2X6XA

Tailspike protein mutant d339n of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN HK620
total genus 235
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6xA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6xA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6xA02
2EWEA 4U4BA 2VJJA 4XLHA 1O8DA 1OGMX 1QJVA 3VMWA 1IDJA 1OFMA 3KRGA 4URRA 4OJ6A 2X6YA 1O8EA 1KCCA 1AIRA 1HG8A 1X0CA 2INUA 3JURA 4XL9A 2NTPA 2UVEA 4YZQA 2NT9A 4W8RA 4YZ0A 1OGOX 2VBKA 3VSVA 2BSPA 3FY3A 4PMHA 1JTAA 1EE6A 2UVFA 4OZZA 4OZYA 1O8IA 1DBOA 2QX3A 2O17A 4NK6A 4XKVA 2PYGA 4AVZA 1DBGA 1WMRA 2PYHA 3VSUA 1O8LA 3T9GA 2QXZA 3VSTA 2VBMA 4XKWA 4XN3A 4XMYA 1BN8A 1O88A 1O8HA 1RWRA 1O8GA 4Z06A 5AMVA 4XOTA 1JRGA 4Z03A 2NTBA 1O8KA 3GQAA 4YELA 3LMWA 4OJPA 4C2LA 1CZFA 4XLFA 2Z8GA 3GRHA 4W8SA 4YZXA 3ZSCA 1RMGA 2IQ7A 4XM3A 3ZPPA 1O8FA 1PE9A 4XLAA 3B4NA 4I84A 2O04A 4MR0A 1RU4A 2ODLA 4XN0A 4XONA 4XOPA 4U49A 1XG2A 4NK8A 1O8MA 3B90A 2NSTA 5C1CA 2X85A 3GQ7A 2NT6A 1BHEA 1H80A 4HWVA 2VBEA 4OJOA 4YZAA 1KTWA 4OJ5A 2NSPA 5C1EA 4XQFA 2PECA 2INVA 3WWGA 1IA5A 1KCDA 1NHCA 2VJIA 1PXZA 3EQNA 4W8TA 4W8QA 3GQ9A 4XORA 1GQ8A 3B8YA 2X6XA 1IDKA 3EQOA 4XLEA 4XNFA 2QY1A 1K5CA 1PLUA 4XLCA 3SUCA 3UW0A 4Z05A 1QCXA 4MXNA 3GQ8A 2NZMA 4XR6A 2NTQA 2O0VA 4EW9A 1OFLA 2O0WA 1O8JA 4YEJA 3VMVA 1IB4A 2X3HA 2X6WA 4OJLA 1VBLA 2O1DA 1OOCA
chains in the Genus database with same CATH superfamily
1X58A 2K3PA 2V7WA 3AVVA 3HSFA 1B4AA 4TMTA 5HS7A 3WTTC 4GDFA 3H35A 4LLGF 3BROA 5JR3A 4A3LJ 4HYEA 1G3WA 2ICWG 2Y0SN 2Y2ZA 1ENHA 3GFJA 1SFEA 2FU4A 1VQ4I 2X6OA 1HW2A 3K2AA 4Y4RA 2L5QA 1ZM3A 4HE5A 3Q0WA 3OW2B 1QPIA 4RPBA 4UVAA 3KP7A 4CXFA 2VFQA 5EEAA 1H42A 1I50J 5IT9Z 1QFZA 4ROXA 4V02C 4LK0F 1R58A 2M30A 1HCRA 3TBIA 2Z9OA 2UVFA 2CF4A 2VPRA 5HLTA 1UHWA 2K02A 5B66C 2IS4A 2XAHA 2VXDA 2X9DA 4EJUA 4AVZA 4YIRX 1WSVA 4PC3A 2AHQA 3RPUD 3MZYA 2X1EA 2K9SA 5F08A 1H8HA 3FXRA 2JN6A 1USTA 2X48A 1AKHB 2XRNA 3LFKA 3QFSA 2IEKA 1O8HA 4UAJA 1XSDA 5HKKA 1P2FA 1XD7A 3CMMA 5GPCA 1FRQA 2GA2A 3S93A 3DTEA 2YX4A 1VQ7B 4FASD 3KZIC 1X3WB 1J2XA 2Z5UA 4M72A 1KU7A 1G7SA 3CC4B 5M5XJ 2D45A 3DBLB 1KK1A 3OEHA 2NS0A 2DDBA 2LVSA 3I64A 4X05A 1I3QJ 4BBRJ 2JA6J 2OBSA 3CCVI 5F4OA 1BI0A 1YX2A 1WOPA 2X53S 3K0LA 4S05A 3D1NI 3P9IA 1BJKA 2LC2A 1GVDA 2R5ZA 2K27A 2VBWA 1YS7A 2LY1A 1TWCJ 2P81A 2VKEA 2QN6A 2YS9A 3G05A 3WHBA 4DYQA 1AIPA 2E36A 2O8XA 3CESA 2FQ3A 4JQFA 3IRQA 3A35A 2QSFX 4P22A 2LLKA 4G5GA 4OPVA 3A8JA 3ZIAA 2VBEA 3I9V2 3A2KA 2PE3A 2H6BA 2GREA 1JJ8C 3ASTA 2X51A 2E7XA 3S8PA 1UAAA 4IJAA 2YUSA 3ONUA 3P9CA 1U8BA 2R7XA 3AGPA 2M3AA 4W8QA 3IV5A 3GCMA 3H0DA 1TWAJ 1YHQB 3ULQB 1OR7C 2LKSA 4E6KG 1LM1A 5HVQC 2G9WA 2DI3A 2L9NA 2ZMEB 3S1QJ 2ZL5A 4F7DA 4KT6A 4ON0A 3ZZUA 3DU5A 4JX4A 2BV6A 2L2OA 3JAMK 1X1BA 3HSRA 4E7JA 5DM7F 3CCEI 1ZG5A 1V5VA 4FN5A 2VFPA 4EW9A 1UG0A 4BACA 1KRHA 2E1NA 3VMVA 4N9HA 4AC9A 3HGYA 4E7ZA 4HZFA 3IAS2 2ZC2A 1AHDP 3PUFA 3DEWA 2Q6IA 1DP7P 2O61A 1HZEA 3LSTA 3O3KA 2JWTA 3SZPA 2X4HA 3WU1B 4M0LA 4XLHA 1X2MA 1NB0A 1VF7A 3K10A 4UZUA 1XB4A 1YOVB 1CLWA 2HKXA 1EA3A 3U6BA 3H9QA 3V8JA 4DNCA 1F9NA 3OS2A 2A5YB 2FNAA 5KAFC 3QRFF 4YAUA 5EEGA 4XRSG 3FDYA 5EG0B 1RR7A 2DCEA 2DERA 4W8RA 2EK5A 2ESHA 2LOOA 4OIPF 2RNGA 4W97A 3S1MJ 3K4BA 1XG1A 5FKLA 2R7VA 2GQFA 3KPHA 3ASQA 4BJ6C 2VOOA 1EE6A 1O3SA 1QZEA 2PN6A 1Y0YA 3AGQA 1JB9A 2HOAA 1U2WA 3U2RA 1YE9A 2HQRA 5FRMA 2RNJA 3Q6QA 2ZFUA 1DBGA 1AU7A 2IOUG 1KA8A 3H1CA 2EIJH 4KKUA 1R7JA 4N9IA 1O8LA 1WI3A 1WJEA 2L7KA 3LVBA 5EZHA 3RKXA 2WTEA 3OOUA 2JVGA 1T98A 1FBUA 2XAUA 4PFPA 4A0XA 1UHMA 2DMUA 4Y7NJ 4X6AJ 3A0HC 4RGUA 3I3LA 4LG0A 2KMUA 4FCYA 1ZRDA 1VQLI 3BY1A 4XOTA 2QUFA 2E1RA 4IXAA 3L7WA 4O5VA 4JP0A 1H88C 1WWXA 1YITB 2XDVA 1MNEA 3B02A 1YTYA 1F5TA 2R92J 1IUYA 1E1QA 2FVGA 1O3RA 1Z3XA 1X19A 1SD5A 3ZQLA 2P7CB 2J7KA 3GTLJ 2OTLB 1YS6A 3A01B 3AG3H 2H8RA 4WWCA 1F60A 2DA5A 1BJAA 2AS5F 3HC7A 3DTKA 3P5JA 4B44A 2CS3A 5DUKA 5HS9A 4Q5SF 1TT0A 2VC0A 4CZZA 4MLOA 1FEXA 1UMKA 3OP1A 4G12A 5TISC 3DCFA 4AM3A 1TL8A 5BQTA 3LAJA 1IG7A 4OPSA 1WXRA 3BCFA 1W2BB 2CFOA 4BAYA 1Q86D 5EGOB 1QQIA 4BHBA 3SY2A 3F23A 4WX9A 4X0CA 2LDUA 3P7NA 1TUIA 1QVTA 1JHHA 1W35A 1VZ0A 4OJOA 2P5KA 1FZPB 4RDJA 1D0YA 3PA2A 4KITB 1EJ9A 4C2MJ 1GV5A 2IVMA 3QPTA 3ZN1A 2B7BA 3MQ0A 3CCJI 1KCDA 3BDDA 1RUNA 4MQVA 1E3XA 4M9SA 1QGZA 2KL4A 3HHHA 3CCUB 4BEHA 2R3SA 2BGCA 2VXZA 2L4AA 5LRRA 3PNTA 2DMPA 1IJFA 1RKWA 4RA2A 2OZUA 1K73D 2XAQA 2QQ8A 3DKYA 1B9NA 1R1TA 3I54A 4OM9A 4FISA 1K6OA 4F7ZA 3BLYA 1AOYA 4UB8C 1IB4A 1BR1A 2HTJA 3ZR8X 1LFPA 2LG4A 3ZGKA 5JFRA 4BNCA 4BKXA 4CCOA 2W00A 1UD8A 3JQPA 2V7FA 5LLQA 1G7RA 2F2EA 2HI3A 3JTHA 4OMZA 2MD0A 2IGKA 2JA2A 1OMIA 4I98B 4ZYGA 2EJRA 1K9MD 5AIQA 2W84A 1Y39A 1J59A 2ZMEA 1N08A 4RM0A 4RGSA 1TP4A 4ZZLA 3JU4A 3HXLA 2XTXA 4EM0B 1QJVA 1FNDA 3ZQCA 3JRGA 4LOCA 4URRA 3FHNA 1PJRA 3LQRA 1IN8A 1OKRA 3MCAA 5FLMJ 5C3EJ 1RRJA 1TTTA 1KONA 1WKMA 1R1VA 3DLLF 3NAWA 1RUOA 4Y13A 5BS6A 4HIZA 3A8IA 2DA4A 2QCOA 2EQRA 1MKMA 2DCUA 3KP5A 3LO8A 4KA4A 4I76A 1FX0A 3ELKA 4X7DA 2FMLA 2WSSA 1OYWA 1TW3A 2ID3A 4R79A 2H09A 3IWZA 4A3JJ 2C5HA 4U9UA 5IYBJ 1P6RA 5CPRB 4RLQA 4BE2A 1OR7A 2QX3A 2ISZA 4XLNF 3JW4A 3VSUA 4RAFA 3WTZA 3M8FA 1APLC 1VQ7I 1FYLA 3AG4H 4UNOA 4EH1A 1UFMA 1LFBA 1SD7A 2BEOA 3OFNA 5D4SA 3CMAB 1R49A 4U87A 3DTIA 5F64A 3RQ4A 1T0FC 1PP8F 3K4KA 1R5HA 1O8GA 1K83J 5AIPA 2XEXA 4HNUA 4UUSB 2CUJA 1SVMA 2ZO4A 2RQQA 2R93J 4IX7A 2D9RA 4UY8I 2GXGA 3EDPA 4XSXF 3G2BA 4LBYA 3ZPPA 1QBJA 1D1AA 3H3VK 2LYCA 4GYGA 1RQRA 2HGCA 2KIFA 4LG3A 1IN7A 1TW2A 5E1XA 4MR0A 3V8KA 4CCKA 3ABLH 3KP3A 5D5VB 5FO0A 2AQEA 3HOVJ 1SFKA 2BF4A 3AL0C 3FXQA 4IRGA 3GTKJ 1Z1DA 2RC6A 3ZMVA 3HIFA 1T6ZA 4I01A 2VUMJ 4C3IJ 3ZPNA 2W48A 1YRNA 2HS5A 3CCLB 1QHGA 1STZA 3DLAA 3F8NA 4RB1A 2NVXJ 2PMHA 2DA3A 1XTAA 1I27A 3QQAA 1FNMA 3PFIA 4M3BA 4NC6A 3L2UA 2P8TA 3JRAA 1BI1A 4BJ5C 1WJDA 1UCRA 4ETSA 3S2DJ 3J81Z 3FKSA 2HTSA 3K4CA 2KJBA 3TDUC 5ILSA 4AUXA 3B78A 3W5HA 3T8RA 3OYGA 1W4MA 1QUFA 5J8CA 1W9XA 2BVLA 1KK3A 3DQVC 3WXMA 1WJCA 1OCCH 3QOEA 3F21A 1K28D 2GXAA 3J7AO 1MBHA 2VNKA 1OCOH 1U5TA 2OBRA 4LB6B 5D8LB 5ICCA 1SFUA 1NJID 1LEAA 1X1DA 4ZGQB 2EV6A 2DJIA 5LHGA 3PIOF 2O9LA 3CXCB 1YJWB 2QDXA 2XNJA 1QQ1A 3OYHA 2ZKZA 2X1CA 3PM1A 2BW3B 2BSAA 3CCRB 2VFOA 4ACBA 3H5RA 3LA3A 5CQGA 1H8AC 1U0JA 2M0CA 3PNYA 2YWGA 4BEHB 4M4SA 2JUGA 5GV7A 2EWEA 1RZ4A 2VONA 1T6XA 4G6IA 2ZCWA 4B09A 3N6ZA 2PMZA 4EEFG 5K7FA 4HW0A 3HBLA 1WGXA 2COBA 5KHDA 1UMQA 3E0JB 3FXUA 5IY5H 4GFBA 2X6YA 2BM1A 2DOAA 2FBKA 5IYCJ 1I5ZA 4EGYA 1OB2A 2YWEA 3JRDA 1QA1A 1SVLA 4C0SA 2DN0A 5M3FJ 1V5EA 2LRDA 4X7CA 2W85A 3RPUA 3K1NA 3CDHA 1X3UA 3ASPA 2M1BA 3IH2A 2HDNB 3KIOA 2V7UA 4X07A 4QUZA 2UVEA 3J80K 3I1FA 2VYQA 2CW7A 1G3TA 3FBIB 4YALA 4E7HA 4AF7A 4AYBA 5JVGF 4MEYF 4NQWB 2OU2A 1Y1WJ 2A5WA 2DK5A 2IRFG 1HKQA 3BCAA 1I18A 2KIQA 5F1JA 1GO2A 3SDBA 3J7ZI 1VI0A 2GAUA 1EF4A 1LPQA 1OB0A 3CLOA 4KKSA 4G6QA 5FGMA 4YFXF 1B6AA 4XD7A 1U2RA 4HF0A 5GPAA 2FRHA 2CRGA 3BTLA 4U7BA 2EFPA 2QA4B 2Q2EA 5HNFA 4E7SA 2E35A 2QEXI 1Y0RA 1TNSA 3WQZA 3SHFA 2VIXA 3ZQGA 4E4HA 1G3SA 5HS8A 2ZJRF 1JUSA 4YAWA 3DPLC 1SANA 2KZGA 2BYVE 4Z2YA 2EZKA 1CZFA 4BQOA 1HXDA 2Y9ZA 1YJ9B 2XT4A 1FSEA 3JSPA 3JSOA 3VEPA 2M7AA 9ANTA 3CTAA 1U3EM 2XHKA 1FTTA 1QGAA 1KCCA 3LFUA 3L2WA 1AA7A 4XONA 3MAJA 2V1UA 2FD5A 4NK8A 1QHHD 2OA4A 1FY7A 3ERMA 2XTWA 3BOQA 1ZQ3P 2R0QC 2QZAA 3WBJA 1K61A 3CPXA 1H80A 1R71A 5JBQA 2QWWA 4TSFA 2NSPA 1YX5A 3GUDA 3OYIA 1HQCA 3M1CA 4B48A 4ACAA 2D1VA 3GQ9A 3SDGA 1WZ2A 1W5TA 5FO5A 1J75A 3KYCB 1FLIA 4E0FA 4Z4SA 2LK2A 2DXIA 2QQBA 1IDKA 2VQLA 4QLCU 2L7ZA 3D5SC 1MJBA 3AAFA 3EUHA 4ZJZA 3L00A 4XNFA 2PJRA 3ES9A 1RQPA 3BH6B 3J7AY 3CZ6A 2R7WA 3KZZA 4A3FJ 3MFKA 3TW7A 2YR2A 1KU2A 3UW0A 4QSHA 4CZCA 3A02A 2L9RA 1E3ZA 2L9SA 2NZMA 2M4KA 3DU1X 2CWEA 3BPXA 1IF1A 3M1EA 2HDWA 3KYLA 4XBFA 2JT1A 2GJPA 2ZNZA 2A05A 3SXYA 4CCMA 2VL8A 3C1DA 3WTYC 4M3EA 3B6CA 1BW5A 4PJJA 2HZTA 2UUZA 4G6TB 5IP9J 4U4BA 1RKTA 4YAOA 1R5ID 2BM6A 2V7TA 4QFMA 3BWGA 4KMUX 2PLYA 2XASA 3CD6B 3VFZA 1OFCX 1HSTA 4AIJA 4I0BA 1VNDA 4GQNA 3OR2C 4MTDA 4KIGA 1FRNA 1MMGA 1IJEA 1D2EA 2V4JC 3C2BA 3U2QA 4C3JJ 2INUA 1QA2A 4XIDA 3JURA 3FJOA 2V6CA 4LLLA 1MJ9A 4IL6C 1ETKA 2GIZA 1BW6A 4ABZA 4RPDA 2FUG2 2BY3A 5A89A 3ZOBA 5DD8A 2JZYA 4P96A 1PUEE 3V76A 3OIOA 4M9XA 1HDDC 3NAUA 3LA2A 2LR8A 1GXPA 4P12A 3WU0A 3K1MA 5B5EC 1VQMI 1VF9A 3GSIA 4A69C 3VSTA 2C2WA 2VBMA 1KQ9A 2XF7A 3ZMSA 2OAZA 3TKYA 2PIAA 3ABUA 2RKHA 1TNTA 4KMFA 4EJWA 3L2QA 2CNDA 2DBBA 2ZB9A 3O8GA 5BOXA 4DK0A 2VKDA 5EJCA 1ZR4A 1E3PA 4XK4A 3MZHA 2Z2SB 2HPMA 1R4MB 4BUPA 1MJAA 1R36A 3W6JB 3SFZA 4EVIA 3H92A 5TY0A 2DPUA 2OQRA 5LFAA 4Z4UA 3FMSA 3WTWC 4RB3C 1HF0A 1FT9A 4R8HA 3DPTA 3BR5A 2A07F 1ZYRF 4B8XA 2YU9J 1G7TA 1IB0A 1OCZH 3HOUJ 4KKTA 2IS6A 4LIVA 1HSJA 4XOPA 1V0FA 1Z21A 3SJMA 3JRCA 1O8MA 2Q2EB 2O7OA 2RDPA 5IP6A 1R9TJ 2GOXB 3GQ7A 4N3NA 5CVJA 1OYIA 1JJ6C 2ZBKA 4HWVA 3H5NA 2J8IA 3ZQHA 2NYXA 2ADUA 3IH3A 4NC7A 4WXCA 3V7RA 3FMRA 3G1MA 2BMWA 2LMDA 1LDKB 5FJ8J 3V4GA 2Y0SA 3T51B 3OEEA 4PGOA 3EQNA 1DQUA 1VHEA 2WJYA 3ZMUA 1GHCA 1OLTA 3S14J 2H27A 4DQLA 3IKTA 4Y9UA 3V7CA 1FP1D 4BDZA 4AC0A 2RREA 4ZTFA 1VQ5I 1LDDA 2CSOA 2QY1A 3CJRB 1I39A 4C2UA 2BY0A 1N25A 1TTYA 3CF5F 1PDNC 2PLFA 2VQGA 3L2VA 2WAEA 2VJ5A 4BQQA 5HLGA 3E5XA 2CFXA 2N8GA 3GX4X 1QNTA 2X6WA 5DSZA 5L3BA 1G6NA 1QRYA 1BIAA 2A3SA 5LHHA 1TQMA 3WG7H 2VI6A 1J9ZA 4ZDLA 5GTIC 3LMMA 3HEFA 2KFDA 2PJRB 4HLXA 4RD1A 3G73A 5GV8A 2WWYA 2FMYA 5CDFA 3QWLA 5K5QA 3VNUA 3L9FA 4WF2A 2Q6LA 4XRSA 1YRNB 3DWLE 4IHWA 4XICA 4K2EA 1W87A 3IAM2 4N4OB 3HGGA 3MZ8A 1N0VC 4UUVA 3HRMA 2QQ9A 3I71A 4OAYA 5EZGA 3E6CC 3NRVA 5M5YJ 2NT9A 4MFDA 3E3VA 3GZ6A 3CCSB 1OGMX 4FX4A 1ZM2A 3F8BA 1C0WA 3CB4A 3B6AA 4B4CA 4CYCB 3AG2H 3OSFA 3I4NJ 1LQ1A 3S2HJ 2B5OA 2JSPA 2DYSH 3M7GA 1U5TB 4XKVA 4PZJA 2Z16A 3UKGA 1RR8C 2PJPA 4D9JA 4WXDA 3HJEA 2B0RA 3CMEI 2ZZEA 1MMSA 3NWTA 4ZYDA 3WNDA 3FZVA 1K78A 2EFOA 5KCMA 2STWA 2BW3A 1RWRA 1IUFA 4YXWA 3GQBA 1FMVA 1D1BA 2CUFA 2AXLA 3BC8A 3IKVA 2WY7Q 5FFXA 1QUEA 1IN4A 1HW1A 2WAQA 1XS9A 1GJRA 2NTBA 2PEXA 3CPWB 1V5GA 3DEUA 3W2WA 1OGJA 2M5SA 2LF8A 2CQ7A 3LQ6A 2K85A 4BYYA 1QG0A 3OS1A 1ZRFA 4QVAA 2QKLB 4TV7A 4G7HF 2W6IA 4DK1A 4RM3A 1FPQA 4MHGA 2P5VA 4A12A 3K69A 1R6RA 4GYIA 3EYYA 3MHPA 4GCVA 1ZLJA 1XG2A 2MSYA 1U9OA 2XPVA 1W7PD 3B90A 3ONQA 4RAGA 1X1PA 2XGCA 1ON1A 1DGWY 2O0YA 5FKKA 3Q5FA 2HMAA 2IGMA 4YAFA 3R0AA 4NQWA 4RM2A 3PUBA 4I02A 4Y33A 2WB1A 2EA2A 4H4KC 1OYYA 3CP8A 3N4MA 1IZ1A 2INVA 4QWQA 1EP1B 3Q0UA 3N05A 2HCJB 1O4XA 1SKQA 3IL2A 3L09A 2DFEA 2ECCA 2QA4I 1GQ8A 1S0UA 4RGRA 2VJ4A 2KRCA 2MLKA 2XC7A 1YJNB 1MBFA 2LY9A 1Z7LA 3WTXC 2IXSA 3CCEB 1SMTA 5JI6A 4G9YA 1V5FA 2RV8A 2P0WA 3ISPA 4LK1F 4KFCA 1DDGA 1E43A 5DEQA 2ZBVA 1K4ZA 2BVNA 2LREA 1SVOA 4PC7A 4Z05A 4R1HA 4NBSA 1TWFJ 4EGZA 4BGDA 1YFHA 1H0MA 2OF7A 3FK6A 2IGNA 3ROUA 3A3GA 3DKWA 2KIMA 3U1DA 5F1RA 2K40A 1YG2A 3H9JA 1JE8A 3RCOA 1JTYA 4NNJA 5ICFA 2L4MA 4ZH4F 5FLXK 2EPFA 4RD2A 1NDHA 4HNTA 2VBXA 4AIHA 3HPHA 1ETVA 2H94A 4FE4A 5F0HA 4LIUA 3G6EI 1ZGJA 1W1WE 1P4WA 2PFBA 3SFIA 2CG4A 3KRGA 5D5XB 2JPBA 4RB0A 2R7UA 1ZN2A 1M90D 2DYRH 2GJRA 4CGZA 1BM9A 4WZKA 3BG7A 1Z6RA 1QRCA 3BZCA 2E5NA 2FQ4A 4FE7A 4IHSA 1TC3C 1DARA 1T5EA 5C44J 1BBYA 3PSZA 1MBJA 1JKRC 3HRTA 2LP0A 3AVWA 1YI2I 5IYQA 1BI3A 2XIGA 3OYNA 4Y9RA 5J4VA 2O17A 2VT2A 3FBNB 3HTSB 1OHHA 1J7KA 3TOBA 2W82A 1F4KA 2F4IA 4Q7JB 2CQKA 4EV0A 3FX3A 1SAXA 2CJJA 4N0BA 2L02A 2V1DA 3FIWA 1OISA 2BV3A 1G4DA 1O88A 2NRAC 2KP6A 3V7SA 3CC2I 4MO7A 4RLFA 1IRFA 3CJQB 3I4MJ 5AMVA 4IKFA 4CQJA 2MYSA 3EUKL 1XMKA 1QFJA 2EA4A 1BR2A 3REOA 1S4MA 3J81k 1JRGA 4MYUA 2QMUA 3PSIA 5BNGA 3BPVA 3R4KA 3KP2A 4M3FA 1ZR2A 2HDCA 2D1HA 2XVCA 4DQKA 5BSXA 4P25A 1ETWA 2ZMEC 1AWCA 2R7FA 4L5JA 1FOYA 4RGXA 5CYVA 4S0HB 4AYBN 3AL0B 3ZN0A 1LVKA 2AXTC 1N05A 5FIUA 1UJ8A 3JRFA 1K78B 2F5CA 4X7EA 2MGQA 1OCTC 2B63J 2C5BA 2M87A 2WYRA 1LE8B 1ZM4A 1IRXA 3MKLA 3GTPJ 5D8KB 3QPSA 2NT6A 1VQNI 3RPQA 1IHMA 4YIIA 2ZZGA 2DLLA 4A0YA 2RN7A 1B8IB 2CH0A 1IDZA 2O6GE 4XQFA 3GTJJ 1KU9A 3WWGA 2K4BA 5TJJA 2V31A 1W5CC 4B47A 1HDPA 4PUSA 4L0YB 2VE8A 1EA0A 4BH9A 4IQ4A 3HL2A 4G7WA 3QU6A 3TMOA 6PAXA 3MVPA 3F8MA 2KHMA 3HOYJ 3H9GA 5E1ZB 1S29A 4WZLA 4E7LA 3LSRA 3MKYB 4BXXJ 5DDGA 1HOMA 5AN9A 3GVKA 1GR1A 4EM2A 5J8FA 5F6FA 2NTQA 2O0VA 2CQQA 1OFLA 3ASNH 2XC1A 4HNVA 3DBHB 3OOPA 1WI9A 2DODA 4KT5C 3RQIA 1IXSB 2HKOA 2X8KA 3VSVA 3CJTB 2GOMA 4MIMA 3LQQA 4MTEA 3VWBA 4MYTA 4ZGNB 2FBHA 3E6BA 4WZTA 1GDTA 3T53B 3CF2A 4XKCA 5F04A 1HKTA 2J8KA 3OZWA 2VBUA 3T56B 3A01A 3VPRA 3ESWB 1JT6A 2VFMA 4L5EA 1POGA 1UHSA 1YIJI 3QYFA 4HV5A 3CDIA 4EJVA 2E2IJ 2GM4A 1X4PA 4QIWN 3PQKA 5F0CA 1H85A 2QGGA 4F92B 2R7SA 1LLWA 2Z33A 4C9YA 2DK8A 2CV1A 1WJBA 3LL7A 4RD6A 1MH3A 4ENNA 1E0EA 2BXYA 2O6WA 1P92A 4ZCLA 3H9NA 2F5EA 1XFOA 2VBZA 1MSFC 2WAFA 3JR9A 3SQNA 5D6EA 1GVJA 3Q9SA 5JHUA 2V7QA 5GAGJ 2PYHA 2EWNA 4MQ9F 1U9NA 2IS1A 2ZNYA 4KISA 3OMYA 4ESBA 2GA1A 1I6HJ 1NG6A 4D5CA 2F5DA 3PO3J 2X3UA 2NS7A 1D5YA 3QFRA 4CYDA 4OOVA 1BA5A 4P3YA 2VBTA 2XAJA 2FSWA 3BP8A 2WJVA 3W5UA 5EYRA 3ASOH 4ZCIA 4CCNA 4HE6A 2QE7A 4ANJA 4IO9F 2D74A 2JDIA 2XPWA 2DMQA 1A6IA 3HTUA 2X1DA 2Z8GA 4W8SA 1TSPA 2L7MP 3W2GA 3CC7B 1G59A 4XM3A 2F3LA 2KPMA 4BU2A 2R7QA 4FETA 3QYEA 1BR4A 4XLAA 2DJNA 4OOXA 4G7OF 5DCFA 4U0VA 2XSDC 2VE9A 1JNYA 3W2VA 3KZYA 4XKBA 3PENA 3TP0A 1XQBA 2FXAA 1MNMC 2DT5A 1IDYA 5EEHA 2QVOA 2QENA 3RYRA 2R7RA 4II2A 5C1CA 3RY8A 2CBXA 4M73A 4CYCA 1WU8A 1IN5A 2EZIA 3CC7I 3G4SI 3BZKA 2NPFA 1B59A 1QVUA 3JRBA 2GK7A 1IA5A 1ONVA 4WCGA 4Y52J 1SD6A 3K4NA 4EM1A 1D8TA 3FXKA 3UR3C 2BM4A 4DBQA 2ZTGA 4F3QA 3R6JA 1VQLB 2DMTA 2XF6A 1HW5A 2HU9A 4AVPA 4E70A 1H9TA 2BPOA 4IEJA 2I1LA 3B8YA 2QKMB 3SZEA 4LGWA 2FEZA 4LJZF 2D2WA 3HOWJ 2WC2A 3QP5A 3BQZA 2M9HA 4JX5A 1IV6A 2QYUA 3GBGA 2E2JJ 1BX0A 1L1IA 4ESFA 1FNNA 4IHVA 1WOSA 3N97A 2DFFA 1ZAOA 4JK1X 1IRGA 3OYJA 2OD5A 3OZVA 3P4GA 1UD2A 1VQKB 5ED4A 3LNNA 4PC2A 5B1AH 5EG0A 4P1WA 2L9VA 4ITVA 3H3UA 4F55A 4PC6A 3BJ6A 4WK8F 4IOCF 4D5FA 2C4TA 1E63A 1R5BA 1MSEC 1YO5C 2DQRA 2L3DA 2VJJA 3R0JA 1L3LA 2DT7B 3IP4B 4BS9A 2YWFA 5GAEJ 3NE5B 1U8RA 4X7FA 2EZHA 4PK4A 1IDJA 4GGGA 5LHIA 4N3GA 1JUMA 3TOAA 1WORA 3TO7A 1EP3B 2IA2A 2VB6A 3I59B 3Q0VA 1NBMA 1R22A 3ASRA 1XCBA 3OSGA 3P26A 4B3GA 2BX6A 3E7LA 1XGSA 4U7DA 3SZGA 2JSCA 4DZJA 3S3OA 4PGGA 2HXOA 4PDKA 1JTXA 4LG0B 2I10A 3OL4A 2AQFA 3AKZA 2BSPA 4X06A 3CUQB 5J1UA 5GP9A 3LA7A 2HWVA 2V9PA 1YW9A 1FJLA 2ZL7A 2O5RA 1ZM9A 4PCQA 3RKQA 1J9IA 2XSJC 4F52A 3OYKA 1NHAA 3BR0A 3HG9A 2KZVA 4U0WA 4EQQA 2Y0MA 3RZOJ 1PKVA 4LBWA 2VBSA 3BC9A 2Z1DA 4NDLA 1K6YA 5K5RA 4UB6C 2P5LC 4Y15A 3S15J 3GFLA 3NQOA 2XV4S 2JMWA 3CCUI 5HXBA 3Q6RA 1HF2A 2QSHX 1BN8A 3BR6A 2H8WA 2K86A 4A3KJ 5J3LA 2VKVA 4WWVA 2L01A 2DOGA 2A6HF 2NV4A 5IK2A 3W2EA 2ACJA 4AF6A 4HQMA 3PSFA 2JQ7A 3RIQA 2HYGD 2KT0A 4XLPF 1B72A 3BY6A 5EGOA 1JKQC 4A5NA 2E1MC 2Z6BD 3GIRA 1ZTRA 3TO9A 2QYOA 2XT2A 3GRHA 5IP7J 2RAEA 2QM3A 3F0CA 2DQLA 4L9JA 3Q3AA 4MFEA 3F6VA 3WU2C 3KP4A 3B82A 3D26A 4QPOA 2DU9A 5HDNA 2QSGX 1DABA 2F48A 3ONYA 1PJ5A 1GAWA 2NNNA 2P6SA 2VNJA 4I09A 5D5UB 2DTZA 3I58A 4UV9A 4EJOA 3H0GJ 3K70D 1NK2P 4M71A 4O3MA 5M3MJ 3S16J 2QQAA 2QBYB 4FTHA 3ZXSA 3HOSA 4EATA 1HC8A 3CW2A 1BMFA 3U6KA 1TYXA 2VFNA 3HRSA 5CKTA 1E62A 4DGWB 3R6KA 4Z1MA 1B9MA 3KE2A 4RD3A 1EV7A 3WGHA 3ABMH 2OZ6A 3B73A 4I7HA 2FOWA 4M53A 1VQKI 2CQNA 1PVEA 1D1CA 3R60A 2DT6A 2OYNA 3JRIA 1Z9CA 1TZLA 3MN2A 5FL7A 3KEWA 2XZLA 4OOSA 3GZNB 3VYSB 4BHPA 2HLDA 2F5FA 4L9TA 1G3YA 5KVRA 4IHTA 5E3NA 2XGJA 2P6TA 1NRKA 4RBOA 1FP2A 1VQPI 2O0WA 1MBKA 4CO8A 1DGRM 1QZZA 3LSHA 4JOMA 1ZLKA 2JJ2A 3T5XA 3MCZA 3HYIA 1GT0C 3LSIA 3MWMA 1WJFA 3WODF 2OK7A 5KW9A 1E79A 2EFQA 1L0OC 1LE8A 4L8JA 3ZBUA 3KEYA 3LSMA 2Y75A 3A03A 4G8XA 1QO0D 3W6KB 2RC5A 4JMQA 1RNLA 2ZFWA 1MGTA 1UD5A 4TN1A 5FD6A 1YITI 1VQ6I 1ITYA 2LY2A 1AIRA 1TLHB 3MD2A 2EIKH 1T6YA 4YZ0A 2M45A 2PMUA 4UUSA 3OOCA 2GPJA 2VQHA 3HRUA 3DP7A 3K4JA 3SJPA 4YFOA 1WDTA 5JLVC 4YEIA 4L0ZB 3PFYA 2UWMA 2HDDA 4NK6A 5TR9A 4GRIA 2ME6A 4QPQA 4I99C 4B3XA 1ZK8A 1SM4A 5DNSA 5BPDA 1CF7A 4ZZDA 5LGUA 4D1QA 2CW0F 3PNVA 3QAHA 4RDUA 2XPUA 1VQ8B 1BOBA 1X4OA 3E97A 4ASNA 5FB2A 3DEEA 3CMYA 2NOGA 5HDKA 3M07A 2NAZA 4XMYA 1IXRC 3K1PA 4IF4A 2MW8A 4PJNA 2HOSA 3ZQIA 3LJYA 1GAQA 4ZCMA 3CDLA 1A8PA 5K7ZA 2DTRA 4CUGA 4FT8A 2LZJA 1ZRCA 2EFWA 2GWRA 2XAFA 3DDYA 3ZP5A 1D8JA 4V2FA 3J80Z 1AMOA 3ZSCA 2E34A 2BN4A 4DNTB 4FHTA 1S72I 2IAIA 3BCBA 3G1LA 1MDMA 1OGIA 2X0LA 3V7AA 2TRTA 1BQEA 1AKHA 1LFUP 1J0RA 1MW7A 3LSGA 3SZTA 5H2FC 5J3OA 5L46A 3FKJA 3Q3SA 4QVJA 1ZG3A 2ELKA 3VYUB 3OY9A 3FWEA 2ELHA 1TWGJ 2K9QA 4RS8A 2A61A 2LBFB 4M6VA 3HHGA 3WTSC 1ON2A 2JJ1A 5HZBA 3G71B 1YIOA 3E1SA 3NB2A 3I56B 1TWHJ 4KNYA 1KGSA 4NC8A 2M8EA 4ZC3A 1KTWA 3VB2A 4JYKA 2ZXHA 2HPIA 2R9VA 1KQ5A 4BQNA 5K1YA 2B7CA 2L7FP 1OFDA 4E7IA 1S6LA 1KYWA 1R00A 2DA7A 3CCYA 2NNYA 2G0YA 4JBAA 5B3SH 1W7PA 1GLNA 4XORA 3ZQFA 1BI2A 4ASUA 3GMEA 2OV7A 3OR1C 1S8NA 3WYAA 3PQJA 4KJZA 3GVAA 3W3CA 1BLIA 3GW2A 4XLEA 1JGSA 3A0BC 4IZZA 1MD0A 4RB2C 2WV1A 3M8EA 5TRDA 1RC9A 3BG6A 3FKIJ 3CCLI 3K7AJ 4HSTA 2ISYA 4DW6A 1S7AA 4J0QA 4DNRB 1VQ5B 5KSWB 5LMZA 3CCMB 3VNVA 3CQZJ 5L3GA 4RJLA 2EB7A 3SQVA 5A2QK 1VBLA 3H09A 3FPKA 2E60A 2DDAA 3D5LA 2CW8A 2PG4A 1PJ7A 3BH4A 5LGNA 1QH0A 1MBGA 2DA2A 4PJLA 4BBSJ 1ETQA 2OQGA 2OCEA 5E3OA 2MC3A 4EJTA 1BC7C 1Y0NA 5BMZA 3M8JA 4KYWA 1K79A 3HKZA 4FK8A 1ACIA 4OJ6A 4G1VA 1S9HA 3M4OJ 2OTJI 3FMQA 2MG4A 4I2OA 1FNCA 3F72A 2JA7J 2E1MB 3DV8A 2MABA 3PUNA 4OIOF 1YQAA 1T33A 2M8GX 2VQCA 4YFKF 5L3DA 1R5OA 2JN9A 3FPPA 1PJ6A 2ZXWH 5GTHC 2YX7A 4GO1A 3TW6A 4HDVA 1EZGA 4HF2A 5J47A 2JA5J 3W2FA 2VBKA 3R61A 2BM5A 3IUOA 2HVQA 3RZDJ 4M74A 4PSWA 3Q38A 4H9GA 2KDOA 4Z6YA 1P4AA 1DBOA 3DXJF 1WSUA 2IA0A 3H5AA 1ZUNB 4F91B 2TDXA 4N4NB 4G7XA 4M1KA 2B0LA 3AK5A 1WMRA 1UB9A 2HVRA 1N8RD 3GZ5A 5CVRA 1ETXA 3ZC3A 1WQ2A 4FXUA 2FNPA 1PYVA 3KP6A 5F27A 2YWHA 3GWZA 1EFUA 3ISXA 2V26A 3JCUC 1TQPA 1XGNA 2EV5A 3QU3A 1ZGWA 4HQEA 3ECHA 3IHUA 4Z06A 4B1RA 2BHZA 1YLOA 1EH7A 2WR8A 4Z03A 2V9VA 3G4SB 1BIBA 5DUIA 3LSPA 3GQAA 1Q9SA 4RLZA 1I7PA 1SD4A 2R7DA 3ECOA 2BE5F 1ETOA 2F4OB 4Y17A 3VDXA 1QPMA 5E3MA 1DUXC 2JUCA 4P9SA 4YCQA 1T08B 5J1YA 2DA6A 1JKOC 4LBZA 3I55B 1VQNB 2IJLA 1FMWA 1XN7A 2MC4A 4II3A 1FIAA 4RDKA 1HA8A 5CJ9A 4XN0A 4KUMA 4C3HJ 1HA3A 2OUMA 1F43A 2WADA 1I1GA 4FWTA 3F22A 3ABTA 5FO1A 3A3BA 2O8KA 4EMSA 3CUQA 5LBQA 3G1OA 2PQ8A 4B4DA 3W5VA 1NG7A 2O3FA 4HBLA 2DO7A 2L0KA 4M3GA 5E1WA 2COMA 1N78A 3W2IA 4IRHA 3P27A 1U6GA 3OS0A 2QF7A 2L54A 1USSA 3BZ6A 1GXQA 3HKZN 2A6EF 1MH4A 3GFMA 2HVSA 1PXZA 4W8TA 2GBYA 3O6BB 2LNBA 2Z3YA 3NEUA 1MMAA 2Y69H 4QHYA 1J5YA 1XSVA 4OAZA 4OU0A 2HYFA 2ZXIA 2H6CA 2XROA 1REPC 4IW3B 3SYTA 4J01A 1R23A 2O03A 1PP7U 2K9MA 1K5CA 3C18A 4XLCA 4PAAA 1SEUA 3ZUGA 2JK3A 3SUCA 3BH7B 3PJRA 4HA8A 3JX8A 3K2ZA 1FOKA 3I56I 1YJNI 1QX4A 2JVHA 5J35A 3GTQJ 2KKOA 2K9NA 4P2NA 3VOEA 1MMNA 3OYCA 2B7EA 1YYVA 2OBTA 1KZHA 2MLGA 1MIJA 4ZYHA 3QPLA 4XRFA 4P9FA 1A36A 3EUAA 5L3CA 4LITA 5TGTA 2IS2A 2ZJPF 2C4UA 2GZWA 3EPZA 3CCQB 1ZGAA 4LB5A 3WE2A 1EXMA 4QV2A 2WAQN 4X1EA 2H1LA 1XB2A 2E2HJ 2ZL6A 5FROA 4UXNA 4ZTJA 2UV1A 4CH7A 1Y56A 1KC8D 1TYUA 2CRVA 1VTNC 2BY1A 5IT9K 2DETA 2GLOA 2QBYA 4A3DJ 5FRNA 3SYJA 3T1BA 4IVNA 2FBIA 2NVUB 3C3WA 2EBIA 3KX2A 4HLYA 2IA1A 3U9GA 2R4GA 2Q6KA 1OGOX 2D3NA 4YRVA 3OIPA 2OJED 4FQGA 1BPLA 1K8AD 1QZYA 2Y48A 3HB9A 2DYIA 3X2QH 3GXOA 4U0YA 2MH9A 3GTOJ 3MMYB 4LBVA 3BT9A 2IGOA 4A6EA 2VBVA 1Z7UA 5LRSA 1NK3P 1FOXA 5FA6A 1F36A 3HDDA 3RKWA 1CQTA 2QXZA 1VQOI 4MEXF 1TBXA 1V0EA 3WTVC 1IW7F 2R5YB 3KFWX 4UVBA 2CV0A 4P5OA 1ZHFA 2WPDA 1IV8A 1WH7A 4OIQF 1O7FA 3GTGJ 4TMXA 4DQ2A 3S1NJ 3BCDA 1FX7A 2BXZA 2WA0A 3DFGA 1MZBA 1T0FA 4H0EA 4XRMA 4YELA 2EIMH 1VFCA 3KETA 3QE2A 2IQ7A 4RAZA 2BBYA 4A0ZA 5HOOA 1PE9A 4HRIA 3B4NA 4TKOB 2B9SA 3G71I 4RCYA 3FISA 2ODLA 3HSEA 1WJAA 2VPLA 3GVLA 4Z4ZA 1OJLA 4HPQA 1KU3A 1FNBA 4U49A 3OYLA 1IAWA 1BL0A 3OYEA 1A5JA 1TLLA 3CCVB 2XGXA 1LDJA 3U1KA 1V55H 3ZMTA 1T8IA 4M6XA 1FYKA 2KISA 4PSXA 5E18F 1E17A 1XMAA 1YJWI 1N75A 2XKPA 3OYFA 2FF4A 2XGEA 5J1RA 5C1EA 1R1UA 2K5CA 5M5WJ 4CCLA 4P6YA 1Y1VJ 2CV2A 1KMHA 2W6JA 1WHUA 4DYRA 1CF7B 3H94A 1G8XA 3V42A 1KQ0A 2UXNA 1N0UA 2QEXB 2EH3A 1VQMB 1X2NA 4L5IA 1G7CA 1QRBA 1A35A 4KIFA 1LJ9A 3RDIA 4OP7A 2OCCH 1T38A 2J5OA 1QGYA 1PLUA 4YZXA 1VQ8I 4CDGA 4R71A 5FFZA 5FD5A 1EFCA 5DS0A 4D7MA 2STTA 3H36A 5FKOA 2XAGA 2XNCA 3GQ8A 1P4XA 2G7UA 1I6XA 3HUGA 2XZPA 3OKXA 4OMYA 5JLWA 3CUOA 1E3OC 4BL0B 1V54H 1SFOJ 1JT0A 1W0KA 4UZEA 5HZAA 4V2GA 3S1RJ 2EFGA 4OJLA 3G3ZA 1K8FA 4G94A 3CP2A 3P9KA 1SC7A 3M9AA 4BY1J 4C2TA 2IP2A 1QVGB 1GVHA 3WHCA 1MRZA 2Q8KA 1W0UA 3RKYA 3OYMA 3FHZA 2DA1A 1LB2A 1O8DA 3I4PA 1X1CA 2CUZA 4F93B 4HDUA 2LBFA 2ID6A 1O3TA 2QTZA 2WBMA 4P1VA 3G6EB 1Q1HA 5K5OA 1OFMA 1IO2A 4D7NA 3TDZC 1O8EA 3VMFA 2MD5A 4HOBA 4Z4TA 1D8KA 1PUFB 2VN2A 1HLVA 2ZTNA 3CLQA 4IHXA 2DOFA 3CC4I 4I6ZA 2R7TA 5BPIA 2MFZA 4IQJA 2YUHA 3OZUA 4G1BA 1Z77A 1UD3A 3PVDA 1W7PB 4PMHA 1DDNA 5ICGA 5HDGA 1FBSA 3FM5A 3TP3A 1ZREA 2JRTA 4AWXB 2M2EA 3HOXJ 3BNWA 3HOTA 3BR1A 1O8IA 2QZ8A 1T56A 3B8HA 3GLXA 2M0MA 3AG1H 3SEJA 2R7OA 4ZYEA 1QA6A 1ELOA 3RJPA 1UD6A 3E1YE 1ZKGA 4P6VF 4Y7CA 5F4JA 1KJZA 1LUJB 5IOZA 3OJWA 4XKWA 5ICEA 4P9UA 1T6SA 2HXIA 5FKMA 1IC8A 3ASSA 2FX3A 1S5LC 2GIVA 1TT5B 2ZZFA 2G7HA 3ZPLA 1TYVA 1V3FA 2DFHA 2JPCA 4A6DA 1LNWA 2HQAA 4PJMA 5E8IA 2VT3A 4BHCA 2YPRA 3HOZJ 1X3ZB 1B23P 3K4LA 3J81K 1IXCA 3ZZ0A 4ZV4A 3GVJA 2HQ5A 3SEZA 2OTJB 4XLFA 3C2GA 1Q7YD 3OYBA 3WBKA 1GV2A 2VC1A 2NVQJ 5EMNA 1YW8A 5CLSA 2M34A 3TQNA 3QOPA 1P7IA 4NB5A 3CO6C 3Q9VA 2V7VA 1RU4A 3E5UA 4YDTA 2W1OA 4Z4RA 3PO2J 3ZRGA 3BR2A 4UHTA 2LTPA 3S32A 1RPWA 3PIPF 5J4YA 3O2PE 4KN7X 1E2XA 1WJ5A 5HLHA 2OTLI 4O6JA 3OE7A 4X8IA 1Z6TA 4CICA 1A04A 2Y31A 2WB1N 3QP6A 1IGNA 4KDPA 3I55I 4WXHA 4K1XA 1KQ8A 4OJ5A 4W1UA 5IYDJ 2AHOA 1OCPA 3BG9A 5CVUA 1CNEA 4MGRA 3W6VA 1UD4A 1BC8C 3E5QA 1UELB 4J00A 1ULYA 2BGJA 1K4TA 2ZSHB 2V4DA 2VJIA 4C30A 1NHCA 3F8CA 3K6GA 3FM3A 2W7NA 2F4MB 2D3LA 3BJAA 4HX4A 5C4JJ 3QODA 3BTJA 4DIQA 2NXNB 2IBDA 1B1BA 1SFXA 4A93J 5IYNA 2XZOA 1XC5A 4ZDPA 1WCMJ 3HZJA 1U78A 3F6OA 2F1LA 1KQSB 1B2RA 5D4RA 3OIQA 1MBEA 1EWYA 4CHUA 1CQXA 1RESA 2BM7A 4P26A 4ESJA 2K9LA 3MEXA 5J6XA 4MXNA 5LGTA 4NUBA 1Y8RB 1SAUA 4PC1A 1BJZA 1OB5A 1CGPA 1WPCA 2ESNA 1O8JA 4J19A 4YEJA 5IOYA 4Z4WA 2Y9YA 2YU3A 2Z99A 3PL8A 3Q39A 2X3HA 2XOKA 1JA0A 2CO5A 1F1ZA 2HOEA 3K70C 1I8DA 4YZAA 3T9GA 3VYRB 1CNFA 1G2HA 1JGGA 3BG5A 3PETA 4RD4A 4M6YA 2W4SA 1RI7A 3F9KA 3E6MA 1DPRA 2KQRA 3ZZTA 3RTRA 2GK6A 1DU0A 1JI8A 3FXLA 3QYBA 5GADJ 3VMWA 4YHBA 3HUGB 1NB9A 2KVOA 2FA5A 1YW7A 4BE1A 1WOOA 2E19A 2NVTJ 2CW5A 4JRAC 1KTVA 1ZH5A 2W25A 4BJTA 2ETHA 2BM0A 2NS8A 1SMYF 3ML6A 4M9ZA 2VOPA 3BQJA 2J5PA 4AIDA 3IWFA 1WVRA 5IPAA 1QFYA 1VQPB 2F4NA 3D5RC 3BG3A 4CSWA 1JTAA 4OZZA 5CQEA 4OZYA 5H20A 5B1BH 5E8GA 2ELJA 5DD4A 1EKEA 2E1BA 3AVYA 4Q4ZF 4Z4YA 2PYGA 2Y30A 4Y3OA 3COAC 4RDLA 4KN4X 1YI2B 3BQYA 2FOKA 1D5VA 5DCMB 5KNLA 2VODA 2DMNA 3S17J 2C6YA 1VHOA 2V7XA 1V4RA 2MBFA 3BTCA 3HPGA 4BE0A 2VNHA 1U5TC 2EFNA 2ZJ2A 1IN6A 1H8EA 1P7JA 1Y8QB 4GXOA 5E6TA 3CCJB 4YIFA 1S7OA 4IPAA 3LAPA 5LEJA 3MMPA 3OWTA 2E5ZA 4OJPA 5DM6F 3JRHA 1WRJA 4M2LA 3LNQA 4YC5A 1KK0A 5ILUA 2Q0OA 5HODA 1EP2B 2OK8A 2K4JA 1JKPC 1HKSA 3OYAA 3N90A 2OC6A 2PX9A 4KICA 3CCQI 5LD2C 3AVTA 1P9QC 2KRHA 3ERED 4HX7A 3ZMZA 1E64A 4CCJA 5F4MA 1Z0XA 4D0PA 4PFOA 5EDNA 3CJNA 2A68F 4ENJA 2A6TA 4BXUA 1VQ6B 3MKZA 3CCRI 2X85A 3GF2A 4I0AA 1XX5A 4L18B 2MH2A 5IT3A 1Q1VA 3IC7A 3QFTA 1BHEA 2XKOA 1XSXA 2WY8Q 5E79C 3CO7C 5E17F 3KCCA 1N06A 1OFEA 1W0TA 3EQLF 3I59A 2EINH 1YJ9I 2V5IA 2IPQX 1XGMA 2V79A 3LWFA 5CVIA 2QTLA 2PECA 3LSKA 2UZKA 4WZEA 4UZFA 3ZBTA 2XTYA 1BX1A 4P3IA 1Q81D 3KL9A 1S7EA 3JREA 3HAGA 2Q1ZB 4MNUA 2R5YA 1K7AA 3WNCA 3WY9A 4HEA2 3VSLA 1IRZA 3OAAA 3EQOA 2M4GA 2E1CA 5IYWA 3C2HA 5K7HA 1T95A 3GLLA 2DOEA 2ZITA 4E7KA 2WV0A 2XB0X 1FBQA 2QLZA 2F1MA 5IYPA 2FE3A 1Y6IA 5A88A 1QCXA 5D6FA 5F0FA 2D5VA 3EYIA 3BR3A 1I3AA 4NHJA 5DV5A 3GEZA 1P4MA 4UVCA 2EIXA 3AVXA 2FJ1A 4CA0A 1H9GA 2BOLA 1RETA 3WG9A 3FF5A 3JAMZ 3TO6A 1F20A 5J40A 1OOCA 2AO9A 2ZZQA 2JTVA 1EH6A 1B72B 4LFUA 1YLFA 3VR6A 1BOAA 1KK2A 1WH5A 2C78A 1J09A 4OOIA 4DBRA 4PABA 1JHFA 3WGIA 2GXBA 4RMNA 2BHYA 1W5SA 1R5NA 3LYCA 3W2AA 1KYZA 1W34A 2M5WA 1NH3A 1EFTA 2LSOA 3OJXA 2LD5A 4Z4VA 5DN6A 3DU6A 1TVCA 4V19K 2DEUA 4NCNA 3K9TA 4BXFA 2PBIA 2CMPA 3LSJA 2ZJQF 4A3IJ 1O57A 3KEQA 5HNHA 4QTRA 1WTHD 2VNIA 3FY3A 3DF8A 4DJAA 1O3QA 4LC0A 3J7YJ 1JA1A 2C77A 1W36C 3C7JA 3K4MA 1FTZA 1KD1D 2RC4A 3T8TA 3FXJA 2HFHA 4LLNA 1H89C 2P7VB 4WQMA 1MNDA 2JJ7A 3SJZA 1DPUA 2KRFA 1FSHA 2GJKA 3SKBA 2KIUA 3E20A 3QSYA 1XPXA 1XDSA 4AD9A 1LVAA 2NVYJ 4XN3A 2V9KA 5C4XJ 1Y0UA 4A3CJ 2XB5A 1FWZA 2PMDA 1ZARA 1ZG1A 4G7ZF 2HOTA 3WGGA 1A31A 2P3MA 1EH8A 2LFBA 3H3ZA 5A8AA 4C43A 1BN5A 3KEOA 3ABKH 2ME0A 4TMZA 2HNHA 2LKXA 2W24A 1KZLA 1RMGA 2NOJB 2V1XA 3S3NA 1O8FA 1VQ9I 5ILVA 3CD6I 2EV0A 2F6CA 1M1EB 2ZXJA 5KK1A 1PUFA 3HM5A 1QVFB 3I53A 1ETYA 5DCMA 3KLOA 2TCTA 3DPUA 2VLAA 4HX8A 3VODA 1FYMA 2M7BA 1OQYA 5DTDA 2PI0A 1X1AA 5B6IA 1S3JA 5KAIC 3RSNA 2YSRA 3GFIA 3VO2A 2CUEA 4A3GJ 4OIRF 2EZLA 5BSYA 2NSTA 3BTIA 1VQ4B 4UV8A 2DAOA 2LH9A 3TEDA 1N07A 3ZQ7A 4KH3A 2VASA 5JVTA 5AONA 1ZELA 4FX0A 3JTGA 1N77A 3ZMDA 1RIOH 2MA3A 3LQEA 3BJOA 1QGPA 1EFRA 2KJCA 3OPOA 4RAYA 3PA1A 2A69F 3TGNA 5H6RA 2VKHA 3RIRA 4B3AA 1TYWA 2LF7A 2DY1A 5TV2A 1W36D 3CCMI 2WZNA 1YX3A 2KLOA 1DDIA 2CK3A 1HVXA 2OPTA 1D0XA 2JRMA 3IRRA 5L3EA 2E7WA 3OYDA 4B3FX 2OBPA 3NWSA 4PGHA 2HQNA 2RQPA 4G6DA 3JQRA 3OV8A 3MKWB 3OL3A 4IRIA 4ZYAA 3D0SA 3UNGC 3AFHA 1QA3A 2CU7A 2H1KA 2CC2A 1TQIA 3E6DA 3DBRB 4YFNF 3NARA 1Q82D 1MMDA 1WFXA 2F43A 4YG2F 1QU3A 1VLOA 1VJSA 3T0YA 3FXMA 3R6SA 2ECBA 1YIJB 2FX0A 3KLNA 3WE3A 1D1NA 3WTUC 5FLVA 5ERIA 3FK7A 5IYRA 2WZPP 1M1KD 1LLZA 5A2QZ 3I5UA 4OPWA 5JLXA 1NTCA 3RYPA 1IJWC 1FIPA 3AVUA 2QGUA 1WP6A 2Q6OA 4ENMA 3V8LA 2XRLA 3CUQC 1MDMB 3FXOA 4A3MJ 3S2WA 1Z05A 1E1RA 2JA8J 5FNZA 1FC3A 4OPOA 3OW7A 2W57A 3L2CA 1HG8A 1X0CA 2E1OA 1ERDA 3PUMA 2V1NA 4XL9A 3SLNA 2NTPA 4YZQA 3SEQA 3GO5A 1DG1G 1GUUA 5JMCB 1FDRA 1COWA 5FKNA 4DZPA 1LEBA 3PSSA 1XCVA 2HR3A 3A1YA 3F3XA 3IH4A 3A4CA 2IT0A 5E20A 2XNDA 1VQOB 1XDUA 2RVCA 2HZDA 1D0ZA 3KYDB 3M3YJ 2DFIA 2HEOA 3ZCOA 5H59A 5LEKA 2UXXA 4LD5A 1K4SA 5H6QA 4OWRB 1ODDA 5L3FA 5DYMA 1R4NB 2PMZN 4HG2A 3EETA 4BY7J 1R5GA 2HYJA 1XMXA 2R5ZB 4TMVA 4LMYA 1I1SA 2BGIA 3CCSI 4DOZA 1MABA 3CMEB 3O8HA 3U21A 1DP3A 1OCRH 2BVMA 4HSRA 4IHYA 1WPKA 3A1PA 4P55A 2KDZA 2ZSIB 1O8KA 4HAMA 4KIBA 5THXA 3LMWA 4C2LA 2P4WA 1W0JA 3VYTB 4AU7A 5EF6A 3TH0A 5E3LA 3WNBA 4M3DA 4UUTA 3QFCA 4I84A 2O04A 1SKYB 4B43A 1ORKA 2RGVA 4ZDOA 4U88A 1FOWA 4IOAF 1A6QA 2DIEA 3W2HA 2XF5A 2EILH 2CGPA 2JIZA 4ENKA 1Z67A 2CQXA 1VQ9B 3BY2A 1XGOA 4S04A 3ML3A 3LOCA 1JXSA 3TL4X 3RI4A 3JQQA 2XGDA 3VSKA 4JX6A 2K7LA 1S72B 2R7ZJ 1UZCA 5FLXZ 2V6EA 2IW5A 3S3MA 1UG2A 4A5MA 1WSRA 2W7ZA 2I5UA 2VBYA 4RCZA 4A2UA 5JHFA 2X0KA 2DPDA 4OINF 4L9NA 4XSZF 3I0TA 3CC2B 4BQAA 2BY2A 1LKXA 1JUPA 2F5VA 1D3YA 2XUBA 4L9VA 5D5WB 4X0GA 3CMAI 5GAHJ 2ZBUA 5H5JA 3GYHX 2X6XA 1HBXG 2G0EA 4BPRA 2GQQA 1VLYA 2R6HA 4PJ0C 5CVVA 4AIKA 1E3HA 2DW4A 4HV6A 1DU6A 3A8KA 1XE1A 2VZLA 3L1PA 1JJ2B 3CRZA 1T39A 4BDYA 2K3FA 2LKPA 5DS9A 1T2KA 4TMWA 1OPCA 4TT3A 5HLIA 2CYYA 3GTMJ 4Q48A 2E71A 4A3EJ 1B8IA 4HF1A 4A3BJ 1Z91A 4RD0A 4Q47A 4XR6A 3QPHA 3SLDA 1Z3YA 3EUHC 1O7LA 2I8DA 1YHQI 2BZTA 3F8FA 3ZQQA 3VO1A 3L2RA 4NBQA 3DKXA 4DYCA 2O1DA
chains in the Genus database with same CATH topology
2K3PA 4PJJA 2UUZA 3CP2A 4G6TB 4U4BA 4C2TA 2VJJA 2DT7B 3IP4B 4BS9A 3H35A 3OYMA 1O8DA 3NE5B 1OGMX 1X1CA 2CUZA 4F93B 2LBFA 4PK4A 2WBMA 1IDJA 1OFMA 4GQNA 3OR2C 1O8EA 2VB6A 1MMGA 2L5QA 4Y4RA 2ZTNA 2V4JC 1NBMA 4B3GA 2INUA 2R7TA 3JURA 4IQJA 2MFZA 3SZGA 3S3OA 1UD3A 3OL4A 2AQFA 3AKZA 2BSPA 4PMHA 3TBIA 2UVFA 2FUG2 3HOTA 2O5RA 5HLTA 1O8IA 2M0MA 2XSJC 2IS4A 4F52A 2VXDA 3OYKA 4AVZA 2R7OA 3HG9A 2KZVA 1PKVA 1UD6A 3RPUD 3BC9A 2X1EA 2Z1DA 1K6YA 1H8HA 3VSTA 2VBMA 4XKWA 2XF7A 1BN8A 1O8HA 5HKKA 5IK2A 3L2QA 3CMMA 2ZZFA 3T51B 3S93A 3DTEA 3PSFA 4DK0A 4FASD 2HQAA 4PJMA 2VKDA 2Z2SB 2HPMA 4BUPA 3K4LA 2E1MC 2Z6BD 3GVJA 3SEZA 3OEHA 4XLFA 3C2GA 3GRHA 3OYBA 5LFAA 3DPTA 2X53S 2LC2A 1RU4A 2W1OA 4QPOA 4KKTA 3ZRGA 4LIVA 4XOPA 2LY1A 2IS6A 3S32A 1V0FA 1Z21A 1O8MA 2Q2EB 1WJ5A 3G05A 3OE7A 2GOXB 3GQ7A 4P22A 3CESA 4JQFA 1NHCA 3A35A 3K70D 4HWVA 3ZIAA 2VBEA 3H5NA 3I9V2 4NC7A 4OJ5A 3A2KA 3ZXSA 3HOSA 4EATA 1UD4A 1BMFA 1LDKB 5CKTA 2X51A 1UELB 4J00A 2Y0SA 3S8PA 2ZSHB 1UAAA 2VJIA 4C30A 4DGWB 2V4DA 3OEEA 1DQUA 3K6GA 2WJYA 2R7XA 4Z1MA 2M3AA 3EQNA 4W8QA 2W7NA 1OLTA 2D3LA 3QODA 3H0DA 4DIQA 1OR7C 4E6KG 4BDZA 4ZTFA 2RREA 1D1CA 4ZDPA 5HVQC 2XZOA 2L9NA 2DT6A 2QY1A 3CJRB 1TZLA 4KT6A 3OIQA 4C2UA 3KEWA 5FL7A 2XZLA 3DU5A 3VYSB 2HLDA 2K9LA 2L2OA 1X1BA 4MXNA 4E7JA 4NUBA 2XGJA 2VQGA 3L2VA 1NRKA 1SAUA 4EW9A 1UG0A 2WAEA 4BACA 1WPCA 2O0WA 2VJ5A 1O8JA 4BQQA 4YEJA 3VMVA 1DGRM 4E7ZA 3PL8A 2X3HA 3LSHA 2XOKA 4JOMA 3IAS2 1I8DA 2JJ2A 3K70C 2X6WA 3T9GA 3VYRB 3LSIA 1WJFA 1HZEA 4ZDLA 2W4SA 3LMMA 1E79A 3F9KA 2PJRB 4XLHA 2KQRA 4L8JA 4UZUA 3RTRA 1VF7A 3K10A 2GK6A 3KEYA 3LSMA 1JI8A 4JMQA 3QYBA 5CDFA 3VMWA 1EA3A 1UD5A 3DWLE 3HUGB 3H9QA 2KVOA 3OS2A 2LY2A 4BE1A 1AIRA 3IAM2 4N4OB 3FDYA 4OAYA 2DCEA 4BJTA 3MD2A 2NT9A 4W8RA 4YZ0A 2LOOA 2RNGA 3OOCA 3D5RC 2VQHA 3K4BA 3K4JA 4CSWA 2R7VA 1JTAA 4BJ6C 1EE6A 5CQEA 4OZZA 4OZYA 3PFYA 2ELJA 2UWMA 2E1BA 4NK6A 1YE9A 2JSPA 4GRIA 5FRMA 4QPQA 4XKVA 2ZFUA 4B3XA 1DBGA 4Y3OA 2Z16A 2PYGA 4KKUA 1O8LA 4D9JA 4D1QA 1WJEA 2L7KA 3PNVA 2ZZEA 3NWTA 1BOBA 1X4OA 3OOUA 2JVGA 3DEEA 2XAUA 5KCMA 5KNLA 4PFPA 4XMYA 2BW3A 1RWRA 3I3LA 3HPGA 2KMUA 4BE0A 4PJNA 4YXWA 3GQBA 1FMVA 1D1BA 4XOTA 1H8EA 3BC8A 2WY7Q 2WAQA 2NTBA 4CUGA 2XDVA 1MNEA 1V5GA 3OWTA 2E5ZA 3W2WA 2LZJA 1E1QA 2M5SA 4OJPA 1Z3XA 1X19A 3DDYA 3ZSCA 3OS1A 2QKLB 4DNTB 2W6IA 3BCBA 3OYAA 4DK1A 2OC6A 4RM3A 5LD2C 3HC7A 3DTKA 4B44A 2CS3A 1MW7A 1P9QC 2KRHA 1R6RA 3LSGA 1TT0A 4MLOA 4CCJA 3FKJA 4PFOA 1XG2A 3VYUB 2A6TA 3OY9A 3B90A 3MKZA 3ONQA 3BCFA 2X85A 2LBFB 2CFOA 1DGWY 2JJ1A 2IGMA 3E1SA 1BHEA 4RM2A 2WY8Q 3PUBA 4NC8A 4ZC3A 1KTWA 4OJOA 4YZAA 1VZ0A 2ZXHA 2WB1A 2HPIA 4H4KC 4Y33A 1D0YA 2R9VA 4BQNA 3CP8A 4KITB 2PECA 3LSKA 2INVA 4E7IA 1KCDA 3N05A 1E3XA 2KL4A 1GLNA 3HAGA 4XORA 4BEHA 2Q1ZB 1GQ8A 2VXZA 4HEA2 3VSLA 4ASUA 2OV7A 3OR1C 3OAAA 2VJ4A 3EQOA 2KRCA 2M4GA 4KJZA 3W3CA 2XC7A 3PNTA 1BLIA 3C2HA 1Z7LA 4XLEA 2IXSA 4IZZA 1V5FA 1E43A 2P0WA 1T95A 2LREA 3DKYA 4E7KA 3BG6A 2F1MA 4Z05A 1QCXA 1Y6IA 3BLYA 4HSTA 4DNRB 4BGDA 1IB4A 2IGNA 1BR1A 3A3GA 3ZR8X 1LFPA 2LG4A 2BOLA 3ZGKA 4CA0A 4CCOA 1UD8A 2W00A 2V7FA 3H9JA 3RCOA 1VBLA 2MD0A 2JA2A 2IGKA 4NNJA 2E60A 1OOCA 3D5LA 2CW8A 2ZZQA 3BH4A 4PJLA 4HNTA 3VR6A 1J09A 3HPHA 4DBRA 3HXLA 3JU4A 1QJVA 4LIUA 3M8JA 4RMNA 3HKZA 3KRGA 4URRA 3FHNA 1PJRA 3W2AA 1S9HA 4OJ6A 2R7UA 1KONA 2GJRA 2E1MB 5DN6A 3DU6A 2MABA 4HIZA 2VQCA 4BXFA 3FPPA 3BG7A 2CMPA 2E5NA 1T5EA 2VBKA 1FX0A 5HNHA 1WTHD 3FY3A 4DJAA 3IUOA 2HVQA 4PSWA 1W36C 2WSSA 3K4MA 2KDOA 4R79A 3OYNA 1DBOA 5CPRB 4BE2A 4RLQA 2O17A 2QX3A 3H5AA 3FBNB 1MNDA 4N4NB 4F91B 1OHHA 4G7XA 2W82A 1WMRA 2HVRA 2F4IA 3VSUA 2GJKA 4FXUA 3OFNA 1PYVA 4U87A 3DTIA 4XN3A 2V9KA 1T0FC 2KP6A 3K4KA 3RQ4A 1O88A 2V26A 1O8GA 4RLFA 4Z06A 3CJQB 5AMVA 4HNUA 4IKFA 2MYSA 3EUKL 2CUJA 1BR2A 1JRGA 4Z03A 2RQQA 4IX7A 3PSIA 3GQAA 2HNHA 3G2BA 3VDXA 1KZLA 3AL0B 2NOJB 1RMGA 4YZXA 3S3NA 1O8FA 1LVKA 3ZPPA 1D1AA 2LYCA 2F6CA 4LG3A 1FMWA 2MC4A 4II3A 4MR0A 4CCKA 3DPUA 2VLAA 1HA8A 4XN0A 2AQEA 2M7BA 1X1AA 2OUMA 3RSNA 1SFKA 2WADA 3AL0C 1IRXA 2NSTA 3A3BA 2NT6A 2LH9A 2ZZGA 1NG7A 3ZPNA 2VASA 1ZELA 1QHGA 3DLAA 2CH0A 1N77A 1N78A 4XQFA 3OS0A 3L2UA 3WWGA 1EFRA 3OPOA 4BJ5C 1PXZA 1WJDA 2HVSA 2V31A 2VKHA 4W8TA 4B47A 3FKSA 4PUSA 3K4CA 4IQ4A 3HL2A 1W36D 1MMAA 3OYGA 1W9XA 4OAZA 4G7WA 1YX3A 2BVLA 2KLOA 3DQVC 2ZXIA 2CK3A 1HVXA 1WJCA 3QOEA 3TMOA 1K28D 1D0XA 2KHMA 3SYTA 4J01A 1K5CA 2K9MA 3OYDA 4XLCA 3H9GA 4B3FX 3NWSA 4E7LA 3MKYB 3SUCA 1X1DA 3PJRA 3GVKA 2DJIA 3MKWB 3OL3A 4ZYAA 2NTQA 3UNGC 2O0VA 2JVHA 3AFHA 1OFLA 3OYHA 2X1CA 1MMNA 2BW3B 3OYCA 3H5RA 5CQGA 1MMDA 1WFXA 2F43A 1U0JA 1QU3A 3PNYA 1VJSA 4BEHB 2X8KA 3VSVA 2GOMA 2JUGA 3EUAA 4LITA 5TGTA 3VWBA 2IS2A 2EWEA 4G6IA 3EPZA 3T53B 3CF2A 4XKCA 2PMZA 2WZPP 5FROA 4ZTJA 2UV1A 4CH7A 1Y56A 5KHDA 3T56B 3E0JB 1WP6A 2X6YA 2DOAA 1KCCA 1E1RA 3QYFA 3OW7A 5FRNA 1V5EA 2LRDA 1HG8A 1X0CA 1X4PA 1ERDA 2V1NA 3KX2A 4XL9A 2NTPA 2UVEA 3SEQA 4F92B 2R7SA 2R4GA 4YZQA 1OGOX 2D3NA 2CW7A 4YRVA 1COWA 4C9YA 3FBIB 3OIPA 1WJBA 3LL7A 3A1YA 4E7HA 2CV1A 2XNDA 3A4CA 4AYBA 1BPLA 1E0EA 4NQWB 2A5WA 2HZDA 1D0ZA 3BCAA 3MMYB 2WAFA 3ZCOA 1I18A 2IGOA 2V7QA 2PYHA 4OWRB 3SDBA 4HG2A 2IS1A 1OB0A 2QXZA 4KKSA 4KISA 1V0EA 3OMYA 2CV0A 4XD7A 1NG6A 4P5OA 2WPDA 4U7BA 4DOZA 1MABA 5HNFA 3BCDA 4E7SA 3WQZA 3U21A 2VIXA 1DP3A 4E4HA 2WJVA 2BVMA 4HSRA 2WA0A 4CCNA 3DPLC 2QE7A 4ANJA 1O8KA 2ZSIB 2JDIA 4YELA 3LMWA 4C2LA 2X1DA 4BQOA 1W0JA 3VYTB 4AU7A 1CZFA 2Z8GA 4W8SA 1G59A 4XM3A 2IQ7A 2KPMA 4BU2A 2M7AA 2R7QA 4FETA 3QYEA 1BR4A 5HOOA 4HRIA 4XLAA 1PE9A 3B4NA 4TKOB 4I84A 2O04A 1SKYB 3LFUA 4B43A 3W2VA 1AA7A 3L2WA 2ODLA 1WJAA 4XKBA 4XONA 2VPLA 4ZDOA 3GVLA 4HPQA 2DIEA 2XF5A 4U49A 2JIZA 4NK8A 3OYLA 1QHHD 3OYEA 3TL4X 4II2A 2R7RA 5C1CA 3VSKA 4PSXA 1H80A 1N75A 3OYFA 3S3MA 2V6EA 4TSFA 2NSPA 5C1EA 1YX5A 2K5CA 4CCLA 2GK7A 2CV2A 5JHFA 3OYIA 1IA5A 1KMHA 2W6JA 3H94A 1G8XA 3K4NA 3V42A 3M1CA 3UR3C 4B48A 1LKXA 4DBQA 2F5VA 4F3QA 2ZTGA 4X0GA 3GQ9A 4E0FA 2XF6A 2HU9A 3B8YA 2X6XA 2DXIA 1VLYA 2QKMB 1IDKA 2VQLA 3D5SC 2PJRA 4ZJZA 4XNFA 3GBGA 4BDYA 1PLUA 3J7AY 3CZ6A 2R7WA 4TT3A 3UW0A 4CZCA 3GQ8A 2NZMA 4XR6A 2L9SA 1E3ZA 2XZPA 2M4KA 1Z3YA 3EUHC 3OYJA 1UD2A 2I8DA 4BL0B 3ZQQA 3LNNA 3L2RA 2HDWA 3KYLA 4P1WA 4F55A 4ITVA 1W0KA 2GJPA 4CCMA 4OJLA 2VL8A 3DKXA 2O1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWE A;  4U4B A;  2VJJ A;  4XLH A;  1O8D A;  1OGM X;  1QJV A;  3VMW A;  1IDJ A;  1OFM A;  3KRG A;  4URR A;  4OJ6 A;  2X6Y A;  1O8E A;  1KCC A;  1AIR A;  1HG8 A;  1X0C A;  2INU A;  3JUR A;  4XL9 A;  2NTP A;  2UVE A;  4YZQ A;  2NT9 A;  4W8R A;  4YZ0 A;  1OGO X;  2VBK A;  3VSV A;  2BSP A;  3FY3 A;  4PMH A;  1JTA A;  1EE6 A;  2UVF A;  4OZZ A;  4OZY A;  1O8I A;  1DBO A;  2QX3 A;  2O17 A;  4NK6 A;  4XKV A;  2PYG A;  4AVZ A;  1DBG A;  1WMR A;  2PYH A;  3VSU A;  1O8L A;  3T9G A;  2QXZ A;  3VST A;  2VBM A;  4XKW A;  4XN3 A;  4XMY A;  1BN8 A;  1O88 A;  1O8H A;  1RWR A;  1O8G A;  4Z06 A;  5AMV A;  4XOT A;  1JRG A;  4Z03 A;  2NTB A;  1O8K A;  3GQA A;  4YEL A;  3LMW A;  4OJP A;  4C2L A;  1CZF A;  4XLF A;  2Z8G A;  3GRH A;  4W8S A;  4YZX A;  3ZSC A;  1RMG A;  2IQ7 A;  4XM3 A;  3ZPP A;  1O8F A;  1PE9 A;  4XLA A;  3B4N A;  4I84 A;  2O04 A;  4MR0 A;  1RU4 A;  2ODL A;  4XN0 A;  4XON A;  4XOP A;  4U49 A;  1XG2 A;  4NK8 A;  1O8M A;  3B90 A;  2NST A;  5C1C A;  2X85 A;  3GQ7 A;  2NT6 A;  1BHE A;  1H80 A;  4HWV A;  2VBE A;  4OJO A;  4YZA A;  1KTW A;  4OJ5 A;  2NSP A;  5C1E A;  4XQF A;  2PEC A;  2INV A;  3WWG A;  1IA5 A;  1KCD A;  1NHC A;  2VJI A;  1PXZ A;  3EQN A;  4W8T A;  4W8Q A;  3GQ9 A;  4XOR A;  1GQ8 A;  3B8Y A;  2X6X A;  1IDK A;  3EQO A;  4XLE A;  4XNF A;  2QY1 A;  1K5C A;  1PLU A;  4XLC A;  3SUC A;  3UW0 A;  4Z05 A;  1QCX A;  4MXN A;  3GQ8 A;  2NZM A;  4XR6 A;  2NTQ A;  2O0V A;  4EW9 A;  1OFL A;  2O0W A;  1O8J A;  4YEJ A;  3VMV A;  1IB4 A;  2X3H A;  2X6W A;  4OJL A;  1VBL A;  2O1D A;  1OOC A; 
#chains in the Genus database with same CATH topology
 1X58 A;  2K3P A;  2V7W A;  3AVV A;  3HSF A;  1B4A A;  4TMT A;  5HS7 A;  3WTT C;  4GDF A;  3H35 A;  4LLG F;  3BRO A;  5JR3 A;  4A3L J;  4HYE A;  1G3W A;  2ICW G;  2Y0S N;  2Y2Z A;  1ENH A;  3GFJ A;  1SFE A;  2FU4 A;  1VQ4 I;  2X6O A;  1HW2 A;  3K2A A;  4Y4R A;  2L5Q A;  1ZM3 A;  4HE5 A;  3Q0W A;  3OW2 B;  1QPI A;  4RPB A;  4UVA A;  3KP7 A;  4CXF A;  2VFQ A;  5EEA A;  1H42 A;  1I50 J;  5IT9 Z;  1QFZ A;  4ROX A;  4V02 C;  4LK0 F;  1R58 A;  2M30 A;  1HCR A;  3TBI A;  2Z9O A;  2UVF A;  2CF4 A;  2VPR A;  5HLT A;  1UHW A;  2K02 A;  5B66 C;  2IS4 A;  2XAH A;  2VXD A;  2X9D A;  4EJU A;  4AVZ A;  4YIR X;  1WSV A;  4PC3 A;  2AHQ A;  3RPU D;  3MZY A;  2X1E A;  2K9S A;  5F08 A;  1H8H A;  3FXR A;  2JN6 A;  1UST A;  2X48 A;  1AKH B;  2XRN A;  3LFK A;  3QFS A;  2IEK A;  1O8H A;  4UAJ A;  1XSD A;  5HKK A;  1P2F A;  1XD7 A;  3CMM A;  5GPC A;  1FRQ A;  2GA2 A;  3S93 A;  3DTE A;  2YX4 A;  1VQ7 B;  4FAS D;  3KZI C;  1X3W B;  1J2X A;  2Z5U A;  4M72 A;  1KU7 A;  1G7S A;  3CC4 B;  5M5X J;  2D45 A;  3DBL B;  1KK1 A;  3OEH A;  2NS0 A;  2DDB A;  2LVS A;  3I64 A;  4X05 A;  1I3Q J;  4BBR J;  2JA6 J;  2OBS A;  3CCV I;  5F4O A;  1BI0 A;  1YX2 A;  1WOP A;  2X53 S;  3K0L A;  4S05 A;  3D1N I;  3P9I A;  1BJK A;  2LC2 A;  1GVD A;  2R5Z A;  2K27 A;  2VBW A;  1YS7 A;  2LY1 A;  1TWC J;  2P81 A;  2VKE A;  2QN6 A;  2YS9 A;  3G05 A;  3WHB A;  4DYQ A;  1AIP A;  2E36 A;  2O8X A;  3CES A;  2FQ3 A;  4JQF A;  3IRQ A;  3A35 A;  2QSF X;  4P22 A;  2LLK A;  4G5G A;  4OPV A;  3A8J A;  3ZIA A;  2VBE A;  3I9V 2;  3A2K A;  2PE3 A;  2H6B A;  2GRE A;  1JJ8 C;  3AST A;  2X51 A;  2E7X A;  3S8P A;  1UAA A;  4IJA A;  2YUS A;  3ONU A;  3P9C A;  1U8B A;  2R7X A;  3AGP A;  2M3A A;  4W8Q A;  3IV5 A;  3GCM A;  3H0D A;  1TWA J;  1YHQ B;  3ULQ B;  1OR7 C;  2LKS A;  4E6K G;  1LM1 A;  5HVQ C;  2G9W A;  2DI3 A;  2L9N A;  2ZME B;  3S1Q J;  2ZL5 A;  4F7D A;  4KT6 A;  4ON0 A;  3ZZU A;  3DU5 A;  4JX4 A;  2BV6 A;  2L2O A;  3JAM K;  1X1B A;  3HSR A;  4E7J A;  5DM7 F;  3CCE I;  1ZG5 A;  1V5V A;  4FN5 A;  2VFP A;  4EW9 A;  1UG0 A;  4BAC A;  1KRH A;  2E1N A;  3VMV A;  4N9H A;  4AC9 A;  3HGY A;  4E7Z A;  4HZF A;  3IAS 2;  2ZC2 A;  1AHD P;  3PUF A;  3DEW A;  2Q6I A;  1DP7 P;  2O61 A;  1HZE A;  3LST A;  3O3K A;  2JWT A;  3SZP A;  2X4H A;  3WU1 B;  4M0L A;  4XLH A;  1X2M A;  1NB0 A;  1VF7 A;  3K10 A;  4UZU A;  1XB4 A;  1YOV B;  1CLW A;  2HKX A;  1EA3 A;  3U6B A;  3H9Q A;  3V8J A;  4DNC A;  1F9N A;  3OS2 A;  2A5Y B;  2FNA A;  5KAF C;  3QRF F;  4YAU A;  5EEG A;  4XRS G;  3FDY A;  5EG0 B;  1RR7 A;  2DCE A;  2DER A;  4W8R A;  2EK5 A;  2ESH A;  2LOO A;  4OIP F;  2RNG A;  4W97 A;  3S1M J;  3K4B A;  1XG1 A;  5FKL A;  2R7V A;  2GQF A;  3KPH A;  3ASQ A;  4BJ6 C;  2VOO A;  1EE6 A;  1O3S A;  1QZE A;  2PN6 A;  1Y0Y A;  3AGQ A;  1JB9 A;  2HOA A;  1U2W A;  3U2R A;  1YE9 A;  2HQR A;  5FRM A;  2RNJ A;  3Q6Q A;  2ZFU A;  1DBG A;  1AU7 A;  2IOU G;  1KA8 A;  3H1C A;  2EIJ H;  4KKU A;  1R7J A;  4N9I A;  1O8L A;  1WI3 A;  1WJE A;  2L7K A;  3LVB A;  5EZH A;  3RKX A;  2WTE A;  3OOU A;  2JVG A;  1T98 A;  1FBU A;  2XAU A;  4PFP A;  4A0X A;  1UHM A;  2DMU A;  4Y7N J;  4X6A J;  3A0H C;  4RGU A;  3I3L A;  4LG0 A;  2KMU A;  4FCY A;  1ZRD A;  1VQL I;  3BY1 A;  4XOT A;  2QUF A;  2E1R A;  4IXA A;  3L7W A;  4O5V A;  4JP0 A;  1H88 C;  1WWX A;  1YIT B;  2XDV A;  1MNE A;  3B02 A;  1YTY A;  1F5T A;  2R92 J;  1IUY A;  1E1Q A;  2FVG A;  1O3R A;  1Z3X A;  1X19 A;  1SD5 A;  3ZQL A;  2P7C B;  2J7K A;  3GTL J;  2OTL B;  1YS6 A;  3A01 B;  3AG3 H;  2H8R A;  4WWC A;  1F60 A;  2DA5 A;  1BJA A;  2AS5 F;  3HC7 A;  3DTK A;  3P5J A;  4B44 A;  2CS3 A;  5DUK A;  5HS9 A;  4Q5S F;  1TT0 A;  2VC0 A;  4CZZ A;  4MLO A;  1FEX A;  1UMK A;  3OP1 A;  4G12 A;  5TIS C;  3DCF A;  4AM3 A;  1TL8 A;  5BQT A;  3LAJ A;  1IG7 A;  4OPS A;  1WXR A;  3BCF A;  1W2B B;  2CFO A;  4BAY A;  1Q86 D;  5EGO B;  1QQI A;  4BHB A;  3SY2 A;  3F23 A;  4WX9 A;  4X0C A;  2LDU A;  3P7N A;  1TUI A;  1QVT A;  1JHH A;  1W35 A;  1VZ0 A;  4OJO A;  2P5K A;  1FZP B;  4RDJ A;  1D0Y A;  3PA2 A;  4KIT B;  1EJ9 A;  4C2M J;  1GV5 A;  2IVM A;  3QPT A;  3ZN1 A;  2B7B A;  3MQ0 A;  3CCJ I;  1KCD A;  3BDD A;  1RUN A;  4MQV A;  1E3X A;  4M9S A;  1QGZ A;  2KL4 A;  3HHH A;  3CCU B;  4BEH A;  2R3S A;  2BGC A;  2VXZ A;  2L4A A;  5LRR A;  3PNT A;  2DMP A;  1IJF A;  1RKW A;  4RA2 A;  2OZU A;  1K73 D;  2XAQ A;  2QQ8 A;  3DKY A;  1B9N A;  1R1T A;  3I54 A;  4OM9 A;  4FIS A;  1K6O A;  4F7Z A;  3BLY A;  1AOY A;  4UB8 C;  1IB4 A;  1BR1 A;  2HTJ A;  3ZR8 X;  1LFP A;  2LG4 A;  3ZGK A;  5JFR A;  4BNC A;  4BKX A;  4CCO A;  2W00 A;  1UD8 A;  3JQP A;  2V7F A;  5LLQ A;  1G7R A;  2F2E A;  2HI3 A;  3JTH A;  4OMZ A;  2MD0 A;  2IGK A;  2JA2 A;  1OMI A;  4I98 B;  4ZYG A;  2EJR A;  1K9M D;  5AIQ A;  2W84 A;  1Y39 A;  1J59 A;  2ZME A;  1N08 A;  4RM0 A;  4RGS A;  1TP4 A;  4ZZL A;  3JU4 A;  3HXL A;  2XTX A;  4EM0 B;  1QJV A;  1FND A;  3ZQC A;  3JRG A;  4LOC A;  4URR A;  3FHN A;  1PJR A;  3LQR A;  1IN8 A;  1OKR A;  3MCA A;  5FLM J;  5C3E J;  1RRJ A;  1TTT A;  1KON A;  1WKM A;  1R1V A;  3DLL F;  3NAW A;  1RUO A;  4Y13 A;  5BS6 A;  4HIZ A;  3A8I A;  2DA4 A;  2QCO A;  2EQR A;  1MKM A;  2DCU A;  3KP5 A;  3LO8 A;  4KA4 A;  4I76 A;  1FX0 A;  3ELK A;  4X7D A;  2FML A;  2WSS A;  1OYW A;  1TW3 A;  2ID3 A;  4R79 A;  2H09 A;  3IWZ A;  4A3J J;  2C5H A;  4U9U A;  5IYB J;  1P6R A;  5CPR B;  4RLQ A;  4BE2 A;  1OR7 A;  2QX3 A;  2ISZ A;  4XLN F;  3JW4 A;  3VSU A;  4RAF A;  3WTZ A;  3M8F A;  1APL C;  1VQ7 I;  1FYL A;  3AG4 H;  4UNO A;  4EH1 A;  1UFM A;  1LFB A;  1SD7 A;  2BEO A;  3OFN A;  5D4S A;  3CMA B;  1R49 A;  4U87 A;  3DTI A;  5F64 A;  3RQ4 A;  1T0F C;  1PP8 F;  3K4K A;  1R5H A;  1O8G A;  1K83 J;  5AIP A;  2XEX A;  4HNU A;  4UUS B;  2CUJ A;  1SVM A;  2ZO4 A;  2RQQ A;  2R93 J;  4IX7 A;  2D9R A;  4UY8 I;  2GXG A;  3EDP A;  4XSX F;  3G2B A;  4LBY A;  3ZPP A;  1QBJ A;  1D1A A;  3H3V K;  2LYC A;  4GYG A;  1RQR A;  2HGC A;  2KIF A;  4LG3 A;  1IN7 A;  1TW2 A;  5E1X A;  4MR0 A;  3V8K A;  4CCK A;  3ABL H;  3KP3 A;  5D5V B;  5FO0 A;  2AQE A;  3HOV J;  1SFK A;  2BF4 A;  3AL0 C;  3FXQ A;  4IRG A;  3GTK J;  1Z1D A;  2RC6 A;  3ZMV A;  3HIF A;  1T6Z A;  4I01 A;  2VUM J;  4C3I J;  3ZPN A;  2W48 A;  1YRN A;  2HS5 A;  3CCL B;  1QHG A;  1STZ A;  3DLA A;  3F8N A;  4RB1 A;  2NVX J;  2PMH A;  2DA3 A;  1XTA A;  1I27 A;  3QQA A;  1FNM A;  3PFI A;  4M3B A;  4NC6 A;  3L2U A;  2P8T A;  3JRA A;  1BI1 A;  4BJ5 C;  1WJD A;  1UCR A;  4ETS A;  3S2D J;  3J81 Z;  3FKS A;  2HTS A;  3K4C A;  2KJB A;  3TDU C;  5ILS A;  4AUX A;  3B78 A;  3W5H A;  3T8R A;  3OYG A;  1W4M A;  1QUF A;  5J8C A;  1W9X A;  2BVL A;  1KK3 A;  3DQV C;  3WXM A;  1WJC A;  1OCC H;  3QOE A;  3F21 A;  1K28 D;  2GXA A;  3J7A O;  1MBH A;  2VNK A;  1OCO H;  1U5T A;  2OBR A;  4LB6 B;  5D8L B;  5ICC A;  1SFU A;  1NJI D;  1LEA A;  1X1D A;  4ZGQ B;  2EV6 A;  2DJI A;  5LHG A;  3PIO F;  2O9L A;  3CXC B;  1YJW B;  2QDX A;  2XNJ A;  1QQ1 A;  3OYH A;  2ZKZ A;  2X1C A;  3PM1 A;  2BW3 B;  2BSA A;  3CCR B;  2VFO A;  4ACB A;  3H5R A;  3LA3 A;  5CQG A;  1H8A C;  1U0J A;  2M0C A;  3PNY A;  2YWG A;  4BEH B;  4M4S A;  2JUG A;  5GV7 A;  2EWE A;  1RZ4 A;  2VON A;  1T6X A;  4G6I A;  2ZCW A;  4B09 A;  3N6Z A;  2PMZ A;  4EEF G;  5K7F A;  4HW0 A;  3HBL A;  1WGX A;  2COB A;  5KHD A;  1UMQ A;  3E0J B;  3FXU A;  5IY5 H;  4GFB A;  2X6Y A;  2BM1 A;  2DOA A;  2FBK A;  5IYC J;  1I5Z A;  4EGY A;  1OB2 A;  2YWE A;  3JRD A;  1QA1 A;  1SVL A;  4C0S A;  2DN0 A;  5M3F J;  1V5E A;  2LRD A;  4X7C A;  2W85 A;  3RPU A;  3K1N A;  3CDH A;  1X3U A;  3ASP A;  2M1B A;  3IH2 A;  2HDN B;  3KIO A;  2V7U A;  4X07 A;  4QUZ A;  2UVE A;  3J80 K;  3I1F A;  2VYQ A;  2CW7 A;  1G3T A;  3FBI B;  4YAL A;  4E7H A;  4AF7 A;  4AYB A;  5JVG F;  4MEY F;  4NQW B;  2OU2 A;  1Y1W J;  2A5W A;  2DK5 A;  2IRF G;  1HKQ A;  3BCA A;  1I18 A;  2KIQ A;  5F1J A;  1GO2 A;  3SDB A;  3J7Z I;  1VI0 A;  2GAU A;  1EF4 A;  1LPQ A;  1OB0 A;  3CLO A;  4KKS A;  4G6Q A;  5FGM A;  4YFX F;  1B6A A;  4XD7 A;  1U2R A;  4HF0 A;  5GPA A;  2FRH A;  2CRG A;  3BTL A;  4U7B A;  2EFP A;  2QA4 B;  2Q2E A;  5HNF A;  4E7S A;  2E35 A;  2QEX I;  1Y0R A;  1TNS A;  3WQZ A;  3SHF A;  2VIX A;  3ZQG A;  4E4H A;  1G3S A;  5HS8 A;  2ZJR F;  1JUS A;  4YAW A;  3DPL C;  1SAN A;  2KZG A;  2BYV E;  4Z2Y A;  2EZK A;  1CZF A;  4BQO A;  1HXD A;  2Y9Z A;  1YJ9 B;  2XT4 A;  1FSE A;  3JSP A;  3JSO A;  3VEP A;  2M7A A;  9ANT A;  3CTA A;  1U3E M;  2XHK A;  1FTT A;  1QGA A;  1KCC A;  3LFU A;  3L2W A;  1AA7 A;  4XON A;  3MAJ A;  2V1U A;  2FD5 A;  4NK8 A;  1QHH D;  2OA4 A;  1FY7 A;  3ERM A;  2XTW A;  3BOQ A;  1ZQ3 P;  2R0Q C;  2QZA A;  3WBJ A;  1K61 A;  3CPX A;  1H80 A;  1R71 A;  5JBQ A;  2QWW A;  4TSF A;  2NSP A;  1YX5 A;  3GUD A;  3OYI A;  1HQC A;  3M1C A;  4B48 A;  4ACA A;  2D1V A;  3GQ9 A;  3SDG A;  1WZ2 A;  1W5T A;  5FO5 A;  1J75 A;  3KYC B;  1FLI A;  4E0F A;  4Z4S A;  2LK2 A;  2DXI A;  2QQB A;  1IDK A;  2VQL A;  4QLC U;  2L7Z A;  3D5S C;  1MJB A;  3AAF A;  3EUH A;  4ZJZ A;  3L00 A;  4XNF A;  2PJR A;  3ES9 A;  1RQP A;  3BH6 B;  3J7A Y;  3CZ6 A;  2R7W A;  3KZZ A;  4A3F J;  3MFK A;  3TW7 A;  2YR2 A;  1KU2 A;  3UW0 A;  4QSH A;  4CZC A;  3A02 A;  2L9R A;  1E3Z A;  2L9S A;  2NZM A;  2M4K A;  3DU1 X;  2CWE A;  3BPX A;  1IF1 A;  3M1E A;  2HDW A;  3KYL A;  4XBF A;  2JT1 A;  2GJP A;  2ZNZ A;  2A05 A;  3SXY A;  4CCM A;  2VL8 A;  3C1D A;  3WTY C;  4M3E A;  3B6C A;  1BW5 A;  4PJJ A;  2HZT A;  2UUZ A;  4G6T B;  5IP9 J;  4U4B A;  1RKT A;  4YAO A;  1R5I D;  2BM6 A;  2V7T A;  4QFM A;  3BWG A;  4KMU X;  2PLY A;  2XAS A;  3CD6 B;  3VFZ A;  1OFC X;  1HST A;  4AIJ A;  4I0B A;  1VND A;  4GQN A;  3OR2 C;  4MTD A;  4KIG A;  1FRN A;  1MMG A;  1IJE A;  1D2E A;  2V4J C;  3C2B A;  3U2Q A;  4C3J J;  2INU A;  1QA2 A;  4XID A;  3JUR A;  3FJO A;  2V6C A;  4LLL A;  1MJ9 A;  4IL6 C;  1ETK A;  2GIZ A;  1BW6 A;  4ABZ A;  4RPD A;  2FUG 2;  2BY3 A;  5A89 A;  3ZOB A;  5DD8 A;  2JZY A;  4P96 A;  1PUE E;  3V76 A;  3OIO A;  4M9X A;  1HDD C;  3NAU A;  3LA2 A;  2LR8 A;  1GXP A;  4P12 A;  3WU0 A;  3K1M A;  5B5E C;  1VQM I;  1VF9 A;  3GSI A;  4A69 C;  3VST A;  2C2W A;  2VBM A;  1KQ9 A;  2XF7 A;  3ZMS A;  2OAZ A;  3TKY A;  2PIA A;  3ABU A;  2RKH A;  1TNT A;  4KMF A;  4EJW A;  3L2Q A;  2CND A;  2DBB A;  2ZB9 A;  3O8G A;  5BOX A;  4DK0 A;  2VKD A;  5EJC A;  1ZR4 A;  1E3P A;  4XK4 A;  3MZH A;  2Z2S B;  2HPM A;  1R4M B;  4BUP A;  1MJA A;  1R36 A;  3W6J B;  3SFZ A;  4EVI A;  3H92 A;  5TY0 A;  2DPU A;  2OQR A;  5LFA A;  4Z4U A;  3FMS A;  3WTW C;  4RB3 C;  1HF0 A;  1FT9 A;  4R8H A;  3DPT A;  3BR5 A;  2A07 F;  1ZYR F;  4B8X A;  2YU9 J;  1G7T A;  1IB0 A;  1OCZ H;  3HOU J;  4KKT A;  2IS6 A;  4LIV A;  1HSJ A;  4XOP A;  1V0F A;  1Z21 A;  3SJM A;  3JRC A;  1O8M A;  2Q2E B;  2O7O A;  2RDP A;  5IP6 A;  1R9T J;  2GOX B;  3GQ7 A;  4N3N A;  5CVJ A;  1OYI A;  1JJ6 C;  2ZBK A;  4HWV A;  3H5N A;  2J8I A;  3ZQH A;  2NYX A;  2ADU A;  3IH3 A;  4NC7 A;  4WXC A;  3V7R A;  3FMR A;  3G1M A;  2BMW A;  2LMD A;  1LDK B;  5FJ8 J;  3V4G A;  2Y0S A;  3T51 B;  3OEE A;  4PGO A;  3EQN A;  1DQU A;  1VHE A;  2WJY A;  3ZMU A;  1GHC A;  1OLT A;  3S14 J;  2H27 A;  4DQL A;  3IKT A;  4Y9U A;  3V7C A;  1FP1 D;  4BDZ A;  4AC0 A;  2RRE A;  4ZTF A;  1VQ5 I;  1LDD A;  2CSO A;  2QY1 A;  3CJR B;  1I39 A;  4C2U A;  2BY0 A;  1N25 A;  1TTY A;  3CF5 F;  1PDN C;  2PLF A;  2VQG A;  3L2V A;  2WAE A;  2VJ5 A;  4BQQ A;  5HLG A;  3E5X A;  2CFX A;  2N8G A;  3GX4 X;  1QNT A;  2X6W A;  5DSZ A;  5L3B A;  1G6N A;  1QRY A;  1BIA A;  2A3S A;  5LHH A;  1TQM A;  3WG7 H;  2VI6 A;  1J9Z A;  4ZDL A;  5GTI C;  3LMM A;  3HEF A;  2KFD A;  2PJR B;  4HLX A;  4RD1 A;  3G73 A;  5GV8 A;  2WWY A;  2FMY A;  5CDF A;  3QWL A;  5K5Q A;  3VNU A;  3L9F A;  4WF2 A;  2Q6L A;  4XRS A;  1YRN B;  3DWL E;  4IHW A;  4XIC A;  4K2E A;  1W87 A;  3IAM 2;  4N4O B;  3HGG A;  3MZ8 A;  1N0V C;  4UUV A;  3HRM A;  2QQ9 A;  3I71 A;  4OAY A;  5EZG A;  3E6C C;  3NRV A;  5M5Y J;  2NT9 A;  4MFD A;  3E3V A;  3GZ6 A;  3CCS B;  1OGM X;  4FX4 A;  1ZM2 A;  3F8B A;  1C0W A;  3CB4 A;  3B6A A;  4B4C A;  4CYC B;  3AG2 H;  3OSF A;  3I4N J;  1LQ1 A;  3S2H J;  2B5O A;  2JSP A;  2DYS H;  3M7G A;  1U5T B;  4XKV A;  4PZJ A;  2Z16 A;  3UKG A;  1RR8 C;  2PJP A;  4D9J A;  4WXD A;  3HJE A;  2B0R A;  3CME I;  2ZZE A;  1MMS A;  3NWT A;  4ZYD A;  3WND A;  3FZV A;  1K78 A;  2EFO A;  5KCM A;  2STW A;  2BW3 A;  1RWR A;  1IUF A;  4YXW A;  3GQB A;  1FMV A;  1D1B A;  2CUF A;  2AXL A;  3BC8 A;  3IKV A;  2WY7 Q;  5FFX A;  1QUE A;  1IN4 A;  1HW1 A;  2WAQ A;  1XS9 A;  1GJR A;  2NTB A;  2PEX A;  3CPW B;  1V5G A;  3DEU A;  3W2W A;  1OGJ A;  2M5S A;  2LF8 A;  2CQ7 A;  3LQ6 A;  2K85 A;  4BYY A;  1QG0 A;  3OS1 A;  1ZRF A;  4QVA A;  2QKL B;  4TV7 A;  4G7H F;  2W6I A;  4DK1 A;  4RM3 A;  1FPQ A;  4MHG A;  2P5V A;  4A12 A;  3K69 A;  1R6R A;  4GYI A;  3EYY A;  3MHP A;  4GCV A;  1ZLJ A;  1XG2 A;  2MSY A;  1U9O A;  2XPV A;  1W7P D;  3B90 A;  3ONQ A;  4RAG A;  1X1P A;  2XGC A;  1ON1 A;  1DGW Y;  2O0Y A;  5FKK A;  3Q5F A;  2HMA A;  2IGM A;  4YAF A;  3R0A A;  4NQW A;  4RM2 A;  3PUB A;  4I02 A;  4Y33 A;  2WB1 A;  2EA2 A;  4H4K C;  1OYY A;  3CP8 A;  3N4M A;  1IZ1 A;  2INV A;  4QWQ A;  1EP1 B;  3Q0U A;  3N05 A;  2HCJ B;  1O4X A;  1SKQ A;  3IL2 A;  3L09 A;  2DFE A;  2ECC A;  2QA4 I;  1GQ8 A;  1S0U A;  4RGR A;  2VJ4 A;  2KRC A;  2MLK A;  2XC7 A;  1YJN B;  1MBF A;  2LY9 A;  1Z7L A;  3WTX C;  2IXS A;  3CCE B;  1SMT A;  5JI6 A;  4G9Y A;  1V5F A;  2RV8 A;  2P0W A;  3ISP A;  4LK1 F;  4KFC A;  1DDG A;  1E43 A;  5DEQ A;  2ZBV A;  1K4Z A;  2BVN A;  2LRE A;  1SVO A;  4PC7 A;  4Z05 A;  4R1H A;  4NBS A;  1TWF J;  4EGZ A;  4BGD A;  1YFH A;  1H0M A;  2OF7 A;  3FK6 A;  2IGN A;  3ROU A;  3A3G A;  3DKW A;  2KIM A;  3U1D A;  5F1R A;  2K40 A;  1YG2 A;  3H9J A;  1JE8 A;  3RCO A;  1JTY A;  4NNJ A;  5ICF A;  2L4M A;  4ZH4 F;  5FLX K;  2EPF A;  4RD2 A;  1NDH A;  4HNT A;  2VBX A;  4AIH A;  3HPH A;  1ETV A;  2H94 A;  4FE4 A;  5F0H A;  4LIU A;  3G6E I;  1ZGJ A;  1W1W E;  1P4W A;  2PFB A;  3SFI A;  2CG4 A;  3KRG A;  5D5X B;  2JPB A;  4RB0 A;  2R7U A;  1ZN2 A;  1M90 D;  2DYR H;  2GJR A;  4CGZ A;  1BM9 A;  4WZK A;  3BG7 A;  1Z6R A;  1QRC A;  3BZC A;  2E5N A;  2FQ4 A;  4FE7 A;  4IHS A;  1TC3 C;  1DAR A;  1T5E A;  5C44 J;  1BBY A;  3PSZ A;  1MBJ A;  1JKR C;  3HRT A;  2LP0 A;  3AVW A;  1YI2 I;  5IYQ A;  1BI3 A;  2XIG A;  3OYN A;  4Y9R A;  5J4V A;  2O17 A;  2VT2 A;  3FBN B;  3HTS B;  1OHH A;  1J7K A;  3TOB A;  2W82 A;  1F4K A;  2F4I A;  4Q7J B;  2CQK A;  4EV0 A;  3FX3 A;  1SAX A;  2CJJ A;  4N0B A;  2L02 A;  2V1D A;  3FIW A;  1OIS A;  2BV3 A;  1G4D A;  1O88 A;  2NRA C;  2KP6 A;  3V7S A;  3CC2 I;  4MO7 A;  4RLF A;  1IRF A;  3CJQ B;  3I4M J;  5AMV A;  4IKF A;  4CQJ A;  2MYS A;  3EUK L;  1XMK A;  1QFJ A;  2EA4 A;  1BR2 A;  3REO A;  1S4M A;  3J81 k;  1JRG A;  4MYU A;  2QMU A;  3PSI A;  5BNG A;  3BPV A;  3R4K A;  3KP2 A;  4M3F A;  1ZR2 A;  2HDC A;  2D1H A;  2XVC A;  4DQK A;  5BSX A;  4P25 A;  1ETW A;  2ZME C;  1AWC A;  2R7F A;  4L5J A;  1FOY A;  4RGX A;  5CYV A;  4S0H B;  4AYB N;  3AL0 B;  3ZN0 A;  1LVK A;  2AXT C;  1N05 A;  5FIU A;  1UJ8 A;  3JRF A;  1K78 B;  2F5C A;  4X7E A;  2MGQ A;  1OCT C;  2B63 J;  2C5B A;  2M87 A;  2WYR A;  1LE8 B;  1ZM4 A;  1IRX A;  3MKL A;  3GTP J;  5D8K B;  3QPS A;  2NT6 A;  1VQN I;  3RPQ A;  1IHM A;  4YII A;  2ZZG A;  2DLL A;  4A0Y A;  2RN7 A;  1B8I B;  2CH0 A;  1IDZ A;  2O6G E;  4XQF A;  3GTJ J;  1KU9 A;  3WWG A;  2K4B A;  5TJJ A;  2V31 A;  1W5C C;  4B47 A;  1HDP A;  4PUS A;  4L0Y B;  2VE8 A;  1EA0 A;  4BH9 A;  4IQ4 A;  3HL2 A;  4G7W A;  3QU6 A;  3TMO A;  6PAX A;  3MVP A;  3F8M A;  2KHM A;  3HOY J;  3H9G A;  5E1Z B;  1S29 A;  4WZL A;  4E7L A;  3LSR A;  3MKY B;  4BXX J;  5DDG A;  1HOM A;  5AN9 A;  3GVK A;  1GR1 A;  4EM2 A;  5J8F A;  5F6F A;  2NTQ A;  2O0V A;  2CQQ A;  1OFL A;  3ASN H;  2XC1 A;  4HNV A;  3DBH B;  3OOP A;  1WI9 A;  2DOD A;  4KT5 C;  3RQI A;  1IXS B;  2HKO A;  2X8K A;  3VSV A;  3CJT B;  2GOM A;  4MIM A;  3LQQ A;  4MTE A;  3VWB A;  4MYT A;  4ZGN B;  2FBH A;  3E6B A;  4WZT A;  1GDT A;  3T53 B;  3CF2 A;  4XKC A;  5F04 A;  1HKT A;  2J8K A;  3OZW A;  2VBU A;  3T56 B;  3A01 A;  3VPR A;  3ESW B;  1JT6 A;  2VFM A;  4L5E A;  1POG A;  1UHS A;  1YIJ I;  3QYF A;  4HV5 A;  3CDI A;  4EJV A;  2E2I J;  2GM4 A;  1X4P A;  4QIW N;  3PQK A;  5F0C A;  1H85 A;  2QGG A;  4F92 B;  2R7S A;  1LLW A;  2Z33 A;  4C9Y A;  2DK8 A;  2CV1 A;  1WJB A;  3LL7 A;  4RD6 A;  1MH3 A;  4ENN A;  1E0E A;  2BXY A;  2O6W A;  1P92 A;  4ZCL A;  3H9N A;  2F5E A;  1XFO A;  2VBZ A;  1MSF C;  2WAF A;  3JR9 A;  3SQN A;  5D6E A;  1GVJ A;  3Q9S A;  5JHU A;  2V7Q A;  5GAG J;  2PYH A;  2EWN A;  4MQ9 F;  1U9N A;  2IS1 A;  2ZNY A;  4KIS A;  3OMY A;  4ESB A;  2GA1 A;  1I6H J;  1NG6 A;  4D5C A;  2F5D A;  3PO3 J;  2X3U A;  2NS7 A;  1D5Y A;  3QFR A;  4CYD A;  4OOV A;  1BA5 A;  4P3Y A;  2VBT A;  2XAJ A;  2FSW A;  3BP8 A;  2WJV A;  3W5U A;  5EYR A;  3ASO H;  4ZCI A;  4CCN A;  4HE6 A;  2QE7 A;  4ANJ A;  4IO9 F;  2D74 A;  2JDI A;  2XPW A;  2DMQ A;  1A6I A;  3HTU A;  2X1D A;  2Z8G A;  4W8S A;  1TSP A;  2L7M P;  3W2G A;  3CC7 B;  1G59 A;  4XM3 A;  2F3L A;  2KPM A;  4BU2 A;  2R7Q A;  4FET A;  3QYE A;  1BR4 A;  4XLA A;  2DJN A;  4OOX A;  4G7O F;  5DCF A;  4U0V A;  2XSD C;  2VE9 A;  1JNY A;  3W2V A;  3KZY A;  4XKB A;  3PEN A;  3TP0 A;  1XQB A;  2FXA A;  1MNM C;  2DT5 A;  1IDY A;  5EEH A;  2QVO A;  2QEN A;  3RYR A;  2R7R A;  4II2 A;  5C1C A;  3RY8 A;  2CBX A;  4M73 A;  4CYC A;  1WU8 A;  1IN5 A;  2EZI A;  3CC7 I;  3G4S I;  3BZK A;  2NPF A;  1B59 A;  1QVU A;  3JRB A;  2GK7 A;  1IA5 A;  1ONV A;  4WCG A;  4Y52 J;  1SD6 A;  3K4N A;  4EM1 A;  1D8T A;  3FXK A;  3UR3 C;  2BM4 A;  4DBQ A;  2ZTG A;  4F3Q A;  3R6J A;  1VQL B;  2DMT A;  2XF6 A;  1HW5 A;  2HU9 A;  4AVP A;  4E70 A;  1H9T A;  2BPO A;  4IEJ A;  2I1L A;  3B8Y A;  2QKM B;  3SZE A;  4LGW A;  2FEZ A;  4LJZ F;  2D2W A;  3HOW J;  2WC2 A;  3QP5 A;  3BQZ A;  2M9H A;  4JX5 A;  1IV6 A;  2QYU A;  3GBG A;  2E2J J;  1BX0 A;  1L1I A;  4ESF A;  1FNN A;  4IHV A;  1WOS A;  3N97 A;  2DFF A;  1ZAO A;  4JK1 X;  1IRG A;  3OYJ A;  2OD5 A;  3OZV A;  3P4G A;  1UD2 A;  1VQK B;  5ED4 A;  3LNN A;  4PC2 A;  5B1A H;  5EG0 A;  4P1W A;  2L9V A;  4ITV A;  3H3U A;  4F55 A;  4PC6 A;  3BJ6 A;  4WK8 F;  4IOC F;  4D5F A;  2C4T A;  1E63 A;  1R5B A;  1MSE C;  1YO5 C;  2DQR A;  2L3D A;  2VJJ A;  3R0J A;  1L3L A;  2DT7 B;  3IP4 B;  4BS9 A;  2YWF A;  5GAE J;  3NE5 B;  1U8R A;  4X7F A;  2EZH A;  4PK4 A;  1IDJ A;  4GGG A;  5LHI A;  4N3G A;  1JUM A;  3TOA A;  1WOR A;  3TO7 A;  1EP3 B;  2IA2 A;  2VB6 A;  3I59 B;  3Q0V A;  1NBM A;  1R22 A;  3ASR A;  1XCB A;  3OSG A;  3P26 A;  4B3G A;  2BX6 A;  3E7L A;  1XGS A;  4U7D A;  3SZG A;  2JSC A;  4DZJ A;  3S3O A;  4PGG A;  2HXO A;  4PDK A;  1JTX A;  4LG0 B;  2I10 A;  3OL4 A;  2AQF A;  3AKZ A;  2BSP A;  4X06 A;  3CUQ B;  5J1U A;  5GP9 A;  3LA7 A;  2HWV A;  2V9P A;  1YW9 A;  1FJL A;  2ZL7 A;  2O5R A;  1ZM9 A;  4PCQ A;  3RKQ A;  1J9I A;  2XSJ C;  4F52 A;  3OYK A;  1NHA A;  3BR0 A;  3HG9 A;  2KZV A;  4U0W A;  4EQQ A;  2Y0M A;  3RZO J;  1PKV A;  4LBW A;  2VBS A;  3BC9 A;  2Z1D A;  4NDL A;  1K6Y A;  5K5R A;  4UB6 C;  2P5L C;  4Y15 A;  3S15 J;  3GFL A;  3NQO A;  2XV4 S;  2JMW A;  3CCU I;  5HXB A;  3Q6R A;  1HF2 A;  2QSH X;  1BN8 A;  3BR6 A;  2H8W A;  2K86 A;  4A3K J;  5J3L A;  2VKV A;  4WWV A;  2L01 A;  2DOG A;  2A6H F;  2NV4 A;  5IK2 A;  3W2E A;  2ACJ A;  4AF6 A;  4HQM A;  3PSF A;  2JQ7 A;  3RIQ A;  2HYG D;  2KT0 A;  4XLP F;  1B72 A;  3BY6 A;  5EGO A;  1JKQ C;  4A5N A;  2E1M C;  2Z6B D;  3GIR A;  1ZTR A;  3TO9 A;  2QYO A;  2XT2 A;  3GRH A;  5IP7 J;  2RAE A;  2QM3 A;  3F0C A;  2DQL A;  4L9J A;  3Q3A A;  4MFE A;  3F6V A;  3WU2 C;  3KP4 A;  3B82 A;  3D26 A;  4QPO A;  2DU9 A;  5HDN A;  2QSG X;  1DAB A;  2F48 A;  3ONY A;  1PJ5 A;  1GAW A;  2NNN A;  2P6S A;  2VNJ A;  4I09 A;  5D5U B;  2DTZ A;  3I58 A;  4UV9 A;  4EJO A;  3H0G J;  3K70 D;  1NK2 P;  4M71 A;  4O3M A;  5M3M J;  3S16 J;  2QQA A;  2QBY B;  4FTH A;  3ZXS A;  3HOS A;  4EAT A;  1HC8 A;  3CW2 A;  1BMF A;  3U6K A;  1TYX A;  2VFN A;  3HRS A;  5CKT A;  1E62 A;  4DGW B;  3R6K A;  4Z1M A;  1B9M A;  3KE2 A;  4RD3 A;  1EV7 A;  3WGH A;  3ABM H;  2OZ6 A;  3B73 A;  4I7H A;  2FOW A;  4M53 A;  1VQK I;  2CQN A;  1PVE A;  1D1C A;  3R60 A;  2DT6 A;  2OYN A;  3JRI A;  1Z9C A;  1TZL A;  3MN2 A;  5FL7 A;  3KEW A;  2XZL A;  4OOS A;  3GZN B;  3VYS B;  4BHP A;  2HLD A;  2F5F A;  4L9T A;  1G3Y A;  5KVR A;  4IHT A;  5E3N A;  2XGJ A;  2P6T A;  1NRK A;  4RBO A;  1FP2 A;  1VQP I;  2O0W A;  1MBK A;  4CO8 A;  1DGR M;  1QZZ A;  3LSH A;  4JOM A;  1ZLK A;  2JJ2 A;  3T5X A;  3MCZ A;  3HYI A;  1GT0 C;  3LSI A;  3MWM A;  1WJF A;  3WOD F;  2OK7 A;  5KW9 A;  1E79 A;  2EFQ A;  1L0O C;  1LE8 A;  4L8J A;  3ZBU A;  3KEY A;  3LSM A;  2Y75 A;  3A03 A;  4G8X A;  1QO0 D;  3W6K B;  2RC5 A;  4JMQ A;  1RNL A;  2ZFW A;  1MGT A;  1UD5 A;  4TN1 A;  5FD6 A;  1YIT I;  1VQ6 I;  1ITY A;  2LY2 A;  1AIR A;  1TLH B;  3MD2 A;  2EIK H;  1T6Y A;  4YZ0 A;  2M45 A;  2PMU A;  4UUS A;  3OOC A;  2GPJ A;  2VQH A;  3HRU A;  3DP7 A;  3K4J A;  3SJP A;  4YFO A;  1WDT A;  5JLV C;  4YEI A;  4L0Z B;  3PFY A;  2UWM A;  2HDD A;  4NK6 A;  5TR9 A;  4GRI A;  2ME6 A;  4QPQ A;  4I99 C;  4B3X A;  1ZK8 A;  1SM4 A;  5DNS A;  5BPD A;  1CF7 A;  4ZZD A;  5LGU A;  4D1Q A;  2CW0 F;  3PNV A;  3QAH A;  4RDU A;  2XPU A;  1VQ8 B;  1BOB A;  1X4O A;  3E97 A;  4ASN A;  5FB2 A;  3DEE A;  3CMY A;  2NOG A;  5HDK A;  3M07 A;  2NAZ A;  4XMY A;  1IXR C;  3K1P A;  4IF4 A;  2MW8 A;  4PJN A;  2HOS A;  3ZQI A;  3LJY A;  1GAQ A;  4ZCM A;  3CDL A;  1A8P A;  5K7Z A;  2DTR A;  4CUG A;  4FT8 A;  2LZJ A;  1ZRC A;  2EFW A;  2GWR A;  2XAF A;  3DDY A;  3ZP5 A;  1D8J A;  4V2F A;  3J80 Z;  1AMO A;  3ZSC A;  2E34 A;  2BN4 A;  4DNT B;  4FHT A;  1S72 I;  2IAI A;  3BCB A;  3G1L A;  1MDM A;  1OGI A;  2X0L A;  3V7A A;  2TRT A;  1BQE A;  1AKH A;  1LFU P;  1J0R A;  1MW7 A;  3LSG A;  3SZT A;  5H2F C;  5J3O A;  5L46 A;  3FKJ A;  3Q3S A;  4QVJ A;  1ZG3 A;  2ELK A;  3VYU B;  3OY9 A;  3FWE A;  2ELH A;  1TWG J;  2K9Q A;  4RS8 A;  2A61 A;  2LBF B;  4M6V A;  3HHG A;  3WTS C;  1ON2 A;  2JJ1 A;  5HZB A;  3G71 B;  1YIO A;  3E1S A;  3NB2 A;  3I56 B;  1TWH J;  4KNY A;  1KGS A;  4NC8 A;  2M8E A;  4ZC3 A;  1KTW A;  3VB2 A;  4JYK A;  2ZXH A;  2HPI A;  2R9V A;  1KQ5 A;  4BQN A;  5K1Y A;  2B7C A;  2L7F P;  1OFD A;  4E7I A;  1S6L A;  1KYW A;  1R00 A;  2DA7 A;  3CCY A;  2NNY A;  2G0Y A;  4JBA A;  5B3S H;  1W7P A;  1GLN A;  4XOR A;  3ZQF A;  1BI2 A;  4ASU A;  3GME A;  2OV7 A;  3OR1 C;  1S8N A;  3WYA A;  3PQJ A;  4KJZ A;  3GVA A;  3W3C A;  1BLI A;  3GW2 A;  4XLE A;  1JGS A;  3A0B C;  4IZZ A;  1MD0 A;  4RB2 C;  2WV1 A;  3M8E A;  5TRD A;  1RC9 A;  3BG6 A;  3FKI J;  3CCL I;  3K7A J;  4HST A;  2ISY A;  4DW6 A;  1S7A A;  4J0Q A;  4DNR B;  1VQ5 B;  5KSW B;  5LMZ A;  3CCM B;  3VNV A;  3CQZ J;  5L3G A;  4RJL A;  2EB7 A;  3SQV A;  5A2Q K;  1VBL A;  3H09 A;  3FPK A;  2E60 A;  2DDA A;  3D5L A;  2CW8 A;  2PG4 A;  1PJ7 A;  3BH4 A;  5LGN A;  1QH0 A;  1MBG A;  2DA2 A;  4PJL A;  4BBS J;  1ETQ A;  2OQG A;  2OCE A;  5E3O A;  2MC3 A;  4EJT A;  1BC7 C;  1Y0N A;  5BMZ A;  3M8J A;  4KYW A;  1K79 A;  3HKZ A;  4FK8 A;  1ACI A;  4OJ6 A;  4G1V A;  1S9H A;  3M4O J;  2OTJ I;  3FMQ A;  2MG4 A;  4I2O A;  1FNC A;  3F72 A;  2JA7 J;  2E1M B;  3DV8 A;  2MAB A;  3PUN A;  4OIO F;  1YQA A;  1T33 A;  2M8G X;  2VQC A;  4YFK F;  5L3D A;  1R5O A;  2JN9 A;  3FPP A;  1PJ6 A;  2ZXW H;  5GTH C;  2YX7 A;  4GO1 A;  3TW6 A;  4HDV A;  1EZG A;  4HF2 A;  5J47 A;  2JA5 J;  3W2F A;  2VBK A;  3R61 A;  2BM5 A;  3IUO A;  2HVQ A;  3RZD J;  4M74 A;  4PSW A;  3Q38 A;  4H9G A;  2KDO A;  4Z6Y A;  1P4A A;  1DBO A;  3DXJ F;  1WSU A;  2IA0 A;  3H5A A;  1ZUN B;  4F91 B;  2TDX A;  4N4N B;  4G7X A;  4M1K A;  2B0L A;  3AK5 A;  1WMR A;  1UB9 A;  2HVR A;  1N8R D;  3GZ5 A;  5CVR A;  1ETX A;  3ZC3 A;  1WQ2 A;  4FXU A;  2FNP A;  1PYV A;  3KP6 A;  5F27 A;  2YWH A;  3GWZ A;  1EFU A;  3ISX A;  2V26 A;  3JCU C;  1TQP A;  1XGN A;  2EV5 A;  3QU3 A;  1ZGW A;  4HQE A;  3ECH A;  3IHU A;  4Z06 A;  4B1R A;  2BHZ A;  1YLO A;  1EH7 A;  2WR8 A;  4Z03 A;  2V9V A;  3G4S B;  1BIB A;  5DUI A;  3LSP A;  3GQA A;  1Q9S A;  4RLZ A;  1I7P A;  1SD4 A;  2R7D A;  3ECO A;  2BE5 F;  1ETO A;  2F4O B;  4Y17 A;  3VDX A;  1QPM A;  5E3M A;  1DUX C;  2JUC A;  4P9S A;  4YCQ A;  1T08 B;  5J1Y A;  2DA6 A;  1JKO C;  4LBZ A;  3I55 B;  1VQN B;  2IJL A;  1FMW A;  1XN7 A;  2MC4 A;  4II3 A;  1FIA A;  4RDK A;  1HA8 A;  5CJ9 A;  4XN0 A;  4KUM A;  4C3H J;  1HA3 A;  2OUM A;  1F43 A;  2WAD A;  1I1G A;  4FWT A;  3F22 A;  3ABT A;  5FO1 A;  3A3B A;  2O8K A;  4EMS A;  3CUQ A;  5LBQ A;  3G1O A;  2PQ8 A;  4B4D A;  3W5V A;  1NG7 A;  2O3F A;  4HBL A;  2DO7 A;  2L0K A;  4M3G A;  5E1W A;  2COM A;  1N78 A;  3W2I A;  4IRH A;  3P27 A;  1U6G A;  3OS0 A;  2QF7 A;  2L54 A;  1USS A;  3BZ6 A;  1GXQ A;  3HKZ N;  2A6E F;  1MH4 A;  3GFM A;  2HVS A;  1PXZ A;  4W8T A;  2GBY A;  3O6B B;  2LNB A;  2Z3Y A;  3NEU A;  1MMA A;  2Y69 H;  4QHY A;  1J5Y A;  1XSV A;  4OAZ A;  4OU0 A;  2HYF A;  2ZXI A;  2H6C A;  2XRO A;  1REP C;  4IW3 B;  3SYT A;  4J01 A;  1R23 A;  2O03 A;  1PP7 U;  2K9M A;  1K5C A;  3C18 A;  4XLC A;  4PAA A;  1SEU A;  3ZUG A;  2JK3 A;  3SUC A;  3BH7 B;  3PJR A;  4HA8 A;  3JX8 A;  3K2Z A;  1FOK A;  3I56 I;  1YJN I;  1QX4 A;  2JVH A;  5J35 A;  3GTQ J;  2KKO A;  2K9N A;  4P2N A;  3VOE A;  1MMN A;  3OYC A;  2B7E A;  1YYV A;  2OBT A;  1KZH A;  2MLG A;  1MIJ A;  4ZYH A;  3QPL A;  4XRF A;  4P9F A;  1A36 A;  3EUA A;  5L3C A;  4LIT A;  5TGT A;  2IS2 A;  2ZJP F;  2C4U A;  2GZW A;  3EPZ A;  3CCQ B;  1ZGA A;  4LB5 A;  3WE2 A;  1EXM A;  4QV2 A;  2WAQ N;  4X1E A;  2H1L A;  1XB2 A;  2E2H J;  2ZL6 A;  5FRO A;  4UXN A;  4ZTJ A;  2UV1 A;  4CH7 A;  1Y56 A;  1KC8 D;  1TYU A;  2CRV A;  1VTN C;  2BY1 A;  5IT9 K;  2DET A;  2GLO A;  2QBY A;  4A3D J;  5FRN A;  3SYJ A;  3T1B A;  4IVN A;  2FBI A;  2NVU B;  3C3W A;  2EBI A;  3KX2 A;  4HLY A;  2IA1 A;  3U9G A;  2R4G A;  2Q6K A;  1OGO X;  2D3N A;  4YRV A;  3OIP A;  2OJE D;  4FQG A;  1BPL A;  1K8A D;  1QZY A;  2Y48 A;  3HB9 A;  2DYI A;  3X2Q H;  3GXO A;  4U0Y A;  2MH9 A;  3GTO J;  3MMY B;  4LBV A;  3BT9 A;  2IGO A;  4A6E A;  2VBV A;  1Z7U A;  5LRS A;  1NK3 P;  1FOX A;  5FA6 A;  1F36 A;  3HDD A;  3RKW A;  1CQT A;  2QXZ A;  1VQO I;  4MEX F;  1TBX A;  1V0E A;  3WTV C;  1IW7 F;  2R5Y B;  3KFW X;  4UVB A;  2CV0 A;  4P5O A;  1ZHF A;  2WPD A;  1IV8 A;  1WH7 A;  4OIQ F;  1O7F A;  3GTG J;  4TMX A;  4DQ2 A;  3S1N J;  3BCD A;  1FX7 A;  2BXZ A;  2WA0 A;  3DFG A;  1MZB A;  1T0F A;  4H0E A;  4XRM A;  4YEL A;  2EIM H;  1VFC A;  3KET A;  3QE2 A;  2IQ7 A;  4RAZ A;  2BBY A;  4A0Z A;  5HOO A;  1PE9 A;  4HRI A;  3B4N A;  4TKO B;  2B9S A;  3G71 I;  4RCY A;  3FIS A;  2ODL A;  3HSE A;  1WJA A;  2VPL A;  3GVL A;  4Z4Z A;  1OJL A;  4HPQ A;  1KU3 A;  1FNB A;  4U49 A;  3OYL A;  1IAW A;  1BL0 A;  3OYE A;  1A5J A;  1TLL A;  3CCV B;  2XGX A;  1LDJ A;  3U1K A;  1V55 H;  3ZMT A;  1T8I A;  4M6X A;  1FYK A;  2KIS A;  4PSX A;  5E18 F;  1E17 A;  1XMA A;  1YJW I;  1N75 A;  2XKP A;  3OYF A;  2FF4 A;  2XGE A;  5J1R A;  5C1E A;  1R1U A;  2K5C A;  5M5W J;  4CCL A;  4P6Y A;  1Y1V J;  2CV2 A;  1KMH A;  2W6J A;  1WHU A;  4DYR A;  1CF7 B;  3H94 A;  1G8X A;  3V42 A;  1KQ0 A;  2UXN A;  1N0U A;  2QEX B;  2EH3 A;  1VQM B;  1X2N A;  4L5I A;  1G7C A;  1QRB A;  1A35 A;  4KIF A;  1LJ9 A;  3RDI A;  4OP7 A;  2OCC H;  1T38 A;  2J5O A;  1QGY A;  1PLU A;  4YZX A;  1VQ8 I;  4CDG A;  4R71 A;  5FFZ A;  5FD5 A;  1EFC A;  5DS0 A;  4D7M A;  2STT A;  3H36 A;  5FKO A;  2XAG A;  2XNC A;  3GQ8 A;  1P4X A;  2G7U A;  1I6X A;  3HUG A;  2XZP A;  3OKX A;  4OMY A;  5JLW A;  3CUO A;  1E3O C;  4BL0 B;  1V54 H;  1SFO J;  1JT0 A;  1W0K A;  4UZE A;  5HZA A;  4V2G A;  3S1R J;  2EFG A;  4OJL A;  3G3Z A;  1K8F A;  4G94 A;  3CP2 A;  3P9K A;  1SC7 A;  3M9A A;  4BY1 J;  4C2T A;  2IP2 A;  1QVG B;  1GVH A;  3WHC A;  1MRZ A;  2Q8K A;  1W0U A;  3RKY A;  3OYM A;  3FHZ A;  2DA1 A;  1LB2 A;  1O8D A;  3I4P A;  1X1C A;  2CUZ A;  4F93 B;  4HDU A;  2LBF A;  2ID6 A;  1O3T A;  2QTZ A;  2WBM A;  4P1V A;  3G6E B;  1Q1H A;  5K5O A;  1OFM A;  1IO2 A;  4D7N A;  3TDZ C;  1O8E A;  3VMF A;  2MD5 A;  4HOB A;  4Z4T A;  1D8K A;  1PUF B;  2VN2 A;  1HLV A;  2ZTN A;  3CLQ A;  4IHX A;  2DOF A;  3CC4 I;  4I6Z A;  2R7T A;  5BPI A;  2MFZ A;  4IQJ A;  2YUH A;  3OZU A;  4G1B A;  1Z77 A;  1UD3 A;  3PVD A;  1W7P B;  4PMH A;  1DDN A;  5ICG A;  5HDG A;  1FBS A;  3FM5 A;  3TP3 A;  1ZRE A;  2JRT A;  4AWX B;  2M2E A;  3HOX J;  3BNW A;  3HOT A;  3BR1 A;  1O8I A;  2QZ8 A;  1T56 A;  3B8H A;  3GLX A;  2M0M A;  3AG1 H;  3SEJ A;  2R7O A;  4ZYE A;  1QA6 A;  1ELO A;  3RJP A;  1UD6 A;  3E1Y E;  1ZKG A;  4P6V F;  4Y7C A;  5F4J A;  1KJZ A;  1LUJ B;  5IOZ A;  3OJW A;  4XKW A;  5ICE A;  4P9U A;  1T6S A;  2HXI A;  5FKM A;  1IC8 A;  3ASS A;  2FX3 A;  1S5L C;  2GIV A;  1TT5 B;  2ZZF A;  2G7H A;  3ZPL A;  1TYV A;  1V3F A;  2DFH A;  2JPC A;  4A6D A;  1LNW A;  2HQA A;  4PJM A;  5E8I A;  2VT3 A;  4BHC A;  2YPR A;  3HOZ J;  1X3Z B;  1B23 P;  3K4L A;  3J81 K;  1IXC A;  3ZZ0 A;  4ZV4 A;  3GVJ A;  2HQ5 A;  3SEZ A;  2OTJ B;  4XLF A;  3C2G A;  1Q7Y D;  3OYB A;  3WBK A;  1GV2 A;  2VC1 A;  2NVQ J;  5EMN A;  1YW8 A;  5CLS A;  2M34 A;  3TQN A;  3QOP A;  1P7I A;  4NB5 A;  3CO6 C;  3Q9V A;  2V7V A;  1RU4 A;  3E5U A;  4YDT A;  2W1O A;  4Z4R A;  3PO2 J;  3ZRG A;  3BR2 A;  4UHT A;  2LTP A;  3S32 A;  1RPW A;  3PIP F;  5J4Y A;  3O2P E;  4KN7 X;  1E2X A;  1WJ5 A;  5HLH A;  2OTL I;  4O6J A;  3OE7 A;  4X8I A;  1Z6T A;  4CIC A;  1A04 A;  2Y31 A;  2WB1 N;  3QP6 A;  1IGN A;  4KDP A;  3I55 I;  4WXH A;  4K1X A;  1KQ8 A;  4OJ5 A;  4W1U A;  5IYD J;  2AHO A;  1OCP A;  3BG9 A;  5CVU A;  1CNE A;  4MGR A;  3W6V A;  1UD4 A;  1BC8 C;  3E5Q A;  1UEL B;  4J00 A;  1ULY A;  2BGJ A;  1K4T A;  2ZSH B;  2V4D A;  2VJI A;  4C30 A;  1NHC A;  3F8C A;  3K6G A;  3FM3 A;  2W7N A;  2F4M B;  2D3L A;  3BJA A;  4HX4 A;  5C4J J;  3QOD A;  3BTJ A;  4DIQ A;  2NXN B;  2IBD A;  1B1B A;  1SFX A;  4A93 J;  5IYN A;  2XZO A;  1XC5 A;  4ZDP A;  1WCM J;  3HZJ A;  1U78 A;  3F6O A;  2F1L A;  1KQS B;  1B2R A;  5D4R A;  3OIQ A;  1MBE A;  1EWY A;  4CHU A;  1CQX A;  1RES A;  2BM7 A;  4P26 A;  4ESJ A;  2K9L A;  3MEX A;  5J6X A;  4MXN A;  5LGT A;  4NUB A;  1Y8R B;  1SAU A;  4PC1 A;  1BJZ A;  1OB5 A;  1CGP A;  1WPC A;  2ESN A;  1O8J A;  4J19 A;  4YEJ A;  5IOY A;  4Z4W A;  2Y9Y A;  2YU3 A;  2Z99 A;  3PL8 A;  3Q39 A;  2X3H A;  2XOK A;  1JA0 A;  2CO5 A;  1F1Z A;  2HOE A;  3K70 C;  1I8D A;  4YZA A;  3T9G A;  3VYR B;  1CNF A;  1G2H A;  1JGG A;  3BG5 A;  3PET A;  4RD4 A;  4M6Y A;  2W4S A;  1RI7 A;  3F9K A;  3E6M A;  1DPR A;  2KQR A;  3ZZT A;  3RTR A;  2GK6 A;  1DU0 A;  1JI8 A;  3FXL A;  3QYB A;  5GAD J;  3VMW A;  4YHB A;  3HUG B;  1NB9 A;  2KVO A;  2FA5 A;  1YW7 A;  4BE1 A;  1WOO A;  2E19 A;  2NVT J;  2CW5 A;  4JRA C;  1KTV A;  1ZH5 A;  2W25 A;  4BJT A;  2ETH A;  2BM0 A;  2NS8 A;  1SMY F;  3ML6 A;  4M9Z A;  2VOP A;  3BQJ A;  2J5P A;  4AID A;  3IWF A;  1WVR A;  5IPA A;  1QFY A;  1VQP B;  2F4N A;  3D5R C;  3BG3 A;  4CSW A;  1JTA A;  4OZZ A;  5CQE A;  4OZY A;  5H20 A;  5B1B H;  5E8G A;  2ELJ A;  5DD4 A;  1EKE A;  2E1B A;  3AVY A;  4Q4Z F;  4Z4Y A;  2PYG A;  2Y30 A;  4Y3O A;  3COA C;  4RDL A;  4KN4 X;  1YI2 B;  3BQY A;  2FOK A;  1D5V A;  5DCM B;  5KNL A;  2VOD A;  2DMN A;  3S17 J;  2C6Y A;  1VHO A;  2V7X A;  1V4R A;  2MBF A;  3BTC A;  3HPG A;  4BE0 A;  2VNH A;  1U5T C;  2EFN A;  2ZJ2 A;  1IN6 A;  1H8E A;  1P7J A;  1Y8Q B;  4GXO A;  5E6T A;  3CCJ B;  4YIF A;  1S7O A;  4IPA A;  3LAP A;  5LEJ A;  3MMP A;  3OWT A;  2E5Z A;  4OJP A;  5DM6 F;  3JRH A;  1WRJ A;  4M2L A;  3LNQ A;  4YC5 A;  1KK0 A;  5ILU A;  2Q0O A;  5HOD A;  1EP2 B;  2OK8 A;  2K4J A;  1JKP C;  1HKS A;  3OYA A;  3N90 A;  2OC6 A;  2PX9 A;  4KIC A;  3CCQ I;  5LD2 C;  3AVT A;  1P9Q C;  2KRH A;  3ERE D;  4HX7 A;  3ZMZ A;  1E64 A;  4CCJ A;  5F4M A;  1Z0X A;  4D0P A;  4PFO A;  5EDN A;  3CJN A;  2A68 F;  4ENJ A;  2A6T A;  4BXU A;  1VQ6 B;  3MKZ A;  3CCR I;  2X85 A;  3GF2 A;  4I0A A;  1XX5 A;  4L18 B;  2MH2 A;  5IT3 A;  1Q1V A;  3IC7 A;  3QFT A;  1BHE A;  2XKO A;  1XSX A;  2WY8 Q;  5E79 C;  3CO7 C;  5E17 F;  3KCC A;  1N06 A;  1OFE A;  1W0T A;  3EQL F;  3I59 A;  2EIN H;  1YJ9 I;  2V5I A;  2IPQ X;  1XGM A;  2V79 A;  3LWF A;  5CVI A;  2QTL A;  2PEC A;  3LSK A;  2UZK A;  4WZE A;  4UZF A;  3ZBT A;  2XTY A;  1BX1 A;  4P3I A;  1Q81 D;  3KL9 A;  1S7E A;  3JRE A;  3HAG A;  2Q1Z B;  4MNU A;  2R5Y A;  1K7A A;  3WNC A;  3WY9 A;  4HEA 2;  3VSL A;  1IRZ A;  3OAA A;  3EQO A;  2M4G A;  2E1C A;  5IYW A;  3C2H A;  5K7H A;  1T95 A;  3GLL A;  2DOE A;  2ZIT A;  4E7K A;  2WV0 A;  2XB0 X;  1FBQ A;  2QLZ A;  2F1M A;  5IYP A;  2FE3 A;  1Y6I A;  5A88 A;  1QCX A;  5D6F A;  5F0F A;  2D5V A;  3EYI A;  3BR3 A;  1I3A A;  4NHJ A;  5DV5 A;  3GEZ A;  1P4M A;  4UVC A;  2EIX A;  3AVX A;  2FJ1 A;  4CA0 A;  1H9G A;  2BOL A;  1RET A;  3WG9 A;  3FF5 A;  3JAM Z;  3TO6 A;  1F20 A;  5J40 A;  1OOC A;  2AO9 A;  2ZZQ A;  2JTV A;  1EH6 A;  1B72 B;  4LFU A;  1YLF A;  3VR6 A;  1BOA A;  1KK2 A;  1WH5 A;  2C78 A;  1J09 A;  4OOI A;  4DBR A;  4PAB A;  1JHF A;  3WGI A;  2GXB A;  4RMN A;  2BHY A;  1W5S A;  1R5N A;  3LYC A;  3W2A A;  1KYZ A;  1W34 A;  2M5W A;  1NH3 A;  1EFT A;  2LSO A;  3OJX A;  2LD5 A;  4Z4V A;  5DN6 A;  3DU6 A;  1TVC A;  4V19 K;  2DEU A;  4NCN A;  3K9T A;  4BXF A;  2PBI A;  2CMP A;  3LSJ A;  2ZJQ F;  4A3I J;  1O57 A;  3KEQ A;  5HNH A;  4QTR A;  1WTH D;  2VNI A;  3FY3 A;  3DF8 A;  4DJA A;  1O3Q A;  4LC0 A;  3J7Y J;  1JA1 A;  2C77 A;  1W36 C;  3C7J A;  3K4M A;  1FTZ A;  1KD1 D;  2RC4 A;  3T8T A;  3FXJ A;  2HFH A;  4LLN A;  1H89 C;  2P7V B;  4WQM A;  1MND A;  2JJ7 A;  3SJZ A;  1DPU A;  2KRF A;  1FSH A;  2GJK A;  3SKB A;  2KIU A;  3E20 A;  3QSY A;  1XPX A;  1XDS A;  4AD9 A;  1LVA A;  2NVY J;  4XN3 A;  2V9K A;  5C4X J;  1Y0U A;  4A3C J;  2XB5 A;  1FWZ A;  2PMD A;  1ZAR A;  1ZG1 A;  4G7Z F;  2HOT A;  3WGG A;  1A31 A;  2P3M A;  1EH8 A;  2LFB A;  3H3Z A;  5A8A A;  4C43 A;  1BN5 A;  3KEO A;  3ABK H;  2ME0 A;  4TMZ A;  2HNH A;  2LKX A;  2W24 A;  1KZL A;  1RMG A;  2NOJ B;  2V1X A;  3S3N A;  1O8F A;  1VQ9 I;  5ILV A;  3CD6 I;  2EV0 A;  2F6C A;  1M1E B;  2ZXJ A;  5KK1 A;  1PUF A;  3HM5 A;  1QVF B;  3I53 A;  1ETY A;  5DCM A;  3KLO A;  2TCT A;  3DPU A;  2VLA A;  4HX8 A;  3VOD A;  1FYM A;  2M7B A;  1OQY A;  5DTD A;  2PI0 A;  1X1A A;  5B6I A;  1S3J A;  5KAI C;  3RSN A;  2YSR A;  3GFI A;  3VO2 A;  2CUE A;  4A3G J;  4OIR F;  2EZL A;  5BSY A;  2NST A;  3BTI A;  1VQ4 B;  4UV8 A;  2DAO A;  2LH9 A;  3TED A;  1N07 A;  3ZQ7 A;  4KH3 A;  2VAS A;  5JVT A;  5AON A;  1ZEL A;  4FX0 A;  3JTG A;  1N77 A;  3ZMD A;  1RIO H;  2MA3 A;  3LQE A;  3BJO A;  1QGP A;  1EFR A;  2KJC A;  3OPO A;  4RAY A;  3PA1 A;  2A69 F;  3TGN A;  5H6R A;  2VKH A;  3RIR A;  4B3A A;  1TYW A;  2LF7 A;  2DY1 A;  5TV2 A;  1W36 D;  3CCM I;  2WZN A;  1YX3 A;  2KLO A;  1DDI A;  2CK3 A;  1HVX A;  2OPT A;  1D0X A;  2JRM A;  3IRR A;  5L3E A;  2E7W A;  3OYD A;  4B3F X;  2OBP A;  3NWS A;  4PGH A;  2HQN A;  2RQP A;  4G6D A;  3JQR A;  3OV8 A;  3MKW B;  3OL3 A;  4IRI A;  4ZYA A;  3D0S A;  3UNG C;  3AFH A;  1QA3 A;  2CU7 A;  2H1K A;  2CC2 A;  1TQI A;  3E6D A;  3DBR B;  4YFN F;  3NAR A;  1Q82 D;  1MMD A;  1WFX A;  2F43 A;  4YG2 F;  1QU3 A;  1VLO A;  1VJS A;  3T0Y A;  3FXM A;  3R6S A;  2ECB A;  1YIJ B;  2FX0 A;  3KLN A;  3WE3 A;  1D1N A;  3WTU C;  5FLV A;  5ERI A;  3FK7 A;  5IYR A;  2WZP P;  1M1K D;  1LLZ A;  5A2Q Z;  3I5U A;  4OPW A;  5JLX A;  1NTC A;  3RYP A;  1IJW C;  1FIP A;  3AVU A;  2QGU A;  1WP6 A;  2Q6O A;  4ENM A;  3V8L A;  2XRL A;  3CUQ C;  1MDM B;  3FXO A;  4A3M J;  3S2W A;  1Z05 A;  1E1R A;  2JA8 J;  5FNZ A;  1FC3 A;  4OPO A;  3OW7 A;  2W57 A;  3L2C A;  1HG8 A;  1X0C A;  2E1O A;  1ERD A;  3PUM A;  2V1N A;  4XL9 A;  3SLN A;  2NTP A;  4YZQ A;  3SEQ A;  3GO5 A;  1DG1 G;  1GUU A;  5JMC B;  1FDR A;  1COW A;  5FKN A;  4DZP A;  1LEB A;  3PSS A;  1XCV A;  2HR3 A;  3A1Y A;  3F3X A;  3IH4 A;  3A4C A;  2IT0 A;  5E20 A;  2XND A;  1VQO B;  1XDU A;  2RVC A;  2HZD A;  1D0Z A;  3KYD B;  3M3Y J;  2DFI A;  2HEO A;  3ZCO A;  5H59 A;  5LEK A;  2UXX A;  4LD5 A;  1K4S A;  5H6Q A;  4OWR B;  1ODD A;  5L3F A;  5DYM A;  1R4N B;  2PMZ N;  4HG2 A;  3EET A;  4BY7 J;  1R5G A;  2HYJ A;  1XMX A;  2R5Z B;  4TMV A;  4LMY A;  1I1S A;  2BGI A;  3CCS I;  4DOZ A;  1MAB A;  3CME B;  3O8H A;  3U21 A;  1DP3 A;  1OCR H;  2BVM A;  4HSR A;  4IHY A;  1WPK A;  3A1P A;  4P55 A;  2KDZ A;  2ZSI B;  1O8K A;  4HAM A;  4KIB A;  5THX A;  3LMW A;  4C2L A;  2P4W A;  1W0J A;  3VYT B;  4AU7 A;  5EF6 A;  3TH0 A;  5E3L A;  3WNB A;  4M3D A;  4UUT A;  3QFC A;  4I84 A;  2O04 A;  1SKY B;  4B43 A;  1ORK A;  2RGV A;  4ZDO A;  4U88 A;  1FOW A;  4IOA F;  1A6Q A;  2DIE A;  3W2H A;  2XF5 A;  2EIL H;  2CGP A;  2JIZ A;  4ENK A;  1Z67 A;  2CQX A;  1VQ9 B;  3BY2 A;  1XGO A;  4S04 A;  3ML3 A;  3LOC A;  1JXS A;  3TL4 X;  3RI4 A;  3JQQ A;  2XGD A;  3VSK A;  4JX6 A;  2K7L A;  1S72 B;  2R7Z J;  1UZC A;  5FLX Z;  2V6E A;  2IW5 A;  3S3M A;  1UG2 A;  4A5M A;  1WSR A;  2W7Z A;  2I5U A;  2VBY A;  4RCZ A;  4A2U A;  5JHF A;  2X0K A;  2DPD A;  4OIN F;  4L9N A;  4XSZ F;  3I0T A;  3CC2 B;  4BQA A;  2BY2 A;  1LKX A;  1JUP A;  2F5V A;  1D3Y A;  2XUB A;  4L9V A;  5D5W B;  4X0G A;  3CMA I;  5GAH J;  2ZBU A;  5H5J A;  3GYH X;  2X6X A;  1HBX G;  2G0E A;  4BPR A;  2GQQ A;  1VLY A;  2R6H A;  4PJ0 C;  5CVV A;  4AIK A;  1E3H A;  2DW4 A;  4HV6 A;  1DU6 A;  3A8K A;  1XE1 A;  2VZL A;  3L1P A;  1JJ2 B;  3CRZ A;  1T39 A;  4BDY A;  2K3F A;  2LKP A;  5DS9 A;  1T2K A;  4TMW A;  1OPC A;  4TT3 A;  5HLI A;  2CYY A;  3GTM J;  4Q48 A;  2E71 A;  4A3E J;  1B8I A;  4HF1 A;  4A3B J;  1Z91 A;  4RD0 A;  4Q47 A;  4XR6 A;  3QPH A;  3SLD A;  1Z3Y A;  3EUH C;  1O7L A;  2I8D A;  1YHQ I;  2BZT A;  3F8F A;  3ZQQ A;  3VO1 A;  3L2R A;  4NBQ A;  3DKX A;  4DYC A;  2O1D A; 
#chains in the Genus database with same CATH homology
 2K3P A;  4PJJ A;  2UUZ A;  3CP2 A;  4G6T B;  4U4B A;  4C2T A;  2VJJ A;  2DT7 B;  3IP4 B;  4BS9 A;  3H35 A;  3OYM A;  1O8D A;  3NE5 B;  1OGM X;  1X1C A;  2CUZ A;  4F93 B;  2LBF A;  4PK4 A;  2WBM A;  1IDJ A;  1OFM A;  4GQN A;  3OR2 C;  1O8E A;  2VB6 A;  1MMG A;  2L5Q A;  4Y4R A;  2ZTN A;  2V4J C;  1NBM A;  4B3G A;  2INU A;  2R7T A;  3JUR A;  4IQJ A;  2MFZ A;  3SZG A;  3S3O A;  1UD3 A;  3OL4 A;  2AQF A;  3AKZ A;  2BSP A;  4PMH A;  3TBI A;  2UVF A;  2FUG 2;  3HOT A;  2O5R A;  5HLT A;  1O8I A;  2M0M A;  2XSJ C;  2IS4 A;  4F52 A;  2VXD A;  3OYK A;  4AVZ A;  2R7O A;  3HG9 A;  2KZV A;  1PKV A;  1UD6 A;  3RPU D;  3BC9 A;  2X1E A;  2Z1D A;  1K6Y A;  1H8H A;  3VST A;  2VBM A;  4XKW A;  2XF7 A;  1BN8 A;  1O8H A;  5HKK A;  5IK2 A;  3L2Q A;  3CMM A;  2ZZF A;  3T51 B;  3S93 A;  3DTE A;  3PSF A;  4DK0 A;  4FAS D;  2HQA A;  4PJM A;  2VKD A;  2Z2S B;  2HPM A;  4BUP A;  3K4L A;  2E1M C;  2Z6B D;  3GVJ A;  3SEZ A;  3OEH A;  4XLF A;  3C2G A;  3GRH A;  3OYB A;  5LFA A;  3DPT A;  2X53 S;  2LC2 A;  1RU4 A;  2W1O A;  4QPO A;  4KKT A;  3ZRG A;  4LIV A;  4XOP A;  2LY1 A;  2IS6 A;  3S32 A;  1V0F A;  1Z21 A;  1O8M A;  2Q2E B;  1WJ5 A;  3G05 A;  3OE7 A;  2GOX B;  3GQ7 A;  4P22 A;  3CES A;  4JQF A;  1NHC A;  3A35 A;  3K70 D;  4HWV A;  3ZIA A;  2VBE A;  3H5N A;  3I9V 2;  4NC7 A;  4OJ5 A;  3A2K A;  3ZXS A;  3HOS A;  4EAT A;  1UD4 A;  1BMF A;  1LDK B;  5CKT A;  2X51 A;  1UEL B;  4J00 A;  2Y0S A;  3S8P A;  2ZSH B;  1UAA A;  2VJI A;  4C30 A;  4DGW B;  2V4D A;  3OEE A;  1DQU A;  3K6G A;  2WJY A;  2R7X A;  4Z1M A;  2M3A A;  3EQN A;  4W8Q A;  2W7N A;  1OLT A;  2D3L A;  3QOD A;  3H0D A;  4DIQ A;  1OR7 C;  4E6K G;  4BDZ A;  4ZTF A;  2RRE A;  1D1C A;  4ZDP A;  5HVQ C;  2XZO A;  2L9N A;  2DT6 A;  2QY1 A;  3CJR B;  1TZL A;  4KT6 A;  3OIQ A;  4C2U A;  3KEW A;  5FL7 A;  2XZL A;  3DU5 A;  3VYS B;  2HLD A;  2K9L A;  2L2O A;  1X1B A;  4MXN A;  4E7J A;  4NUB A;  2XGJ A;  2VQG A;  3L2V A;  1NRK A;  1SAU A;  4EW9 A;  1UG0 A;  2WAE A;  4BAC A;  1WPC A;  2O0W A;  2VJ5 A;  1O8J A;  4BQQ A;  4YEJ A;  3VMV A;  1DGR M;  4E7Z A;  3PL8 A;  2X3H A;  3LSH A;  2XOK A;  4JOM A;  3IAS 2;  1I8D A;  2JJ2 A;  3K70 C;  2X6W A;  3T9G A;  3VYR B;  3LSI A;  1WJF A;  1HZE A;  4ZDL A;  2W4S A;  3LMM A;  1E79 A;  3F9K A;  2PJR B;  4XLH A;  2KQR A;  4L8J A;  4UZU A;  3RTR A;  1VF7 A;  3K10 A;  2GK6 A;  3KEY A;  3LSM A;  1JI8 A;  4JMQ A;  3QYB A;  5CDF A;  3VMW A;  1EA3 A;  1UD5 A;  3DWL E;  3HUG B;  3H9Q A;  2KVO A;  3OS2 A;  2LY2 A;  4BE1 A;  1AIR A;  3IAM 2;  4N4O B;  3FDY A;  4OAY A;  2DCE A;  4BJT A;  3MD2 A;  2NT9 A;  4W8R A;  4YZ0 A;  2LOO A;  2RNG A;  3OOC A;  3D5R C;  2VQH A;  3K4B A;  3K4J A;  4CSW A;  2R7V A;  1JTA A;  4BJ6 C;  1EE6 A;  5CQE A;  4OZZ A;  4OZY A;  3PFY A;  2ELJ A;  2UWM A;  2E1B A;  4NK6 A;  1YE9 A;  2JSP A;  4GRI A;  5FRM A;  4QPQ A;  4XKV A;  2ZFU A;  4B3X A;  1DBG A;  4Y3O A;  2Z16 A;  2PYG A;  4KKU A;  1O8L A;  4D9J A;  4D1Q A;  1WJE A;  2L7K A;  3PNV A;  2ZZE A;  3NWT A;  1BOB A;  1X4O A;  3OOU A;  2JVG A;  3DEE A;  2XAU A;  5KCM A;  5KNL A;  4PFP A;  4XMY A;  2BW3 A;  1RWR A;  3I3L A;  3HPG A;  2KMU A;  4BE0 A;  4PJN A;  4YXW A;  3GQB A;  1FMV A;  1D1B A;  4XOT A;  1H8E A;  3BC8 A;  2WY7 Q;  2WAQ A;  2NTB A;  4CUG A;  2XDV A;  1MNE A;  1V5G A;  3OWT A;  2E5Z A;  3W2W A;  2LZJ A;  1E1Q A;  2M5S A;  4OJP A;  1Z3X A;  1X19 A;  3DDY A;  3ZSC A;  3OS1 A;  2QKL B;  4DNT B;  2W6I A;  3BCB A;  3OYA A;  4DK1 A;  2OC6 A;  4RM3 A;  5LD2 C;  3HC7 A;  3DTK A;  4B44 A;  2CS3 A;  1MW7 A;  1P9Q C;  2KRH A;  1R6R A;  3LSG A;  1TT0 A;  4MLO A;  4CCJ A;  3FKJ A;  4PFO A;  1XG2 A;  3VYU B;  2A6T A;  3OY9 A;  3B90 A;  3MKZ A;  3ONQ A;  3BCF A;  2X85 A;  2LBF B;  2CFO A;  1DGW Y;  2JJ1 A;  2IGM A;  3E1S A;  1BHE A;  4RM2 A;  2WY8 Q;  3PUB A;  4NC8 A;  4ZC3 A;  1KTW A;  4OJO A;  4YZA A;  1VZ0 A;  2ZXH A;  2WB1 A;  2HPI A;  4H4K C;  4Y33 A;  1D0Y A;  2R9V A;  4BQN A;  3CP8 A;  4KIT B;  2PEC A;  3LSK A;  2INV A;  4E7I A;  1KCD A;  3N05 A;  1E3X A;  2KL4 A;  1GLN A;  3HAG A;  4XOR A;  4BEH A;  2Q1Z B;  1GQ8 A;  2VXZ A;  4HEA 2;  3VSL A;  4ASU A;  2OV7 A;  3OR1 C;  3OAA A;  2VJ4 A;  3EQO A;  2KRC A;  2M4G A;  4KJZ A;  3W3C A;  2XC7 A;  3PNT A;  1BLI A;  3C2H A;  1Z7L A;  4XLE A;  2IXS A;  4IZZ A;  1V5F A;  1E43 A;  2P0W A;  1T95 A;  2LRE A;  3DKY A;  4E7K A;  3BG6 A;  2F1M A;  4Z05 A;  1QCX A;  1Y6I A;  3BLY A;  4HST A;  4DNR B;  4BGD A;  1IB4 A;  2IGN A;  1BR1 A;  3A3G A;  3ZR8 X;  1LFP A;  2LG4 A;  2BOL A;  3ZGK A;  4CA0 A;  4CCO A;  1UD8 A;  2W00 A;  2V7F A;  3H9J A;  3RCO A;  1VBL A;  2MD0 A;  2JA2 A;  2IGK A;  4NNJ A;  2E60 A;  1OOC A;  3D5L A;  2CW8 A;  2ZZQ A;  3BH4 A;  4PJL A;  4HNT A;  3VR6 A;  1J09 A;  3HPH A;  4DBR A;  3HXL A;  3JU4 A;  1QJV A;  4LIU A;  3M8J A;  4RMN A;  3HKZ A;  3KRG A;  4URR A;  3FHN A;  1PJR A;  3W2A A;  1S9H A;  4OJ6 A;  2R7U A;  1KON A;  2GJR A;  2E1M B;  5DN6 A;  3DU6 A;  2MAB A;  4HIZ A;  2VQC A;  4BXF A;  3FPP A;  3BG7 A;  2CMP A;  2E5N A;  1T5E A;  2VBK A;  1FX0 A;  5HNH A;  1WTH D;  3FY3 A;  4DJA A;  3IUO A;  2HVQ A;  4PSW A;  1W36 C;  2WSS A;  3K4M A;  2KDO A;  4R79 A;  3OYN A;  1DBO A;  5CPR B;  4BE2 A;  4RLQ A;  2O17 A;  2QX3 A;  3H5A A;  3FBN B;  1MND A;  4N4N B;  4F91 B;  1OHH A;  4G7X A;  2W82 A;  1WMR A;  2HVR A;  2F4I A;  3VSU A;  2GJK A;  4FXU A;  3OFN A;  1PYV A;  4U87 A;  3DTI A;  4XN3 A;  2V9K A;  1T0F C;  2KP6 A;  3K4K A;  3RQ4 A;  1O88 A;  2V26 A;  1O8G A;  4RLF A;  4Z06 A;  3CJQ B;  5AMV A;  4HNU A;  4IKF A;  2MYS A;  3EUK L;  2CUJ A;  1BR2 A;  1JRG A;  4Z03 A;  2RQQ A;  4IX7 A;  3PSI A;  3GQA A;  2HNH A;  3G2B A;  3VDX A;  1KZL A;  3AL0 B;  2NOJ B;  1RMG A;  4YZX A;  3S3N A;  1O8F A;  1LVK A;  3ZPP A;  1D1A A;  2LYC A;  2F6C A;  4LG3 A;  1FMW A;  2MC4 A;  4II3 A;  4MR0 A;  4CCK A;  3DPU A;  2VLA A;  1HA8 A;  4XN0 A;  2AQE A;  2M7B A;  1X1A A;  2OUM A;  3RSN A;  1SFK A;  2WAD A;  3AL0 C;  1IRX A;  2NST A;  3A3B A;  2NT6 A;  2LH9 A;  2ZZG A;  1NG7 A;  3ZPN A;  2VAS A;  1ZEL A;  1QHG A;  3DLA A;  2CH0 A;  1N77 A;  1N78 A;  4XQF A;  3OS0 A;  3L2U A;  3WWG A;  1EFR A;  3OPO A;  4BJ5 C;  1PXZ A;  1WJD A;  2HVS A;  2V31 A;  2VKH A;  4W8T A;  4B47 A;  3FKS A;  4PUS A;  3K4C A;  4IQ4 A;  3HL2 A;  1W36 D;  1MMA A;  3OYG A;  1W9X A;  4OAZ A;  4G7W A;  1YX3 A;  2BVL A;  2KLO A;  3DQV C;  2ZXI A;  2CK3 A;  1HVX A;  1WJC A;  3QOE A;  3TMO A;  1K28 D;  1D0X A;  2KHM A;  3SYT A;  4J01 A;  1K5C A;  2K9M A;  3OYD A;  4XLC A;  3H9G A;  4B3F X;  3NWS A;  4E7L A;  3MKY B;  3SUC A;  1X1D A;  3PJR A;  3GVK A;  2DJI A;  3MKW B;  3OL3 A;  4ZYA A;  2NTQ A;  3UNG C;  2O0V A;  2JVH A;  3AFH A;  1OFL A;  3OYH A;  2X1C A;  1MMN A;  2BW3 B;  3OYC A;  3H5R A;  5CQG A;  1MMD A;  1WFX A;  2F43 A;  1U0J A;  1QU3 A;  3PNY A;  1VJS A;  4BEH B;  2X8K A;  3VSV A;  2GOM A;  2JUG A;  3EUA A;  4LIT A;  5TGT A;  3VWB A;  2IS2 A;  2EWE A;  4G6I A;  3EPZ A;  3T53 B;  3CF2 A;  4XKC A;  2PMZ A;  2WZP P;  5FRO A;  4ZTJ A;  2UV1 A;  4CH7 A;  1Y56 A;  5KHD A;  3T56 B;  3E0J B;  1WP6 A;  2X6Y A;  2DOA A;  1KCC A;  1E1R A;  3QYF A;  3OW7 A;  5FRN A;  1V5E A;  2LRD A;  1HG8 A;  1X0C A;  1X4P A;  1ERD A;  2V1N A;  3KX2 A;  4XL9 A;  2NTP A;  2UVE A;  3SEQ A;  4F92 B;  2R7S A;  2R4G A;  4YZQ A;  1OGO X;  2D3N A;  2CW7 A;  4YRV A;  1COW A;  4C9Y A;  3FBI B;  3OIP A;  1WJB A;  3LL7 A;  3A1Y A;  4E7H A;  2CV1 A;  2XND A;  3A4C A;  4AYB A;  1BPL A;  1E0E A;  4NQW B;  2A5W A;  2HZD A;  1D0Z A;  3BCA A;  3MMY B;  2WAF A;  3ZCO A;  1I18 A;  2IGO A;  2V7Q A;  2PYH A;  4OWR B;  3SDB A;  4HG2 A;  2IS1 A;  1OB0 A;  2QXZ A;  4KKS A;  4KIS A;  1V0E A;  3OMY A;  2CV0 A;  4XD7 A;  1NG6 A;  4P5O A;  2WPD A;  4U7B A;  4DOZ A;  1MAB A;  5HNF A;  3BCD A;  4E7S A;  3WQZ A;  3U21 A;  2VIX A;  1DP3 A;  4E4H A;  2WJV A;  2BVM A;  4HSR A;  2WA0 A;  4CCN A;  3DPL C;  2QE7 A;  4ANJ A;  1O8K A;  2ZSI B;  2JDI A;  4YEL A;  3LMW A;  4C2L A;  2X1D A;  4BQO A;  1W0J A;  3VYT B;  4AU7 A;  1CZF A;  2Z8G A;  4W8S A;  1G59 A;  4XM3 A;  2IQ7 A;  2KPM A;  4BU2 A;  2M7A A;  2R7Q A;  4FET A;  3QYE A;  1BR4 A;  5HOO A;  4HRI A;  4XLA A;  1PE9 A;  3B4N A;  4TKO B;  4I84 A;  2O04 A;  1SKY B;  3LFU A;  4B43 A;  3W2V A;  1AA7 A;  3L2W A;  2ODL A;  1WJA A;  4XKB A;  4XON A;  2VPL A;  4ZDO A;  3GVL A;  4HPQ A;  2DIE A;  2XF5 A;  4U49 A;  2JIZ A;  4NK8 A;  3OYL A;  1QHH D;  3OYE A;  3TL4 X;  4II2 A;  2R7R A;  5C1C A;  3VSK A;  4PSX A;  1H80 A;  1N75 A;  3OYF A;  3S3M A;  2V6E A;  4TSF A;  2NSP A;  5C1E A;  1YX5 A;  2K5C A;  4CCL A;  2GK7 A;  2CV2 A;  5JHF A;  3OYI A;  1IA5 A;  1KMH A;  2W6J A;  3H94 A;  1G8X A;  3K4N A;  3V42 A;  3M1C A;  3UR3 C;  4B48 A;  1LKX A;  4DBQ A;  2F5V A;  4F3Q A;  2ZTG A;  4X0G A;  3GQ9 A;  4E0F A;  2XF6 A;  2HU9 A;  3B8Y A;  2X6X A;  2DXI A;  1VLY A;  2QKM B;  1IDK A;  2VQL A;  3D5S C;  2PJR A;  4ZJZ A;  4XNF A;  3GBG A;  4BDY A;  1PLU A;  3J7A Y;  3CZ6 A;  2R7W A;  4TT3 A;  3UW0 A;  4CZC A;  3GQ8 A;  2NZM A;  4XR6 A;  2L9S A;  1E3Z A;  2XZP A;  2M4K A;  1Z3Y A;  3EUH C;  3OYJ A;  1UD2 A;  2I8D A;  4BL0 B;  3ZQQ A;  3LNN A;  3L2R A;  2HDW A;  3KYL A;  4P1W A;  4F55 A;  4ITV A;  1W0K A;  2GJP A;  4CCM A;  4OJL A;  2VL8 A;  3DKX A;  2O1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...