2X6XA

Tailspike protein mutant d339n of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE PROTEIN HK620
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 235
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6xA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6xA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6xA02
2VBEA 4XR6A 4YZ0A 2INUA 2O17A 4W8SA 4XN3A 1O88A 1O8FA 1KCCA 1GQ8A 1O8JA 4XMYA 2VJIA 4URRA 5C1EA 1BN8A 2NTBA 1O8GA 3EQNA 2X6XA 4YZAA 1QCXA 4U4BA 1QJVA 4XLEA 2VJJA 1PLUA 4I84A 4OJ5A 5C1CA 4W8RA 2O0VA 3VMVA 2QY1A 2PYGA 3JURA 3SUCA 1CZFA 4XQFA 4Z03A 4NK6A 4W8QA 2NZMA 3B90A 4OJLA 3VSVA 1JTAA 1DBOA 2NT6A 2UVEA 4U49A 4NK8A 1OFLA 1IDKA 3T9GA 3VSTA 3GQ8A 1PXZA 2QX3A 4MXNA 2X85A 1WMRA 1IDJA 1AIRA 2O1DA 1RWRA 3ZPPA 2PYHA 3GQ9A 4YZXA 4EW9A 2NTQA 4OJPA 2VBMA 3VMWA 1NHCA 2X6YA 1KCDA 4W8TA 3UW0A 1OGOX 4MR0A 1RU4A 4XOTA 4OZYA 3FY3A 4HWVA 1HG8A 2INVA 2O0WA 2BSPA 1DBGA 2O04A 1BHEA 1O8IA 1JRGA 1X0CA 2NSTA 1O8EA 2NTPA 2X3HA 4Z06A 3LMWA 4XLCA 2ODLA 4PMHA 1O8DA 1RMGA 4XKVA 4YZQA 1OGMX 4OZZA 4XLFA 4XORA 1OOCA 4OJ6A 4YELA 3WWGA 1O8MA 3EQOA 2NT9A 1K5CA 4XL9A 2VBKA 3GQAA 4YEJA 3KRGA 2NSPA 1IA5A 1PE9A 1EE6A 2QXZA 4XKWA 4XM3A 3B4NA 1O8HA 2IQ7A 3VSUA 2EWEA 3GRHA 4XOPA 2PECA 3GQ7A 4XN0A 1XG2A 5AMVA 4XLHA 2UVFA 4XLAA 1OFMA 3B8YA 2Z8GA 1KTWA 4XONA 1O8LA 4XNFA 2X6WA 1IB4A 4Z05A 4AVZA 1O8KA 4OJOA 3ZSCA 1VBLA 4C2LA 1H80A
chains in the Genus database with same CATH superfamily
1I50J 1LUJB 2X1EA 1MBFA 2ECCA 1WKMA 2CQ7A 4X07A 2HZDA 3OR2C 2WWYA 3ZPLA 3ZQ7A 1O8JA 3SYJA 2VJIA 1HVXA 1PKVA 1T5EA 1MNMC 3SZEA 4IZZA 3EUAA 1MMNA 1R1TA 3K4LA 3S32A 3OZWA 5EG0A 3LSIA 3OOCA 3LNQA 1FYMA 4AVPA 4E6KG 4EJWA 2KVOA 4CYDA 1B72B 2VBVA 3B78A 1JTYA 3OPOA 1BJZA 3M8EA 4E7KA 1BM9A 2X6OA 1CF7A 3Q0WA 3DBLB 5FROA 4EM0B 2O6WA 3AAFA 1QGZA 2F5FA 3GVJA 3KPHA 4AYBA 2HOTA 5ICEA 3HRUA 2CQQA 1QGYA 3TEDA 2XDVA 2KKOA 2P4WA 1OB0A 1IRXA 4E0FA 2M4KA 2WJYA 3LVBA 3MCAA 4DNRB 3CPWB 2WY7Q 3VNUA 3FXLA 3SLDA 2Q8KA 3W2EA 3WQZA 1BI1A 3Q9VA 3LSKA 3K70C 4P6VF 2E2JJ 1D8TA 1U5TB 5HKKA 2KRCA 3K6GA 3TP3A 4RD1A 4BNCA 4KIFA 2EZHA 1K8AD 3FM3A 5E3LA 3FM5A 1R5HA 2VKVA 5DS0A 1K4ZA 2Q6KA 4BEHA 3R0JA 3FXUA 3WG9A 3M07A 4KA4A 3A8KA 1R6RA 3D5LA 3HHHA 2EIMH 2Y30A 1AHDP 4KDPA 3E97A 4P6YA 3FY3A 2ELKA 2R7OA 4ENJA 2EA2A 1P6RA 3CO6C 2V9VA 2VBUA 3SY2A 4RLFA 3LA7A 2F5DA 5HLIA 1H88C 1Z77A 2P3MA 1QRYA 2DFEA 1I5ZA 2MGQA 5J4VA 3Q6RA 1ZTRA 1ZG3A 3O8GA 4IKFA 2VLAA 1E62A 2XHKA 4XLCA 3A02A 1REPC 2CQXA 3T8RA 3OYJA 3CLQA 1O3QA 4IHXA 1RMGA 3HGYA 3E0JB 2XB0X 2RNJA 2PBIA 5IY5H 1X2MA 3H92A 4OJ6A 5IYCJ 5D4SA 2L7FP 5LBQA 2NT9A 5H20A 1XMXA 1IN7A 3KL9A 3AVYA 2YUHA 2WB1A 2OCEA 4HZFA 2HLDA 4B44A 3LSTA 1B1BA 1L1IA 3S2HJ 2H1KA 1FBUA 3VDXA 2I10A 3HL2A 3H1CA 4CSWA 1JGGA 3CCYA 4L5EA 1BR2A 5M5WJ 4MNUA 2IQ7A 3VSUA 4QPOA 2ZXJA 2RAEA 1YW8A 3DFGA 1VQKI 1OHHA 2M5WA 3CMMA 4DJAA 3IRQA 2E5NA 1EF4A 4ZDOA 4A3IJ 4UVCA 2YWGA 1D0YA 5CVUA 2CRGA 2C77A 3OJXA 4RCYA 3AKZA 4N0BA 2VNJA 3VOEA 3FISA 3PQKA 2CG4A 2XRNA 4LITA 1R58A 3KEQA 4BQQA 2XRLA 3QAHA 1QHGA 4NC8A 3DU1X 1IXSB 3PUNA 1XMAA 3HEFA 1HA3A 2FQ3A 4G6DA 1VBLA 5F4OA 3QQAA 4HDUA 4QVAA 3DPLC 2WC2A 1H8EA 2ZFWA 1EKEA 1TT5B 3DU5A 4UB6C 2BF4A 2JPCA 5FNZA 2MYSA 2F3LA 3HJEA 3LAPA 1DQUA 3GTPJ 3HOWJ 3ONYA 1ZRFA 3VSKA 1WRJA 3KP7A 2VBTA 2M7BA 3A1PA 2K9SA 2OK7A 3SJPA 4H9GA 3U9GA 1B23P 3A1YA 4BJ6C 4LK1F 5EMNA 4U9UA 4G94A 3MZ8A 1FBQA 4ACBA 1ZGAA 2HCJB 4V2GA 4H4KC 4DQKA 1X3WB 1SEUA 1SVMA 3BY1A 4I99C 4XLEA 2F2EA 2DK8A 3ZQFA 1OB2A 4KISA 1Q86D 3MAJA 5DM6F 1PLUA 3PIOF 4GGGA 3F72A 5FGMA 3TBIA 4F92B 4W8RA 2X4HA 2J7KA 3VMVA 3I71A 2WAEA 1XB4A 2H8RA 4O5VA 3PSSA 4AIHA 2ZXHA 2HXIA 2LTPA 3W2HA 1QZZA 1GUUA 2NZMA 3TGNA 3OZUA 2DMQA 3DEEA 2OBTA 4J00A 3F8FA 2MC4A 4HF0A 1S5LC 3C2BA 2W7NA 4BPRA 2QZAA 4PC2A 3WGIA 2RC5A 2Y0SA 4Z6YA 4ENMA 2M2EA 4HDVA 2LDUA 1YIJI 2MA3A 3L1PA 2HOSA 5FKOA 5IOZA 2FMLA 5FB2A 4Y9UA 3CCJB 4CGZA 1IAWA 1SFKA 4R79A 4NDLA 3FMRA 4FASD 4Q4ZF 4BE1A 4KMFA 3OL3A 2A61A 1G6NA 3BR5A 3RKXA 2V4JC 2QTLA 2XT2A 2MLGA 1VQPB 1GHCA 1F20A 2QBYB 1XN7A 2M8GX 5FLXK 1AMOA 2CWEA 2KFDA 4G1BA 2VT2A 3CMYA 4OAZA 3RKYA 3CMEI 1VQ7B 1U9OA 3BZKA 3OYBA 2AQFA 2FA5A 4RA2A 1KRHA 1VF9A 1LE8A 2OUMA 2EZLA 4HSTA 3B8HA 4UAJA 3S93A 2R7TA 1YITI 1GVJA 4M3EA 1BHEA 1XQBA 1ZAOA 2NSTA 1B8IA 1D0XA 1M1EB 2R7QA 2DODA 6PAXA 1FX0A 4RLQA 3KYLA 3WXMA 4G7WA 4A69C 2CUZA 3T8TA 4XKVA 4DBQA 3E5XA 1U2WA 2XGXA 4ZGQB 3HB9A 1OOCA 2J8IA 1BJAA 1R23A 5FRMA 4XL9A 4LB6B 2PJRA 1FOXA 3SZTA 1GDTA 3I1FA 2XB5A 3MEXA 1I1SA 1G3YA 4M3FA 4KN4X 4MIMA 1HSJA 2M3AA 2D5VA 1E43A 3Q38A 2DETA 1X3UA 1MJ9A 5DS9A 4PC7A 4PJLA 2GOMA 2L4MA 2DJNA 4ZZDA 4MYUA 5D8LB 3QPTA 4Y7NJ 1VQMI 2R5ZB 2V7UA 3PIPF 4YFKF 1AOYA 2BM4A 1W36D 3TO9A 4PC3A 2E7XA 2X48A 1W5TA 5EDNA 1HZEA 2CS3A 5J3LA 5DD4A 3G71I 5JMCB 2QF7A 1A31A 1HKSA 3DPTA 3L2UA 3CC7I 5H5JA 4DYQA 1K28D 1U6GA 3FBNB 1VFCA 1FMWA 1H8AC 1D8JA 3KP5A 4KJZA 4KH3A 3OYHA 4YXWA 1SVOA 2PMZA 1O8KA 3IRRA 3JQRA 3CCUB 4YZ0A 1G3WA 1EFRA 3LWFA 3OFNA 1WZ2A 3HPGA 2WJVA 1LVKA 4BBRJ 4TSFA 3I55B 3B73A 2L9VA 2Y48A 2UXNA 5HDGA 4H0EA 1X1DA 3ECHA 4KKSA 4LOCA 4AU7A 2OBSA 4FISA 3EUHA 2XC7A 4A3CJ 2YX4A 3BR1A 4A3LJ 2X51A 3BCBA 4UB8C 2OV7A 2IS6A 1QA1A 1Y1WJ 3J7AY 3TO6A 2ZXWH 2DMNA 4W97A 1RI7A 2P6TA 3AVWA 2BM0A 4KN7X 3A2KA 4QPQA 3HKZN 3CCEI 3ROUA 2DT5A 4BY7J 4XD7A 2V7FA 2FJ1A 3HG9A 2VBZA 1GVDA 2Z9OA 1VQKB 5KVRA 3I59A 3JRGA 2XGEA 4MYTA 3BTJA 2BGCA 3WHCA 2ZBUA 1FOYA 2Y9ZA 2E19A 2QMUA 1YE9A 1EA3A 2P8TA 1S7AA 3AVXA 1WMRA 2GBYA 3GX4X 3D5SC 1Q7YD 3BH6B 1EH7A 2W6IA 3CJRB 5EG0B 3J81k 1NJID 2LRDA 2QSFX 1SANA 2JQ7A 2R93J 4X6AJ 3DDYA 2WAQA 1TQPA 3PUBA 2L01A 1CF7B 3UW0A 1MH4A 1B59A 3CCVI 1Z9CA 1X4OA 2B5OA 3ZUGA 2LY1A 1ZRCA 3N05A 1JJ2B 4ZTJA 1HG8A 4RAZA 3I4NJ 5IYWA 3S3OA 3V42A 1VQ8I 1SFEA 4YIIA 4CCNA 4IHVA 4IEJA 4CH7A 4G7XA 1V4RA 4J0QA 2DDAA 3OYIA 1G7CA 3OEHA 4U0VA 2DDBA 1Z3YA 2DMUA 2P0WA 4GYGA 3CCQB 2V4DA 4S0HB 4AIJA 3M4OJ 1H0MA 5IYDJ 1O8DA 4LG0A 1ORKA 1SVLA 4Y15A 4MEXF 2WV1A 2KZGA 5L3CA 1XG1A 1HKQA 3OMYA 3KP6A 4BEHB 5TJJA 4E7JA 2ID3A 2HWVA 1O8MA 4M6VA 3WU1B 2XF6A 3ZQCA 1GLNA 1COWA 2Y31A 4NNJA 3VR6A 1YIJB 2LYCA 4RS8A 2HPIA 2RC4A 3ZZTA 3AG2H 3L2VA 3A03A 1YS6A 4CXFA 2NVYJ 1B9MA 3BDDA 4AYBN 3DTEA 2QSHX 2Q6LA 1R49A 4E70A 5J6XA 5BSXA 2LD5A 2HGCA 2WY8Q 3BY2A 2BM5A 2Z33A 3ABMH 5J3OA 2DFIA 2LC2A 2R7SA 5IYPA 2WYRA 1ZN2A 3DP7A 2F1LA 2DA1A 4BHCA 1X1PA 2BOLA 5ILSA 1IXRC 2IS1A 3CMEB 3BP8A 1FOKA 3RIQA 4G12A 1PJ7A 1UG0A 2O8KA 3HDDA 3OIPA 3LA2A 4GQNA 1P4XA 4ZYAA 3CCSB 3PSFA 3S2WA 1U78A 4OOXA 5J35A 4BE0A 1T0FC 4A3EJ 4TT3A 3V8JA 5KCMA 1O4XA 4HW0A 3HOXJ 3I5UA 1AA7A 1BI2A 3U1DA 4EVIA 1OKRA 2VBSA 3FKSA 1RR8C 3BG6A 1IN4A 2DY1A 1VZ0A 2M87A 3QE2A 1IN8A 1TBXA 1TP4A 3AG1H 2ECBA 2M45A 2ZB9A 2EV0A 3I58A 3OV8A 1X19A 1UHMA 4PJMA 5HNFA 2OTLI 3ASRA 1WU8A 4QLCU 3T51B 2DI3A 2DLLA 1PUFA 2CUJA 3BY6A 2VPLA 2PIAA 2V26A 4IRIA 2BMWA 4I98B 5F6FA 2M30A 4OJ5A 1S6LA 1Y0NA 5ED4A 3I3LA 4XRMA 4FE4A 4I2OA 2ZFUA 2RGVA 4G6QA 3MKWB 4RD3A 1IC8A 3A35A 2PYGA 1JNYA 3U2QA 1DDGA 1VQOI 3FK7A 1K7AA 2P7VB 2J8KA 3LO8A 9ANTA 3EDPA 2WB1N 4MO7A 1V5EA 2MBFA 3QPLA 3SXYA 4CYCA 1G3TA 4IO9F 1GO2A 3G71B 1DBOA 4NK8A 2ZZFA 2EH3A 1QQ1A 1BJKA 1J5YA 3BQZA 1GV5A 4M9ZA 3VWBA 2VQHA 4UV9A 2LBFA 5HVQC 1R5OA 1FMVA 2XSDC 1UJ8A 2IGNA 1VHOA 4PC6A 5EYRA 3ZXSA 1G7SA 4Z4YA 1H85A 4PGHA 3S14J 1FIPA 1ZLJA 2C6YA 1OCCH 2JMWA 1XSDA 3A8JA 1W0UA 1LPQA 3IHUA 3FXOA 5A2QK 2LOOA 2FNAA 2NOJB 2ETHA 1YX5A 4X1EA 2V6EA 1OGJA 5HS8A 4DNCA 2FQ4A 3J81Z 1TW2A 1Y0YA 3G6EB 5D4RA 1LEBA 2PLFA 3V7AA 4HWVA 1ETWA 3VPRA 3QYBA 4RGUA 1LVAA 3O8HA 3IL2A 4ZTFA 1WH7A 3GO5A 1JKPC 2CW8A 3WTSC 2XV4S 2ZTGA 3K10A 2JWTA 3BROA 3P7NA 4QTRA 3LQEA 1TQIA 2XASA 5AIQA 2E1MC 2LY2A 2VFPA 3JTGA 4X7DA 2JVHA 4P1VA 4OZZA 1QX4A 4LGWA 1BI3A 5JHFA 3WE2A 4B43A 2MD5A 5KAIC 4ZV4A 2ELHA 2VKHA 3QWLA 4BJ5C 1S9HA 3BLYA 2NVUB 2XAHA 2D2WA 4YFNF 4XKWA 3K4BA 4D5FA 3GUDA 3V7SA 2DEUA 1WXRA 5EGOA 3OS0A 2V1UA 5ICFA 1W35A 2K85A 3BPXA 4LIVA 3IKTA 4Y4RA 1BIBA 2FXAA 2KIMA 3MKLA 3OS1A 1RUOA 2ZSIB 4XN0A 1B8IB 4B3GA 2Y0SN 2XKOA 2Q2EA 1KQSB 3EPZA 1LEAA 4HEA2 4CHUA 2K7LA 1W36C 3BQJA 1XX5A 1MDMA 2M5SA 3P9KA 2XPUA 2LR8A 1QBJA 3FMSA 2DCUA 1NHAA 1ERDA 1T56A 4WXDA 1W0JA 4Y52J 3OYAA 4XLPF 3GW2A 1M1KD 1ZK8A 2DYRH 4DIQA 4AVZA 5LEJA 1CLWA 5TISC 3ML6A 1WJFA 4K2EA 4IX7A 5L3GA 1Y0UA 5F1RA 2BGJA 2M8EA 2F5EA 1YS7A 1N8RD 4ZCLA 3O6BB 3F6OA 2EFOA 3LSJA 3GFJA 3SDBA 4JRAC 4OINF 2HKOA 5A89A 4MFEA 1E2XA 3H36A 3QPSA 5CPRB 4CCOA 1F5TA 1FIAA 5M5YJ 1YQAA 4ZGNB 3JAMK 4U0WA 2F43A 3ZQLA 5BPIA 1WCMJ 5IP7J 2QEXB 4M73A 4A5NA 2OBPA 2KRFA 3F21A 2HQAA 1FOWA 3RQ4A 5K5RA 5ILVA 1GV2A 2GA1A 1TW3A 3SEQA 5FLVA 2EZKA 4Z4TA 1EFTA 3BG9A 3T9GA 4PZJA 2VXDA 3G2BA 2OU2A 5TGTA 1QFYA 5AIPA 5C1EA 2ZMEA 3ZCOA 3QU3A 3N97A 2DO7A 1JJ6C 2IT0A 5LGUA 2L3DA 3K4CA 5HLGA 2P7CB 2HVQA 2EFQA 4II3A 5EEHA 3JRBA 2OPTA 3K4JA 1D2EA 1B6AA 1O3SA 4MGRA 1SKQA 2GOXB 5H59A 4BHBA 1YIOA 2GPJA 1HF0A 4YFXF 2R7VA 1X58A 1F9NA 4M3GA 3V7CA 1KK0A 1XDSA 1JTXA 3DBRB 5CVJA 4IHYA 1QU3A 1TUIA 4XOTA 1VLYA 1ZM9A 3W5UA 2OBRA 1TLHB 2PMZN 3H9QA 3I59B 2A5WA 4LJZF 4UUTA 1YHQB 3BR6A 2YU9J 2BXZA 4YHBA 5LHIA 2R7RA 4PJNA 5JHUA 1WPCA 1OISA 4WZTA 3K2AA 2PX9A 1O8EA 1OMIA 4B09A 3FJOA 3BR3A 5TV2A 1KK2A 1H9TA 4L0ZB 3ZMDA 2XVCA 3ZN1A 4HNUA 5DUKA 3GTLJ 1YYVA 3S1NJ 3LMMA 2E1NA 1UMKA 3CCLB 2EK5A 4BU2A 3OYLA 2VI6A 1UMQA 1FNDA 1ZARA 2LFBA 2ME6A 4LBWA 1DDIA 2ICWG 4RD6A 1PE9A 5IYBJ 4NUBA 5B66C 3KX2A 2FMYA 3U1KA 1I18A 1QPMA 3F8CA 2GIZA 5CLSA 1Z6RA 1VQNI 3C7JA 5CQGA 1Y39A 1V5FA 2CO5A 3ZR8X 4A12A 1SAXA 1JUPA 1XG2A 2LMDA 2X9DA 1ENHA 2K4BA 3F8MA 3VODA 3OY9A 4E7HA 4LG0B 5FO0A 1T6SA 1JJ8C 4I02A 3HRTA 4HPQA 1Q1HA 3ISPA 3M8JA 1I1GA 3JRAA 1R71A 4YCQA 1LFBA 2BE5F 1IRFA 2WAQN 1L3LA 1V54H 2YU3A 2UUZA 2D45A 4YAOA 3CCMI 4LK0F 5J1UA 4I01A 1FZPB 1YI2B 3T53B 3SZGA 1N0VC 2VOOA 3RDIA 2KLOA 4A3MJ 3TH0A 1XMKA 1Z1DA 1HW2A 1JGSA 1BC8C 2ZKZA 4ZYGA 3PFIA 2A68F 2F5CA 4WZEA 2WA0A 2PMHA 1JT0A 2LF7A 3BZ6A 3VYTB 2XAGA 2V6CA 3OIQA 4RPBA 2W24A 4X7FA 1FPQA 5B6IA 2EV5A 4HX8A 1ZLKA 2IS4A 1NK2P 2EIXA 3ZIAA 1WOSA 3R61A 2EQRA 1W9XA 4OIQF 3R6SA 2XNDA 3CCJI 2M7AA 1E63A 2WZPP 5B1BH 4CUGA 3GTMJ 3S17J 1XFOA 3OYDA 2KISA 2L0KA 5LMZA 2BHYA 1QG0A 2EJRA 4ETSA 1VQPI 3Q0UA 2DMPA 3MWMA 5FKLA 3O2PE 4I6ZA 4B3FX 2ESHA 3WG7H 4A3BJ 3HYIA 1VJSA 2RDPA 2TDXA 2XKPA 2VFOA 4RB3C 3CUOA 1RESA 3VYRB 3B02A 1VQ7I 2XEXA 3BNWA 5IP9J 1BR1A 1PUFB 4WWCA 3IH2A 5AN9A 4BGDA 4M9XA 1K61A 4A93J 4OOSA 2NTQA 1Z3XA 2VBMA 1XB2A 2FD5A 2W82A 1LFPA 3BG7A 4A3FJ 3BZCA 1RUNA 1I39A 1PVEA 2W6JA 3WBKA 2ELJA 2AQEA 4QHYA 1I8DA 1R1UA 3QOPA 4EJUA 1APLC 5BS6A 4Y17A 1E64A 3LSRA 4CYCB 2DA3A 1G8XA 4NQWA 3CUQC 3CPXA 2O04A 2ZZGA 3EYYA 4HQMA 2NV4A 4M74A 1N77A 2E35A 4HE6A 4L8JA 4X0GA 1VI0A 1MBGA 1RR7A 1WJEA 1HLVA 2OYNA 2IVMA 1WI3A 3SKBA 2H09A 3FBIB 3WTZA 4DZJA 3L2CA 2R7XA 4AF6A 3SEZA 2BEOA 2BBYA 2UV1A 2V31A 5ICGA 1DDNA 4JOMA 2GIVA 1KU9A 3FXJA 2XAUA 4JBAA 4YEJA 4BDZA 5GV8A 5L3FA 2NSPA 2XNJA 4QSHA 2CU7A 3JRHA 2TCTA 4NCNA 3NAWA 2FX0A 3G4SI 4EATA 4LB5A 4IJAA 3RIRA 4OIPF 4OMZA 3FXKA 3NWSA 3IWFA 4P22A 1R4NB 2Y2ZA 3OOPA 1JI8A 3WBJA 2YWFA 1GR1A 3CCUI 2NOGA 2NPFA 1R4MB 2LP0A 2VJ4A 2JA7J 3OL4A 5J40A 3WY9A 2JPBA 1BMFA 4GO1A 3OYMA 3I55I 3LSGA 3Q9SA 3MMPA 4G6IA 2XF5A 5D6EA 4OOIA 3CRZA 2DQRA 3I9V2 3V8KA 1QH0A 1IB4A 4EJVA 3W6VA 4F52A 4RDUA 3I4MJ 3BR0A 4Z05A 1WOPA 5FLMJ 1VNDA 3VFZA 3WTXC 2CK3A 1DP3A 4P26A 4XR6A 2E71A 2EFNA 2H8WA 3BJOA 2E1CA 1OQYA 1VQ9B 1QVTA 2EIJH 1YX3A 1IZ1A 4DZPA 4IL6C 2MFZA 2ZL5A 5EGOB 1O8FA 4WWVA 3KLOA 2HVRA 3GLXA 4UXNA 5E1ZB 5B1AH 4U0YA 3J80K 2GZWA 3K4KA 3K1NA 1W4MA 2Q2EB 1D3YA 1WHUA 5GTHC 1ODDA 4D5CA 1W0TA 2IRFG 1ON2A 2DT7B 3LSHA 1V0EA 1U0JA 4JP0A 1JT6A 1T33A 3AFHA 3RPUA 2K3FA 3LQRA 1TZLA 1ZUNB 4NK6A 1KGSA 3FPPA 4N3NA 4OPVA 5GPAA 5JLVC 3PVDA 1VQNB 3UKGA 1W7PA 1EZGA 2H1LA 3K4MA 3GYHX 4BL0B 4EEFG 4OAYA 3VYUB 1NH3A 4NHJA 1N05A 2JIZA 1JTAA 1YW9A 4ACAA 4I76A 2Z5UA 1MZBA 2VE8A 5EEGA 4RM3A 3W5VA 2XGCA 1PXZA 3ZQQA 2X85A 4ITVA 1D1NA 2EWNA 4MEYF 1U5TC 3H3ZA 2HOEA 5E8GA 5HDNA 2R0QC 1AIRA 2H6CA 2E1OA 3W5HA 4M71A 2PYHA 3C18A 4OMYA 3CLOA 1FRNA 3CCMB 2STWA 1LDJA 1OCOH 2FBIA 2QTZA 3H5NA 2NNNA 1BLIA 2X6YA 1LFUP 4W8TA 3V8LA 4XICA 4E4HA 2C4UA 3CCQI 4X8IA 3HSFA 2ZSHB 1VQ5I 2IW5A 3FHNA 4FXUA 2DQLA 4ZYDA 2O6GE 2HKXA 2M1BA 2VFQA 5E8IA 1WWXA 2D3NA 4NC6A 1FNCA 3HSEA 2ZMEB 4E7LA 2CH0A 2IJLA 1D8KA 2ZL6A 4PCQA 2IP2A 4A6EA 1MJBA 4I0AA 3CD6B 2XAFA 4KFCA 5CVRA 5K5QA 4LLLA 2DTRA 4DGWB 3WTUC 2IA0A 2G7UA 5FLXZ 3S8PA 1TC3C 2YPRA 5L3BA 1HW1A 2BY2A 4TV7A 1NTCA 4IPAA 4HLYA 4ANJA 3L2WA 2LG4A 3CCSI 1QQIA 3OYGA 1FNBA 2HFHA 2BYVE 1LNWA 3EQLF 3M1EA 2OC6A 2A6EF 2UZKA 2FF4A 1FEXA 3DLLF 1G2HA 2I1LA 4AC9A 2AHOA 2PMUA 1ZM3A 1E0EA 4CCMA 4YIFA 3COAC 1S72I 3OSFA 2BZTA 1YLFA 1T6XA 3RPQA 1KYWA 2Z8GA 3WTVC 2K9NA 5E1XA 1FSEA 1QVUA 1Z21A 4I09A 4RAFA 3VO2A 3GTKJ 1D1AA 4QV2A 2W00A 1LQ1A 3M8FA 2P5VA 3ECOA 3SYTA 4C2LA 5AONA 1XD7A 1KK3A 2X1CA 3Q39A 3DCFA 2LNBA 4BBSJ 1FP2A 2XSJC 3OYKA 2DW4A 3QFCA 2VBXA 3MKYB 1WJCA 1I3QJ 2JT1A 2OZUA 1AWCA 1DU0A 2OZ6A 1UFMA 1WSVA 2FOKA 2YX7A 2HPMA 2FUG2 5DCFA 4OP7A 3P9IA 1BN8A 1TWCJ 3HSRA 1A8PA 1O8GA 3OOUA 3AK5A 4Y9RA 1R5ID 4YZAA 1KTVA 1RIOH 2D74A 1ZQ3P 1EXMA 1GXQA 4ZYEA 1LLZA 1SMTA 3G4SB 2R92J 4P25A 3A0HC 2CFOA 2QY1A 1T6ZA 3A8IA 2PE3A 4Z03A 4NB5A 3OE7A 3WNCA 4YAWA 1D5YA 5IK2A 2EINH 4RGSA 2CJJA 2R9VA 5HZBA 1UD2A 4A0XA 3GLLA 1IN5A 4F91B 1QVFB 2EPFA 3G3ZA 1POGA 2V7TA 3BCDA 2O8XA 1ONVA 1OR7C 4JX6A 2W57A 3BPVA 3G6EI 1OYIA 4Z4VA 4DQLA 1RWRA 3CMAB 2K40A 3S15J 2R5YB 4JMQA 3AVTA 2ZO4A 4OJPA 3HZJA 3PM1A 1NHCA 3EUKL 3PO2J 2K9LA 2HXOA 3ES9A 3H3VK 4M0LA 2BSAA 3OAAA 4UZUA 3BH7B 5LLQA 3OYFA 2DFFA 2WSSA 4L5JA 5BMZA 2EV6A 3W2FA 3C1DA 2NS8A 4X7CA 3ISXA 4IHWA 1UHWA 5KW9A 3HOUJ 3ASSA 2VNHA 5JBQA 1MBKA 3JQQA 4L9VA 2V7QA 5EJCA 2EILH 4CZCA 2PLYA 5FKNA 2I5UA 2DA2A 2JK3A 1MSFC 2PJPA 1GVHA 3ZMSA 4TMWA 2L7ZA 4BYYA 1FWZA 3A0BC 2N8GA 5IP6A 1IXCA 3DQVC 1PJ6A 3HTUA 4HF1A 5EZGA 2HS5A 4RDJA 4HG2A 4BQOA 5TRDA 2GWRA 1ELOA 4EQQA 2Z1DA 2MW8A 2QSGX 3BOQA 1E3HA 2FX3A 5F1JA 3GXOA 4S04A 3TDZC 1O7LA 2FOWA 1EP2B 5IYQA 5F4JA 4NQWB 3GWZA 5DSZA 4BH9A 4NBQA 3DPUA 5D5XB 2PECA 2AXLA 1HSTA 1K83J 3MZYA 4HQEA 3ZPNA 4MQ9F 3N4MA 5IT3A 3OWTA 1YO5C 1RZ4A 1UCRA 1OFMA 3P27A 1VQ5B 1DU6A 1FNNA 3FZVA 1DGWY 1KTWA 3GFIA 3HOZJ 4IF4A 4AM3A 3PL8A 4LMYA 1N0UA 1N25A 4E7ZA 2DOEA 1GJRA 3ZSCA 2X3UA 1WJBA 3KP2A 3UNGC 2HMAA 2HDWA 2VC1A 3ZP5A 3PENA 3D1NI 4AD9A 2K5CA 1FRQA 1SM4A 4Z4SA 3CCRB 2L02A 2LKPA 2VL8A 4ESBA 5JR3A 1EWYA 3JRDA 2QEXI 1MGTA 4RDKA 2BW3A 3F3XA 1LJ9A 1ZRDA 4LLGF 5B5EC 3FHZA 3RZDJ 2X0KA 3CF5F 3EQNA 3PUFA 2O03A 2WZNA 2X0LA 5C4XJ 4JYKA 1NG7A 5E1WA 3H5RA 2RC6A 1S7OA 1QCXA 3AL0B 3GF2A 4RM0A 1QJVA 3ASQA 2L4AA 3HGGA 5HLTA 4ENKA 1JUSA 1DG1G 3RYRA 4QFMA 2WTEA 1WOOA 4RDLA 4R8HA 2GXBA 4YALA 4LLNA 5CQEA 2FEZA 4C2TA 1M90D 2DAOA 1O7FA 4M72A 1CGPA 1OCZH 3BC8A 1G59A 5GPCA 5LEKA 1S72B 2P81A 1BPLA 1I7PA 1IDKA 1OFLA 3Q3SA 2HOAA 2QQBA 2K02A 3ZQIA 3BTCA 3MQ0A 3BC9A 1YRNA 2UXXA 1YHQI 1K6OA 1ZH5A 3ML3A 3ZPPA 1QHHD 1RQPA 2OQRA 3KIOA 2V5IA 4YZXA 2BY0A 1OCPA 3VMWA 1F1ZA 1WQ2A 1MKMA 2ZCWA 3BTLA 4U87A 5DUIA 2XGJA 4B3XA 2VXZA 3B6AA 3ZN0A 4MTDA 1RRJA 1K79A 4UY8I 2CRVA 1KCDA 4BHPA 3WTWC 3SZPA 2ZNYA 2OQGA 5LRRA 3W2AA 5TR9A 1W5SA 1W7PB 3CCLI 4F55A 1VQLB 3JU4A 2STTA 2BSPA 2JN9A 3OYCA 2D1HA 2KRHA 4PAAA 2PEXA 3H9NA 2QUFA 3JX8A 1R5BA 2XC1A 3HOSA 3L09A 2R7ZJ 3LMWA 4C3HJ 2WADA 1V55H 4V19K 4X0CA 4KKUA 3OYNA 3P26A 1X1AA 2A6TA 2MG4A 1QA3A 1KQ9A 2KPMA 2XGDA 4L9JA 4A3DJ 2IA1A 5A2QZ 4JQFA 4ON0A 1IJFA 5K7HA 1AKHA 5IPAA 4BDYA 3W3CA 1YJ9B 1X1BA 3KE2A 3GVAA 5A8AA 2E1RA 4FN5A 3RI4A 5FO1A 5KNLA 1WI9A 2KDOA 4D7NA 2JJ7A 3V7RA 1YFHA 2NVXJ 5FKKA 2VUMJ 2EZIA 5E17F 1IB0A 2J5OA 3GCMA 2C5BA 2XZOA 4OIOF 2XTWA 1TNTA 2BXYA 2JSPA 5ILUA 4HNTA 1YLOA 4M2LA 1O8HA 2KJCA 3E6BA 1E79A 4G8XA 4Y33A 3KZZA 2JZYA 1P4MA 1U5TA 3U6BA 1BOAA 1PP8F 1GXPA 1T08B 4D9JA 2C78A 4M4SA 3AGQA 3OSGA 2ESNA 5FIUA 1YI2I 5LRSA 1FDRA 1KC8D 2PQ8A 3SFIA 4FK8A 5GTIC 4Z4WA 4MHGA 2QM3A 5LFAA 3S1MJ 4G6TB 2CV1A 1O8LA 4XNFA 1RPWA 1OPCA 3KP4A 4RMNA 5LGNA 4RB2C 4AIKA 1O3RA 3VMFA 4ZCIA 4WZLA 4IHSA 2VIXA 4WXHA 1AIPA 3CF2A 2MC3A 1H42A 1XGNA 4RGRA 3K70D 3QODA 2F48A 4I0BA 4M53A 2IPQX 4X06A 1LE8B 4X05A 1KCCA 1NRKA 1GQ8A 2KT0A 3HBLA 3DEWA 2QCOA 2CUFA 2VNIA 3TL4X 3PJRA 3BG3A 4J19A 1B2RA 1FTZA 2DT6A 4UV8A 3F22A 3HAGA 4AWXB 5D5WB 4U4BA 2VYQA 4I84A 5CVIA 1ZYRF 2LK2A 3RJPA 4BE2A 1KJZA 4TMXA 1TTYA 2C4TA 5FJ8J 2V79A 3FXQA 3E6MA 4FX4A 2COBA 4A0YA 5M5XJ 2VT3A 4RJLA 4HBLA 1R36A 2PJRB 2CNDA 4IRGA 2F4MB 5HODA 2QWWA 4UZFA 2JTVA 1ITYA 2BM6A 4R1HA 2NT6A 4U49A 1MIJA 1YJNI 3Q0VA 2XTYA 2YS9A 5TY0A 1IW7F 3QYEA 1VHEA 5GAHJ 1T6YA 4UVBA 3OEEA 1MRZA 4HA8A 1XE1A 3CJNA 1J59A 4ZDPA 2XROA 5FL7A 4KT5C 3K0LA 3V4GA 3REOA 2RNGA 5E3OA 2BM1A 2L2OA 2P6SA 3RKWA 4AF7A 3ZQGA 4L9NA 2MH2A 2IXSA 1JKRC 3CC2B 1N07A 2X1DA 2OAZA 1HF2A 1OFCX 1ZR2A 2EB7A 3NEUA 4RAGA 4L18B 2V7WA 4EM1A 3LAJA 4B47A 3PA1A 2C2WA 4C3IJ 2CC2A 1VTNC 1H8HA 3CO7C 1HDPA 1O57A 3IP4B 2V7VA 4WZKA 3BR2A 4PFPA 5D8KB 3WNDA 1S3JA 2DU9A 2D3LA 1RKWA 1K4TA 1BX0A 2K3PA 2E2IJ 1R5NA 2ODLA 2CUEA 4DYRA 5IYNA 3I56B 4YDTA 3A4CA 2XAQA 4RBOA 1MNDA 4DYCA 4XKBA 4XRSG 3V76A 3ASNH 2A5YB 2O61A 2GJKA 3S16J 3HC7A 5JVTA 4OOVA 1ETXA 4CA0A 4DBRA 1UD3A 5IT9K 1JA0A 3SLNA 3KEOA 2QYOA 2CV0A 5GP9A 1Q1VA 1Y6IA 3KYDB 3NQOA 2A05A 3WGHA 4IVNA 2F4OB 4HX4A 4N4NB 2BVLA 5J1RA 1FNMA 4XOPA 3LQQA 3ASOH 2Y69H 2EIKH 1VQ9I 2IGOA 1MSEC 1HW5A 2VBYA 4F7DA 5KK1A 2F4NA 3OZVA 3B8YA 2PG4A 3LNNA 2QA4B 2QBYA 2QN6A 1ZR4A 2WPDA 2GLOA 2V1XA 2XUBA 1A35A 2FE3A 2A07F 2IOUG 3L7WA 3DU6A 1HDDC 1S0UA 3IAM2 4QVJA 1IO2A 3H35A 1HQCA 3NRVA 2DTZA 2W1OA 4HAMA 3RCOA 3VYSB 5JI6A 1CNEA 4HV5A 4DOZA 2INUA 4MQVA 1IN6A 2O17A 3H5AA 3KZIC 3BTIA 1UD8A 2C5HA 5FA6A 2DA4A 1N75A 1D1BA 1NG6A 3MMYB 4URRA 3CJQB 1WJAA 2NXNB 1S4MA 4WF2A 2NTBA 3AG3H 4B3AA 4OPOA 1T98A 2RQPA 3FF5A 2R3SA 2VJJA 3DEUA 3CB4A 4KITB 1IHMA 1W87A 2GREA 3J7ZI 1CQXA 2VN2A 2R7DA 5JLWA 1SFUA 1Y56A 3ONQA 3AGPA 2OTJB 3SUCA 1FYKA 1IDZA 5H6RA 3SJMA 4II2A 1Q82D 2YUSA 3NB2A 5JFRA 1BX1A 3HRSA 2M34A 2JDIA 4O3MA 3HOYJ 3VNVA 1R00A 1ZGWA 3SQVA 3BCFA 1PJ5A 2BW3B 2KJBA 3SDGA 2D9RA 5HXBA 1BL0A 3OR1C 2DA7A 1PDNC 3UR3C 1BW5A 3J7AO 1JA1A 3ESWB 4V02C 3EUHC 2XTXA 2L5QA 4EJTA 2DMTA 1BI0A 4AC0A 1FC3A 1QGPA 1Z7LA 2L7MP 5F0HA 1SC7A 4JK1X 1G3SA 3T0YA 2CV2A 1SMYF 3PNYA 4IHTA 1QUEA 5K1YA 2QYUA 1N08A 4YFOA 3AVUA 1E1RA 1VQ4I 2IBDA 4P55A 1SD7A 2JA2A 1UD4A 2E60A 1RU4A 3CESA 3SHFA 1TQMA 3CD6I 1IUYA 1LKXA 5D5UB 1UG2A 4P3YA 3RSNA 4KKTA 2V1DA 1WP6A 3BH4A 1JRGA 3SJZA 2HDNB 3GVKA 3DLAA 1YOVB 3QP5A 2NTPA 2Q0OA 5HS9A 2F1MA 4ASNA 2BV3A 1NB9A 4LFUA 1YRNB 1TT0A 1TLLA 4AIDA 1U8RA 3CP8A 2ZNZA 3F6VA 1W1WE 2CFXA 5FKMA 3P4GA 4XLFA 1P2FA 1WDTA 3ASTA 3GMEA 2GK7A 2LH9A 3F8NA 3FX3A 3C2HA 2Z3YA 2BY1A 4P5OA 2KMUA 1QGAA 3GQAA 1T0FA 1U2RA 1EA0A 1YJNB 4ZZLA 2L9NA 3GIRA 1D5VA 4LG3A 2RREA 3IH4A 1FY7A 4HE5A 2DIEA 2ADUA 1UB9A 3OP1A 4P96A 2HEOA 4XRSA 2LKSA 3JRIA 2E2HJ 4LBYA 3OIOA 4Z4ZA 4U7BA 3FWEA 2ISZA 1MBJA 2CF4A 1JUMA 5HLHA 3ASPA 5JLXA 4MLOA 1E3OC 4WX9A 1IRGA 1RETA 2LBFB 4YRVA 1WJ5A 3S1RJ 1JKQC 4RB0A 5E79C 4XLHA 3HOTA 1OFEA 1XSVA 4XLAA 1SKYB 5FD6A 1HA8A 5THXA 2MABA 4IRHA 4FETA 1T39A 1ZREA 4E7IA 2F4IA 1AKHB 4X7EA 2NAZA 3E6DA 4GYIA 3K69A 5E3MA 3BJAA 4N9HA 5EEAA 1D0ZA 2E36A 3KETA 1TYXA 2VBEA 3PETA 3KP3A 1P7JA 3E7LA 3QP6A 1U9NA 2DOFA 3M9AA 3FPKA 3AG4H 3EETA 4PUSA 5H6QA 3VO1A 5DM7F 3G05A 1PUEE 1W5CC 2EFGA 4L5IA 3OW7A 2XF7A 2NVQJ 1Z7UA 4E7SA 1OFDA 4QUZA 2VBWA 3Q3AA 3GTJJ 2DOGA 1XCBA 1E3ZA 5C1CA 2Y0MA 2DBBA 2O0VA 3HHGA 2QQAA 4EGYA 3W2WA 4XQFA 4IQ4A 4ABZA 3TMOA 1V5VA 1WPKA 3S3NA 2CMPA 3CMAI 1IV6A 1P92A 4EGZA 1HC8A 2HYJA 1MMGA 1QRBA 4W8QA 1DUXC 3B90A 4RD4A 1D1CA 5FFZA 5IOYA 4M9SA 5E18F 1KU7A 2B0RA 1QO0D 1SAUA 3J80Z 1A36A 3HIFA 4OPWA 1U8BA 2X8KA 1N78A 5HZAA 2EWEA 5F04A 2HQRA 1G4DA 1TWAJ 2ZZEA 5J8CA 4A3KJ 3ZBUA 4HF2A 3HXLA 2Z6BD 2KZVA 4YC5A 3U6KA 3GZ6A 1Z6TA 3CDHA 4P2NA 5H2FC 1XPXA 1IF1A 1MDMB 4FTHA 3QYFA 5CDFA 2BM7A 2HDDA 2L7KA 3T1BA 1GAWA 1OGOX 2MH9A 1XTAA 2ZZQA 1UD5A 5HS7A 2FBKA 3S3MA 4HNVA 1FLIA 2CBXA 4CCJA 4RB1A 5A88A 1X2NA 4KNYA 4UUSA 3R0AA 1ON1A 4Y3OA 1PYVA 4N9IA 1EP1B 3TOAA 2QKMB 3ULQB 4Z4UA 3ZMZA 2JN6A 2WV0A 4HOBA 2JSCA 1ZHFA 5D6FA 2R6HA 4PABA 5F4MA 2MSYA 3E1YE 3ABKH 4XORA 4JX5A 2QQ8A 4ZDLA 1A5JA 1KQ5A 2DXIA 4G5GA 4DK1A 3LSMA 4BS9A 2OCCH 1R22A 4CCLA 1OB5A 1FP1D 4BXUA 5F0FA 1JXSA 1E17A 2QXZA 1IA5A 2QGGA 1TYVA 4UNOA 4TN1A 1LDDA 4C3JJ 2ZL7A 5FFXA 2AO9A 4B48A 3DKXA 1F60A 2VOPA 1LB2A 1VF7A 4XBFA 1TWGJ 2VFNA 3GRHA 3G1OA 1DP7P 4TKOB 4KMUX 2Q1ZB 2HVSA 1VQ6B 1KA8A 2EBIA 4RD2A 2XPVA 1Y8QB 5GADJ 1OYYA 3CCRI 1VQ4B 2UVFA 2KQRA 2G9WA 1QZEA 5HNHA 3E6CC 3G73A 2VKDA 3MZHA 2G7HA 3F9KA 2CSOA 1Y8RB 2JRMA 2AHQA 3FMQA 3HUGA 4CCKA 1ETKA 2XT4A 1TTTA 4B8XA 4DW6A 3CC4I 3ZZ0A 1KQ8A 3FXRA 3EYIA 2KIFA 1CNFA 1OCRH 1LM1A 4OJOA 1SD4A 1H80A 2VNKA 4EM2A 1WGXA 1YG2A 3GZ5A 4KIGA 4JX4A 2VASA 4YEIA 3GTQJ 1TL8A 2BN4A 3KCCA 2R7WA 4XMYA 3O3KA 3D0SA 2HQNA 4FWTA 1BN5A 3DBHB 3W6JB 2MLKA 2JUGA 4RAYA 3H0DA 1NDHA 1YJWB 2YWHA 2VFMA 2R7FA 1C0WA 5DD8A 2X6XA 2FVGA 1I6XA 4CDGA 2BY3A 4P9UA 2L54A 4OU0A 2HYGD 2DK5A 1J2XA 2KL4A 4ZC3A 2WR8A 3LYCA 2DA5A 3TW6A 4EV0A 1AU7A 3RTRA 2COMA 2DFHA 2VQGA 4L9TA 3JURA 2LSOA 1TNSA 2ACJA 1TWHJ 2XIGA 5FO5A 3CJTB 4FQGA 2WBMA 4PSXA 2YWEA 2NVTJ 2PFBA 3ZOBA 5JVGF 4NBSA 1BA5A 4PJ0C 2UVEA 4HRIA 1T95A 5L3DA 2PMDA 5CYVA 2F6CA 3PQJA 2KHMA 2GQFA 1FYLA 2GM4A 3DTKA 3TDUC 3JSOA 1IDJA 2O1DA 1VQLI 3BCAA 1IJWC 4ENNA 3IAS2 3GQ9A 3I54A 1X3ZB 1YW7A 3RPUD 4EMSA 3P5JA 4L0YB 1W7PD 5DNSA 3JRFA 2IGKA 2DPDA 1Q9SA 3BT9A 1ZELA 4M3DA 3B82A 1ZM4A 1J9IA 4P3IA 1P4WA 4RGXA 4Z1MA 2R7UA 1W34A 1IJEA 2L9RA 2O7OA 2O0WA 4N4OB 1R1VA 4G1VA 2RV8A 2BVMA 3NE5B 4UZEA 1WFXA 5KAFC 1YJ9I 4CO8A 2CQKA 1WH5A 1T38A 1H89C 2FBHA 2ZMEC 2X3HA 4IOCF 4RLZA 5DCMA 3RZOJ 2RKHA 2OD5A 4PMHA 1SFXA 1ZG1A 4WK8F 4YZQA 3QU6A 1PP7U 1BQEA 3PFYA 3WE3A 3RY8A 1V0FA 4XK4A 1R7JA 1FT9A 4XRFA 3Q5FA 2K86A 1BOBA 2K9MA 5FRNA 1G7TA 3JCUC 3HPHA 3W2VA 3PUMA 2Z16A 2K4JA 4ESJA 3IWZA 1JKOC 2IA2A 3R60A 4RPDA 1MW7A 4WCGA 4XLNF 4UHTA 5K7ZA 1WJDA 2G0YA 3CZ6A 2YSRA 2Z99A 3KEYA 3WTYC 2GAUA 4FX0A 5GAGJ 3WNBA 2FRHA 3S1QJ 5F0CA 1GT0C 1KK1A 1HOMA 2GK6A 1Q81D 5LHHA 2RVCA 1QUFA 4GRIA 3IH3A 1A6IA 3IV5A 3IC7A 2H94A 3M7GA 3GQBA 3OKXA 1U3EM 1ZG5A 2QZ8A 1F36A 3VSLA 3ERED 5J1YA 2RQQA 3H94A 3G1LA 2DOAA 2IAIA 3FIWA 5K7FA 1QFZA 1O3TA 3ABUA 1JE8A 1HCRA 1ZM2A 1BC7C 4ZJZA 3DTIA 1FBSA 1J9ZA 2ZTNA 2ZJ2A 1ULYA 4BY1J 2KIQA 2GXAA 4XN3A 1O88A 1ZGJA 3ZZUA 3ONUA 1ACIA 2VZLA 2Y9YA 5ICCA 4UUVA 4OPSA 1J0RA 2FNPA 2QLZA 4IXAA 2E7WA 1XS9A 2JA5J 5ERIA 3PO3J 4ZCMA 1BBYA 1I3AA 1EP3B 5F27A 1XGOA 2JVGA 1A6QA 4S05A 2VB6A 2O5RA 3ERMA 2W85A 4O6JA 3LQ6A 1STZA 2XNCA 1KZLA 1OYWA 3PSIA 5CVVA 4U7DA 3L9FA 4BKXA 2O3FA 4EJOA 4WQMA 2DJIA 4LD5A 4BXXJ 2B0LA 4Y7CA 5GV7A 4OJLA 3CUQA 4F93B 3VB2A 1TYUA 4M1KA 3F0CA 2A3SA 4CZZA 3W2GA 3VSVA 3L00A 4D1QA 2ZITA 1J09A 1ETYA 1SD5A 3TQNA 3GQ8A 4PFOA 2QX3A 4ZH4F 3K1PA 3CC2I 4C43A 3CC4B 4LC0A 2KIUA 1UZCA 4TMZA 5LGTA 4OIRF 1N06A 1F43A 4W1UA 1KU2A 2DA6A 4BJTA 2WAFA 2Q6OA 1IG7A 4EW9A 4XIDA 3A01A 5J47A 1DABA 2HI3A 3ZQHA 1T2KA 1Y0RA 4KIBA 2RN7A 1RKTA 4Q5SF 2GQQA 4QWQA 2LLKA 5LD2C 3DWLE 3I56I 4XSZF 2GJPA 2YR2A 2PN6A 2INVA 3WHBA 4LBZA 3OJWA 3KLNA 4ESFA 5DV5A 3JTHA 1DBGA 4P9FA 2TRTA 3BG5A 4KYWA 2VODA 3LFUA 2XAJA 1B9NA 5K5OA 4A5MA 2E1MB 1OCTC 3B6CA 2JA6J 2MD0A 1TSPA 1E3PA 2B63J 1FX7A 2E5ZA 4PGOA 5GAEJ 3GEZA 4M6XA 2BX6A 3WWGA 3H09A 3E3VA 1EV7A 3EQOA 3MVPA 1KU3A 1K5CA 1YITB 3I0TA 1QNTA 3IUOA 3KRGA 1K78A 5L3EA 2NS7A 3DV8A 3F23A 1QPIA 1IDYA 1KZHA 2XZLA 4HX7A 2VONA 1CQTA 1RQRA 4BQNA 1WORA 2NRAC 2VPRA 2QA4I 3B4NA 2NS0A 2V9PA 3I53A 1QRCA 4UUSB 2LY9A 3GTGJ 1IUFA 2Q6IA 4IOAF 1EH6A 3RQIA 2ZJRF 2JA8J 1BIAA 2HR3A 1QA6A 2BGIA 1E3XA 2JJ1A 1QA2A 2IGMA 4A2UA 1FJLA 5AMVA 1B72A 2DN0A 3GVLA 4QIWN 1VLOA 2LZJA 2E1BA 4C0SA 2W25A 3TO7A 1UELB 4XONA 4A0ZA 3X2QH 5HDKA 5M3FJ 4M6YA 4YAFA 4Z4RA 3QSYA 1G7RA 3S2DJ 1VQMB 3GTOJ 1ETQA 3CP2A 2ID6A 3RKQA 5E3NA 3E1SA 3G1MA 3WODF 1MBEA 5E20A 2HTSA 3J7YJ 2VJ5A 3JREA 1W0KA 1HXDA 4G7OF 2QE7A 2PI0A 3H3UA 1GAQA 3CC7B 2OTJI 1KMHA 1Z05A 3SFZA 3TOBA 1B4AA 4B4CA 3BJ6A 2LREA 2P5KA 3L2RA 2V7XA 5EF6A 4P1WA 2VE9A 1MJAA 4PJJA 1Z91A 1QVGB 1X4PA 2LF8A 3K1MA 4BAYA 3AL0C 2BPOA 4CQJA 1LLWA 4DK0A 1QZYA 4PC1A 2IEKA 3VEPA 1EH8A 3HUGB 2LKXA 5CJ9A 2QDXA 5J4YA 2H6BA 1CZFA 2NYXA 4OWRB 4D7MA 2O9LA 2AS5F 1WTHD 4G9YA 3ZBTA 3J81K 1USTA 1DPRA 2OJED 3FDYA 4GCVA 2XOKA 1I6HJ 2D1VA 5DYMA 1SFOJ 3DKYA 1XGSA 1TWFJ 4LIUA 5LHGA 3C3WA 3IKVA 4MTEA 3LL7A 3VSTA 4HYEA 4Y13A 1MMDA 2AXTC 1ETVA 5KSWB 4YAUA 4PDKA 3ZRGA 1I27A 5C4JJ 3HTSB 3CCEB 3U2RA 1P9QC 3PA2A 3T5XA 3TW7A 3L2QA 2V9KA 3CW2A 5L46A 3QFRA 1R9TJ 3CQZJ 1EFUA 2LVSA 4C9YA 3FKJA 4HSRA 4D0PA 1UD6A 2W84A 4Q47A 5CKTA 5BNGA 3CDLA 3M3YJ 2QKLB 2VC0A 4J01A 2KDZA 3F8BA 2ZBKA 4MR0A 4OZYA 1XC5A 1X1CA 1WSUA 3D26A 4N3GA 2HZTA 3U21A 2QENA 3NWTA 3QRFF 2X53S 4IW3B 3FXMA 2Y75A 1X0CA 3BWGA 4UVAA 3NARA 1BW6A 3ZMVA 4C2MJ 3JSPA 3HRMA 3LFKA 1WSRA 4Q7JB 3CCVB 3R4KA 1ETOA 3PSZA 3OYEA 3RYPA 1MMAA 1FSHA 1NB0A 1V5GA 2EFPA 5FD5A 3MHPA 5M3MJ 2HNHA 1OGMX 3JAMZ 4B4DA 2Z2SB 4PSWA 1S8NA 3I4PA 5BPDA 3R6JA 1VQ8B 3ZC3A 4YELA 1L0OC 2ZJQF 3JQPA 2VBKA 4MFDA 2HYFA 1IGNA 1UAAA 2DCEA 3WU2C 1JHFA 5B3SH 5C3EJ 3E20A 4OM9A 2OK8A 1DGRM 1KONA 2FU4A 1OLTA 2HU9A 4PGGA 1Y1VJ 3WU0A 4XM3A 5IYRA 4I7HA 3BQYA 1K9MD 3DXJF 1KD1D 1K6YA 1BR4A 2CW0F 4Q48A 1MD0A 4RCZA 2CGPA 2B7CA 4V2FA 3ZMTA 1NBMA 3GQ7A 1XSXA 3C2GA 3KEWA 2M4GA 2B7BA 3LOCA 1RNLA 5DCMB 2G0EA 1QFJA 3OS2A 1YX2A 5EZHA 3DKWA 2EFWA 3H9JA 1J75A 2W48A 4FE7A 5DDGA 4K1XA 2J5PA 3GSIA 3ABLH 3WGGA 2K27A 3MCZA 5HOOA 5IT9Z 2M9HA 5BOXA 3QFTA 3SEJA 2FSWA 1MMSA 2OA4A 3CTAA 1EJ9A 4ZYHA 2W4SA 2DYIA 2P5LC 4W8SA 4G7HF 4EH1A 2OF7A 2GA2A 1HBXG 3OW2B 3TP0A 1OR7A 2ZJPF 3AVVA 1OJLA 1SD6A 5KHDA 2XPWA 3GZNB 3ZMUA 2B7EA 5DTDA 4KICA 2BV6A 3H9GA 4GDFA 2A69F 3M1CA 4WXCA 4HIZA 2DYSH 3K4NA 3D5RC 2A6HF 4B1RA 1S29A 1OGIA 3KFWX 2BHZA 2VQLA 1H9GA 1Z67A 2CW7A 2O0YA 1MNEA 1XGMA 3MN2A 3QPHA 1T8IA 3A3GA 1XCVA 3JR9A 2DPUA 2QGUA 3GFLA 1LDKB 4HLXA 2K9QA 4AUXA 2OTLB 1DARA 3JW4A 4A6DA 4A3GJ 2VKEA 1DPUA 3QFSA 2ISYA 4F3QA 3HOVJ 2GJRA 2L9SA 2GXGA 5D5VB 4IQJA 2HTJA 4BUPA 2UWMA 2CYYA 2QQ9A 1P7IA 1J7KA 1KQ0A 1UHSA 4P9SA 3ZGKA 4KT6A 4MXNA 4TMVA 1PJRA 1MBHA 2IS2A 3K9TA 3LSPA 1WVRA 1VQOB 3H0GJ 2ME0A 4U88A 1K4SA 2JUCA 1MABA 2BVNA 4G7ZF 2JJ2A 1IRZA 2B9SA 3TKYA 1YTYA 1V3FA 1S7EA 1HKTA 4GFBA 4C2UA 4XKCA 1IV8A 4Z2YA 2DERA 4P12A 3QOEA 4R71A 3W2IA 4FT8A 1EFCA 3E5QA 3WYAA 4ASUA 3CUQB 1TYWA 2XZPA 4PK4A 2W7ZA 5E6TA 2V1NA 2HDCA 4BQAA 3R6KA 2R5ZA 4XSXF 1O8IA 1KYZA 3CDIA 4FCYA 3LA3A 3W6KB 4YIRX 3FKIJ 5DN6A 2NNYA 3GFMA 3CXCB 4Z06A 1K8FA 1ZKGA 1W2BB 1JHHA 4HV6A 3SQNA 4YG2F 4RD0A 3DF8A 2H27A 3K2ZA 3P9CA 5DEQA 3N6ZA 3HKZA 2F5VA 5BQTA 2R4GA 1A04A 3A01B 3NAUA 4NC7A 3GBGA 3E5UA 4BACA 1VQ6I 3MKZA 5J8FA 4LBVA 3A3BA 3LJYA 2ZC2A 2E34A 3FK6A 1EE6A 1USSA 4FHTA 2QVOA 3N90A 2VQCA 4RM2A 1RC9A 2M0MA 1FTTA 3PNTA 1XDUA 3MD2A 1E1QA 1TVCA 3HM5A 5F08A 2KP6A 1NK3P 4TMTA 4A3JJ 2I8DA 4BXFA 3I64A 1K73D 4GXOA 4CICA 4DQ2A 2CW5A 2ZBVA 5C44J 2R5YA 3ABTA 3KYCB 3K7AJ 5F64A 3WTTC 1JB9A 1P4AA 3Q6QA 4F7ZA 3KZYA 3JRCA 2EA4A 4C30A 3T56B 2CQNA 5BSYA 1R5GA 4ROXA 2ZXIA 2JRTA 1Z0XA 4M3BA 1YJWI 1MH3A 2X6WA 2M0CA 2HQ5A 3PNVA 4KUMA 4DNTB 1K78B 1F4KA 3ELKA 3MFKA
chains in the Genus database with same CATH topology
3UNGC 2HDWA 4IX7A 2X1EA 2K5CA 2HZDA 2VL8A 2VASA 3OR2C 2BW3A 2R7WA 1O8JA 4XMYA 3SDBA 2VJIA 1HVXA 1PKVA 1T5EA 5C1EA 3H0DA 2JUGA 4IZZA 3EUAA 1MMNA 3K4LA 3S32A 4CCOA 5CPRB 3EQNA 3LSIA 3OOCA 1NG7A 2X6XA 3H5RA 1QCXA 4E6KG 3AL0B 2KVOA 1QJVA 4ZC3A 2KL4A 3OPOA 2F43A 5HLTA 4E7KA 5FROA 3RTRA 2VQGA 3JURA 3GVJA 5CQEA 2HQAA 2WBMA 4PSXA 3RQ4A 4AYBA 4C2TA 3BC8A 1G59A 2XDVA 3SEQA 1OB0A 2UVEA 4HRIA 1IRXA 1T95A 2M4KA 2WJYA 1BPLA 4DNRB 4E0FA 1IDKA 2WY7Q 1OFLA 2F6CA 2VXDA 2KHMA 3G2BA 5TGTA 3T9GA 3WQZA 3LSKA 3ZCOA 3K70C 3BC9A 3DTKA 3K4CA 5HKKA 2KRCA 2HVQA 3K6GA 1IDJA 2O1DA 3BCAA 4II3A 3IAS2 3ZPPA 1QHHD 3GQ9A 3K4JA 4YZXA 3RPUD 3VMWA 2GOXB 4BEHA 2XGJA 4U87A 4B3XA 2VXZA 1KCDA 2R7VA 1R6RA 3D5LA 1QU3A 2IGKA 1VLYA 4XOTA 1ZELA 3W2AA 4Z1MA 3FY3A 2R7OA 3H9QA 2R7UA 2A5WA 4F55A 3JU4A 2O0WA 4N4OB 2BSPA 4RLFA 2BVMA 3NE5B 3OYCA 2KRHA 1WFXA 2R7RA 4PJNA 1WPCA 3HOSA 1O8EA 2X3HA 4IKFA 2VLAA 3LMWA 4XLCA 2WADA 3OYJA 4PMHA 4KKUA 3OYNA 1RMGA 4HNUA 4YZQA 3LMMA 1X1AA 2A6TA 3E0JB 3PFYA 1V0FA 2KPMA 4BU2A 4OJ6A 1BOBA 2K9MA 3OYLA 5FRNA 4JQFA 3HPHA 2NT9A 3W2VA 4BDYA 2Z16A 3W3CA 1X1BA 2WB1A 2HLDA 1MW7A 4B44A 5KNLA 1PE9A 2KDOA 5DN6A 3VDXA 1WJDA 3HL2A 3CZ6A 4NUBA 4CSWA 2XZOA 3KEYA 3KX2A 2JSPA 1BR2A 4HNTA 1O8HA 1I18A 2IQ7A 3VSUA 4QPOA 1E79A 1OHHA 4Y33A 2GK6A 5CQGA 4D9JA 3CMMA 4DJAA 1V5FA 4GRIA 2E5NA 3ZR8X 1XG2A 4ZDOA 3GQBA 3OY9A 1D0YA 4E7HA 3AKZA 4LITA 3VSLA 5LFAA 2RQQA 4G6TB 4HPQA 2CV1A 3H94A 4XNFA 4BQQA 3M8JA 1QHGA 4NC8A 4RMNA 1O8LA 2DOAA 1VBLA 2VIXA 2UUZA 3CF2A 3DPLC 1H8EA 3DU5A 4ZJZA 3DTIA 3K70D 3QODA 2ZTNA 3T53B 3SZGA 2MYSA 2KLOA 1DQUA 4XN3A 1O88A 3VSKA 1KCCA 1NRKA 2M7BA 1GQ8A 2WA0A 3A1YA 4BJ6C 3TL4X 3VYTB 3PJRA 3OIQA 2DT6A 4U4BA 4H4KC 3HAGA 2JVGA 4XLEA 1PLUA 4I84A 2VB6A 4KISA 2O5RA 2IS4A 3ZIAA 3TBIA 4BE2A 4F92B 4W8RA 1KZLA 3PSIA 3VMVA 1W9XA 2XNDA 2WAEA 2WZPP 2M7AA 2ZXHA 4CUGA 2PJRB 2DJIA 2NZMA 3OYDA 4OJLA 3DEEA 4J00A 4F93B 3VSVA 2MC4A 2NT6A 4U49A 4G6IA 4D1QA 2W7NA 1J09A 2Y0SA 4B3FX 1VJSA 3GQ8A 3QYEA 4PFOA 2QX3A 3VYRB 3OEEA 1BR1A 1SFKA 4R79A 4BE1A 4FASD 4ZDPA 5FL7A 4BJTA 4EW9A 2WAFA 3OL3A 4BGDA 2NTQA 1Z3XA 2VBMA 2V4JC 2RNGA 2W82A 2L2OA 1LFPA 3BG7A 2W6JA 2ELJA 3DWLE 4OAZA 2AQEA 2IXSA 5LD2C 2GJPA 3OYBA 2X1DA 1I8DA 2AQFA 2INVA 2OUMA 4HSTA 1G8XA 4B47A 1DBGA 3S93A 2R7TA 2O04A 2ZZGA 1H8HA 1BHEA 3LFUA 1N77A 3IP4B 2NSTA 4PFPA 1D0XA 2E1MB 4X0GA 2R7QA 4L8JA 2MD0A 1FX0A 1WJEA 4RLQA 3KYLA 2K3PA 2D3LA 2ODLA 4G7WA 2CUZA 2E5ZA 4XKVA 3A4CA 1MNDA 3FBIB 4DBQA 4XKBA 1OOCA 2R7XA 3WWGA 3SEZA 3EQOA 2V31A 2UV1A 1K5CA 5FRMA 3IUOA 4XL9A 3KRGA 4JOMA 4YEJA 4BDZA 2GJKA 2XAUA 3HC7A 2PJRA 2NSPA 4CA0A 4DBRA 2XZLA 1UD3A 4BQNA 2M3AA 1E43A 2CV0A 3B4NA 4EATA 1Y6IA 4PJLA 2GOMA 3NWSA 4P22A 4N4NB 2BVLA 1JI8A 4XOPA 1W36D 2VJ4A 1E3XA 3OL4A 1HZEA 2JJ1A 2IGMA 5AMVA 2CS3A 2IGOA 1BMFA 3B8YA 3L2UA 3DPTA 3OYMA 3GVLA 3LSGA 1K28D 2LZJA 2E1BA 2XF5A 3FBNB 3LNNA 1FMWA 1UELB 4XONA 2WPDA 4KJZA 3OYHA 3I9V2 4YXWA 1IB4A 4Z05A 3DU6A 4F52A 2PMZA 1O8KA 3CP2A 3IAM2 4YZ0A 3H35A 1EFRA 2CK3A 3E1SA 2W1OA 4XR6A 3RCOA 3VYSB 1DP3A 3OFNA 4DOZA 2INUA 2VJ5A 1W0KA 1YX3A 2O17A 3H5AA 2QE7A 2MFZA 3HPGA 2WJVA 1LVKA 1UD8A 1KMHA 4TSFA 1O8FA 1N75A 1D1BA 1NG6A 3MMYB 2HVRA 4URRA 1X1DA 2LREA 1WJAA 3CJQB 3L2RA 4KKSA 3K4KA 4P1WA 4AU7A 2NTBA 4PJJA 2XC7A 2Q2EB 2X51A 3BCBA 2OV7A 1X4PA 2IS6A 3J7AY 3AL0C 2VJJA 4DK0A 2DT7B 3LSHA 1V0EA 4KITB 1U0JA 3A2KA 3HUGB 3AFHA 1Y56A 3ONQA 4QPQA 3SUCA 1CZFA 4OWRB 1TZLA 4NK6A 4XD7A 3FPPA 2V7FA 3HG9A 1WTHD 3FDYA 4II2A 3K4MA 2XOKA 4BL0B 4OAYA 3VYUB 2JIZA 2JDIA 1JTAA 3DKYA 3BCFA 4LIUA 2BW3B 3LL7A 1YE9A 1EA3A 4RM3A 1PXZA 3VSTA 1MMDA 3ZQQA 3OR1C 2X85A 4ITVA 1WMRA 3ZRGA 3UR3C 3D5SC 1AIRA 1P9QC 3EUHC 2W6IA 3CJRB 3L2QA 2L5QA 2PYHA 2V9KA 1Z7LA 2LRDA 2CV2A 3DDYA 2WAQA 3PNYA 3PUBA 3H5NA 3FKJA 4HSRA 2X6YA 4C9YA 5CKTA 1BLIA 1UD6A 4W8TA 1E1RA 3UW0A 2QKLB 4J01A 1X4OA 4E4HA 2JA2A 1UD4A 2E60A 2LY1A 1RU4A 4MR0A 3CESA 1X1CA 3N05A 2ZSHB 4OZYA 4ZTJA 1HG8A 3S3OA 3V42A 3FHNA 3U21A 4CCNA 4G7XA 4FXUA 1LKXA 4CH7A 3NWTA 3RSNA 4KKTA 3OYIA 1WP6A 2D3NA 2X53S 3BH4A 3OEHA 1JRGA 1X0CA 3GVKA 3DLAA 1Z3YA 2NTPA 4E7LA 2CH0A 2P0WA 2F1MA 3OYEA 1MMAA 1TT0A 2V4DA 1V5GA 3CP8A 1O8DA 2HNHA 1OGMX 4XLFA 2Z2SB 4PSWA 2GK7A 4YELA 2LH9A 4DGWB 3OMYA 4BEHB 4E7JA 1O8MA 3C2HA 3S8PA 4P5OA 2VBKA 2KMUA 3GQAA 1UAAA 2DCEA 2XF6A 2L9NA 1GLNA 1COWA 4LG3A 2RREA 4NNJA 3VR6A 1DGRM 1KONA 2LYCA 1OLTA 2HU9A 2DIEA 2HPIA 4XM3A 3L2VA 4ANJA 3L2WA 2LG4A 3DTEA 3OYGA 1K6YA 1BR4A 4U7BA 2EWEA 2OC6A 2WY8Q 1NBMA 4MLOA 3GQ7A 3KEWA 3C2GA 1E0EA 2M4GA 2LC2A 4CCMA 2R7SA 2LBFB 4YRVA 1WJ5A 3HOTA 4XLHA 1SKYB 4XLAA 3OS2A 2BOLA 2IS1A 2Z8GA 1HA8A 3H9JA 2MABA 1UG0A 3OIPA 4FETA 4GQNA 4ZYAA 1Z21A 3PSFA 4E7IA 2F4IA 1D1AA 2W00A 4BE0A 1D0ZA 1T0FC 3SYTA 5HOOA 4TT3A 4C2LA 2VBEA 5KCMA 2X1CA 1AA7A 2W4SA 3FKSA 2XSJC 3BG6A 3OYKA 1VZ0A 4PUSA 3MKYB 1WJCA 4W8SA 3G05A 2HPMA 2FUG2 5KHDA 1X19A 4PJMA 3OW7A 5HNFA 3T51B 2XF7A 1BN8A 4E7SA 1O8GA 2CUJA 3H9GA 3OOUA 3M1CA 2VPLA 2V26A 4HIZA 4YZAA 3K4NA 3D5RC 1E3ZA 4OJ5A 5C1CA 2VQLA 3I3LA 2CW7A 1MNEA 2O0VA 3A3GA 2ZFUA 3MKWB 2CFOA 2QY1A 2PYGA 3A35A 3W2WA 1LDKB 4IQ4A 4XQFA 3TMOA 4Z03A 3S3NA 3OE7A 2CMPA 4W8QA 1MMGA 5IK2A 3B90A 2R9VA 1V5EA 1D1CA 4F3QA 2GJRA 2L9SA 1UD2A 4IQJA 1DBOA 4BUPA 4F91B 2ZZFA 4NK8A 2UWMA 1SAUA 3BCDA 1OR7C 3VWBA 2VQHA 2LBFA 3ZGKA 4KT6A 5HVQC 1FMVA 1N78A 2X8KA 1PJRA 2IGNA 4MXNA 2IS2A 2ZZEA 3HXLA 1RWRA 2Z6BD 3ZXSA 2KZVA 1MABA 4JMQA 4OJPA 2JJ2A 3QYFA 1NHCA 3EUKL 5CDFA 2L7KA 2K9LA 2LOOA 4C2UA 4XKCA 2NOJB 1OGOX 1YX5A 2V6EA 3OAAA 3QOEA 2ZZQA 4UZUA 1UD5A 3S3MA 3OYFA 2WSSA 4HWVA 4CCJA 3QYBA 4ASUA 2XZPA 4PK4A 2V1NA 4ZTFA 2CW8A 2ZTGA 1O8IA 3K10A 4Y3OA 1PYVA 2V7QA 2QKMB 4CZCA 4Z06A 2E1MC 2LY2A 2JVHA 4OZZA 3HKZA 2F5VA 4XORA 4ZDLA 2R4GA 5JHFA 4NC7A 2DXIA 3GBGA 4B43A 4BACA 3DQVC 3MKZA 4DK1A 3LSMA 2VKHA 4BS9A 4BJ5C 1S9HA 4HG2A 3BLYA 4BQOA 4CCLA 3A3BA 1IA5A 2QXZA 1EE6A 2Z1DA 4XKWA 3K4BA 2VQCA 4RM2A 2M0MA 3PNTA 3OS0A 3MD2A 1E1QA 4NQWB 4B48A 3DKXA 1VF7A 3GRHA 2KP6A 4LIVA 3DPUA 2PECA 4Y4RA 4B3GA 3OS1A 4TKOB 2I8DA 2Q1ZB 2ZSIB 4XN0A 4BXFA 2HVSA 3ZPNA 3EPZA 3OWTA 4HEA2 2UVFA 1W36C 2KQRA 1OFMA 5HNHA 2M5SA 2VKDA 3T56B 4C30A 3F9KA 1DGWY 1KTWA 2ZXIA 1ERDA 4CCKA 1W0JA 3OYAA 3PL8A 2X6WA 3PNVA 4DIQA 4E7ZA 4AVZA 4DNTB 4OJOA 3ZSCA 1WJBA 1H80A 1WJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBE A;  4XR6 A;  4YZ0 A;  2INU A;  2O17 A;  4W8S A;  4XN3 A;  1O88 A;  1O8F A;  1KCC A;  1GQ8 A;  1O8J A;  4XMY A;  2VJI A;  4URR A;  5C1E A;  1BN8 A;  2NTB A;  1O8G A;  3EQN A;  2X6X A;  4YZA A;  1QCX A;  4U4B A;  1QJV A;  4XLE A;  2VJJ A;  1PLU A;  4I84 A;  4OJ5 A;  5C1C A;  4W8R A;  2O0V A;  3VMV A;  2QY1 A;  2PYG A;  3JUR A;  3SUC A;  1CZF A;  4XQF A;  4Z03 A;  4NK6 A;  4W8Q A;  2NZM A;  3B90 A;  4OJL A;  3VSV A;  1JTA A;  1DBO A;  2NT6 A;  2UVE A;  4U49 A;  4NK8 A;  1OFL A;  1IDK A;  3T9G A;  3VST A;  3GQ8 A;  1PXZ A;  2QX3 A;  4MXN A;  2X85 A;  1WMR A;  1IDJ A;  1AIR A;  2O1D A;  1RWR A;  3ZPP A;  2PYH A;  3GQ9 A;  4YZX A;  4EW9 A;  2NTQ A;  4OJP A;  2VBM A;  3VMW A;  1NHC A;  2X6Y A;  1KCD A;  4W8T A;  3UW0 A;  1OGO X;  4MR0 A;  1RU4 A;  4XOT A;  4OZY A;  3FY3 A;  4HWV A;  1HG8 A;  2INV A;  2O0W A;  2BSP A;  1DBG A;  2O04 A;  1BHE A;  1O8I A;  1JRG A;  1X0C A;  2NST A;  1O8E A;  2NTP A;  2X3H A;  4Z06 A;  3LMW A;  4XLC A;  2ODL A;  4PMH A;  1O8D A;  1RMG A;  4XKV A;  4YZQ A;  1OGM X;  4OZZ A;  4XLF A;  4XOR A;  1OOC A;  4OJ6 A;  4YEL A;  3WWG A;  1O8M A;  3EQO A;  2NT9 A;  1K5C A;  4XL9 A;  2VBK A;  3GQA A;  4YEJ A;  3KRG A;  2NSP A;  1IA5 A;  1PE9 A;  1EE6 A;  2QXZ A;  4XKW A;  4XM3 A;  3B4N A;  1O8H A;  2IQ7 A;  3VSU A;  2EWE A;  3GRH A;  4XOP A;  2PEC A;  3GQ7 A;  4XN0 A;  1XG2 A;  5AMV A;  4XLH A;  2UVF A;  4XLA A;  1OFM A;  3B8Y A;  2Z8G A;  1KTW A;  4XON A;  1O8L A;  4XNF A;  2X6W A;  1IB4 A;  4Z05 A;  4AVZ A;  1O8K A;  4OJO A;  3ZSC A;  1VBL A;  4C2L A;  1H80 A; 
#chains in the Genus database with same CATH topology
 1I50 J;  1LUJ B;  2X1E A;  1MBF A;  2ECC A;  1WKM A;  2CQ7 A;  4X07 A;  2HZD A;  3OR2 C;  2WWY A;  3ZPL A;  3ZQ7 A;  1O8J A;  3SYJ A;  2VJI A;  1HVX A;  1PKV A;  1T5E A;  1MNM C;  3SZE A;  4IZZ A;  3EUA A;  1MMN A;  1R1T A;  3K4L A;  3S32 A;  3OZW A;  5EG0 A;  3LSI A;  3OOC A;  3LNQ A;  1FYM A;  4AVP A;  4E6K G;  4EJW A;  2KVO A;  4CYD A;  1B72 B;  2VBV A;  3B78 A;  1JTY A;  3OPO A;  1BJZ A;  3M8E A;  4E7K A;  1BM9 A;  2X6O A;  1CF7 A;  3Q0W A;  3DBL B;  5FRO A;  4EM0 B;  2O6W A;  3AAF A;  1QGZ A;  2F5F A;  3GVJ A;  3KPH A;  4AYB A;  2HOT A;  5ICE A;  3HRU A;  2CQQ A;  1QGY A;  3TED A;  2XDV A;  2KKO A;  2P4W A;  1OB0 A;  1IRX A;  4E0F A;  2M4K A;  2WJY A;  3LVB A;  3MCA A;  4DNR B;  3CPW B;  2WY7 Q;  3VNU A;  3FXL A;  3SLD A;  2Q8K A;  3W2E A;  3WQZ A;  1BI1 A;  3Q9V A;  3LSK A;  3K70 C;  4P6V F;  2E2J J;  1D8T A;  1U5T B;  5HKK A;  2KRC A;  3K6G A;  3TP3 A;  4RD1 A;  4BNC A;  4KIF A;  2EZH A;  1K8A D;  3FM3 A;  5E3L A;  3FM5 A;  1R5H A;  2VKV A;  5DS0 A;  1K4Z A;  2Q6K A;  4BEH A;  3R0J A;  3FXU A;  3WG9 A;  3M07 A;  4KA4 A;  3A8K A;  1R6R A;  3D5L A;  3HHH A;  2EIM H;  2Y30 A;  1AHD P;  4KDP A;  3E97 A;  4P6Y A;  3FY3 A;  2ELK A;  2R7O A;  4ENJ A;  2EA2 A;  1P6R A;  3CO6 C;  2V9V A;  2VBU A;  3SY2 A;  4RLF A;  3LA7 A;  2F5D A;  5HLI A;  1H88 C;  1Z77 A;  2P3M A;  1QRY A;  2DFE A;  1I5Z A;  2MGQ A;  5J4V A;  3Q6R A;  1ZTR A;  1ZG3 A;  3O8G A;  4IKF A;  2VLA A;  1E62 A;  2XHK A;  4XLC A;  3A02 A;  1REP C;  2CQX A;  3T8R A;  3OYJ A;  3CLQ A;  1O3Q A;  4IHX A;  1RMG A;  3HGY A;  3E0J B;  2XB0 X;  2RNJ A;  2PBI A;  5IY5 H;  1X2M A;  3H92 A;  4OJ6 A;  5IYC J;  5D4S A;  2L7F P;  5LBQ A;  2NT9 A;  5H20 A;  1XMX A;  1IN7 A;  3KL9 A;  3AVY A;  2YUH A;  2WB1 A;  2OCE A;  4HZF A;  2HLD A;  4B44 A;  3LST A;  1B1B A;  1L1I A;  3S2H J;  2H1K A;  1FBU A;  3VDX A;  2I10 A;  3HL2 A;  3H1C A;  4CSW A;  1JGG A;  3CCY A;  4L5E A;  1BR2 A;  5M5W J;  4MNU A;  2IQ7 A;  3VSU A;  4QPO A;  2ZXJ A;  2RAE A;  1YW8 A;  3DFG A;  1VQK I;  1OHH A;  2M5W A;  3CMM A;  4DJA A;  3IRQ A;  2E5N A;  1EF4 A;  4ZDO A;  4A3I J;  4UVC A;  2YWG A;  1D0Y A;  5CVU A;  2CRG A;  2C77 A;  3OJX A;  4RCY A;  3AKZ A;  4N0B A;  2VNJ A;  3VOE A;  3FIS A;  3PQK A;  2CG4 A;  2XRN A;  4LIT A;  1R58 A;  3KEQ A;  4BQQ A;  2XRL A;  3QAH A;  1QHG A;  4NC8 A;  3DU1 X;  1IXS B;  3PUN A;  1XMA A;  3HEF A;  1HA3 A;  2FQ3 A;  4G6D A;  1VBL A;  5F4O A;  3QQA A;  4HDU A;  4QVA A;  3DPL C;  2WC2 A;  1H8E A;  2ZFW A;  1EKE A;  1TT5 B;  3DU5 A;  4UB6 C;  2BF4 A;  2JPC A;  5FNZ A;  2MYS A;  2F3L A;  3HJE A;  3LAP A;  1DQU A;  3GTP J;  3HOW J;  3ONY A;  1ZRF A;  3VSK A;  1WRJ A;  3KP7 A;  2VBT A;  2M7B A;  3A1P A;  2K9S A;  2OK7 A;  3SJP A;  4H9G A;  3U9G A;  1B23 P;  3A1Y A;  4BJ6 C;  4LK1 F;  5EMN A;  4U9U A;  4G94 A;  3MZ8 A;  1FBQ A;  4ACB A;  1ZGA A;  2HCJ B;  4V2G A;  4H4K C;  4DQK A;  1X3W B;  1SEU A;  1SVM A;  3BY1 A;  4I99 C;  4XLE A;  2F2E A;  2DK8 A;  3ZQF A;  1OB2 A;  4KIS A;  1Q86 D;  3MAJ A;  5DM6 F;  1PLU A;  3PIO F;  4GGG A;  3F72 A;  5FGM A;  3TBI A;  4F92 B;  4W8R A;  2X4H A;  2J7K A;  3VMV A;  3I71 A;  2WAE A;  1XB4 A;  2H8R A;  4O5V A;  3PSS A;  4AIH A;  2ZXH A;  2HXI A;  2LTP A;  3W2H A;  1QZZ A;  1GUU A;  2NZM A;  3TGN A;  3OZU A;  2DMQ A;  3DEE A;  2OBT A;  4J00 A;  3F8F A;  2MC4 A;  4HF0 A;  1S5L C;  3C2B A;  2W7N A;  4BPR A;  2QZA A;  4PC2 A;  3WGI A;  2RC5 A;  2Y0S A;  4Z6Y A;  4ENM A;  2M2E A;  4HDV A;  2LDU A;  1YIJ I;  2MA3 A;  3L1P A;  2HOS A;  5FKO A;  5IOZ A;  2FML A;  5FB2 A;  4Y9U A;  3CCJ B;  4CGZ A;  1IAW A;  1SFK A;  4R79 A;  4NDL A;  3FMR A;  4FAS D;  4Q4Z F;  4BE1 A;  4KMF A;  3OL3 A;  2A61 A;  1G6N A;  3BR5 A;  3RKX A;  2V4J C;  2QTL A;  2XT2 A;  2MLG A;  1VQP B;  1GHC A;  1F20 A;  2QBY B;  1XN7 A;  2M8G X;  5FLX K;  1AMO A;  2CWE A;  2KFD A;  4G1B A;  2VT2 A;  3CMY A;  4OAZ A;  3RKY A;  3CME I;  1VQ7 B;  1U9O A;  3BZK A;  3OYB A;  2AQF A;  2FA5 A;  4RA2 A;  1KRH A;  1VF9 A;  1LE8 A;  2OUM A;  2EZL A;  4HST A;  3B8H A;  4UAJ A;  3S93 A;  2R7T A;  1YIT I;  1GVJ A;  4M3E A;  1BHE A;  1XQB A;  1ZAO A;  2NST A;  1B8I A;  1D0X A;  1M1E B;  2R7Q A;  2DOD A;  6PAX A;  1FX0 A;  4RLQ A;  3KYL A;  3WXM A;  4G7W A;  4A69 C;  2CUZ A;  3T8T A;  4XKV A;  4DBQ A;  3E5X A;  1U2W A;  2XGX A;  4ZGQ B;  3HB9 A;  1OOC A;  2J8I A;  1BJA A;  1R23 A;  5FRM A;  4XL9 A;  4LB6 B;  2PJR A;  1FOX A;  3SZT A;  1GDT A;  3I1F A;  2XB5 A;  3MEX A;  1I1S A;  1G3Y A;  4M3F A;  4KN4 X;  4MIM A;  1HSJ A;  2M3A A;  2D5V A;  1E43 A;  3Q38 A;  2DET A;  1X3U A;  1MJ9 A;  5DS9 A;  4PC7 A;  4PJL A;  2GOM A;  2L4M A;  2DJN A;  4ZZD A;  4MYU A;  5D8L B;  3QPT A;  4Y7N J;  1VQM I;  2R5Z B;  2V7U A;  3PIP F;  4YFK F;  1AOY A;  2BM4 A;  1W36 D;  3TO9 A;  4PC3 A;  2E7X A;  2X48 A;  1W5T A;  5EDN A;  1HZE A;  2CS3 A;  5J3L A;  5DD4 A;  3G71 I;  5JMC B;  2QF7 A;  1A31 A;  1HKS A;  3DPT A;  3L2U A;  3CC7 I;  5H5J A;  4DYQ A;  1K28 D;  1U6G A;  3FBN B;  1VFC A;  1FMW A;  1H8A C;  1D8J A;  3KP5 A;  4KJZ A;  4KH3 A;  3OYH A;  4YXW A;  1SVO A;  2PMZ A;  1O8K A;  3IRR A;  3JQR A;  3CCU B;  4YZ0 A;  1G3W A;  1EFR A;  3LWF A;  3OFN A;  1WZ2 A;  3HPG A;  2WJV A;  1LVK A;  4BBR J;  4TSF A;  3I55 B;  3B73 A;  2L9V A;  2Y48 A;  2UXN A;  5HDG A;  4H0E A;  1X1D A;  3ECH A;  4KKS A;  4LOC A;  4AU7 A;  2OBS A;  4FIS A;  3EUH A;  2XC7 A;  4A3C J;  2YX4 A;  3BR1 A;  4A3L J;  2X51 A;  3BCB A;  4UB8 C;  2OV7 A;  2IS6 A;  1QA1 A;  1Y1W J;  3J7A Y;  3TO6 A;  2ZXW H;  2DMN A;  4W97 A;  1RI7 A;  2P6T A;  3AVW A;  2BM0 A;  4KN7 X;  3A2K A;  4QPQ A;  3HKZ N;  3CCE I;  3ROU A;  2DT5 A;  4BY7 J;  4XD7 A;  2V7F A;  2FJ1 A;  3HG9 A;  2VBZ A;  1GVD A;  2Z9O A;  1VQK B;  5KVR A;  3I59 A;  3JRG A;  2XGE A;  4MYT A;  3BTJ A;  2BGC A;  3WHC A;  2ZBU A;  1FOY A;  2Y9Z A;  2E19 A;  2QMU A;  1YE9 A;  1EA3 A;  2P8T A;  1S7A A;  3AVX A;  1WMR A;  2GBY A;  3GX4 X;  3D5S C;  1Q7Y D;  3BH6 B;  1EH7 A;  2W6I A;  3CJR B;  5EG0 B;  3J81 k;  1NJI D;  2LRD A;  2QSF X;  1SAN A;  2JQ7 A;  2R93 J;  4X6A J;  3DDY A;  2WAQ A;  1TQP A;  3PUB A;  2L01 A;  1CF7 B;  3UW0 A;  1MH4 A;  1B59 A;  3CCV I;  1Z9C A;  1X4O A;  2B5O A;  3ZUG A;  2LY1 A;  1ZRC A;  3N05 A;  1JJ2 B;  4ZTJ A;  1HG8 A;  4RAZ A;  3I4N J;  5IYW A;  3S3O A;  3V42 A;  1VQ8 I;  1SFE A;  4YII A;  4CCN A;  4IHV A;  4IEJ A;  4CH7 A;  4G7X A;  1V4R A;  4J0Q A;  2DDA A;  3OYI A;  1G7C A;  3OEH A;  4U0V A;  2DDB A;  1Z3Y A;  2DMU A;  2P0W A;  4GYG A;  3CCQ B;  2V4D A;  4S0H B;  4AIJ A;  3M4O J;  1H0M A;  5IYD J;  1O8D A;  4LG0 A;  1ORK A;  1SVL A;  4Y15 A;  4MEX F;  2WV1 A;  2KZG A;  5L3C A;  1XG1 A;  1HKQ A;  3OMY A;  3KP6 A;  4BEH B;  5TJJ A;  4E7J A;  2ID3 A;  2HWV A;  1O8M A;  4M6V A;  3WU1 B;  2XF6 A;  3ZQC A;  1GLN A;  1COW A;  2Y31 A;  4NNJ A;  3VR6 A;  1YIJ B;  2LYC A;  4RS8 A;  2HPI A;  2RC4 A;  3ZZT A;  3AG2 H;  3L2V A;  3A03 A;  1YS6 A;  4CXF A;  2NVY J;  1B9M A;  3BDD A;  4AYB N;  3DTE A;  2QSH X;  2Q6L A;  1R49 A;  4E70 A;  5J6X A;  5BSX A;  2LD5 A;  2HGC A;  2WY8 Q;  3BY2 A;  2BM5 A;  2Z33 A;  3ABM H;  5J3O A;  2DFI A;  2LC2 A;  2R7S A;  5IYP A;  2WYR A;  1ZN2 A;  3DP7 A;  2F1L A;  2DA1 A;  4BHC A;  1X1P A;  2BOL A;  5ILS A;  1IXR C;  2IS1 A;  3CME B;  3BP8 A;  1FOK A;  3RIQ A;  4G12 A;  1PJ7 A;  1UG0 A;  2O8K A;  3HDD A;  3OIP A;  3LA2 A;  4GQN A;  1P4X A;  4ZYA A;  3CCS B;  3PSF A;  3S2W A;  1U78 A;  4OOX A;  5J35 A;  4BE0 A;  1T0F C;  4A3E J;  4TT3 A;  3V8J A;  5KCM A;  1O4X A;  4HW0 A;  3HOX J;  3I5U A;  1AA7 A;  1BI2 A;  3U1D A;  4EVI A;  1OKR A;  2VBS A;  3FKS A;  1RR8 C;  3BG6 A;  1IN4 A;  2DY1 A;  1VZ0 A;  2M87 A;  3QE2 A;  1IN8 A;  1TBX A;  1TP4 A;  3AG1 H;  2ECB A;  2M45 A;  2ZB9 A;  2EV0 A;  3I58 A;  3OV8 A;  1X19 A;  1UHM A;  4PJM A;  5HNF A;  2OTL I;  3ASR A;  1WU8 A;  4QLC U;  3T51 B;  2DI3 A;  2DLL A;  1PUF A;  2CUJ A;  3BY6 A;  2VPL A;  2PIA A;  2V26 A;  4IRI A;  2BMW A;  4I98 B;  5F6F A;  2M30 A;  4OJ5 A;  1S6L A;  1Y0N A;  5ED4 A;  3I3L A;  4XRM A;  4FE4 A;  4I2O A;  2ZFU A;  2RGV A;  4G6Q A;  3MKW B;  4RD3 A;  1IC8 A;  3A35 A;  2PYG A;  1JNY A;  3U2Q A;  1DDG A;  1VQO I;  3FK7 A;  1K7A A;  2P7V B;  2J8K A;  3LO8 A;  9ANT A;  3EDP A;  2WB1 N;  4MO7 A;  1V5E A;  2MBF A;  3QPL A;  3SXY A;  4CYC A;  1G3T A;  4IO9 F;  1GO2 A;  3G71 B;  1DBO A;  4NK8 A;  2ZZF A;  2EH3 A;  1QQ1 A;  1BJK A;  1J5Y A;  3BQZ A;  1GV5 A;  4M9Z A;  3VWB A;  2VQH A;  4UV9 A;  2LBF A;  5HVQ C;  1R5O A;  1FMV A;  2XSD C;  1UJ8 A;  2IGN A;  1VHO A;  4PC6 A;  5EYR A;  3ZXS A;  1G7S A;  4Z4Y A;  1H85 A;  4PGH A;  3S14 J;  1FIP A;  1ZLJ A;  2C6Y A;  1OCC H;  2JMW A;  1XSD A;  3A8J A;  1W0U A;  1LPQ A;  3IHU A;  3FXO A;  5A2Q K;  2LOO A;  2FNA A;  2NOJ B;  2ETH A;  1YX5 A;  4X1E A;  2V6E A;  1OGJ A;  5HS8 A;  4DNC A;  2FQ4 A;  3J81 Z;  1TW2 A;  1Y0Y A;  3G6E B;  5D4R A;  1LEB A;  2PLF A;  3V7A A;  4HWV A;  1ETW A;  3VPR A;  3QYB A;  4RGU A;  1LVA A;  3O8H A;  3IL2 A;  4ZTF A;  1WH7 A;  3GO5 A;  1JKP C;  2CW8 A;  3WTS C;  2XV4 S;  2ZTG A;  3K10 A;  2JWT A;  3BRO A;  3P7N A;  4QTR A;  3LQE A;  1TQI A;  2XAS A;  5AIQ A;  2E1M C;  2LY2 A;  2VFP A;  3JTG A;  4X7D A;  2JVH A;  4P1V A;  4OZZ A;  1QX4 A;  4LGW A;  1BI3 A;  5JHF A;  3WE2 A;  4B43 A;  2MD5 A;  5KAI C;  4ZV4 A;  2ELH A;  2VKH A;  3QWL A;  4BJ5 C;  1S9H A;  3BLY A;  2NVU B;  2XAH A;  2D2W A;  4YFN F;  4XKW A;  3K4B A;  4D5F A;  3GUD A;  3V7S A;  2DEU A;  1WXR A;  5EGO A;  3OS0 A;  2V1U A;  5ICF A;  1W35 A;  2K85 A;  3BPX A;  4LIV A;  3IKT A;  4Y4R A;  1BIB A;  2FXA A;  2KIM A;  3MKL A;  3OS1 A;  1RUO A;  2ZSI B;  4XN0 A;  1B8I B;  4B3G A;  2Y0S N;  2XKO A;  2Q2E A;  1KQS B;  3EPZ A;  1LEA A;  4HEA 2;  4CHU A;  2K7L A;  1W36 C;  3BQJ A;  1XX5 A;  1MDM A;  2M5S A;  3P9K A;  2XPU A;  2LR8 A;  1QBJ A;  3FMS A;  2DCU A;  1NHA A;  1ERD A;  1T56 A;  4WXD A;  1W0J A;  4Y52 J;  3OYA A;  4XLP F;  3GW2 A;  1M1K D;  1ZK8 A;  2DYR H;  4DIQ A;  4AVZ A;  5LEJ A;  1CLW A;  5TIS C;  3ML6 A;  1WJF A;  4K2E A;  4IX7 A;  5L3G A;  1Y0U A;  5F1R A;  2BGJ A;  2M8E A;  2F5E A;  1YS7 A;  1N8R D;  4ZCL A;  3O6B B;  3F6O A;  2EFO A;  3LSJ A;  3GFJ A;  3SDB A;  4JRA C;  4OIN F;  2HKO A;  5A89 A;  4MFE A;  1E2X A;  3H36 A;  3QPS A;  5CPR B;  4CCO A;  1F5T A;  1FIA A;  5M5Y J;  1YQA A;  4ZGN B;  3JAM K;  4U0W A;  2F43 A;  3ZQL A;  5BPI A;  1WCM J;  5IP7 J;  2QEX B;  4M73 A;  4A5N A;  2OBP A;  2KRF A;  3F21 A;  2HQA A;  1FOW A;  3RQ4 A;  5K5R A;  5ILV A;  1GV2 A;  2GA1 A;  1TW3 A;  3SEQ A;  5FLV A;  2EZK A;  4Z4T A;  1EFT A;  3BG9 A;  3T9G A;  4PZJ A;  2VXD A;  3G2B A;  2OU2 A;  5TGT A;  1QFY A;  5AIP A;  5C1E A;  2ZME A;  3ZCO A;  3QU3 A;  3N97 A;  2DO7 A;  1JJ6 C;  2IT0 A;  5LGU A;  2L3D A;  3K4C A;  5HLG A;  2P7C B;  2HVQ A;  2EFQ A;  4II3 A;  5EEH A;  3JRB A;  2OPT A;  3K4J A;  1D2E A;  1B6A A;  1O3S A;  4MGR A;  1SKQ A;  2GOX B;  5H59 A;  4BHB A;  1YIO A;  2GPJ A;  1HF0 A;  4YFX F;  2R7V A;  1X58 A;  1F9N A;  4M3G A;  3V7C A;  1KK0 A;  1XDS A;  1JTX A;  3DBR B;  5CVJ A;  4IHY A;  1QU3 A;  1TUI A;  4XOT A;  1VLY A;  1ZM9 A;  3W5U A;  2OBR A;  1TLH B;  2PMZ N;  3H9Q A;  3I59 B;  2A5W A;  4LJZ F;  4UUT A;  1YHQ B;  3BR6 A;  2YU9 J;  2BXZ A;  4YHB A;  5LHI A;  2R7R A;  4PJN A;  5JHU A;  1WPC A;  1OIS A;  4WZT A;  3K2A A;  2PX9 A;  1O8E A;  1OMI A;  4B09 A;  3FJO A;  3BR3 A;  5TV2 A;  1KK2 A;  1H9T A;  4L0Z B;  3ZMD A;  2XVC A;  3ZN1 A;  4HNU A;  5DUK A;  3GTL J;  1YYV A;  3S1N J;  3LMM A;  2E1N A;  1UMK A;  3CCL B;  2EK5 A;  4BU2 A;  3OYL A;  2VI6 A;  1UMQ A;  1FND A;  1ZAR A;  2LFB A;  2ME6 A;  4LBW A;  1DDI A;  2ICW G;  4RD6 A;  1PE9 A;  5IYB J;  4NUB A;  5B66 C;  3KX2 A;  2FMY A;  3U1K A;  1I18 A;  1QPM A;  3F8C A;  2GIZ A;  5CLS A;  1Z6R A;  1VQN I;  3C7J A;  5CQG A;  1Y39 A;  1V5F A;  2CO5 A;  3ZR8 X;  4A12 A;  1SAX A;  1JUP A;  1XG2 A;  2LMD A;  2X9D A;  1ENH A;  2K4B A;  3F8M A;  3VOD A;  3OY9 A;  4E7H A;  4LG0 B;  5FO0 A;  1T6S A;  1JJ8 C;  4I02 A;  3HRT A;  4HPQ A;  1Q1H A;  3ISP A;  3M8J A;  1I1G A;  3JRA A;  1R71 A;  4YCQ A;  1LFB A;  2BE5 F;  1IRF A;  2WAQ N;  1L3L A;  1V54 H;  2YU3 A;  2UUZ A;  2D45 A;  4YAO A;  3CCM I;  4LK0 F;  5J1U A;  4I01 A;  1FZP B;  1YI2 B;  3T53 B;  3SZG A;  1N0V C;  2VOO A;  3RDI A;  2KLO A;  4A3M J;  3TH0 A;  1XMK A;  1Z1D A;  1HW2 A;  1JGS A;  1BC8 C;  2ZKZ A;  4ZYG A;  3PFI A;  2A68 F;  2F5C A;  4WZE A;  2WA0 A;  2PMH A;  1JT0 A;  2LF7 A;  3BZ6 A;  3VYT B;  2XAG A;  2V6C A;  3OIQ A;  4RPB A;  2W24 A;  4X7F A;  1FPQ A;  5B6I A;  2EV5 A;  4HX8 A;  1ZLK A;  2IS4 A;  1NK2 P;  2EIX A;  3ZIA A;  1WOS A;  3R61 A;  2EQR A;  1W9X A;  4OIQ F;  3R6S A;  2XND A;  3CCJ I;  2M7A A;  1E63 A;  2WZP P;  5B1B H;  4CUG A;  3GTM J;  3S17 J;  1XFO A;  3OYD A;  2KIS A;  2L0K A;  5LMZ A;  2BHY A;  1QG0 A;  2EJR A;  4ETS A;  1VQP I;  3Q0U A;  2DMP A;  3MWM A;  5FKL A;  3O2P E;  4I6Z A;  4B3F X;  2ESH A;  3WG7 H;  4A3B J;  3HYI A;  1VJS A;  2RDP A;  2TDX A;  2XKP A;  2VFO A;  4RB3 C;  3CUO A;  1RES A;  3VYR B;  3B02 A;  1VQ7 I;  2XEX A;  3BNW A;  5IP9 J;  1BR1 A;  1PUF B;  4WWC A;  3IH2 A;  5AN9 A;  4BGD A;  4M9X A;  1K61 A;  4A93 J;  4OOS A;  2NTQ A;  1Z3X A;  2VBM A;  1XB2 A;  2FD5 A;  2W82 A;  1LFP A;  3BG7 A;  4A3F J;  3BZC A;  1RUN A;  1I39 A;  1PVE A;  2W6J A;  3WBK A;  2ELJ A;  2AQE A;  4QHY A;  1I8D A;  1R1U A;  3QOP A;  4EJU A;  1APL C;  5BS6 A;  4Y17 A;  1E64 A;  3LSR A;  4CYC B;  2DA3 A;  1G8X A;  4NQW A;  3CUQ C;  3CPX A;  2O04 A;  2ZZG A;  3EYY A;  4HQM A;  2NV4 A;  4M74 A;  1N77 A;  2E35 A;  4HE6 A;  4L8J A;  4X0G A;  1VI0 A;  1MBG A;  1RR7 A;  1WJE A;  1HLV A;  2OYN A;  2IVM A;  1WI3 A;  3SKB A;  2H09 A;  3FBI B;  3WTZ A;  4DZJ A;  3L2C A;  2R7X A;  4AF6 A;  3SEZ A;  2BEO A;  2BBY A;  2UV1 A;  2V31 A;  5ICG A;  1DDN A;  4JOM A;  2GIV A;  1KU9 A;  3FXJ A;  2XAU A;  4JBA A;  4YEJ A;  4BDZ A;  5GV8 A;  5L3F A;  2NSP A;  2XNJ A;  4QSH A;  2CU7 A;  3JRH A;  2TCT A;  4NCN A;  3NAW A;  2FX0 A;  3G4S I;  4EAT A;  4LB5 A;  4IJA A;  3RIR A;  4OIP F;  4OMZ A;  3FXK A;  3NWS A;  3IWF A;  4P22 A;  1R4N B;  2Y2Z A;  3OOP A;  1JI8 A;  3WBJ A;  2YWF A;  1GR1 A;  3CCU I;  2NOG A;  2NPF A;  1R4M B;  2LP0 A;  2VJ4 A;  2JA7 J;  3OL4 A;  5J40 A;  3WY9 A;  2JPB A;  1BMF A;  4GO1 A;  3OYM A;  3I55 I;  3LSG A;  3Q9S A;  3MMP A;  4G6I A;  2XF5 A;  5D6E A;  4OOI A;  3CRZ A;  2DQR A;  3I9V 2;  3V8K A;  1QH0 A;  1IB4 A;  4EJV A;  3W6V A;  4F52 A;  4RDU A;  3I4M J;  3BR0 A;  4Z05 A;  1WOP A;  5FLM J;  1VND A;  3VFZ A;  3WTX C;  2CK3 A;  1DP3 A;  4P26 A;  4XR6 A;  2E71 A;  2EFN A;  2H8W A;  3BJO A;  2E1C A;  1OQY A;  1VQ9 B;  1QVT A;  2EIJ H;  1YX3 A;  1IZ1 A;  4DZP A;  4IL6 C;  2MFZ A;  2ZL5 A;  5EGO B;  1O8F A;  4WWV A;  3KLO A;  2HVR A;  3GLX A;  4UXN A;  5E1Z B;  5B1A H;  4U0Y A;  3J80 K;  2GZW A;  3K4K A;  3K1N A;  1W4M A;  2Q2E B;  1D3Y A;  1WHU A;  5GTH C;  1ODD A;  4D5C A;  1W0T A;  2IRF G;  1ON2 A;  2DT7 B;  3LSH A;  1V0E A;  1U0J A;  4JP0 A;  1JT6 A;  1T33 A;  3AFH A;  3RPU A;  2K3F A;  3LQR A;  1TZL A;  1ZUN B;  4NK6 A;  1KGS A;  3FPP A;  4N3N A;  4OPV A;  5GPA A;  5JLV C;  3PVD A;  1VQN B;  3UKG A;  1W7P A;  1EZG A;  2H1L A;  3K4M A;  3GYH X;  4BL0 B;  4EEF G;  4OAY A;  3VYU B;  1NH3 A;  4NHJ A;  1N05 A;  2JIZ A;  1JTA A;  1YW9 A;  4ACA A;  4I76 A;  2Z5U A;  1MZB A;  2VE8 A;  5EEG A;  4RM3 A;  3W5V A;  2XGC A;  1PXZ A;  3ZQQ A;  2X85 A;  4ITV A;  1D1N A;  2EWN A;  4MEY F;  1U5T C;  3H3Z A;  2HOE A;  5E8G A;  5HDN A;  2R0Q C;  1AIR A;  2H6C A;  2E1O A;  3W5H A;  4M71 A;  2PYH A;  3C18 A;  4OMY A;  3CLO A;  1FRN A;  3CCM B;  2STW A;  1LDJ A;  1OCO H;  2FBI A;  2QTZ A;  3H5N A;  2NNN A;  1BLI A;  2X6Y A;  1LFU P;  4W8T A;  3V8L A;  4XIC A;  4E4H A;  2C4U A;  3CCQ I;  4X8I A;  3HSF A;  2ZSH B;  1VQ5 I;  2IW5 A;  3FHN A;  4FXU A;  2DQL A;  4ZYD A;  2O6G E;  2HKX A;  2M1B A;  2VFQ A;  5E8I A;  1WWX A;  2D3N A;  4NC6 A;  1FNC A;  3HSE A;  2ZME B;  4E7L A;  2CH0 A;  2IJL A;  1D8K A;  2ZL6 A;  4PCQ A;  2IP2 A;  4A6E A;  1MJB A;  4I0A A;  3CD6 B;  2XAF A;  4KFC A;  5CVR A;  5K5Q A;  4LLL A;  2DTR A;  4DGW B;  3WTU C;  2IA0 A;  2G7U A;  5FLX Z;  3S8P A;  1TC3 C;  2YPR A;  5L3B A;  1HW1 A;  2BY2 A;  4TV7 A;  1NTC A;  4IPA A;  4HLY A;  4ANJ A;  3L2W A;  2LG4 A;  3CCS I;  1QQI A;  3OYG A;  1FNB A;  2HFH A;  2BYV E;  1LNW A;  3EQL F;  3M1E A;  2OC6 A;  2A6E F;  2UZK A;  2FF4 A;  1FEX A;  3DLL F;  1G2H A;  2I1L A;  4AC9 A;  2AHO A;  2PMU A;  1ZM3 A;  1E0E A;  4CCM A;  4YIF A;  3COA C;  1S72 I;  3OSF A;  2BZT A;  1YLF A;  1T6X A;  3RPQ A;  1KYW A;  2Z8G A;  3WTV C;  2K9N A;  5E1X A;  1FSE A;  1QVU A;  1Z21 A;  4I09 A;  4RAF A;  3VO2 A;  3GTK J;  1D1A A;  4QV2 A;  2W00 A;  1LQ1 A;  3M8F A;  2P5V A;  3ECO A;  3SYT A;  4C2L A;  5AON A;  1XD7 A;  1KK3 A;  2X1C A;  3Q39 A;  3DCF A;  2LNB A;  4BBS J;  1FP2 A;  2XSJ C;  3OYK A;  2DW4 A;  3QFC A;  2VBX A;  3MKY B;  1WJC A;  1I3Q J;  2JT1 A;  2OZU A;  1AWC A;  1DU0 A;  2OZ6 A;  1UFM A;  1WSV A;  2FOK A;  2YX7 A;  2HPM A;  2FUG 2;  5DCF A;  4OP7 A;  3P9I A;  1BN8 A;  1TWC J;  3HSR A;  1A8P A;  1O8G A;  3OOU A;  3AK5 A;  4Y9R A;  1R5I D;  4YZA A;  1KTV A;  1RIO H;  2D74 A;  1ZQ3 P;  1EXM A;  1GXQ A;  4ZYE A;  1LLZ A;  1SMT A;  3G4S B;  2R92 J;  4P25 A;  3A0H C;  2CFO A;  2QY1 A;  1T6Z A;  3A8I A;  2PE3 A;  4Z03 A;  4NB5 A;  3OE7 A;  3WNC A;  4YAW A;  1D5Y A;  5IK2 A;  2EIN H;  4RGS A;  2CJJ A;  2R9V A;  5HZB A;  1UD2 A;  4A0X A;  3GLL A;  1IN5 A;  4F91 B;  1QVF B;  2EPF A;  3G3Z A;  1POG A;  2V7T A;  3BCD A;  2O8X A;  1ONV A;  1OR7 C;  4JX6 A;  2W57 A;  3BPV A;  3G6E I;  1OYI A;  4Z4V A;  4DQL A;  1RWR A;  3CMA B;  2K40 A;  3S15 J;  2R5Y B;  4JMQ A;  3AVT A;  2ZO4 A;  4OJP A;  3HZJ A;  3PM1 A;  1NHC A;  3EUK L;  3PO2 J;  2K9L A;  2HXO A;  3ES9 A;  3H3V K;  4M0L A;  2BSA A;  3OAA A;  4UZU A;  3BH7 B;  5LLQ A;  3OYF A;  2DFF A;  2WSS A;  4L5J A;  5BMZ A;  2EV6 A;  3W2F A;  3C1D A;  2NS8 A;  4X7C A;  3ISX A;  4IHW A;  1UHW A;  5KW9 A;  3HOU J;  3ASS A;  2VNH A;  5JBQ A;  1MBK A;  3JQQ A;  4L9V A;  2V7Q A;  5EJC A;  2EIL H;  4CZC A;  2PLY A;  5FKN A;  2I5U A;  2DA2 A;  2JK3 A;  1MSF C;  2PJP A;  1GVH A;  3ZMS A;  4TMW A;  2L7Z A;  4BYY A;  1FWZ A;  3A0B C;  2N8G A;  5IP6 A;  1IXC A;  3DQV C;  1PJ6 A;  3HTU A;  4HF1 A;  5EZG A;  2HS5 A;  4RDJ A;  4HG2 A;  4BQO A;  5TRD A;  2GWR A;  1ELO A;  4EQQ A;  2Z1D A;  2MW8 A;  2QSG X;  3BOQ A;  1E3H A;  2FX3 A;  5F1J A;  3GXO A;  4S04 A;  3TDZ C;  1O7L A;  2FOW A;  1EP2 B;  5IYQ A;  5F4J A;  4NQW B;  3GWZ A;  5DSZ A;  4BH9 A;  4NBQ A;  3DPU A;  5D5X B;  2PEC A;  2AXL A;  1HST A;  1K83 J;  3MZY A;  4HQE A;  3ZPN A;  4MQ9 F;  3N4M A;  5IT3 A;  3OWT A;  1YO5 C;  1RZ4 A;  1UCR A;  1OFM A;  3P27 A;  1VQ5 B;  1DU6 A;  1FNN A;  3FZV A;  1DGW Y;  1KTW A;  3GFI A;  3HOZ J;  4IF4 A;  4AM3 A;  3PL8 A;  4LMY A;  1N0U A;  1N25 A;  4E7Z A;  2DOE A;  1GJR A;  3ZSC A;  2X3U A;  1WJB A;  3KP2 A;  3UNG C;  2HMA A;  2HDW A;  2VC1 A;  3ZP5 A;  3PEN A;  3D1N I;  4AD9 A;  2K5C A;  1FRQ A;  1SM4 A;  4Z4S A;  3CCR B;  2L02 A;  2LKP A;  2VL8 A;  4ESB A;  5JR3 A;  1EWY A;  3JRD A;  2QEX I;  1MGT A;  4RDK A;  2BW3 A;  3F3X A;  1LJ9 A;  1ZRD A;  4LLG F;  5B5E C;  3FHZ A;  3RZD J;  2X0K A;  3CF5 F;  3EQN A;  3PUF A;  2O03 A;  2WZN A;  2X0L A;  5C4X J;  4JYK A;  1NG7 A;  5E1W A;  3H5R A;  2RC6 A;  1S7O A;  1QCX A;  3AL0 B;  3GF2 A;  4RM0 A;  1QJV A;  3ASQ A;  2L4A A;  3HGG A;  5HLT A;  4ENK A;  1JUS A;  1DG1 G;  3RYR A;  4QFM A;  2WTE A;  1WOO A;  4RDL A;  4R8H A;  2GXB A;  4YAL A;  4LLN A;  5CQE A;  2FEZ A;  4C2T A;  1M90 D;  2DAO A;  1O7F A;  4M72 A;  1CGP A;  1OCZ H;  3BC8 A;  1G59 A;  5GPC A;  5LEK A;  1S72 B;  2P81 A;  1BPL A;  1I7P A;  1IDK A;  1OFL A;  3Q3S A;  2HOA A;  2QQB A;  2K02 A;  3ZQI A;  3BTC A;  3MQ0 A;  3BC9 A;  1YRN A;  2UXX A;  1YHQ I;  1K6O A;  1ZH5 A;  3ML3 A;  3ZPP A;  1QHH D;  1RQP A;  2OQR A;  3KIO A;  2V5I A;  4YZX A;  2BY0 A;  1OCP A;  3VMW A;  1F1Z A;  1WQ2 A;  1MKM A;  2ZCW A;  3BTL A;  4U87 A;  5DUI A;  2XGJ A;  4B3X A;  2VXZ A;  3B6A A;  3ZN0 A;  4MTD A;  1RRJ A;  1K79 A;  4UY8 I;  2CRV A;  1KCD A;  4BHP A;  3WTW C;  3SZP A;  2ZNY A;  2OQG A;  5LRR A;  3W2A A;  5TR9 A;  1W5S A;  1W7P B;  3CCL I;  4F55 A;  1VQL B;  3JU4 A;  2STT A;  2BSP A;  2JN9 A;  3OYC A;  2D1H A;  2KRH A;  4PAA A;  2PEX A;  3H9N A;  2QUF A;  3JX8 A;  1R5B A;  2XC1 A;  3HOS A;  3L09 A;  2R7Z J;  3LMW A;  4C3H J;  2WAD A;  1V55 H;  4V19 K;  4X0C A;  4KKU A;  3OYN A;  3P26 A;  1X1A A;  2A6T A;  2MG4 A;  1QA3 A;  1KQ9 A;  2KPM A;  2XGD A;  4L9J A;  4A3D J;  2IA1 A;  5A2Q Z;  4JQF A;  4ON0 A;  1IJF A;  5K7H A;  1AKH A;  5IPA A;  4BDY A;  3W3C A;  1YJ9 B;  1X1B A;  3KE2 A;  3GVA A;  5A8A A;  2E1R A;  4FN5 A;  3RI4 A;  5FO1 A;  5KNL A;  1WI9 A;  2KDO A;  4D7N A;  2JJ7 A;  3V7R A;  1YFH A;  2NVX J;  5FKK A;  2VUM J;  2EZI A;  5E17 F;  1IB0 A;  2J5O A;  3GCM A;  2C5B A;  2XZO A;  4OIO F;  2XTW A;  1TNT A;  2BXY A;  2JSP A;  5ILU A;  4HNT A;  1YLO A;  4M2L A;  1O8H A;  2KJC A;  3E6B A;  1E79 A;  4G8X A;  4Y33 A;  3KZZ A;  2JZY A;  1P4M A;  1U5T A;  3U6B A;  1BOA A;  1PP8 F;  1GXP A;  1T08 B;  4D9J A;  2C78 A;  4M4S A;  3AGQ A;  3OSG A;  2ESN A;  5FIU A;  1YI2 I;  5LRS A;  1FDR A;  1KC8 D;  2PQ8 A;  3SFI A;  4FK8 A;  5GTI C;  4Z4W A;  4MHG A;  2QM3 A;  5LFA A;  3S1M J;  4G6T B;  2CV1 A;  1O8L A;  4XNF A;  1RPW A;  1OPC A;  3KP4 A;  4RMN A;  5LGN A;  4RB2 C;  4AIK A;  1O3R A;  3VMF A;  4ZCI A;  4WZL A;  4IHS A;  2VIX A;  4WXH A;  1AIP A;  3CF2 A;  2MC3 A;  1H42 A;  1XGN A;  4RGR A;  3K70 D;  3QOD A;  2F48 A;  4I0B A;  4M53 A;  2IPQ X;  4X06 A;  1LE8 B;  4X05 A;  1KCC A;  1NRK A;  1GQ8 A;  2KT0 A;  3HBL A;  3DEW A;  2QCO A;  2CUF A;  2VNI A;  3TL4 X;  3PJR A;  3BG3 A;  4J19 A;  1B2R A;  1FTZ A;  2DT6 A;  4UV8 A;  3F22 A;  3HAG A;  4AWX B;  5D5W B;  4U4B A;  2VYQ A;  4I84 A;  5CVI A;  1ZYR F;  2LK2 A;  3RJP A;  4BE2 A;  1KJZ A;  4TMX A;  1TTY A;  2C4T A;  5FJ8 J;  2V79 A;  3FXQ A;  3E6M A;  4FX4 A;  2COB A;  4A0Y A;  5M5X J;  2VT3 A;  4RJL A;  4HBL A;  1R36 A;  2PJR B;  2CND A;  4IRG A;  2F4M B;  5HOD A;  2QWW A;  4UZF A;  2JTV A;  1ITY A;  2BM6 A;  4R1H A;  2NT6 A;  4U49 A;  1MIJ A;  1YJN I;  3Q0V A;  2XTY A;  2YS9 A;  5TY0 A;  1IW7 F;  3QYE A;  1VHE A;  5GAH J;  1T6Y A;  4UVB A;  3OEE A;  1MRZ A;  4HA8 A;  1XE1 A;  3CJN A;  1J59 A;  4ZDP A;  2XRO A;  5FL7 A;  4KT5 C;  3K0L A;  3V4G A;  3REO A;  2RNG A;  5E3O A;  2BM1 A;  2L2O A;  2P6S A;  3RKW A;  4AF7 A;  3ZQG A;  4L9N A;  2MH2 A;  2IXS A;  1JKR C;  3CC2 B;  1N07 A;  2X1D A;  2OAZ A;  1HF2 A;  1OFC X;  1ZR2 A;  2EB7 A;  3NEU A;  4RAG A;  4L18 B;  2V7W A;  4EM1 A;  3LAJ A;  4B47 A;  3PA1 A;  2C2W A;  4C3I J;  2CC2 A;  1VTN C;  1H8H A;  3CO7 C;  1HDP A;  1O57 A;  3IP4 B;  2V7V A;  4WZK A;  3BR2 A;  4PFP A;  5D8K B;  3WND A;  1S3J A;  2DU9 A;  2D3L A;  1RKW A;  1K4T A;  1BX0 A;  2K3P A;  2E2I J;  1R5N A;  2ODL A;  2CUE A;  4DYR A;  5IYN A;  3I56 B;  4YDT A;  3A4C A;  2XAQ A;  4RBO A;  1MND A;  4DYC A;  4XKB A;  4XRS G;  3V76 A;  3ASN H;  2A5Y B;  2O61 A;  2GJK A;  3S16 J;  3HC7 A;  5JVT A;  4OOV A;  1ETX A;  4CA0 A;  4DBR A;  1UD3 A;  5IT9 K;  1JA0 A;  3SLN A;  3KEO A;  2QYO A;  2CV0 A;  5GP9 A;  1Q1V A;  1Y6I A;  3KYD B;  3NQO A;  2A05 A;  3WGH A;  4IVN A;  2F4O B;  4HX4 A;  4N4N B;  2BVL A;  5J1R A;  1FNM A;  4XOP A;  3LQQ A;  3ASO H;  2Y69 H;  2EIK H;  1VQ9 I;  2IGO A;  1MSE C;  1HW5 A;  2VBY A;  4F7D A;  5KK1 A;  2F4N A;  3OZV A;  3B8Y A;  2PG4 A;  3LNN A;  2QA4 B;  2QBY A;  2QN6 A;  1ZR4 A;  2WPD A;  2GLO A;  2V1X A;  2XUB A;  1A35 A;  2FE3 A;  2A07 F;  2IOU G;  3L7W A;  3DU6 A;  1HDD C;  1S0U A;  3IAM 2;  4QVJ A;  1IO2 A;  3H35 A;  1HQC A;  3NRV A;  2DTZ A;  2W1O A;  4HAM A;  3RCO A;  3VYS B;  5JI6 A;  1CNE A;  4HV5 A;  4DOZ A;  2INU A;  4MQV A;  1IN6 A;  2O17 A;  3H5A A;  3KZI C;  3BTI A;  1UD8 A;  2C5H A;  5FA6 A;  2DA4 A;  1N75 A;  1D1B A;  1NG6 A;  3MMY B;  4URR A;  3CJQ B;  1WJA A;  2NXN B;  1S4M A;  4WF2 A;  2NTB A;  3AG3 H;  4B3A A;  4OPO A;  1T98 A;  2RQP A;  3FF5 A;  2R3S A;  2VJJ A;  3DEU A;  3CB4 A;  4KIT B;  1IHM A;  1W87 A;  2GRE A;  3J7Z I;  1CQX A;  2VN2 A;  2R7D A;  5JLW A;  1SFU A;  1Y56 A;  3ONQ A;  3AGP A;  2OTJ B;  3SUC A;  1FYK A;  1IDZ A;  5H6R A;  3SJM A;  4II2 A;  1Q82 D;  2YUS A;  3NB2 A;  5JFR A;  1BX1 A;  3HRS A;  2M34 A;  2JDI A;  4O3M A;  3HOY J;  3VNV A;  1R00 A;  1ZGW A;  3SQV A;  3BCF A;  1PJ5 A;  2BW3 B;  2KJB A;  3SDG A;  2D9R A;  5HXB A;  1BL0 A;  3OR1 C;  2DA7 A;  1PDN C;  3UR3 C;  1BW5 A;  3J7A O;  1JA1 A;  3ESW B;  4V02 C;  3EUH C;  2XTX A;  2L5Q A;  4EJT A;  2DMT A;  1BI0 A;  4AC0 A;  1FC3 A;  1QGP A;  1Z7L A;  2L7M P;  5F0H A;  1SC7 A;  4JK1 X;  1G3S A;  3T0Y A;  2CV2 A;  1SMY F;  3PNY A;  4IHT A;  1QUE A;  5K1Y A;  2QYU A;  1N08 A;  4YFO A;  3AVU A;  1E1R A;  1VQ4 I;  2IBD A;  4P55 A;  1SD7 A;  2JA2 A;  1UD4 A;  2E60 A;  1RU4 A;  3CES A;  3SHF A;  1TQM A;  3CD6 I;  1IUY A;  1LKX A;  5D5U B;  1UG2 A;  4P3Y A;  3RSN A;  4KKT A;  2V1D A;  1WP6 A;  3BH4 A;  1JRG A;  3SJZ A;  2HDN B;  3GVK A;  3DLA A;  1YOV B;  3QP5 A;  2NTP A;  2Q0O A;  5HS9 A;  2F1M A;  4ASN A;  2BV3 A;  1NB9 A;  4LFU A;  1YRN B;  1TT0 A;  1TLL A;  4AID A;  1U8R A;  3CP8 A;  2ZNZ A;  3F6V A;  1W1W E;  2CFX A;  5FKM A;  3P4G A;  4XLF A;  1P2F A;  1WDT A;  3AST A;  3GME A;  2GK7 A;  2LH9 A;  3F8N A;  3FX3 A;  3C2H A;  2Z3Y A;  2BY1 A;  4P5O A;  2KMU A;  1QGA A;  3GQA A;  1T0F A;  1U2R A;  1EA0 A;  1YJN B;  4ZZL A;  2L9N A;  3GIR A;  1D5V A;  4LG3 A;  2RRE A;  3IH4 A;  1FY7 A;  4HE5 A;  2DIE A;  2ADU A;  1UB9 A;  3OP1 A;  4P96 A;  2HEO A;  4XRS A;  2LKS A;  3JRI A;  2E2H J;  4LBY A;  3OIO A;  4Z4Z A;  4U7B A;  3FWE A;  2ISZ A;  1MBJ A;  2CF4 A;  1JUM A;  5HLH A;  3ASP A;  5JLX A;  4MLO A;  1E3O C;  4WX9 A;  1IRG A;  1RET A;  2LBF B;  4YRV A;  1WJ5 A;  3S1R J;  1JKQ C;  4RB0 A;  5E79 C;  4XLH A;  3HOT A;  1OFE A;  1XSV A;  4XLA A;  1SKY B;  5FD6 A;  1HA8 A;  5THX A;  2MAB A;  4IRH A;  4FET A;  1T39 A;  1ZRE A;  4E7I A;  2F4I A;  1AKH B;  4X7E A;  2NAZ A;  3E6D A;  4GYI A;  3K69 A;  5E3M A;  3BJA A;  4N9H A;  5EEA A;  1D0Z A;  2E36 A;  3KET A;  1TYX A;  2VBE A;  3PET A;  3KP3 A;  1P7J A;  3E7L A;  3QP6 A;  1U9N A;  2DOF A;  3M9A A;  3FPK A;  3AG4 H;  3EET A;  4PUS A;  5H6Q A;  3VO1 A;  5DM7 F;  3G05 A;  1PUE E;  1W5C C;  2EFG A;  4L5I A;  3OW7 A;  2XF7 A;  2NVQ J;  1Z7U A;  4E7S A;  1OFD A;  4QUZ A;  2VBW A;  3Q3A A;  3GTJ J;  2DOG A;  1XCB A;  1E3Z A;  5C1C A;  2Y0M A;  2DBB A;  2O0V A;  3HHG A;  2QQA A;  4EGY A;  3W2W A;  4XQF A;  4IQ4 A;  4ABZ A;  3TMO A;  1V5V A;  1WPK A;  3S3N A;  2CMP A;  3CMA I;  1IV6 A;  1P92 A;  4EGZ A;  1HC8 A;  2HYJ A;  1MMG A;  1QRB A;  4W8Q A;  1DUX C;  3B90 A;  4RD4 A;  1D1C A;  5FFZ A;  5IOY A;  4M9S A;  5E18 F;  1KU7 A;  2B0R A;  1QO0 D;  1SAU A;  3J80 Z;  1A36 A;  3HIF A;  4OPW A;  1U8B A;  2X8K A;  1N78 A;  5HZA A;  2EWE A;  5F04 A;  2HQR A;  1G4D A;  1TWA J;  2ZZE A;  5J8C A;  4A3K J;  3ZBU A;  4HF2 A;  3HXL A;  2Z6B D;  2KZV A;  4YC5 A;  3U6K A;  3GZ6 A;  1Z6T A;  3CDH A;  4P2N A;  5H2F C;  1XPX A;  1IF1 A;  1MDM B;  4FTH A;  3QYF A;  5CDF A;  2BM7 A;  2HDD A;  2L7K A;  3T1B A;  1GAW A;  1OGO X;  2MH9 A;  1XTA A;  2ZZQ A;  1UD5 A;  5HS7 A;  2FBK A;  3S3M A;  4HNV A;  1FLI A;  2CBX A;  4CCJ A;  4RB1 A;  5A88 A;  1X2N A;  4KNY A;  4UUS A;  3R0A A;  1ON1 A;  4Y3O A;  1PYV A;  4N9I A;  1EP1 B;  3TOA A;  2QKM B;  3ULQ B;  4Z4U A;  3ZMZ A;  2JN6 A;  2WV0 A;  4HOB A;  2JSC A;  1ZHF A;  5D6F A;  2R6H A;  4PAB A;  5F4M A;  2MSY A;  3E1Y E;  3ABK H;  4XOR A;  4JX5 A;  2QQ8 A;  4ZDL A;  1A5J A;  1KQ5 A;  2DXI A;  4G5G A;  4DK1 A;  3LSM A;  4BS9 A;  2OCC H;  1R22 A;  4CCL A;  1OB5 A;  1FP1 D;  4BXU A;  5F0F A;  1JXS A;  1E17 A;  2QXZ A;  1IA5 A;  2QGG A;  1TYV A;  4UNO A;  4TN1 A;  1LDD A;  4C3J J;  2ZL7 A;  5FFX A;  2AO9 A;  4B48 A;  3DKX A;  1F60 A;  2VOP A;  1LB2 A;  1VF7 A;  4XBF A;  1TWG J;  2VFN A;  3GRH A;  3G1O A;  1DP7 P;  4TKO B;  4KMU X;  2Q1Z B;  2HVS A;  1VQ6 B;  1KA8 A;  2EBI A;  4RD2 A;  2XPV A;  1Y8Q B;  5GAD J;  1OYY A;  3CCR I;  1VQ4 B;  2UVF A;  2KQR A;  2G9W A;  1QZE A;  5HNH A;  3E6C C;  3G73 A;  2VKD A;  3MZH A;  2G7H A;  3F9K A;  2CSO A;  1Y8R B;  2JRM A;  2AHQ A;  3FMQ A;  3HUG A;  4CCK A;  1ETK A;  2XT4 A;  1TTT A;  4B8X A;  4DW6 A;  3CC4 I;  3ZZ0 A;  1KQ8 A;  3FXR A;  3EYI A;  2KIF A;  1CNF A;  1OCR H;  1LM1 A;  4OJO A;  1SD4 A;  1H80 A;  2VNK A;  4EM2 A;  1WGX A;  1YG2 A;  3GZ5 A;  4KIG A;  4JX4 A;  2VAS A;  4YEI A;  3GTQ J;  1TL8 A;  2BN4 A;  3KCC A;  2R7W A;  4XMY A;  3O3K A;  3D0S A;  2HQN A;  4FWT A;  1BN5 A;  3DBH B;  3W6J B;  2MLK A;  2JUG A;  4RAY A;  3H0D A;  1NDH A;  1YJW B;  2YWH A;  2VFM A;  2R7F A;  1C0W A;  5DD8 A;  2X6X A;  2FVG A;  1I6X A;  4CDG A;  2BY3 A;  4P9U A;  2L54 A;  4OU0 A;  2HYG D;  2DK5 A;  1J2X A;  2KL4 A;  4ZC3 A;  2WR8 A;  3LYC A;  2DA5 A;  3TW6 A;  4EV0 A;  1AU7 A;  3RTR A;  2COM A;  2DFH A;  2VQG A;  4L9T A;  3JUR A;  2LSO A;  1TNS A;  2ACJ A;  1TWH J;  2XIG A;  5FO5 A;  3CJT B;  4FQG A;  2WBM A;  4PSX A;  2YWE A;  2NVT J;  2PFB A;  3ZOB A;  5JVG F;  4NBS A;  1BA5 A;  4PJ0 C;  2UVE A;  4HRI A;  1T95 A;  5L3D A;  2PMD A;  5CYV A;  2F6C A;  3PQJ A;  2KHM A;  2GQF A;  1FYL A;  2GM4 A;  3DTK A;  3TDU C;  3JSO A;  1IDJ A;  2O1D A;  1VQL I;  3BCA A;  1IJW C;  4ENN A;  3IAS 2;  3GQ9 A;  3I54 A;  1X3Z B;  1YW7 A;  3RPU D;  4EMS A;  3P5J A;  4L0Y B;  1W7P D;  5DNS A;  3JRF A;  2IGK A;  2DPD A;  1Q9S A;  3BT9 A;  1ZEL A;  4M3D A;  3B82 A;  1ZM4 A;  1J9I A;  4P3I A;  1P4W A;  4RGX A;  4Z1M A;  2R7U A;  1W34 A;  1IJE A;  2L9R A;  2O7O A;  2O0W A;  4N4O B;  1R1V A;  4G1V A;  2RV8 A;  2BVM A;  3NE5 B;  4UZE A;  1WFX A;  5KAF C;  1YJ9 I;  4CO8 A;  2CQK A;  1WH5 A;  1T38 A;  1H89 C;  2FBH A;  2ZME C;  2X3H A;  4IOC F;  4RLZ A;  5DCM A;  3RZO J;  2RKH A;  2OD5 A;  4PMH A;  1SFX A;  1ZG1 A;  4WK8 F;  4YZQ A;  3QU6 A;  1PP7 U;  1BQE A;  3PFY A;  3WE3 A;  3RY8 A;  1V0F A;  4XK4 A;  1R7J A;  1FT9 A;  4XRF A;  3Q5F A;  2K86 A;  1BOB A;  2K9M A;  5FRN A;  1G7T A;  3JCU C;  3HPH A;  3W2V A;  3PUM A;  2Z16 A;  2K4J A;  4ESJ A;  3IWZ A;  1JKO C;  2IA2 A;  3R60 A;  4RPD A;  1MW7 A;  4WCG A;  4XLN F;  4UHT A;  5K7Z A;  1WJD A;  2G0Y A;  3CZ6 A;  2YSR A;  2Z99 A;  3KEY A;  3WTY C;  2GAU A;  4FX0 A;  5GAG J;  3WNB A;  2FRH A;  3S1Q J;  5F0C A;  1GT0 C;  1KK1 A;  1HOM A;  2GK6 A;  1Q81 D;  5LHH A;  2RVC A;  1QUF A;  4GRI A;  3IH3 A;  1A6I A;  3IV5 A;  3IC7 A;  2H94 A;  3M7G A;  3GQB A;  3OKX A;  1U3E M;  1ZG5 A;  2QZ8 A;  1F36 A;  3VSL A;  3ERE D;  5J1Y A;  2RQQ A;  3H94 A;  3G1L A;  2DOA A;  2IAI A;  3FIW A;  5K7F A;  1QFZ A;  1O3T A;  3ABU A;  1JE8 A;  1HCR A;  1ZM2 A;  1BC7 C;  4ZJZ A;  3DTI A;  1FBS A;  1J9Z A;  2ZTN A;  2ZJ2 A;  1ULY A;  4BY1 J;  2KIQ A;  2GXA A;  4XN3 A;  1O88 A;  1ZGJ A;  3ZZU A;  3ONU A;  1ACI A;  2VZL A;  2Y9Y A;  5ICC A;  4UUV A;  4OPS A;  1J0R A;  2FNP A;  2QLZ A;  4IXA A;  2E7W A;  1XS9 A;  2JA5 J;  5ERI A;  3PO3 J;  4ZCM A;  1BBY A;  1I3A A;  1EP3 B;  5F27 A;  1XGO A;  2JVG A;  1A6Q A;  4S05 A;  2VB6 A;  2O5R A;  3ERM A;  2W85 A;  4O6J A;  3LQ6 A;  1STZ A;  2XNC A;  1KZL A;  1OYW A;  3PSI A;  5CVV A;  4U7D A;  3L9F A;  4BKX A;  2O3F A;  4EJO A;  4WQM A;  2DJI A;  4LD5 A;  4BXX J;  2B0L A;  4Y7C A;  5GV7 A;  4OJL A;  3CUQ A;  4F93 B;  3VB2 A;  1TYU A;  4M1K A;  3F0C A;  2A3S A;  4CZZ A;  3W2G A;  3VSV A;  3L00 A;  4D1Q A;  2ZIT A;  1J09 A;  1ETY A;  1SD5 A;  3TQN A;  3GQ8 A;  4PFO A;  2QX3 A;  4ZH4 F;  3K1P A;  3CC2 I;  4C43 A;  3CC4 B;  4LC0 A;  2KIU A;  1UZC A;  4TMZ A;  5LGT A;  4OIR F;  1N06 A;  1F43 A;  4W1U A;  1KU2 A;  2DA6 A;  4BJT A;  2WAF A;  2Q6O A;  1IG7 A;  4EW9 A;  4XID A;  3A01 A;  5J47 A;  1DAB A;  2HI3 A;  3ZQH A;  1T2K A;  1Y0R A;  4KIB A;  2RN7 A;  1RKT A;  4Q5S F;  2GQQ A;  4QWQ A;  2LLK A;  5LD2 C;  3DWL E;  3I56 I;  4XSZ F;  2GJP A;  2YR2 A;  2PN6 A;  2INV A;  3WHB A;  4LBZ A;  3OJW A;  3KLN A;  4ESF A;  5DV5 A;  3JTH A;  1DBG A;  4P9F A;  2TRT A;  3BG5 A;  4KYW A;  2VOD A;  3LFU A;  2XAJ A;  1B9N A;  5K5O A;  4A5M A;  2E1M B;  1OCT C;  3B6C A;  2JA6 J;  2MD0 A;  1TSP A;  1E3P A;  2B63 J;  1FX7 A;  2E5Z A;  4PGO A;  5GAE J;  3GEZ A;  4M6X A;  2BX6 A;  3WWG A;  3H09 A;  3E3V A;  1EV7 A;  3EQO A;  3MVP A;  1KU3 A;  1K5C A;  1YIT B;  3I0T A;  1QNT A;  3IUO A;  3KRG A;  1K78 A;  5L3E A;  2NS7 A;  3DV8 A;  3F23 A;  1QPI A;  1IDY A;  1KZH A;  2XZL A;  4HX7 A;  2VON A;  1CQT A;  1RQR A;  4BQN A;  1WOR A;  2NRA C;  2VPR A;  2QA4 I;  3B4N A;  2NS0 A;  2V9P A;  3I53 A;  1QRC A;  4UUS B;  2LY9 A;  3GTG J;  1IUF A;  2Q6I A;  4IOA F;  1EH6 A;  3RQI A;  2ZJR F;  2JA8 J;  1BIA A;  2HR3 A;  1QA6 A;  2BGI A;  1E3X A;  2JJ1 A;  1QA2 A;  2IGM A;  4A2U A;  1FJL A;  5AMV A;  1B72 A;  2DN0 A;  3GVL A;  4QIW N;  1VLO A;  2LZJ A;  2E1B A;  4C0S A;  2W25 A;  3TO7 A;  1UEL B;  4XON A;  4A0Z A;  3X2Q H;  5HDK A;  5M3F J;  4M6Y A;  4YAF A;  4Z4R A;  3QSY A;  1G7R A;  3S2D J;  1VQM B;  3GTO J;  1ETQ A;  3CP2 A;  2ID6 A;  3RKQ A;  5E3N A;  3E1S A;  3G1M A;  3WOD F;  1MBE A;  5E20 A;  2HTS A;  3J7Y J;  2VJ5 A;  3JRE A;  1W0K A;  1HXD A;  4G7O F;  2QE7 A;  2PI0 A;  3H3U A;  1GAQ A;  3CC7 B;  2OTJ I;  1KMH A;  1Z05 A;  3SFZ A;  3TOB A;  1B4A A;  4B4C A;  3BJ6 A;  2LRE A;  2P5K A;  3L2R A;  2V7X A;  5EF6 A;  4P1W A;  2VE9 A;  1MJA A;  4PJJ A;  1Z91 A;  1QVG B;  1X4P A;  2LF8 A;  3K1M A;  4BAY A;  3AL0 C;  2BPO A;  4CQJ A;  1LLW A;  4DK0 A;  1QZY A;  4PC1 A;  2IEK A;  3VEP A;  1EH8 A;  3HUG B;  2LKX A;  5CJ9 A;  2QDX A;  5J4Y A;  2H6B A;  1CZF A;  2NYX A;  4OWR B;  4D7M A;  2O9L A;  2AS5 F;  1WTH D;  4G9Y A;  3ZBT A;  3J81 K;  1UST A;  1DPR A;  2OJE D;  3FDY A;  4GCV A;  2XOK A;  1I6H J;  2D1V A;  5DYM A;  1SFO J;  3DKY A;  1XGS A;  1TWF J;  4LIU A;  5LHG A;  3C3W A;  3IKV A;  4MTE A;  3LL7 A;  3VST A;  4HYE A;  4Y13 A;  1MMD A;  2AXT C;  1ETV A;  5KSW B;  4YAU A;  4PDK A;  3ZRG A;  1I27 A;  5C4J J;  3HTS B;  3CCE B;  3U2R A;  1P9Q C;  3PA2 A;  3T5X A;  3TW7 A;  3L2Q A;  2V9K A;  3CW2 A;  5L46 A;  3QFR A;  1R9T J;  3CQZ J;  1EFU A;  2LVS A;  4C9Y A;  3FKJ A;  4HSR A;  4D0P A;  1UD6 A;  2W84 A;  4Q47 A;  5CKT A;  5BNG A;  3CDL A;  3M3Y J;  2QKL B;  2VC0 A;  4J01 A;  2KDZ A;  3F8B A;  2ZBK A;  4MR0 A;  4OZY A;  1XC5 A;  1X1C A;  1WSU A;  3D26 A;  4N3G A;  2HZT A;  3U21 A;  2QEN A;  3NWT A;  3QRF F;  2X53 S;  4IW3 B;  3FXM A;  2Y75 A;  1X0C A;  3BWG A;  4UVA A;  3NAR A;  1BW6 A;  3ZMV A;  4C2M J;  3JSP A;  3HRM A;  3LFK A;  1WSR A;  4Q7J B;  3CCV B;  3R4K A;  1ETO A;  3PSZ A;  3OYE A;  3RYP A;  1MMA A;  1FSH A;  1NB0 A;  1V5G A;  2EFP A;  5FD5 A;  3MHP A;  5M3M J;  2HNH A;  1OGM X;  3JAM Z;  4B4D A;  2Z2S B;  4PSW A;  1S8N A;  3I4P A;  5BPD A;  3R6J A;  1VQ8 B;  3ZC3 A;  4YEL A;  1L0O C;  2ZJQ F;  3JQP A;  2VBK A;  4MFD A;  2HYF A;  1IGN A;  1UAA A;  2DCE A;  3WU2 C;  1JHF A;  5B3S H;  5C3E J;  3E20 A;  4OM9 A;  2OK8 A;  1DGR M;  1KON A;  2FU4 A;  1OLT A;  2HU9 A;  4PGG A;  1Y1V J;  3WU0 A;  4XM3 A;  5IYR A;  4I7H A;  3BQY A;  1K9M D;  3DXJ F;  1KD1 D;  1K6Y A;  1BR4 A;  2CW0 F;  4Q48 A;  1MD0 A;  4RCZ A;  2CGP A;  2B7C A;  4V2F A;  3ZMT A;  1NBM A;  3GQ7 A;  1XSX A;  3C2G A;  3KEW A;  2M4G A;  2B7B A;  3LOC A;  1RNL A;  5DCM B;  2G0E A;  1QFJ A;  3OS2 A;  1YX2 A;  5EZH A;  3DKW A;  2EFW A;  3H9J A;  1J75 A;  2W48 A;  4FE7 A;  5DDG A;  4K1X A;  2J5P A;  3GSI A;  3ABL H;  3WGG A;  2K27 A;  3MCZ A;  5HOO A;  5IT9 Z;  2M9H A;  5BOX A;  3QFT A;  3SEJ A;  2FSW A;  1MMS A;  2OA4 A;  3CTA A;  1EJ9 A;  4ZYH A;  2W4S A;  2DYI A;  2P5L C;  4W8S A;  4G7H F;  4EH1 A;  2OF7 A;  2GA2 A;  1HBX G;  3OW2 B;  3TP0 A;  1OR7 A;  2ZJP F;  3AVV A;  1OJL A;  1SD6 A;  5KHD A;  2XPW A;  3GZN B;  3ZMU A;  2B7E A;  5DTD A;  4KIC A;  2BV6 A;  3H9G A;  4GDF A;  2A69 F;  3M1C A;  4WXC A;  4HIZ A;  2DYS H;  3K4N A;  3D5R C;  2A6H F;  4B1R A;  1S29 A;  1OGI A;  3KFW X;  2BHZ A;  2VQL A;  1H9G A;  1Z67 A;  2CW7 A;  2O0Y A;  1MNE A;  1XGM A;  3MN2 A;  3QPH A;  1T8I A;  3A3G A;  1XCV A;  3JR9 A;  2DPU A;  2QGU A;  3GFL A;  1LDK B;  4HLX A;  2K9Q A;  4AUX A;  2OTL B;  1DAR A;  3JW4 A;  4A6D A;  4A3G J;  2VKE A;  1DPU A;  3QFS A;  2ISY A;  4F3Q A;  3HOV J;  2GJR A;  2L9S A;  2GXG A;  5D5V B;  4IQJ A;  2HTJ A;  4BUP A;  2UWM A;  2CYY A;  2QQ9 A;  1P7I A;  1J7K A;  1KQ0 A;  1UHS A;  4P9S A;  3ZGK A;  4KT6 A;  4MXN A;  4TMV A;  1PJR A;  1MBH A;  2IS2 A;  3K9T A;  3LSP A;  1WVR A;  1VQO B;  3H0G J;  2ME0 A;  4U88 A;  1K4S A;  2JUC A;  1MAB A;  2BVN A;  4G7Z F;  2JJ2 A;  1IRZ A;  2B9S A;  3TKY A;  1YTY A;  1V3F A;  1S7E A;  1HKT A;  4GFB A;  4C2U A;  4XKC A;  1IV8 A;  4Z2Y A;  2DER A;  4P12 A;  3QOE A;  4R71 A;  3W2I A;  4FT8 A;  1EFC A;  3E5Q A;  3WYA A;  4ASU A;  3CUQ B;  1TYW A;  2XZP A;  4PK4 A;  2W7Z A;  5E6T A;  2V1N A;  2HDC A;  4BQA A;  3R6K A;  2R5Z A;  4XSX F;  1O8I A;  1KYZ A;  3CDI A;  4FCY A;  3LA3 A;  3W6K B;  4YIR X;  3FKI J;  5DN6 A;  2NNY A;  3GFM A;  3CXC B;  4Z06 A;  1K8F A;  1ZKG A;  1W2B B;  1JHH A;  4HV6 A;  3SQN A;  4YG2 F;  4RD0 A;  3DF8 A;  2H27 A;  3K2Z A;  3P9C A;  5DEQ A;  3N6Z A;  3HKZ A;  2F5V A;  5BQT A;  2R4G A;  1A04 A;  3A01 B;  3NAU A;  4NC7 A;  3GBG A;  3E5U A;  4BAC A;  1VQ6 I;  3MKZ A;  5J8F A;  4LBV A;  3A3B A;  3LJY A;  2ZC2 A;  2E34 A;  3FK6 A;  1EE6 A;  1USS A;  4FHT A;  2QVO A;  3N90 A;  2VQC A;  4RM2 A;  1RC9 A;  2M0M A;  1FTT A;  3PNT A;  1XDU A;  3MD2 A;  1E1Q A;  1TVC A;  3HM5 A;  5F08 A;  2KP6 A;  1NK3 P;  4TMT A;  4A3J J;  2I8D A;  4BXF A;  3I64 A;  1K73 D;  4GXO A;  4CIC A;  4DQ2 A;  2CW5 A;  2ZBV A;  5C44 J;  2R5Y A;  3ABT A;  3KYC B;  3K7A J;  5F64 A;  3WTT C;  1JB9 A;  1P4A A;  3Q6Q A;  4F7Z A;  3KZY A;  3JRC A;  2EA4 A;  4C30 A;  3T56 B;  2CQN A;  5BSY A;  1R5G A;  4ROX A;  2ZXI A;  2JRT A;  1Z0X A;  4M3B A;  1YJW I;  1MH3 A;  2X6W A;  2M0C A;  2HQ5 A;  3PNV A;  4KUM A;  4DNT B;  1K78 B;  1F4K A;  3ELK A;  3MFK A; 
#chains in the Genus database with same CATH homology
 3UNG C;  2HDW A;  4IX7 A;  2X1E A;  2K5C A;  2HZD A;  2VL8 A;  2VAS A;  3OR2 C;  2BW3 A;  2R7W A;  1O8J A;  4XMY A;  3SDB A;  2VJI A;  1HVX A;  1PKV A;  1T5E A;  5C1E A;  3H0D A;  2JUG A;  4IZZ A;  3EUA A;  1MMN A;  3K4L A;  3S32 A;  4CCO A;  5CPR B;  3EQN A;  3LSI A;  3OOC A;  1NG7 A;  2X6X A;  3H5R A;  1QCX A;  4E6K G;  3AL0 B;  2KVO A;  1QJV A;  4ZC3 A;  2KL4 A;  3OPO A;  2F43 A;  5HLT A;  4E7K A;  5FRO A;  3RTR A;  2VQG A;  3JUR A;  3GVJ A;  5CQE A;  2HQA A;  2WBM A;  4PSX A;  3RQ4 A;  4AYB A;  4C2T A;  3BC8 A;  1G59 A;  2XDV A;  3SEQ A;  1OB0 A;  2UVE A;  4HRI A;  1IRX A;  1T95 A;  2M4K A;  2WJY A;  1BPL A;  4DNR B;  4E0F A;  1IDK A;  2WY7 Q;  1OFL A;  2F6C A;  2VXD A;  2KHM A;  3G2B A;  5TGT A;  3T9G A;  3WQZ A;  3LSK A;  3ZCO A;  3K70 C;  3BC9 A;  3DTK A;  3K4C A;  5HKK A;  2KRC A;  2HVQ A;  3K6G A;  1IDJ A;  2O1D A;  3BCA A;  4II3 A;  3IAS 2;  3ZPP A;  1QHH D;  3GQ9 A;  3K4J A;  4YZX A;  3RPU D;  3VMW A;  2GOX B;  4BEH A;  2XGJ A;  4U87 A;  4B3X A;  2VXZ A;  1KCD A;  2R7V A;  1R6R A;  3D5L A;  1QU3 A;  2IGK A;  1VLY A;  4XOT A;  1ZEL A;  3W2A A;  4Z1M A;  3FY3 A;  2R7O A;  3H9Q A;  2R7U A;  2A5W A;  4F55 A;  3JU4 A;  2O0W A;  4N4O B;  2BSP A;  4RLF A;  2BVM A;  3NE5 B;  3OYC A;  2KRH A;  1WFX A;  2R7R A;  4PJN A;  1WPC A;  3HOS A;  1O8E A;  2X3H A;  4IKF A;  2VLA A;  3LMW A;  4XLC A;  2WAD A;  3OYJ A;  4PMH A;  4KKU A;  3OYN A;  1RMG A;  4HNU A;  4YZQ A;  3LMM A;  1X1A A;  2A6T A;  3E0J B;  3PFY A;  1V0F A;  2KPM A;  4BU2 A;  4OJ6 A;  1BOB A;  2K9M A;  3OYL A;  5FRN A;  4JQF A;  3HPH A;  2NT9 A;  3W2V A;  4BDY A;  2Z16 A;  3W3C A;  1X1B A;  2WB1 A;  2HLD A;  1MW7 A;  4B44 A;  5KNL A;  1PE9 A;  2KDO A;  5DN6 A;  3VDX A;  1WJD A;  3HL2 A;  3CZ6 A;  4NUB A;  4CSW A;  2XZO A;  3KEY A;  3KX2 A;  2JSP A;  1BR2 A;  4HNT A;  1O8H A;  1I18 A;  2IQ7 A;  3VSU A;  4QPO A;  1E79 A;  1OHH A;  4Y33 A;  2GK6 A;  5CQG A;  4D9J A;  3CMM A;  4DJA A;  1V5F A;  4GRI A;  2E5N A;  3ZR8 X;  1XG2 A;  4ZDO A;  3GQB A;  3OY9 A;  1D0Y A;  4E7H A;  3AKZ A;  4LIT A;  3VSL A;  5LFA A;  2RQQ A;  4G6T B;  4HPQ A;  2CV1 A;  3H94 A;  4XNF A;  4BQQ A;  3M8J A;  1QHG A;  4NC8 A;  4RMN A;  1O8L A;  2DOA A;  1VBL A;  2VIX A;  2UUZ A;  3CF2 A;  3DPL C;  1H8E A;  3DU5 A;  4ZJZ A;  3DTI A;  3K70 D;  3QOD A;  2ZTN A;  3T53 B;  3SZG A;  2MYS A;  2KLO A;  1DQU A;  4XN3 A;  1O88 A;  3VSK A;  1KCC A;  1NRK A;  2M7B A;  1GQ8 A;  2WA0 A;  3A1Y A;  4BJ6 C;  3TL4 X;  3VYT B;  3PJR A;  3OIQ A;  2DT6 A;  4U4B A;  4H4K C;  3HAG A;  2JVG A;  4XLE A;  1PLU A;  4I84 A;  2VB6 A;  4KIS A;  2O5R A;  2IS4 A;  3ZIA A;  3TBI A;  4BE2 A;  4F92 B;  4W8R A;  1KZL A;  3PSI A;  3VMV A;  1W9X A;  2XND A;  2WAE A;  2WZP P;  2M7A A;  2ZXH A;  4CUG A;  2PJR B;  2DJI A;  2NZM A;  3OYD A;  4OJL A;  3DEE A;  4J00 A;  4F93 B;  3VSV A;  2MC4 A;  2NT6 A;  4U49 A;  4G6I A;  4D1Q A;  2W7N A;  1J09 A;  2Y0S A;  4B3F X;  1VJS A;  3GQ8 A;  3QYE A;  4PFO A;  2QX3 A;  3VYR B;  3OEE A;  1BR1 A;  1SFK A;  4R79 A;  4BE1 A;  4FAS D;  4ZDP A;  5FL7 A;  4BJT A;  4EW9 A;  2WAF A;  3OL3 A;  4BGD A;  2NTQ A;  1Z3X A;  2VBM A;  2V4J C;  2RNG A;  2W82 A;  2L2O A;  1LFP A;  3BG7 A;  2W6J A;  2ELJ A;  3DWL E;  4OAZ A;  2AQE A;  2IXS A;  5LD2 C;  2GJP A;  3OYB A;  2X1D A;  1I8D A;  2AQF A;  2INV A;  2OUM A;  4HST A;  1G8X A;  4B47 A;  1DBG A;  3S93 A;  2R7T A;  2O04 A;  2ZZG A;  1H8H A;  1BHE A;  3LFU A;  1N77 A;  3IP4 B;  2NST A;  4PFP A;  1D0X A;  2E1M B;  4X0G A;  2R7Q A;  4L8J A;  2MD0 A;  1FX0 A;  1WJE A;  4RLQ A;  3KYL A;  2K3P A;  2D3L A;  2ODL A;  4G7W A;  2CUZ A;  2E5Z A;  4XKV A;  3A4C A;  1MND A;  3FBI B;  4DBQ A;  4XKB A;  1OOC A;  2R7X A;  3WWG A;  3SEZ A;  3EQO A;  2V31 A;  2UV1 A;  1K5C A;  5FRM A;  3IUO A;  4XL9 A;  3KRG A;  4JOM A;  4YEJ A;  4BDZ A;  2GJK A;  2XAU A;  3HC7 A;  2PJR A;  2NSP A;  4CA0 A;  4DBR A;  2XZL A;  1UD3 A;  4BQN A;  2M3A A;  1E43 A;  2CV0 A;  3B4N A;  4EAT A;  1Y6I A;  4PJL A;  2GOM A;  3NWS A;  4P22 A;  4N4N B;  2BVL A;  1JI8 A;  4XOP A;  1W36 D;  2VJ4 A;  1E3X A;  3OL4 A;  1HZE A;  2JJ1 A;  2IGM A;  5AMV A;  2CS3 A;  2IGO A;  1BMF A;  3B8Y A;  3L2U A;  3DPT A;  3OYM A;  3GVL A;  3LSG A;  1K28 D;  2LZJ A;  2E1B A;  2XF5 A;  3FBN B;  3LNN A;  1FMW A;  1UEL B;  4XON A;  2WPD A;  4KJZ A;  3OYH A;  3I9V 2;  4YXW A;  1IB4 A;  4Z05 A;  3DU6 A;  4F52 A;  2PMZ A;  1O8K A;  3CP2 A;  3IAM 2;  4YZ0 A;  3H35 A;  1EFR A;  2CK3 A;  3E1S A;  2W1O A;  4XR6 A;  3RCO A;  3VYS B;  1DP3 A;  3OFN A;  4DOZ A;  2INU A;  2VJ5 A;  1W0K A;  1YX3 A;  2O17 A;  3H5A A;  2QE7 A;  2MFZ A;  3HPG A;  2WJV A;  1LVK A;  1UD8 A;  1KMH A;  4TSF A;  1O8F A;  1N75 A;  1D1B A;  1NG6 A;  3MMY B;  2HVR A;  4URR A;  1X1D A;  2LRE A;  1WJA A;  3CJQ B;  3L2R A;  4KKS A;  3K4K A;  4P1W A;  4AU7 A;  2NTB A;  4PJJ A;  2XC7 A;  2Q2E B;  2X51 A;  3BCB A;  2OV7 A;  1X4P A;  2IS6 A;  3J7A Y;  3AL0 C;  2VJJ A;  4DK0 A;  2DT7 B;  3LSH A;  1V0E A;  4KIT B;  1U0J A;  3A2K A;  3HUG B;  3AFH A;  1Y56 A;  3ONQ A;  4QPQ A;  3SUC A;  1CZF A;  4OWR B;  1TZL A;  4NK6 A;  4XD7 A;  3FPP A;  2V7F A;  3HG9 A;  1WTH D;  3FDY A;  4II2 A;  3K4M A;  2XOK A;  4BL0 B;  4OAY A;  3VYU B;  2JIZ A;  2JDI A;  1JTA A;  3DKY A;  3BCF A;  4LIU A;  2BW3 B;  3LL7 A;  1YE9 A;  1EA3 A;  4RM3 A;  1PXZ A;  3VST A;  1MMD A;  3ZQQ A;  3OR1 C;  2X85 A;  4ITV A;  1WMR A;  3ZRG A;  3UR3 C;  3D5S C;  1AIR A;  1P9Q C;  3EUH C;  2W6I A;  3CJR B;  3L2Q A;  2L5Q A;  2PYH A;  2V9K A;  1Z7L A;  2LRD A;  2CV2 A;  3DDY A;  2WAQ A;  3PNY A;  3PUB A;  3H5N A;  3FKJ A;  4HSR A;  2X6Y A;  4C9Y A;  5CKT A;  1BLI A;  1UD6 A;  4W8T A;  1E1R A;  3UW0 A;  2QKL B;  4J01 A;  1X4O A;  4E4H A;  2JA2 A;  1UD4 A;  2E60 A;  2LY1 A;  1RU4 A;  4MR0 A;  3CES A;  1X1C A;  3N05 A;  2ZSH B;  4OZY A;  4ZTJ A;  1HG8 A;  3S3O A;  3V42 A;  3FHN A;  3U21 A;  4CCN A;  4G7X A;  4FXU A;  1LKX A;  4CH7 A;  3NWT A;  3RSN A;  4KKT A;  3OYI A;  1WP6 A;  2D3N A;  2X53 S;  3BH4 A;  3OEH A;  1JRG A;  1X0C A;  3GVK A;  3DLA A;  1Z3Y A;  2NTP A;  4E7L A;  2CH0 A;  2P0W A;  2F1M A;  3OYE A;  1MMA A;  1TT0 A;  2V4D A;  1V5G A;  3CP8 A;  1O8D A;  2HNH A;  1OGM X;  4XLF A;  2Z2S B;  4PSW A;  2GK7 A;  4YEL A;  2LH9 A;  4DGW B;  3OMY A;  4BEH B;  4E7J A;  1O8M A;  3C2H A;  3S8P A;  4P5O A;  2VBK A;  2KMU A;  3GQA A;  1UAA A;  2DCE A;  2XF6 A;  2L9N A;  1GLN A;  1COW A;  4LG3 A;  2RRE A;  4NNJ A;  3VR6 A;  1DGR M;  1KON A;  2LYC A;  1OLT A;  2HU9 A;  2DIE A;  2HPI A;  4XM3 A;  3L2V A;  4ANJ A;  3L2W A;  2LG4 A;  3DTE A;  3OYG A;  1K6Y A;  1BR4 A;  4U7B A;  2EWE A;  2OC6 A;  2WY8 Q;  1NBM A;  4MLO A;  3GQ7 A;  3KEW A;  3C2G A;  1E0E A;  2M4G A;  2LC2 A;  4CCM A;  2R7S A;  2LBF B;  4YRV A;  1WJ5 A;  3HOT A;  4XLH A;  1SKY B;  4XLA A;  3OS2 A;  2BOL A;  2IS1 A;  2Z8G A;  1HA8 A;  3H9J A;  2MAB A;  1UG0 A;  3OIP A;  4FET A;  4GQN A;  4ZYA A;  1Z21 A;  3PSF A;  4E7I A;  2F4I A;  1D1A A;  2W00 A;  4BE0 A;  1D0Z A;  1T0F C;  3SYT A;  5HOO A;  4TT3 A;  4C2L A;  2VBE A;  5KCM A;  2X1C A;  1AA7 A;  2W4S A;  3FKS A;  2XSJ C;  3BG6 A;  3OYK A;  1VZ0 A;  4PUS A;  3MKY B;  1WJC A;  4W8S A;  3G05 A;  2HPM A;  2FUG 2;  5KHD A;  1X19 A;  4PJM A;  3OW7 A;  5HNF A;  3T51 B;  2XF7 A;  1BN8 A;  4E7S A;  1O8G A;  2CUJ A;  3H9G A;  3OOU A;  3M1C A;  2VPL A;  2V26 A;  4HIZ A;  4YZA A;  3K4N A;  3D5R C;  1E3Z A;  4OJ5 A;  5C1C A;  2VQL A;  3I3L A;  2CW7 A;  1MNE A;  2O0V A;  3A3G A;  2ZFU A;  3MKW B;  2CFO A;  2QY1 A;  2PYG A;  3A35 A;  3W2W A;  1LDK B;  4IQ4 A;  4XQF A;  3TMO A;  4Z03 A;  3S3N A;  3OE7 A;  2CMP A;  4W8Q A;  1MMG A;  5IK2 A;  3B90 A;  2R9V A;  1V5E A;  1D1C A;  4F3Q A;  2GJR A;  2L9S A;  1UD2 A;  4IQJ A;  1DBO A;  4BUP A;  4F91 B;  2ZZF A;  4NK8 A;  2UWM A;  1SAU A;  3BCD A;  1OR7 C;  3VWB A;  2VQH A;  2LBF A;  3ZGK A;  4KT6 A;  5HVQ C;  1FMV A;  1N78 A;  2X8K A;  1PJR A;  2IGN A;  4MXN A;  2IS2 A;  2ZZE A;  3HXL A;  1RWR A;  2Z6B D;  3ZXS A;  2KZV A;  1MAB A;  4JMQ A;  4OJP A;  2JJ2 A;  3QYF A;  1NHC A;  3EUK L;  5CDF A;  2L7K A;  2K9L A;  2LOO A;  4C2U A;  4XKC A;  2NOJ B;  1OGO X;  1YX5 A;  2V6E A;  3OAA A;  3QOE A;  2ZZQ A;  4UZU A;  1UD5 A;  3S3M A;  3OYF A;  2WSS A;  4HWV A;  4CCJ A;  3QYB A;  4ASU A;  2XZP A;  4PK4 A;  2V1N A;  4ZTF A;  2CW8 A;  2ZTG A;  1O8I A;  3K10 A;  4Y3O A;  1PYV A;  2V7Q A;  2QKM B;  4CZC A;  4Z06 A;  2E1M C;  2LY2 A;  2JVH A;  4OZZ A;  3HKZ A;  2F5V A;  4XOR A;  4ZDL A;  2R4G A;  5JHF A;  4NC7 A;  2DXI A;  3GBG A;  4B43 A;  4BAC A;  3DQV C;  3MKZ A;  4DK1 A;  3LSM A;  2VKH A;  4BS9 A;  4BJ5 C;  1S9H A;  4HG2 A;  3BLY A;  4BQO A;  4CCL A;  3A3B A;  1IA5 A;  2QXZ A;  1EE6 A;  2Z1D A;  4XKW A;  3K4B A;  2VQC A;  4RM2 A;  2M0M A;  3PNT A;  3OS0 A;  3MD2 A;  1E1Q A;  4NQW B;  4B48 A;  3DKX A;  1VF7 A;  3GRH A;  2KP6 A;  4LIV A;  3DPU A;  2PEC A;  4Y4R A;  4B3G A;  3OS1 A;  4TKO B;  2I8D A;  2Q1Z B;  2ZSI B;  4XN0 A;  4BXF A;  2HVS A;  3ZPN A;  3EPZ A;  3OWT A;  4HEA 2;  2UVF A;  1W36 C;  2KQR A;  1OFM A;  5HNH A;  2M5S A;  2VKD A;  3T56 B;  4C30 A;  3F9K A;  1DGW Y;  1KTW A;  2ZXI A;  1ERD A;  4CCK A;  1W0J A;  3OYA A;  3PL8 A;  2X6W A;  3PNV A;  4DIQ A;  4E7Z A;  4AVZ A;  4DNT B;  4OJO A;  3ZSC A;  1WJB A;  1H80 A;  1WJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...