2X6XA

Tailspike protein mutant d339n of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE PROTEIN HK620
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 235
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6xA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6xA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6xA02
2VBKA 3EQOA 2NTBA 2ODLA 4XQFA 1DBGA 4OJOA 4YEJA 1IDJA 2VJJA 4U4BA 1RMGA 4XMYA 1RWRA 4XONA 2BSPA 4XKVA 4W8RA 4C2LA 4XN3A 4XOPA 1O88A 2UVFA 4YZAA 1PXZA 4XLFA 2NTQA 2Z8GA 1O8FA 2VJIA 2O0WA 2X3HA 3B90A 3KRGA 2IQ7A 4NK6A 1BHEA 2PECA 4XL9A 3VSTA 3GQ8A 4OZYA 4XNFA 1X0CA 4YZQA 2PYGA 1IB4A 4W8QA 4XOTA 4EW9A 3EQNA 1PE9A 4XLEA 1H80A 3VMWA 3B4NA 3GQ9A 1QCXA 4YZ0A 1WMRA 3T9GA 3GQ7A 1OGMX 2O04A 1PLUA 2QY1A 2X85A 3WWGA 4XLAA 1DBOA 1JRGA 4AVZA 1EE6A 1XG2A 4W8TA 4NK8A 4OZZA 1O8MA 4YELA 2EWEA 1QJVA 2X6XA 4MXNA 2QXZA 1O8IA 3B8YA 2X6WA 4U49A 4MR0A 3VSVA 2QX3A 2NTPA 1O8JA 1IA5A 3ZSCA 3JURA 4I84A 1HG8A 1IDKA 4XN0A 1VBLA 1O8EA 2O0VA 2NT9A 4XR6A 1CZFA 1OOCA 2NT6A 1O8LA 1RU4A 4OJ6A 1OFMA 2X6YA 3FY3A 1O8KA 3LMWA 4W8SA 4OJPA 4YZXA 4URRA 4XKWA 4OJLA 1O8HA 2NSTA 4XLCA 5AMVA 4Z06A 1O8DA 1BN8A 5C1CA 1GQ8A 1JTAA 4XORA 1AIRA 3VSUA 2VBMA 2UVEA 2O17A 1KCCA 2O1DA 4OJ5A 1NHCA 3GRHA 4Z03A 1KTWA 2PYHA 2NZMA 5C1EA 3ZPPA 4XLHA 4XM3A 1KCDA 3VMVA 4Z05A 2INUA 2VBEA 4PMHA 3SUCA 2INVA 1OFLA 2NSPA 3GQAA 3UW0A 1K5CA 4HWVA 1OGOX 1O8GA
chains in the Genus database with same CATH superfamily
4M6XA 4EQQA 3TO6A 2HZDA 3ZQHA 4YEJA 2QZAA 4DZJA 3HOTA 2KIQA 5E6TA 2Z99A 3GMEA 1H9GA 2VJJA 5K5OA 4BACA 2R7XA 1HZEA 5CDFA 4KYWA 4G8XA 2RV8A 4Z4TA 1D0YA 4IO9F 1ZLJA 1WP6A 4WX9A 1LE8B 1N0UA 5IYPA 2K9SA 3CZ6A 2XZOA 3CCEB 3MVPA 3DXJF 1S3JA 3BY2A 3TGNA 5IOYA 3W2WA 3HOUJ 4TN1A 1HCRA 1N78A 3AVTA 2QZ8A 5JHUA 1X0CA 1FTTA 4BXUA 2B7BA 1EH8A 5D5VB 3HRMA 3ZCOA 2LF8A 4CCNA 4KN7X 1E1RA 2M0CA 3ZQ7A 3T9GA 2F5DA 3NEUA 4XRSG 1E2XA 3IUOA 2IPQX 5DNSA 2E1OA 2WAEA 4L9TA 4AVZA 4J01A 3DTKA 4S04A 2NOJB 2E2IJ 1KQSB 3DTEA 1QHGA 2ID3A 1QJVA 1BW6A 5FIUA 4EM0B 3SYTA 2C77A 1VTNC 3ZQIA 3LMMA 1SANA 2EFQA 4E7HA 2A5WA 2K40A 4CZCA 2VB6A 4A3IJ 1AHDP 2WYRA 1OCPA 3L2WA 3RKQA 3OP1A 1RETA 3HOZJ 3BLYA 2K3PA 3JURA 3LA3A 2XAQA 4RAZA 2XF5A 3QWLA 2F4NA 3DQVC 2LREA 2X0LA 4ANJA 2DYSH 2QQAA 4KUMA 2BV3A 2E1NA 5BPIA 2JUCA 2CS3A 3LSTA 3A1PA 2VNHA 4X8IA 1OPCA 3S2HJ 1CNEA 3R4KA 5LRSA 3FISA 3HOYJ 1RPWA 2BXYA 4ZGNB 3FF5A 2LP0A 3HGGA 1YHQI 3G1LA 2Y30A 3LSJA 2XGEA 5EGOB 5F27A 3ZZUA 4NB5A 1QX4A 2F4IA 2GXGA 1I18A 4B1RA 4UUVA 3M8EA 3WU2C 1W0JA 2NSTA 3KEYA 3NRVA 2G0YA 1O8DA 3B02A 2B5OA 1UFMA 2CUEA 2HDWA 3OS2A 3NE5B 3DU1X 4P1WA 3S93A 2JSPA 4CO8A 4D7NA 5C1CA 4M74A 1LVKA 4Z4ZA 1REPC 2HLDA 3K1NA 1VQOI 3VSUA 2C4UA 5J1YA 2CC2A 3H92A 3JQPA 1B59A 4M3GA 1W9XA 1R6RA 4IHYA 1GVHA 3V8KA 1TVCA 5FO5A 2CNDA 4U0WA 5EF6A 3GTOJ 3FXJA 4KN4X 1VHEA 4OOIA 1FBUA 3MQ0A 2FQ4A 1KCDA 4DK1A 3ASRA 4Z05A 3JR9A 4KIBA 1IV6A 4UXNA 2X8KA 2VBEA 1BX0A 3A1YA 3N05A 3FK7A 4NQWB 3I55I 2XC1A 4YAUA 1HXDA 4A5MA 4HF2A 4P55A 5LGNA 5GTHC 3IRQA 5KSWB 1TYVA 3W6VA 3Q0WA 3BG9A 1RESA 4LIVA 3OYNA 2BMWA 2VODA 1QH0A 1VQ7B 1EKEA 5EZGA 4KKUA 3TP0A 1B2RA 2XC7A 1D1BA 1FBQA 1NK2P 3AK5A 3T5XA 3Q5FA 1XB2A 2ZTNA 4U4BA 1TNSA 5CYVA 2R5YA 1VQMB 2OZUA 5LD2C 1S6LA 2ZJ2A 3RZDJ 3HDDA 1FNDA 4A6EA 1GAQA 2J8IA 4RAGA 4B3GA 2CV1A 4XSZF 2XF7A 3JCUC 1ETQA 2DCEA 4L5IA 1OYYA 3CQZJ 3B90A 1TQPA 1GVJA 2M9HA 2GLOA 4KIFA 3K1PA 4J00A 1MBJA 4HNUA 1BQEA 4G1BA 1S7OA 4XL9A 3I9V2 2JN9A 4RB2C 2VPRA 3ZQQA 5FLXZ 2VYQA 3CUQA 4W97A 4I99C 1BX1A 1PJ7A 2XGJA 1XSVA 4M9SA 3TBIA 4YHBA 2ID6A 2MLGA 1BI3A 1J0RA 1WSRA 3LNNA 1KQ8A 1Q9SA 4TT3A 4R79A 2G7HA 3CCVB 3FMRA 1JKPC 3GVKA 2L3DA 4M2LA 3ZGKA 1WORA 3WHCA 5J47A 4A3JJ 3BCAA 4Y17A 5DCMA 3O8HA 3TW7A 4YC5A 2X6OA 1JRGA 2VFNA 2CRGA 1D1NA 3TEDA 4OZZA 1ERDA 2PMHA 2YWEA 1GJRA 2X6XA 1CNFA 4X0CA 1HDDC 4KISA 4FTHA 4U49A 1WI9A 1VF9A 2VNIA 2YU3A 3RPUD 2XPWA 4ETSA 3AL0C 4IX7A 3F8CA 2HOEA 2A68F 3LNQA 2F5EA 3AGPA 3GWZA 1F36A 5FB2A 1O8EA 1LNWA 3VB2A 1HSJA 4LOCA 2OAZA 1S7EA 2QQ9A 2R7WA 1OGJA 4KKTA 1Y56A 2Y0SN 2H1LA 3JRGA 3BR2A 2R7ZJ 3MHPA 5CVRA 3C2HA 4MEYF 2DI3A 3LAPA 2WY7Q 4II2A 3E6CC 4BE2A 2DN0A 1YJWI 5DN6A 2LD5A 1MW7A 4Q5SF 3R0AA 3CC2I 1LLZA 1XB4A 2NV4A 2E71A 4RLQA 3CCQB 1WJDA 2R5ZB 4RB1A 2ZCWA 3V8JA 4OOXA 3KP7A 4XKWA 2LY1A 3A8KA 4TMXA 3ZBTA 5HZBA 1R23A 1R4NB 2YX7A 1A31A 2DETA 2J5PA 4RGUA 1BJZA 1WXRA 5JI6A 2CV2A 1KJZA 3HOSA 4LBVA 2YSRA 1RKWA 4HZFA 3D5SC 2LR8A 2BF4A 3ZPLA 2IA0A 1R1VA 1ETYA 2LZJA 1TWFJ 1X2NA 4ZZDA 1VQ4I 1FNCA 4C2UA 3WG9A 1NG6A 2DA7A 3AVXA 1IW7F 1Q7YD 2UVEA 2XT2A 4BY7J 4IQJA 1NTCA 2CJJA 4QSHA 3VSLA 1OCTC 2KZVA 4N3GA 1OFCX 2R3SA 3K4CA 4PAAA 3RTRA 1P2FA 3NWTA 3SZTA 4K1XA 4G12A 1JHHA 2E2JJ 3OYEA 3W2VA 2V7QA 5CVJA 4UV8A 2OTLB 5JLWA 3LQQA 3WU0A 3WHBA 2YWHA 2O61A 1OGOX 2G7UA 2BVMA 3VYTB 5GPCA 3M8FA 3ONUA 1G7CA 3ASTA 1HKTA 2C5BA 1ZQ3P 5JR3A 5L3EA 1JKOC 1Z91A 3ABKH 3DBLB 2XAHA 4JX5A 2BYVE 3NAWA 2W84A 4V02C 1WCMJ 2F48A 2VQCA 1TL8A 2EZIA 3DBRB 1SAXA 4YIIA 4XN3A 2DQRA 5HDKA 1FWZA 2RREA 3E20A 2H27A 2CUZA 3S17J 4OP7A 3G6EB 1U5TC 3K10A 5J8FA 5IK2A 2OCEA 3GQ8A 2V7TA 4PK4A 5LGTA 2R7UA 2COMA 3SZPA 1O3RA 5H20A 3ZMTA 1DG1G 4Z4SA 3HUGA 3BQZA 2PYGA 5HS7A 1X4PA 1WWXA 1RZ4A 2M87A 3G1OA 3WTYC 1BLIA 3EQNA 3LJYA 1FSHA 4ZZLA 1JTYA 1YITB 1TYXA 3GQ9A 2NXNB 3ZMSA 3CUOA 5BPDA 3COAC 1EJ9A 2MH9A 5CJ9A 1MSEC 3CB4A 3SJPA 3GFMA 4HF0A 2CV0A 4MTEA 2XB5A 1AWCA 1X3WB 2JMWA 4CYCA 4LLNA 2R92J 1MKMA 3HGYA 3J7AY 2V6CA 2Q6LA 2V9VA 4I76A 4TMTA 1OQYA 1UMQA 4KDPA 2JA8J 1IHMA 1VF7A 3DKXA 2Y0MA 1NBMA 2DMUA 5JLXA 3CCRI 1MABA 2E36A 2H6BA 3F9KA 3S15J 3ZSCA 3BH6B 5J6XA 1V0EA 1KYZA 1FX0A 1IDKA 3M9AA 4CYDA 1G3SA 2K5CA 1R58A 1YJ9B 3Q3AA 4LBWA 4GRIA 4G6DA 1BIBA 3OJXA 3O6BB 2VBXA 5FLXK 3QFSA 2EILH 2CQNA 4RDUA 3MZHA 2AXLA 4KMUX 3MZYA 1CF7B 2CRVA 3SYJA 2IVMA 3BJ6A 3A35A 5ICGA 5KAFC 1FJLA 3IH2A 3ML3A 1BI2A 3FM3A 3D1NI 1VQPB 4OJLA 1X2MA 1QZEA 2Y75A 2MD5A 4E0FA 3DWLE 3DF8A 3TO9A 1OGIA 1BN8A 2C5HA 4FE4A 4YFKF 3I54A 2O9LA 5DD8A 2QENA 3PSIA 2QDXA 3OKXA 3HKZN 1T0FC 2YWGA 3WTUC 3KEOA 2CUFA 2HQRA 2M5SA 4LC0A 1EA0A 3SJMA 4HW0A 1USSA 1ZKGA 2BM7A 2Y0SA 4BQNA 2V31A 2EWNA 4A12A 5DD4A 4RB0A 1BBYA 3JRHA 2QQ8A 4HE5A 3ZPPA 3OIQA 4C9YA 2QM3A 4IRGA 2XTWA 2CO5A 3CC2B 2IP2A 3GVAA 2DJIA 4ENJA 2EA4A 1EA3A 1QRBA 3GQAA 3BG3A 3MN2A 5FLVA 2XROA 4RGXA 4XD7A 2QA4B 3LFKA 1QPMA 4H4KC 3R0JA 2AHQA 2QE7A 5EG0A 3S2DJ 4ZDOA 3ABLH 1R22A 4KJZA 3CLOA 3VOEA 1R5HA 4BYYA 2JA5J 1QFYA 1EP1B 2KHMA 3D0SA 3K4JA 3R6KA 3LYCA 4HEA2 1G6NA 1LFBA 3LL7A 5DCFA 1VQ4B 4ZH4F 4XRSA 4MQVA 1VQ5I 1MBEA 3WE2A 2EB7A 4XOPA 1R36A 2DTRA 2E5ZA 2ELJA 2YR2A 4RGRA 5HS9A 3CXCB 3TDZC 2F2EA 4RB3C 3CCLB 4H0EA 2IGMA 4QPOA 4UAJA 3KRGA 2HR3A 1Z77A 4OWRB 3L1PA 4KITB 2LKXA 2DMNA 3E7LA 5B66C 1W0UA 2E2HJ 1H85A 2OTJB 2FD5A 3FWEA 2PQ8A 4OU0A 2DK8A 2Z33A 2X9DA 2BY2A 3M07A 1E1QA 3CD6B 1D5VA 2LTPA 3GW2A 1O7FA 1EFTA 2W48A 3MFKA 1Z3XA 5JLVC 4X7DA 1PP7U 5KK1A 1LM1A 2F4OB 1AKHA 3DCFA 1WPCA 4AF6A 2XEXA 5BSXA 2CQQA 3R61A 2A61A 4EMSA 5ED4A 3OYLA 2DTZA 1FP2A 2XSJC 3QQAA 4BPRA 2VNKA 3L00A 2ZC2A 2QY1A 1UD4A 2GXAA 4ZC3A 3J7YJ 1FOYA 3R60A 4IQ4A 4M6YA 3BY6A 4DGWB 4D9JA 2L7ZA 1ZRDA 3FIWA 3Q6RA 2IW5A 4Z4RA 2EWEA 1QO0D 4UVAA 4OPOA 2OC6A 2HYGD 2PN6A 3RDIA 2BY1A 1NK3P 4QV2A 2X6WA 3CMEI 1S5LC 2TRTA 2FJ1A 1IJEA 2QX3A 3CPWB 2LYCA 1IGNA 2B7EA 3LA7A 5E3OA 1QRCA 5EMNA 4BE0A 2V7VA 1BOBA 2IXSA 3GTQJ 2O6WA 2DA4A 3BOQA 5DDGA 2ISZA 2OBPA 1U5TA 1WOPA 4RJLA 2EPFA 2OQRA 1FRNA 3HPGA 1HKSA 4P3YA 4Y13A 3HTSB 5J4VA 3WNCA 5ILVA 3BZ6A 2JJ2A 4V2FA 4BKXA 2E1MB 5C3EJ 3QFCA 3OL4A 2VBZA 4E6KG 1DU0A 4M9XA 2QSGX 2XGCA 1WH7A 4M72A 3KZIC 1YX2A 2ISYA 4YFXF 4A3KJ 4BY1J 4KMFA 5B1BH 3BCDA 1ZN2A 2XUBA 1LDJA 3GFLA 3VO1A 4M9ZA 2MLKA 2KJCA 2W57A 2QTLA 3K6GA 3HSFA 1MSFC 1R5GA 3CCRB 3PUNA 1EZGA 2V5IA 3W6KB 3TW6A 2NVYJ 4GFBA 4OMYA 1K8FA 1GDTA 4L8JA 1LKXA 3BTIA 2GOMA 2IBDA 1DARA 1QA2A 4HSTA 1T6SA 1JI8A 4OJ5A 4QWQA 4LIUA 4OM9A 3ZQFA 4B4DA 5TRDA 2ECBA 3OWTA 2A5YB 3L2RA 2VFOA 2GWRA 1B9NA 5IYWA 2INUA 2E5NA 1MBGA 3SUCA 3OS0A 1OFLA 3EETA 2RNGA 3O2PE 3JQQA 3ASNH 3LSKA 1X1AA 4IHVA 3I53A 4AWXB 4E7KA 1W2BB 5JMCB 2QSFX 2KMUA 5E3LA 4Y3OA 5FJ8J 3OYBA 2HI3A 2C6YA 2FOKA 5CVIA 2IGNA 4F92B 1XX5A 2I1LA 1K28D 2L0KA 3FHZA 2Q6IA 4XICA 4MQ9F 2OYNA 3BPXA 5JHFA 1YI2I 3TOBA 3PNVA 4TKOB 4RAYA 1QRYA 2R5YB 1ZG1A 1T0FA 3BP8A 2O0WA 2ICWG 2IOUG 4RM2A 2WADA 2V7WA 3ZR8X 1IDZA 4LG0B 1EFRA 4GGGA 4MLOA 2OPTA 1MBKA 1O7LA 1KU7A 2VUMJ 4RD2A 1W5TA 2QSHX 1U2RA 4YZQA 5A2QZ 2F6CA 1MJBA 3AAFA 1RKTA 2BM6A 2EV0A 5ILSA 5IY5H 4NCNA 3ABUA 2GIVA 2KLOA 3CUQB 1WDTA 3EUKL 2KRCA 5LEKA 1MMAA 4ZV4A 1R49A 3L09A 1EF4A 1V5EA 2K7LA 5ICEA 1VQNB 1H0MA 3GQ7A 2M1BA 1I6XA 2O04A 3FXKA 3NAUA 2Q6KA 3QFTA 3GUDA 1TWHJ 3SLDA 1Z3YA 1VQ5B 3ISXA 1CLWA 3BDDA 1VNDA 3C1DA 4CZZA 4Y7NJ 4HBLA 3CCSB 2GA2A 4EEFG 3ZP5A 2R0QC 2NVQJ 4NK8A 2JA7J 3KFWX 2LY9A 3JREA 5DCMB 5K7ZA 5HKKA 3GYHX 4MTDA 1P7JA 2W82A 4U87A 1SFXA 2LOOA 3VSVA 1E79A 3NQOA 1RNLA 4E7IA 1O8JA 2O0YA 4LFUA 4PGOA 2WJYA 2Y69H 5IYCJ 1LJ9A 2HQAA 3REOA 3WTVC 3CTAA 4C3IJ 2NT9A 3H09A 4RS8A 1PUFB 1XD7A 2ZBKA 5BOXA 2JA6J 2A6HF 1S7AA 2QGGA 2M45A 1HDPA 4AD9A 4YALA 4ACBA 2PX9A 4WWVA 2MABA 2L54A 5HLTA 3MZ8A 5CQEA 1GXPA 2CBXA 4URRA 3B8HA 2BGIA 3T0YA 1QQIA 1L0OC 2L7FP 1HW5A 3HZJA 1WQ2A 4Q48A 1V55H 1WJEA 5CLSA 3F8MA 1I39A 2GAUA 5IP6A 3FXRA 1TQIA 3U9GA 2HFHA 4BDYA 4MO7A 1BW5A 1YLFA 2LKSA 5KCMA 3GFJA 5J8CA 1QGPA 1APLC 4P12A 1MGTA 5AN9A 1JGSA 2O17A 2AO9A 2RDPA 2O1DA 1W5SA 5LGUA 3WYAA 3QYEA 2J5OA 2HXIA 4FETA 5J1UA 1MH4A 4TSFA 4MIMA 4ZYEA 3AVYA 4CGZA 4E4HA 1OCOH 1XGOA 5ICFA 1OYIA 3PVDA 3ZMDA 3LSIA 1S0UA 1YIJB 1XMAA 2QYOA 2Z16A 1WJFA 1D0XA 3GLLA 5LLQA 4XLPF 4E7JA 3OSGA 4QIWN 4HWVA 3ASOH 2RVCA 4B8XA 2RC4A 5HDGA 1JA0A 3KZZA 1P9QC 5D5UB 1UHMA 3H0DA 1IXSB 1KQ9A 2E19A 2V7FA 5L3DA 4ZCIA 1RMGA 1VQ8I 1RWRA 1JXSA 2DCUA 4HDUA 5CKTA 2BSPA 1FNBA 3IWFA 4P5OA 2R7OA 2Y48A 3AG4H 4JMQA 5DSZA 2UVFA 4KNYA 2BHYA 5EYRA 3RZOJ 5THXA 3CJNA 3I56B 5F0FA 3BTCA 2IQ7A 3DBHB 1ETOA 3QYBA 1Z1DA 1UAAA 1VQKI 4NK6A 3H3UA 4M6VA 3AG2H 1LEBA 1TTYA 2R93J 3H5NA 4FHTA 5BQTA 2D3LA 2VOPA 4OOSA 2RC6A 4EGZA 4EVIA 4RDLA 2YWFA 1G7SA 2CQKA 4MFEA 2LG4A 3EYYA 2V1NA 1QA1A 1G3YA 1I3AA 3L9FA 3V7CA 2YU9J 2QYUA 5EZHA 2JZYA 1PYVA 1AIPA 4WXCA 1J7KA 1Y1VJ 3H3ZA 3FK6A 2ZL6A 1QCXA 4YZ0A 2L9NA 2K86A 2XZPA 3BH7B 1MJ9A 1OGMX 2ZMEC 2WC2A 2L02A 3ZZ0A 1RIOH 3ESWB 3MKZA 3IV5A 2M5WA 1EE6A 1EFUA 4X0GA 3G3ZA 4ZYHA 1B72B 4CYCB 1LFUP 4MXNA 4TMVA 1ENHA 2H8RA 4CCMA 2QLZA 2FVGA 2P0WA 2ZJPF 1IN4A 2O8XA 4OIPF 2KDOA 4BUPA 3H94A 2V1DA 1TSPA 2WBMA 3CMMA 4A69C 2ZL5A 1A5JA 5F4MA 3VFZA 1IJFA 1RQPA 4ZYAA 1SD6A 4JRAC 1VQ6B 3P9CA 1VI0A 1IB4A 2CW8A 4CCKA 3Q0UA 3CMYA 1QFZA 1Q81D 2D9RA 5A2QK 1HLVA 4OJ6A 1IXRC 4G5GA 1TWGJ 2EFNA 3G2BA 1PJ5A 3J80Z 1KGSA 2IT0A 2J7KA 4D1QA 5J4YA 3CJQB 3RI4A 1E3ZA 1J9ZA 3S1MJ 5GV7A 3J7ZI 3I4NJ 1GHCA 1O8HA 3A0BC 1FC3A 2ZZGA 3HPHA 3W3CA 4B47A 2HXOA 1X1DA 2VQLA 3PNTA 3ML6A 4RA2A 2E1BA 3ABMH 4L0ZB 3G73A 1SKQA 3OZVA 2EIJH 3GTKJ 4U7BA 4Q4ZF 1WSUA 3DLLF 3CDIA 2EV6A 3CRZA 2FF4A 1HA3A 1A8PA 1QVGB 2HVSA 2HOSA 5D8KB 2V1UA 4OAZA 1WSVA 3AL0B 1G8XA 4R1HA 1MBHA 3JRBA 2L9RA 3IRRA 2Z9OA 1R5NA 4RD0A 4HX7A 3CCMI 4PMHA 5DEQA 1HBXG 2W4SA 2JJ1A 3CC4B 2ZSIB 4I98B 4II3A 2E7XA 2Q2EA 2ZXJA 3ZUGA 2X1DA 1JNYA 3BT9A 2C78A 2MBFA 4NHJA 3CJTB 5D5WB 2FOWA 2K9LA 2WTEA 5F4JA 3IKTA 3JTGA 4PGHA 5EG0B 3FXOA 2COBA 4XMYA 3H9QA 3S8PA 4HG2A 3GTLJ 3NB2A 3OYFA 3CP2A 2DIEA 4X06A 2KDZA 1O88A 1XC5A 1XQBA 1K73D 2FMLA 1TYUA 1RQRA 1E0EA 1MDMB 4XLFA 3F6OA 3ASSA 2VQGA 3SEJA 2DXIA 3H36A 2AQFA 2K3FA 5HXBA 1XE1A 4WCGA 1Y1WJ 4Z4WA 2BV6A 4PJNA 3A8JA 1BR2A 1BC7C 2M8EA 1EV7A 1JHFA 4UV9A 3EUAA 1E43A 1XMXA 2QEXB 1SFKA 4MYUA 4NC7A 2NVUB 3U6BA 3GFIA 3HL2A 1X1PA 4A0ZA 1RUOA 1W36C 2BN4A 1KZHA 2VJ5A 2MG4A 4RLZA 4QFMA 1GAWA 1J9IA 3CCUI 1TT5B 3HYIA 5HLHA 2IS2A 2CK3A 3GSIA 3PFIA 3JQRA 3SHFA 1FP1D 5FO0A 3A3GA 5F64A 4DYQA 4EJWA 1S72B 1K8AD 1FTZA 4B48A 2MSYA 2W00A 4MFDA 4P9SA 2WV1A 4IHWA 1ULYA 3OYHA 3S1NJ 4YELA 2E35A 3BC8A 3KP2A 1D1AA 1O8MA 2EFGA 3U6KA 1PUEE 1ETXA 4YAFA 1OFEA 3TP3A 3B8YA 4IKFA 1YYVA 1R00A 3WGGA 3PO3J 1OISA 1T6ZA 1ZM3A 3A0HC 2MC3A 4LMYA 4ESBA 2EBIA 5HOOA 4I01A 2PG4A 1WGXA 2PEXA 1YIOA 3VNUA 2LRDA 1VBLA 5FFZA 1V54H 3HJEA 2RQQA 4WXDA 1U5TB 4G9YA 5B3SH 3HSEA 1DDIA 3ZZTA 3H1CA 1V3FA 2BM1A 3WNDA 2P4WA 2GK7A 1U9NA 2X0KA 3FXLA 3K70C 1IN8A 1BN5A 4GO1A 2BZTA 4RD3A 2BEOA 3WE3A 2O5RA 4BEHB 1HC8A 3F0CA 3AGQA 5AMVA 3VODA 4WZEA 5FRMA 3FXUA 4X7FA 3FBIB 1TZLA 3KEQA 3WBJA 3WTSC 1OJLA 3MEXA 1T56A 1SD5A 4YFNF 5M3FJ 1P4XA 5IYNA 4ZCMA 1FYKA 4KT6A 3OZUA 1ZM4A 2M0MA 5C4JJ 3EQLF 3KX2A 4N9HA 1NRKA 1UHSA 4KH3A 2B0LA 3IH4A 5LHHA 5HNHA 2KJBA 2NZMA 3OYMA 4DW6A 3KIOA 4BXXJ 4BJ6C 2QCOA 1BJKA 2B0RA 2JA2A 4BE1A 3BR6A 2X4HA 2AQEA 2OJED 5JVTA 5K5QA 1YRNB 3J81k 4ZYDA 3VNVA 1U8RA 4Z2YA 3W5UA 2PMZN 3I59A 4D7MA 5HNFA 3K2ZA 2L4AA 1J5YA 2R7SA 4DJAA 4DOZA 4ZTFA 2ZBUA 3QP6A 2FU4A 2XKOA 5CVUA 3HHHA 3MCAA 2IJLA 4R8HA 3J80K 2VASA 1Z6TA 2JIZA 4NC8A 2F5FA 3UNGC 3S16J 2OK8A 3GCMA 4XONA 4YIRX 2LDUA 4UZEA 4XKVA 1FMVA 2PFBA 4CCOA 2VXDA 2PJRA 2CUJA 5H59A 1WOSA 4IW3B 3G05A 2M34A 4Y33A 4PC7A 2F3LA 2DYRH 1G2HA 2FSWA 1YHQB 2ESNA 1IG7A 4WF2A 1Y0RA 4C30A 5L3BA 1NH3A 1HVXA 4FT8A 4MNUA 1UD6A 4XIDA 2NOGA 2IEKA 1S29A 4BDZA 3HTUA 3MCZA 3HRTA 5E1WA 4BS9A 1VZ0A 5F6FA 2LH9A 3BCFA 3QAHA 3VMFA 3VMWA 1Y39A 2O8KA 2E60A 1KYWA 2DBBA 4AVPA 4C2MJ 1LPQA 4AIDA 2B63J 3QE2A 1N8RD 2F1LA 3JW4A 4P22A 3BG6A 4EJUA 3GTPJ 4RD6A 1BMFA 3F72A 4N3NA 1T95A 4XLAA 1VQOB 2WB1N 3V76A 1D1CA 1ZGAA 2DFEA 4N9IA 3AG1H 4F52A 2DT5A 4JK1X 1WKMA 2JQ7A 1T8IA 1ZARA 1PJ6A 4Y7CA 5FKMA 1MNMC 4CUGA 3B82A 4HQMA 3A01A 3C18A 3FMSA 2XNCA 1D8KA 3I55B 3ZOBA 3PUFA 1L3LA 1KK2A 2M7AA 5M3MJ 1MH3A 4ZDLA 5LMZA 4NNJA 3JAMZ 1HG8A 3OAAA 5E3MA 3CDLA 4BHPA 3ZN1A 2HZTA 2LKPA 2PIAA 1W0TA 2Z6BD 4DQKA 3W5VA 1ZYRF 3RIQA 1AMOA 1WJBA 4U88A 1Z7UA 2GXBA 3H3VK 4WZTA 4Z4UA 1N0VC 2VL8A 2VQHA 2P5LC 1MNDA 4PSXA 5D6FA 4AM3A 1OB5A 1FMWA 2LMDA 4OMZA 2OCCH 4IOAF 1OFMA 3M3YJ 3OOPA 3GTJJ 2CW7A 2DQLA 1G7TA 1POGA 1UHWA 4YZXA 4LK0F 1KK3A 5FO1A 2FNPA 3CP8A 1Q86D 2H94A 2YUHA 1UELB 2XB0X 4H9GA 1E17A 3IHUA 3OIOA 2L7MP 4X07A 3DDYA 4P3IA 2E7WA 4AUXA 3W2FA 3KYCB 1N08A 1LLWA 2MA3A 3LAJA 2VJ4A 1ZK8A 2ZXHA 2ESHA 2VN2A 1JTAA 1BR4A 1PP8F 3PA1A 1QA3A 1LE8A 4F55A 3ONYA 4EATA 4I0AA 1P4MA 2EINH 1TWCJ 5F1RA 3BQJA 1LQ1A 1GT0C 5EJCA 2R7RA 4XKCA 2L9VA 2IGKA 1KTWA 5HZAA 3LSPA 1FX7A 2VIXA 4XM3A 4PZJA 1PDNC 3ES9A 2VFQA 2K85A 2AXTC 1KRHA 3OW7A 3A03A 5E20A 3OW2B 1N25A 3ERMA 1YLOA 1ODDA 2ODLA 4CCLA 1T98A 1IN5A 4DZPA 1IDJA 2QKMB 4E7LA 3Q9SA 1ON1A 1T2KA 1NB0A 2ME0A 3LA2A 1SC7A 4AIKA 1FLIA 2WR8A 2F5VA 4BQQA 1SFUA 5FFXA 2ZJRF 4YAOA 3OYIA 5K1YA 2F1MA 3RQ4A 2FA5A 3LSHA 4M3DA 4ENMA 2ZL7A 3I71A 4NDLA 1R1TA 3FMQA 4YAWA 2NTQA 4A3FJ 1YJWB 5DS0A 3BC9A 3GZ5A 4GXOA 5LHIA 4X7CA 1R5BA 3OSFA 2MD0A 4F7DA 2PECA 5E8IA 3VSTA 4L5EA 1ZH5A 2ME6A 4DBQA 4XNFA 3U21A 3ZMZA 1FOKA 5M5XJ 2W85A 4IVNA 2BM5A 1DU6A 5FKLA 1AA7A 4XRFA 5AIPA 2UZKA 1H80A 1ZM2A 1MRZA 2RNJA 2XTXA 1FT9A 3C2BA 4QLCU 1BOAA 3BH4A 2P5KA 1J2XA 4R71A 4QPQA 1T39A 5CQGA 5LEJA 1U3EM 4AIHA 3NARA 2EIKH 3SFIA 5EGOA 4MEXF 2EIXA 2BGJA 5L46A 1OFDA 3ZXSA 3IL2A 1I6HJ 4PC6A 2HDCA 3WGHA 2B7CA 4UY8I 3CPXA 1IDYA 3N97A 1K4ZA 1OLTA 4RCYA 1VQ9I 2VFPA 4HNVA 4BGDA 1V5GA 4QHYA 4LD5A 1MZBA 3I0TA 3ELKA 4D5CA 4G7XA 3K4LA 3L2QA 2M2EA 4ASNA 3AKZA 2R7VA 1WTHD 1T6XA 5FKNA 2KIFA 1ETVA 3RIRA 1TBXA 2QGUA 2X1EA 3AVUA 3W2GA 1W34A 1L1IA 3OS1A 5DUKA 1M90D 1IUFA 1IZ1A 5DS9A 1O8LA 4GYGA 1WI3A 4LB5A 3KLNA 4E7ZA 4OPVA 2XV4S 2WB1A 1ZUNB 4PFOA 1HW2A 4FCYA 2X6YA 4I0BA 4QUZA 2YX4A 2IS6A 3CLQA 3PM1A 2G9WA 1HA8A 2PLFA 4W8SA 2P5VA 1JA1A 5IP9J 1UMKA 1K78A 3FXQA 4M3EA 3HSRA 3F8NA 9ANTA 4IRHA 5IPAA 2F5CA 3GBGA 2O7OA 1G4DA 2E34A 4Q47A 4LB6B 4DK0A 2HGCA 3E5QA 1XPXA 5JVGF 1W35A 1UD8A 2C4TA 4Y9RA 3DKWA 2OBRA 2M8GX 5FL7A 2GJKA 2STWA 4XORA 2YS9A 3QPHA 1AIRA 1QHHD 2A6EF 2W6IA 2DMPA 4I09A 5J40A 1B23P 3SY2A 4LK1F 1N77A 4ZCLA 2ZXIA 1SKYB 1OCRH 4KT5C 2LK2A 1IRXA 3VYUB 5FROA 1KQ0A 2V4DA 4WQMA 3KLOA 5E1XA 5AONA 2VOOA 3CJRB 1D0ZA 3RCOA 2HWVA 2WSSA 2W25A 2GPJA 2LSOA 4CDGA 3JAMK 2M7BA 1JJ6C 2BSAA 1H8AC 2INVA 2EA2A 2FE3A 1HW1A 3KP6A 4FK8A 1KQ5A 4YDTA 2X48A 3EDPA 3TKYA 1FIPA 4XQFA 2VKEA 4CCJA 2HKXA 2Q2EB 3FBNB 3GZNB 2ZJQF 1B4AA 3MD2A 4JX6A 1XS9A 5F1JA 4P26A 4PJLA 5TR9A 1JKQC 3PJRA 3V8LA 4Y4RA 3IP4B 3CMAI 4M0LA 1MIJA 4OIRF 4B09A 3CC7I 1D2EA 2ZZFA 2EV5A 2V4JC 4BBRJ 2KIUA 4A3MJ 1M1EB 3JRFA 3BCBA 4P25A 2JUGA 4XKBA 4FXUA 3B6CA 1BJAA 4UVBA 5HLIA 3F8FA 3J7AO 2PBIA 5FGMA 1RR8C 2P3MA 2VBSA 1O3QA 3H9JA 4RAFA 3RYRA 5DTDA 1XGSA 2OQGA 2P6TA 4XOTA 4D5FA 3CO7C 1MMGA 2D3NA 2DYIA 2ZZEA 3JU4A 5HDNA 3G4SI 2HS5A 1DP3A 2DOGA 5DM7F 4O3MA 4L9NA 1VHOA 3R6JA 3HKZA 4LLGF 3HRUA 1SVOA 3BR3A 2ETHA 3KP3A 2DJNA 5ICCA 4KKSA 3CCJI 2R5ZA 2X85A 2VBTA 1WJAA 1D8JA 2RGVA 3Q9VA 2NS7A 1OCCH 1DDNA 2BM4A 4CICA 4W8TA 2HNHA 2NNNA 1W0KA 1JT0A 2NVTJ 1W5CC 2FQ3A 4HQEA 3I58A 3F3XA 3B6AA 4M53A 2QXZA 1UCRA 3P9IA 2GQFA 3P27A 2OBSA 2EZHA 3JRIA 2GIZA 3K4NA 3M4OJ 2L2OA 2Q8KA 3L2UA 1Y0NA 3BQYA 3HHGA 4EM1A 1UD3A 2EJRA 1JGGA 1F9NA 3FJOA 4B3XA 2HCJB 1ZTRA 2EZLA 2GJRA 4L5JA 1SFEA 4RDJA 2VBWA 1LEAA 4DNTB 4RBOA 2O0VA 2ZTGA 3GF2A 1QZYA 4UB6C 3SEQA 1ELOA 4BHCA 1T08B 4WZLA 4EV0A 3CCEI 4B4CA 1E62A 3OEEA 2D45A 4WZKA 4X05A 2CYYA 1QFJA 4IPAA 2FX3A 1R71A 4N4OB 1P7IA 4RLFA 5BMZA 1JJ8C 5IYDJ 2XNJA 4A3EJ 5LRRA 3QPTA 3RJPA 4XLCA 5J3OA 1YW8A 3ROUA 2TCTA 2FNAA 2RAEA 3OYAA 3SZGA 1FZPB 2BPOA 2XRLA 1DPUA 2X51A 2X1CA 2A3SA 1VQLI 2VZLA 1PVEA 4Y52J 4YEIA 3FDYA 3K7AJ 3IH3A 2CW0F 2ECCA 4P9FA 2EQRA 1WHUA 4UVCA 3E0JB 3J81K 1XSXA 3K4MA 3S32A 1Y8RB 4YRVA 1WZ2A 3S14J 2BY0A 2I5UA 3LSGA 2R7DA 5H5JA 5A8AA 5FA6A 1ZGJA 2Y9ZA 1VJSA 3KP4A 2DEUA 2L4MA 2BVLA 4HLXA 4IJAA 3BY1A 4M1KA 3PIOF 3N6ZA 2FBIA 2K9QA 2LBFA 2NSPA 2VE8A 4HE6A 3OMYA 1O8GA 4ZGQB 4OAYA 1I8DA 3T51B 3EQOA 3CMEB 3I59B 1SD4A 4OIOF 2JVGA 2P7VB 1K83J 1JUPA 3GTMJ 3A3BA 4HYEA 1T38A 1K4TA 2MGQA 1U8BA 4P6YA 2FX0A 3DU5A 2NVXJ 3U2QA 5TGTA 5DUIA 4A3GJ 1YQAA 2BE5F 3OE7A 3A2KA 3LOCA 3Q6QA 4ENKA 2DY1A 4HX4A 4B3AA 1O8FA 1FEXA 4LITA 1YFHA 2HKOA 3ISPA 2PJRB 2VPLA 2PMUA 1F43A 3F6VA 4BHBA 2UXXA 1FSEA 2D2WA 4A6DA 2XAGA 4ZYGA 1UD2A 1W87A 4OZYA 2ZNZA 4AU7A 1KONA 3FKIJ 1MD0A 3K4BA 1H8HA 1OHHA 1QUFA 3HB9A 4U0YA 4C43A 4MHGA 3ZPNA 4DQ2A 3B4NA 3IAM2 1TW2A 3GQBA 4ITVA 5GAHJ 5TJJA 4U7DA 3OYDA 4HA8A 1H9TA 1FOWA 1Z05A 2BXZA 2DA1A 4P96A 3F22A 3L2CA 3E97A 4G1VA 2JPBA 3ZBUA 1YG2A 4PDKA 5FKKA 3QU6A 2XF6A 1P4WA 3KE2A 3I4MJ 5J3LA 1ACIA 3F21A 2XAUA 3O8GA 4C0SA 1O57A 4IF4A 4E7SA 1I1SA 3VSKA 1HOMA 5IOZA 1H88C 4A3CJ 3BR0A 4RDKA 1LDDA 1VQ7I 1LB2A 3PIPF 4I84A 3M1CA 1VQMI 1KK1A 4XN0A 2DT7B 1R1UA 2OU2A 3HUGB 2HOAA 1IF1A 1J09A 2DA3A 5FLMJ 1UB9A 5F0CA 4UNOA 2NT6A 1XDUA 2XT4A 3WTXC 1HQCA 4PJMA 3ZQGA 3OY9A 1YI2B 3T8TA 3KZYA 3ZN0A 4P9UA 1F20A 3JRDA 5DV5A 5D4SA 3ZC3A 3LMWA 3PL8A 3A8IA 2OV7A 4ASUA 3QPSA 1DGWY 2MFZA 3DV8A 4J0QA 5B5EC 1TQMA 4O5VA 5GADJ 1F5TA 5GTIC 1K7AA 1I5ZA 1WH5A 1ZG5A 1KC8D 4G6QA 4UZUA 2XHKA 4G7ZF 1X4OA 1SFOJ 3QFRA 4WWCA 2VE9A 2XAFA 1TP4A 2HTSA 5D8LB 2IS4A 2N8GA 3BZCA 1BM9A 3CCVI 1RRJA 2A07F 4XBFA 5D4RA 1SAUA 1YJNI 2DPUA 1GLNA 3C2GA 2RQPA 2VBMA 2VI6A 2EZKA 2I8DA 1YS6A 4FX4A 3M7GA 4IRIA 3GRHA 3I64A 4G94A 2LC2A 3BG5A 3WXMA 2AHOA 2VC0A 4Z03A 2JVHA 3E3VA 1YS7A 2DT6A 3M8JA 5F08A 1NJID 4XLHA 3HOXJ 2CQ7A 1ZR2A 4DYRA 1I27A 1D3YA 1SD7A 2DDBA 2HQNA 4PJJA 2K27A 2CGPA 2HVQA 2EH3A 3H5AA 4KIGA 4MGRA 3TL4X 2MH2A 3LO8A 1XMKA 1F60A 4RMNA 4AC9A 4EJTA 2V9KA 2NTBA 2ZKZA 3FXMA 3LFUA 1D8TA 4IHTA 1DBGA 4OJOA 4OIQF 1FYLA 3K9TA 4G6IA 2VLAA 2M4GA 1A6QA 3RSNA 4NUBA 1VQLB 1K6YA 1OMIA 3ASPA 2W1OA 4S0HB 3U1KA 2JSCA 3DU6A 3ZQCA 2X3UA 2JT1A 2NS0A 1RC9A 2V79A 5TISC 1G3WA 4E70A 3WU1B 3CCQI 1IO2A 2L01A 3MKYB 3D26A 2WZPP 2P81A 4HV5A 2MYSA 4PCQA 1ZRFA 2X3HA 4Z1MA 5D6EA 4B43A 4RD1A 3PETA 3KETA 5TY0A 2V1XA 1R4MB 2MW8A 1I1GA 3HM5A 4X1EA 1D5YA 1MNEA 2NNYA 4B3FX 4ABZA 2ADUA 2RKHA 3SDBA 2WPDA 1MJAA 5EDNA 1N07A 1W36D 4JQFA 1PE9A 1N06A 3JTHA 3BR5A 4EJVA 3K0LA 1IXCA 3RKWA 2HVRA 4XSXF 1OR7C 1V0FA 5L3CA 1RR7A 2TDXA 4L9JA 3N4MA 2QQBA 1DPRA 2RN7A 1PLUA 3FX3A 2ELKA 1Q82D 1DBOA 2CFOA 2QBYA 5CVVA 4A2UA 4UHTA 3TH0A 2KL4A 1STZA 3GZ6A 5E3NA 2OTLI 1EH6A 2ZO4A 4IL6C 1OYWA 3WTTC 3FPPA 2D5VA 3WTWC 1YX3A 4JX4A 2K4BA 4FX0A 1ORKA 1XFOA 3ZRGA 2MC4A 2FEZA 2OK7A 2KQRA 4IZZA 3P4GA 3OR1C 4XK4A 2ACJA 3SZEA 2BW3A 2K9NA 2Z5UA 2HEOA 4XLNF 2PI0A 3RKXA 2CG4A 2KKOA 4O6JA 2BX6A 1GV5A 4LG3A 1M1KD 3GVJA 3LQ6A 1E63A 4HOBA 1AKHB 2O6GE 2GA1A 4GDFA 3GXOA 3LVBA 1VQ8B 4D0PA 2BVNA 5FD5A 3VEPA 3K70D 5KNLA 3K69A 3G6EI 1WRJA 3AG3H 2CFXA 2LF7A 2YPRA 5HS8A 5LHGA 4I6ZA 1VQKB 4UUTA 2DA5A 1EWYA 1U9OA 1J75A 1DABA 1YTYA 1YITI 1K78B 4A3BJ 5M5YJ 3K2AA 1PJRA 4JYKA 4BAYA 2R7TA 2NYXA 1OKRA 4JP0A 1XDSA 3D5LA 3LQEA 2Z3YA 3S1QJ 4LBZA 1TC3C 3W2IA 2XZLA 4HX8A 4HNTA 2NPFA 2WAQN 5ERIA 2EK5A 4IXAA 4LG0A 2FBKA 1R5ID 4BBSJ 1XCBA 3SXYA 4F91B 1ON2A 2O03A 4ROXA 3F8BA 2WY8Q 1G7RA 3MWMA 4F3QA 4QTRA 3Q3SA 1TTTA 5GV8A 2ZMEA 1K5CA 1YX5A 2DFIA 3I3LA 4GYIA 2R6HA 3BTJA 1QQ1A 3PUMA 1C0WA 3OIPA 2EFWA 1R7JA 3TDUC 1YJ9I 2KVOA 4X7EA 1GO2A 3PQJA 1TLLA 4EJOA 4NBQA 1Y0YA 1A6IA 2QWWA 2R7QA 2JDIA 2ZB9A 3H5RA 2BHZA 4I2OA 2Z2SB 5B1AH 1YJNB 4M3BA 1W1WE 2P7CB 4IOCF 1QU3A 4YZAA 1K6OA 4M73A 4HDVA 1E3XA 5JBQA 1PXZA 4OPWA 2Z8GA 4CH7A 2CWEA 1VQPI 3QRFF 3W6JB 5IYBJ 2H8WA 3SQNA 1Q1VA 1W7PA 4ZDPA 1BHEA 3WQZA 3UR3C 3OYCA 1KK0A 1ETKA 5C4XJ 1TLHB 4IEJA 4YXWA 1T6YA 3RY8A 2KIMA 1TT0A 4BJTA 4QVAA 3MMPA 1I50J 1PUFA 4XLEA 3VWBA 3Q0VA 1MMSA 3ZIAA 2EFOA 4Q7JB 5KHDA 3PSSA 1KTVA 3O3KA 3HBLA 4UB8C 1X3ZB 1X19A 1V5FA 3PUBA 3KYDB 1HF2A 2OBTA 4I7HA 5IT9Z 5IP7J 1GXQA 3C3WA 2OF7A 5FRNA 3CO6C 3JSPA 2QA4I 2WWYA 2FXAA 2ZZQA 4P2NA 2X53S 3JRCA 3CCMB 3TO7A 5BNGA 3RKYA 2KFDA 3KL9A 2DPDA 3HEFA 5EEHA 4PC3A 2QUFA 3FPKA 4IHXA 2BY3A 1FY7A 1IRGA 2BBYA 1WJCA 3A4CA 2JTVA 1QBJA 1RUNA 3D5RC 3KEWA 1JB9A 4XR6A 2IA1A 2H09A 4DBRA 1P92A 2A6TA 1R5OA 2JN6A 3PQKA 3CCLI 1USTA 4M3FA 3IKVA 1ZAOA 4RM0A 2V26A 1Z6RA 3HOWJ 2QF7A 1YE9A 4S05A 2VNJA 2KP6A 3MMYB 1Z0XA 4PUSA 2PJPA 2OTJI 1IV8A 1OR7A 1LFPA 2IA2A 1IC8A 4LLLA 1F4KA 1O8KA 3FY3A 5DM6F 2V7UA 2F4MB 3CD6I 3QU3A 4RPBA 3MAJA 2Y9YA 3W2EA 2KT0A 1H89C 5F4OA 4I02A 2VKVA 3RYPA 2W7ZA 3AFHA 1BPLA 2V7XA 3RPQA 3CESA 3QPLA 2M4KA 1Z9CA 1DUXC 3E1YE 1QVUA 4DIQA 2NAZA 1TW3A 1I7PA 1X58A 3BWGA 3OZWA 1Y0UA 2IGOA 4NBSA 1ETWA 3ECOA 5DYMA 4F93B 1KZLA 1KU9A 5K7HA 1YW9A 1SEUA 2QN6A 2XGDA 1SM4A 3B73A 1CGPA 1ONVA 1NDHA 3CCUB 4OOVA 4C3HJ 2WJVA 4UUSA 1QG0A 2AS5F 2WV0A 5C1EA 4YG2F 1J59A 1B8IA 2Z1DA 2J8KA 3QYFA 2FUG2 4ESJA 3MKWB 3MKLA 4BU2A 3BJAA 3GVLA 3JRAA 1BR1A 2VBKA 4PGGA 2XSDC 1N75A 2LBFB 2DMTA 4BH9A 3PSFA 3SQVA 2R7FA 5H2FC 4HRIA 4GCVA 6PAXA 1QGYA 2DU9A 4UZFA 3FZVA 3DEEA 3LQRA 1XCVA 3ECHA 1B72A 1O3SA 3ERED 2WAFA 3BNWA 2DODA 4TV7A 1V4RA 3U1DA 5H6RA 1DGRM 4P6VF 2WAQA 2VJIA 1P4AA 3JX8A 2A05A 1LUJB 1QA6A 1FDRA 2FRHA 3HAGA 2Q0OA 1FPQA 4DNCA 2VXZA 3OL3A 1G59A 1BIAA 2QTZA 3S3NA 4M4SA 4ON0A 3PENA 4EW9A 4IHSA 5F04A 4NC6A 2GOXB 1G3TA 2XNDA 1U78A 4XRMA 1UD5A 3ZMVA 1T5EA 2ZNYA 3DFGA 1SMTA 4L18B 3C7JA 4K2EA 1DQUA 2KRFA 3L7WA 2HU9A 1E3OC 4A93J 3GO5A 2W24A 4AYBN 5GAEJ 4FE7A 1JTXA 3HIFA 4FQGA 2HPIA 1ZRCA 2CQXA 1K9MD 4A3LJ 2PMDA 1GUUA 5B6IA 2UWMA 4Z4VA 1UZCA 3OR2C 4MR0A 4HV6A 4DYCA 3P9KA 2NTPA 2PMZA 3EYIA 1E3PA 1KMHA 1ZM9A 5E17F 2VONA 4A5NA 3OFNA 3E6MA 4CHUA 3SLNA 3BROA 4Y15A 5L3FA 5JFRA 2STTA 2VKHA 3H9GA 3DTIA 4N0BA 2IS1A 2RC5A 4RPDA 3V7AA 4ENNA 2BM0A 4OPSA 4ACAA 3I1FA 4FASD 3E5UA 3V7SA 2Y31A 2O3FA 3VYSB 1QVTA 4B44A 3PNYA 5GP9A 1ZGWA 1KU2A 3TQNA 2CMPA 2DW4A 2JWTA 1U6GA 4JBAA 3TMOA 4U9UA 4AC0A 2H6CA 4WK8F 1QGAA 3PA2A 3W2HA 4OJPA 2BGCA 3J81Z 4Z06A 1FNMA 1NHAA 3VPRA 1BC8C 1AOYA 2D74A 1VLYA 4YFOA 3HXLA 2QMUA 1GQ8A 2HTJA 1YW7A 5IT9K 2ZSHB 1VQNI 5A89A 3FM5A 1JE8A 1A04A 2D1VA 4LGWA 4YIFA 1XTAA 1MDMA 1H8EA 3BTLA 2A69F 3S2WA 2L9SA 2OA4A 3RPUA 2D1HA 5K5RA 1WJ5A 3CF5F 2XPVA 3CCSI 1NHCA 1UG0A 2DLLA 2PYHA 4CQJA 4RGSA 2C2WA 3T56B 4X6AJ 4BJ5C 2V9PA 4NQWA 4J19A 4C2TA 4BQAA 1S8NA 5BSYA 4OINF 1MMDA 3EUHC 3P26A 3FKJA 2DAOA 2JRTA 4EGYA 3BG7A 1HSTA 4RD4A 1GV2A 3GLXA 1QNTA 3P5JA 2ZBVA 4W1UA 1ZLKA 5D5XB 2HPMA 1ZREA 3BJOA 2VT3A 4A0XA 2I10A 2OUMA 1FBSA 1O3TA 4L0YB 3OEHA 1R9TJ 1FRQA 1KU3A 1FIAA 3OV8A 4ZJZA 1E64A 3V42A 3QSYA 4W8RA 2R4GA 1ZG3A 2DA6A 5BS6A 3G71I 3S3MA 4TMZA 1IB0A 3M1EA 1OB2A 1UG2A 3SKBA 5K7FA 3T8RA 1YO5C 2GREA 3LSMA 3B78A 4HIZA 3LWFA 3FHNA 3ULQB 1K79A 1GR1A 1WU8A 4M71A 2K9MA 2ZITA 1HF0A 3VR6A 1JJ2B 3FKSA 3G1MA 3I4PA 2PE3A 1UJ8A 2XOKA 1OCZH 3S1RJ 3ZQLA 2HYJA 4RM3A 3GX4X 1B9MA 1V5VA 1CQXA 2NS8A 4W8QA 5E8GA 4Y9UA 1WVRA 2G0EA 3AVWA 1U0JA 5AIQA 2XGXA 3WGIA 3KCCA 1JUMA 3KP5A 1WMRA 1S9HA 2QVOA 3IC7A 3DPLC 1XN7A 4HSRA 5HODA 1N05A 4EM2A 2DO7A 2VFMA 4CSWA 3EPZA 3WWGA 5HLGA 1YOVB 2DA2A 4BEHA 4DQLA 2XTYA 1XG2A 1YIJI 1ZELA 1NG7A 3SEZA 2QBYB 1H42A 4PFPA 3ONQA 1Z21A 3T1BA 1O8IA 2E1RA 3CW2A 2DDAA 3RQIA 2JRMA 2GK6A 3WBKA 2LY2A 1B6AA 2DFHA 2DFFA 5L3GA 2WZNA 3GIRA 3OOCA 1IA5A 1BI0A 3OYKA 4PC1A 1Y8QB 5GPAA 4N4NB 2JK3A 1NB9A 4G7OF 1SMYF 3W2AA 2IRFG 2GJPA 2XVCA 1B1BA 2BW3B 2DK5A 2XASA 1QGZA 2M30A 2HDDA 1CZFA 1OOCA 3W5HA 2LLKA 4A3DJ 4HLYA 4HPQA 3BPVA 3I56I 1YRNA 3BR1A 1Z7LA 2HQ5A 4A0YA 1EFCA 1KD1D 3ABTA 4AYBA 1BA5A 4TMWA 2R9VA 3F23A 1E3HA 2GZWA 2OZ6A 5E18F 1EH7A 1X1BA 1Y6IA 1W4MA 2WA0A 3OOUA 2W7NA 3DEWA 4KICA 3TOAA 3QOPA 1COWA 3WG7H 5GAGJ 5J1RA 1QZZA 3PO2J 3IWZA 3DPTA 4DNRB 5IT3A 3S3OA 1HKQA 4C3JJ 4PJ0C 4BXFA 2DOFA 2XRNA 1JUSA 1WFXA 2ZXWH 2KPMA 1XGNA 5FD6A 2UUZA 1TWAJ 1BL0A 3H9NA 4EH1A 1KCCA 3VDXA 2CU7A 1OB0A 2Q1ZB 3X2QH 4BL0B 3JSOA 1QVFB 3PFYA 3V4GA 1XGMA 2JPCA 2LNBA 3Q38A 1Q1HA 1T33A 3E6DA 1K61A 4Z4YA 1LDKB 4G6TB 4G7WA 2HDNB 2KISA 3HC7A 5TV2A 2DOAA 5J35A 1WPKA 3CCYA 3K4KA 5E79C 5LFAA 4KA4A 5HVQC 3UW0A 2M3AA 1MBFA 1GVDA 1ZR4A 2E1CA 3PSZA 1JKRC 1IJWC 2HMAA 4PC2A 2FBHA 2ZMEB 2P6SA 1K4SA 2B9SA 1Z67A 1VQ9B 3AVVA 2XDVA 2W6JA 2CSOA 3UKGA 1VQ6I 2K02A 2XIGA 2PLYA 1TNTA 4BQOA 5C44J 4AIJA 2VT2A 2XKPA 2VBYA 5EEAA 1FOXA 3DPUA 5KAIC 1WOOA 4C2LA 1QUEA 3OJWA 2ZFUA 5IYQA 4F7ZA 4CA0A 4L9VA 4Z6YA 2NRAC 1IN7A 4V2GA 3OYGA 3QOEA 4KFCA 1DDGA 2XPUA 2IAIA 5KVRA 1XG1A 4YCQA 1QPIA 3SDGA 4P1VA 2KZGA 1ITYA 2FMYA 3V7RA 2V6EA 2EIMH 2E1MC 1RI7A 3L2VA 2L7KA 4PABA 2VC1A 2GM4A 1W7PB 1CQTA 3Q39A 4AF7A 4BNCA 3ASQA 1FYMA 5IYRA 3E6BA 2KRHA 1AU7A 3VYRB 3K1MA 1P6RA 4FN5A 2LFBA 3EUHA 5CPRB 3I5UA 2L5QA 3H35A 1SVMA 5LBQA 5ILUA 1MMNA 1EP3B 1U2WA 3A02A 1DP7P 1EP2B 2CH0A 3G71B 3WTZA 2F43A 1X3UA 2ZFWA 4FISA 3HRSA 4PSWA 5M5WJ 3CC4I 2UV1A 1F1ZA 2HOTA 4HF1A 2DMQA 1X1CA 2CF4A 5E1ZB 5FKOA 3OYJA 2UXNA 2VBUA 3E1SA 1BI1A 3VO2A 4LJZF 1TUIA 3NWSA 3T53B 3DEUA 3H0GJ 3OPOA 4RCZA 3DLAA 1IAWA 4ZTJA 4G7HF 4MYTA 4LBYA 3GTGJ 3SFZA 3DKYA 1XSDA 2LVSA 3IAS2 1IUYA 1S4MA 1CF7A 1IN6A 3WODF 4GQNA 1I3QJ 2GQQA 1FNNA 3BZKA 1EXMA 5H6QA 3KPHA 3HOVJ 1RU4A 3CMAB 2ELHA 2Q6OA 1JT6A 3CC7B 3WY9A 3GEZA 4QVJA 4FWTA 4CXFA 2QEXI 1A35A 5EEGA 2H1KA 1SVLA 3LSRA 1A36A 3QP5A 2P8TA 1O4XA 2JJ7A 3DP7A 4ESFA 3QODA 1TYWA 3A01B 3R6SA 3ZMUA 3SJZA 2OD5A 3CDHA 3WNBA 2VKDA 1ZHFA 2Y2ZA 3G4SB 1W7PD 5A88A 4JOMA 3N90A 1S72I 1PKVA 4U0VA 2QKLB 2BOLA 3P7NA 4V19K 1IRZA 3U2RA 5F0HA 4HAMA 3HG9A 1LVAA 2EFPA 4WXHA 3CF2A 3CUQC 3CCJB 2CW5A 1IRFA 1KA8A 3KYLA 2GBYA 5FNZA 2HYFA 2VBVA 2YUSA 1VLOA 3VMVA 3E5XA 2DOEA 4UUSB 2XAJA 1VFCA 2K4JA 1B8IB 5KW9A 2DERA
chains in the Genus database with same CATH topology
2KMUA 2ODLA 2HZDA 4Y3OA 3OYBA 4CCLA 4YEJA 3OIPA 3HOTA 2KVOA 1IDJA 2IGNA 2QKMB 4F92B 4E7LA 2VJJA 4BACA 2R7XA 1HZEA 1K28D 5CDFA 2R7QA 2JDIA 3H5RA 5JHFA 2F5VA 1D0YA 4BQQA 2Z2SB 3PNVA 3OYIA 2F1MA 3RQ4A 1QU3A 1WP6A 1E3XA 3LSHA 4TKOB 4YZAA 1PXZA 2NTQA 3CZ6A 2Z8GA 2XZOA 2O0WA 4CH7A 4RM2A 2WADA 3BC9A 4ZDPA 3ZR8X 1BHEA 3WQZA 2MD0A 2PECA 3W2WA 3UR3C 1EFRA 3OYCA 4MLOA 1N78A 3VSTA 4YXWA 4DBQA 4XNFA 1X0CA 4YZQA 3U21A 1TT0A 2F6CA 4BJTA 1AA7A 4XLEA 3VWBA 3ZCOA 2KLOA 1H80A 3EUKL 2KRCA 4CCNA 1MMAA 1E1RA 3ZIAA 5KHDA 3BH4A 3T9GA 1V5EA 4QPQA 3GQ7A 1X19A 5CQGA 1V5FA 2O04A 3IUOA 3PUBA 1Z3YA 2WAEA 3ZXSA 4AVZA 4J01A 3DTKA 2NOJB 4NK8A 3DTEA 1QHGA 5FRNA 1QJVA 3SYTA 5HKKA 2ZZQA 2X53S 2W82A 4U87A 3LMMA 1OLTA 2LOOA 3VSVA 4E7HA 1E79A 2A5WA 4CZCA 2VB6A 1O8JA 4BGDA 1V5GA 3L2WA 4E7IA 4G7XA 3BLYA 2WJYA 2K3PA 3K4LA 3L2QA 3JURA 3AKZA 2R7VA 1WTHD 2XF5A 3A4CA 1WJCA 2HQAA 3DQVC 3D5RC 2LREA 2X1EA 4ANJA 3KEWA 2NT9A 4XR6A 3OS1A 4DBRA 2A6TA 2CS3A 1O8LA 2V26A 1YE9A 4E7ZA 2WB1A 2MABA 2KP6A 3MMYB 4PUSA 4PFOA 5HLTA 2X6YA 3FY3A 1LFPA 1O8KA 2IS6A 1HA8A 4W8SA 2F4IA 1I18A 5CQEA 4URRA 1W0JA 2NSTA 3KEYA 1O8DA 1WJEA 3NE5B 3AFHA 2HDWA 3GBGA 3OS2A 4BDYA 3CESA 4P1WA 2JSPA 3S93A 1BPLA 2M4KA 4DK0A 4DIQA 5KCMA 1UD8A 5FL7A 1LVKA 2GJKA 2IGOA 4XORA 2HLDA 4F93B 1AIRA 1KZLA 3VSUA 1QHHD 2W6IA 2O17A 1N77A 2O1DA 2ZXIA 1W9XA 1R6RA 3QYEA 1SKYB 4FETA 2WJVA 4TSFA 1IRXA 3VYUB 5FROA 2V4DA 5C1EA 2Z1DA 3CJRB 1D0ZA 3QYFA 3RCOA 4E4HA 2FUG2 2WSSA 3MKWB 4DK1A 4Z05A 2M7BA 2X8KA 2VBEA 3LSIA 4BU2A 2INVA 3A1YA 3N05A 3GVLA 4NQWB 2Z16A 1WJFA 1D0XA 4E7JA 1BR1A 4HWVA 2VBKA 1N75A 2LBFB 4XQFA 3PSFA 4LIVA 4CCJA 1P9QC 3OYNA 2Q2EB 3FBNB 4HRIA 3H0DA 4KKUA 3MD2A 2XC7A 1D1BA 2V7FA 3DEEA 4U4BA 4PJLA 2ZTNA 1RMGA 1RWRA 3PJRA 5LD2C 5CKTA 2BSPA 2WAFA 4Y4RA 3IP4B 4B3GA 2CV1A 4P5OA 2R7OA 4JMQA 2UVFA 2ZZFA 2XF7A 1DGRM 2DCEA 2WAQA 2V4JC 2VJIA 3B90A 1KCDA 3BCBA 2IQ7A 3HAGA 3QYBA 4J00A 1UAAA 4NK6A 2JUGA 4HNUA 4XKBA 4FXUA 3H5NA 2VXZA 3OL3A 4XL9A 3I9V2 1G59A 2D3LA 3ZQQA 3H9JA 3S3NA 2LG4A 4EW9A 4XOTA 1IB4A 1MMGA 2V1NA 2D3NA 2ZZEA 3JU4A 2GOXB 2XGJA 3TBIA 2XNDA 1PYVA 1UD5A 1DP3A 1T5EA 3LNNA 1QCXA 4YZ0A 3HKZA 4TT3A 2L9NA 2XZPA 4R79A 1DQUA 1OGMX 3GVKA 3ZGKA 4KKSA 2HU9A 2X85A 1WJAA 3BCAA 3MKZA 1JRGA 1EE6A 4W8TA 4X0GA 2HNHA 1W0KA 2HPIA 4OZZA 1ERDA 2X6XA 4MXNA 2UWMA 2QXZA 4KISA 4CCMA 4U49A 3OR2C 4MR0A 3K4NA 3RPUD 3AL0C 2P0WA 2L2OA 3L2UA 2NTPA 4IX7A 2PMZA 3H94A 2KDOA 4BUPA 1UD3A 1KMHA 2WBMA 3CMMA 4B3XA 3OFNA 2GJRA 1O8EA 2VKHA 3H9GA 3DTIA 4ZYAA 2IS1A 4KKTA 2R7WA 4DNTB 2ZTGA 2O0VA 1Y56A 3SEQA 4FASD 2CW8A 4CCKA 3VYSB 3C2HA 3PNYA 4B44A 3OEEA 4BE2A 2WY7Q 4II2A 4OJ6A 5DN6A 1MW7A 2CMPA 3G2BA 4RLQA 4D1QA 3CJQB 1WJDA 4N4OB 4RLFA 3TMOA 1E3ZA 4OJPA 4XKWA 2LY1A 1O8HA 4XLCA 4Z06A 2ZZGA 3HPHA 3W3CA 4B47A 2CV2A 1X1DA 2VQLA 3PNTA 3HOSA 2E1BA 1VLYA 3OYAA 3HXLA 3SZGA 1GQ8A 3D5SC 2X51A 2X1CA 2ZSHB 2LZJA 3FDYA 4U7BA 4C2UA 1NG6A 1H8EA 2L9SA 3E0JB 2UVEA 3S32A 3K4MA 4YRVA 4IQJA 2HVSA 1WJ5A 3VSLA 1NHCA 2KZVA 3LSGA 4OAZA 1UG0A 3AL0B 2PYHA 1G8XA 3T56B 4BJ5C 3K4CA 1VJSA 3RTRA 3NWTA 4C2TA 2BVLA 3OYEA 3W2VA 2V7QA 4PMHA 2W4SA 2LBFA 2JJ1A 2NSPA 1MMDA 2ZSIB 3EUHC 4II3A 3FKJA 3OMYA 2X1DA 1O8GA 1OGOX 4OAYA 1I8DA 2BVMA 3T51B 3VYTB 3EQOA 3BG7A 2JVGA 2K9LA 2HPMA 3A3BA 2OUMA 4XMYA 3OEHA 3H9QA 3S8PA 2VQCA 3DU5A 4HG2A 4ZJZA 5TGTA 3CP2A 3V42A 3OYFA 2R4GA 4XN3A 2DIEA 4W8RA 1O88A 3S3MA 3OE7A 3A2KA 1E0EA 4XLFA 2VQGA 1O8FA 2DXIA 2AQFA 2RREA 4LITA 3LSMA 2PJRB 2VPLA 4HIZA 3FHNA 4PJNA 2CUZA 2K9MA 1BR2A 3VR6A 3K10A 5IK2A 3FKSA 2XOKA 1UD2A 3GQ8A 4OZYA 4PK4A 3EUAA 2R7UA 1E43A 2PYGA 4RM3A 4AU7A 1KONA 4W8QA 1SFKA 1X4PA 3K4BA 1H8HA 4NC7A 1OHHA 1BLIA 3EQNA 1U0JA 3HL2A 3ZPNA 1W36C 2VJ5A 3B4NA 3IAM2 3GQ9A 3GQBA 1WMRA 1S9HA 3DPLC 4ITVA 4HSRA 2IS2A 2CK3A 2CV0A 4CSWA 3A3GA 3OYDA 3EPZA 3WWGA 4B48A 2W00A 4BEHA 3J7AY 1XG2A 2XF6A 3OYHA 1O8MA 4YELA 3BC8A 1D1AA 1NG7A 1ZELA 3SEZA 2XAUA 4PFPA 3ONQA 1Z21A 1O8IA 1VF7A 4E7SA 4IKFA 3DKXA 3VSKA 3B8YA 2GK6A 1NBMA 2LY2A 3OOCA 1IA5A 1MABA 3ZSCA 3F9KA 5HOOA 1V0EA 1FX0A 4I84A 3OYKA 1IDKA 3M1CA 4XN0A 2DT7B 2LRDA 1VBLA 4N4NB 2K5CA 3HUGB 1J09A 3W2AA 4GRIA 2GJPA 1CZFA 2BW3B 2RQQA 1OOCA 2NT6A 4HPQA 4PJMA 3OY9A 1Z7LA 2GK7A 4AYBA 3K70C 2R9VA 3A35A 3LMWA 3PL8A 2OV7A 4ASUA 1DGWY 2MFZA 1X1BA 1Y6IA 4BEHB 2O5RA 2WA0A 4OJLA 3OOUA 2W7NA 5AMVA 5FRMA 1COWA 4E0FA 3DWLE 1BN8A 3FBIB 1TZLA 4UZUA 1X4OA 3PSIA 3DPTA 4DNRB 3S3OA 2IS4A 1T0FC 4BXFA 4KT6A 2M5SA 1WFXA 2M0MA 1SAUA 2KPMA 1GLNA 3C2GA 3KX2A 2VBMA 1NRKA 2UUZA 1KCCA 2Y0SA 4BQNA 2I8DA 2V31A 3VDXA 1OB0A 2Q1ZB 4BL0B 3GRHA 2LC2A 5HNHA 3PFYA 4Z03A 2JVHA 2DT6A 2NZMA 3OYMA 3OIQA 3ZPPA 3M8JA 4C9YA 4BJ6C 1LDKB 4G6TB 4XLHA 4G7WA 2JA2A 4BE1A 3HC7A 2AQEA 2DOAA 2DJIA 4PJJA 1EA3A 2HVQA 3H5AA 3TL4X 3K4KA 5LFAA 3GQAA 3UW0A 5HVQC 5HNFA 2M3AA 4XD7A 4RMNA 2V9KA 4H4KC 2NTBA 2QE7A 2R7SA 4DJAA 4DOZA 3LFUA 4ZTFA 1DBGA 4OJOA 4ZDOA 2XDVA 4KJZA 2W6JA 4G6IA 2VLAA 2M4GA 2KHMA 3RSNA 2VASA 3K4JA 4NUBA 4BQOA 1K6YA 4HEA2 3LL7A 2JIZA 4NC8A 3UNGC 2W1OA 4XONA 3DPUA 3DU6A 4XKVA 4C2LA 1FMVA 4XOPA 4CCOA 2VXDA 2ZFUA 2CUJA 2PJRA 2E5ZA 2ELJA 3G05A 2WZPP 4CA0A 3MKYB 4Y33A 3OYGA 2IGMA 2MYSA 4QPOA 2X3HA 3KRGA 3QOEA 4Z1MA 4OWRB 4B43A 4KITB 2V6EA 4C30A 2E1MC 3L2VA 1MNEA 2L7KA 4B3FX 1E1QA 1HVXA 1UD6A 3SDBA 2WPDA 4BDZA 1Z3XA 1W36D 2KRHA 4JQFA 1PE9A 3VYRB 4BS9A 1VZ0A 1WPCA 2LH9A 3BCFA 3VMWA 2HVRA 1OR7C 2E60A 5CPRB 3OYLA 1V0FA 5C1CA 2XSJC 2L5QA 3H35A 4P22A 3BG6A 1PLUA 1MMNA 1BMFA 2QY1A 1T95A 4XLAA 1UD4A 1D1CA 4ZC3A 2CFOA 4F52A 1DBOA 2CH0A 2F43A 2KL4A 4IQ4A 4PSWA 4DGWB 4D9JA 3FPPA 2UV1A 2EWEA 4CUGA 1YX3A 2OC6A 1X1CA 2X6WA 3ZRGA 3OYJA 2MC4A 2QX3A 2LYCA 3E1SA 2KQRA 4IZZA 3T53B 2M7AA 3NWSA 3OPOA 4BE0A 1BOBA 2IXSA 3OR1C 4ZDLA 4NNJA 1HG8A 2BW3A 3OAAA 3DLAA 4ZTJA 2Z6BD 3HPGA 3DKYA 3IAS2 1WJBA 4LG3A 3GVJA 2JJ2A 4GQNA 2E1MB 2VL8A 2VQHA 1MNDA 3OL4A 4PSXA 3K70D 1RU4A 4E6KG 1FMWA 5KNLA 1OFMA 2CW7A 3BCDA 4YZXA 3CP8A 1UELB 3DDYA 3K6GA 3QODA 1PJRA 2VJ4A 2ZXHA 1JTAA 1BR4A 2R7TA 4L8JA 2VKDA 1LKXA 4F55A 2GOMA 3D5LA 4JOMA 4EATA 1PKVA 4HSTA 2XZLA 2QKLB 2BOLA 1JI8A 4OJ5A 4HNTA 4LIUA 4XKCA 2R7RA 3HG9A 2IGKA 1KTWA 3CF2A 2VIXA 3OWTA 3L2RA 4XM3A 4F91B 3KYLA 3VMVA 2INUA 2WY8Q 3SUCA 2E5NA 4F3QA 3OW7A 3OS0A 1OFLA 2RNGA 3LSKA 1X1AA 1YX5A 1K5CA 4E7KA 3I3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBK A;  3EQO A;  2NTB A;  2ODL A;  4XQF A;  1DBG A;  4OJO A;  4YEJ A;  1IDJ A;  2VJJ A;  4U4B A;  1RMG A;  4XMY A;  1RWR A;  4XON A;  2BSP A;  4XKV A;  4W8R A;  4C2L A;  4XN3 A;  4XOP A;  1O88 A;  2UVF A;  4YZA A;  1PXZ A;  4XLF A;  2NTQ A;  2Z8G A;  1O8F A;  2VJI A;  2O0W A;  2X3H A;  3B90 A;  3KRG A;  2IQ7 A;  4NK6 A;  1BHE A;  2PEC A;  4XL9 A;  3VST A;  3GQ8 A;  4OZY A;  4XNF A;  1X0C A;  4YZQ A;  2PYG A;  1IB4 A;  4W8Q A;  4XOT A;  4EW9 A;  3EQN A;  1PE9 A;  4XLE A;  1H80 A;  3VMW A;  3B4N A;  3GQ9 A;  1QCX A;  4YZ0 A;  1WMR A;  3T9G A;  3GQ7 A;  1OGM X;  2O04 A;  1PLU A;  2QY1 A;  2X85 A;  3WWG A;  4XLA A;  1DBO A;  1JRG A;  4AVZ A;  1EE6 A;  1XG2 A;  4W8T A;  4NK8 A;  4OZZ A;  1O8M A;  4YEL A;  2EWE A;  1QJV A;  2X6X A;  4MXN A;  2QXZ A;  1O8I A;  3B8Y A;  2X6W A;  4U49 A;  4MR0 A;  3VSV A;  2QX3 A;  2NTP A;  1O8J A;  1IA5 A;  3ZSC A;  3JUR A;  4I84 A;  1HG8 A;  1IDK A;  4XN0 A;  1VBL A;  1O8E A;  2O0V A;  2NT9 A;  4XR6 A;  1CZF A;  1OOC A;  2NT6 A;  1O8L A;  1RU4 A;  4OJ6 A;  1OFM A;  2X6Y A;  3FY3 A;  1O8K A;  3LMW A;  4W8S A;  4OJP A;  4YZX A;  4URR A;  4XKW A;  4OJL A;  1O8H A;  2NST A;  4XLC A;  5AMV A;  4Z06 A;  1O8D A;  1BN8 A;  5C1C A;  1GQ8 A;  1JTA A;  4XOR A;  1AIR A;  3VSU A;  2VBM A;  2UVE A;  2O17 A;  1KCC A;  2O1D A;  4OJ5 A;  1NHC A;  3GRH A;  4Z03 A;  1KTW A;  2PYH A;  2NZM A;  5C1E A;  3ZPP A;  4XLH A;  4XM3 A;  1KCD A;  3VMV A;  4Z05 A;  2INU A;  2VBE A;  4PMH A;  3SUC A;  2INV A;  1OFL A;  2NSP A;  3GQA A;  3UW0 A;  1K5C A;  4HWV A;  1OGO X;  1O8G A; 
#chains in the Genus database with same CATH topology
 4M6X A;  4EQQ A;  3TO6 A;  2HZD A;  3ZQH A;  4YEJ A;  2QZA A;  4DZJ A;  3HOT A;  2KIQ A;  5E6T A;  2Z99 A;  3GME A;  1H9G A;  2VJJ A;  5K5O A;  4BAC A;  2R7X A;  1HZE A;  5CDF A;  4KYW A;  4G8X A;  2RV8 A;  4Z4T A;  1D0Y A;  4IO9 F;  1ZLJ A;  1WP6 A;  4WX9 A;  1LE8 B;  1N0U A;  5IYP A;  2K9S A;  3CZ6 A;  2XZO A;  3CCE B;  3MVP A;  3DXJ F;  1S3J A;  3BY2 A;  3TGN A;  5IOY A;  3W2W A;  3HOU J;  4TN1 A;  1HCR A;  1N78 A;  3AVT A;  2QZ8 A;  5JHU A;  1X0C A;  1FTT A;  4BXU A;  2B7B A;  1EH8 A;  5D5V B;  3HRM A;  3ZCO A;  2LF8 A;  4CCN A;  4KN7 X;  1E1R A;  2M0C A;  3ZQ7 A;  3T9G A;  2F5D A;  3NEU A;  4XRS G;  1E2X A;  3IUO A;  2IPQ X;  5DNS A;  2E1O A;  2WAE A;  4L9T A;  4AVZ A;  4J01 A;  3DTK A;  4S04 A;  2NOJ B;  2E2I J;  1KQS B;  3DTE A;  1QHG A;  2ID3 A;  1QJV A;  1BW6 A;  5FIU A;  4EM0 B;  3SYT A;  2C77 A;  1VTN C;  3ZQI A;  3LMM A;  1SAN A;  2EFQ A;  4E7H A;  2A5W A;  2K40 A;  4CZC A;  2VB6 A;  4A3I J;  1AHD P;  2WYR A;  1OCP A;  3L2W A;  3RKQ A;  3OP1 A;  1RET A;  3HOZ J;  3BLY A;  2K3P A;  3JUR A;  3LA3 A;  2XAQ A;  4RAZ A;  2XF5 A;  3QWL A;  2F4N A;  3DQV C;  2LRE A;  2X0L A;  4ANJ A;  2DYS H;  2QQA A;  4KUM A;  2BV3 A;  2E1N A;  5BPI A;  2JUC A;  2CS3 A;  3LST A;  3A1P A;  2VNH A;  4X8I A;  1OPC A;  3S2H J;  1CNE A;  3R4K A;  5LRS A;  3FIS A;  3HOY J;  1RPW A;  2BXY A;  4ZGN B;  3FF5 A;  2LP0 A;  3HGG A;  1YHQ I;  3G1L A;  2Y30 A;  3LSJ A;  2XGE A;  5EGO B;  5F27 A;  3ZZU A;  4NB5 A;  1QX4 A;  2F4I A;  2GXG A;  1I18 A;  4B1R A;  4UUV A;  3M8E A;  3WU2 C;  1W0J A;  2NST A;  3KEY A;  3NRV A;  2G0Y A;  1O8D A;  3B02 A;  2B5O A;  1UFM A;  2CUE A;  2HDW A;  3OS2 A;  3NE5 B;  3DU1 X;  4P1W A;  3S93 A;  2JSP A;  4CO8 A;  4D7N A;  5C1C A;  4M74 A;  1LVK A;  4Z4Z A;  1REP C;  2HLD A;  3K1N A;  1VQO I;  3VSU A;  2C4U A;  5J1Y A;  2CC2 A;  3H92 A;  3JQP A;  1B59 A;  4M3G A;  1W9X A;  1R6R A;  4IHY A;  1GVH A;  3V8K A;  1TVC A;  5FO5 A;  2CND A;  4U0W A;  5EF6 A;  3GTO J;  3FXJ A;  4KN4 X;  1VHE A;  4OOI A;  1FBU A;  3MQ0 A;  2FQ4 A;  1KCD A;  4DK1 A;  3ASR A;  4Z05 A;  3JR9 A;  4KIB A;  1IV6 A;  4UXN A;  2X8K A;  2VBE A;  1BX0 A;  3A1Y A;  3N05 A;  3FK7 A;  4NQW B;  3I55 I;  2XC1 A;  4YAU A;  1HXD A;  4A5M A;  4HF2 A;  4P55 A;  5LGN A;  5GTH C;  3IRQ A;  5KSW B;  1TYV A;  3W6V A;  3Q0W A;  3BG9 A;  1RES A;  4LIV A;  3OYN A;  2BMW A;  2VOD A;  1QH0 A;  1VQ7 B;  1EKE A;  5EZG A;  4KKU A;  3TP0 A;  1B2R A;  2XC7 A;  1D1B A;  1FBQ A;  1NK2 P;  3AK5 A;  3T5X A;  3Q5F A;  1XB2 A;  2ZTN A;  4U4B A;  1TNS A;  5CYV A;  2R5Y A;  1VQM B;  2OZU A;  5LD2 C;  1S6L A;  2ZJ2 A;  3RZD J;  3HDD A;  1FND A;  4A6E A;  1GAQ A;  2J8I A;  4RAG A;  4B3G A;  2CV1 A;  4XSZ F;  2XF7 A;  3JCU C;  1ETQ A;  2DCE A;  4L5I A;  1OYY A;  3CQZ J;  3B90 A;  1TQP A;  1GVJ A;  2M9H A;  2GLO A;  4KIF A;  3K1P A;  4J00 A;  1MBJ A;  4HNU A;  1BQE A;  4G1B A;  1S7O A;  4XL9 A;  3I9V 2;  2JN9 A;  4RB2 C;  2VPR A;  3ZQQ A;  5FLX Z;  2VYQ A;  3CUQ A;  4W97 A;  4I99 C;  1BX1 A;  1PJ7 A;  2XGJ A;  1XSV A;  4M9S A;  3TBI A;  4YHB A;  2ID6 A;  2MLG A;  1BI3 A;  1J0R A;  1WSR A;  3LNN A;  1KQ8 A;  1Q9S A;  4TT3 A;  4R79 A;  2G7H A;  3CCV B;  3FMR A;  1JKP C;  3GVK A;  2L3D A;  4M2L A;  3ZGK A;  1WOR A;  3WHC A;  5J47 A;  4A3J J;  3BCA A;  4Y17 A;  5DCM A;  3O8H A;  3TW7 A;  4YC5 A;  2X6O A;  1JRG A;  2VFN A;  2CRG A;  1D1N A;  3TED A;  4OZZ A;  1ERD A;  2PMH A;  2YWE A;  1GJR A;  2X6X A;  1CNF A;  4X0C A;  1HDD C;  4KIS A;  4FTH A;  4U49 A;  1WI9 A;  1VF9 A;  2VNI A;  2YU3 A;  3RPU D;  2XPW A;  4ETS A;  3AL0 C;  4IX7 A;  3F8C A;  2HOE A;  2A68 F;  3LNQ A;  2F5E A;  3AGP A;  3GWZ A;  1F36 A;  5FB2 A;  1O8E A;  1LNW A;  3VB2 A;  1HSJ A;  4LOC A;  2OAZ A;  1S7E A;  2QQ9 A;  2R7W A;  1OGJ A;  4KKT A;  1Y56 A;  2Y0S N;  2H1L A;  3JRG A;  3BR2 A;  2R7Z J;  3MHP A;  5CVR A;  3C2H A;  4MEY F;  2DI3 A;  3LAP A;  2WY7 Q;  4II2 A;  3E6C C;  4BE2 A;  2DN0 A;  1YJW I;  5DN6 A;  2LD5 A;  1MW7 A;  4Q5S F;  3R0A A;  3CC2 I;  1LLZ A;  1XB4 A;  2NV4 A;  2E71 A;  4RLQ A;  3CCQ B;  1WJD A;  2R5Z B;  4RB1 A;  2ZCW A;  3V8J A;  4OOX A;  3KP7 A;  4XKW A;  2LY1 A;  3A8K A;  4TMX A;  3ZBT A;  5HZB A;  1R23 A;  1R4N B;  2YX7 A;  1A31 A;  2DET A;  2J5P A;  4RGU A;  1BJZ A;  1WXR A;  5JI6 A;  2CV2 A;  1KJZ A;  3HOS A;  4LBV A;  2YSR A;  1RKW A;  4HZF A;  3D5S C;  2LR8 A;  2BF4 A;  3ZPL A;  2IA0 A;  1R1V A;  1ETY A;  2LZJ A;  1TWF J;  1X2N A;  4ZZD A;  1VQ4 I;  1FNC A;  4C2U A;  3WG9 A;  1NG6 A;  2DA7 A;  3AVX A;  1IW7 F;  1Q7Y D;  2UVE A;  2XT2 A;  4BY7 J;  4IQJ A;  1NTC A;  2CJJ A;  4QSH A;  3VSL A;  1OCT C;  2KZV A;  4N3G A;  1OFC X;  2R3S A;  3K4C A;  4PAA A;  3RTR A;  1P2F A;  3NWT A;  3SZT A;  4K1X A;  4G12 A;  1JHH A;  2E2J J;  3OYE A;  3W2V A;  2V7Q A;  5CVJ A;  4UV8 A;  2OTL B;  5JLW A;  3LQQ A;  3WU0 A;  3WHB A;  2YWH A;  2O61 A;  1OGO X;  2G7U A;  2BVM A;  3VYT B;  5GPC A;  3M8F A;  3ONU A;  1G7C A;  3AST A;  1HKT A;  2C5B A;  1ZQ3 P;  5JR3 A;  5L3E A;  1JKO C;  1Z91 A;  3ABK H;  3DBL B;  2XAH A;  4JX5 A;  2BYV E;  3NAW A;  2W84 A;  4V02 C;  1WCM J;  2F48 A;  2VQC A;  1TL8 A;  2EZI A;  3DBR B;  1SAX A;  4YII A;  4XN3 A;  2DQR A;  5HDK A;  1FWZ A;  2RRE A;  3E20 A;  2H27 A;  2CUZ A;  3S17 J;  4OP7 A;  3G6E B;  1U5T C;  3K10 A;  5J8F A;  5IK2 A;  2OCE A;  3GQ8 A;  2V7T A;  4PK4 A;  5LGT A;  2R7U A;  2COM A;  3SZP A;  1O3R A;  5H20 A;  3ZMT A;  1DG1 G;  4Z4S A;  3HUG A;  3BQZ A;  2PYG A;  5HS7 A;  1X4P A;  1WWX A;  1RZ4 A;  2M87 A;  3G1O A;  3WTY C;  1BLI A;  3EQN A;  3LJY A;  1FSH A;  4ZZL A;  1JTY A;  1YIT B;  1TYX A;  3GQ9 A;  2NXN B;  3ZMS A;  3CUO A;  5BPD A;  3COA C;  1EJ9 A;  2MH9 A;  5CJ9 A;  1MSE C;  3CB4 A;  3SJP A;  3GFM A;  4HF0 A;  2CV0 A;  4MTE A;  2XB5 A;  1AWC A;  1X3W B;  2JMW A;  4CYC A;  4LLN A;  2R92 J;  1MKM A;  3HGY A;  3J7A Y;  2V6C A;  2Q6L A;  2V9V A;  4I76 A;  4TMT A;  1OQY A;  1UMQ A;  4KDP A;  2JA8 J;  1IHM A;  1VF7 A;  3DKX A;  2Y0M A;  1NBM A;  2DMU A;  5JLX A;  3CCR I;  1MAB A;  2E36 A;  2H6B A;  3F9K A;  3S15 J;  3ZSC A;  3BH6 B;  5J6X A;  1V0E A;  1KYZ A;  1FX0 A;  1IDK A;  3M9A A;  4CYD A;  1G3S A;  2K5C A;  1R58 A;  1YJ9 B;  3Q3A A;  4LBW A;  4GRI A;  4G6D A;  1BIB A;  3OJX A;  3O6B B;  2VBX A;  5FLX K;  3QFS A;  2EIL H;  2CQN A;  4RDU A;  3MZH A;  2AXL A;  4KMU X;  3MZY A;  1CF7 B;  2CRV A;  3SYJ A;  2IVM A;  3BJ6 A;  3A35 A;  5ICG A;  5KAF C;  1FJL A;  3IH2 A;  3ML3 A;  1BI2 A;  3FM3 A;  3D1N I;  1VQP B;  4OJL A;  1X2M A;  1QZE A;  2Y75 A;  2MD5 A;  4E0F A;  3DWL E;  3DF8 A;  3TO9 A;  1OGI A;  1BN8 A;  2C5H A;  4FE4 A;  4YFK F;  3I54 A;  2O9L A;  5DD8 A;  2QEN A;  3PSI A;  2QDX A;  3OKX A;  3HKZ N;  1T0F C;  2YWG A;  3WTU C;  3KEO A;  2CUF A;  2HQR A;  2M5S A;  4LC0 A;  1EA0 A;  3SJM A;  4HW0 A;  1USS A;  1ZKG A;  2BM7 A;  2Y0S A;  4BQN A;  2V31 A;  2EWN A;  4A12 A;  5DD4 A;  4RB0 A;  1BBY A;  3JRH A;  2QQ8 A;  4HE5 A;  3ZPP A;  3OIQ A;  4C9Y A;  2QM3 A;  4IRG A;  2XTW A;  2CO5 A;  3CC2 B;  2IP2 A;  3GVA A;  2DJI A;  4ENJ A;  2EA4 A;  1EA3 A;  1QRB A;  3GQA A;  3BG3 A;  3MN2 A;  5FLV A;  2XRO A;  4RGX A;  4XD7 A;  2QA4 B;  3LFK A;  1QPM A;  4H4K C;  3R0J A;  2AHQ A;  2QE7 A;  5EG0 A;  3S2D J;  4ZDO A;  3ABL H;  1R22 A;  4KJZ A;  3CLO A;  3VOE A;  1R5H A;  4BYY A;  2JA5 J;  1QFY A;  1EP1 B;  2KHM A;  3D0S A;  3K4J A;  3R6K A;  3LYC A;  4HEA 2;  1G6N A;  1LFB A;  3LL7 A;  5DCF A;  1VQ4 B;  4ZH4 F;  4XRS A;  4MQV A;  1VQ5 I;  1MBE A;  3WE2 A;  2EB7 A;  4XOP A;  1R36 A;  2DTR A;  2E5Z A;  2ELJ A;  2YR2 A;  4RGR A;  5HS9 A;  3CXC B;  3TDZ C;  2F2E A;  4RB3 C;  3CCL B;  4H0E A;  2IGM A;  4QPO A;  4UAJ A;  3KRG A;  2HR3 A;  1Z77 A;  4OWR B;  3L1P A;  4KIT B;  2LKX A;  2DMN A;  3E7L A;  5B66 C;  1W0U A;  2E2H J;  1H85 A;  2OTJ B;  2FD5 A;  3FWE A;  2PQ8 A;  4OU0 A;  2DK8 A;  2Z33 A;  2X9D A;  2BY2 A;  3M07 A;  1E1Q A;  3CD6 B;  1D5V A;  2LTP A;  3GW2 A;  1O7F A;  1EFT A;  2W48 A;  3MFK A;  1Z3X A;  5JLV C;  4X7D A;  1PP7 U;  5KK1 A;  1LM1 A;  2F4O B;  1AKH A;  3DCF A;  1WPC A;  4AF6 A;  2XEX A;  5BSX A;  2CQQ A;  3R61 A;  2A61 A;  4EMS A;  5ED4 A;  3OYL A;  2DTZ A;  1FP2 A;  2XSJ C;  3QQA A;  4BPR A;  2VNK A;  3L00 A;  2ZC2 A;  2QY1 A;  1UD4 A;  2GXA A;  4ZC3 A;  3J7Y J;  1FOY A;  3R60 A;  4IQ4 A;  4M6Y A;  3BY6 A;  4DGW B;  4D9J A;  2L7Z A;  1ZRD A;  3FIW A;  3Q6R A;  2IW5 A;  4Z4R A;  2EWE A;  1QO0 D;  4UVA A;  4OPO A;  2OC6 A;  2HYG D;  2PN6 A;  3RDI A;  2BY1 A;  1NK3 P;  4QV2 A;  2X6W A;  3CME I;  1S5L C;  2TRT A;  2FJ1 A;  1IJE A;  2QX3 A;  3CPW B;  2LYC A;  1IGN A;  2B7E A;  3LA7 A;  5E3O A;  1QRC A;  5EMN A;  4BE0 A;  2V7V A;  1BOB A;  2IXS A;  3GTQ J;  2O6W A;  2DA4 A;  3BOQ A;  5DDG A;  2ISZ A;  2OBP A;  1U5T A;  1WOP A;  4RJL A;  2EPF A;  2OQR A;  1FRN A;  3HPG A;  1HKS A;  4P3Y A;  4Y13 A;  3HTS B;  5J4V A;  3WNC A;  5ILV A;  3BZ6 A;  2JJ2 A;  4V2F A;  4BKX A;  2E1M B;  5C3E J;  3QFC A;  3OL4 A;  2VBZ A;  4E6K G;  1DU0 A;  4M9X A;  2QSG X;  2XGC A;  1WH7 A;  4M72 A;  3KZI C;  1YX2 A;  2ISY A;  4YFX F;  4A3K J;  4BY1 J;  4KMF A;  5B1B H;  3BCD A;  1ZN2 A;  2XUB A;  1LDJ A;  3GFL A;  3VO1 A;  4M9Z A;  2MLK A;  2KJC A;  2W57 A;  2QTL A;  3K6G A;  3HSF A;  1MSF C;  1R5G A;  3CCR B;  3PUN A;  1EZG A;  2V5I A;  3W6K B;  3TW6 A;  2NVY J;  4GFB A;  4OMY A;  1K8F A;  1GDT A;  4L8J A;  1LKX A;  3BTI A;  2GOM A;  2IBD A;  1DAR A;  1QA2 A;  4HST A;  1T6S A;  1JI8 A;  4OJ5 A;  4QWQ A;  4LIU A;  4OM9 A;  3ZQF A;  4B4D A;  5TRD A;  2ECB A;  3OWT A;  2A5Y B;  3L2R A;  2VFO A;  2GWR A;  1B9N A;  5IYW A;  2INU A;  2E5N A;  1MBG A;  3SUC A;  3OS0 A;  1OFL A;  3EET A;  2RNG A;  3O2P E;  3JQQ A;  3ASN H;  3LSK A;  1X1A A;  4IHV A;  3I53 A;  4AWX B;  4E7K A;  1W2B B;  5JMC B;  2QSF X;  2KMU A;  5E3L A;  4Y3O A;  5FJ8 J;  3OYB A;  2HI3 A;  2C6Y A;  2FOK A;  5CVI A;  2IGN A;  4F92 B;  1XX5 A;  2I1L A;  1K28 D;  2L0K A;  3FHZ A;  2Q6I A;  4XIC A;  4MQ9 F;  2OYN A;  3BPX A;  5JHF A;  1YI2 I;  3TOB A;  3PNV A;  4TKO B;  4RAY A;  1QRY A;  2R5Y B;  1ZG1 A;  1T0F A;  3BP8 A;  2O0W A;  2ICW G;  2IOU G;  4RM2 A;  2WAD A;  2V7W A;  3ZR8 X;  1IDZ A;  4LG0 B;  1EFR A;  4GGG A;  4MLO A;  2OPT A;  1MBK A;  1O7L A;  1KU7 A;  2VUM J;  4RD2 A;  1W5T A;  2QSH X;  1U2R A;  4YZQ A;  5A2Q Z;  2F6C A;  1MJB A;  3AAF A;  1RKT A;  2BM6 A;  2EV0 A;  5ILS A;  5IY5 H;  4NCN A;  3ABU A;  2GIV A;  2KLO A;  3CUQ B;  1WDT A;  3EUK L;  2KRC A;  5LEK A;  1MMA A;  4ZV4 A;  1R49 A;  3L09 A;  1EF4 A;  1V5E A;  2K7L A;  5ICE A;  1VQN B;  1H0M A;  3GQ7 A;  2M1B A;  1I6X A;  2O04 A;  3FXK A;  3NAU A;  2Q6K A;  3QFT A;  3GUD A;  1TWH J;  3SLD A;  1Z3Y A;  1VQ5 B;  3ISX A;  1CLW A;  3BDD A;  1VND A;  3C1D A;  4CZZ A;  4Y7N J;  4HBL A;  3CCS B;  2GA2 A;  4EEF G;  3ZP5 A;  2R0Q C;  2NVQ J;  4NK8 A;  2JA7 J;  3KFW X;  2LY9 A;  3JRE A;  5DCM B;  5K7Z A;  5HKK A;  3GYH X;  4MTD A;  1P7J A;  2W82 A;  4U87 A;  1SFX A;  2LOO A;  3VSV A;  1E79 A;  3NQO A;  1RNL A;  4E7I A;  1O8J A;  2O0Y A;  4LFU A;  4PGO A;  2WJY A;  2Y69 H;  5IYC J;  1LJ9 A;  2HQA A;  3REO A;  3WTV C;  3CTA A;  4C3I J;  2NT9 A;  3H09 A;  4RS8 A;  1PUF B;  1XD7 A;  2ZBK A;  5BOX A;  2JA6 J;  2A6H F;  1S7A A;  2QGG A;  2M45 A;  1HDP A;  4AD9 A;  4YAL A;  4ACB A;  2PX9 A;  4WWV A;  2MAB A;  2L54 A;  5HLT A;  3MZ8 A;  5CQE A;  1GXP A;  2CBX A;  4URR A;  3B8H A;  2BGI A;  3T0Y A;  1QQI A;  1L0O C;  2L7F P;  1HW5 A;  3HZJ A;  1WQ2 A;  4Q48 A;  1V55 H;  1WJE A;  5CLS A;  3F8M A;  1I39 A;  2GAU A;  5IP6 A;  3FXR A;  1TQI A;  3U9G A;  2HFH A;  4BDY A;  4MO7 A;  1BW5 A;  1YLF A;  2LKS A;  5KCM A;  3GFJ A;  5J8C A;  1QGP A;  1APL C;  4P12 A;  1MGT A;  5AN9 A;  1JGS A;  2O17 A;  2AO9 A;  2RDP A;  2O1D A;  1W5S A;  5LGU A;  3WYA A;  3QYE A;  2J5O A;  2HXI A;  4FET A;  5J1U A;  1MH4 A;  4TSF A;  4MIM A;  4ZYE A;  3AVY A;  4CGZ A;  4E4H A;  1OCO H;  1XGO A;  5ICF A;  1OYI A;  3PVD A;  3ZMD A;  3LSI A;  1S0U A;  1YIJ B;  1XMA A;  2QYO A;  2Z16 A;  1WJF A;  1D0X A;  3GLL A;  5LLQ A;  4XLP F;  4E7J A;  3OSG A;  4QIW N;  4HWV A;  3ASO H;  2RVC A;  4B8X A;  2RC4 A;  5HDG A;  1JA0 A;  3KZZ A;  1P9Q C;  5D5U B;  1UHM A;  3H0D A;  1IXS B;  1KQ9 A;  2E19 A;  2V7F A;  5L3D A;  4ZCI A;  1RMG A;  1VQ8 I;  1RWR A;  1JXS A;  2DCU A;  4HDU A;  5CKT A;  2BSP A;  1FNB A;  3IWF A;  4P5O A;  2R7O A;  2Y48 A;  3AG4 H;  4JMQ A;  5DSZ A;  2UVF A;  4KNY A;  2BHY A;  5EYR A;  3RZO J;  5THX A;  3CJN A;  3I56 B;  5F0F A;  3BTC A;  2IQ7 A;  3DBH B;  1ETO A;  3QYB A;  1Z1D A;  1UAA A;  1VQK I;  4NK6 A;  3H3U A;  4M6V A;  3AG2 H;  1LEB A;  1TTY A;  2R93 J;  3H5N A;  4FHT A;  5BQT A;  2D3L A;  2VOP A;  4OOS A;  2RC6 A;  4EGZ A;  4EVI A;  4RDL A;  2YWF A;  1G7S A;  2CQK A;  4MFE A;  2LG4 A;  3EYY A;  2V1N A;  1QA1 A;  1G3Y A;  1I3A A;  3L9F A;  3V7C A;  2YU9 J;  2QYU A;  5EZH A;  2JZY A;  1PYV A;  1AIP A;  4WXC A;  1J7K A;  1Y1V J;  3H3Z A;  3FK6 A;  2ZL6 A;  1QCX A;  4YZ0 A;  2L9N A;  2K86 A;  2XZP A;  3BH7 B;  1MJ9 A;  1OGM X;  2ZME C;  2WC2 A;  2L02 A;  3ZZ0 A;  1RIO H;  3ESW B;  3MKZ A;  3IV5 A;  2M5W A;  1EE6 A;  1EFU A;  4X0G A;  3G3Z A;  4ZYH A;  1B72 B;  4CYC B;  1LFU P;  4MXN A;  4TMV A;  1ENH A;  2H8R A;  4CCM A;  2QLZ A;  2FVG A;  2P0W A;  2ZJP F;  1IN4 A;  2O8X A;  4OIP F;  2KDO A;  4BUP A;  3H94 A;  2V1D A;  1TSP A;  2WBM A;  3CMM A;  4A69 C;  2ZL5 A;  1A5J A;  5F4M A;  3VFZ A;  1IJF A;  1RQP A;  4ZYA A;  1SD6 A;  4JRA C;  1VQ6 B;  3P9C A;  1VI0 A;  1IB4 A;  2CW8 A;  4CCK A;  3Q0U A;  3CMY A;  1QFZ A;  1Q81 D;  2D9R A;  5A2Q K;  1HLV A;  4OJ6 A;  1IXR C;  4G5G A;  1TWG J;  2EFN A;  3G2B A;  1PJ5 A;  3J80 Z;  1KGS A;  2IT0 A;  2J7K A;  4D1Q A;  5J4Y A;  3CJQ B;  3RI4 A;  1E3Z A;  1J9Z A;  3S1M J;  5GV7 A;  3J7Z I;  3I4N J;  1GHC A;  1O8H A;  3A0B C;  1FC3 A;  2ZZG A;  3HPH A;  3W3C A;  4B47 A;  2HXO A;  1X1D A;  2VQL A;  3PNT A;  3ML6 A;  4RA2 A;  2E1B A;  3ABM H;  4L0Z B;  3G73 A;  1SKQ A;  3OZV A;  2EIJ H;  3GTK J;  4U7B A;  4Q4Z F;  1WSU A;  3DLL F;  3CDI A;  2EV6 A;  3CRZ A;  2FF4 A;  1HA3 A;  1A8P A;  1QVG B;  2HVS A;  2HOS A;  5D8K B;  2V1U A;  4OAZ A;  1WSV A;  3AL0 B;  1G8X A;  4R1H A;  1MBH A;  3JRB A;  2L9R A;  3IRR A;  2Z9O A;  1R5N A;  4RD0 A;  4HX7 A;  3CCM I;  4PMH A;  5DEQ A;  1HBX G;  2W4S A;  2JJ1 A;  3CC4 B;  2ZSI B;  4I98 B;  4II3 A;  2E7X A;  2Q2E A;  2ZXJ A;  3ZUG A;  2X1D A;  1JNY A;  3BT9 A;  2C78 A;  2MBF A;  4NHJ A;  3CJT B;  5D5W B;  2FOW A;  2K9L A;  2WTE A;  5F4J A;  3IKT A;  3JTG A;  4PGH A;  5EG0 B;  3FXO A;  2COB A;  4XMY A;  3H9Q A;  3S8P A;  4HG2 A;  3GTL J;  3NB2 A;  3OYF A;  3CP2 A;  2DIE A;  4X06 A;  2KDZ A;  1O88 A;  1XC5 A;  1XQB A;  1K73 D;  2FML A;  1TYU A;  1RQR A;  1E0E A;  1MDM B;  4XLF A;  3F6O A;  3ASS A;  2VQG A;  3SEJ A;  2DXI A;  3H36 A;  2AQF A;  2K3F A;  5HXB A;  1XE1 A;  4WCG A;  1Y1W J;  4Z4W A;  2BV6 A;  4PJN A;  3A8J A;  1BR2 A;  1BC7 C;  2M8E A;  1EV7 A;  1JHF A;  4UV9 A;  3EUA A;  1E43 A;  1XMX A;  2QEX B;  1SFK A;  4MYU A;  4NC7 A;  2NVU B;  3U6B A;  3GFI A;  3HL2 A;  1X1P A;  4A0Z A;  1RUO A;  1W36 C;  2BN4 A;  1KZH A;  2VJ5 A;  2MG4 A;  4RLZ A;  4QFM A;  1GAW A;  1J9I A;  3CCU I;  1TT5 B;  3HYI A;  5HLH A;  2IS2 A;  2CK3 A;  3GSI A;  3PFI A;  3JQR A;  3SHF A;  1FP1 D;  5FO0 A;  3A3G A;  5F64 A;  4DYQ A;  4EJW A;  1S72 B;  1K8A D;  1FTZ A;  4B48 A;  2MSY A;  2W00 A;  4MFD A;  4P9S A;  2WV1 A;  4IHW A;  1ULY A;  3OYH A;  3S1N J;  4YEL A;  2E35 A;  3BC8 A;  3KP2 A;  1D1A A;  1O8M A;  2EFG A;  3U6K A;  1PUE E;  1ETX A;  4YAF A;  1OFE A;  3TP3 A;  3B8Y A;  4IKF A;  1YYV A;  1R00 A;  3WGG A;  3PO3 J;  1OIS A;  1T6Z A;  1ZM3 A;  3A0H C;  2MC3 A;  4LMY A;  4ESB A;  2EBI A;  5HOO A;  4I01 A;  2PG4 A;  1WGX A;  2PEX A;  1YIO A;  3VNU A;  2LRD A;  1VBL A;  5FFZ A;  1V54 H;  3HJE A;  2RQQ A;  4WXD A;  1U5T B;  4G9Y A;  5B3S H;  3HSE A;  1DDI A;  3ZZT A;  3H1C A;  1V3F A;  2BM1 A;  3WND A;  2P4W A;  2GK7 A;  1U9N A;  2X0K A;  3FXL A;  3K70 C;  1IN8 A;  1BN5 A;  4GO1 A;  2BZT A;  4RD3 A;  2BEO A;  3WE3 A;  2O5R A;  4BEH B;  1HC8 A;  3F0C A;  3AGQ A;  5AMV A;  3VOD A;  4WZE A;  5FRM A;  3FXU A;  4X7F A;  3FBI B;  1TZL A;  3KEQ A;  3WBJ A;  3WTS C;  1OJL A;  3MEX A;  1T56 A;  1SD5 A;  4YFN F;  5M3F J;  1P4X A;  5IYN A;  4ZCM A;  1FYK A;  4KT6 A;  3OZU A;  1ZM4 A;  2M0M A;  5C4J J;  3EQL F;  3KX2 A;  4N9H A;  1NRK A;  1UHS A;  4KH3 A;  2B0L A;  3IH4 A;  5LHH A;  5HNH A;  2KJB A;  2NZM A;  3OYM A;  4DW6 A;  3KIO A;  4BXX J;  4BJ6 C;  2QCO A;  1BJK A;  2B0R A;  2JA2 A;  4BE1 A;  3BR6 A;  2X4H A;  2AQE A;  2OJE D;  5JVT A;  5K5Q A;  1YRN B;  3J81 k;  4ZYD A;  3VNV A;  1U8R A;  4Z2Y A;  3W5U A;  2PMZ N;  3I59 A;  4D7M A;  5HNF A;  3K2Z A;  2L4A A;  1J5Y A;  2R7S A;  4DJA A;  4DOZ A;  4ZTF A;  2ZBU A;  3QP6 A;  2FU4 A;  2XKO A;  5CVU A;  3HHH A;  3MCA A;  2IJL A;  4R8H A;  3J80 K;  2VAS A;  1Z6T A;  2JIZ A;  4NC8 A;  2F5F A;  3UNG C;  3S16 J;  2OK8 A;  3GCM A;  4XON A;  4YIR X;  2LDU A;  4UZE A;  4XKV A;  1FMV A;  2PFB A;  4CCO A;  2VXD A;  2PJR A;  2CUJ A;  5H59 A;  1WOS A;  4IW3 B;  3G05 A;  2M34 A;  4Y33 A;  4PC7 A;  2F3L A;  2DYR H;  1G2H A;  2FSW A;  1YHQ B;  2ESN A;  1IG7 A;  4WF2 A;  1Y0R A;  4C30 A;  5L3B A;  1NH3 A;  1HVX A;  4FT8 A;  4MNU A;  1UD6 A;  4XID A;  2NOG A;  2IEK A;  1S29 A;  4BDZ A;  3HTU A;  3MCZ A;  3HRT A;  5E1W A;  4BS9 A;  1VZ0 A;  5F6F A;  2LH9 A;  3BCF A;  3QAH A;  3VMF A;  3VMW A;  1Y39 A;  2O8K A;  2E60 A;  1KYW A;  2DBB A;  4AVP A;  4C2M J;  1LPQ A;  4AID A;  2B63 J;  3QE2 A;  1N8R D;  2F1L A;  3JW4 A;  4P22 A;  3BG6 A;  4EJU A;  3GTP J;  4RD6 A;  1BMF A;  3F72 A;  4N3N A;  1T95 A;  4XLA A;  1VQO B;  2WB1 N;  3V76 A;  1D1C A;  1ZGA A;  2DFE A;  4N9I A;  3AG1 H;  4F52 A;  2DT5 A;  4JK1 X;  1WKM A;  2JQ7 A;  1T8I A;  1ZAR A;  1PJ6 A;  4Y7C A;  5FKM A;  1MNM C;  4CUG A;  3B82 A;  4HQM A;  3A01 A;  3C18 A;  3FMS A;  2XNC A;  1D8K A;  3I55 B;  3ZOB A;  3PUF A;  1L3L A;  1KK2 A;  2M7A A;  5M3M J;  1MH3 A;  4ZDL A;  5LMZ A;  4NNJ A;  3JAM Z;  1HG8 A;  3OAA A;  5E3M A;  3CDL A;  4BHP A;  3ZN1 A;  2HZT A;  2LKP A;  2PIA A;  1W0T A;  2Z6B D;  4DQK A;  3W5V A;  1ZYR F;  3RIQ A;  1AMO A;  1WJB A;  4U88 A;  1Z7U A;  2GXB A;  3H3V K;  4WZT A;  4Z4U A;  1N0V C;  2VL8 A;  2VQH A;  2P5L C;  1MND A;  4PSX A;  5D6F A;  4AM3 A;  1OB5 A;  1FMW A;  2LMD A;  4OMZ A;  2OCC H;  4IOA F;  1OFM A;  3M3Y J;  3OOP A;  3GTJ J;  2CW7 A;  2DQL A;  1G7T A;  1POG A;  1UHW A;  4YZX A;  4LK0 F;  1KK3 A;  5FO1 A;  2FNP A;  3CP8 A;  1Q86 D;  2H94 A;  2YUH A;  1UEL B;  2XB0 X;  4H9G A;  1E17 A;  3IHU A;  3OIO A;  2L7M P;  4X07 A;  3DDY A;  4P3I A;  2E7W A;  4AUX A;  3W2F A;  3KYC B;  1N08 A;  1LLW A;  2MA3 A;  3LAJ A;  2VJ4 A;  1ZK8 A;  2ZXH A;  2ESH A;  2VN2 A;  1JTA A;  1BR4 A;  1PP8 F;  3PA1 A;  1QA3 A;  1LE8 A;  4F55 A;  3ONY A;  4EAT A;  4I0A A;  1P4M A;  2EIN H;  1TWC J;  5F1R A;  3BQJ A;  1LQ1 A;  1GT0 C;  5EJC A;  2R7R A;  4XKC A;  2L9V A;  2IGK A;  1KTW A;  5HZA A;  3LSP A;  1FX7 A;  2VIX A;  4XM3 A;  4PZJ A;  1PDN C;  3ES9 A;  2VFQ A;  2K85 A;  2AXT C;  1KRH A;  3OW7 A;  3A03 A;  5E20 A;  3OW2 B;  1N25 A;  3ERM A;  1YLO A;  1ODD A;  2ODL A;  4CCL A;  1T98 A;  1IN5 A;  4DZP A;  1IDJ A;  2QKM B;  4E7L A;  3Q9S A;  1ON1 A;  1T2K A;  1NB0 A;  2ME0 A;  3LA2 A;  1SC7 A;  4AIK A;  1FLI A;  2WR8 A;  2F5V A;  4BQQ A;  1SFU A;  5FFX A;  2ZJR F;  4YAO A;  3OYI A;  5K1Y A;  2F1M A;  3RQ4 A;  2FA5 A;  3LSH A;  4M3D A;  4ENM A;  2ZL7 A;  3I71 A;  4NDL A;  1R1T A;  3FMQ A;  4YAW A;  2NTQ A;  4A3F J;  1YJW B;  5DS0 A;  3BC9 A;  3GZ5 A;  4GXO A;  5LHI A;  4X7C A;  1R5B A;  3OSF A;  2MD0 A;  4F7D A;  2PEC A;  5E8I A;  3VST A;  4L5E A;  1ZH5 A;  2ME6 A;  4DBQ A;  4XNF A;  3U21 A;  3ZMZ A;  1FOK A;  5M5X J;  2W85 A;  4IVN A;  2BM5 A;  1DU6 A;  5FKL A;  1AA7 A;  4XRF A;  5AIP A;  2UZK A;  1H80 A;  1ZM2 A;  1MRZ A;  2RNJ A;  2XTX A;  1FT9 A;  3C2B A;  4QLC U;  1BOA A;  3BH4 A;  2P5K A;  1J2X A;  4R71 A;  4QPQ A;  1T39 A;  5CQG A;  5LEJ A;  1U3E M;  4AIH A;  3NAR A;  2EIK H;  3SFI A;  5EGO A;  4MEX F;  2EIX A;  2BGJ A;  5L46 A;  1OFD A;  3ZXS A;  3IL2 A;  1I6H J;  4PC6 A;  2HDC A;  3WGH A;  2B7C A;  4UY8 I;  3CPX A;  1IDY A;  3N97 A;  1K4Z A;  1OLT A;  4RCY A;  1VQ9 I;  2VFP A;  4HNV A;  4BGD A;  1V5G A;  4QHY A;  4LD5 A;  1MZB A;  3I0T A;  3ELK A;  4D5C A;  4G7X A;  3K4L A;  3L2Q A;  2M2E A;  4ASN A;  3AKZ A;  2R7V A;  1WTH D;  1T6X A;  5FKN A;  2KIF A;  1ETV A;  3RIR A;  1TBX A;  2QGU A;  2X1E A;  3AVU A;  3W2G A;  1W34 A;  1L1I A;  3OS1 A;  5DUK A;  1M90 D;  1IUF A;  1IZ1 A;  5DS9 A;  1O8L A;  4GYG A;  1WI3 A;  4LB5 A;  3KLN A;  4E7Z A;  4OPV A;  2XV4 S;  2WB1 A;  1ZUN B;  4PFO A;  1HW2 A;  4FCY A;  2X6Y A;  4I0B A;  4QUZ A;  2YX4 A;  2IS6 A;  3CLQ A;  3PM1 A;  2G9W A;  1HA8 A;  2PLF A;  4W8S A;  2P5V A;  1JA1 A;  5IP9 J;  1UMK A;  1K78 A;  3FXQ A;  4M3E A;  3HSR A;  3F8N A;  9ANT A;  4IRH A;  5IPA A;  2F5C A;  3GBG A;  2O7O A;  1G4D A;  2E34 A;  4Q47 A;  4LB6 B;  4DK0 A;  2HGC A;  3E5Q A;  1XPX A;  5JVG F;  1W35 A;  1UD8 A;  2C4T A;  4Y9R A;  3DKW A;  2OBR A;  2M8G X;  5FL7 A;  2GJK A;  2STW A;  4XOR A;  2YS9 A;  3QPH A;  1AIR A;  1QHH D;  2A6E F;  2W6I A;  2DMP A;  4I09 A;  5J40 A;  1B23 P;  3SY2 A;  4LK1 F;  1N77 A;  4ZCL A;  2ZXI A;  1SKY B;  1OCR H;  4KT5 C;  2LK2 A;  1IRX A;  3VYU B;  5FRO A;  1KQ0 A;  2V4D A;  4WQM A;  3KLO A;  5E1X A;  5AON A;  2VOO A;  3CJR B;  1D0Z A;  3RCO A;  2HWV A;  2WSS A;  2W25 A;  2GPJ A;  2LSO A;  4CDG A;  3JAM K;  2M7B A;  1JJ6 C;  2BSA A;  1H8A C;  2INV A;  2EA2 A;  2FE3 A;  1HW1 A;  3KP6 A;  4FK8 A;  1KQ5 A;  4YDT A;  2X48 A;  3EDP A;  3TKY A;  1FIP A;  4XQF A;  2VKE A;  4CCJ A;  2HKX A;  2Q2E B;  3FBN B;  3GZN B;  2ZJQ F;  1B4A A;  3MD2 A;  4JX6 A;  1XS9 A;  5F1J A;  4P26 A;  4PJL A;  5TR9 A;  1JKQ C;  3PJR A;  3V8L A;  4Y4R A;  3IP4 B;  3CMA I;  4M0L A;  1MIJ A;  4OIR F;  4B09 A;  3CC7 I;  1D2E A;  2ZZF A;  2EV5 A;  2V4J C;  4BBR J;  2KIU A;  4A3M J;  1M1E B;  3JRF A;  3BCB A;  4P25 A;  2JUG A;  4XKB A;  4FXU A;  3B6C A;  1BJA A;  4UVB A;  5HLI A;  3F8F A;  3J7A O;  2PBI A;  5FGM A;  1RR8 C;  2P3M A;  2VBS A;  1O3Q A;  3H9J A;  4RAF A;  3RYR A;  5DTD A;  1XGS A;  2OQG A;  2P6T A;  4XOT A;  4D5F A;  3CO7 C;  1MMG A;  2D3N A;  2DYI A;  2ZZE A;  3JU4 A;  5HDN A;  3G4S I;  2HS5 A;  1DP3 A;  2DOG A;  5DM7 F;  4O3M A;  4L9N A;  1VHO A;  3R6J A;  3HKZ A;  4LLG F;  3HRU A;  1SVO A;  3BR3 A;  2ETH A;  3KP3 A;  2DJN A;  5ICC A;  4KKS A;  3CCJ I;  2R5Z A;  2X85 A;  2VBT A;  1WJA A;  1D8J A;  2RGV A;  3Q9V A;  2NS7 A;  1OCC H;  1DDN A;  2BM4 A;  4CIC A;  4W8T A;  2HNH A;  2NNN A;  1W0K A;  1JT0 A;  2NVT J;  1W5C C;  2FQ3 A;  4HQE A;  3I58 A;  3F3X A;  3B6A A;  4M53 A;  2QXZ A;  1UCR A;  3P9I A;  2GQF A;  3P27 A;  2OBS A;  2EZH A;  3JRI A;  2GIZ A;  3K4N A;  3M4O J;  2L2O A;  2Q8K A;  3L2U A;  1Y0N A;  3BQY A;  3HHG A;  4EM1 A;  1UD3 A;  2EJR A;  1JGG A;  1F9N A;  3FJO A;  4B3X A;  2HCJ B;  1ZTR A;  2EZL A;  2GJR A;  4L5J A;  1SFE A;  4RDJ A;  2VBW A;  1LEA A;  4DNT B;  4RBO A;  2O0V A;  2ZTG A;  3GF2 A;  1QZY A;  4UB6 C;  3SEQ A;  1ELO A;  4BHC A;  1T08 B;  4WZL A;  4EV0 A;  3CCE I;  4B4C A;  1E62 A;  3OEE A;  2D45 A;  4WZK A;  4X05 A;  2CYY A;  1QFJ A;  4IPA A;  2FX3 A;  1R71 A;  4N4O B;  1P7I A;  4RLF A;  5BMZ A;  1JJ8 C;  5IYD J;  2XNJ A;  4A3E J;  5LRR A;  3QPT A;  3RJP A;  4XLC A;  5J3O A;  1YW8 A;  3ROU A;  2TCT A;  2FNA A;  2RAE A;  3OYA A;  3SZG A;  1FZP B;  2BPO A;  2XRL A;  1DPU A;  2X51 A;  2X1C A;  2A3S A;  1VQL I;  2VZL A;  1PVE A;  4Y52 J;  4YEI A;  3FDY A;  3K7A J;  3IH3 A;  2CW0 F;  2ECC A;  4P9F A;  2EQR A;  1WHU A;  4UVC A;  3E0J B;  3J81 K;  1XSX A;  3K4M A;  3S32 A;  1Y8R B;  4YRV A;  1WZ2 A;  3S14 J;  2BY0 A;  2I5U A;  3LSG A;  2R7D A;  5H5J A;  5A8A A;  5FA6 A;  1ZGJ A;  2Y9Z A;  1VJS A;  3KP4 A;  2DEU A;  2L4M A;  2BVL A;  4HLX A;  4IJA A;  3BY1 A;  4M1K A;  3PIO F;  3N6Z A;  2FBI A;  2K9Q A;  2LBF A;  2NSP A;  2VE8 A;  4HE6 A;  3OMY A;  1O8G A;  4ZGQ B;  4OAY A;  1I8D A;  3T51 B;  3EQO A;  3CME B;  3I59 B;  1SD4 A;  4OIO F;  2JVG A;  2P7V B;  1K83 J;  1JUP A;  3GTM J;  3A3B A;  4HYE A;  1T38 A;  1K4T A;  2MGQ A;  1U8B A;  4P6Y A;  2FX0 A;  3DU5 A;  2NVX J;  3U2Q A;  5TGT A;  5DUI A;  4A3G J;  1YQA A;  2BE5 F;  3OE7 A;  3A2K A;  3LOC A;  3Q6Q A;  4ENK A;  2DY1 A;  4HX4 A;  4B3A A;  1O8F A;  1FEX A;  4LIT A;  1YFH A;  2HKO A;  3ISP A;  2PJR B;  2VPL A;  2PMU A;  1F43 A;  3F6V A;  4BHB A;  2UXX A;  1FSE A;  2D2W A;  4A6D A;  2XAG A;  4ZYG A;  1UD2 A;  1W87 A;  4OZY A;  2ZNZ A;  4AU7 A;  1KON A;  3FKI J;  1MD0 A;  3K4B A;  1H8H A;  1OHH A;  1QUF A;  3HB9 A;  4U0Y A;  4C43 A;  4MHG A;  3ZPN A;  4DQ2 A;  3B4N A;  3IAM 2;  1TW2 A;  3GQB A;  4ITV A;  5GAH J;  5TJJ A;  4U7D A;  3OYD A;  4HA8 A;  1H9T A;  1FOW A;  1Z05 A;  2BXZ A;  2DA1 A;  4P96 A;  3F22 A;  3L2C A;  3E97 A;  4G1V A;  2JPB A;  3ZBU A;  1YG2 A;  4PDK A;  5FKK A;  3QU6 A;  2XF6 A;  1P4W A;  3KE2 A;  3I4M J;  5J3L A;  1ACI A;  3F21 A;  2XAU A;  3O8G A;  4C0S A;  1O57 A;  4IF4 A;  4E7S A;  1I1S A;  3VSK A;  1HOM A;  5IOZ A;  1H88 C;  4A3C J;  3BR0 A;  4RDK A;  1LDD A;  1VQ7 I;  1LB2 A;  3PIP F;  4I84 A;  3M1C A;  1VQM I;  1KK1 A;  4XN0 A;  2DT7 B;  1R1U A;  2OU2 A;  3HUG B;  2HOA A;  1IF1 A;  1J09 A;  2DA3 A;  5FLM J;  1UB9 A;  5F0C A;  4UNO A;  2NT6 A;  1XDU A;  2XT4 A;  3WTX C;  1HQC A;  4PJM A;  3ZQG A;  3OY9 A;  1YI2 B;  3T8T A;  3KZY A;  3ZN0 A;  4P9U A;  1F20 A;  3JRD A;  5DV5 A;  5D4S A;  3ZC3 A;  3LMW A;  3PL8 A;  3A8I A;  2OV7 A;  4ASU A;  3QPS A;  1DGW Y;  2MFZ A;  3DV8 A;  4J0Q A;  5B5E C;  1TQM A;  4O5V A;  5GAD J;  1F5T A;  5GTI C;  1K7A A;  1I5Z A;  1WH5 A;  1ZG5 A;  1KC8 D;  4G6Q A;  4UZU A;  2XHK A;  4G7Z F;  1X4O A;  1SFO J;  3QFR A;  4WWC A;  2VE9 A;  2XAF A;  1TP4 A;  2HTS A;  5D8L B;  2IS4 A;  2N8G A;  3BZC A;  1BM9 A;  3CCV I;  1RRJ A;  2A07 F;  4XBF A;  5D4R A;  1SAU A;  1YJN I;  2DPU A;  1GLN A;  3C2G A;  2RQP A;  2VBM A;  2VI6 A;  2EZK A;  2I8D A;  1YS6 A;  4FX4 A;  3M7G A;  4IRI A;  3GRH A;  3I64 A;  4G94 A;  2LC2 A;  3BG5 A;  3WXM A;  2AHO A;  2VC0 A;  4Z03 A;  2JVH A;  3E3V A;  1YS7 A;  2DT6 A;  3M8J A;  5F08 A;  1NJI D;  4XLH A;  3HOX J;  2CQ7 A;  1ZR2 A;  4DYR A;  1I27 A;  1D3Y A;  1SD7 A;  2DDB A;  2HQN A;  4PJJ A;  2K27 A;  2CGP A;  2HVQ A;  2EH3 A;  3H5A A;  4KIG A;  4MGR A;  3TL4 X;  2MH2 A;  3LO8 A;  1XMK A;  1F60 A;  4RMN A;  4AC9 A;  4EJT A;  2V9K A;  2NTB A;  2ZKZ A;  3FXM A;  3LFU A;  1D8T A;  4IHT A;  1DBG A;  4OJO A;  4OIQ F;  1FYL A;  3K9T A;  4G6I A;  2VLA A;  2M4G A;  1A6Q A;  3RSN A;  4NUB A;  1VQL B;  1K6Y A;  1OMI A;  3ASP A;  2W1O A;  4S0H B;  3U1K A;  2JSC A;  3DU6 A;  3ZQC A;  2X3U A;  2JT1 A;  2NS0 A;  1RC9 A;  2V79 A;  5TIS C;  1G3W A;  4E70 A;  3WU1 B;  3CCQ I;  1IO2 A;  2L01 A;  3MKY B;  3D26 A;  2WZP P;  2P81 A;  4HV5 A;  2MYS A;  4PCQ A;  1ZRF A;  2X3H A;  4Z1M A;  5D6E A;  4B43 A;  4RD1 A;  3PET A;  3KET A;  5TY0 A;  2V1X A;  1R4M B;  2MW8 A;  1I1G A;  3HM5 A;  4X1E A;  1D5Y A;  1MNE A;  2NNY A;  4B3F X;  4ABZ A;  2ADU A;  2RKH A;  3SDB A;  2WPD A;  1MJA A;  5EDN A;  1N07 A;  1W36 D;  4JQF A;  1PE9 A;  1N06 A;  3JTH A;  3BR5 A;  4EJV A;  3K0L A;  1IXC A;  3RKW A;  2HVR A;  4XSX F;  1OR7 C;  1V0F A;  5L3C A;  1RR7 A;  2TDX A;  4L9J A;  3N4M A;  2QQB A;  1DPR A;  2RN7 A;  1PLU A;  3FX3 A;  2ELK A;  1Q82 D;  1DBO A;  2CFO A;  2QBY A;  5CVV A;  4A2U A;  4UHT A;  3TH0 A;  2KL4 A;  1STZ A;  3GZ6 A;  5E3N A;  2OTL I;  1EH6 A;  2ZO4 A;  4IL6 C;  1OYW A;  3WTT C;  3FPP A;  2D5V A;  3WTW C;  1YX3 A;  4JX4 A;  2K4B A;  4FX0 A;  1ORK A;  1XFO A;  3ZRG A;  2MC4 A;  2FEZ A;  2OK7 A;  2KQR A;  4IZZ A;  3P4G A;  3OR1 C;  4XK4 A;  2ACJ A;  3SZE A;  2BW3 A;  2K9N A;  2Z5U A;  2HEO A;  4XLN F;  2PI0 A;  3RKX A;  2CG4 A;  2KKO A;  4O6J A;  2BX6 A;  1GV5 A;  4LG3 A;  1M1K D;  3GVJ A;  3LQ6 A;  1E63 A;  4HOB A;  1AKH B;  2O6G E;  2GA1 A;  4GDF A;  3GXO A;  3LVB A;  1VQ8 B;  4D0P A;  2BVN A;  5FD5 A;  3VEP A;  3K70 D;  5KNL A;  3K69 A;  3G6E I;  1WRJ A;  3AG3 H;  2CFX A;  2LF7 A;  2YPR A;  5HS8 A;  5LHG A;  4I6Z A;  1VQK B;  4UUT A;  2DA5 A;  1EWY A;  1U9O A;  1J75 A;  1DAB A;  1YTY A;  1YIT I;  1K78 B;  4A3B J;  5M5Y J;  3K2A A;  1PJR A;  4JYK A;  4BAY A;  2R7T A;  2NYX A;  1OKR A;  4JP0 A;  1XDS A;  3D5L A;  3LQE A;  2Z3Y A;  3S1Q J;  4LBZ A;  1TC3 C;  3W2I A;  2XZL A;  4HX8 A;  4HNT A;  2NPF A;  2WAQ N;  5ERI A;  2EK5 A;  4IXA A;  4LG0 A;  2FBK A;  1R5I D;  4BBS J;  1XCB A;  3SXY A;  4F91 B;  1ON2 A;  2O03 A;  4ROX A;  3F8B A;  2WY8 Q;  1G7R A;  3MWM A;  4F3Q A;  4QTR A;  3Q3S A;  1TTT A;  5GV8 A;  2ZME A;  1K5C A;  1YX5 A;  2DFI A;  3I3L A;  4GYI A;  2R6H A;  3BTJ A;  1QQ1 A;  3PUM A;  1C0W A;  3OIP A;  2EFW A;  1R7J A;  3TDU C;  1YJ9 I;  2KVO A;  4X7E A;  1GO2 A;  3PQJ A;  1TLL A;  4EJO A;  4NBQ A;  1Y0Y A;  1A6I A;  2QWW A;  2R7Q A;  2JDI A;  2ZB9 A;  3H5R A;  2BHZ A;  4I2O A;  2Z2S B;  5B1A H;  1YJN B;  4M3B A;  1W1W E;  2P7C B;  4IOC F;  1QU3 A;  4YZA A;  1K6O A;  4M73 A;  4HDV A;  1E3X A;  5JBQ A;  1PXZ A;  4OPW A;  2Z8G A;  4CH7 A;  2CWE A;  1VQP I;  3QRF F;  3W6J B;  5IYB J;  2H8W A;  3SQN A;  1Q1V A;  1W7P A;  4ZDP A;  1BHE A;  3WQZ A;  3UR3 C;  3OYC A;  1KK0 A;  1ETK A;  5C4X J;  1TLH B;  4IEJ A;  4YXW A;  1T6Y A;  3RY8 A;  2KIM A;  1TT0 A;  4BJT A;  4QVA A;  3MMP A;  1I50 J;  1PUF A;  4XLE A;  3VWB A;  3Q0V A;  1MMS A;  3ZIA A;  2EFO A;  4Q7J B;  5KHD A;  3PSS A;  1KTV A;  3O3K A;  3HBL A;  4UB8 C;  1X3Z B;  1X19 A;  1V5F A;  3PUB A;  3KYD B;  1HF2 A;  2OBT A;  4I7H A;  5IT9 Z;  5IP7 J;  1GXQ A;  3C3W A;  2OF7 A;  5FRN A;  3CO6 C;  3JSP A;  2QA4 I;  2WWY A;  2FXA A;  2ZZQ A;  4P2N A;  2X53 S;  3JRC A;  3CCM B;  3TO7 A;  5BNG A;  3RKY A;  2KFD A;  3KL9 A;  2DPD A;  3HEF A;  5EEH A;  4PC3 A;  2QUF A;  3FPK A;  4IHX A;  2BY3 A;  1FY7 A;  1IRG A;  2BBY A;  1WJC A;  3A4C A;  2JTV A;  1QBJ A;  1RUN A;  3D5R C;  3KEW A;  1JB9 A;  4XR6 A;  2IA1 A;  2H09 A;  4DBR A;  1P92 A;  2A6T A;  1R5O A;  2JN6 A;  3PQK A;  3CCL I;  1UST A;  4M3F A;  3IKV A;  1ZAO A;  4RM0 A;  2V26 A;  1Z6R A;  3HOW J;  2QF7 A;  1YE9 A;  4S05 A;  2VNJ A;  2KP6 A;  3MMY B;  1Z0X A;  4PUS A;  2PJP A;  2OTJ I;  1IV8 A;  1OR7 A;  1LFP A;  2IA2 A;  1IC8 A;  4LLL A;  1F4K A;  1O8K A;  3FY3 A;  5DM6 F;  2V7U A;  2F4M B;  3CD6 I;  3QU3 A;  4RPB A;  3MAJ A;  2Y9Y A;  3W2E A;  2KT0 A;  1H89 C;  5F4O A;  4I02 A;  2VKV A;  3RYP A;  2W7Z A;  3AFH A;  1BPL A;  2V7X A;  3RPQ A;  3CES A;  3QPL A;  2M4K A;  1Z9C A;  1DUX C;  3E1Y E;  1QVU A;  4DIQ A;  2NAZ A;  1TW3 A;  1I7P A;  1X58 A;  3BWG A;  3OZW A;  1Y0U A;  2IGO A;  4NBS A;  1ETW A;  3ECO A;  5DYM A;  4F93 B;  1KZL A;  1KU9 A;  5K7H A;  1YW9 A;  1SEU A;  2QN6 A;  2XGD A;  1SM4 A;  3B73 A;  1CGP A;  1ONV A;  1NDH A;  3CCU B;  4OOV A;  4C3H J;  2WJV A;  4UUS A;  1QG0 A;  2AS5 F;  2WV0 A;  5C1E A;  4YG2 F;  1J59 A;  1B8I A;  2Z1D A;  2J8K A;  3QYF A;  2FUG 2;  4ESJ A;  3MKW B;  3MKL A;  4BU2 A;  3BJA A;  3GVL A;  3JRA A;  1BR1 A;  2VBK A;  4PGG A;  2XSD C;  1N75 A;  2LBF B;  2DMT A;  4BH9 A;  3PSF A;  3SQV A;  2R7F A;  5H2F C;  4HRI A;  4GCV A;  6PAX A;  1QGY A;  2DU9 A;  4UZF A;  3FZV A;  3DEE A;  3LQR A;  1XCV A;  3ECH A;  1B72 A;  1O3S A;  3ERE D;  2WAF A;  3BNW A;  2DOD A;  4TV7 A;  1V4R A;  3U1D A;  5H6R A;  1DGR M;  4P6V F;  2WAQ A;  2VJI A;  1P4A A;  3JX8 A;  2A05 A;  1LUJ B;  1QA6 A;  1FDR A;  2FRH A;  3HAG A;  2Q0O A;  1FPQ A;  4DNC A;  2VXZ A;  3OL3 A;  1G59 A;  1BIA A;  2QTZ A;  3S3N A;  4M4S A;  4ON0 A;  3PEN A;  4EW9 A;  4IHS A;  5F04 A;  4NC6 A;  2GOX B;  1G3T A;  2XND A;  1U78 A;  4XRM A;  1UD5 A;  3ZMV A;  1T5E A;  2ZNY A;  3DFG A;  1SMT A;  4L18 B;  3C7J A;  4K2E A;  1DQU A;  2KRF A;  3L7W A;  2HU9 A;  1E3O C;  4A93 J;  3GO5 A;  2W24 A;  4AYB N;  5GAE J;  4FE7 A;  1JTX A;  3HIF A;  4FQG A;  2HPI A;  1ZRC A;  2CQX A;  1K9M D;  4A3L J;  2PMD A;  1GUU A;  5B6I A;  2UWM A;  4Z4V A;  1UZC A;  3OR2 C;  4MR0 A;  4HV6 A;  4DYC A;  3P9K A;  2NTP A;  2PMZ A;  3EYI A;  1E3P A;  1KMH A;  1ZM9 A;  5E17 F;  2VON A;  4A5N A;  3OFN A;  3E6M A;  4CHU A;  3SLN A;  3BRO A;  4Y15 A;  5L3F A;  5JFR A;  2STT A;  2VKH A;  3H9G A;  3DTI A;  4N0B A;  2IS1 A;  2RC5 A;  4RPD A;  3V7A A;  4ENN A;  2BM0 A;  4OPS A;  4ACA A;  3I1F A;  4FAS D;  3E5U A;  3V7S A;  2Y31 A;  2O3F A;  3VYS B;  1QVT A;  4B44 A;  3PNY A;  5GP9 A;  1ZGW A;  1KU2 A;  3TQN A;  2CMP A;  2DW4 A;  2JWT A;  1U6G A;  4JBA A;  3TMO A;  4U9U A;  4AC0 A;  2H6C A;  4WK8 F;  1QGA A;  3PA2 A;  3W2H A;  4OJP A;  2BGC A;  3J81 Z;  4Z06 A;  1FNM A;  1NHA A;  3VPR A;  1BC8 C;  1AOY A;  2D74 A;  1VLY A;  4YFO A;  3HXL A;  2QMU A;  1GQ8 A;  2HTJ A;  1YW7 A;  5IT9 K;  2ZSH B;  1VQN I;  5A89 A;  3FM5 A;  1JE8 A;  1A04 A;  2D1V A;  4LGW A;  4YIF A;  1XTA A;  1MDM A;  1H8E A;  3BTL A;  2A69 F;  3S2W A;  2L9S A;  2OA4 A;  3RPU A;  2D1H A;  5K5R A;  1WJ5 A;  3CF5 F;  2XPV A;  3CCS I;  1NHC A;  1UG0 A;  2DLL A;  2PYH A;  4CQJ A;  4RGS A;  2C2W A;  3T56 B;  4X6A J;  4BJ5 C;  2V9P A;  4NQW A;  4J19 A;  4C2T A;  4BQA A;  1S8N A;  5BSY A;  4OIN F;  1MMD A;  3EUH C;  3P26 A;  3FKJ A;  2DAO A;  2JRT A;  4EGY A;  3BG7 A;  1HST A;  4RD4 A;  1GV2 A;  3GLX A;  1QNT A;  3P5J A;  2ZBV A;  4W1U A;  1ZLK A;  5D5X B;  2HPM A;  1ZRE A;  3BJO A;  2VT3 A;  4A0X A;  2I10 A;  2OUM A;  1FBS A;  1O3T A;  4L0Y B;  3OEH A;  1R9T J;  1FRQ A;  1KU3 A;  1FIA A;  3OV8 A;  4ZJZ A;  1E64 A;  3V42 A;  3QSY A;  4W8R A;  2R4G A;  1ZG3 A;  2DA6 A;  5BS6 A;  3G71 I;  3S3M A;  4TMZ A;  1IB0 A;  3M1E A;  1OB2 A;  1UG2 A;  3SKB A;  5K7F A;  3T8R A;  1YO5 C;  2GRE A;  3LSM A;  3B78 A;  4HIZ A;  3LWF A;  3FHN A;  3ULQ B;  1K79 A;  1GR1 A;  1WU8 A;  4M71 A;  2K9M A;  2ZIT A;  1HF0 A;  3VR6 A;  1JJ2 B;  3FKS A;  3G1M A;  3I4P A;  2PE3 A;  1UJ8 A;  2XOK A;  1OCZ H;  3S1R J;  3ZQL A;  2HYJ A;  4RM3 A;  3GX4 X;  1B9M A;  1V5V A;  1CQX A;  2NS8 A;  4W8Q A;  5E8G A;  4Y9U A;  1WVR A;  2G0E A;  3AVW A;  1U0J A;  5AIQ A;  2XGX A;  3WGI A;  3KCC A;  1JUM A;  3KP5 A;  1WMR A;  1S9H A;  2QVO A;  3IC7 A;  3DPL C;  1XN7 A;  4HSR A;  5HOD A;  1N05 A;  4EM2 A;  2DO7 A;  2VFM A;  4CSW A;  3EPZ A;  3WWG A;  5HLG A;  1YOV B;  2DA2 A;  4BEH A;  4DQL A;  2XTY A;  1XG2 A;  1YIJ I;  1ZEL A;  1NG7 A;  3SEZ A;  2QBY B;  1H42 A;  4PFP A;  3ONQ A;  1Z21 A;  3T1B A;  1O8I A;  2E1R A;  3CW2 A;  2DDA A;  3RQI A;  2JRM A;  2GK6 A;  3WBK A;  2LY2 A;  1B6A A;  2DFH A;  2DFF A;  5L3G A;  2WZN A;  3GIR A;  3OOC A;  1IA5 A;  1BI0 A;  3OYK A;  4PC1 A;  1Y8Q B;  5GPA A;  4N4N B;  2JK3 A;  1NB9 A;  4G7O F;  1SMY F;  3W2A A;  2IRF G;  2GJP A;  2XVC A;  1B1B A;  2BW3 B;  2DK5 A;  2XAS A;  1QGZ A;  2M30 A;  2HDD A;  1CZF A;  1OOC A;  3W5H A;  2LLK A;  4A3D J;  4HLY A;  4HPQ A;  3BPV A;  3I56 I;  1YRN A;  3BR1 A;  1Z7L A;  2HQ5 A;  4A0Y A;  1EFC A;  1KD1 D;  3ABT A;  4AYB A;  1BA5 A;  4TMW A;  2R9V A;  3F23 A;  1E3H A;  2GZW A;  2OZ6 A;  5E18 F;  1EH7 A;  1X1B A;  1Y6I A;  1W4M A;  2WA0 A;  3OOU A;  2W7N A;  3DEW A;  4KIC A;  3TOA A;  3QOP A;  1COW A;  3WG7 H;  5GAG J;  5J1R A;  1QZZ A;  3PO2 J;  3IWZ A;  3DPT A;  4DNR B;  5IT3 A;  3S3O A;  1HKQ A;  4C3J J;  4PJ0 C;  4BXF A;  2DOF A;  2XRN A;  1JUS A;  1WFX A;  2ZXW H;  2KPM A;  1XGN A;  5FD6 A;  2UUZ A;  1TWA J;  1BL0 A;  3H9N A;  4EH1 A;  1KCC A;  3VDX A;  2CU7 A;  1OB0 A;  2Q1Z B;  3X2Q H;  4BL0 B;  3JSO A;  1QVF B;  3PFY A;  3V4G A;  1XGM A;  2JPC A;  2LNB A;  3Q38 A;  1Q1H A;  1T33 A;  3E6D A;  1K61 A;  4Z4Y A;  1LDK B;  4G6T B;  4G7W A;  2HDN B;  2KIS A;  3HC7 A;  5TV2 A;  2DOA A;  5J35 A;  1WPK A;  3CCY A;  3K4K A;  5E79 C;  5LFA A;  4KA4 A;  5HVQ C;  3UW0 A;  2M3A A;  1MBF A;  1GVD A;  1ZR4 A;  2E1C A;  3PSZ A;  1JKR C;  1IJW C;  2HMA A;  4PC2 A;  2FBH A;  2ZME B;  2P6S A;  1K4S A;  2B9S A;  1Z67 A;  1VQ9 B;  3AVV A;  2XDV A;  2W6J A;  2CSO A;  3UKG A;  1VQ6 I;  2K02 A;  2XIG A;  2PLY A;  1TNT A;  4BQO A;  5C44 J;  4AIJ A;  2VT2 A;  2XKP A;  2VBY A;  5EEA A;  1FOX A;  3DPU A;  5KAI C;  1WOO A;  4C2L A;  1QUE A;  3OJW A;  2ZFU A;  5IYQ A;  4F7Z A;  4CA0 A;  4L9V A;  4Z6Y A;  2NRA C;  1IN7 A;  4V2G A;  3OYG A;  3QOE A;  4KFC A;  1DDG A;  2XPU A;  2IAI A;  5KVR A;  1XG1 A;  4YCQ A;  1QPI A;  3SDG A;  4P1V A;  2KZG A;  1ITY A;  2FMY A;  3V7R A;  2V6E A;  2EIM H;  2E1M C;  1RI7 A;  3L2V A;  2L7K A;  4PAB A;  2VC1 A;  2GM4 A;  1W7P B;  1CQT A;  3Q39 A;  4AF7 A;  4BNC A;  3ASQ A;  1FYM A;  5IYR A;  3E6B A;  2KRH A;  1AU7 A;  3VYR B;  3K1M A;  1P6R A;  4FN5 A;  2LFB A;  3EUH A;  5CPR B;  3I5U A;  2L5Q A;  3H35 A;  1SVM A;  5LBQ A;  5ILU A;  1MMN A;  1EP3 B;  1U2W A;  3A02 A;  1DP7 P;  1EP2 B;  2CH0 A;  3G71 B;  3WTZ A;  2F43 A;  1X3U A;  2ZFW A;  4FIS A;  3HRS A;  4PSW A;  5M5W J;  3CC4 I;  2UV1 A;  1F1Z A;  2HOT A;  4HF1 A;  2DMQ A;  1X1C A;  2CF4 A;  5E1Z B;  5FKO A;  3OYJ A;  2UXN A;  2VBU A;  3E1S A;  1BI1 A;  3VO2 A;  4LJZ F;  1TUI A;  3NWS A;  3T53 B;  3DEU A;  3H0G J;  3OPO A;  4RCZ A;  3DLA A;  1IAW A;  4ZTJ A;  4G7H F;  4MYT A;  4LBY A;  3GTG J;  3SFZ A;  3DKY A;  1XSD A;  2LVS A;  3IAS 2;  1IUY A;  1S4M A;  1CF7 A;  1IN6 A;  3WOD F;  4GQN A;  1I3Q J;  2GQQ A;  1FNN A;  3BZK A;  1EXM A;  5H6Q A;  3KPH A;  3HOV J;  1RU4 A;  3CMA B;  2ELH A;  2Q6O A;  1JT6 A;  3CC7 B;  3WY9 A;  3GEZ A;  4QVJ A;  4FWT A;  4CXF A;  2QEX I;  1A35 A;  5EEG A;  2H1K A;  1SVL A;  3LSR A;  1A36 A;  3QP5 A;  2P8T A;  1O4X A;  2JJ7 A;  3DP7 A;  4ESF A;  3QOD A;  1TYW A;  3A01 B;  3R6S A;  3ZMU A;  3SJZ A;  2OD5 A;  3CDH A;  3WNB A;  2VKD A;  1ZHF A;  2Y2Z A;  3G4S B;  1W7P D;  5A88 A;  4JOM A;  3N90 A;  1S72 I;  1PKV A;  4U0V A;  2QKL B;  2BOL A;  3P7N A;  4V19 K;  1IRZ A;  3U2R A;  5F0H A;  4HAM A;  3HG9 A;  1LVA A;  2EFP A;  4WXH A;  3CF2 A;  3CUQ C;  3CCJ B;  2CW5 A;  1IRF A;  1KA8 A;  3KYL A;  2GBY A;  5FNZ A;  2HYF A;  2VBV A;  2YUS A;  1VLO A;  3VMV A;  3E5X A;  2DOE A;  4UUS B;  2XAJ A;  1VFC A;  2K4J A;  1B8I B;  5KW9 A;  2DER A; 
#chains in the Genus database with same CATH homology
 2KMU A;  2ODL A;  2HZD A;  4Y3O A;  3OYB A;  4CCL A;  4YEJ A;  3OIP A;  3HOT A;  2KVO A;  1IDJ A;  2IGN A;  2QKM B;  4F92 B;  4E7L A;  2VJJ A;  4BAC A;  2R7X A;  1HZE A;  1K28 D;  5CDF A;  2R7Q A;  2JDI A;  3H5R A;  5JHF A;  2F5V A;  1D0Y A;  4BQQ A;  2Z2S B;  3PNV A;  3OYI A;  2F1M A;  3RQ4 A;  1QU3 A;  1WP6 A;  1E3X A;  3LSH A;  4TKO B;  4YZA A;  1PXZ A;  2NTQ A;  3CZ6 A;  2Z8G A;  2XZO A;  2O0W A;  4CH7 A;  4RM2 A;  2WAD A;  3BC9 A;  4ZDP A;  3ZR8 X;  1BHE A;  3WQZ A;  2MD0 A;  2PEC A;  3W2W A;  3UR3 C;  1EFR A;  3OYC A;  4MLO A;  1N78 A;  3VST A;  4YXW A;  4DBQ A;  4XNF A;  1X0C A;  4YZQ A;  3U21 A;  1TT0 A;  2F6C A;  4BJT A;  1AA7 A;  4XLE A;  3VWB A;  3ZCO A;  2KLO A;  1H80 A;  3EUK L;  2KRC A;  4CCN A;  1MMA A;  1E1R A;  3ZIA A;  5KHD A;  3BH4 A;  3T9G A;  1V5E A;  4QPQ A;  3GQ7 A;  1X19 A;  5CQG A;  1V5F A;  2O04 A;  3IUO A;  3PUB A;  1Z3Y A;  2WAE A;  3ZXS A;  4AVZ A;  4J01 A;  3DTK A;  2NOJ B;  4NK8 A;  3DTE A;  1QHG A;  5FRN A;  1QJV A;  3SYT A;  5HKK A;  2ZZQ A;  2X53 S;  2W82 A;  4U87 A;  3LMM A;  1OLT A;  2LOO A;  3VSV A;  4E7H A;  1E79 A;  2A5W A;  4CZC A;  2VB6 A;  1O8J A;  4BGD A;  1V5G A;  3L2W A;  4E7I A;  4G7X A;  3BLY A;  2WJY A;  2K3P A;  3K4L A;  3L2Q A;  3JUR A;  3AKZ A;  2R7V A;  1WTH D;  2XF5 A;  3A4C A;  1WJC A;  2HQA A;  3DQV C;  3D5R C;  2LRE A;  2X1E A;  4ANJ A;  3KEW A;  2NT9 A;  4XR6 A;  3OS1 A;  4DBR A;  2A6T A;  2CS3 A;  1O8L A;  2V26 A;  1YE9 A;  4E7Z A;  2WB1 A;  2MAB A;  2KP6 A;  3MMY B;  4PUS A;  4PFO A;  5HLT A;  2X6Y A;  3FY3 A;  1LFP A;  1O8K A;  2IS6 A;  1HA8 A;  4W8S A;  2F4I A;  1I18 A;  5CQE A;  4URR A;  1W0J A;  2NST A;  3KEY A;  1O8D A;  1WJE A;  3NE5 B;  3AFH A;  2HDW A;  3GBG A;  3OS2 A;  4BDY A;  3CES A;  4P1W A;  2JSP A;  3S93 A;  1BPL A;  2M4K A;  4DK0 A;  4DIQ A;  5KCM A;  1UD8 A;  5FL7 A;  1LVK A;  2GJK A;  2IGO A;  4XOR A;  2HLD A;  4F93 B;  1AIR A;  1KZL A;  3VSU A;  1QHH D;  2W6I A;  2O17 A;  1N77 A;  2O1D A;  2ZXI A;  1W9X A;  1R6R A;  3QYE A;  1SKY B;  4FET A;  2WJV A;  4TSF A;  1IRX A;  3VYU B;  5FRO A;  2V4D A;  5C1E A;  2Z1D A;  3CJR B;  1D0Z A;  3QYF A;  3RCO A;  4E4H A;  2FUG 2;  2WSS A;  3MKW B;  4DK1 A;  4Z05 A;  2M7B A;  2X8K A;  2VBE A;  3LSI A;  4BU2 A;  2INV A;  3A1Y A;  3N05 A;  3GVL A;  4NQW B;  2Z16 A;  1WJF A;  1D0X A;  4E7J A;  1BR1 A;  4HWV A;  2VBK A;  1N75 A;  2LBF B;  4XQF A;  3PSF A;  4LIV A;  4CCJ A;  1P9Q C;  3OYN A;  2Q2E B;  3FBN B;  4HRI A;  3H0D A;  4KKU A;  3MD2 A;  2XC7 A;  1D1B A;  2V7F A;  3DEE A;  4U4B A;  4PJL A;  2ZTN A;  1RMG A;  1RWR A;  3PJR A;  5LD2 C;  5CKT A;  2BSP A;  2WAF A;  4Y4R A;  3IP4 B;  4B3G A;  2CV1 A;  4P5O A;  2R7O A;  4JMQ A;  2UVF A;  2ZZF A;  2XF7 A;  1DGR M;  2DCE A;  2WAQ A;  2V4J C;  2VJI A;  3B90 A;  1KCD A;  3BCB A;  2IQ7 A;  3HAG A;  3QYB A;  4J00 A;  1UAA A;  4NK6 A;  2JUG A;  4HNU A;  4XKB A;  4FXU A;  3H5N A;  2VXZ A;  3OL3 A;  4XL9 A;  3I9V 2;  1G59 A;  2D3L A;  3ZQQ A;  3H9J A;  3S3N A;  2LG4 A;  4EW9 A;  4XOT A;  1IB4 A;  1MMG A;  2V1N A;  2D3N A;  2ZZE A;  3JU4 A;  2GOX B;  2XGJ A;  3TBI A;  2XND A;  1PYV A;  1UD5 A;  1DP3 A;  1T5E A;  3LNN A;  1QCX A;  4YZ0 A;  3HKZ A;  4TT3 A;  2L9N A;  2XZP A;  4R79 A;  1DQU A;  1OGM X;  3GVK A;  3ZGK A;  4KKS A;  2HU9 A;  2X85 A;  1WJA A;  3BCA A;  3MKZ A;  1JRG A;  1EE6 A;  4W8T A;  4X0G A;  2HNH A;  1W0K A;  2HPI A;  4OZZ A;  1ERD A;  2X6X A;  4MXN A;  2UWM A;  2QXZ A;  4KIS A;  4CCM A;  4U49 A;  3OR2 C;  4MR0 A;  3K4N A;  3RPU D;  3AL0 C;  2P0W A;  2L2O A;  3L2U A;  2NTP A;  4IX7 A;  2PMZ A;  3H94 A;  2KDO A;  4BUP A;  1UD3 A;  1KMH A;  2WBM A;  3CMM A;  4B3X A;  3OFN A;  2GJR A;  1O8E A;  2VKH A;  3H9G A;  3DTI A;  4ZYA A;  2IS1 A;  4KKT A;  2R7W A;  4DNT B;  2ZTG A;  2O0V A;  1Y56 A;  3SEQ A;  4FAS D;  2CW8 A;  4CCK A;  3VYS B;  3C2H A;  3PNY A;  4B44 A;  3OEE A;  4BE2 A;  2WY7 Q;  4II2 A;  4OJ6 A;  5DN6 A;  1MW7 A;  2CMP A;  3G2B A;  4RLQ A;  4D1Q A;  3CJQ B;  1WJD A;  4N4O B;  4RLF A;  3TMO A;  1E3Z A;  4OJP A;  4XKW A;  2LY1 A;  1O8H A;  4XLC A;  4Z06 A;  2ZZG A;  3HPH A;  3W3C A;  4B47 A;  2CV2 A;  1X1D A;  2VQL A;  3PNT A;  3HOS A;  2E1B A;  1VLY A;  3OYA A;  3HXL A;  3SZG A;  1GQ8 A;  3D5S C;  2X51 A;  2X1C A;  2ZSH B;  2LZJ A;  3FDY A;  4U7B A;  4C2U A;  1NG6 A;  1H8E A;  2L9S A;  3E0J B;  2UVE A;  3S32 A;  3K4M A;  4YRV A;  4IQJ A;  2HVS A;  1WJ5 A;  3VSL A;  1NHC A;  2KZV A;  3LSG A;  4OAZ A;  1UG0 A;  3AL0 B;  2PYH A;  1G8X A;  3T56 B;  4BJ5 C;  3K4C A;  1VJS A;  3RTR A;  3NWT A;  4C2T A;  2BVL A;  3OYE A;  3W2V A;  2V7Q A;  4PMH A;  2W4S A;  2LBF A;  2JJ1 A;  2NSP A;  1MMD A;  2ZSI B;  3EUH C;  4II3 A;  3FKJ A;  3OMY A;  2X1D A;  1O8G A;  1OGO X;  4OAY A;  1I8D A;  2BVM A;  3T51 B;  3VYT B;  3EQO A;  3BG7 A;  2JVG A;  2K9L A;  2HPM A;  3A3B A;  2OUM A;  4XMY A;  3OEH A;  3H9Q A;  3S8P A;  2VQC A;  3DU5 A;  4HG2 A;  4ZJZ A;  5TGT A;  3CP2 A;  3V42 A;  3OYF A;  2R4G A;  4XN3 A;  2DIE A;  4W8R A;  1O88 A;  3S3M A;  3OE7 A;  3A2K A;  1E0E A;  4XLF A;  2VQG A;  1O8F A;  2DXI A;  2AQF A;  2RRE A;  4LIT A;  3LSM A;  2PJR B;  2VPL A;  4HIZ A;  3FHN A;  4PJN A;  2CUZ A;  2K9M A;  1BR2 A;  3VR6 A;  3K10 A;  5IK2 A;  3FKS A;  2XOK A;  1UD2 A;  3GQ8 A;  4OZY A;  4PK4 A;  3EUA A;  2R7U A;  1E43 A;  2PYG A;  4RM3 A;  4AU7 A;  1KON A;  4W8Q A;  1SFK A;  1X4P A;  3K4B A;  1H8H A;  4NC7 A;  1OHH A;  1BLI A;  3EQN A;  1U0J A;  3HL2 A;  3ZPN A;  1W36 C;  2VJ5 A;  3B4N A;  3IAM 2;  3GQ9 A;  3GQB A;  1WMR A;  1S9H A;  3DPL C;  4ITV A;  4HSR A;  2IS2 A;  2CK3 A;  2CV0 A;  4CSW A;  3A3G A;  3OYD A;  3EPZ A;  3WWG A;  4B48 A;  2W00 A;  4BEH A;  3J7A Y;  1XG2 A;  2XF6 A;  3OYH A;  1O8M A;  4YEL A;  3BC8 A;  1D1A A;  1NG7 A;  1ZEL A;  3SEZ A;  2XAU A;  4PFP A;  3ONQ A;  1Z21 A;  1O8I A;  1VF7 A;  4E7S A;  4IKF A;  3DKX A;  3VSK A;  3B8Y A;  2GK6 A;  1NBM A;  2LY2 A;  3OOC A;  1IA5 A;  1MAB A;  3ZSC A;  3F9K A;  5HOO A;  1V0E A;  1FX0 A;  4I84 A;  3OYK A;  1IDK A;  3M1C A;  4XN0 A;  2DT7 B;  2LRD A;  1VBL A;  4N4N B;  2K5C A;  3HUG B;  1J09 A;  3W2A A;  4GRI A;  2GJP A;  1CZF A;  2BW3 B;  2RQQ A;  1OOC A;  2NT6 A;  4HPQ A;  4PJM A;  3OY9 A;  1Z7L A;  2GK7 A;  4AYB A;  3K70 C;  2R9V A;  3A35 A;  3LMW A;  3PL8 A;  2OV7 A;  4ASU A;  1DGW Y;  2MFZ A;  1X1B A;  1Y6I A;  4BEH B;  2O5R A;  2WA0 A;  4OJL A;  3OOU A;  2W7N A;  5AMV A;  5FRM A;  1COW A;  4E0F A;  3DWL E;  1BN8 A;  3FBI B;  1TZL A;  4UZU A;  1X4O A;  3PSI A;  3DPT A;  4DNR B;  3S3O A;  2IS4 A;  1T0F C;  4BXF A;  4KT6 A;  2M5S A;  1WFX A;  2M0M A;  1SAU A;  2KPM A;  1GLN A;  3C2G A;  3KX2 A;  2VBM A;  1NRK A;  2UUZ A;  1KCC A;  2Y0S A;  4BQN A;  2I8D A;  2V31 A;  3VDX A;  1OB0 A;  2Q1Z B;  4BL0 B;  3GRH A;  2LC2 A;  5HNH A;  3PFY A;  4Z03 A;  2JVH A;  2DT6 A;  2NZM A;  3OYM A;  3OIQ A;  3ZPP A;  3M8J A;  4C9Y A;  4BJ6 C;  1LDK B;  4G6T B;  4XLH A;  4G7W A;  2JA2 A;  4BE1 A;  3HC7 A;  2AQE A;  2DOA A;  2DJI A;  4PJJ A;  1EA3 A;  2HVQ A;  3H5A A;  3TL4 X;  3K4K A;  5LFA A;  3GQA A;  3UW0 A;  5HVQ C;  5HNF A;  2M3A A;  4XD7 A;  4RMN A;  2V9K A;  4H4K C;  2NTB A;  2QE7 A;  2R7S A;  4DJA A;  4DOZ A;  3LFU A;  4ZTF A;  1DBG A;  4OJO A;  4ZDO A;  2XDV A;  4KJZ A;  2W6J A;  4G6I A;  2VLA A;  2M4G A;  2KHM A;  3RSN A;  2VAS A;  3K4J A;  4NUB A;  4BQO A;  1K6Y A;  4HEA 2;  3LL7 A;  2JIZ A;  4NC8 A;  3UNG C;  2W1O A;  4XON A;  3DPU A;  3DU6 A;  4XKV A;  4C2L A;  1FMV A;  4XOP A;  4CCO A;  2VXD A;  2ZFU A;  2CUJ A;  2PJR A;  2E5Z A;  2ELJ A;  3G05 A;  2WZP P;  4CA0 A;  3MKY B;  4Y33 A;  3OYG A;  2IGM A;  2MYS A;  4QPO A;  2X3H A;  3KRG A;  3QOE A;  4Z1M A;  4OWR B;  4B43 A;  4KIT B;  2V6E A;  4C30 A;  2E1M C;  3L2V A;  1MNE A;  2L7K A;  4B3F X;  1E1Q A;  1HVX A;  1UD6 A;  3SDB A;  2WPD A;  4BDZ A;  1Z3X A;  1W36 D;  2KRH A;  4JQF A;  1PE9 A;  3VYR B;  4BS9 A;  1VZ0 A;  1WPC A;  2LH9 A;  3BCF A;  3VMW A;  2HVR A;  1OR7 C;  2E60 A;  5CPR B;  3OYL A;  1V0F A;  5C1C A;  2XSJ C;  2L5Q A;  3H35 A;  4P22 A;  3BG6 A;  1PLU A;  1MMN A;  1BMF A;  2QY1 A;  1T95 A;  4XLA A;  1UD4 A;  1D1C A;  4ZC3 A;  2CFO A;  4F52 A;  1DBO A;  2CH0 A;  2F43 A;  2KL4 A;  4IQ4 A;  4PSW A;  4DGW B;  4D9J A;  3FPP A;  2UV1 A;  2EWE A;  4CUG A;  1YX3 A;  2OC6 A;  1X1C A;  2X6W A;  3ZRG A;  3OYJ A;  2MC4 A;  2QX3 A;  2LYC A;  3E1S A;  2KQR A;  4IZZ A;  3T53 B;  2M7A A;  3NWS A;  3OPO A;  4BE0 A;  1BOB A;  2IXS A;  3OR1 C;  4ZDL A;  4NNJ A;  1HG8 A;  2BW3 A;  3OAA A;  3DLA A;  4ZTJ A;  2Z6B D;  3HPG A;  3DKY A;  3IAS 2;  1WJB A;  4LG3 A;  3GVJ A;  2JJ2 A;  4GQN A;  2E1M B;  2VL8 A;  2VQH A;  1MND A;  3OL4 A;  4PSX A;  3K70 D;  1RU4 A;  4E6K G;  1FMW A;  5KNL A;  1OFM A;  2CW7 A;  3BCD A;  4YZX A;  3CP8 A;  1UEL B;  3DDY A;  3K6G A;  3QOD A;  1PJR A;  2VJ4 A;  2ZXH A;  1JTA A;  1BR4 A;  2R7T A;  4L8J A;  2VKD A;  1LKX A;  4F55 A;  2GOM A;  3D5L A;  4JOM A;  4EAT A;  1PKV A;  4HST A;  2XZL A;  2QKL B;  2BOL A;  1JI8 A;  4OJ5 A;  4HNT A;  4LIU A;  4XKC A;  2R7R A;  3HG9 A;  2IGK A;  1KTW A;  3CF2 A;  2VIX A;  3OWT A;  3L2R A;  4XM3 A;  4F91 B;  3KYL A;  3VMV A;  2INU A;  2WY8 Q;  3SUC A;  2E5N A;  4F3Q A;  3OW7 A;  3OS0 A;  1OFL A;  2RNG A;  3LSK A;  1X1A A;  1YX5 A;  1K5C A;  4E7K A;  3I3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...