2X6XA

Tailspike protein mutant d339n of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
598
structure length
598
Chain Sequence
b'DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE PROTEIN HK620
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 235
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6xA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6xA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6xA02
3T9GA 1RU4A 1O8LA 4XORA 1IA5A 4W8TA 2O17A 4XLCA 1IDJA 1KCDA 3GQAA 2NTBA 1XG2A 4XLFA 4URRA 1HG8A 2X85A 1KTWA 4XOPA 1O8EA 4PMHA 2QX3A 4NK6A 1DBOA 2UVFA 1O8GA 1O8KA 1PLUA 1VBLA 4OJLA 4XKWA 1PE9A 2BSPA 4YZAA 1KCCA 2NSPA 4YELA 2UVEA 1OGOX 1O8JA 4OJPA 3GQ9A 1PXZA 3B90A 1JRGA 1K5CA 4XR6A 1AIRA 4AVZA 1IDKA 4MR0A 4U49A 2INUA 4XOTA 3VSVA 4XQFA 2X6YA 1IB4A 3VSTA 4XKVA 1H80A 1OGMX 1O8MA 4Z06A 1O88A 4EW9A 2VBMA 4W8QA 4HWVA 2NT9A 2IQ7A 2O1DA 1X0CA 4YZQA 3KRGA 4XLEA 4NK8A 2VBKA 4XM3A 3B4NA 2X6XA 4Z05A 4W8RA 2QY1A 1JTAA 2PYGA 3B8YA 2PECA 4XN3A 2NZMA 3SUCA 2EWEA 1BN8A 4YEJA 1O8FA 4XLAA 2NTQA 5AMVA 4XN0A 1O8HA 2NT6A 2QXZA 4C2LA 3ZSCA 1RWRA 1WMRA 3GRHA 4MXNA 4OJ6A 2VJIA 4XLHA 2INVA 3WWGA 4OJ5A 4Z03A 1OFLA 1O8IA 4XL9A 2O04A 3FY3A 1DBGA 4W8SA 4OJOA 3VSUA 2Z8GA 1RMGA 4OZYA 3VMWA 2NTPA 4XONA 2X3HA 4YZ0A 2O0VA 1QCXA 3EQOA 3ZPPA 2VJJA 3JURA 1CZFA 1BHEA 2PYHA 2VBEA 2ODLA 3GQ8A 1EE6A 3GQ7A 2O0WA 5C1EA 4OZZA 4I84A 4XMYA 1O8DA 2NSTA 4YZXA 3VMVA 3EQNA 1OFMA 4XNFA 1OOCA 3LMWA 1NHCA 4U4BA 2X6WA 1QJVA 5C1CA 3UW0A 1GQ8A
chains in the Genus database with same CATH superfamily
4CGZA 2GQQA 4KN4X 3KFWX 2W7NA 3TL4X 3RPUA 4X07A 1WCMJ 2KIFA 3MVPA 3KE2A 4Y33A 5J3LA 3J81k 3BCDA 3P7NA 2MC4A 4CZZA 1A8PA 4HV6A 1KQ5A 2I10A 3HYIA 1YHQB 5JBQA 1TLLA 4D9JA 1VQ6I 1IN8A 3R60A 2KMUA 4PJMA 2XNCA 2ZJQF 1IW7F 2WAQN 1SD7A 4FASD 2O3FA 1UD3A 2YWEA 5FKMA 4OOXA 2V9KA 2DA4A 1JI8A 1YI2B 1TYWA 3SJMA 2QWWA 2E7XA 4A69C 5M5WJ 1RR8C 2Z99A 4OJPA 3W3CA 3CXCB 1TL8A 3VEPA 1JHHA 4DNCA 1XSXA 4RGUA 5EGOA 3HOWJ 4RCYA 3E1SA 3I56I 5CQGA 2LSOA 2GREA 4UZEA 3CUQB 3R4KA 1HC8A 3K1NA 1W0JA 3DKYA 2JWTA 4FISA 4BQNA 1IO2A 4ZTFA 4U49A 1OMIA 2CGPA 5DCMB 5CPRB 3RKXA 1G2HA 4XQFA 1PP7U 4ESFA 3TEDA 1K78B 4C9YA 1JGSA 1X19A 4D5CA 3DF8A 3CUOA 2ZJRF 2DXIA 2L7FP 2O8KA 2V6CA 4O3MA 2JA7J 1I5ZA 1EKEA 2XAHA 2VBMA 4W8QA 1WRJA 4J01A 1KQ9A 2K02A 1FRNA 3BJ6A 1T8IA 4EATA 4Y3OA 2DK8A 4NC7A 4IHVA 1W5TA 2ZZEA 2VKEA 1K8FA 3WBKA 1W0TA 1ZRFA 3NAWA 1FWZA 3CMEB 5HLHA 1JUPA 2GM4A 2XROA 1RETA 4RAZA 2CU7A 1BA5A 2EWEA 3FJOA 2VFQA 5AN9A 4YALA 1NG6A 3FXUA 5F0HA 3HKZA 2IXSA 4I02A 3E7LA 5FLMJ 2HEOA 2DFHA 2P5KA 2C2WA 1USTA 2WZPP 4QUZA 1R7JA 1MGTA 2DA6A 4HG2A 4XN0A 5K7FA 3CCVI 3Q39A 4OOIA 3RCOA 3DLLF 3LYCA 2KPMA 2QM3A 3ZMUA 5FGMA 1RWRA 1SVLA 3OYLA 3QPSA 4QVJA 2YR2A 2GOXB 2IA1A 4IPAA 5JR3A 4BY1J 1JT6A 2YS9A 2IRFG 1JJ2B 3G73A 4Z03A 3E0JB 1B72A 3I58A 2FMLA 2QENA 2JVHA 4OAYA 4F7DA 4OIQF 4X0GA 4DOZA 2GIVA 1K28D 4WZEA 2Z8GA 1RR7A 2ZMEC 3HZJA 4F55A 3GTJJ 1ZG1A 1QCXA 3J81Z 1ZM4A 3OOPA 3JURA 4HAMA 4KJZA 1BHEA 1IUYA 1UD2A 1EE6A 2HR3A 5AIQA 3S8PA 3WGGA 4J19A 2J8IA 3BDDA 3AVTA 4WXDA 2HPMA 2ESNA 2L01A 4D7MA 1QPIA 2ZNZA 2LH9A 4RM2A 2GK6A 3WG9A 4BQOA 1FYLA 2CK3A 3KEWA 4ENKA 5FO5A 3BCFA 5B6IA 4UVBA 1Q82D 1OOCA 2GA2A 2O61A 2R7TA 4B3XA 4M73A 1SAXA 2DT5A 5BPDA 1H8HA 1Z6RA 4LFUA 1IV6A 1IRFA 2GXAA 2Q6KA 2LKSA 4G6IA 1FOYA 2Y69H 3K69A 3D5LA 4Z4ZA 5EEHA 2CQ7A 2HOTA 2DA5A 1O8LA 3V7RA 2R5ZA 2WPDA 4M3DA 1JA0A 2HVSA 1EA3A 3C18A 3SY2A 3HHHA 3CCEB 2JA6J 3IKTA 2H6BA 3U1KA 5BSYA 1XG2A 4YEIA 4B4CA 1GXPA 2BMWA 3K4MA 3ASNH 4OJLA 2HPIA 1X1DA 2RV8A 5LGNA 4IHTA 2Q2EB 1ZTRA 2JUCA 1VJSA 2WB1A 4YZAA 3R0JA 5LFAA 2H27A 1KC8D 1E62A 3SJPA 3P9KA 2PX9A 3VO1A 2ID3A 5EZGA 1P4XA 5HDKA 4AM3A 1JRGA 5HS8A 1JA1A 1K5CA 2YPRA 3TO7A 2ZSIB 1K73D 2DMTA 1QGPA 3IRRA 5J35A 4R1HA 2R7QA 4B47A 2J5OA 3GXOA 3HOTA 1NK2P 3SLNA 3ZQIA 3CDHA 2HS5A 1QPMA 3GQBA 2KJBA 2HXOA 4HEA2 5FFXA 3M07A 1I6HJ 2AQFA 4JBAA 4ZDPA 1UCRA 4XRFA 4CO8A 1FRQA 4XKVA 1BR2A 1IB4A 1WJCA 1WPCA 1X3UA 1G3TA 3FXMA 4ZYAA 3B82A 1D0YA 4EW9A 4P96A 4Z4VA 5K7ZA 2BM4A 3AL0B 2VQGA 5KSWB 3K2AA 4HWVA 2L3DA 3ESWB 1ZRDA 2FNPA 4LK0F 5HLGA 1YLFA 2HMAA 5HDNA 5GADJ 2JJ2A 1LEBA 3JRDA 2DN0A 3BR5A 1A6IA 3G4SI 1VQ5I 4MTEA 3TW6A 2CMPA 3CCQI 2R93J 3U21A 4LLNA 2KRHA 5IP6A 2AXLA 1ZLKA 4HOBA 3H9NA 2XDVA 2P6TA 1IF1A 3HSFA 2XIGA 1T0FA 3SEZA 5DN6A 1ZKGA 1MZBA 3H9QA 1XGSA 3C2BA 1K8AD 3HSRA 2QYUA 3WGHA 3O8HA 2R7RA 4HDUA 3FXQA 3HEFA 1E79A 1GVJA 4Y4RA 5HNHA 1K4TA 2QXZA 1U2RA 4UHTA 3GSIA 4OOVA 1W36D 2B7BA 4UXNA 1DABA 4ENMA 3CCYA 2ELHA 3GTMJ 4OJ6A 1MBKA 3O8GA 2L54A 4WQMA 1W5CC 1OJLA 2ZXIA 1YIOA 3DQVC 5CVVA 2RQPA 3COAC 5DSZA 3EUHA 2K5CA 2QQBA 1OFDA 3U2RA 3HRSA 3T0YA 4QPQA 5F08A 4AF7A 1KQ0A 2XKOA 2M4GA 4P9FA 4P9SA 3K2ZA 2NOGA 3WU0A 1VQ9B 3QFRA 2PMHA 1FNDA 3VSUA 3GMEA 1ZH5A 1JKRC 5FD6A 2BXYA 2EA2A 2Y30A 3M1CA 2MBFA 5IP9J 4YG2F 2M9HA 1QUFA 1LFPA 2E7WA 4Y17A 4MYTA 2BSAA 1SKQA 1FNCA 5F27A 3BG9A 1WJDA 2Y9YA 5D5XB 3D26A 1H8EA 3CC4B 2EWNA 3CMYA 3RQIA 3EQNA 2YWGA 2DMPA 2L0KA 2BW3B 1YTYA 4KFCA 3MZ8A 1YS7A 4NBSA 1HVXA 4J00A 5LEJA 2LNBA 3IH3A 1WJAA 1QG0A 1UHMA 2P5VA 5J40A 3PNTA 2QKLB 5THXA 4BL0B 2PG4A 2YSRA 5BOXA 3T9GA 1E64A 2VB6A 3GWZA 4Z1MA 4BPRA 1YITB 4C3JJ 1Y0YA 4M1KA 4PFPA 2W1OA 5IOYA 1HG8A 3EQLF 4FT8A 1KTWA 4X7FA 4PMHA 4RGRA 1JHFA 4M53A 4PC6A 3LA7A 3BTIA 4N9IA 5B1BH 4HDVA 2DOGA 4PK4A 1N25A 4YIRX 3BZ6A 3ZQGA 2IP2A 4EJTA 1D2EA 1T6ZA 3WTVC 2DERA 2BM0A 4U0WA 2RDPA 1PE9A 1RZ4A 2HNHA 3K7AJ 4OINF 1TW2A 1DP7P 2OPTA 2R7ZJ 2NS8A 3S15J 4A0XA 4EJOA 2ZXHA 1BL0A 2ID6A 1HDPA 4ZCLA 1WP6A 1PVEA 1W34A 4E7LA 3TW7A 3CCMB 1RIOH 1OFEA 1X1BA 5J3OA 1YQAA 3V8JA 2PN6A 1MD0A 3H5NA 3VSLA 4HSTA 4FQGA 6PAXA 2V9VA 1UHWA 2JA5J 3FXKA 2BBYA 4TV7A 1J59A 1I6XA 1HF2A 3L2RA 2DA3A 5H6RA 4BJ5C 3F21A 2XAGA 2PMUA 3CC7I 3A1YA 3CDIA 4UNOA 1QGZA 4HF1A 2Y0MA 1QNTA 3A03A 2JPCA 2OTLI 1XGNA 3T56B 4LJZF 3BQJA 1YJ9B 3LQ6A 2OZUA 1G7TA 1XSVA 4F93B 1N8RD 2Q1ZB 1LDJA 3TO6A 1BR4A 1UMKA 3QSYA 2YUHA 1FIPA 2AHQA 3L2WA 3CF5F 2IGNA 3TP3A 5FKOA 1VQ7I 3W2AA 3I1FA 4YEJA 1BI3A 1ONVA 2ZKZA 1VQPB 5E3MA 2HOSA 4X0CA 2B0LA 3IWZA 3GYHX 1TP4A 3ASOH 1OGIA 2BY1A 2CW0F 2LLKA 4G7WA 3BR0A 4DQKA 2E34A 5DM7F 3OW2B 1BN5A 4GCVA 2DOAA 3CCJI 3LWFA 3TDUC 2HDWA 3LJYA 4LGWA 3ZQFA 3WGIA 4I76A 2DETA 2F4NA 1SD5A 4OJ5A 4X1EA 4BEHB 2BEOA 5FLVA 1O8IA 1HXDA 1KQSB 3CPXA 3LSRA 3E6DA 4D0PA 4NCNA 4U87A 3JQPA 1QFYA 3QPTA 1G4DA 4P25A 3RY8A 2BX6A 3SDGA 1KZHA 4HF2A 1QZYA 2VL8A 2VT3A 2JZYA 3G6EB 3QOEA 1IRXA 4RLQA 4P1WA 3R6SA 1K4ZA 4BAYA 1FPQA 4TN1A 1JTYA 4EGYA 3GQ8A 1FDRA 1GUUA 5C1EA 1T0FC 1Q1VA 3A35A 3A4CA 3RI4A 3CUQA 1ETWA 1W87A 3DWLE 3S3NA 2V4JC 4HF0A 4M9SA 3I4MJ 3OFNA 4Z4UA 1OFMA 1K6OA 3OYAA 2CWEA 3A0BC 2QMUA 3AK5A 4Z4YA 2UXXA 2V7TA 5IYNA 4A6EA 1MBHA 3FIWA 4AIHA 2DOEA 1WWXA 1MMAA 3QPHA 4HNUA 3JQRA 2CQKA 2WY8Q 2PLFA 3ECOA 5K7HA 4U7DA 2OBRA 2PBIA 1U3EM 3PFIA 3AG2H 2LBFB 1KCDA 3RPUD 3H94A 2OA4A 3LFKA 3ZMTA 2D1VA 4EEFG 4GDFA 3GW2A 4II2A 3U1DA 3K0LA 2X4HA 4S0HB 1F20A 1Q81D 1ULYA 3N05A 3HHGA 3GVLA 4XRMA 3G1MA 2EV0A 2PE3A 4MFDA 1UMQA 3ASTA 3JRIA 2NSPA 1QRCA 2DBBA 1MABA 4RGXA 2R7OA 3BG7A 1MRZA 4WZTA 3SLDA 1WORA 1ACIA 1WU8A 2CBXA 3K70D 3E6CC 1H8AC 3FKIJ 2DT6A 2LKPA 3IAM2 2DEUA 3QYFA 4G1BA 2IGOA 1FMVA 4NUBA 3ZP5A 1IXRC 1YW9A 4HQEA 1YIJI 4YFXF 4H9GA 1D8TA 2XGXA 5J4VA 2O0YA 5FRNA 4OM9A 2X1DA 2XF5A 2STTA 3CCSB 5DYMA 3WTXC 2LTPA 4DYRA 1MNEA 5D6FA 1QGYA 1WJBA 4AWXB 1WOPA 4Z06A 2FF4A 4UZUA 2IQ7A 3W2FA 3JTHA 5TGTA 2C78A 1KRHA 3QYEA 4ABZA 2IVMA 1OLTA 4ACBA 5H20A 3Q0UA 1YG2A 2HXIA 4A0ZA 2IT0A 3GUDA 3CQZJ 2A69F 2KP6A 5HZAA 1CNFA 1KMHA 3LAJA 2GJRA 2ZBVA 3FHNA 1KK0A 4LG3A 1FNMA 2QQ9A 4OWRB 1U8BA 1DDGA 1RNLA 3LSMA 2H09A 5DNSA 1TQPA 2QA4I 4P5OA 4DW6A 4RM3A 2QTZA 5M5YJ 4X6AJ 3BTCA 1VHEA 1XB2A 4RD0A 4FE7A 4F91B 3BH7B 2LYCA 1IN6A 2W82A 3FMRA 4XSZF 3OP1A 4P3IA 2ZL6A 2F4IA 4TMVA 1B6AA 4XLHA 1Y0NA 2D9RA 1E1QA 3FBIB 3LOCA 4I0AA 3PVDA 3E1YE 2EJRA 2VPLA 1IRZA 4CYCB 1ZGJA 1AKHA 3ZQ7A 4N4NB 4BXXJ 2DTRA 3CW2A 2Y75A 3SYTA 2JQ7A 2VKVA 2ZB9A 4OMZA 4IQJA 2XF6A 2VXZA 5GTHC 4ESBA 1RI7A 3OMYA 2XB0X 2OK8A 4RPDA 4EV0A 2W84A 3BTLA 1I7PA 1YJNI 4L18B 3LFUA 3GQ7A 4YFOA 1D1AA 2O0WA 1B9MA 2GAUA 5J8CA 3FMSA 2OBPA 3HIFA 3SKBA 5LEKA 1Z21A 1HZEA 4MO7A 4EM1A 1T2KA 3H1CA 3ZQLA 1NK3P 3NEUA 3OIOA 3PA2A 1ETYA 3F22A 3K4CA 5F1JA 2QEXB 2Z33A 4M3GA 1SD4A 2B7EA 1TQMA 2WTEA 3H5AA 3JRBA 3UW0A 2JK3A 1XCBA 2LY1A 4G6DA 2CUJA 3W6VA 2MD5A 1ZYRF 1W35A 4B43A 4HE6A 1YS6A 3PUBA 1VFCA 4RPBA 3CCRI 3I55B 4PC2A 2HYJA 2NOJB 3L00A 3P9CA 3QU6A 4HRIA 2MH2A 2VODA 2A68F 1EF4A 2XHKA 1X3ZB 5BPIA 3ONYA 2HFHA 4KUMA 4UY8I 4G6QA 3KL9A 2PFBA 5E1XA 3G1OA 5TY0A 1Z91A 3K1PA 4A3LJ 3ULQB 1G59A 1BPLA 1GHCA 3WBJA 4KYWA 2K9SA 4H4KC 4D1QA 1ZK8A 2FX0A 3QU3A 2QTLA 2YU9J 4C3IJ 1QVGB 2UVEA 4RD2A 4B48A 2HKOA 5L3DA 1U8RA 4Z4WA 1B9NA 3CO6C 3HTSB 2BGJA 5JMCB 4ZYGA 4YDTA 2J5PA 2EZKA 4JQFA 4NDLA 2E1CA 2ACJA 4RMNA 1OQYA 1ITYA 1XTAA 2FQ3A 1T6XA 4KKTA 4P2NA 5J1YA 4JRAC 1XGOA 1X2MA 4ZZDA 3Q38A 2V31A 3MKWB 1TSPA 4G12A 2ME6A 1YHQI 4AC0A 3Q3AA 4FX4A 3OYCA 1T33A 2QYOA 3DLAA 4G1VA 3AVXA 2M2EA 2COBA 1O8MA 2EINH 2QSGX 3W5VA 1JT0A 3GZ5A 3LSTA 1OCCH 2QUFA 3CD6B 2FVGA 3NE5B 3DV8A 1A5JA 3ONUA 2W57A 5J8FA 1KK3A 3HRMA 1IUFA 1S0UA 2KT0A 2BHZA 5AONA 1GV2A 2JUGA 4AD9A 3HOZJ 3VYSB 1VLOA 4TMTA 3CMMA 3OAAA 1GXQA 4GQNA 2CW7A 2E1MC 4D7NA 2X6XA 3VWBA 5FRMA 1V4RA 5GAHJ 4W8RA 4MTDA 1XQBA 2PECA 4N0BA 1Q9SA 1J09A 1KA8A 2L7ZA 3EUKL 1CQTA 4KITB 5HLTA 1Z6TA 4V2GA 1RC9A 2GA1A 2VNHA 5DUIA 3HL2A 1P92A 2M7AA 3OS2A 2K4JA 5LD2C 5CJ9A 3WQZA 3QODA 4DQLA 2IS2A 2FU4A 5B5EC 2QGGA 1TT5B 3SZTA 2OTJB 3G71I 1DQUA 4QWQA 2V4DA 4MXNA 1HCRA 4UZFA 2Z16A 1TZLA 5TR9A 1XMXA 3LSKA 2ADUA 2QF7A 3WWGA 4XL9A 4ASUA 4YC5A 1I50J 4CYDA 5A2QZ 4MHGA 4AYBA 2FQ4A 2R6HA 5GPAA 2X9DA 2RC4A 2KISA 5J6XA 5IYCJ 5BSXA 1I18A 2EIKH 3N4MA 3K9TA 5DCFA 1TNSA 1PP8F 2PI0A 2ZJ2A 2L9VA 4RD6A 1MJ9A 3C7JA 4P3YA 2IA0A 4GXOA 1O8DA 2PQ8A 5BQTA 2HTJA 3SZEA 3M9AA 1LEAA 5D4RA 4RB0A 2TDXA 5JLVC 3W6KB 2ELJA 1STZA 2VE8A 4UUVA 4YCQA 4V19K 2KIUA 2PLYA 1R5NA 2NVXJ 2E1BA 2MG4A 2VOPA 4RB3C 1CF7A 3S93A 3O3KA 4IXAA 1C0WA 2QSFX 1I39A 4W8TA 2EA4A 3MWMA 1IJEA 2CH0A 2X85A 3I3LA 2QVOA 3MEXA 5IPAA 4ENJA 3MMPA 1K6YA 2B7CA 4P55A 3ABLH 2ZL5A 5HZBA 2UVFA 4OPOA 2M87A 1WXRA 1U5TA 1VQNB 2F5VA 2EZIA 1W4MA 4M6YA 4N9HA 1QH0A 1RQPA 1X4PA 3OS0A 4PC7A 1KU2A 2LREA 1YJWI 3IL2A 3CPWB 3FPPA 3I53A 1OGOX 2F1MA 1O8JA 3PSSA 3ZCOA 4CCOA 3HUGB 2CJJA 3FDYA 3OIPA 1Z67A 1W36C 1WI3A 2EPFA 2K85A 1LDKB 2HDDA 2MLKA 3D5RC 3T1BA 4G7ZF 4BU2A 4XLPF 3QRFF 3JAMK 1GR1A 1YRNA 3OZWA 1HKSA 5HVQC 1ZUNB 3FBNB 2VFMA 2I5UA 3F8MA 1WOSA 3JRHA 3KP2A 4BGDA 3LA3A 4RA2A 3S1RJ 5FO1A 3FXRA 2CW5A 3KEYA 4A3EJ 5ICGA 3S14J 2Y31A 2R7DA 5H2FC 3HOYJ 3PQJA 4A3MJ 2XF7A 1QQIA 1PJ5A 1W7PB 3RIQA 3KZIC 1MBGA 5F6FA 2B0RA 2JN9A 2V1DA 2VC0A 3ONQA 3OYEA 2R5YA 1R36A 4NBQA 2HTSA 1E3XA 4HIZA 2KIMA 1SFUA 2VN2A 1F4KA 2HDCA 4U0YA 2VUMJ 1KGSA 3MZYA 2BOLA 4LBWA 1JKPC 1V0EA 2QY1A 4KT6A 2PYGA 5IYWA 1MDMB 1SFXA 3SUCA 3FKJA 2E35A 5DV5A 2VBZA 1ZREA 5IT9Z 3FM3A 3ZGKA 2A6TA 4ON0A 1B23P 3ZZ0A 4YAFA 2KQRA 2E36A 3BG3A 4QHYA 4DJAA 1M90D 4HX7A 2PJRA 4YIIA 2LBFA 3E5UA 1EFUA 2F1LA 1VQLB 5K1YA 5F64A 3E20A 1KK2A 2I8DA 1Z0XA 2RNGA 2QDXA 2DU9A 3MKZA 3EPZA 2IS6A 2VZLA 1LNWA 1XG1A 2RKHA 4MIMA 3WNCA 3VR6A 2F3LA 3JX8A 1IXSB 3KLOA 3OYNA 4OJOA 1VTNC 3JRCA 1IN5A 1NG7A 1U78A 3H3VK 4XRSG 3WU2C 4XONA 5AIPA 3S32A 4WWVA 1TVCA 1U9OA 4RDJA 4OP7A 1F43A 2BHYA 2NS7A 2X1EA 1N06A 2VJ4A 2ZZQA 1LM1A 2DYRH 2ZFWA 2M4KA 2GIZA 2DPUA 2GOMA 3OY9A 1LLZA 4IO9F 4YZXA 4ZZLA 5C4JJ 3O2PE 2ELKA 2Z1DA 3PUMA 1P7JA 2MLGA 1ETKA 3AG4H 1B4AA 4LC0A 4OIOF 1O7LA 3H92A 1FBQA 2F43A 2ZITA 1GT0C 1IJWC 3G1LA 4DIQA 3M8EA 1SFOJ 1REPC 5CLSA 2Y0SA 2W48A 5E1ZB 3A8JA 1IC8A 4JX4A 1GAWA 3X2QH 2BM1A 2WBMA 1J2XA 1MSEC 3OJXA 1W2BB 2QZAA 3KCCA 5FLXK 4KT5C 3W2WA 5LRRA 5FD5A 5EYRA 4XLFA 1E1RA 1QVFB 4URRA 3GEZA 4BY7J 1BX0A 1QFJA 3GTQJ 3WTZA 1VF9A 1S72B 4FTHA 1J5YA 3C2HA 4WZLA 1FP1D 1M1EB 2WZNA 3OL4A 3AGPA 3CJTB 4PJ0C 3SZGA 2V79A 2UV1A 1P7IA 2X0LA 3WTYC 4L9JA 4E7KA 4OAZA 2BM6A 5KW9A 5L3GA 3GVKA 2DJIA 1E3OC 4W97A 4YFNF 1VQOI 3QWLA 3B78A 2XUBA 1AHDP 4WXCA 2R9VA 3EUAA 3JW4A 3KIOA 3ZN0A 1MSFC 2MYSA 4AVZA 4K2EA 3CCUI 1MH4A 3H0GJ 1FTTA 1UD6A 4B1RA 4LLGF 1H85A 1UD8A 1DDIA 3PUNA 3FHZA 4PC3A 1FY7A 1X58A 1FBSA 4QLCU 2ECBA 3RYRA 2VBXA 2PMDA 4CYCA 1LLWA 3K4LA 1LE8A 3KP6A 4UUSB 1BLIA 2O03A 3K4NA 1U5TC 5ILVA 2D74A 5GTIC 3PIPF 2PMZN 2DLLA 5LRSA 1LVAA 4ANJA 3EETA 3WE2A 1EP3B 3GFLA 2EILH 3CCMI 1MBFA 3DTIA 3KZYA 2NXNB 2M7BA 2BN4A 1IV8A 2ZBUA 2P3MA 2VKHA 3BCAA 2OU2A 2ZFUA 4A93J 1GAQA 3OEHA 4JOMA 5IK2A 1UB9A 5D6EA 3H5RA 3F8BA 5ILSA 5K5QA 1PUEE 3Q6QA 3ZUGA 1FYKA 4HLYA 1O8FA 4P1VA 4WK8F 1VQ6B 1X2NA 4Y9RA 3ABTA 3GZ6A 4ENNA 2HCJB 4B3GA 1D0ZA 4HV5A 3W2HA 4N4OB 3OYJA 3RJPA 2A6EF 1EP1B 3HGYA 2M8EA 1DU0A 2RC5A 1B1BA 4KMUX 3N97A 3I56B 3CCLI 4P26A 4RAFA 4ZYEA 5M3FJ 1HDDC 2F5DA 2CUZA 2A5YB 1TWCJ 3AVWA 3CJNA 3E3VA 2VKDA 2STWA 1VQ8I 3K70C 1QRBA 1S8NA 3S16J 2O0VA 2DODA 3EQOA 2K9MA 4OMYA 1H0MA 1BMFA 3QAHA 2GJPA 4P12A 1R1VA 2ODLA 2WA0A 3GZNB 3RZOJ 2VBVA 1P2FA 3IHUA 2K9QA 1WKMA 1D1CA 3UKGA 4AVPA 2H1KA 1FNBA 4E70A 2XGDA 3OL3A 3F3XA 2LOOA 1BC7C 2QQAA 2FXAA 1R5BA 3VPRA 2XT2A 1SD6A 3IWFA 3DPTA 5TISC 2BGIA 1O3QA 3N6ZA 2NNNA 4UVAA 2XOKA 3VNVA 1B59A 1OB0A 2KDOA 4TKOB 1I1SA 3HPGA 4M3EA 1T38A 1SANA 3FISA 4XORA 1I3QJ 1IA5A 4HA8A 5DUKA 3OYDA 1SKYB 3F8CA 2HQRA 4HNVA 1ETVA 3G6EI 3Q5FA 2NTBA 1T56A 2E1NA 1ZAOA 4HX4A 3IUOA 1L3LA 1MNMC 1F60A 1DBOA 1R1TA 2XPWA 4IOCF 4C2UA 5DTDA 1K9MD 3CCVB 5J4YA 2V5IA 1BR1A 4IL6C 2FSWA 1D3YA 1B8IA 3LQQA 1YX2A 5EEGA 1EA0A 2E1OA 4M71A 2R7SA 5FFZA 3DEUA 1QUEA 4KISA 1WJ5A 1DU6A 4KKUA 2VYQA 3P26A 1OPCA 3OYKA 4IF4A 2DFFA 2CUEA 1XD7A 4JX5A 4E7IA 1NRKA 3JU4A 3GFMA 1Z1DA 1QA1A 3ZZTA 2DMUA 3PSFA 5HXBA 3ERED 2QBYA 3VFZA 4CCMA 1PJ7A 2JA2A 1MJBA 3HOVJ 3PO3J 2HLDA 4MYUA 1QU3A 2XNJA 1QVUA 1VI0A 4HBLA 3BG5A 3SHFA 4EJVA 1XC5A 3PNVA 2RREA 1OCRH 1SVOA 1V55H 4FHTA 3CF2A 1O7FA 2FBKA 5GAGJ 2YX4A 2ZNYA 2K9NA 3PNYA 4A5NA 1R5HA 1OYIA 1WH5A 2F5EA 2ZBKA 4FETA 4XKBA 3HOSA 3L2VA 5IT3A 3L2CA 4Z05A 3PFYA 1JTAA 4C0SA 4PGHA 3H3UA 1R58A 2OCCH 1QHGA 3FPKA 5HOOA 1JB9A 2OD5A 3CC2I 2ZMEB 1J75A 3TP0A 4PSXA 2VLAA 1ON2A 1Z05A 2QE7A 1WI9A 3WTUC 3ZSCA 5CYVA 5DS0A 4NHJA 1UD4A 4Q47A 2LRDA 4LG0B 1G3SA 4L8JA 3OW7A 1RESA 4ZGNB 2E1RA 1F1ZA 2JDIA 1YX3A 3W5HA 2VFOA 5JI6A 4AIKA 2VFNA 3HKZN 2FA5A 1PUFB 1ZGWA 1Q1HA 2GQFA 1OFLA 2F6CA 2K40A 1U2WA 2O04A 1MBJA 4JYKA 1Y1WJ 1EV7A 1QBJA 5CVIA 2FRHA 3RTRA 1HBXG 1IGNA 4PJJA 2P4WA 2VT2A 1EH6A 2B9SA 1XS9A 4RD1A 1R5ID 4LOCA 2F4MB 2BV6A 2Z6BD 3HUGA 2VBEA 5FO0A 3LSHA 4B3FX 2D2WA 3BTJA 3VMVA 4UUTA 4QPOA 2E5NA 2XZLA 4ZJZA 2V6EA 1TNTA 1TWHJ 4OIRF 1U0JA 1H9TA 4BDZA 3KYDB 3OJWA 3ZQHA 1HKTA 3PJRA 3BWGA 3WTWC 1R9TJ 2O9LA 1H88C 1QQ1A 3G4SB 1VQ5B 3CCQB 2Q6IA 1S4MA 3W2IA 1W1WE 3JRGA 1ELOA 3VB2A 2O17A 3GQAA 3CRZA 3V7AA 2LF7A 5LGUA 3S1NJ 3B6CA 3I59B 3QP5A 1NJID 2FNAA 2JIZA 1VQKB 2VNKA 5TV2A 3KEQA 5BMZA 4FX0A 5C4XJ 5KCMA 3Q3SA 1SEUA 4J0QA 1VBLA 4NQWB 3RQ4A 1OCZH 5FKNA 3MKYB 4OOSA 4X8IA 2IOUG 4DK1A 1R1UA 3B6AA 2E2HJ 2XZPA 2HYFA 4AC9A 2TRTA 3V8LA 2V7XA 3B02A 3QPLA 1KCCA 1BOAA 2KLOA 4JP0A 2R7WA 1N08A 1AMOA 1FX7A 1KYZA 2FBIA 2GJKA 2AHOA 4N3GA 2V9PA 5DCMA 3SZPA 4A3IJ 5BNGA 4FWTA 4YAWA 4JX6A 1K78A 3BJOA 3BP8A 3ZR8X 2IEKA 3BR3A 4KNYA 2MH9A 3CMAI 1BIAA 4C30A 4NC6A 1MBEA 3EUHC 2VBUA 3GVAA 2WB1N 1FJLA 1ETOA 1A31A 3CB4A 1AA7A 5EGOB 3ZBTA 1G3WA 2DCEA 3TMOA 1QVTA 3QOPA 2JA8J 3ASPA 2MABA 3KP4A 1S7EA 4BBRJ 1LVKA 1HSTA 2OF7A 3OZVA 2DA1A 2FE3A 3WNBA 1N05A 1FEXA 4HLXA 1ZR4A 2L9RA 2A07F 4HPQA 1VQMI 1VQ4I 1EFTA 2RQQA 5GV8A 4KIFA 2KZVA 3DEEA 4F3QA 2B63J 3D1NI 3A3GA 4P22A 5L3CA 2LVSA 1VNDA 1WSRA 4NC8A 1B2RA 2FEZA 3T8TA 1R23A 3OIQA 2HQNA 2E2JJ 2NZMA 4M9XA 4L0YB 1V5FA 3WHCA 3J81K 4TMZA 1PDNC 2OK7A 4LMYA 3BY6A 2V7VA 4PCQA 4UB8C 2G0YA 3ABMH 2Z2SB 1IZ1A 1P4WA 2DO7A 3I0TA 4C2LA 4Q5SF 3HG9A 3KP5A 3ASQA 3CD6I 1WMRA 3E5QA 2BV3A 3LSJA 1MMDA 2KZGA 4M3FA 4CUGA 3HB9A 1F36A 5ICCA 3FY3A 4HE5A 4OPWA 2QSHX 3ZPLA 1HA8A 3J80K 5IYDJ 2P7VB 3VMWA 3EDPA 3CTAA 3ZPPA 1RPWA 5DD8A 5E6TA 2K86A 1ORKA 4WWCA 2PYHA 2RGVA 3F9KA 2NYXA 5DM6F 1B72B 3DBRB 5E1WA 4ZDLA 1S9HA 5M3MJ 2GLOA 3IV5A 2DT7B 3ZMZA 3QE2A 3R6KA 4I09A 3I5UA 2TCTA 2L4AA 3DBHB 3LNQA 3P4GA 4OZZA 1YYVA 2YU3A 3M8FA 1IN7A 2OTLB 2CS3A 2HZDA 1U6GA 2L7MP 2D45A 4QFMA 3H9GA 4M2LA 2FOWA 1QJVA 2PJPA 2FBHA 3K10A 4IW3B 1T5EA 1LJ9A 3B73A 3DBLB 4ETSA 1K61A 1APLC 1DUXC 1X1AA 4LIUA 5FLXZ 2ESHA 4CCLA 1EJ9A 2EH3A 2Q2EA 3F6VA 3JRFA 5JLXA 1VQ7B 1F5TA 1HF0A 1DGRM 4LD5A 1SC7A 2NVTJ 3IKVA 2DJNA 2R7FA 1MKMA 2R5ZB 1D5YA 3GIRA 1XSDA 4DGWB 4WX9A 3CCJB 4AF6A 1FTZA 1JUMA 4EM0B 4BHCA 2LK2A 4O5VA 1OCPA 2LC2A 3IH2A 3B8HA 2BY2A 1N78A 4V2FA 3WNDA 2YX7A 4KA4A 1HW2A 2OJED 3RDIA 3GTPJ 5D5VB 1SFKA 1XDSA 3BPXA 4ASNA 1QZEA 1T39A 5LGTA 4XR6A 5HNFA 2F48A 1BJZA 1BI0A 1X3WB 1OCOH 4Y9UA 4MR0A 1YFHA 3RIRA 3DTKA 2OC6A 3JRAA 2P0WA 3K4KA 3AG3H 1E3PA 4ZV4A 4GGGA 5DEQA 4DK0A 4R8HA 1YLOA 2GXBA 3GTLJ 3W2EA 5FKLA 4B09A 1ZG3A 2CQQA 4MLOA 3MD2A 4MNUA 2G7UA 4CCJA 4BDYA 5IY5H 4BE0A 4JMQA 1MW7A 2XAFA 4L5EA 3W2VA 1ZG5A 1R5OA 2BF4A 1QZZA 2NT9A 2BY3A 3PQKA 3CUQC 2XRNA 3I64A 3F6OA 3K6GA 3H0DA 1TYUA 4NK8A 1IRGA 5KK1A 4XM3A 2O7OA 4YRVA 3OV8A 4RGSA 3OYHA 4GFBA 3A3BA 1S7OA 1AOYA 3J7AY 5ED4A 2X1CA 3ZXSA 4TT3A 2G0EA 2C4TA 2NPFA 2XRLA 2DPDA 4GRIA 1SAUA 1I8DA 2BM7A 2D1HA 1N75A 3HOXJ 1TTTA 3BC9A 3OYIA 5FB2A 3AG1H 2CO5A 1Z7LA 2R0QC 3LAPA 2CRGA 4BH9A 1XPXA 4X05A 1O8HA 4RD3A 4F52A 1YI2I 3SEJA 1DP3A 2RAEA 1GV5A 2ETHA 2P6SA 1XGMA 4DBQA 2DA2A 2WAEA 1X1CA 1J7KA 4W1UA 3QQAA 3GTGJ 1YIJB 2MGQA 2IAIA 2Y48A 2WC2A 2BW3A 4R71A 1V0FA 2J7KA 3OR2C 5HODA 2JSCA 4RAGA 5KAFC 2GWRA 4BACA 2CV2A 3MMYB 3N90A 3DU5A 1K79A 1T08B 4I84A 5LHHA 9ANTA 1S3JA 4DNTB 1E3HA 1G7SA 2CQNA 2JJ7A 1M1KD 1Y0RA 2MD0A 1OFCX 3E97A 2ME0A 3HBLA 2X6WA 3REOA 1R4MB 4OPVA 4X7CA 1J0RA 3BC8A 3ELKA 3U6KA 4L0ZB 5KVRA 2LP0A 3BY1A 3HTUA 4MGRA 1TWFJ 2P8TA 1JUSA 3BNWA 4P6YA 4AUXA 1NB0A 3BZKA 4HQMA 3CMEI 3BT9A 5D4SA 4IHYA 2M45A 2EFGA 2ZTNA 1KD1D 2MW8A 1TYVA 2IA2A 4XOPA 3SFZA 2K9LA 1HA3A 2FX3A 2Q6OA 4B4DA 2OQRA 1Z9CA 3OKXA 2QX3A 3TDZC 5JHFA 1WGXA 4A2UA 3PSZA 1ETXA 4JK1X 2QA4B 1EZGA 2VI6A 3UNGC 5GPCA 2K4BA 1IAWA 4AIJA 4XICA 3IH4A 2IGMA 3KZZA 1HW1A 1SMYF 3M1EA 3VMFA 4BUPA 1BI1A 2QLZA 4DBRA 2BPOA 3WG7H 4TMWA 3LSIA 1RKTA 1ZLJA 3A02A 2XZOA 4O6JA 4IRGA 3Q9VA 3AVVA 1QA3A 1KZLA 1Q7YD 2BVLA 1F9NA 3EYIA 2K27A 3M3YJ 1LFBA 2UWMA 1E2XA 1WVRA 1VZ0A 3S17J 1PJ6A 1AIRA 2G7HA 1I1GA 2DFIA 2HQ5A 2VIXA 5B66C 4A12A 1MIJA 3OYMA 3U6BA 1XX5A 2ZL7A 2O6WA 1HSJA 3NAUA 3CLOA 3RSNA 1S72I 2X6YA 4RDUA 1YJNB 3OS1A 4RB2C 5D5UB 5DD4A 3SDBA 5E8IA 2CF4A 3K4JA 1VHOA 2W6IA 4RLFA 4I01A 4N3NA 4EMSA 2JVGA 1MMSA 5EZHA 2OBSA 2V7QA 1LDDA 2PEXA 3NRVA 3DEWA 4UB6C 3A1PA 4YZQA 4XLEA 2ZO4A 4IZZA 4E7JA 3NB2A 3VNUA 3LQEA 4CCKA 2NAZA 1V3FA 2PIAA 4MEYF 3E6BA 2P5LC 1G7CA 1J9ZA 4QV2A 1FC3A 4AIDA 1WSUA 3CCRB 2XTWA 4LK1F 2BE5F 1LQ1A 4XN3A 1GDTA 3BR2A 1VF7A 3CCEI 4YAOA 1GVDA 3OR1C 3WHBA 2HOEA 3GFIA 1N0VC 5FJ8J 1NH3A 3ES9A 1N77A 5LHIA 3FK6A 4BEHA 3L2QA 5IYBJ 4GYIA 1UG2A 4V02C 4X7EA 3AL0C 2P7CB 1ZGAA 1WOOA 2RN7A 1G3YA 2VNIA 1EFCA 1JTXA 2BVMA 3V76A 4B44A 1HW5A 3VYUB 4WCGA 1HKQA 3SQVA 3I59A 3KETA 2G9WA 3OOUA 4K1XA 4ROXA 3FX3A 3CDLA 5ICEA 3Q6RA 1S6LA 3IC7A 4NQWA 1FMWA 1YOVB 3M4OJ 1QA6A 3OEEA 4RDKA 3DFGA 1COWA 2ZXJA 2GK7A 2CRVA 2VBWA 5F4OA 1AIPA 1YW8A 4IRIA 3BQZA 2Y2ZA 2H6CA 2IBDA 2OUMA 4C43A 5EJCA 2ZCWA 4FK8A 3AFHA 2E60A 2BM5A 1YW7A 1LUJB 2WV0A 4XMYA 4ZH4F 2XSJC 4H0EA 1NB9A 3KLNA 1P4AA 2NS0A 1T98A 4U4BA 3O6BB 1Z7UA 5F1RA 1V5VA 2A61A 2QN6A 3E6MA 3JSPA 2DOFA 4M9ZA 2EFWA 2K3FA 2VJ5A 3H3ZA 4KIGA 2R7UA 2A05A 2V1XA 1W7PD 1IDJA 2F4OB 5FROA 4Y15A 1MMNA 4P9UA 5EMNA 5J47A 4G94A 3TGNA 4EGZA 1ETQA 3I4PA 3ERMA 3DKWA 3A2KA 2M34A 3DDYA 1O8KA 1PLUA 3CLQA 1R5GA 4G9YA 5JVGF 2KL4A 1BX1A 2D3LA 3G71B 1FNNA 1QRYA 3OYBA 4Z4TA 4BHPA 1BW6A 2DI3A 3GQ9A 3F0CA 3BOQA 2X48A 3V7SA 3GFJA 4EM2A 1QX4A 1J9IA 5L3EA 1L1IA 3MQ0A 2DQRA 4HZFA 2NVQJ 3I4NJ 3MCAA 1A6QA 3GLLA 2COMA 1VQ9I 3DU6A 1HLVA 3MN2A 1P6RA 3A01B 2X3UA 5E3LA 2E1MB 2HU9A 2ZJPF 4XOTA 2KRCA 4KH3A 2EFPA 3SYJA 3KYCB 3K4BA 3KP7A 2HQAA 1NTCA 4BYYA 1RUOA 5IYQA 3VSTA 1NBMA 2KDZA 3CC4I 1G8XA 2LF8A 4IVNA 2UZKA 3AGQA 3DKXA 2HKXA 1FX0A 2L2OA 1CNEA 3A8IA 5HS9A 4M0LA 1Y39A 2HOAA 4E7ZA 2VFPA 3GX4X 2CFXA 4LLLA 1R22A 2IW5A 1X0CA 3T53B 1L0OC 2W85A 3F8NA 4A5MA 2W25A 2V7UA 1USSA 2CW8A 2Q0OA 5EG0B 2R7XA 1OISA 5CKTA 1YITI 4PUSA 1LPQA 4KDPA 5F0FA 3ZZUA 3TKYA 1TQIA 1AU7A 4PGOA 2V1UA 2WYRA 1H42A 2H94A 2JN6A 2XASA 4CHUA 3HGGA 4CSWA 5LBQA 1IDYA 2C5BA 2VQLA 2Y9ZA 2NTQA 4DZPA 1D1BA 2O8XA 2Z5UA 3LA2A 1IJFA 2QKMB 3SFIA 2XGEA 3HSEA 4CZCA 4ZDOA 4PABA 1YJWB 5GP9A 5D8KB 3HPHA 4Q48A 2HWVA 4C2TA 1KU9A 2EV6A 1DGWY 2O5RA 3VYTB 2HYGD 2ZZFA 2M0CA 4A3FJ 3U9GA 1D0XA 3H09A 1O3RA 4Z6YA 2LKXA 3PSIA 4A3JJ 2ISZA 2EZHA 2K7LA 2KJCA 2X51A 2V1NA 3S3OA 1FZPB 1N0UA 4DZJA 3J80Z 5J1UA 1K4SA 1WSVA 2W00A 2QGUA 4Z4SA 2VBTA 3M8JA 1RMGA 3CZ6A 1TYXA 4U7BA 4RDLA 3DTEA 4XD7A 1ODDA 3LL7A 4M6VA 2DYSH 3ECHA 2CQXA 2VC1A 4I6ZA 4ESJA 1WQ2A 1WPKA 4OU0A 1AKHB 4YIFA 2A3SA 2DA7A 5F04A 4DYCA 1Y1VJ 2NSTA 1E0EA 2KIQA 3P27A 4KKSA 4AYBN 1MNDA 3VO2A 5K5RA 2QCOA 2BVNA 3VSKA 2JRTA 2EIXA 1WJEA 4YAUA 3LQRA 4BQAA 3G3ZA 1YJ9I 4IHXA 2IS4A 1EH8A 5H6QA 3DPUA 2C77A 1ZELA 5E3NA 3MHPA 3HDDA 1XB4A 5J1RA 4M3BA 4ZCMA 1W5SA 3T5XA 1V5EA 3FF5A 4F92B 3DCFA 1RRJA 4I2OA 1KYWA 4NK6A 2CYYA 1JJ6C 2XPVA 2CV0A 1FBUA 2MSYA 3RKYA 3RKWA 1VQPI 1O8GA 3OOCA 2M8GX 1YX5A 3MKLA 3GBGA 3ZQCA 3WY9A 5E8GA 3ZMSA 1ZM2A 4WZKA 2Q8KA 3NARA 3BJAA 5CVJA 3V8KA 3HJEA 5JHUA 2BXZA 1O3TA 4G7OF 3ABKH 4BNCA 3LVBA 3S2HJ 1PXZA 3BH4A 1K83J 3F8FA 2QQ8A 3B90A 4WF2A 3Q0VA 3L09A 4L9NA 3PO2J 5HKKA 4Q7JB 3T51B 2KFDA 1BJAA 4PZJA 1IDKA 5EF6A 4OPSA 3P9IA 2H1LA 1PJRA 1X4OA 5FNZA 1VQKI 3L7WA 4CICA 2XPUA 1ENHA 2VPRA 4XLNF 4QVAA 2GBYA 3F23A 5A89A 3Q9SA 1XN7A 2ZTGA 3HC7A 4RD4A 2BGCA 4Y7CA 3LMMA 1O88A 2XTXA 1KU3A 2XGCA 2F2EA 1K7AA 5E17F 3MAJA 5ILUA 4I99C 4RLZA 3WU1B 3OYGA 3FMQA 3W5UA 2H8WA 4XSXF 5A2QK 2M5SA 2L4MA 1Y6IA 1TT0A 1RKWA 3OSFA 1OYYA 3DU1X 4BE2A 3KPHA 1IHMA 3KYLA 2F5CA 5IOZA 3L2UA 2LMDA 2WJVA 1LB2A 2D5VA 4IOAF 1JXSA 2W24A 3BCBA 2GZWA 5L3FA 3ROUA 4XLAA 1I3AA 1T6YA 4E7HA 1I27A 4ZCIA 3GTKJ 4Y13A 4E4HA 3QFTA 4ACAA 2UUZA 4LIVA 2XGJA 1JGGA 2EV5A 2VBSA 3CP8A 4FN5A 3BPVA 4G7HF 3W2GA 2J8KA 1DPRA 2CC2A 1ZN2A 4LB6B 2LY9A 2OZ6A 1ERDA 3WODF 1WDTA 2WY7Q 1VQOB 2EQRA 3MCZA 3R61A 2L7KA 4UV9A 3BLYA 3VDXA 1V5GA 3R0AA 4A3GJ 2Z3YA 3EYYA 3K1MA 2EIJH 4KIBA 1Y0UA 3I71A 3E5XA 3SJZA 4LITA 2DTZA 1YE9A 1R49A 3ASRA 2XC7A 1A35A 2DMNA 5L3BA 2XV4S 3CCUB 4OZYA 3FXOA 4YZ0A 2P81A 4BE1A 1OYWA 2DK5A 3GLXA 3HOUJ 2V7WA 1CZFA 1WHUA 1OR7A 1ON1A 4Z4RA 3P5JA 4QTRA 3IRQA 5F4JA 3CCSI 4YHBA 1UELB 3ZBUA 2VBYA 4M6XA 1FLIA 3NWSA 1O4XA 3SQNA 2XSDC 1JKOC 1FSHA 2VQCA 1BBYA 3FWEA 1GQ8A 4EQQA 2WJYA 2NVYJ 1RU4A 3VODA 1R00A 1TWGJ 3TOBA 4YXWA 1Z3XA 3G05A 3PM1A 3L1PA 1O8EA 3GCMA 1KONA 3C3WA 1CF7B 2OV7A 5IYRA 2Y0SN 2LZJA 3UR3C 3OZUA 2IPQX 4XKWA 2XT4A 1SVMA 1T6SA 3CO7C 4XBFA 1R4NB 2FUG2 1N07A 4UAJA 2JJ1A 4E0FA 1OGJA 4CDGA 2EIMH 4F7ZA 3CCLB 1U5TB 3RKQA 4Y52J 1DARA 3JQQA 2HZTA 1KTVA 1BJKA 1JKQC 4BXFA 1GLNA 1D8JA 3BR6A 1VQ8B 3FM5A 5B1AH 1KU7A 4RB1A 3PUFA 1W7PA 2X6OA 4XKCA 3JREA 2ZSHB 3ASSA 2RC6A 1QA2A 4IHSA 2H8RA 2VASA 2LY2A 4UV8A 1CGPA 1QO0D 5IT9K 2YWHA 5F0CA 1OGMX 5BS6A 3GTOJ 3DPLC 1YRNB 3D0SA 3RYPA 2IGKA 4PFOA 5JFRA 4CH7A 3SXYA 2L5QA 2CV1A 1MDMA 4BXUA 2CUFA 2UXNA 2ZXWH 4ZTJA 2QEXI 3KRGA 5LHGA 2VNJA 3ZRGA 5KAIC 4P6VF 2VBKA 4BS9A 1Z77A 1WTHD 4ZC3A 2W4SA 4BKXA 3JSOA 1IB0A 1S29A 3JAMZ 3I55I 3HM5A 1EFRA 2OQGA 4PJNA 2I1LA 3IP4B 3SEQA 2R5YB 1KQ8A 3C2GA 2CNDA 4RM0A 2EK5A 4EVIA 4B3AA 1E63A 2ZZGA 2M3AA 5HS7A 1EWYA 4U9UA 2XVCA 2X8KA 4A0YA 3GRHA 2MFZA 3LO8A 1G6NA 2OCEA 1DPUA 4E6KG 3CJQB 2E2IJ 2GPJA 1OKRA 2YUSA 2DYIA 4HYEA 2L9SA 1W9XA 3HRTA 3MZHA 2W6JA 5IYPA 4W8SA 2PJRB 5CVRA 1W0UA 4TSFA 2X0KA 4RJLA 4GO1A 2XC1A 5FKKA 1FT9A 3JR9A 1Y8RB 1MH3A 2AXTC 3MFKA 4GYGA 2EB7A 1ZRCA 1QGAA 2WR8A 4LBYA 1UFMA 4CCNA 5K5OA 1O57A 4M74A 4PSWA 1XDUA 5E79C 5GAEJ 2VE9A 2D3NA 4KICA 4CA0A 1SMTA 2Q6LA 2OBTA 5C3EJ 3GO5A 4L5IA 3A01A 1W0KA 1BM9A 1MJAA 3LMWA 2JT1A 1Z3YA 4IKFA 1NHCA 1UG0A 1FIAA 2V26A 2DDAA 1XFOA 5D8LB 3ZN1A 1P4MA 3OYFA 2WAFA 4RCZA 2XKPA 4NB5A 5C1CA 4NNJA 3WYAA 2DDBA 4RAYA 3VOEA 1Y56A 4EJUA 3W6JB 3JCUC 4IHWA 1BIBA 4XLCA 1GVHA 3A8KA 4A3CJ 4M4SA 5TJJA 1UJ8A 2IS1A 2ECCA 1RQRA 3HRUA 3CC2B 1LFUP 3TQNA 2DFEA 1XMAA 5EDNA 4BJ6C 3V7CA 3BY2A 3CC7B 1G7RA 5EG0A 1IN4A 1OR7C 4HNTA 2ZC2A 2KHMA 4PJLA 2MC3A 4M72A 4XK4A 1GO2A 3BZCA 2RNJA 1UZCA 4C2MJ 2OTJI 3ISXA 4S05A 4E7SA 1NHAA 3V42A 1WZ2A 3ML6A 4G5GA 1BI2A 1U9NA 2WAQA 2NRAC 3H9JA 3OSGA 4I0BA 1XMKA 5C44J 2AS5F 3CESA 4FCYA 3PL8A 2NVUB 5FIUA 3WXMA 4UUSA 5DDGA 2BY0A 4AU7A 3AAFA 2LR8A 5DS9A 3S2DJ 2INUA 1LKXA 4YFKF 1ZARA 3WTTC 1HOMA 4X06A 3C1DA 5IP7J 3L9FA 1BQEA 3QFCA 4RS8A 1SFEA 4A6DA 1YO5C 2JTVA 2XAQA 2XAUA 2VONA 4II3A 4EJWA 1OB2A 2EBIA 4L9TA 2HI3A 3QYBA 2O1DA 2R4GA 1ZHFA 3F72A 2NV4A 3DP7A 4MEXF 1A36A 1DG1G 5H59A 1WH7A 1LE8B 2RVCA 2XTYA 3B4NA 2JRMA 3B8YA 3T8RA 1BN8A 2WWYA 3RPQA 1TWAJ 3ZOBA 1IG7A 1JE8A 4QSHA 2A6HF 1OCTC 1BOBA 4MFEA 1H9GA 1TW3A 3FK7A 1AWCA 1SM4A 4G7XA 2EFOA 1ZR2A 5D5WB 5AMVA 4PGGA 2LD5A 1FYMA 1VQNI 2ISYA 4I7HA 4IRHA 3AVYA 2R3SA 4G6TB 2NT6A 5ICFA 2LFBA 3TBIA 2INVA 2JMWA 4DNRB 2L02A 1R71A 3ISPA 3GVJA 2W7ZA 2M0MA 2XEXA 4IEJA 3PA1A 3HAGA 5HLIA 4QIWN 3AKZA 4IJAA 2AO9A 3CMAB 4IQ4A 2HDNB 5FA6A 3I9V2 2WV1A 3CP2A 5M5XJ 1DDNA 5E3OA 2NTPA 2DIEA 3WTSC 3Q0WA 2X3HA 3V4GA 2C5HA 4HSRA 3LSPA 4S04A 2KVOA 2VJJA 3J7AO 2OYNA 2YWFA 1BC8C 5KNLA 4BBSJ 5JVTA 4FE4A 4Z2YA 3ZQQA 4R79A 2R92J 1FP2A 4CQJA 2FOKA 2CFOA 4ZYDA 3S1MJ 2IJLA 1EH7A 3PENA 3PIOF 2M1BA 1CQXA 3H36A 3FKSA 2CSOA 2VOOA 2BYVE 4Q4ZF 1GJRA 1PKVA 4X7DA 1VQMB 4BQQA 1VQ4B 1RUNA 3OWTA 1NDHA 1TTYA 4ITVA 1FOXA 2DCUA 1ZQ3P 1Y8QB 3AVUA 5CDFA 5CVUA 5TRDA 3HXLA 2DAOA 2MA3A 3CJRB 1TUIA 1E3ZA 4PC1A 2E5ZA 4XIDA 4BJTA 2VQHA 3TOAA 3FXLA 5CQEA 4C3HJ 1ZM9A 1QHHD 2HVQA 5JLWA 2A5WA 3TH0A 2F5FA 1D1NA 2C4UA 1UAAA 2KKOA 1E17A 3OE7A 1X1PA 1EP2B 4LBVA 4HW0A 1CLWA 2BSPA 4A3KJ 4LBZA 4YELA 1VQLI 1POGA 2KRFA 1H89C 5A8AA 1D8KA 3ML3A 3BR1A 4U88A 2M5WA 3ZPNA 3GF2A 3H35A 2X53S 3KX2A 2AQEA 3NWTA 1PYVA 4ZGQB 1B8IB 4KN7X 2WADA 1MMGA 4RBOA 3FZVA 3G2BA 1KJZA 2B5OA 2EFNA 2PMZA 3J7ZI 5LMZA 4G8XA 3VSVA 3PETA 2V7FA 2E19A 3BH6B 4B8XA 1H80A 4TMXA 3S1QJ 3ZC3A 3WE3A 1UHSA 2ICWG 4U0VA 3S3MA 3NQOA 2EFQA 2C6YA 1FSEA 4FXUA 5F4MA 3A0HC 3D5SC 2EZLA 2L9NA 1IDZA 5EEAA 5KHDA 2XAJA 1XE1A 2QBYB 2XNDA 2CG4A 4CXFA 5GV7A 3I54A 4PDKA 3S2WA 3IAS2 3R6JA 3U2QA 1IXCA 1XCVA 1A04A 2ZMEA 3BQYA 2DY1A 2K3PA 2R7VA 4EH1A 1Q86D 3DXJF 1HQCA 4KMFA 1WJFA 1T95A 2LG4A 5E18F 5B3SH 2WSSA 2OAZA 5FL7A 2VXDA 4LG0A 3JTGA 1V54H 2LDUA 2Z9OA 3M7GA 3RZDJ 4MQVA 1KK1A 4DQ2A 2O6GE 1P9QC 3QFSA 5A88A 4ZYHA 1PUFA 3ZMVA 5H5JA 3ZIAA 4IX7A 4DYQA 1TLHB 2FJ1A 2BZTA 5ERIA 1ZM3A 3BROA 1TBXA 5E20A 4OIPF 4L9VA 1UD5A 1JJ8C 4UVCA 2XB5A 1S5LC 1R6RA 1S7AA 4HX8A 2N8GA 4I98B 2VJIA 4XRSA 3TO9A 2GXGA 4BHBA 2E71A 2DW4A 2NNYA 3QP6A 2DMQA 1E43A 4PAAA 1DBGA 2HVRA 1WFXA 2FD5A 2QZ8A 4WXHA 1FOKA 1D5VA 3LSGA 3OPOA 4L5JA 5HDGA 3VYRB 1OHHA 3FXJA 4D5FA 4Y7NJ 5L46A 1BW5A 1TC3C 3KEOA 5LLQA 1OB5A 2DQLA 1FOWA 3ZMDA 3LNNA 1JNYA 2JPBA 4A3DJ 4XNFA 1QFZA 4A3BJ 3J7YJ 2HGCA 2M30A 4MQ9F 1EXMA 3KP3A 2JSPA 3BG6A 2FMYA 1O3SA 4LB5A 3ABUA 1VLYA
chains in the Genus database with same CATH topology
3DPUA 2CUJA 1ZELA 2W7NA 4B43A 3PUBA 3TL4X 2O17A 3GQAA 2NOJB 1V5EA 4F92B 4HRIA 4Y33A 3BCDA 4NK6A 2MC4A 2CV0A 2JIZA 1O8GA 4D9JA 3OOCA 4PJMA 5KCMA 2KMUA 1VBLA 4NQWB 3RQ4A 1YX5A 3MKYB 3GBGA 4FASD 1UD3A 1G59A 4DK1A 1BPLA 2XZPA 2V9KA 1JI8A 4H4KC 4D1QA 1KCCA 2UVEA 2KLOA 4OJPA 3W3CA 2R7WA 2GJKA 4B48A 1PXZA 3BH4A 3E1SA 5CQGA 3B90A 4JQFA 3ZR8X 4RMNA 5HKKA 4C30A 4KKTA 3T51B 1W0JA 1IDKA 3DKYA 3EUHC 4BQNA 4ZTFA 2V31A 4U49A 1AA7A 3MKWB 1PJRA 1X4OA 5CPRB 2DCEA 3TMOA 4XQFA 3OYCA 4C9YA 2MABA 1X19A 3DLAA 1LVKA 2DXIA 1O8MA 2ZTGA 3HC7A 3NE5B 3LMMA 1O88A 2VBMA 4W8QA 4J01A 4HPQA 2RQQA 4EATA 4Y3OA 2KZVA 3DEEA 4NC7A 4F3QA 2JUGA 3OYGA 2ZZEA 3A3GA 4P22A 3VYSB 2M5SA 3CMMA 3OAAA 4GQNA 2CW7A 1Y6IA 1TT0A 2E1MC 4NC8A 2X6XA 4BE2A 3VWBA 3KYLA 5FRMA 3L2UA 2WJVA 4W8RA 2PECA 3OIQA 2NZMA 1J09A 2EWEA 3EUKL 1V5FA 3BCBA 4KITB 5HLTA 1NG6A 3HKZA 2IXSA 4XLAA 3HL2A 2M7AA 3OS2A 4E7HA 2WZPP 5LD2C 4XN0A 2Z2SB 3WQZA 4HG2A 3QODA 4E4HA 2UUZA 4LIVA 3RCOA 2IS2A 2XGJA 4C2LA 2KPMA 3HG9A 1RWRA 3CP8A 1WMRA 3OYLA 1DQUA 2GOXB 2V4DA 1MMDA 1ERDA 4MXNA 2Z16A 1TZLA 4CUGA 3LSKA 3WWGA 2WY7Q 4Z03A 2L7KA 3E0JB 4XL9A 3BLYA 3VDXA 4ASUA 1V5GA 3FY3A 2JVHA 4OAYA 4X0GA 4LITA 1HA8A 4AYBA 4DOZA 1YE9A 1K28D 2Z8GA 2XC7A 4OZYA 3VMWA 4YZ0A 4F55A 1I18A 1QCXA 4BE1A 3ZPPA 3JURA 4KJZA 1CZFA 1BHEA 2PYHA 3F9KA 4ZDLA 1S9HA 1UD2A 1EE6A 3S8PA 2DT7B 4OZZA 1UELB 2HPMA 2GK6A 1O8DA 2LH9A 4RM2A 4BQOA 2CS3A 3NWSA 2CK3A 3KEWA 2HZDA 3BCFA 1OOCA 2ELJA 3H9GA 2R7TA 4B3XA 1H8HA 1QJVA 2VQCA 2E1BA 4G6IA 3K10A 1GQ8A 1T5EA 2WJYA 3S93A 3D5LA 1RU4A 1O8LA 1X1AA 4LIUA 4CCLA 2WPDA 4W8TA 4YXWA 2HVSA 1Z3XA 3G05A 1EA3A 2CH0A 2X85A 3I3LA 1O8EA 1K6YA 1DGRM 1KONA 2UVFA 2OV7A 3K4MA 2LZJA 2F5VA 3UR3C 2HPIA 1X1DA 4XKWA 4OJLA 1X4PA 3OS0A 4DGWB 2Q2EB 2LREA 2FUG2 4E0FA 2JJ1A 1VJSA 2WB1A 3FPPA 4YZAA 1OGOX 2LC2A 2F1MA 5LFAA 1O8JA 1N78A 3ZCOA 4CCOA 3HUGB 3FDYA 3OIPA 1W36C 1JRGA 1SFKA 1LDKB 1K5CA 3D5RC 4BXFA 1GLNA 2ZSIB 4XR6A 5HNFA 4BU2A 2R7QA 4B47A 4XKCA 5HVQC 3HOTA 3FBNB 4MR0A 2ZSHB 3DTKA 2OC6A 4BGDA 2P0WA 2VASA 3K4KA 4HEA2 2LY2A 3GQBA 2QY1A 4DK0A 2AQFA 4ZDPA 1IB4A 4XKVA 1BR2A 1OGMX 1WJCA 1WPCA 3KEYA 3DPLC 2XF7A 2IGKA 4PFOA 4ZYAA 4MLOA 4BE0A 3MD2A 4CH7A 4CCJA 1D0YA 2L5QA 4BDYA 4JMQA 1MW7A 3W2VA 2CV1A 4EW9A 3AL0B 2VQGA 4HWVA 4ZTJA 2NT9A 3OYEA 3ONQA 3K6GA 3KRGA 3H0DA 4NK8A 3ZRGA 2VBKA 4BS9A 1E3XA 4HIZA 2JJ2A 1WTHD 4ZC3A 2W4SA 4XM3A 2BOLA 4YRVA 2CMPA 3OYHA 3U21A 1V0EA 2KRHA 4KT6A 3A3BA 3J7AY 2PYGA 1EFRA 2X1CA 3ZXSA 4TT3A 2XDVA 4PJNA 3SUCA 3IP4B 4GRIA 3FKJA 3SEQA 1SAUA 3SEZA 1I8DA 1N75A 3H9QA 5DN6A 3BC9A 3C2GA 3OYIA 3ZGKA 2A6TA 2R7RA 1E79A 2KQRA 1Z7LA 4Y4RA 2M3AA 5HNHA 2ZZGA 1O8HA 4DJAA 2X8KA 2QXZA 2PJRA 2LBFA 1W36D 4F52A 2I8DA 2MFZA 2RNGA 3GRHA 4OJ6A 3MKZA 1DP3A 3EPZA 2IS6A 4E6KG 3CJQB 2ZXIA 3DQVC 2INVA 3VR6A 2K5CA 4DBQA 2L9SA 1W9XA 2WAEA 4QPQA 2W6JA 1X1CA 3OYNA 2M4GA 2PJRB 4OJOA 4W8SA 4TSFA 1NG7A 3VSUA 4XONA 3S32A 3M1CA 2BW3A 1LFPA 1V0FA 3OR2C 2X1EA 2VJ4A 2ZZQA 4CCNA 1WJDA 2M4KA 4PSWA 1H8EA 2D3NA 2GOMA 4BACA 3OY9A 2CV2A 3MMYB 4I84A 3DU5A 4YZXA 4CA0A 3EQNA 2Z1DA 4DNTB 2BW3B 1W0KA 1HVXA 4J00A 2MD0A 3LMWA 4IKFA 1Z3YA 2F43A 1WJAA 2X6WA 1UG0A 1NHCA 2V26A 4DIQA 5C1CA 3BC8A 2QKLB 2WAFA 2Y0SA 3PNTA 3OYFA 4BL0B 3T9GA 4NNJA 2VB6A 4Z1MA 2WBMA 1Y56A 4PFPA 2W1OA 4XLCA 3W2WA 1E1RA 2ZTNA 4XLFA 1XG2A 1HG8A 4URRA 1KTWA 4XOPA 4PMHA 2K9LA 2QX3A 2IS1A 5JHFA 4PK4A 3C2HA 4BJ6C 3UNGC 3OL4A 1OR7C 2IGMA 4HNTA 2KHMA 4PJLA 2HNHA 3SZGA 4BUPA 1PE9A 2UV1A 4DBRA 3LSIA 2ZXHA 2XZOA 4E7SA 4OAZA 4E7KA 3V42A 1KZLA 1WP6A 2BVLA 3GVKA 2DJIA 4E7LA 2UWMA 1X1BA 2WAQA 1VZ0A 3H9JA 2R9VA 3EUAA 1AIRA 3H5NA 2MYSA 3CESA 3PL8A 3VSLA 4AVZA 4HSTA 2VIXA 4AU7A 3OYMA 1UD6A 2INUA 1LKXA 3RSNA 1UD8A 2X6YA 3L2RA 3OS1A 4BJ5C 3SDBA 3A1YA 3K4LA 3K4JA 1BLIA 3K4NA 2W6IA 2XAUA 4RLFA 3T56B 4II3A 2JVGA 2V7QA 3QYBA 2O1DA 2R4GA 4ANJA 4YZQA 4XLEA 4IZZA 4E7JA 4F93B 3DTIA 4CCKA 2Q1ZB 2M7BA 1BR4A 3B4NA 2VKHA 3BCAA 2ZFUA 3B8YA 3OEHA 4JOMA 3L2WA 4XN3A 5IK2A 2IGNA 3H5RA 3W2AA 1VF7A 4YEJA 1BN8A 3OR1C 1O8FA 1BOBA 4G7XA 1N77A 5AMVA 4G7WA 4BEHA 3L2QA 3AL0C 4G6TB 4B3GA 2NT6A 1D0ZA 3TBIA 4N4OB 3OYJA 2DOAA 2BVMA 4DNRB 3GVJA 2HDWA 3VYUB 4B44A 2M0MA 3HAGA 3OOUA 3AKZA 4OJ5A 4BEHB 1O8IA 2CUZA 1FMWA 4IQ4A 3I9V2 3CP2A 4U87A 2VKDA 3OEEA 3K70C 2NTPA 2DIEA 2VL8A 2X3HA 2O0VA 1COWA 2KVOA 3QOEA 4HSRA 2GK7A 3EQOA 2VJJA 1IRXA 2K9MA 4P1WA 4RLQA 1BMFA 2GJPA 5KNLA 2ODLA 2OUMA 2WA0A 3GQ8A 3ZQQA 4R79A 5C1EA 1T0FC 3AFHA 2E60A 2CFOA 3A35A 3A4CA 4XMYA 3DWLE 1D1CA 2V4JC 2XSJC 3S3NA 3FKSA 3OL3A 3OFNA 1OFMA 2LOOA 1PKVA 3OYAA 4BQQA 4U4BA 3OWTA 3DPTA 4ITVA 2XOKA 1OB0A 2KDOA 4TKOB 5CDFA 3HPGA 1MMAA 4HNUA 3HXLA 4XORA 3CJRB 2WY8Q 1IA5A 1SKYB 3OYDA 2R7UA 2VJ5A 1E3ZA 2LBFB 1KCDA 1IDJA 2E5ZA 2NTBA 3RPUD 4BJTA 2VQHA 5FROA 3H94A 1MMNA 3IUOA 5CQEA 1QHHD 2HVQA 1DBOA 3A2KA 4II2A 4C2UA 2A5WA 3DDYA 1O8KA 1PLUA 1UAAA 1BR1A 3OE7A 3N05A 3GVLA 2KL4A 2D3LA 2BSPA 2NSPA 4YELA 3OYBA 1MABA 2R7SA 3GQ9A 2R7OA 3BG7A 4KKUA 4KISA 1WJ5A 3ZPNA 3K70D 3H35A 2X53S 3KX2A 2AQEA 2DT6A 3NWTA 1PYVA 3IAM2 3OYKA 2WADA 1MMGA 3QYFA 2IGOA 3DU6A 1FMVA 3G2BA 4NUBA 4E7IA 1NRKA 2PMZA 3JU4A 2E1MB 2HU9A 4XOTA 3PSFA 5FRNA 2KRCA 3VSVA 2V7FA 2X1DA 2XF5A 3K4BA 2HQAA 4CCMA 3VSTA 2HLDA 2JA2A 1H80A 1NBMA 1G8XA 1QU3A 3DKXA 1MNEA 1FX0A 1WJBA 2L2OA 3S3MA 4Z06A 4FXUA 3D5SC 4UZUA 2L9NA 4E7ZA 3PNVA 2RREA 5KHDA 2IQ7A 2XNDA 1X0CA 3T53B 3CF2A 5TGTA 3IAS2 3PNYA 3QYEA 4FETA 2CW8A 4XKBA 1OLTA 3HOSA 2K3PA 3L2VA 2R7XA 5CKTA 4Z05A 2R7VA 3PFYA 4PUSA 1JTAA 2KP6A 1WJFA 1KMHA 2GJRA 1T95A 2LG4A 3FHNA 2WSSA 5FL7A 2VXDA 4LG3A 1QHGA 4CSWA 5HOOA 4OWRB 2VQLA 1P9QC 3LSMA 2NTQA 1D1BA 3ZIAA 4IX7A 4P5OA 4PSXA 2VLAA 2QE7A 4RM3A 2QKMB 4ZDOA 4CZCA 3ZSCA 1UD5A 3HPHA 4F91B 4C2TA 1UD4A 2LYCA 2LRDA 2W82A 1DGWY 2O5RA 1R6RA 3VYTB 2F4IA 4L8JA 3OW7A 2ZZFA 2VJIA 4XLHA 2JDIA 1YX3A 1D0XA 1E1QA 3FBIB 1OFLA 3PSIA 2F6CA 1E43A 2VPLA 2O04A 2X51A 1DBGA 2V1NA 3S3OA 4N4NB 2HVRA 1WFXA 2W00A 3RTRA 3M8JA 1RMGA 3CZ6A 4PJJA 4U7BA 3SYTA 3DTEA 3OPOA 3LSGA 4IQJA 2XF6A 4XD7A 2VXZA 3LL7A 3OMYA 2Z6BD 3VYRB 1OHHA 2VBEA 3LSHA 3LFUA 3GQ7A 1D1AA 2O0WA 4B3FX 1HZEA 1Z21A 2NSTA 3VMVA 4QPOA 1E0EA 3LNNA 4KKSA 2E5NA 2XZLA 1MNDA 4ZJZA 2V6EA 4XNFA 1U0JA 3K4CA 3VSKA 4BDZA 1WJEA 3H5AA 2JSPA 2IS4A 3BG6A 3PJRA 3UW0A 1VLYA 2LY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9G A;  1RU4 A;  1O8L A;  4XOR A;  1IA5 A;  4W8T A;  2O17 A;  4XLC A;  1IDJ A;  1KCD A;  3GQA A;  2NTB A;  1XG2 A;  4XLF A;  4URR A;  1HG8 A;  2X85 A;  1KTW A;  4XOP A;  1O8E A;  4PMH A;  2QX3 A;  4NK6 A;  1DBO A;  2UVF A;  1O8G A;  1O8K A;  1PLU A;  1VBL A;  4OJL A;  4XKW A;  1PE9 A;  2BSP A;  4YZA A;  1KCC A;  2NSP A;  4YEL A;  2UVE A;  1OGO X;  1O8J A;  4OJP A;  3GQ9 A;  1PXZ A;  3B90 A;  1JRG A;  1K5C A;  4XR6 A;  1AIR A;  4AVZ A;  1IDK A;  4MR0 A;  4U49 A;  2INU A;  4XOT A;  3VSV A;  4XQF A;  2X6Y A;  1IB4 A;  3VST A;  4XKV A;  1H80 A;  1OGM X;  1O8M A;  4Z06 A;  1O88 A;  4EW9 A;  2VBM A;  4W8Q A;  4HWV A;  2NT9 A;  2IQ7 A;  2O1D A;  1X0C A;  4YZQ A;  3KRG A;  4XLE A;  4NK8 A;  2VBK A;  4XM3 A;  3B4N A;  2X6X A;  4Z05 A;  4W8R A;  2QY1 A;  1JTA A;  2PYG A;  3B8Y A;  2PEC A;  4XN3 A;  2NZM A;  3SUC A;  2EWE A;  1BN8 A;  4YEJ A;  1O8F A;  4XLA A;  2NTQ A;  5AMV A;  4XN0 A;  1O8H A;  2NT6 A;  2QXZ A;  4C2L A;  3ZSC A;  1RWR A;  1WMR A;  3GRH A;  4MXN A;  4OJ6 A;  2VJI A;  4XLH A;  2INV A;  3WWG A;  4OJ5 A;  4Z03 A;  1OFL A;  1O8I A;  4XL9 A;  2O04 A;  3FY3 A;  1DBG A;  4W8S A;  4OJO A;  3VSU A;  2Z8G A;  1RMG A;  4OZY A;  3VMW A;  2NTP A;  4XON A;  2X3H A;  4YZ0 A;  2O0V A;  1QCX A;  3EQO A;  3ZPP A;  2VJJ A;  3JUR A;  1CZF A;  1BHE A;  2PYH A;  2VBE A;  2ODL A;  3GQ8 A;  1EE6 A;  3GQ7 A;  2O0W A;  5C1E A;  4OZZ A;  4I84 A;  4XMY A;  1O8D A;  2NST A;  4YZX A;  3VMV A;  3EQN A;  1OFM A;  4XNF A;  1OOC A;  3LMW A;  1NHC A;  4U4B A;  2X6W A;  1QJV A;  5C1C A;  3UW0 A;  1GQ8 A; 
#chains in the Genus database with same CATH topology
 4CGZ A;  2GQQ A;  4KN4 X;  3KFW X;  2W7N A;  3TL4 X;  3RPU A;  4X07 A;  1WCM J;  2KIF A;  3MVP A;  3KE2 A;  4Y33 A;  5J3L A;  3J81 k;  3BCD A;  3P7N A;  2MC4 A;  4CZZ A;  1A8P A;  4HV6 A;  1KQ5 A;  2I10 A;  3HYI A;  1YHQ B;  5JBQ A;  1TLL A;  4D9J A;  1VQ6 I;  1IN8 A;  3R60 A;  2KMU A;  4PJM A;  2XNC A;  2ZJQ F;  1IW7 F;  2WAQ N;  1SD7 A;  4FAS D;  2O3F A;  1UD3 A;  2YWE A;  5FKM A;  4OOX A;  2V9K A;  2DA4 A;  1JI8 A;  1YI2 B;  1TYW A;  3SJM A;  2QWW A;  2E7X A;  4A69 C;  5M5W J;  1RR8 C;  2Z99 A;  4OJP A;  3W3C A;  3CXC B;  1TL8 A;  3VEP A;  1JHH A;  4DNC A;  1XSX A;  4RGU A;  5EGO A;  3HOW J;  4RCY A;  3E1S A;  3I56 I;  5CQG A;  2LSO A;  2GRE A;  4UZE A;  3CUQ B;  3R4K A;  1HC8 A;  3K1N A;  1W0J A;  3DKY A;  2JWT A;  4FIS A;  4BQN A;  1IO2 A;  4ZTF A;  4U49 A;  1OMI A;  2CGP A;  5DCM B;  5CPR B;  3RKX A;  1G2H A;  4XQF A;  1PP7 U;  4ESF A;  3TED A;  1K78 B;  4C9Y A;  1JGS A;  1X19 A;  4D5C A;  3DF8 A;  3CUO A;  2ZJR F;  2DXI A;  2L7F P;  2O8K A;  2V6C A;  4O3M A;  2JA7 J;  1I5Z A;  1EKE A;  2XAH A;  2VBM A;  4W8Q A;  1WRJ A;  4J01 A;  1KQ9 A;  2K02 A;  1FRN A;  3BJ6 A;  1T8I A;  4EAT A;  4Y3O A;  2DK8 A;  4NC7 A;  4IHV A;  1W5T A;  2ZZE A;  2VKE A;  1K8F A;  3WBK A;  1W0T A;  1ZRF A;  3NAW A;  1FWZ A;  3CME B;  5HLH A;  1JUP A;  2GM4 A;  2XRO A;  1RET A;  4RAZ A;  2CU7 A;  1BA5 A;  2EWE A;  3FJO A;  2VFQ A;  5AN9 A;  4YAL A;  1NG6 A;  3FXU A;  5F0H A;  3HKZ A;  2IXS A;  4I02 A;  3E7L A;  5FLM J;  2HEO A;  2DFH A;  2P5K A;  2C2W A;  1UST A;  2WZP P;  4QUZ A;  1R7J A;  1MGT A;  2DA6 A;  4HG2 A;  4XN0 A;  5K7F A;  3CCV I;  3Q39 A;  4OOI A;  3RCO A;  3DLL F;  3LYC A;  2KPM A;  2QM3 A;  3ZMU A;  5FGM A;  1RWR A;  1SVL A;  3OYL A;  3QPS A;  4QVJ A;  2YR2 A;  2GOX B;  2IA1 A;  4IPA A;  5JR3 A;  4BY1 J;  1JT6 A;  2YS9 A;  2IRF G;  1JJ2 B;  3G73 A;  4Z03 A;  3E0J B;  1B72 A;  3I58 A;  2FML A;  2QEN A;  2JVH A;  4OAY A;  4F7D A;  4OIQ F;  4X0G A;  4DOZ A;  2GIV A;  1K28 D;  4WZE A;  2Z8G A;  1RR7 A;  2ZME C;  3HZJ A;  4F55 A;  3GTJ J;  1ZG1 A;  1QCX A;  3J81 Z;  1ZM4 A;  3OOP A;  3JUR A;  4HAM A;  4KJZ A;  1BHE A;  1IUY A;  1UD2 A;  1EE6 A;  2HR3 A;  5AIQ A;  3S8P A;  3WGG A;  4J19 A;  2J8I A;  3BDD A;  3AVT A;  4WXD A;  2HPM A;  2ESN A;  2L01 A;  4D7M A;  1QPI A;  2ZNZ A;  2LH9 A;  4RM2 A;  2GK6 A;  3WG9 A;  4BQO A;  1FYL A;  2CK3 A;  3KEW A;  4ENK A;  5FO5 A;  3BCF A;  5B6I A;  4UVB A;  1Q82 D;  1OOC A;  2GA2 A;  2O61 A;  2R7T A;  4B3X A;  4M73 A;  1SAX A;  2DT5 A;  5BPD A;  1H8H A;  1Z6R A;  4LFU A;  1IV6 A;  1IRF A;  2GXA A;  2Q6K A;  2LKS A;  4G6I A;  1FOY A;  2Y69 H;  3K69 A;  3D5L A;  4Z4Z A;  5EEH A;  2CQ7 A;  2HOT A;  2DA5 A;  1O8L A;  3V7R A;  2R5Z A;  2WPD A;  4M3D A;  1JA0 A;  2HVS A;  1EA3 A;  3C18 A;  3SY2 A;  3HHH A;  3CCE B;  2JA6 J;  3IKT A;  2H6B A;  3U1K A;  5BSY A;  1XG2 A;  4YEI A;  4B4C A;  1GXP A;  2BMW A;  3K4M A;  3ASN H;  4OJL A;  2HPI A;  1X1D A;  2RV8 A;  5LGN A;  4IHT A;  2Q2E B;  1ZTR A;  2JUC A;  1VJS A;  2WB1 A;  4YZA A;  3R0J A;  5LFA A;  2H27 A;  1KC8 D;  1E62 A;  3SJP A;  3P9K A;  2PX9 A;  3VO1 A;  2ID3 A;  5EZG A;  1P4X A;  5HDK A;  4AM3 A;  1JRG A;  5HS8 A;  1JA1 A;  1K5C A;  2YPR A;  3TO7 A;  2ZSI B;  1K73 D;  2DMT A;  1QGP A;  3IRR A;  5J35 A;  4R1H A;  2R7Q A;  4B47 A;  2J5O A;  3GXO A;  3HOT A;  1NK2 P;  3SLN A;  3ZQI A;  3CDH A;  2HS5 A;  1QPM A;  3GQB A;  2KJB A;  2HXO A;  4HEA 2;  5FFX A;  3M07 A;  1I6H J;  2AQF A;  4JBA A;  4ZDP A;  1UCR A;  4XRF A;  4CO8 A;  1FRQ A;  4XKV A;  1BR2 A;  1IB4 A;  1WJC A;  1WPC A;  1X3U A;  1G3T A;  3FXM A;  4ZYA A;  3B82 A;  1D0Y A;  4EW9 A;  4P96 A;  4Z4V A;  5K7Z A;  2BM4 A;  3AL0 B;  2VQG A;  5KSW B;  3K2A A;  4HWV A;  2L3D A;  3ESW B;  1ZRD A;  2FNP A;  4LK0 F;  5HLG A;  1YLF A;  2HMA A;  5HDN A;  5GAD J;  2JJ2 A;  1LEB A;  3JRD A;  2DN0 A;  3BR5 A;  1A6I A;  3G4S I;  1VQ5 I;  4MTE A;  3TW6 A;  2CMP A;  3CCQ I;  2R93 J;  3U21 A;  4LLN A;  2KRH A;  5IP6 A;  2AXL A;  1ZLK A;  4HOB A;  3H9N A;  2XDV A;  2P6T A;  1IF1 A;  3HSF A;  2XIG A;  1T0F A;  3SEZ A;  5DN6 A;  1ZKG A;  1MZB A;  3H9Q A;  1XGS A;  3C2B A;  1K8A D;  3HSR A;  2QYU A;  3WGH A;  3O8H A;  2R7R A;  4HDU A;  3FXQ A;  3HEF A;  1E79 A;  1GVJ A;  4Y4R A;  5HNH A;  1K4T A;  2QXZ A;  1U2R A;  4UHT A;  3GSI A;  4OOV A;  1W36 D;  2B7B A;  4UXN A;  1DAB A;  4ENM A;  3CCY A;  2ELH A;  3GTM J;  4OJ6 A;  1MBK A;  3O8G A;  2L54 A;  4WQM A;  1W5C C;  1OJL A;  2ZXI A;  1YIO A;  3DQV C;  5CVV A;  2RQP A;  3COA C;  5DSZ A;  3EUH A;  2K5C A;  2QQB A;  1OFD A;  3U2R A;  3HRS A;  3T0Y A;  4QPQ A;  5F08 A;  4AF7 A;  1KQ0 A;  2XKO A;  2M4G A;  4P9F A;  4P9S A;  3K2Z A;  2NOG A;  3WU0 A;  1VQ9 B;  3QFR A;  2PMH A;  1FND A;  3VSU A;  3GME A;  1ZH5 A;  1JKR C;  5FD6 A;  2BXY A;  2EA2 A;  2Y30 A;  3M1C A;  2MBF A;  5IP9 J;  4YG2 F;  2M9H A;  1QUF A;  1LFP A;  2E7W A;  4Y17 A;  4MYT A;  2BSA A;  1SKQ A;  1FNC A;  5F27 A;  3BG9 A;  1WJD A;  2Y9Y A;  5D5X B;  3D26 A;  1H8E A;  3CC4 B;  2EWN A;  3CMY A;  3RQI A;  3EQN A;  2YWG A;  2DMP A;  2L0K A;  2BW3 B;  1YTY A;  4KFC A;  3MZ8 A;  1YS7 A;  4NBS A;  1HVX A;  4J00 A;  5LEJ A;  2LNB A;  3IH3 A;  1WJA A;  1QG0 A;  1UHM A;  2P5V A;  5J40 A;  3PNT A;  2QKL B;  5THX A;  4BL0 B;  2PG4 A;  2YSR A;  5BOX A;  3T9G A;  1E64 A;  2VB6 A;  3GWZ A;  4Z1M A;  4BPR A;  1YIT B;  4C3J J;  1Y0Y A;  4M1K A;  4PFP A;  2W1O A;  5IOY A;  1HG8 A;  3EQL F;  4FT8 A;  1KTW A;  4X7F A;  4PMH A;  4RGR A;  1JHF A;  4M53 A;  4PC6 A;  3LA7 A;  3BTI A;  4N9I A;  5B1B H;  4HDV A;  2DOG A;  4PK4 A;  1N25 A;  4YIR X;  3BZ6 A;  3ZQG A;  2IP2 A;  4EJT A;  1D2E A;  1T6Z A;  3WTV C;  2DER A;  2BM0 A;  4U0W A;  2RDP A;  1PE9 A;  1RZ4 A;  2HNH A;  3K7A J;  4OIN F;  1TW2 A;  1DP7 P;  2OPT A;  2R7Z J;  2NS8 A;  3S15 J;  4A0X A;  4EJO A;  2ZXH A;  1BL0 A;  2ID6 A;  1HDP A;  4ZCL A;  1WP6 A;  1PVE A;  1W34 A;  4E7L A;  3TW7 A;  3CCM B;  1RIO H;  1OFE A;  1X1B A;  5J3O A;  1YQA A;  3V8J A;  2PN6 A;  1MD0 A;  3H5N A;  3VSL A;  4HST A;  4FQG A;  6PAX A;  2V9V A;  1UHW A;  2JA5 J;  3FXK A;  2BBY A;  4TV7 A;  1J59 A;  1I6X A;  1HF2 A;  3L2R A;  2DA3 A;  5H6R A;  4BJ5 C;  3F21 A;  2XAG A;  2PMU A;  3CC7 I;  3A1Y A;  3CDI A;  4UNO A;  1QGZ A;  4HF1 A;  2Y0M A;  1QNT A;  3A03 A;  2JPC A;  2OTL I;  1XGN A;  3T56 B;  4LJZ F;  3BQJ A;  1YJ9 B;  3LQ6 A;  2OZU A;  1G7T A;  1XSV A;  4F93 B;  1N8R D;  2Q1Z B;  1LDJ A;  3TO6 A;  1BR4 A;  1UMK A;  3QSY A;  2YUH A;  1FIP A;  2AHQ A;  3L2W A;  3CF5 F;  2IGN A;  3TP3 A;  5FKO A;  1VQ7 I;  3W2A A;  3I1F A;  4YEJ A;  1BI3 A;  1ONV A;  2ZKZ A;  1VQP B;  5E3M A;  2HOS A;  4X0C A;  2B0L A;  3IWZ A;  3GYH X;  1TP4 A;  3ASO H;  1OGI A;  2BY1 A;  2CW0 F;  2LLK A;  4G7W A;  3BR0 A;  4DQK A;  2E34 A;  5DM7 F;  3OW2 B;  1BN5 A;  4GCV A;  2DOA A;  3CCJ I;  3LWF A;  3TDU C;  2HDW A;  3LJY A;  4LGW A;  3ZQF A;  3WGI A;  4I76 A;  2DET A;  2F4N A;  1SD5 A;  4OJ5 A;  4X1E A;  4BEH B;  2BEO A;  5FLV A;  1O8I A;  1HXD A;  1KQS B;  3CPX A;  3LSR A;  3E6D A;  4D0P A;  4NCN A;  4U87 A;  3JQP A;  1QFY A;  3QPT A;  1G4D A;  4P25 A;  3RY8 A;  2BX6 A;  3SDG A;  1KZH A;  4HF2 A;  1QZY A;  2VL8 A;  2VT3 A;  2JZY A;  3G6E B;  3QOE A;  1IRX A;  4RLQ A;  4P1W A;  3R6S A;  1K4Z A;  4BAY A;  1FPQ A;  4TN1 A;  1JTY A;  4EGY A;  3GQ8 A;  1FDR A;  1GUU A;  5C1E A;  1T0F C;  1Q1V A;  3A35 A;  3A4C A;  3RI4 A;  3CUQ A;  1ETW A;  1W87 A;  3DWL E;  3S3N A;  2V4J C;  4HF0 A;  4M9S A;  3I4M J;  3OFN A;  4Z4U A;  1OFM A;  1K6O A;  3OYA A;  2CWE A;  3A0B C;  2QMU A;  3AK5 A;  4Z4Y A;  2UXX A;  2V7T A;  5IYN A;  4A6E A;  1MBH A;  3FIW A;  4AIH A;  2DOE A;  1WWX A;  1MMA A;  3QPH A;  4HNU A;  3JQR A;  2CQK A;  2WY8 Q;  2PLF A;  3ECO A;  5K7H A;  4U7D A;  2OBR A;  2PBI A;  1U3E M;  3PFI A;  3AG2 H;  2LBF B;  1KCD A;  3RPU D;  3H94 A;  2OA4 A;  3LFK A;  3ZMT A;  2D1V A;  4EEF G;  4GDF A;  3GW2 A;  4II2 A;  3U1D A;  3K0L A;  2X4H A;  4S0H B;  1F20 A;  1Q81 D;  1ULY A;  3N05 A;  3HHG A;  3GVL A;  4XRM A;  3G1M A;  2EV0 A;  2PE3 A;  4MFD A;  1UMQ A;  3AST A;  3JRI A;  2NSP A;  1QRC A;  2DBB A;  1MAB A;  4RGX A;  2R7O A;  3BG7 A;  1MRZ A;  4WZT A;  3SLD A;  1WOR A;  1ACI A;  1WU8 A;  2CBX A;  3K70 D;  3E6C C;  1H8A C;  3FKI J;  2DT6 A;  2LKP A;  3IAM 2;  2DEU A;  3QYF A;  4G1B A;  2IGO A;  1FMV A;  4NUB A;  3ZP5 A;  1IXR C;  1YW9 A;  4HQE A;  1YIJ I;  4YFX F;  4H9G A;  1D8T A;  2XGX A;  5J4V A;  2O0Y A;  5FRN A;  4OM9 A;  2X1D A;  2XF5 A;  2STT A;  3CCS B;  5DYM A;  3WTX C;  2LTP A;  4DYR A;  1MNE A;  5D6F A;  1QGY A;  1WJB A;  4AWX B;  1WOP A;  4Z06 A;  2FF4 A;  4UZU A;  2IQ7 A;  3W2F A;  3JTH A;  5TGT A;  2C78 A;  1KRH A;  3QYE A;  4ABZ A;  2IVM A;  1OLT A;  4ACB A;  5H20 A;  3Q0U A;  1YG2 A;  2HXI A;  4A0Z A;  2IT0 A;  3GUD A;  3CQZ J;  2A69 F;  2KP6 A;  5HZA A;  1CNF A;  1KMH A;  3LAJ A;  2GJR A;  2ZBV A;  3FHN A;  1KK0 A;  4LG3 A;  1FNM A;  2QQ9 A;  4OWR B;  1U8B A;  1DDG A;  1RNL A;  3LSM A;  2H09 A;  5DNS A;  1TQP A;  2QA4 I;  4P5O A;  4DW6 A;  4RM3 A;  2QTZ A;  5M5Y J;  4X6A J;  3BTC A;  1VHE A;  1XB2 A;  4RD0 A;  4FE7 A;  4F91 B;  3BH7 B;  2LYC A;  1IN6 A;  2W82 A;  3FMR A;  4XSZ F;  3OP1 A;  4P3I A;  2ZL6 A;  2F4I A;  4TMV A;  1B6A A;  4XLH A;  1Y0N A;  2D9R A;  1E1Q A;  3FBI B;  3LOC A;  4I0A A;  3PVD A;  3E1Y E;  2EJR A;  2VPL A;  1IRZ A;  4CYC B;  1ZGJ A;  1AKH A;  3ZQ7 A;  4N4N B;  4BXX J;  2DTR A;  3CW2 A;  2Y75 A;  3SYT A;  2JQ7 A;  2VKV A;  2ZB9 A;  4OMZ A;  4IQJ A;  2XF6 A;  2VXZ A;  5GTH C;  4ESB A;  1RI7 A;  3OMY A;  2XB0 X;  2OK8 A;  4RPD A;  4EV0 A;  2W84 A;  3BTL A;  1I7P A;  1YJN I;  4L18 B;  3LFU A;  3GQ7 A;  4YFO A;  1D1A A;  2O0W A;  1B9M A;  2GAU A;  5J8C A;  3FMS A;  2OBP A;  3HIF A;  3SKB A;  5LEK A;  1Z21 A;  1HZE A;  4MO7 A;  4EM1 A;  1T2K A;  3H1C A;  3ZQL A;  1NK3 P;  3NEU A;  3OIO A;  3PA2 A;  1ETY A;  3F22 A;  3K4C A;  5F1J A;  2QEX B;  2Z33 A;  4M3G A;  1SD4 A;  2B7E A;  1TQM A;  2WTE A;  3H5A A;  3JRB A;  3UW0 A;  2JK3 A;  1XCB A;  2LY1 A;  4G6D A;  2CUJ A;  3W6V A;  2MD5 A;  1ZYR F;  1W35 A;  4B43 A;  4HE6 A;  1YS6 A;  3PUB A;  1VFC A;  4RPB A;  3CCR I;  3I55 B;  4PC2 A;  2HYJ A;  2NOJ B;  3L00 A;  3P9C A;  3QU6 A;  4HRI A;  2MH2 A;  2VOD A;  2A68 F;  1EF4 A;  2XHK A;  1X3Z B;  5BPI A;  3ONY A;  2HFH A;  4KUM A;  4UY8 I;  4G6Q A;  3KL9 A;  2PFB A;  5E1X A;  3G1O A;  5TY0 A;  1Z91 A;  3K1P A;  4A3L J;  3ULQ B;  1G59 A;  1BPL A;  1GHC A;  3WBJ A;  4KYW A;  2K9S A;  4H4K C;  4D1Q A;  1ZK8 A;  2FX0 A;  3QU3 A;  2QTL A;  2YU9 J;  4C3I J;  1QVG B;  2UVE A;  4RD2 A;  4B48 A;  2HKO A;  5L3D A;  1U8R A;  4Z4W A;  1B9N A;  3CO6 C;  3HTS B;  2BGJ A;  5JMC B;  4ZYG A;  4YDT A;  2J5P A;  2EZK A;  4JQF A;  4NDL A;  2E1C A;  2ACJ A;  4RMN A;  1OQY A;  1ITY A;  1XTA A;  2FQ3 A;  1T6X A;  4KKT A;  4P2N A;  5J1Y A;  4JRA C;  1XGO A;  1X2M A;  4ZZD A;  3Q38 A;  2V31 A;  3MKW B;  1TSP A;  4G12 A;  2ME6 A;  1YHQ I;  4AC0 A;  3Q3A A;  4FX4 A;  3OYC A;  1T33 A;  2QYO A;  3DLA A;  4G1V A;  3AVX A;  2M2E A;  2COB A;  1O8M A;  2EIN H;  2QSG X;  3W5V A;  1JT0 A;  3GZ5 A;  3LST A;  1OCC H;  2QUF A;  3CD6 B;  2FVG A;  3NE5 B;  3DV8 A;  1A5J A;  3ONU A;  2W57 A;  5J8F A;  1KK3 A;  3HRM A;  1IUF A;  1S0U A;  2KT0 A;  2BHZ A;  5AON A;  1GV2 A;  2JUG A;  4AD9 A;  3HOZ J;  3VYS B;  1VLO A;  4TMT A;  3CMM A;  3OAA A;  1GXQ A;  4GQN A;  2CW7 A;  2E1M C;  4D7N A;  2X6X A;  3VWB A;  5FRM A;  1V4R A;  5GAH J;  4W8R A;  4MTD A;  1XQB A;  2PEC A;  4N0B A;  1Q9S A;  1J09 A;  1KA8 A;  2L7Z A;  3EUK L;  1CQT A;  4KIT B;  5HLT A;  1Z6T A;  4V2G A;  1RC9 A;  2GA1 A;  2VNH A;  5DUI A;  3HL2 A;  1P92 A;  2M7A A;  3OS2 A;  2K4J A;  5LD2 C;  5CJ9 A;  3WQZ A;  3QOD A;  4DQL A;  2IS2 A;  2FU4 A;  5B5E C;  2QGG A;  1TT5 B;  3SZT A;  2OTJ B;  3G71 I;  1DQU A;  4QWQ A;  2V4D A;  4MXN A;  1HCR A;  4UZF A;  2Z16 A;  1TZL A;  5TR9 A;  1XMX A;  3LSK A;  2ADU A;  2QF7 A;  3WWG A;  4XL9 A;  4ASU A;  4YC5 A;  1I50 J;  4CYD A;  5A2Q Z;  4MHG A;  4AYB A;  2FQ4 A;  2R6H A;  5GPA A;  2X9D A;  2RC4 A;  2KIS A;  5J6X A;  5IYC J;  5BSX A;  1I18 A;  2EIK H;  3N4M A;  3K9T A;  5DCF A;  1TNS A;  1PP8 F;  2PI0 A;  2ZJ2 A;  2L9V A;  4RD6 A;  1MJ9 A;  3C7J A;  4P3Y A;  2IA0 A;  4GXO A;  1O8D A;  2PQ8 A;  5BQT A;  2HTJ A;  3SZE A;  3M9A A;  1LEA A;  5D4R A;  4RB0 A;  2TDX A;  5JLV C;  3W6K B;  2ELJ A;  1STZ A;  2VE8 A;  4UUV A;  4YCQ A;  4V19 K;  2KIU A;  2PLY A;  1R5N A;  2NVX J;  2E1B A;  2MG4 A;  2VOP A;  4RB3 C;  1CF7 A;  3S93 A;  3O3K A;  4IXA A;  1C0W A;  2QSF X;  1I39 A;  4W8T A;  2EA4 A;  3MWM A;  1IJE A;  2CH0 A;  2X85 A;  3I3L A;  2QVO A;  3MEX A;  5IPA A;  4ENJ A;  3MMP A;  1K6Y A;  2B7C A;  4P55 A;  3ABL H;  2ZL5 A;  5HZB A;  2UVF A;  4OPO A;  2M87 A;  1WXR A;  1U5T A;  1VQN B;  2F5V A;  2EZI A;  1W4M A;  4M6Y A;  4N9H A;  1QH0 A;  1RQP A;  1X4P A;  3OS0 A;  4PC7 A;  1KU2 A;  2LRE A;  1YJW I;  3IL2 A;  3CPW B;  3FPP A;  3I53 A;  1OGO X;  2F1M A;  1O8J A;  3PSS A;  3ZCO A;  4CCO A;  3HUG B;  2CJJ A;  3FDY A;  3OIP A;  1Z67 A;  1W36 C;  1WI3 A;  2EPF A;  2K85 A;  1LDK B;  2HDD A;  2MLK A;  3D5R C;  3T1B A;  4G7Z F;  4BU2 A;  4XLP F;  3QRF F;  3JAM K;  1GR1 A;  1YRN A;  3OZW A;  1HKS A;  5HVQ C;  1ZUN B;  3FBN B;  2VFM A;  2I5U A;  3F8M A;  1WOS A;  3JRH A;  3KP2 A;  4BGD A;  3LA3 A;  4RA2 A;  3S1R J;  5FO1 A;  3FXR A;  2CW5 A;  3KEY A;  4A3E J;  5ICG A;  3S14 J;  2Y31 A;  2R7D A;  5H2F C;  3HOY J;  3PQJ A;  4A3M J;  2XF7 A;  1QQI A;  1PJ5 A;  1W7P B;  3RIQ A;  3KZI C;  1MBG A;  5F6F A;  2B0R A;  2JN9 A;  2V1D A;  2VC0 A;  3ONQ A;  3OYE A;  2R5Y A;  1R36 A;  4NBQ A;  2HTS A;  1E3X A;  4HIZ A;  2KIM A;  1SFU A;  2VN2 A;  1F4K A;  2HDC A;  4U0Y A;  2VUM J;  1KGS A;  3MZY A;  2BOL A;  4LBW A;  1JKP C;  1V0E A;  2QY1 A;  4KT6 A;  2PYG A;  5IYW A;  1MDM B;  1SFX A;  3SUC A;  3FKJ A;  2E35 A;  5DV5 A;  2VBZ A;  1ZRE A;  5IT9 Z;  3FM3 A;  3ZGK A;  2A6T A;  4ON0 A;  1B23 P;  3ZZ0 A;  4YAF A;  2KQR A;  2E36 A;  3BG3 A;  4QHY A;  4DJA A;  1M90 D;  4HX7 A;  2PJR A;  4YII A;  2LBF A;  3E5U A;  1EFU A;  2F1L A;  1VQL B;  5K1Y A;  5F64 A;  3E20 A;  1KK2 A;  2I8D A;  1Z0X A;  2RNG A;  2QDX A;  2DU9 A;  3MKZ A;  3EPZ A;  2IS6 A;  2VZL A;  1LNW A;  1XG1 A;  2RKH A;  4MIM A;  3WNC A;  3VR6 A;  2F3L A;  3JX8 A;  1IXS B;  3KLO A;  3OYN A;  4OJO A;  1VTN C;  3JRC A;  1IN5 A;  1NG7 A;  1U78 A;  3H3V K;  4XRS G;  3WU2 C;  4XON A;  5AIP A;  3S32 A;  4WWV A;  1TVC A;  1U9O A;  4RDJ A;  4OP7 A;  1F43 A;  2BHY A;  2NS7 A;  2X1E A;  1N06 A;  2VJ4 A;  2ZZQ A;  1LM1 A;  2DYR H;  2ZFW A;  2M4K A;  2GIZ A;  2DPU A;  2GOM A;  3OY9 A;  1LLZ A;  4IO9 F;  4YZX A;  4ZZL A;  5C4J J;  3O2P E;  2ELK A;  2Z1D A;  3PUM A;  1P7J A;  2MLG A;  1ETK A;  3AG4 H;  1B4A A;  4LC0 A;  4OIO F;  1O7L A;  3H92 A;  1FBQ A;  2F43 A;  2ZIT A;  1GT0 C;  1IJW C;  3G1L A;  4DIQ A;  3M8E A;  1SFO J;  1REP C;  5CLS A;  2Y0S A;  2W48 A;  5E1Z B;  3A8J A;  1IC8 A;  4JX4 A;  1GAW A;  3X2Q H;  2BM1 A;  2WBM A;  1J2X A;  1MSE C;  3OJX A;  1W2B B;  2QZA A;  3KCC A;  5FLX K;  4KT5 C;  3W2W A;  5LRR A;  5FD5 A;  5EYR A;  4XLF A;  1E1R A;  1QVF B;  4URR A;  3GEZ A;  4BY7 J;  1BX0 A;  1QFJ A;  3GTQ J;  3WTZ A;  1VF9 A;  1S72 B;  4FTH A;  1J5Y A;  3C2H A;  4WZL A;  1FP1 D;  1M1E B;  2WZN A;  3OL4 A;  3AGP A;  3CJT B;  4PJ0 C;  3SZG A;  2V79 A;  2UV1 A;  1P7I A;  2X0L A;  3WTY C;  4L9J A;  4E7K A;  4OAZ A;  2BM6 A;  5KW9 A;  5L3G A;  3GVK A;  2DJI A;  1E3O C;  4W97 A;  4YFN F;  1VQO I;  3QWL A;  3B78 A;  2XUB A;  1AHD P;  4WXC A;  2R9V A;  3EUA A;  3JW4 A;  3KIO A;  3ZN0 A;  1MSF C;  2MYS A;  4AVZ A;  4K2E A;  3CCU I;  1MH4 A;  3H0G J;  1FTT A;  1UD6 A;  4B1R A;  4LLG F;  1H85 A;  1UD8 A;  1DDI A;  3PUN A;  3FHZ A;  4PC3 A;  1FY7 A;  1X58 A;  1FBS A;  4QLC U;  2ECB A;  3RYR A;  2VBX A;  2PMD A;  4CYC A;  1LLW A;  3K4L A;  1LE8 A;  3KP6 A;  4UUS B;  1BLI A;  2O03 A;  3K4N A;  1U5T C;  5ILV A;  2D74 A;  5GTI C;  3PIP F;  2PMZ N;  2DLL A;  5LRS A;  1LVA A;  4ANJ A;  3EET A;  3WE2 A;  1EP3 B;  3GFL A;  2EIL H;  3CCM I;  1MBF A;  3DTI A;  3KZY A;  2NXN B;  2M7B A;  2BN4 A;  1IV8 A;  2ZBU A;  2P3M A;  2VKH A;  3BCA A;  2OU2 A;  2ZFU A;  4A93 J;  1GAQ A;  3OEH A;  4JOM A;  5IK2 A;  1UB9 A;  5D6E A;  3H5R A;  3F8B A;  5ILS A;  5K5Q A;  1PUE E;  3Q6Q A;  3ZUG A;  1FYK A;  4HLY A;  1O8F A;  4P1V A;  4WK8 F;  1VQ6 B;  1X2N A;  4Y9R A;  3ABT A;  3GZ6 A;  4ENN A;  2HCJ B;  4B3G A;  1D0Z A;  4HV5 A;  3W2H A;  4N4O B;  3OYJ A;  3RJP A;  2A6E F;  1EP1 B;  3HGY A;  2M8E A;  1DU0 A;  2RC5 A;  1B1B A;  4KMU X;  3N97 A;  3I56 B;  3CCL I;  4P26 A;  4RAF A;  4ZYE A;  5M3F J;  1HDD C;  2F5D A;  2CUZ A;  2A5Y B;  1TWC J;  3AVW A;  3CJN A;  3E3V A;  2VKD A;  2STW A;  1VQ8 I;  3K70 C;  1QRB A;  1S8N A;  3S16 J;  2O0V A;  2DOD A;  3EQO A;  2K9M A;  4OMY A;  1H0M A;  1BMF A;  3QAH A;  2GJP A;  4P12 A;  1R1V A;  2ODL A;  2WA0 A;  3GZN B;  3RZO J;  2VBV A;  1P2F A;  3IHU A;  2K9Q A;  1WKM A;  1D1C A;  3UKG A;  4AVP A;  2H1K A;  1FNB A;  4E70 A;  2XGD A;  3OL3 A;  3F3X A;  2LOO A;  1BC7 C;  2QQA A;  2FXA A;  1R5B A;  3VPR A;  2XT2 A;  1SD6 A;  3IWF A;  3DPT A;  5TIS C;  2BGI A;  1O3Q A;  3N6Z A;  2NNN A;  4UVA A;  2XOK A;  3VNV A;  1B59 A;  1OB0 A;  2KDO A;  4TKO B;  1I1S A;  3HPG A;  4M3E A;  1T38 A;  1SAN A;  3FIS A;  4XOR A;  1I3Q J;  1IA5 A;  4HA8 A;  5DUK A;  3OYD A;  1SKY B;  3F8C A;  2HQR A;  4HNV A;  1ETV A;  3G6E I;  3Q5F A;  2NTB A;  1T56 A;  2E1N A;  1ZAO A;  4HX4 A;  3IUO A;  1L3L A;  1MNM C;  1F60 A;  1DBO A;  1R1T A;  2XPW A;  4IOC F;  4C2U A;  5DTD A;  1K9M D;  3CCV B;  5J4Y A;  2V5I A;  1BR1 A;  4IL6 C;  2FSW A;  1D3Y A;  1B8I A;  3LQQ A;  1YX2 A;  5EEG A;  1EA0 A;  2E1O A;  4M71 A;  2R7S A;  5FFZ A;  3DEU A;  1QUE A;  4KIS A;  1WJ5 A;  1DU6 A;  4KKU A;  2VYQ A;  3P26 A;  1OPC A;  3OYK A;  4IF4 A;  2DFF A;  2CUE A;  1XD7 A;  4JX5 A;  4E7I A;  1NRK A;  3JU4 A;  3GFM A;  1Z1D A;  1QA1 A;  3ZZT A;  2DMU A;  3PSF A;  5HXB A;  3ERE D;  2QBY A;  3VFZ A;  4CCM A;  1PJ7 A;  2JA2 A;  1MJB A;  3HOV J;  3PO3 J;  2HLD A;  4MYU A;  1QU3 A;  2XNJ A;  1QVU A;  1VI0 A;  4HBL A;  3BG5 A;  3SHF A;  4EJV A;  1XC5 A;  3PNV A;  2RRE A;  1OCR H;  1SVO A;  1V55 H;  4FHT A;  3CF2 A;  1O7F A;  2FBK A;  5GAG J;  2YX4 A;  2ZNY A;  2K9N A;  3PNY A;  4A5N A;  1R5H A;  1OYI A;  1WH5 A;  2F5E A;  2ZBK A;  4FET A;  4XKB A;  3HOS A;  3L2V A;  5IT3 A;  3L2C A;  4Z05 A;  3PFY A;  1JTA A;  4C0S A;  4PGH A;  3H3U A;  1R58 A;  2OCC H;  1QHG A;  3FPK A;  5HOO A;  1JB9 A;  2OD5 A;  3CC2 I;  2ZME B;  1J75 A;  3TP0 A;  4PSX A;  2VLA A;  1ON2 A;  1Z05 A;  2QE7 A;  1WI9 A;  3WTU C;  3ZSC A;  5CYV A;  5DS0 A;  4NHJ A;  1UD4 A;  4Q47 A;  2LRD A;  4LG0 B;  1G3S A;  4L8J A;  3OW7 A;  1RES A;  4ZGN B;  2E1R A;  1F1Z A;  2JDI A;  1YX3 A;  3W5H A;  2VFO A;  5JI6 A;  4AIK A;  2VFN A;  3HKZ N;  2FA5 A;  1PUF B;  1ZGW A;  1Q1H A;  2GQF A;  1OFL A;  2F6C A;  2K40 A;  1U2W A;  2O04 A;  1MBJ A;  4JYK A;  1Y1W J;  1EV7 A;  1QBJ A;  5CVI A;  2FRH A;  3RTR A;  1HBX G;  1IGN A;  4PJJ A;  2P4W A;  2VT2 A;  1EH6 A;  2B9S A;  1XS9 A;  4RD1 A;  1R5I D;  4LOC A;  2F4M B;  2BV6 A;  2Z6B D;  3HUG A;  2VBE A;  5FO0 A;  3LSH A;  4B3F X;  2D2W A;  3BTJ A;  3VMV A;  4UUT A;  4QPO A;  2E5N A;  2XZL A;  4ZJZ A;  2V6E A;  1TNT A;  1TWH J;  4OIR F;  1U0J A;  1H9T A;  4BDZ A;  3KYD B;  3OJW A;  3ZQH A;  1HKT A;  3PJR A;  3BWG A;  3WTW C;  1R9T J;  2O9L A;  1H88 C;  1QQ1 A;  3G4S B;  1VQ5 B;  3CCQ B;  2Q6I A;  1S4M A;  3W2I A;  1W1W E;  3JRG A;  1ELO A;  3VB2 A;  2O17 A;  3GQA A;  3CRZ A;  3V7A A;  2LF7 A;  5LGU A;  3S1N J;  3B6C A;  3I59 B;  3QP5 A;  1NJI D;  2FNA A;  2JIZ A;  1VQK B;  2VNK A;  5TV2 A;  3KEQ A;  5BMZ A;  4FX0 A;  5C4X J;  5KCM A;  3Q3S A;  1SEU A;  4J0Q A;  1VBL A;  4NQW B;  3RQ4 A;  1OCZ H;  5FKN A;  3MKY B;  4OOS A;  4X8I A;  2IOU G;  4DK1 A;  1R1U A;  3B6A A;  2E2H J;  2XZP A;  2HYF A;  4AC9 A;  2TRT A;  3V8L A;  2V7X A;  3B02 A;  3QPL A;  1KCC A;  1BOA A;  2KLO A;  4JP0 A;  2R7W A;  1N08 A;  1AMO A;  1FX7 A;  1KYZ A;  2FBI A;  2GJK A;  2AHO A;  4N3G A;  2V9P A;  5DCM A;  3SZP A;  4A3I J;  5BNG A;  4FWT A;  4YAW A;  4JX6 A;  1K78 A;  3BJO A;  3BP8 A;  3ZR8 X;  2IEK A;  3BR3 A;  4KNY A;  2MH9 A;  3CMA I;  1BIA A;  4C30 A;  4NC6 A;  1MBE A;  3EUH C;  2VBU A;  3GVA A;  2WB1 N;  1FJL A;  1ETO A;  1A31 A;  3CB4 A;  1AA7 A;  5EGO B;  3ZBT A;  1G3W A;  2DCE A;  3TMO A;  1QVT A;  3QOP A;  2JA8 J;  3ASP A;  2MAB A;  3KP4 A;  1S7E A;  4BBR J;  1LVK A;  1HST A;  2OF7 A;  3OZV A;  2DA1 A;  2FE3 A;  3WNB A;  1N05 A;  1FEX A;  4HLX A;  1ZR4 A;  2L9R A;  2A07 F;  4HPQ A;  1VQM I;  1VQ4 I;  1EFT A;  2RQQ A;  5GV8 A;  4KIF A;  2KZV A;  3DEE A;  4F3Q A;  2B63 J;  3D1N I;  3A3G A;  4P22 A;  5L3C A;  2LVS A;  1VND A;  1WSR A;  4NC8 A;  1B2R A;  2FEZ A;  3T8T A;  1R23 A;  3OIQ A;  2HQN A;  2E2J J;  2NZM A;  4M9X A;  4L0Y B;  1V5F A;  3WHC A;  3J81 K;  4TMZ A;  1PDN C;  2OK7 A;  4LMY A;  3BY6 A;  2V7V A;  4PCQ A;  4UB8 C;  2G0Y A;  3ABM H;  2Z2S B;  1IZ1 A;  1P4W A;  2DO7 A;  3I0T A;  4C2L A;  4Q5S F;  3HG9 A;  3KP5 A;  3ASQ A;  3CD6 I;  1WMR A;  3E5Q A;  2BV3 A;  3LSJ A;  1MMD A;  2KZG A;  4M3F A;  4CUG A;  3HB9 A;  1F36 A;  5ICC A;  3FY3 A;  4HE5 A;  4OPW A;  2QSH X;  3ZPL A;  1HA8 A;  3J80 K;  5IYD J;  2P7V B;  3VMW A;  3EDP A;  3CTA A;  3ZPP A;  1RPW A;  5DD8 A;  5E6T A;  2K86 A;  1ORK A;  4WWC A;  2PYH A;  2RGV A;  3F9K A;  2NYX A;  5DM6 F;  1B72 B;  3DBR B;  5E1W A;  4ZDL A;  1S9H A;  5M3M J;  2GLO A;  3IV5 A;  2DT7 B;  3ZMZ A;  3QE2 A;  3R6K A;  4I09 A;  3I5U A;  2TCT A;  2L4A A;  3DBH B;  3LNQ A;  3P4G A;  4OZZ A;  1YYV A;  2YU3 A;  3M8F A;  1IN7 A;  2OTL B;  2CS3 A;  2HZD A;  1U6G A;  2L7M P;  2D45 A;  4QFM A;  3H9G A;  4M2L A;  2FOW A;  1QJV A;  2PJP A;  2FBH A;  3K10 A;  4IW3 B;  1T5E A;  1LJ9 A;  3B73 A;  3DBL B;  4ETS A;  1K61 A;  1APL C;  1DUX C;  1X1A A;  4LIU A;  5FLX Z;  2ESH A;  4CCL A;  1EJ9 A;  2EH3 A;  2Q2E A;  3F6V A;  3JRF A;  5JLX A;  1VQ7 B;  1F5T A;  1HF0 A;  1DGR M;  4LD5 A;  1SC7 A;  2NVT J;  3IKV A;  2DJN A;  2R7F A;  1MKM A;  2R5Z B;  1D5Y A;  3GIR A;  1XSD A;  4DGW B;  4WX9 A;  3CCJ B;  4AF6 A;  1FTZ A;  1JUM A;  4EM0 B;  4BHC A;  2LK2 A;  4O5V A;  1OCP A;  2LC2 A;  3IH2 A;  3B8H A;  2BY2 A;  1N78 A;  4V2F A;  3WND A;  2YX7 A;  4KA4 A;  1HW2 A;  2OJE D;  3RDI A;  3GTP J;  5D5V B;  1SFK A;  1XDS A;  3BPX A;  4ASN A;  1QZE A;  1T39 A;  5LGT A;  4XR6 A;  5HNF A;  2F48 A;  1BJZ A;  1BI0 A;  1X3W B;  1OCO H;  4Y9U A;  4MR0 A;  1YFH A;  3RIR A;  3DTK A;  2OC6 A;  3JRA A;  2P0W A;  3K4K A;  3AG3 H;  1E3P A;  4ZV4 A;  4GGG A;  5DEQ A;  4DK0 A;  4R8H A;  1YLO A;  2GXB A;  3GTL J;  3W2E A;  5FKL A;  4B09 A;  1ZG3 A;  2CQQ A;  4MLO A;  3MD2 A;  4MNU A;  2G7U A;  4CCJ A;  4BDY A;  5IY5 H;  4BE0 A;  4JMQ A;  1MW7 A;  2XAF A;  4L5E A;  3W2V A;  1ZG5 A;  1R5O A;  2BF4 A;  1QZZ A;  2NT9 A;  2BY3 A;  3PQK A;  3CUQ C;  2XRN A;  3I64 A;  3F6O A;  3K6G A;  3H0D A;  1TYU A;  4NK8 A;  1IRG A;  5KK1 A;  4XM3 A;  2O7O A;  4YRV A;  3OV8 A;  4RGS A;  3OYH A;  4GFB A;  3A3B A;  1S7O A;  1AOY A;  3J7A Y;  5ED4 A;  2X1C A;  3ZXS A;  4TT3 A;  2G0E A;  2C4T A;  2NPF A;  2XRL A;  2DPD A;  4GRI A;  1SAU A;  1I8D A;  2BM7 A;  2D1H A;  1N75 A;  3HOX J;  1TTT A;  3BC9 A;  3OYI A;  5FB2 A;  3AG1 H;  2CO5 A;  1Z7L A;  2R0Q C;  3LAP A;  2CRG A;  4BH9 A;  1XPX A;  4X05 A;  1O8H A;  4RD3 A;  4F52 A;  1YI2 I;  3SEJ A;  1DP3 A;  2RAE A;  1GV5 A;  2ETH A;  2P6S A;  1XGM A;  4DBQ A;  2DA2 A;  2WAE A;  1X1C A;  1J7K A;  4W1U A;  3QQA A;  3GTG J;  1YIJ B;  2MGQ A;  2IAI A;  2Y48 A;  2WC2 A;  2BW3 A;  4R71 A;  1V0F A;  2J7K A;  3OR2 C;  5HOD A;  2JSC A;  4RAG A;  5KAF C;  2GWR A;  4BAC A;  2CV2 A;  3MMY B;  3N90 A;  3DU5 A;  1K79 A;  1T08 B;  4I84 A;  5LHH A;  9ANT A;  1S3J A;  4DNT B;  1E3H A;  1G7S A;  2CQN A;  2JJ7 A;  1M1K D;  1Y0R A;  2MD0 A;  1OFC X;  3E97 A;  2ME0 A;  3HBL A;  2X6W A;  3REO A;  1R4M B;  4OPV A;  4X7C A;  1J0R A;  3BC8 A;  3ELK A;  3U6K A;  4L0Z B;  5KVR A;  2LP0 A;  3BY1 A;  3HTU A;  4MGR A;  1TWF J;  2P8T A;  1JUS A;  3BNW A;  4P6Y A;  4AUX A;  1NB0 A;  3BZK A;  4HQM A;  3CME I;  3BT9 A;  5D4S A;  4IHY A;  2M45 A;  2EFG A;  2ZTN A;  1KD1 D;  2MW8 A;  1TYV A;  2IA2 A;  4XOP A;  3SFZ A;  2K9L A;  1HA3 A;  2FX3 A;  2Q6O A;  4B4D A;  2OQR A;  1Z9C A;  3OKX A;  2QX3 A;  3TDZ C;  5JHF A;  1WGX A;  4A2U A;  3PSZ A;  1ETX A;  4JK1 X;  2QA4 B;  1EZG A;  2VI6 A;  3UNG C;  5GPC A;  2K4B A;  1IAW A;  4AIJ A;  4XIC A;  3IH4 A;  2IGM A;  3KZZ A;  1HW1 A;  1SMY F;  3M1E A;  3VMF A;  4BUP A;  1BI1 A;  2QLZ A;  4DBR A;  2BPO A;  3WG7 H;  4TMW A;  3LSI A;  1RKT A;  1ZLJ A;  3A02 A;  2XZO A;  4O6J A;  4IRG A;  3Q9V A;  3AVV A;  1QA3 A;  1KZL A;  1Q7Y D;  2BVL A;  1F9N A;  3EYI A;  2K27 A;  3M3Y J;  1LFB A;  2UWM A;  1E2X A;  1WVR A;  1VZ0 A;  3S17 J;  1PJ6 A;  1AIR A;  2G7H A;  1I1G A;  2DFI A;  2HQ5 A;  2VIX A;  5B66 C;  4A12 A;  1MIJ A;  3OYM A;  3U6B A;  1XX5 A;  2ZL7 A;  2O6W A;  1HSJ A;  3NAU A;  3CLO A;  3RSN A;  1S72 I;  2X6Y A;  4RDU A;  1YJN B;  3OS1 A;  4RB2 C;  5D5U B;  5DD4 A;  3SDB A;  5E8I A;  2CF4 A;  3K4J A;  1VHO A;  2W6I A;  4RLF A;  4I01 A;  4N3N A;  4EMS A;  2JVG A;  1MMS A;  5EZH A;  2OBS A;  2V7Q A;  1LDD A;  2PEX A;  3NRV A;  3DEW A;  4UB6 C;  3A1P A;  4YZQ A;  4XLE A;  2ZO4 A;  4IZZ A;  4E7J A;  3NB2 A;  3VNU A;  3LQE A;  4CCK A;  2NAZ A;  1V3F A;  2PIA A;  4MEY F;  3E6B A;  2P5L C;  1G7C A;  1J9Z A;  4QV2 A;  1FC3 A;  4AID A;  1WSU A;  3CCR B;  2XTW A;  4LK1 F;  2BE5 F;  1LQ1 A;  4XN3 A;  1GDT A;  3BR2 A;  1VF7 A;  3CCE I;  4YAO A;  1GVD A;  3OR1 C;  3WHB A;  2HOE A;  3GFI A;  1N0V C;  5FJ8 J;  1NH3 A;  3ES9 A;  1N77 A;  5LHI A;  3FK6 A;  4BEH A;  3L2Q A;  5IYB J;  4GYI A;  1UG2 A;  4V02 C;  4X7E A;  3AL0 C;  2P7C B;  1ZGA A;  1WOO A;  2RN7 A;  1G3Y A;  2VNI A;  1EFC A;  1JTX A;  2BVM A;  3V76 A;  4B44 A;  1HW5 A;  3VYU B;  4WCG A;  1HKQ A;  3SQV A;  3I59 A;  3KET A;  2G9W A;  3OOU A;  4K1X A;  4ROX A;  3FX3 A;  3CDL A;  5ICE A;  3Q6R A;  1S6L A;  3IC7 A;  4NQW A;  1FMW A;  1YOV B;  3M4O J;  1QA6 A;  3OEE A;  4RDK A;  3DFG A;  1COW A;  2ZXJ A;  2GK7 A;  2CRV A;  2VBW A;  5F4O A;  1AIP A;  1YW8 A;  4IRI A;  3BQZ A;  2Y2Z A;  2H6C A;  2IBD A;  2OUM A;  4C43 A;  5EJC A;  2ZCW A;  4FK8 A;  3AFH A;  2E60 A;  2BM5 A;  1YW7 A;  1LUJ B;  2WV0 A;  4XMY A;  4ZH4 F;  2XSJ C;  4H0E A;  1NB9 A;  3KLN A;  1P4A A;  2NS0 A;  1T98 A;  4U4B A;  3O6B B;  1Z7U A;  5F1R A;  1V5V A;  2A61 A;  2QN6 A;  3E6M A;  3JSP A;  2DOF A;  4M9Z A;  2EFW A;  2K3F A;  2VJ5 A;  3H3Z A;  4KIG A;  2R7U A;  2A05 A;  2V1X A;  1W7P D;  1IDJ A;  2F4O B;  5FRO A;  4Y15 A;  1MMN A;  4P9U A;  5EMN A;  5J47 A;  4G94 A;  3TGN A;  4EGZ A;  1ETQ A;  3I4P A;  3ERM A;  3DKW A;  3A2K A;  2M34 A;  3DDY A;  1O8K A;  1PLU A;  3CLQ A;  1R5G A;  4G9Y A;  5JVG F;  2KL4 A;  1BX1 A;  2D3L A;  3G71 B;  1FNN A;  1QRY A;  3OYB A;  4Z4T A;  4BHP A;  1BW6 A;  2DI3 A;  3GQ9 A;  3F0C A;  3BOQ A;  2X48 A;  3V7S A;  3GFJ A;  4EM2 A;  1QX4 A;  1J9I A;  5L3E A;  1L1I A;  3MQ0 A;  2DQR A;  4HZF A;  2NVQ J;  3I4N J;  3MCA A;  1A6Q A;  3GLL A;  2COM A;  1VQ9 I;  3DU6 A;  1HLV A;  3MN2 A;  1P6R A;  3A01 B;  2X3U A;  5E3L A;  2E1M B;  2HU9 A;  2ZJP F;  4XOT A;  2KRC A;  4KH3 A;  2EFP A;  3SYJ A;  3KYC B;  3K4B A;  3KP7 A;  2HQA A;  1NTC A;  4BYY A;  1RUO A;  5IYQ A;  3VST A;  1NBM A;  2KDZ A;  3CC4 I;  1G8X A;  2LF8 A;  4IVN A;  2UZK A;  3AGQ A;  3DKX A;  2HKX A;  1FX0 A;  2L2O A;  1CNE A;  3A8I A;  5HS9 A;  4M0L A;  1Y39 A;  2HOA A;  4E7Z A;  2VFP A;  3GX4 X;  2CFX A;  4LLL A;  1R22 A;  2IW5 A;  1X0C A;  3T53 B;  1L0O C;  2W85 A;  3F8N A;  4A5M A;  2W25 A;  2V7U A;  1USS A;  2CW8 A;  2Q0O A;  5EG0 B;  2R7X A;  1OIS A;  5CKT A;  1YIT I;  4PUS A;  1LPQ A;  4KDP A;  5F0F A;  3ZZU A;  3TKY A;  1TQI A;  1AU7 A;  4PGO A;  2V1U A;  2WYR A;  1H42 A;  2H94 A;  2JN6 A;  2XAS A;  4CHU A;  3HGG A;  4CSW A;  5LBQ A;  1IDY A;  2C5B A;  2VQL A;  2Y9Z A;  2NTQ A;  4DZP A;  1D1B A;  2O8X A;  2Z5U A;  3LA2 A;  1IJF A;  2QKM B;  3SFI A;  2XGE A;  3HSE A;  4CZC A;  4ZDO A;  4PAB A;  1YJW B;  5GP9 A;  5D8K B;  3HPH A;  4Q48 A;  2HWV A;  4C2T A;  1KU9 A;  2EV6 A;  1DGW Y;  2O5R A;  3VYT B;  2HYG D;  2ZZF A;  2M0C A;  4A3F J;  3U9G A;  1D0X A;  3H09 A;  1O3R A;  4Z6Y A;  2LKX A;  3PSI A;  4A3J J;  2ISZ A;  2EZH A;  2K7L A;  2KJC A;  2X51 A;  2V1N A;  3S3O A;  1FZP B;  1N0U A;  4DZJ A;  3J80 Z;  5J1U A;  1K4S A;  1WSV A;  2W00 A;  2QGU A;  4Z4S A;  2VBT A;  3M8J A;  1RMG A;  3CZ6 A;  1TYX A;  4U7B A;  4RDL A;  3DTE A;  4XD7 A;  1ODD A;  3LL7 A;  4M6V A;  2DYS H;  3ECH A;  2CQX A;  2VC1 A;  4I6Z A;  4ESJ A;  1WQ2 A;  1WPK A;  4OU0 A;  1AKH B;  4YIF A;  2A3S A;  2DA7 A;  5F04 A;  4DYC A;  1Y1V J;  2NST A;  1E0E A;  2KIQ A;  3P27 A;  4KKS A;  4AYB N;  1MND A;  3VO2 A;  5K5R A;  2QCO A;  2BVN A;  3VSK A;  2JRT A;  2EIX A;  1WJE A;  4YAU A;  3LQR A;  4BQA A;  3G3Z A;  1YJ9 I;  4IHX A;  2IS4 A;  1EH8 A;  5H6Q A;  3DPU A;  2C77 A;  1ZEL A;  5E3N A;  3MHP A;  3HDD A;  1XB4 A;  5J1R A;  4M3B A;  4ZCM A;  1W5S A;  3T5X A;  1V5E A;  3FF5 A;  4F92 B;  3DCF A;  1RRJ A;  4I2O A;  1KYW A;  4NK6 A;  2CYY A;  1JJ6 C;  2XPV A;  2CV0 A;  1FBU A;  2MSY A;  3RKY A;  3RKW A;  1VQP I;  1O8G A;  3OOC A;  2M8G X;  1YX5 A;  3MKL A;  3GBG A;  3ZQC A;  3WY9 A;  5E8G A;  3ZMS A;  1ZM2 A;  4WZK A;  2Q8K A;  3NAR A;  3BJA A;  5CVJ A;  3V8K A;  3HJE A;  5JHU A;  2BXZ A;  1O3T A;  4G7O F;  3ABK H;  4BNC A;  3LVB A;  3S2H J;  1PXZ A;  3BH4 A;  1K83 J;  3F8F A;  2QQ8 A;  3B90 A;  4WF2 A;  3Q0V A;  3L09 A;  4L9N A;  3PO2 J;  5HKK A;  4Q7J B;  3T51 B;  2KFD A;  1BJA A;  4PZJ A;  1IDK A;  5EF6 A;  4OPS A;  3P9I A;  2H1L A;  1PJR A;  1X4O A;  5FNZ A;  1VQK I;  3L7W A;  4CIC A;  2XPU A;  1ENH A;  2VPR A;  4XLN F;  4QVA A;  2GBY A;  3F23 A;  5A89 A;  3Q9S A;  1XN7 A;  2ZTG A;  3HC7 A;  4RD4 A;  2BGC A;  4Y7C A;  3LMM A;  1O88 A;  2XTX A;  1KU3 A;  2XGC A;  2F2E A;  1K7A A;  5E17 F;  3MAJ A;  5ILU A;  4I99 C;  4RLZ A;  3WU1 B;  3OYG A;  3FMQ A;  3W5U A;  2H8W A;  4XSX F;  5A2Q K;  2M5S A;  2L4M A;  1Y6I A;  1TT0 A;  1RKW A;  3OSF A;  1OYY A;  3DU1 X;  4BE2 A;  3KPH A;  1IHM A;  3KYL A;  2F5C A;  5IOZ A;  3L2U A;  2LMD A;  2WJV A;  1LB2 A;  2D5V A;  4IOA F;  1JXS A;  2W24 A;  3BCB A;  2GZW A;  5L3F A;  3ROU A;  4XLA A;  1I3A A;  1T6Y A;  4E7H A;  1I27 A;  4ZCI A;  3GTK J;  4Y13 A;  4E4H A;  3QFT A;  4ACA A;  2UUZ A;  4LIV A;  2XGJ A;  1JGG A;  2EV5 A;  2VBS A;  3CP8 A;  4FN5 A;  3BPV A;  4G7H F;  3W2G A;  2J8K A;  1DPR A;  2CC2 A;  1ZN2 A;  4LB6 B;  2LY9 A;  2OZ6 A;  1ERD A;  3WOD F;  1WDT A;  2WY7 Q;  1VQO B;  2EQR A;  3MCZ A;  3R61 A;  2L7K A;  4UV9 A;  3BLY A;  3VDX A;  1V5G A;  3R0A A;  4A3G J;  2Z3Y A;  3EYY A;  3K1M A;  2EIJ H;  4KIB A;  1Y0U A;  3I71 A;  3E5X A;  3SJZ A;  4LIT A;  2DTZ A;  1YE9 A;  1R49 A;  3ASR A;  2XC7 A;  1A35 A;  2DMN A;  5L3B A;  2XV4 S;  3CCU B;  4OZY A;  3FXO A;  4YZ0 A;  2P81 A;  4BE1 A;  1OYW A;  2DK5 A;  3GLX A;  3HOU J;  2V7W A;  1CZF A;  1WHU A;  1OR7 A;  1ON1 A;  4Z4R A;  3P5J A;  4QTR A;  3IRQ A;  5F4J A;  3CCS I;  4YHB A;  1UEL B;  3ZBU A;  2VBY A;  4M6X A;  1FLI A;  3NWS A;  1O4X A;  3SQN A;  2XSD C;  1JKO C;  1FSH A;  2VQC A;  1BBY A;  3FWE A;  1GQ8 A;  4EQQ A;  2WJY A;  2NVY J;  1RU4 A;  3VOD A;  1R00 A;  1TWG J;  3TOB A;  4YXW A;  1Z3X A;  3G05 A;  3PM1 A;  3L1P A;  1O8E A;  3GCM A;  1KON A;  3C3W A;  1CF7 B;  2OV7 A;  5IYR A;  2Y0S N;  2LZJ A;  3UR3 C;  3OZU A;  2IPQ X;  4XKW A;  2XT4 A;  1SVM A;  1T6S A;  3CO7 C;  4XBF A;  1R4N B;  2FUG 2;  1N07 A;  4UAJ A;  2JJ1 A;  4E0F A;  1OGJ A;  4CDG A;  2EIM H;  4F7Z A;  3CCL B;  1U5T B;  3RKQ A;  4Y52 J;  1DAR A;  3JQQ A;  2HZT A;  1KTV A;  1BJK A;  1JKQ C;  4BXF A;  1GLN A;  1D8J A;  3BR6 A;  1VQ8 B;  3FM5 A;  5B1A H;  1KU7 A;  4RB1 A;  3PUF A;  1W7P A;  2X6O A;  4XKC A;  3JRE A;  2ZSH B;  3ASS A;  2RC6 A;  1QA2 A;  4IHS A;  2H8R A;  2VAS A;  2LY2 A;  4UV8 A;  1CGP A;  1QO0 D;  5IT9 K;  2YWH A;  5F0C A;  1OGM X;  5BS6 A;  3GTO J;  3DPL C;  1YRN B;  3D0S A;  3RYP A;  2IGK A;  4PFO A;  5JFR A;  4CH7 A;  3SXY A;  2L5Q A;  2CV1 A;  1MDM A;  4BXU A;  2CUF A;  2UXN A;  2ZXW H;  4ZTJ A;  2QEX I;  3KRG A;  5LHG A;  2VNJ A;  3ZRG A;  5KAI C;  4P6V F;  2VBK A;  4BS9 A;  1Z77 A;  1WTH D;  4ZC3 A;  2W4S A;  4BKX A;  3JSO A;  1IB0 A;  1S29 A;  3JAM Z;  3I55 I;  3HM5 A;  1EFR A;  2OQG A;  4PJN A;  2I1L A;  3IP4 B;  3SEQ A;  2R5Y B;  1KQ8 A;  3C2G A;  2CND A;  4RM0 A;  2EK5 A;  4EVI A;  4B3A A;  1E63 A;  2ZZG A;  2M3A A;  5HS7 A;  1EWY A;  4U9U A;  2XVC A;  2X8K A;  4A0Y A;  3GRH A;  2MFZ A;  3LO8 A;  1G6N A;  2OCE A;  1DPU A;  4E6K G;  3CJQ B;  2E2I J;  2GPJ A;  1OKR A;  2YUS A;  2DYI A;  4HYE A;  2L9S A;  1W9X A;  3HRT A;  3MZH A;  2W6J A;  5IYP A;  4W8S A;  2PJR B;  5CVR A;  1W0U A;  4TSF A;  2X0K A;  4RJL A;  4GO1 A;  2XC1 A;  5FKK A;  1FT9 A;  3JR9 A;  1Y8R B;  1MH3 A;  2AXT C;  3MFK A;  4GYG A;  2EB7 A;  1ZRC A;  1QGA A;  2WR8 A;  4LBY A;  1UFM A;  4CCN A;  5K5O A;  1O57 A;  4M74 A;  4PSW A;  1XDU A;  5E79 C;  5GAE J;  2VE9 A;  2D3N A;  4KIC A;  4CA0 A;  1SMT A;  2Q6L A;  2OBT A;  5C3E J;  3GO5 A;  4L5I A;  3A01 A;  1W0K A;  1BM9 A;  1MJA A;  3LMW A;  2JT1 A;  1Z3Y A;  4IKF A;  1NHC A;  1UG0 A;  1FIA A;  2V26 A;  2DDA A;  1XFO A;  5D8L B;  3ZN1 A;  1P4M A;  3OYF A;  2WAF A;  4RCZ A;  2XKP A;  4NB5 A;  5C1C A;  4NNJ A;  3WYA A;  2DDB A;  4RAY A;  3VOE A;  1Y56 A;  4EJU A;  3W6J B;  3JCU C;  4IHW A;  1BIB A;  4XLC A;  1GVH A;  3A8K A;  4A3C J;  4M4S A;  5TJJ A;  1UJ8 A;  2IS1 A;  2ECC A;  1RQR A;  3HRU A;  3CC2 B;  1LFU P;  3TQN A;  2DFE A;  1XMA A;  5EDN A;  4BJ6 C;  3V7C A;  3BY2 A;  3CC7 B;  1G7R A;  5EG0 A;  1IN4 A;  1OR7 C;  4HNT A;  2ZC2 A;  2KHM A;  4PJL A;  2MC3 A;  4M72 A;  4XK4 A;  1GO2 A;  3BZC A;  2RNJ A;  1UZC A;  4C2M J;  2OTJ I;  3ISX A;  4S05 A;  4E7S A;  1NHA A;  3V42 A;  1WZ2 A;  3ML6 A;  4G5G A;  1BI2 A;  1U9N A;  2WAQ A;  2NRA C;  3H9J A;  3OSG A;  4I0B A;  1XMK A;  5C44 J;  2AS5 F;  3CES A;  4FCY A;  3PL8 A;  2NVU B;  5FIU A;  3WXM A;  4UUS A;  5DDG A;  2BY0 A;  4AU7 A;  3AAF A;  2LR8 A;  5DS9 A;  3S2D J;  2INU A;  1LKX A;  4YFK F;  1ZAR A;  3WTT C;  1HOM A;  4X06 A;  3C1D A;  5IP7 J;  3L9F A;  1BQE A;  3QFC A;  4RS8 A;  1SFE A;  4A6D A;  1YO5 C;  2JTV A;  2XAQ A;  2XAU A;  2VON A;  4II3 A;  4EJW A;  1OB2 A;  2EBI A;  4L9T A;  2HI3 A;  3QYB A;  2O1D A;  2R4G A;  1ZHF A;  3F72 A;  2NV4 A;  3DP7 A;  4MEX F;  1A36 A;  1DG1 G;  5H59 A;  1WH7 A;  1LE8 B;  2RVC A;  2XTY A;  3B4N A;  2JRM A;  3B8Y A;  3T8R A;  1BN8 A;  2WWY A;  3RPQ A;  1TWA J;  3ZOB A;  1IG7 A;  1JE8 A;  4QSH A;  2A6H F;  1OCT C;  1BOB A;  4MFE A;  1H9G A;  1TW3 A;  3FK7 A;  1AWC A;  1SM4 A;  4G7X A;  2EFO A;  1ZR2 A;  5D5W B;  5AMV A;  4PGG A;  2LD5 A;  1FYM A;  1VQN I;  2ISY A;  4I7H A;  4IRH A;  3AVY A;  2R3S A;  4G6T B;  2NT6 A;  5ICF A;  2LFB A;  3TBI A;  2INV A;  2JMW A;  4DNR B;  2L02 A;  1R71 A;  3ISP A;  3GVJ A;  2W7Z A;  2M0M A;  2XEX A;  4IEJ A;  3PA1 A;  3HAG A;  5HLI A;  4QIW N;  3AKZ A;  4IJA A;  2AO9 A;  3CMA B;  4IQ4 A;  2HDN B;  5FA6 A;  3I9V 2;  2WV1 A;  3CP2 A;  5M5X J;  1DDN A;  5E3O A;  2NTP A;  2DIE A;  3WTS C;  3Q0W A;  2X3H A;  3V4G A;  2C5H A;  4HSR A;  3LSP A;  4S04 A;  2KVO A;  2VJJ A;  3J7A O;  2OYN A;  2YWF A;  1BC8 C;  5KNL A;  4BBS J;  5JVT A;  4FE4 A;  4Z2Y A;  3ZQQ A;  4R79 A;  2R92 J;  1FP2 A;  4CQJ A;  2FOK A;  2CFO A;  4ZYD A;  3S1M J;  2IJL A;  1EH7 A;  3PEN A;  3PIO F;  2M1B A;  1CQX A;  3H36 A;  3FKS A;  2CSO A;  2VOO A;  2BYV E;  4Q4Z F;  1GJR A;  1PKV A;  4X7D A;  1VQM B;  4BQQ A;  1VQ4 B;  1RUN A;  3OWT A;  1NDH A;  1TTY A;  4ITV A;  1FOX A;  2DCU A;  1ZQ3 P;  1Y8Q B;  3AVU A;  5CDF A;  5CVU A;  5TRD A;  3HXL A;  2DAO A;  2MA3 A;  3CJR B;  1TUI A;  1E3Z A;  4PC1 A;  2E5Z A;  4XID A;  4BJT A;  2VQH A;  3TOA A;  3FXL A;  5CQE A;  4C3H J;  1ZM9 A;  1QHH D;  2HVQ A;  5JLW A;  2A5W A;  3TH0 A;  2F5F A;  1D1N A;  2C4U A;  1UAA A;  2KKO A;  1E17 A;  3OE7 A;  1X1P A;  1EP2 B;  4LBV A;  4HW0 A;  1CLW A;  2BSP A;  4A3K J;  4LBZ A;  4YEL A;  1VQL I;  1POG A;  2KRF A;  1H89 C;  5A8A A;  1D8K A;  3ML3 A;  3BR1 A;  4U88 A;  2M5W A;  3ZPN A;  3GF2 A;  3H35 A;  2X53 S;  3KX2 A;  2AQE A;  3NWT A;  1PYV A;  4ZGQ B;  1B8I B;  4KN7 X;  2WAD A;  1MMG A;  4RBO A;  3FZV A;  3G2B A;  1KJZ A;  2B5O A;  2EFN A;  2PMZ A;  3J7Z I;  5LMZ A;  4G8X A;  3VSV A;  3PET A;  2V7F A;  2E19 A;  3BH6 B;  4B8X A;  1H80 A;  4TMX A;  3S1Q J;  3ZC3 A;  3WE3 A;  1UHS A;  2ICW G;  4U0V A;  3S3M A;  3NQO A;  2EFQ A;  2C6Y A;  1FSE A;  4FXU A;  5F4M A;  3A0H C;  3D5S C;  2EZL A;  2L9N A;  1IDZ A;  5EEA A;  5KHD A;  2XAJ A;  1XE1 A;  2QBY B;  2XND A;  2CG4 A;  4CXF A;  5GV7 A;  3I54 A;  4PDK A;  3S2W A;  3IAS 2;  3R6J A;  3U2Q A;  1IXC A;  1XCV A;  1A04 A;  2ZME A;  3BQY A;  2DY1 A;  2K3P A;  2R7V A;  4EH1 A;  1Q86 D;  3DXJ F;  1HQC A;  4KMF A;  1WJF A;  1T95 A;  2LG4 A;  5E18 F;  5B3S H;  2WSS A;  2OAZ A;  5FL7 A;  2VXD A;  4LG0 A;  3JTG A;  1V54 H;  2LDU A;  2Z9O A;  3M7G A;  3RZD J;  4MQV A;  1KK1 A;  4DQ2 A;  2O6G E;  1P9Q C;  3QFS A;  5A88 A;  4ZYH A;  1PUF A;  3ZMV A;  5H5J A;  3ZIA A;  4IX7 A;  4DYQ A;  1TLH B;  2FJ1 A;  2BZT A;  5ERI A;  1ZM3 A;  3BRO A;  1TBX A;  5E20 A;  4OIP F;  4L9V A;  1UD5 A;  1JJ8 C;  4UVC A;  2XB5 A;  1S5L C;  1R6R A;  1S7A A;  4HX8 A;  2N8G A;  4I98 B;  2VJI A;  4XRS A;  3TO9 A;  2GXG A;  4BHB A;  2E71 A;  2DW4 A;  2NNY A;  3QP6 A;  2DMQ A;  1E43 A;  4PAA A;  1DBG A;  2HVR A;  1WFX A;  2FD5 A;  2QZ8 A;  4WXH A;  1FOK A;  1D5V A;  3LSG A;  3OPO A;  4L5J A;  5HDG A;  3VYR B;  1OHH A;  3FXJ A;  4D5F A;  4Y7N J;  5L46 A;  1BW5 A;  1TC3 C;  3KEO A;  5LLQ A;  1OB5 A;  2DQL A;  1FOW A;  3ZMD A;  3LNN A;  1JNY A;  2JPB A;  4A3D J;  4XNF A;  1QFZ A;  4A3B J;  3J7Y J;  2HGC A;  2M30 A;  4MQ9 F;  1EXM A;  3KP3 A;  2JSP A;  3BG6 A;  2FMY A;  1O3S A;  4LB5 A;  3ABU A;  1VLY A; 
#chains in the Genus database with same CATH homology
 3DPU A;  2CUJ A;  1ZEL A;  2W7N A;  4B43 A;  3PUB A;  3TL4 X;  2O17 A;  3GQA A;  2NOJ B;  1V5E A;  4F92 B;  4HRI A;  4Y33 A;  3BCD A;  4NK6 A;  2MC4 A;  2CV0 A;  2JIZ A;  1O8G A;  4D9J A;  3OOC A;  4PJM A;  5KCM A;  2KMU A;  1VBL A;  4NQW B;  3RQ4 A;  1YX5 A;  3MKY B;  3GBG A;  4FAS D;  1UD3 A;  1G59 A;  4DK1 A;  1BPL A;  2XZP A;  2V9K A;  1JI8 A;  4H4K C;  4D1Q A;  1KCC A;  2UVE A;  2KLO A;  4OJP A;  3W3C A;  2R7W A;  2GJK A;  4B48 A;  1PXZ A;  3BH4 A;  3E1S A;  5CQG A;  3B90 A;  4JQF A;  3ZR8 X;  4RMN A;  5HKK A;  4C30 A;  4KKT A;  3T51 B;  1W0J A;  1IDK A;  3DKY A;  3EUH C;  4BQN A;  4ZTF A;  2V31 A;  4U49 A;  1AA7 A;  3MKW B;  1PJR A;  1X4O A;  5CPR B;  2DCE A;  3TMO A;  4XQF A;  3OYC A;  4C9Y A;  2MAB A;  1X19 A;  3DLA A;  1LVK A;  2DXI A;  1O8M A;  2ZTG A;  3HC7 A;  3NE5 B;  3LMM A;  1O88 A;  2VBM A;  4W8Q A;  4J01 A;  4HPQ A;  2RQQ A;  4EAT A;  4Y3O A;  2KZV A;  3DEE A;  4NC7 A;  4F3Q A;  2JUG A;  3OYG A;  2ZZE A;  3A3G A;  4P22 A;  3VYS B;  2M5S A;  3CMM A;  3OAA A;  4GQN A;  2CW7 A;  1Y6I A;  1TT0 A;  2E1M C;  4NC8 A;  2X6X A;  4BE2 A;  3VWB A;  3KYL A;  5FRM A;  3L2U A;  2WJV A;  4W8R A;  2PEC A;  3OIQ A;  2NZM A;  1J09 A;  2EWE A;  3EUK L;  1V5F A;  3BCB A;  4KIT B;  5HLT A;  1NG6 A;  3HKZ A;  2IXS A;  4XLA A;  3HL2 A;  2M7A A;  3OS2 A;  4E7H A;  2WZP P;  5LD2 C;  4XN0 A;  2Z2S B;  3WQZ A;  4HG2 A;  3QOD A;  4E4H A;  2UUZ A;  4LIV A;  3RCO A;  2IS2 A;  2XGJ A;  4C2L A;  2KPM A;  3HG9 A;  1RWR A;  3CP8 A;  1WMR A;  3OYL A;  1DQU A;  2GOX B;  2V4D A;  1MMD A;  1ERD A;  4MXN A;  2Z16 A;  1TZL A;  4CUG A;  3LSK A;  3WWG A;  2WY7 Q;  4Z03 A;  2L7K A;  3E0J B;  4XL9 A;  3BLY A;  3VDX A;  4ASU A;  1V5G A;  3FY3 A;  2JVH A;  4OAY A;  4X0G A;  4LIT A;  1HA8 A;  4AYB A;  4DOZ A;  1YE9 A;  1K28 D;  2Z8G A;  2XC7 A;  4OZY A;  3VMW A;  4YZ0 A;  4F55 A;  1I18 A;  1QCX A;  4BE1 A;  3ZPP A;  3JUR A;  4KJZ A;  1CZF A;  1BHE A;  2PYH A;  3F9K A;  4ZDL A;  1S9H A;  1UD2 A;  1EE6 A;  3S8P A;  2DT7 B;  4OZZ A;  1UEL B;  2HPM A;  2GK6 A;  1O8D A;  2LH9 A;  4RM2 A;  4BQO A;  2CS3 A;  3NWS A;  2CK3 A;  3KEW A;  2HZD A;  3BCF A;  1OOC A;  2ELJ A;  3H9G A;  2R7T A;  4B3X A;  1H8H A;  1QJV A;  2VQC A;  2E1B A;  4G6I A;  3K10 A;  1GQ8 A;  1T5E A;  2WJY A;  3S93 A;  3D5L A;  1RU4 A;  1O8L A;  1X1A A;  4LIU A;  4CCL A;  2WPD A;  4W8T A;  4YXW A;  2HVS A;  1Z3X A;  3G05 A;  1EA3 A;  2CH0 A;  2X85 A;  3I3L A;  1O8E A;  1K6Y A;  1DGR M;  1KON A;  2UVF A;  2OV7 A;  3K4M A;  2LZJ A;  2F5V A;  3UR3 C;  2HPI A;  1X1D A;  4XKW A;  4OJL A;  1X4P A;  3OS0 A;  4DGW B;  2Q2E B;  2LRE A;  2FUG 2;  4E0F A;  2JJ1 A;  1VJS A;  2WB1 A;  3FPP A;  4YZA A;  1OGO X;  2LC2 A;  2F1M A;  5LFA A;  1O8J A;  1N78 A;  3ZCO A;  4CCO A;  3HUG B;  3FDY A;  3OIP A;  1W36 C;  1JRG A;  1SFK A;  1LDK B;  1K5C A;  3D5R C;  4BXF A;  1GLN A;  2ZSI B;  4XR6 A;  5HNF A;  4BU2 A;  2R7Q A;  4B47 A;  4XKC A;  5HVQ C;  3HOT A;  3FBN B;  4MR0 A;  2ZSH B;  3DTK A;  2OC6 A;  4BGD A;  2P0W A;  2VAS A;  3K4K A;  4HEA 2;  2LY2 A;  3GQB A;  2QY1 A;  4DK0 A;  2AQF A;  4ZDP A;  1IB4 A;  4XKV A;  1BR2 A;  1OGM X;  1WJC A;  1WPC A;  3KEY A;  3DPL C;  2XF7 A;  2IGK A;  4PFO A;  4ZYA A;  4MLO A;  4BE0 A;  3MD2 A;  4CH7 A;  4CCJ A;  1D0Y A;  2L5Q A;  4BDY A;  4JMQ A;  1MW7 A;  3W2V A;  2CV1 A;  4EW9 A;  3AL0 B;  2VQG A;  4HWV A;  4ZTJ A;  2NT9 A;  3OYE A;  3ONQ A;  3K6G A;  3KRG A;  3H0D A;  4NK8 A;  3ZRG A;  2VBK A;  4BS9 A;  1E3X A;  4HIZ A;  2JJ2 A;  1WTH D;  4ZC3 A;  2W4S A;  4XM3 A;  2BOL A;  4YRV A;  2CMP A;  3OYH A;  3U21 A;  1V0E A;  2KRH A;  4KT6 A;  3A3B A;  3J7A Y;  2PYG A;  1EFR A;  2X1C A;  3ZXS A;  4TT3 A;  2XDV A;  4PJN A;  3SUC A;  3IP4 B;  4GRI A;  3FKJ A;  3SEQ A;  1SAU A;  3SEZ A;  1I8D A;  1N75 A;  3H9Q A;  5DN6 A;  3BC9 A;  3C2G A;  3OYI A;  3ZGK A;  2A6T A;  2R7R A;  1E79 A;  2KQR A;  1Z7L A;  4Y4R A;  2M3A A;  5HNH A;  2ZZG A;  1O8H A;  4DJA A;  2X8K A;  2QXZ A;  2PJR A;  2LBF A;  1W36 D;  4F52 A;  2I8D A;  2MFZ A;  2RNG A;  3GRH A;  4OJ6 A;  3MKZ A;  1DP3 A;  3EPZ A;  2IS6 A;  4E6K G;  3CJQ B;  2ZXI A;  3DQV C;  2INV A;  3VR6 A;  2K5C A;  4DBQ A;  2L9S A;  1W9X A;  2WAE A;  4QPQ A;  2W6J A;  1X1C A;  3OYN A;  2M4G A;  2PJR B;  4OJO A;  4W8S A;  4TSF A;  1NG7 A;  3VSU A;  4XON A;  3S32 A;  3M1C A;  2BW3 A;  1LFP A;  1V0F A;  3OR2 C;  2X1E A;  2VJ4 A;  2ZZQ A;  4CCN A;  1WJD A;  2M4K A;  4PSW A;  1H8E A;  2D3N A;  2GOM A;  4BAC A;  3OY9 A;  2CV2 A;  3MMY B;  4I84 A;  3DU5 A;  4YZX A;  4CA0 A;  3EQN A;  2Z1D A;  4DNT B;  2BW3 B;  1W0K A;  1HVX A;  4J00 A;  2MD0 A;  3LMW A;  4IKF A;  1Z3Y A;  2F43 A;  1WJA A;  2X6W A;  1UG0 A;  1NHC A;  2V26 A;  4DIQ A;  5C1C A;  3BC8 A;  2QKL B;  2WAF A;  2Y0S A;  3PNT A;  3OYF A;  4BL0 B;  3T9G A;  4NNJ A;  2VB6 A;  4Z1M A;  2WBM A;  1Y56 A;  4PFP A;  2W1O A;  4XLC A;  3W2W A;  1E1R A;  2ZTN A;  4XLF A;  1XG2 A;  1HG8 A;  4URR A;  1KTW A;  4XOP A;  4PMH A;  2K9L A;  2QX3 A;  2IS1 A;  5JHF A;  4PK4 A;  3C2H A;  4BJ6 C;  3UNG C;  3OL4 A;  1OR7 C;  2IGM A;  4HNT A;  2KHM A;  4PJL A;  2HNH A;  3SZG A;  4BUP A;  1PE9 A;  2UV1 A;  4DBR A;  3LSI A;  2ZXH A;  2XZO A;  4E7S A;  4OAZ A;  4E7K A;  3V42 A;  1KZL A;  1WP6 A;  2BVL A;  3GVK A;  2DJI A;  4E7L A;  2UWM A;  1X1B A;  2WAQ A;  1VZ0 A;  3H9J A;  2R9V A;  3EUA A;  1AIR A;  3H5N A;  2MYS A;  3CES A;  3PL8 A;  3VSL A;  4AVZ A;  4HST A;  2VIX A;  4AU7 A;  3OYM A;  1UD6 A;  2INU A;  1LKX A;  3RSN A;  1UD8 A;  2X6Y A;  3L2R A;  3OS1 A;  4BJ5 C;  3SDB A;  3A1Y A;  3K4L A;  3K4J A;  1BLI A;  3K4N A;  2W6I A;  2XAU A;  4RLF A;  3T56 B;  4II3 A;  2JVG A;  2V7Q A;  3QYB A;  2O1D A;  2R4G A;  4ANJ A;  4YZQ A;  4XLE A;  4IZZ A;  4E7J A;  4F93 B;  3DTI A;  4CCK A;  2Q1Z B;  2M7B A;  1BR4 A;  3B4N A;  2VKH A;  3BCA A;  2ZFU A;  3B8Y A;  3OEH A;  4JOM A;  3L2W A;  4XN3 A;  5IK2 A;  2IGN A;  3H5R A;  3W2A A;  1VF7 A;  4YEJ A;  1BN8 A;  3OR1 C;  1O8F A;  1BOB A;  4G7X A;  1N77 A;  5AMV A;  4G7W A;  4BEH A;  3L2Q A;  3AL0 C;  4G6T B;  4B3G A;  2NT6 A;  1D0Z A;  3TBI A;  4N4O B;  3OYJ A;  2DOA A;  2BVM A;  4DNR B;  3GVJ A;  2HDW A;  3VYU B;  4B44 A;  2M0M A;  3HAG A;  3OOU A;  3AKZ A;  4OJ5 A;  4BEH B;  1O8I A;  2CUZ A;  1FMW A;  4IQ4 A;  3I9V 2;  3CP2 A;  4U87 A;  2VKD A;  3OEE A;  3K70 C;  2NTP A;  2DIE A;  2VL8 A;  2X3H A;  2O0V A;  1COW A;  2KVO A;  3QOE A;  4HSR A;  2GK7 A;  3EQO A;  2VJJ A;  1IRX A;  2K9M A;  4P1W A;  4RLQ A;  1BMF A;  2GJP A;  5KNL A;  2ODL A;  2OUM A;  2WA0 A;  3GQ8 A;  3ZQQ A;  4R79 A;  5C1E A;  1T0F C;  3AFH A;  2E60 A;  2CFO A;  3A35 A;  3A4C A;  4XMY A;  3DWL E;  1D1C A;  2V4J C;  2XSJ C;  3S3N A;  3FKS A;  3OL3 A;  3OFN A;  1OFM A;  2LOO A;  1PKV A;  3OYA A;  4BQQ A;  4U4B A;  3OWT A;  3DPT A;  4ITV A;  2XOK A;  1OB0 A;  2KDO A;  4TKO B;  5CDF A;  3HPG A;  1MMA A;  4HNU A;  3HXL A;  4XOR A;  3CJR B;  2WY8 Q;  1IA5 A;  1SKY B;  3OYD A;  2R7U A;  2VJ5 A;  1E3Z A;  2LBF B;  1KCD A;  1IDJ A;  2E5Z A;  2NTB A;  3RPU D;  4BJT A;  2VQH A;  5FRO A;  3H94 A;  1MMN A;  3IUO A;  5CQE A;  1QHH D;  2HVQ A;  1DBO A;  3A2K A;  4II2 A;  4C2U A;  2A5W A;  3DDY A;  1O8K A;  1PLU A;  1UAA A;  1BR1 A;  3OE7 A;  3N05 A;  3GVL A;  2KL4 A;  2D3L A;  2BSP A;  2NSP A;  4YEL A;  3OYB A;  1MAB A;  2R7S A;  3GQ9 A;  2R7O A;  3BG7 A;  4KKU A;  4KIS A;  1WJ5 A;  3ZPN A;  3K70 D;  3H35 A;  2X53 S;  3KX2 A;  2AQE A;  2DT6 A;  3NWT A;  1PYV A;  3IAM 2;  3OYK A;  2WAD A;  1MMG A;  3QYF A;  2IGO A;  3DU6 A;  1FMV A;  3G2B A;  4NUB A;  4E7I A;  1NRK A;  2PMZ A;  3JU4 A;  2E1M B;  2HU9 A;  4XOT A;  3PSF A;  5FRN A;  2KRC A;  3VSV A;  2V7F A;  2X1D A;  2XF5 A;  3K4B A;  2HQA A;  4CCM A;  3VST A;  2HLD A;  2JA2 A;  1H80 A;  1NBM A;  1G8X A;  1QU3 A;  3DKX A;  1MNE A;  1FX0 A;  1WJB A;  2L2O A;  3S3M A;  4Z06 A;  4FXU A;  3D5S C;  4UZU A;  2L9N A;  4E7Z A;  3PNV A;  2RRE A;  5KHD A;  2IQ7 A;  2XND A;  1X0C A;  3T53 B;  3CF2 A;  5TGT A;  3IAS 2;  3PNY A;  3QYE A;  4FET A;  2CW8 A;  4XKB A;  1OLT A;  3HOS A;  2K3P A;  3L2V A;  2R7X A;  5CKT A;  4Z05 A;  2R7V A;  3PFY A;  4PUS A;  1JTA A;  2KP6 A;  1WJF A;  1KMH A;  2GJR A;  1T95 A;  2LG4 A;  3FHN A;  2WSS A;  5FL7 A;  2VXD A;  4LG3 A;  1QHG A;  4CSW A;  5HOO A;  4OWR B;  2VQL A;  1P9Q C;  3LSM A;  2NTQ A;  1D1B A;  3ZIA A;  4IX7 A;  4P5O A;  4PSX A;  2VLA A;  2QE7 A;  4RM3 A;  2QKM B;  4ZDO A;  4CZC A;  3ZSC A;  1UD5 A;  3HPH A;  4F91 B;  4C2T A;  1UD4 A;  2LYC A;  2LRD A;  2W82 A;  1DGW Y;  2O5R A;  1R6R A;  3VYT B;  2F4I A;  4L8J A;  3OW7 A;  2ZZF A;  2VJI A;  4XLH A;  2JDI A;  1YX3 A;  1D0X A;  1E1Q A;  3FBI B;  1OFL A;  3PSI A;  2F6C A;  1E43 A;  2VPL A;  2O04 A;  2X51 A;  1DBG A;  2V1N A;  3S3O A;  4N4N B;  2HVR A;  1WFX A;  2W00 A;  3RTR A;  3M8J A;  1RMG A;  3CZ6 A;  4PJJ A;  4U7B A;  3SYT A;  3DTE A;  3OPO A;  3LSG A;  4IQJ A;  2XF6 A;  4XD7 A;  2VXZ A;  3LL7 A;  3OMY A;  2Z6B D;  3VYR B;  1OHH A;  2VBE A;  3LSH A;  3LFU A;  3GQ7 A;  1D1A A;  2O0W A;  4B3F X;  1HZE A;  1Z21 A;  2NST A;  3VMV A;  4QPO A;  1E0E A;  3LNN A;  4KKS A;  2E5N A;  2XZL A;  1MND A;  4ZJZ A;  2V6E A;  4XNF A;  1U0J A;  3K4C A;  3VSK A;  4BDZ A;  1WJE A;  3H5A A;  2JSP A;  2IS4 A;  3BG6 A;  3PJR A;  3UW0 A;  1VLY A;  2LY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...