;  3KEO A;  1ETO A;  3ZPL A;  2QYO A;  3W6K B;  2GJR A;  1K4Z A;  2VAS A;  1R1T A;  3I58 A;  5E6T A;  1K6Y A;  5JLW A;  2QSG X;  1ZRC A;  4M9Z A;  1G7R A;  3OZV A;  1IZ1 A;  3OYG A;  5DEQ A;  1QFY A;  2X0K A;  3VWB A;  4YAO A;  4TMW A;  1G2H A;  1SFX A;  3HHH A;  1ETX A;  3FMR A;  4I0A A;  3GME A;  3MQ0 A;  3WGG A;  2ZJR F;  5HNH A;  4R79 A;  1OGO X;  1Z6R A;  3JX8 A;  5L3B A;  2MA3 A;  2A3S A;  4CHU A;  2A6E F;  1V0E A;  1NTC A;  3E0J B;  3W2W A;  3CTA A;  2CF4 A;  4CCJ A;  4PC6 A;  4U49 A;  1DGW Y;  2F4O B;  1FYL A;  2RAE A;  4G6D A;  2O0V A;  4P1W A;  4BY7 J;  1KU9 A;  1Z3Y A;  3FXQ A;  2BGJ A;  2E1O A;  2CWE A;  5JHF A;  3G4S I;  2NAZ A;  2FU4 A;  4RB1 A;  1EFU A;  3W2E A;  3H1C A;  3I59 B;  2X51 A;  4OAZ A;  4TSF A;  2R9V A;  2PIA A;  2W57 A;  2JA5 J;  2A5W A;  1FLI A;  2H8W A;  3M9A A;  3A02 A;  3AVX A;  4GXO A;  1XN7 A;  1I50 J;  5EJC A;  4UVB A;  3H09 A;  3JUR A;  1O8G A;  3GZ5 A;  3DTE A;  4E7Z A;  3ASP A;  1H42 A;  1IDY A;  4HOB A;  4F52 A;  1ZHF A;  2FJ1 A;  2L4A A;  1AIP A;  1FOX A;  1Q86 D;  1WI3 A;  3SJP A;  3WNB A;  2CYY A;  4W97 A;  2KT0 A;  1I6H J;  4H4K C;  1FWZ A;  2H6B A;  2L9V A;  3L00 A;  3NQO A;  5KK1 A;  2QSH X;  2Q6K A;  3ELK A;  1PDN C;  2MW8 A;  5IYC J;  3OR2 C;  2VPR A;  1W36 C;  5HDK A;  5IYR A;  5BSY A;  3ONQ A;  4V19 K;  3E97 A;  4UHT A;  2JDI A;  2C5B A;  4XSX F;  4RD1 A;  1GO2 A;  1PJ5 A;  3WG9 A;  1H8A C;  2HVR A;  3H3V K;  1G7T A;  4CA0 A;  4DNT B;  4HQE A;  2VKH A;  5J35 A;  1WXR A;  2Z99 A;  4F7Z A;  2O03 A;  1WHU A;  2V4J C;  1S72 B;  1EP2 B;  4LGW A;  3TH0 A;  1P2F A;  2PMD A;  1XS9 A;  3F6O A;  5FRM A;  2QGG A;  2XDV A;  2OZ6 A;  1POG A;  2ZL6 A;  2NST A;  5JVT A;  1JGS A;  2VQH A;  1TTT A;  2R7S A;  1EFR A;  4EJO A;  1J0R A;  4HV5 A;  4MFD A;  1O7L A;  1G3Y A;  2IP2 A;  1VQM B;  3ZIA A;  3R61 A;  1L1I A;  1O8H A;  3AK5 A;  2EFQ A;  2X4H A;  5HNF A;  4HQM A;  4KIG A;  2VL8 A;  3S3N A;  4FE4 A;  4MGR A;  3IKT A;  2RKH A;  3G2B A;  5THX A;  3MN2 A;  2V26 A;  5CVJ A;  3VYS B;  2MGQ A;  4M6X A;  2WAF A;  2PJR B;  4R1H A;  1WOO A;  2LZJ A;  1UD5 A;  1DDG A;  3A8J A;  5H20 A;  2GK6 A;  3SYJ A;  1E3Z A;  1LDD A;  2PMH A;  2L01 A;  4UVA A;  3CDH A;  4XR6 A;  4D7N A;  3ZOB A;  3D5S C;  4Z4Z A;  1O3Q A;  3ZQF A;  3M8E A;  3RZD J;  1O8J A;  3WHB A;  2Z16 A;  2R7F A;  4U7B A;  3H3U A;  1PP7 U;  4Y33 A;  5F1J A;  1IB0 A;  2WB1 N;  2B5O A;  2LG4 A;  1HF2 A;  5C1C A;  4IL6 C;  3V8K A;  1Z21 A;  3CC2 B;  4Y3O A;  3B8Y A;  1I39 A;  4QLC U;  3W3C A;  2ZJQ F;  1X1B A;  3OSG A;  1MDM B;  2IJL A;  4M3B A;  4P55 A;  1WDT A;  2W25 A;  4MNU A;  3UKG A;  5BNG A;  4KJZ A;  1R9T J;  3AGP A;  1N8R D;  3AVW A;  1RU4 A;  5IYQ A;  3HEF A;  2WAQ N;  3D0S A;  3Q5F A;  4GO1 A;  2ZJP F;  1IDJ A;  4URR A;  4GCV A;  3PNT A;  1EF4 A;  3GUD A;  2GA2 A;  3BY2 A;  4ETS A;  1AMO A;  3W6V A;  1V5E A;  2X1D A;  2Z9O A;  3DBL B;  3PQK A;  4XBF A;  1DP3 A;  3L9F A;  1VF7 A;  3O2P E;  3BQJ A;  1O57 A;  1V55 H;  1FNC A;  2XC1 A;  1MDM A;  5ICF A;  3BT9 A;  2CC2 A;  2B63 J;  1EV7 A;  1ZM3 A;  1FYM A;  1J09 A;  4NNJ A;  4HLY A;  4A3G J;  1N0V C;  4QFM A;  2HWV A;  2L7Z A;  5FB2 A;  1EXM A;  3FMS A;  3CF5 F;  2NS7 A;  1PUF B;  2VON A;  3BPX A;  1QFZ A;  1EZG A;  2BXY A;  2ME0 A;  1D5Y A;  1T6S A;  4XMY A;  3Q9V A;  4IRG A;  3S1R J;  3CXC B;  4OPS A;  2VC1 A;  1XDS A;  3MKW B;  3E1Y E;  2TCT A;  2ZO4 A;  3HOX J;  4XRS A;  1RC9 A;  4A3F J;  3ZZU A;  2F1L A;  1N75 A;  1DG1 G;  2M7A A;  1FJL A;  2CW5 A;  1X4O A;  1YHQ B;  3AG1 H;  4Z03 A;  2ZXJ A;  3D5R C;  3CCQ B;  5M3F J;  2RQP A;  1TYV A;  2VUM J;  4RCY A;  2MH9 A;  2FD5 A;  1AKH B;  2IS1 A;  4Z4T A;  4E0F A;  1E63 A;  1XMK A;  3WXM A;  3BG9 A;  1RUO A;  1BI2 A;  3EET A;  2G7H A;  4ASN A;  4Q4Z F;  2ZFW A;  1WJE A;  5ICC A;  5E1W A;  2DER A;  2R7W A;  2GXB A;  4ROX A;  1T5E A;  1YO5 C;  1FY7 A;  2I5U A;  2E1M C;  4XID A;  1X19 A;  1BA5 A;  2COM A;  1KGS A;  3WE2 A;  3ZP5 A;  2GOM A;  1GHC A;  1BI0 A;  4G6Q A;  4C3I J;  2M34 A;  5F08 A;  1A6Q A;  1KRH A;  1YX3 A;  3SJM A;  2XTY A;  2Y0S A;  5E8G A;  4LG0 B;  1RR7 A;  2AQF A;  2O8X A;  2BV6 A;  2LC2 A;  2R4G A;  3RI4 A;  1AU7 A;  5FLV A;  3J7A Y;  3ZQI A;  1WI9 A;  1OB2 A;  5F6F A;  1WFX A;  2NVX J;  1V5G A;  2LF7 A;  4U0Y A;  4KKT A;  4P9F A;  1WJA A;  3OYL A;  2VOO A;  3L2W A;  2F5V A;  4Y4R A;  1PLU A;  3KZY A;  4LOC A;  1IAW A;  4L5E A;  3GEZ A;  4UXN A;  2DOA A;  2OAZ A;  3BR3 A;  4KN4 X;  5M5X J;  4II2 A;  3WU2 C;  2WAE A;  3VNU A;  1MAB A;  1FNN A;  2JVG A;  2FSW A;  2QKL B;  3WGI A;  1GT0 C;  1IXS B;  2CUZ A;  2QDX A;  3LOC A;  4MIM A;  2L9S A;  3NE5 B;  2EFG A;  1R4M B;  3SDB A;  4OIO F;  2LD5 A;  2CND A;  4UB6 C;  2GAU A;  3DU1 X;  3JRE A;  1Q81 D;  2DDA A;  3HRT A;  3E1S A;  1VZ0 A;  4DYQ A;  1EA0 A;  4LLN A;  1QU3 A;  4H0E A;  4EAT A;  1UG0 A;  1ZK8 A;  3BTJ A;  4ZZD A;  2ZL7 A;  4ITV A;  4X7F A;  3VO2 A;  1OFE A;  3H0G J;  3ZUG A;  1U5T C;  2DY1 A;  2XEX A;  1Q1H A;  1MW7 A;  5GTI C;  1Y1V J;  1DDI A;  2G0E A;  2HDW A;  2K9Q A;  3I59 A;  3FXU A;  2QWW A;  3OV8 A;  2OK8 A;  2FBK A;  2E2I J;  4A3J J;  1IRZ A;  1JI8 A;  3CCS I;  1QBJ A;  1E3H A;  1K7A A;  1DQU A;  1BBY A;  2CU7 A;  1TYU A;  2KZV A;  1BHE A;  4UZE A;  3DQV C;  1ACI A;  2LBF B;  4BH9 A;  3I1F A;  4P26 A;  3EUH A;  3GX4 X;  1L3L A;  3LL7 A;  2DA1 A;  1TBX A;  3RCO A;  3WTW C;  3NEU A;  4PGH A;  1VQ8 B;  2XZL A;  4GFB A;  2M3A A;  3OYA A;  3HRS A;  3CO7 C;  2DMT A;  1IJE A;  3B8H A;  1IDK A;  3S2D J;  1JUS A;  4UUS A;  2O3F A;  3GQA A;  4G7W A;  3BP8 A;  4CQJ A;  3PL8 A;  4YFN F;  1W2B B;  2MAB A;  1WOR A;  4ACA A;  4G7X A;  3KCC A;  4C43 A;  1QGP A;  2ZSI B;  3GVK A;  2A5Y B;  4N9I A;  1S7E A;  3S3O A;  1NK2 P;  3KP6 A;  3C3W A;  3SEQ A;  3OYK A;  4E6K G;  3A01 A;  3FKS A;  3T51 B;  2P6T A;  2NVU B;  3LSJ A;  5FLX Z;  5FO5 A;  1YHQ I;  5LGN A;  2INU A;  2VLA A;  4YIR X;  3FF5 A;  4A3K J;  2KRF A;  3DLA A;  4FT8 A;  2CH0 A;  5HS8 A;  4P12 A;  2OTL I;  2YUH A;  3GBG A;  4GQN A;  1IHM A;  1SKQ A;  1RKW A;  4U7D A;  3B78 A;  3ML3 A;  2DOF A;  4LB5 A;  3UNG C;  4EGZ A;  2LRD A;  1VQ9 B;  1OGM X;  4W8Q A;  3K4N A;  5FKL A;  1U5T B;  1GAW A;  4DK1 A;  1Q82 D;  2ID6 A;  3DEW A;  4EJU A;  1TNT A;  2KP6 A;  2P4W A;  4CCL A;  5HLG A;  1ZM4 A;  2VKV A;  3FPK A;  1FOK A;  2M2E A;  3CLO A;  3ZZT A;  3BR5 A;  4TN1 A;  2BVN A;  2V9P A;  1EP3 B;  2Z1D A;  1FYK A;  3FBN B;  1OFC X;  2VBM A;  1JJ6 C;  1SFU A;  4IPA A;  1JTY A;  3GCM A;  2DPU A;  2CFX A;  1ETK A;  1BJK A;  3JCU C;  1ZRD A;  4A3E J;  3VB2 A;  2L54 A;  4TT3 A;  4GRI A;  2BV3 A;  4S05 A;  4W8S A;  1MND A;  5HDG A;  3DTI A;  1VHO A;  5L3E A;  3BPV A;  2GQQ A;  3BH7 B;  4EVI A;  5F0H A;  1HW2 A;  1B9M A;  1CQT A;  2DYS H;  2A69 F;  2MBF A;  2OUM A;  2XF6 A;  5DCF A;  2BY1 A;  3HPH A;  2VBX A;  4BXX J;  1OYW A;  3HUG A;  3ZXS A;  1UD8 A;  2BM1 A;  2L4M A;  1NJI D;  4ZYE A;  1TZL A;  5DYM A;  3LWF A;  1CGP A;  4Z4U A;  1ONV A;  2P3M A;  2CRV A;  2OCC H;  3ZQG A;  2JWT A;  4PC2 A;  4WK8 F;  2M45 A;  2PYG A;  1G3S A;  3MZH A;  4W1U A;  4I0B A;  2LY9 A;  2ADU A;  1N08 A;  4G9Y A;  4AC0 A;  5M5Y J;  2BW3 A;  1U8R A;  4A0X A;  4KMU X;  4IRI A;  4XOT A;  1LQ1 A;  5H6Q A;  4DOZ A;  4XKB A;  3GRH A;  1IRF A;  4M3D A;  2RC6 A;  2X48 A;  3FIS A;  4AC9 A;  5DTD A;  2QBY A;  2FQ3 A;  4B09 A;  3QSY A;  4XKC A;  3NWT A;  4EJV A;  2L3D A;  3W2G A;  1G4D A;  2DA5 A;  3ULQ B;  2D3L A;  2V4D A;  5H59 A;  3VFZ A;  2M9H A;  1TNS A;  2LNB A;  3U1K A;  3OY9 A;  3I4N J;  3ABK H;  1S4M A;  1JUP A;  2DW4 A;  2LYC A;  4NC6 A;  3JQR A;  1JJ8 C;  1FP1 D;  2DET A;  4M9S A;  5E17 F;  3JRB A;  1CNE A;  2UVE A;  1T0F A;  3PQJ A;  1XGS A;  1Z1D A;  2CJJ A;  2HTS A;  3OYI A;  2PBI A;  1NB9 A;  4MR0 A;  2IA0 A;  1EH8 A;  4PC7 A;  4LBV A;  1TWC J;  5B3S H;  3JW4 A;  1U5T A;  4XLP F;  3I56 I;  5AON A;  2CV2 A;  4A3L J;  3ES9 A;  1FMW A;  5ERI A;  1JTA A;  3L09 A;  1FOY A;  1HSJ A;  3OOP A;  3OYF A;  2ZBU A;  4EMS A;  2FMY A;  3A1P A;  4KYW A;  2CO5 A;  3A2K A;  3OJW A;  2O8K A;  3IUO A;  4HBL A;  2WSS A;  2X8K A;  3QP5 A;  4XLA A;  2XIG A;  2HVS A;  2ZZG A;  3IRQ A;  2VNJ A;  3KFW X;  5DDG A;  1XQB A;  1D0Y A;  1I1G A;  4P9S A;  3D1N I;  4OJP A;  3M1E A;  2R5Z A;  2CQK A;  1J2X A;  3GQ8 A;  2RC5 A;  1HCR A;  2J7K A;  3QFC A;  1WJF A;  4KT6 A;  1VLY A;  1JT6 A;  1BN8 A;  5D5U B;  5J1R A;  4CGZ A;  3H5R A;  3CCE B;  1K28 D;  5HLH A;  3QP6 A;  5HOD A;  2JK3 A;  1FSE A;  4LK0 F;  3GTL J;  1R49 A;  5B6I A;  1O3S A;  4DQK A;  2QA4 B;  3E6M A;  2W6I A;  3QFR A;  3F72 A;  2EBI A;  1WKM A;  2HQR A;  4QSH A;  2RC4 A;  1BMF A;  1FIA A;  1G3W A;  4ENN A;  3DXJ F;  2IPQ X;  3IAS 2;  3VSU A;  4N3N A;  2IVM A;  3S14 J;  1R5B A;  4H9G A;  3AFH A;  2GZW A;  2JSP A;  4P5O A;  4HF1 A;  5IOY A;  1H88 C;  2BMW A;  1TVC A;  4FWT A;  1TWA J;  2P5K A;  4DGW B;  5EGO B;  4DBR A;  3SFI A;  1G3T A;  2O6G E;  3BG3 A;  1W0T A;  2CW0 F;  4RDK A;  5GV8 A;  4HX4 A;  2W6J A;  3PIO F;  3D26 A;  1W9X A;  2L9N A;  2OF7 A;  1N05 A;  1R58 A;  3EQN A;  3BLY A;  5K5R A;  2XT2 A;  2J5O A;  3G3Z A;  1MBE A;  1EFC A;  2EA2 A;  3W6J B;  1LLW A;  4P9U A;  3Q9S A;  2ZZE A;  5GPA A;  1NHA A;  1VJS A;  1NG6 A;  5CPR B;  4C2U A;  4OIN F;  5ICG A;  1DU0 A;  4OOI A;  1RMG A;  1D8T A;  1QZZ A;  2QQA A;  2R5Z B;  4I6Z A;  4RDJ A;  1RR8 C;  4J00 A;  3DEE A;  3F8B A;  2WV0 A;  2EV0 A;  3K4J A;  4ANJ A;  5HDN A;  4Z4S A;  4RA2 A;  2DA2 A;  4HEA 2;  1F43 A;  1B4A A;  2DA3 A;  2XKO A;  5KCM A;  5E8I A;  2DXI A;  1LB2 A;  2YU9 J;  2HOE A;  2P7V B;  2ZZF A;  4IW3 B;  2BZT A;  1H8H A;  3HC7 A;  2B7B A;  1G6N A;  2ECC A;  2XTW A;  3FIW A;  1JTX A;  1UHM A;  2Z6B D;  2K9S A;  3I55 B;  2FOW A;  3M1C A;  3ZQ7 A;  2JA8 J;  2IAI A;  3HM5 A;  1W35 A;  3DKW A;  5B1B H;  3PSF A;  3B6C A;  3M8J A;  4XRF A;  1OQY A;  1IUF A;  1JKP C;  4I98 B;  1UFM A;  1YS7 A;  2HDD A;  4P3Y A;  4LG0 A;  2GJK A;  3B73 A;  1R5H A;  5FFX A;  3GQ9 A;  1BM9 A;  2OQR A;  5BS6 A;  4IVN A;  1B8I A;  3P27 A;  4XIC A;  2C78 A;  3C1D A;  3CDL A;  4RLF A;  5IYP A;  3GLX A;  3RIR A;  2M5W A;  1K79 A;  2V1N A;  2QZ8 A;  4B44 A;  1MMA A;  4M1K A;  3GTP J;  1U6G A;  4QVA A;  4NC7 A;  1JKO C;  1OCO H;  3DPT A;  3VPR A;  2BY2 A;  1QFJ A;  4BEH B;  2P6S A;  2H1L A;  3VYR B;  3JRF A;  4N3G A;  2DYI A;  2QTZ A;  3C2H A;  3KPH A;  5GAH J;  2O04 A;  2VJJ A;  1SD7 A;  4D1Q A;  5A2Q Z;  2MYS A;  3FK7 A;  4HPQ A;  1YJN B;  1PJ7 A;  2ZJ2 A;  1CQX A;  3HOW J;  2EIJ H;  2DA6 A;  5K7H A;  2ISY A;  3GTO J;  4NHJ A;  4IOA F;  4X7E A;  1JGG A;  1DGR M;  1TW2 A;  4UZF A;  2Q1Z B;  1JT0 A;  5M5W J;  5DS9 A;  1P7J A;  5TV2 A;  4QPQ A;  1ZGJ A;  1IV8 A;  4XRM A;  4BNC A;  5D8L B;  4MQV A;  2RNG A;  2FQ4 A;  4AWX B;  1IXR C;  2DTZ A;  4PJM A;  3WBK A;  2ZFU A;  3C7J A;  1AHD P;  2JN6 A;  4PUS A;  1AIR A;  4X1E A;  1G59 A;  2MLG A;  3JSP A;  1K61 A;  1RIO H;  4RAZ A;  3S32 A;  5LRR A;  1ZRF A;  3KP5 A;  1KJZ A;  4XOP A;  4NBS A;  4I99 C;  3QE2 A;  2DFI A;  1Y8R B;  5F64 A;  4P22 A;  3Q0U A;  2E1M B;  2K9M A;  4MFE A;  3T53 B;  1R36 A;  4KT5 C;  2XB5 A;  4X06 A;  4FAS D;  4ESF A;  4ZCL A;  3CMY A;  1QZY A;  2OU2 A;  3WBJ A;  1HST A;  4EM1 A;  1EFT A;  1OYI A;  2K86 A;  2OK7 A;  4AF7 A;  1MBH A;  2EPF A;  1QUE A;  3E5X A;  3B4N A;  4N4N B;  4Q48 A;  1R7J A;  3VYT B;  4B8X A;  5C1E A;  4U9U A;  1X0C A;  1U9O A;  5H6R A;  2E2H J;  2DFF A;  4XKV A;  1RES A;  4IOC F;  2BX6 A;  3CDI A;  4CH7 A;  2C2W A;  3E5U A;  3SQN A;  1GDT A;  3D5L A;  3QOP A;  2W4S A;  4AIH A;  1U3E M;  2KLO A;  2O0Y A;  4A5M A;  4KN7 X;  2DLL A;  5A8A A;  2ZCW A;  2DOD A;  2VOD A;  2Y69 H;  3LQR A;  1OIS A;  2KRC A;  3IWZ A;  4PJL A;  3MKY B;  2RNJ A;  1YIT I;  4RDL A;  4MEX F;  1ETV A;  2DMQ A;  1ULY A;  5DD4 A;  4JQF A;  5DD8 A;  2LK2 A;  3OYD A;  1ZG1 A;  3BDD A;  1TQM A;  5D6E A;  2E19 A;  3DPU A;  2PLF A;  5BSX A;  3FXM A;  2ZME C;  2F43 A;  2VBW A;  3QAH A;  3F6V A;  2I8D A;  3I71 A;  4CSW A;  5TGT A;  1RNL A;  5CQG A;  5KNL A;  3GFI A;  3LFK A;  2L7K A;  3N97 A;  1ZG5 A;  3HZJ A;  2PJR A;  5J1Y A;  4GYG A;  2QGU A;  1JHF A;  1UD2 A;  1W5T A;  4IHS A;  2VBT A;  1J5Y A;  5FGM A;  4EEF G;  3JAM Z;  4PJJ A;  5JLX A;  1FX0 A;  1MJB A;  1QZE A;  3V42 A;  1KTW A;  3F23 A;  2V7U A;  2G7U A;  2X0L A;  3QQA A;  4M6Y A;  4LK1 F;  4XON A;  5FA6 A;  2LVS A;  1E2X A;  3RZO J;  2M5S A;  2BM5 A;  2KIU A;  2QVO A;  3ZSC A;  1VQ5 B;  1F4K A;  3H94 A;  2XRN A;  5IOZ A;  4YAF A;  2GA1 A;  2JA2 A;  2B9S A;  1W0U A;  4AM3 A;  3AG4 H;  3OE7 A;  1QQI A;  2BHZ A;  1VQO I;  2LKX A;  2PMU A;  1YW8 A;  3REO A;  4BBR J;  3GWZ A;  3AG3 H;  3LSP A;  1UEL B;  2QQ9 A;  1CF7 B;  4OOS A;  2R7Q A;  1H9T A;  3WND A;  2HTJ A;  3AL0 C;  4BJT A;  4XL9 A;  1HKQ A;  3U6K A;  4BHB A;  4CXF A;  1LEB A;  1WQ2 A;  1OLT A;  2LP0 A;  1Q1V A;  3GFL A;  4J19 A;  4X0C A;  3E5Q A;  2VQC A;  3RPU A;  1F20 A;  1KCC A;  2AXT C;  3HHG A;  2O61 A;  1OCC H;  2A68 F;  1T95 A;  3N4M A;  2MSY A;  2C5H A;  2NT9 A;  3QFS A;  2BY0 A;  2V79 A;  3GYH X;  3M4O J;  5K7Z A;  3Q38 A;  3HTU A;  5GTH C;  3SQV A;  1QVG B;  1OKR A;  1P6R A;  2F5E A;  5BQT A;  1GV5 A;  3MKL A;  1A8P A;  2ZL5 A;  2P7C B;  2VI6 A;  3F8F A;  3CMM A;  3KYL A;  4L18 B;  2ZBV A;  2JSC A;  3KZZ A;  4IHX A;  5IPA A;  5EEG A;  4QVJ A;  2RDP A;  4P96 A;  5J3O A;  1N25 A;  3FXR A;  4Y7C A;  1P4M A;  4ZZL A;  4YAU A;  3AVY A;  2V6C A;  2K9N A; 
#chains in the Genus database with same CATH homology
 1N75 A;  1QJV A;  2M7A A;  1X4O A;  5CQE A;  3H5N A;  4NC8 A;  2DT7 B;  3HPG A;  1COW A;  1KMH A;  4JMQ A;  1UD3 A;  3D5R C;  3S93 A;  3DU6 A;  3A3B A;  2DT6 A;  4Z03 A;  4BGD A;  2Z8G A;  4YZQ A;  3HOS A;  1E43 A;  3EQO A;  4II3 A;  2IS1 A;  1MMD A;  1ZEL A;  4E0F A;  4ZDL A;  1IB4 A;  4D9J A;  3QYF A;  1SKY B;  2ZXH A;  1O8D A;  3MKZ A;  3EUA A;  4C30 A;  2GOX B;  3GQ7 A;  1KCD A;  3H0D A;  1WJE A;  3CJQ B;  4YZA A;  4F92 B;  2CW8 A;  1EE6 A;  2R7W A;  2JJ1 A;  3K6G A;  2WY7 Q;  2O0W A;  2RRE A;  3CP2 A;  1T5E A;  4IZZ A;  3AKZ A;  5FL7 A;  1WPC A;  2E1M C;  2ZXI A;  1X19 A;  1PKV A;  1UD2 A;  3K4B A;  2GOM A;  2W1O A;  2F1M A;  2UUZ A;  3CJR B;  4PFP A;  3VSK A;  2NZM A;  1YX3 A;  3UR3 C;  2Y0S A;  2X1E A;  2AQF A;  4ZTJ A;  4IKF A;  2LC2 A;  2R4G A;  2W7N A;  3J7A Y;  4QPO A;  4CZC A;  1RWR A;  3VST A;  1WFX A;  3CF2 A;  1V5G A;  2ELJ A;  1OFL A;  4KKT A;  4J01 A;  2QXZ A;  3DTK A;  1WJA A;  3OYL A;  4BDZ A;  4AU7 A;  2F5V A;  4Y4R A;  3L2W A;  1PLU A;  4U87 A;  4HIZ A;  2V7Q A;  2VB6 A;  4RLQ A;  2DOA A;  1E0E A;  4F55 A;  4G6T B;  4II2 A;  4F93 B;  2KL4 A;  2WAE A;  4XKW A;  1OB0 A;  2ZTN A;  2IS2 A;  1MAB A;  2JVG A;  2IGO A;  1O8M A;  2QKL B;  1OR7 C;  2CUZ A;  2CV0 A;  2L9S A;  3NE5 B;  1WMR A;  2V9K A;  1MNE A;  3SDB A;  3OIQ A;  3RQ4 A;  4CCM A;  4MLO A;  3L2U A;  2NT6 A;  4ZYA A;  2BW3 B;  3E1S A;  1VZ0 A;  2LY2 A;  4W8T A;  3HUG B;  1QU3 A;  2KHM A;  4XN3 A;  1UG0 A;  4EAT A;  3ZGK A;  1SAU A;  4U4B A;  4ITV A;  1D1C A;  3ZPP A;  1MW7 A;  2K9L A;  1G8X A;  4YZX A;  2VXZ A;  2X53 S;  2HDW A;  3HAG A;  3DKX A;  4BEH A;  4BE0 A;  1I8D A;  3K4L A;  4B43 A;  1O8I A;  1JI8 A;  3BH4 A;  3KRG A;  2XAU A;  1DQU A;  4YXW A;  1WJ5 A;  2KZV A;  2VBE A;  1BHE A;  3DQV C;  2HPI A;  2LBF B;  4BQO A;  3LL7 A;  3H9G A;  1O88 A;  2JVH A;  3RCO A;  2INV A;  1K5C A;  2XZL A;  2M3A A;  4HSR A;  4E7S A;  3OYA A;  1IDK A;  2M4K A;  2O1D A;  1PJR A;  4X0G A;  2CW7 A;  1DBG A;  3GQA A;  4G7W A;  3PL8 A;  1Z3X A;  2MAB A;  4G7X A;  2ZSI B;  2LRE A;  3GVK A;  4PMH A;  4IX7 A;  2IGM A;  2UWM A;  3JU4 A;  3S3O A;  1H8E A;  1O8K A;  2IQ7 A;  4OZY A;  4C2L A;  2O17 A;  3SEQ A;  3HOT A;  3OYK A;  4E6K G;  3FKS A;  4BQQ A;  4LG3 A;  3T51 B;  3I9V 2;  1QHG A;  3T56 B;  1U0J A;  1KON A;  1D1B A;  4AVZ A;  3OS1 A;  2VLA A;  2KVO A;  4AYB A;  2INU A;  3DLA A;  2CH0 A;  4OZZ A;  4CCN A;  2KRH A;  2VJ4 A;  2IS6 A;  1AA7 A;  1WJD A;  3K10 A;  3RPU D;  3RTR A;  3QOE A;  3GBG A;  4GQN A;  2X6W A;  3IP4 B;  4ZC3 A;  4B3G A;  3FDY A;  4XM3 A;  2Z2S B;  1IRX A;  3UNG C;  2LRD A;  4B47 A;  1OGM X;  4W8Q A;  3H5A A;  3K4N A;  4B48 A;  4ZJZ A;  4DK1 A;  1E3X A;  3EUH C;  3F9K A;  2WJY A;  3OFN A;  4CCL A;  2KP6 A;  1HA8 A;  5HOO A;  2JIZ A;  2KQR A;  3U21 A;  5LFA A;  2QY1 A;  3CP8 A;  3DDY A;  2IXS A;  3QYE A;  2Z1D A;  3A35 A;  3LMW A;  3FBN B;  3SZG A;  2PYH A;  2VBM A;  1E79 A;  1EA3 A;  2VIX A;  2K3P A;  2XZP A;  2LBF A;  4XLE A;  2E60 A;  3OYH A;  2W82 A;  1IA5 A;  4TT3 A;  4GRI A;  2HLD A;  1E1Q A;  4W8S A;  1MND A;  2W00 A;  3MMY B;  4BAC A;  3KEW A;  4ZDO A;  4BJ6 C;  3DTI A;  2XC7 A;  1UD4 A;  3DPL C;  3BCF A;  2XZO A;  1NHC A;  2OUM A;  1BOB A;  2XF6 A;  4HNT A;  1OOC A;  3HPH A;  1UD8 A;  3ZXS A;  2NTQ A;  1TZL A;  3MD2 A;  5FRO A;  2MC4 A;  3OYC A;  1W0J A;  3BCD A;  3TMO A;  3QYB A;  2PYG A;  2WB1 A;  1WTH D;  4NK6 A;  2IGK A;  2IS4 A;  4EW9 A;  3EUK L;  2NOJ B;  3VMW A;  2LY1 A;  4OWR B;  4E7I A;  2ZZQ A;  3ZR8 X;  4BDY A;  2BW3 A;  3BC8 A;  1HVX A;  2X3H A;  3NWS A;  1VBL A;  3OL4 A;  3PNY A;  4XOT A;  4DOZ A;  1BR2 A;  4XKB A;  3GRH A;  1D0Z A;  3OIP A;  3DKY A;  3B90 A;  1TT0 A;  3DU5 A;  4XKC A;  3NWT A;  3LSG A;  4DNR B;  3K70 C;  1ERD A;  4F91 B;  1Y6I A;  3BCA A;  2D3L A;  4L8J A;  2V4D A;  3WWG A;  2R7U A;  1BR1 A;  1OHH A;  4XQF A;  4KKU A;  4IQ4 A;  3OY9 A;  3PSI A;  2WPD A;  4NK8 A;  3IAM 2;  4E4H A;  2LYC A;  2XF7 A;  1GLN A;  4E7H A;  2UVF A;  2X85 A;  1N77 A;  4BL0 B;  2X6X A;  2UVE A;  1YX5 A;  2CFO A;  1D0X A;  3HL2 A;  3OYI A;  2VJI A;  4MR0 A;  1H80 A;  1N78 A;  4KKS A;  2DCE A;  3T9G A;  2CV2 A;  1FMW A;  4E7K A;  1PXZ A;  2DIE A;  1JTA A;  4UZU A;  4Z06 A;  1X1C A;  3OYF A;  2IGN A;  3EPZ A;  3ZQQ A;  3VSL A;  2DJI A;  3S3M A;  3A2K A;  1WJC A;  2M0M A;  3IUO A;  2HPM A;  2WSS A;  2X8K A;  2WBM A;  2A6T A;  2NSP A;  4XLA A;  1I18 A;  2HVS A;  2ZZG A;  4DJA A;  3HKZ A;  2KPM A;  4HNU A;  5HKK A;  1D0Y A;  1W36 D;  1WJB A;  2XGJ A;  2NTB A;  4RM2 A;  1P9Q C;  4OJP A;  1QCX A;  2FUG 2;  3GQ8 A;  2VKD A;  1WJF A;  4KT6 A;  3TL4 X;  4BS9 A;  1VLY A;  1BN8 A;  3WQZ A;  3H5R A;  3BC9 A;  1K28 D;  2WZP P;  4DBQ A;  3GVL A;  2KDO A;  2MFZ A;  1X1A A;  3OEH A;  3HG9 A;  2W6I A;  2OV7 A;  2L2O A;  1KZL A;  2LOO A;  3S8P A;  4Z1M A;  2BVM A;  4IQJ A;  2HNH A;  1BMF A;  2WJV A;  4ZDP A;  3IAS 2;  4N4O B;  1UD6 A;  1GQ8 A;  2HU9 A;  3VSU A;  2L5Q A;  2XSJ C;  2HQA A;  3K70 D;  2P0W A;  3AFH A;  3FPP A;  4P5O A;  2JSP A;  2VJ5 A;  4RMN A;  3G05 A;  3QOD A;  3OEE A;  4HST A;  3SYT A;  4JOM A;  2QE7 A;  4OJL A;  4DGW B;  4DBR A;  3OOC A;  3L2V A;  1X4P A;  2PMZ A;  2CK3 A;  2QKM B;  1NBM A;  2V7F A;  2W6J A;  4ZTF A;  1W9X A;  2L9N A;  3EQN A;  2E5Z A;  4PSX A;  2E1B A;  3ZRG A;  3BLY A;  3CZ6 A;  3PJR A;  3PNV A;  1O8L A;  4HG2 A;  3C2G A;  2VQL A;  1Z7L A;  2CV1 A;  5DN6 A;  4OAY A;  2ZZE A;  1VJS A;  1PE9 A;  2E5N A;  5CDF A;  2BOL A;  1NG6 A;  5CPR B;  4C2U A;  1LDK B;  3OPO A;  1RMG A;  3GQB A;  4J00 A;  5LD2 C;  3DEE A;  3OAA A;  4FXU A;  3K4J A;  4ANJ A;  4LIT A;  3SEZ A;  4BQN A;  2R7T A;  2CUJ A;  4HEA 2;  2CS3 A;  3HXL A;  2CMP A;  5KCM A;  3LSK A;  5HVQ C;  2DXI A;  4HRI A;  2ZZF A;  1H8H A;  2XND A;  3HC7 A;  3OS0 A;  4BU2 A;  1BPL A;  2UV1 A;  3OL3 A;  3BG7 A;  1LFP A;  2Z6B D;  2R7R A;  3KEY A;  4CCO A;  3VSV A;  3M1C A;  3SUC A;  3BG6 A;  2GJR A;  2ZSH B;  4RM3 A;  4KIS A;  4CCK A;  2VAS A;  3PSF A;  2VPL A;  3M8J A;  1K6Y A;  3OYG A;  4YRV A;  2GJK A;  3VWB A;  1HG8 A;  3GQ9 A;  4Z05 A;  3LSI A;  4E7J A;  2VBK A;  2R7O A;  4RLF A;  1W0K A;  5HNH A;  4R79 A;  2Q2E B;  3OYN A;  1OGO X;  1BR4 A;  2V1N A;  3OWT A;  2ODL A;  4B44 A;  1MMA A;  1YE9 A;  1V0E A;  4NC7 A;  3E0J B;  3W2W A;  4NUB A;  1MMG A;  2XF5 A;  4CCJ A;  5FRN A;  1DGW Y;  3N05 A;  1O8E A;  4U49 A;  3DPT A;  4BEH B;  2V31 A;  2O0V A;  4P1W A;  3VYR B;  4XLH A;  4G6I A;  1Z3Y A;  5JHF A;  4NQW B;  3C2H A;  4FET A;  4CUG A;  2O04 A;  2VJJ A;  4D1Q A;  4PK4 A;  3L2R A;  3RSN A;  2MYS A;  4HPQ A;  4PSW A;  2GK7 A;  2WA0 A;  3VYU B;  2ZTG A;  2X51 A;  1BLI A;  4OAZ A;  3OMY A;  4OJ6 A;  4TSF A;  3FY3 A;  2R9V A;  1DGR M;  4LIU A;  4XLF A;  2A5W A;  2Q1Z B;  3FBI B;  4BXF A;  3KX2 A;  2AQE A;  4QPQ A;  2VQG A;  3JUR A;  3H35 A;  1O8G A;  2RNG A;  3DTE A;  4E7Z A;  3VMV A;  1R6R A;  2OC6 A;  4PJM A;  3ZCO A;  4I84 A;  1CZF A;  3I3L A;  2ZFU A;  3FHN A;  4PUS A;  1AIR A;  4F52 A;  5HLT A;  1NG7 A;  1G59 A;  3A4C A;  1WP6 A;  1UAA A;  1V5F A;  3S32 A;  2X1C A;  3UW0 A;  4H4K C;  4XOP A;  1S9H A;  4BE2 A;  2JJ2 A;  1W36 C;  3OR2 C;  1E1R A;  4P22 A;  2LH9 A;  4MXN A;  2E1M B;  2K9M A;  3DWL E;  3ONQ A;  3T53 B;  3LFU A;  2R7V A;  2JDI A;  4XNF A;  4FAS D;  2HVR A;  4TKO B;  2MD0 A;  4C2T A;  4CA0 A;  4DNT B;  2VKH A;  3OYE A;  2V4J C;  3B4N A;  4N4N B;  2NTP A;  1LVK A;  4B3F X;  2F4I A;  2D3N A;  3VYT B;  5C1E A;  2V6E A;  1X0C A;  1X1D A;  5FRM A;  2VXD A;  4ASU A;  4XKV A;  2XDV A;  2NST A;  2VQH A;  4CH7 A;  2R7S A;  2WAD A;  1EFR A;  3K4K A;  3D5L A;  2W4S A;  2KLO A;  3ZPN A;  3OYM A;  4PFO A;  2BSP A;  3A3G A;  3ZIA A;  2PEC A;  5IK2 A;  2KRC A;  1O8H A;  4PJL A;  3MKY B;  4W8R A;  4XLC A;  3CES A;  5HNF A;  1LKX A;  2VL8 A;  3S3N A;  3OYD A;  4JQF A;  4LIV A;  1D1A A;  1FMV A;  3G2B A;  2M4G A;  2V26 A;  3DPU A;  4YEL A;  3VYS B;  2PJR B;  2O5R A;  2WAF A;  2F43 A;  4CSW A;  3LNN A;  2I8D A;  2LZJ A;  1UD5 A;  2BVL A;  5CQG A;  5TGT A;  5KNL A;  4DIQ A;  2GK6 A;  2L7K A;  4XOR A;  4HWV A;  2PJR A;  3PFY A;  1E3Z A;  2M7B A;  3OOU A;  1OFM A;  2XOK A;  2KMU A;  1O8F A;  4XR6 A;  3K4M A;  4KIT B;  3D5S C;  4PJJ A;  1FX0 A;  3VDX A;  1SFK A;  3W2A A;  3V42 A;  1O8J A;  1XG2 A;  1KTW A;  3FKJ A;  3LSH A;  4YEJ A;  2F6C A;  4YZ0 A;  3LMM A;  3BCB A;  4XON A;  2Z16 A;  2M5S A;  4U7B A;  4E7L A;  4Y33 A;  1QHH D;  3ZSC A;  3LSM A;  5C1C A;  2LG4 A;  3K4C A;  3H94 A;  3VR6 A;  2EWE A;  1DBO A;  3OYB A;  1Z21 A;  3B8Y A;  2JA2 A;  4Y3O A;  2QX3 A;  2RQQ A;  3OE7 A;  1NRK A;  1MMN A;  3PUB A;  3W3C A;  4XN0 A;  1X1B A;  1Y56 A;  1RU4 A;  3L2Q A;  2WAQ A;  4KJZ A;  1UEL B;  3A1Y A;  2R7Q A;  2X6Y A;  3OS2 A;  1IDJ A;  1T0F C;  4URR A;  3AL0 C;  3TBI A;  4BJT A;  4XL9 A;  2WY8 Q;  3PNT A;  3GVJ A;  5KHD A;  3H9Q A;  5AMV A;  4C9Y A;  1OLT A;  1V5E A;  2X1D A;  4BE1 A;  4DK0 A;  3OW7 A;  2VQC A;  1V0F A;  1KCC A;  1DP3 A;  1VF7 A;  1T95 A;  2NT9 A;  2HVQ A;  3H9J A;  4OJO A;  3AL0 B;  1JRG A;  4OJ5 A;  3OYJ A;  4B3X A;  1J09 A;  4NNJ A;  4PJN A;  5CKT A;  1PYV A;  2K5C A;  3OR1 C;  4XD7 A;  3CMM A;  3KYL A;  2GJP A;  2HZD A;  3W2V A;  2JUG A;  4F3Q A;  4XMY A;  2R7X A;  1HZE A;  4BUP A;  3MKW B;  4BJ5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...