2X76A

The crystal structure of phaz7 at atomic (1.2 angstrom) resolution reveals details of the active site and suggests a substrate binding mode
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
342
structure length
342
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of PhaZ7 at atomic (1.2 A) resolution reveals details of the active site and suggests a substrate-binding mode.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
total genus 132
structure length 342
sequence length 342
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x76A00
1UKCA 3G0CA 1LPOA 3WLAA 4ZREA 1XRRA 5BWBA 3FBWA 5AOAA 4J0CA 4DIUA 4GHWA 3B3QA 3E1GA 2WG1A 4UBJA 5T4EA 1EVQA 5HF8A 2OG1A 3GZJA 1CUGA 3H2HA 4CG3A 1QLWA 1JI3A 1QIGA 3C6BA 4QDZA 4J0KA 3I1YA 1CUYA 4H0CA 3S2ZA 2C7BA 4Y7DA 2WHPA 4KRXA 1ZIXA 5C81A 1UKBA 5K3FB 2WG0A 3OPMA 3WL5A 4XWGA 4DYHA 1W75A 1E5TA 4AN0A 3I2KA 4GDMA 4QDUA 3KDAA 5JYCA 4OB7A 2XUIA 1WHSA 3ESCA 1CUFA 3QZUA 4KR0A 3ED1A 1E8NA 2WJ4A 4J0IA 4G9GA 1ZIYA 2PSJA 4UBMA 4X97A 1UOPA 4DSAA 3C6ZA 4A5SA 4QNNA 1BN7A 1ETHA 5EGNA 4NMWA 4FMPA 2Z3ZA 4BAGA 5CT4A 3HI4A 4B6GA 1XZMA 3HXKA 2X5XA 2RHTA 2HA5A 3DCNA 4OSEA 5EHNA 5KWJA 1EHYA 4XIIA 1R3DA 1LPPA 1VA4A 3IBTA 3BF7A 2DHEA 2RAUA 2XQGA 2H7CA 1H2ZA 1CPYA 3IB3A 4FOLA 5JALA 5T4FA 2OGZA 2HA3A 3GUUA 4DMHA 2JGFA 1Z68A 5ALHA 1CUBA 2C5GA 2WLSA 4KAJA 2Z5GA 4Y2TA 4H77A 3BDVA 4J7AA 2XQFA 3DYIA 5I8PA 3U1TA 5EHZA 4PO3X 4B7ZA 2YXPX 1U2EA 3D2BA 3WMRA 1M33A 1SCQA 1TK3A 5A71A 4FNGA 4AO8A 2PM8A 1IZ7A 3WI7A 3FNBA 2D5LA 1QIEA 3DS8A 3K9BA 1WPXA 3STTA 4Y2UA 4X90A 5FXMA 4U2DA 1TKRA 4FDMA 3KXPA 3WWOA 1FFCA 2O2HA 3W06A 4BVJA 3MUOA 4UUQA 4UFOA 1HBJA 3G0IA 2IIVA 1QIKA 1MX5A 3RKSA 4N8DA 4DGQA 5JAUA 4I3FA 1UK9A 2WJ3A 1VLQA 4IHAA 1CLEA 4UPDA 4BBZA 4HXFB 4UBKA 1N5RA 1DWOA 4RPCA 1OXMA 4KE6A 1YS1X 2I03A 2PKYX 2R11A 5ESRA 1UZAA 3ANTA 2HL6A 5LIPA 4RNCA 1CQZA 5AK5A 3ZLVA 3WK9A 1XZKA 2FJ0A 1LBTA 1Q0ZA 1SCKA 4WY5A 1AGYA 5ALQA 2H1IA 5LP1A 3KWFA 2WIGA 2HM7A 1IVYA 3WWEA 1CUIA 1VE6A 3STYA 3D2AA 2QXUA 4AMZA 2BUBA 2QJRA 2ZSHA 3X3HA 1UXOA 5LZ4A 3JW8A 4IO0A 1L7QA 1F8UA 1BCSA 4U2CA 3PUHA 5AKYA 4HS9A 1ISPA 1ZGCA 5A7FA 5CTAA 1WPRA 5EHXA 4EY5A 1DQYA 2Z8XA 1RWQA 5A62A 4H7EA 4K5QA 1AQLA 1EVEA 1PV1A 1UK8A 2FX5A 4HZGA 1QIJA 3RLIA 2I78A 1K8QA 3DNMA 3QBJA 1ZOIA 5AIAA 3G9TA 4M0EA 3WZLA 5CMLA 5EIEA 3EQ8A 2DCMA 2JIDA 3KSRA 3G8YA 5D3ZA 3T52A 2V98A 3H0CA 3D4LA 4X94A 3GELA 1TCBA 3QPAA 2RONA 2CKMA 3WK6A 3STXA 4W9RA 4DSZA 3A70A 1H2YA 4Q05A 2G5TA 3EF3A 2PU7A 1QFMA 3A2MA 2WUFA 3HABA 4X95A 4C6HA 5K3FA 4X6UA 3G0BA 3HJUA 5C8VA 2OCKA 4OYYA 2VTVA 1H2XA 2V96A 3OURA 1L7RA 4BTLA 3CXUA 1LZKA 1R88A 5ALYA 1ORVA 2I3ZA 5HK8A 2XUAA 4L9AA 4MYDA 4X91A 1CUEA 2X76A 2OQVA 5JAOA 3H17A 3WKDA 3BF8A 1DWPA 2CMFA 2AXEA 2C0QA 4P93A 4Y2YA 1RP1A 3NOXA 4L72A 2WFZA 1EB9A 1EB8A 3CCBA 1Y7HA 1AURA 3MVEA 5I7UA 4JYPA 3M81A 3D2CA 2XMQA 2DSNA 4X93A 2VQ6A 5AM5A 4HRYA 5CW2A 3OTQA 2W22A 4TVKA 2XUFA 4FLMA 5AKHA 4KYVA 3H1BA 4FFWA 1G66A 3BE8A 1GPKA 3R0VA 2XQJA 3EIOA 1AX9A 4KE7A 2H7YA 2ROQA 4MEAA 1JJIA 2B4KA 3VDXA 4OYLA 2XMCA 3PE6A 3MUNA 1QO7A 4FKBA 2OPHA 4LKOA 4B85A 5AI0A 2ZJFA 2OXEA 3T4UA 1Q83A 2ORYA 1CUVA 1CFJA 3FYUA 3ANSA 2WJ6A 1MN6A 1CUJA 3BDIA 2X8BA 5IVHA 1G42A 5HZGA 4OU4A 2QXTA 4AMYA 3WKAA 2AJLI 4E15A 2JGKA 3AJAA 4WFJA 4KJXA 1P0QA 3IIIA 3TEJA 3WWCA 4XVCA 3PICA 3AZPA 2ZJ7A 1XRPA 2WIFA 2VSQA 4HXEB 4JEIA 4AZ3A 5ALNA 1BU8A 3W2TA 1K63A 1CEXA 4DNOA 5ALWA 4GEGA 2VAXA 3W9UA 5EIHA 1K4YA 1EINA 2RI6A 1ZD5A 4FHZA 2QUAA 2PPLA 2HA6A 5HK9A 2ACEA 3HYSA 5A6VA 1B41A 1WCYA 5AK6A 5D6OA 1R9NA 1FFBA 1DT3A 1T4MA 4X85A 2DFPA 1MNAA 1XRNA 4UHDA 1GKLA 5AH0A 4UHFA 1CUCA 1N8SA 1JU4A 3O9MA 3GBSA 5FKJA 4J0HA 1ODCA 1ZD3A 2HA0A 4W63A 4QDTA 3DQZA 4XX1A 4FNMA 5HKBA 4FLEA 5HF9A 3M3DA 4I19A 4CCYB 4DM7A 4E14A 1P0PA 5EIAA 4QA9A 5AKZA 2WIKA 1HLGA 4Q3LA 4ARBA 4WFKA 4WDQA 2Z3WA 4TPKA 4DNQA 3STUA 4MQLA 1W52X 1N5MA 2XMSA 3E4DA 3R3ZA 1UK7A 1UKAA 2AJDA 3AZOA 1YA8A 3P2MA 3EQ7A 1MT3A 4GI1A 3ZWQA 4H35A 5JANA 3HACA 4G8BA 3HRHA 5AP9A 2XLBA 3B5EA 3RM3A 1BEEA 1A7UA 1QGED 3AZQA 4F0JA 1VZ3A 1XROA 3WZMA 4KRYA 4Y2QA 4LYDA 3Q0TA 1TIBA 3QMWA 4MXDA 3V1LA 3ZLUA 2BUCA 1T2NA 4JH0A 3QH4A 4RGYA 4M0MA 1WB4A 1KU0A 2XUGA 4HTAA 6YASA 1CUHA 1TRHA 1DQZA 4G5XA 5AOCA 3R3XA 2QR5A 1E89A 1VJ5A 3G9XA 2QVBA 3H1AA 3V48A 5DWDA 5D3KA 3ZPXA 3ESBA 2ONCA 3C8DA 1AKNA 3BJMA 2AJ8A 3C5WP 4MEBA 4NVRA 1BCRA 2RGUA 3A2NA 3WA6A 2Y6UA 5JD4A 4DTCA 2V9ZA 5KWIA 1W1IA 3HSSA 2XMBA 3DL4A 3WWPA 3A6ZA 3LS2A 4N5IX 5AI8A 4X7BA 2O2GA 2HFKA 4GW3A 1BN6A 4C4YA 4ZV7A 1R50A 3M83A 4AO6A 3QMMA 3O9VA 1JMYA 1U65A 5JAHA 5IVDA 1WOMA 2JEYA 4B9EA 1QTRA 1XZBA 1U4NA 2PSDA 1DU4A 2FUKA 3WYDA 3DOHA 5E4YA 5AI9A 4U2BA 2PUJA 4BAZA 1CUWA 3PDCA 1GPLA 1XFDA 4LIPD 1DINA 5LKRA 7YASA 5AI4A 4HRXA 3K6KA 3DD5A 3VJLA 1VE7A 2O7RA 5K5EA 3TGLA 2WU4A 5T4BA 1UOQA 3O4GA 3U0VA 4H18A 1J06A 1THGA 5EHQA 5LZ2A 4Q3OA 1ZI8A 4WDRA 4XJVA 4NS4A 4UHHA 2GZRA 3OC0A 3C87A 1XZGA 2VAVA 3O4JA 5BOVA 5ALZA 4B9AA 4P92A 1SOMA 1THTA 2BKLA 3F9CA 2CZQA 3WKBA 4X92A 1ZJ5A 4Q1VA 1QOZA 1MJ5A 3H18A 4UBNA 4X3CA 1DX6A 1EA5A 1YB6A 3H04A 3IURA 1HL7A 2PU5A 3BIWA 4BDTA 5JZSA 5IH7A 4CG1A 4JUIA 3F67A 4MQMA 1JU3A 1EI9A 2XUPA 3V1MA 4Q3KA 1X70A 4NZZA 2JEZA 5IVKA 5C8XA 4Y2XA 2VF2A 4ZGBA 2QOEA 1EX9A 4ZRDA 3CN7A 2BCEA 5AO9A 4BVLA 1MAAA 4KE9A 2WSLA 2ZVDA 4IH1A 4FWBA 2C58A 3ESAA 4DNPA 3AILA 4X00A 1KEZA 4TGLA 3ZI7A 1QIIA 1GQRA 1CUUA 4G4GA 2CB9A 1J2EA 5ALUA 2GBCA 4W1PA 4F5ZA 2Y6VA 3PF9A 1ZI6A 1XZFA 3BXPA 3BJRA 2FJPA 3AINA 3R3UA 4C4XA 5AM3A 2V97A 3SC2A 1EK2A 2GBFA 1DT5A 4H7JA 2Z8ZA 1WHTA 4BE9A 1VKHA 5CT6A 5ALDA 1XKLA 2WUDA 5FPQA 3HZOA 2WIDA 4UBIA 5AKEA 5FRDA 1G5FA 3W05A 4A16A 2GBIA 2WKWA 4ZI5A 4GLBA 1LPMA 2Y2UA 4UHCA 3VKFA 2O7VA 5AKLA 3R41A 4OB6A 5ALFA 4CI9A 1P0MA 3FLEA 4S0XA 4ZV9A 5AI5A 3I2JA 4Y2PA 5HKAA 3V1NA 5JAPA 3ICVA 2DHCA 4CIBA 4CFSA 1NU8A 2VT6A 4G1FA 1Q0RA 4EB0A 3D3NA 2CJPA 4WCVA 3KOOA 5FLKA 2HU5A 3VJKA 1DWQA 3AUKA 3FLAA 4KE8A 1C4XA 2WHRA 3LLCA 2ZYRA 1XRLA 1XLWA 4Y2SA 1YB7A 1LBSA 4W1SA 4G8DA 4QZVA 3VVMA 5JIBA 2OCLA 5LZ8A 2AJCA 5JZ9A 3LIPA 2OGTA 3G9ZA 3D59A 4IQ4A 3D0KA 4BB0A 3O95A 2QS9A 4B84A 3I2GA 1K5PA 5H3HA 5EI5A 5LZ5A 3ZLTA 3DOIA 3H2JA 4UBLA 4BC1A 4H7IA 5HQ3A 2GYWA 2D0DA 1TQHA 1W4LA 3WL6A 3KD2A 4PW0A 4BAUA 1XZHA 3I6YA 1XQVA 5CXUA 5JZBA 4YASA 2WG2A 4PSDA 3I2FA 1QIDA 3NGMA 2HIHA 3PFCA 1TCCA 5AM4A 2XE4A 3UMJA 3LCRA 2DQZA 4ZWNA 4UHEA 3QPDA 2PVSA 1AMNA 3IUJA 3TJMA 1XLUA 3VVLA 1BRTA 1GGVA 2WIJA 4G9EA 1E8DA 4W1QA 1IUNA 2ES4A 1ZI9A 1NX9A 4GBGA 3IUMA 2OGSA 1BE0A 5DJ5A 4X71A 1QFSA 1VOTA 1XLVA 4HVTA 1SC9A 2VT7A 5FV4A 1CIJA 4K6GA 4ROTA 2Q0XA 1XZIA 3I1IA 4LXHA 1DTEA 1QIHA 2VJAA 4KACA 1WM1A 3O0DA 3GA7A 3N2ZB 2DQYA 1DX4A 1OILA 3IA2A 2XMDA 3UUEA 3FCXA 4B81A 5E4TA 3B12A 1ACJA 3WWDA 5JD5A 1QIFA 4J3JA 5ALTA 4YK7A 4FBMA 4JYMA 1JJBA 5ALVA 2ACKA 5FP0A 1LNSA 1UOOA 4PSUA 1VA5A 5JARA 2VATA 3QPCA 2PSEA 3MGAA 5K3BA 1RYYA 4BZWA 5ALXA 3O4IA 4QLAA 1HKHA 3EQ9A 1USWA 2HA4A 4IH4A 3C70A 2HDWA 1CV2A 2OQIA 4U2FA 5CT8A 2IITA 3N0TA 4FFVA 4BZZA 4AB1A 2PX6A 4QDXA 1XZDA 2C0PA 4MWSA 1LZLA 3RK4A 1MTZA 4P9NA 3WIOA 3FYUC 3A2LA 3G0DA 1LPNA 3PFBA 3DLTA 2JGJA 4QE3A 4C88A 4CCWA 1K6EA 4U2GA 5ALSA 4EY4A 1G4HA 1C7JA 3SK0A 2PL5A 1BEZA 1QIMA 2PSHA 1UFOA 1EDBA 4N8SA 3QMVA 2GZSA 1QONA 1A8SA 4B83A 3L1HA 2Y1KA 4GECA 1XZJA 4O08A 5ALJA 1YA4A 5AI6A 3DJYA 1A8QA 2WM2A 2QUBA 4G4JA 1WB5A 3LIIA 5CT5A 1W76A 2J3QA 5AIBA 3JWEA 3H2IA 3QYJA 3V1KA 3VXKA 5D7BA 5BWCA 1W6RA 3PI6A 1E8MA 2VA9A 3IULA 1QTIA 4OB8A 3WK4A 1XZEA 1JMKC 2OCGA 4UHBA 4LYEA 5A2GA 4H7HA 5E2IA 1P0IA 3OG9A 2XLCA 5LZ9A 5AKKA 1JJFA 2EEPA 3AIKA 3G02A 4ARAA 1R9MA 1FFEA 2QRUA 4Z49A 4C4ZA 3GFFA 2OLEA 3R3YA 5AKGA 4X6XA 1FFAA 3BWXA 2JGLA 3Q8WA 4B80A 4WJLA 1BS9A 2WFLA 3H19A 5LYYA 4BCBA 1TAHA 3PUIA 3DDUA 5DTJA 4N8EA 5CBKA 2ZJ6A 2PUHA 5LKAA 3DEAA 4J03A 2LIPA 4BE4A 3YASA 5CURA 5BV7A 5HCUA 2WQZA 3F98A 2XUDA 1GT6A 1ODTC 4BRZA 2QZPA 2QJWA 1ZD4A 5JATA 4BTVA 3STWA 4KEAA 1I6WA 2QTBA 3BIXA 3FLBA 1JKMA 2G63A 3WJ1A 4ETWA 5HFAA 2JF0A 5K3CA 3R3WA 5ALOA 5SYMA 2ZYHA 4UBOA 4QEKA 2HA2A 4H7FA 1IUOA 2OAEA 2HADA 5CH8A 2ZYIA 4H7KA 4WY8A 4Y9SA 4BP8A 5JD6A 4OCZA 4HXGA 1KU6A 4J0JA 5CH3A 1BROA 2O2IA 2WFMA 5HQ3B 2B20A 3QVMA 1XQYA 3OOSA 3FYUB 5EFZA 4MJ3A 4GWLA 1YAHA 2RIPA 2QKYA 5IVIA 1YSCA 5FDFA 3I6ZA 5IKXA 1ORWA 1HPLA 4GXNA 4L3WA 4C89A 1LPAB 4C87A 1FJ2A 1ZICA 2XQIA 4V2IA 1XRMA 1UK6A 1F0PA 3WK7A 4FTWA 3ICWA 4AQDA 3ILSA 4INZA 1EH5A 4MYSA 3E0XA 2XUOA 4BYMA 2Y2VA 4OUKX 2E3JA 2XUHA 4AO7A 3EBLA 3GROA 1XRQA 2C4HA 2JGEA 3L1JA 1YS2X 1TCAA 3AIMA 3F97A 1X2BA 3AFIA 1X2EA 2HHAA 2ZYSA 3VISA 1H22A 5DYYA 4G8CA 2WUGA 2UZ0A 1EDEA 5J3JA 1CUAA 3FCYA 1FFDA 4OU5A 4PNZA 4E46A 2OAGA 1LGYA 4G4IA 1EDDA 5A7HA 2PBLA 4X6YA 4DMKA 4EUSA 1JT2A 4K6KA 4Q82A 1F0NA 4CG2A 1CRLA 1ACLA 2VJBA 4AXBA 1VXOA 5AM0A 4LHEA 5SYNA 5I9IA 2BFNA 4QWMA 1H23A 1E66A 5LLSA 3C5VA 2WFLB 3W04A 4BATA 2XQKA 5DNVA 4RE6A 4WFIA 3FWHA 2XMGA 1CUDA 2VEOA 3STVA 3IUNA 4BDSA 1EK1A 2XT0A 4DLNA 3NUZA 4UFNA 5AKIA 5ALLA 3TRDA 3UUFA 2WTNA 4ITVA 3CN9A 2CEKA 3C43A 5FPPA 5ALRA 1SCIA 1YAJA 3FSGD 4Y2JA 2YASA 3C6XA 4PSCA 2R8BA 1U8EA 5JASA 1CQWA 5AKXA 2WTMA 5E4JA 4PQEA 4Q34A 4PF1A 4LXIA 3V9AA 5DNUA 3BL8A 2XUQA 3HEAA 3I28A 4EBBA 1R1DA 2GYVA 1HQDA 3QITA 1J1IA 1YR2A 5C8ZA 2J4FA 3WKCA 3SWWA 1F6WA 1AZWA 3I2IA 4K2AA 4J0DA 2G5PA 2VJCA 5AK4A 5K3DA 3DKRA 4EY6A 2WU3A 1Y7IA 2YH2A 1UWCA 2BGNA 3DKKA 1AUOA 2WHPB 1XZLA 4EA6A 1QE3A 4FLFA 3WQHA 2P8SA 5DLPA 4DNFA 3VJMA 1H2WA 3OM8A 2HA7A 1QZ3A 1IMJA 1XKTA 5ISMA 3FSGA 3RARA 1LLFA 5ALMA 1PJAA 4DMFA 2BJHA 5AK3A 2HRQA 3F96A 2CBGA 5CRIA 5C7YA 4QLOA 4KAAA 4AX4A 2HRRA 1Q84A 1ZJ4A 5ALIA 3DYVA 1MAHA 2CUTA 2XI4A 5DYWA 2BUAA 3G7NA 2OCIA 2VJDA 2XMRA 2C5FA 2GBGA 4CIAA 2BAGA 4KAFA 2YYSA 1IUPA 3WKEA 3H2GA 2JGMA 1MX9A 4EY8A 2XB6A 5DYTA 1N1MA 1VXRA 2G4LA 4L0CA 3R3VA 5K3AA 5AKJA 5HF6A 4BCDA 5A7GA 1Y37A 4BCCA 5F4ZA 5T4HA 1HDEA 2H9YA 2WHQA 3D7RA 4AZ0A 3FYTA 4N5HX 5AJHA 5LZ7A 1E3QA 3C45A 1ZD2P 2XMZA 1GZ7A 1ZGBA 2HU7A 1D07A 4F60A 4H7DA 3HLKA 4BVKA 1IZ8A 3D5EA 1MPXA 3DL7A 3S8YA 4B0OA 2BGRA 4DMCA 2EDCA 1VZ2A 1C7IA 1A88A 3W9BA 3H2KA 2ZSIA 5HF5A 4E11A 5ALKA 1FSSA 1CVLA 3FOBA 4W1RA 1J07A 4ZXFA 3WA7A 2J4CA 3IUQA 5ALEA 4Y2VA 3WYNA 4Y2RA 1R4ZA 3C8HA 4BRSA 5AHXA 5K3EA 4QWWA 4K6HA 4BP9A 3E3AA 2NW6A 1YASA 5CT9A 1GXSA 5ALPA 3WL7A 2HFJA 3JYHA 5JADA 2AJBA 2XUJA 3O4HA 2ECFA 1WB6A 1B6GA 1CUSA 2IX9A 3C6YA 4MWTA 1QJ4A 3WL8A 1GKKA 2DR0A 3M82A 3L1IA 5YASA 1MX1A 1QO9A 2B61A 1CUXA 5AOBA 1UT6A 1OCEA 4OD0A 4CCYA 2HU8A 4YX9A 4AN1A 2XUKA 4PV7A 4BC0A 4D9JA 3LP5A 4IH9A 1SFRA 1EXWA 1XZAA 3FAKA 5DNWA 2GYUA 1O6GA 4C01A 1CUZA 2JGIA 3QM1A 3WIBA 4FBLA 1PFQA 2QMQA 3G0GA 3HC7A 1L7AA 1MU0A 4B0PA 3WK8A 4EY7A 2EDAA 1JFRA 5AM1A 5AICA 5CXXA 1LPSA 3NWOA 5KREA 5FOQA 1GQSA 3IDAA 3KWJA 1XZCA 5KBYA 3FVRA 3R40A 4UFPA 2QT9A 1GPNA 3F8SA 1XQWA 4YPVA 1LPBB 3I6MA 4I4CA 4A23A 2WILA 3SX4A 3FVTA 3K2IA 3ZV7A 2I3DA 3CCCA 5FUMA 4HAIA 1AC5A 3WJ2A 2K2QB 4LXGA 4M0FA 4RE5A 3G9UA 3WK5A 4B82A 5CH5A 4J0GA 4U2EA 1O6FA 1NU6A 3ESDA 5AM2A 2J3DA 4EHBA 1XQXA 2PSFA 2RHWA 2XDWA 2B9VA 2JBWA 1S8OA 3AIOA 1MO2A 1YCDA 4P08A 2QM0A 5ALGA 2WUEA 5DTIA 3PF8A 3I2HA 1ODSA 4JNCA 1MNQA 1CR6A 2W6CX 2H7XA 3IVMA 1A8UA 4F21A 4OPMA 5HFNA 4QDOA 2DHDA 4EZIA
chains in the Genus database with same CATH superfamily
3ZWYA 2BKVA 2EQAA 2ZE6A 1B14A 1BDBA 1W29A 1T8TA 1G4UR 1U2GC 3GRKA 1FIUA 4PG4A 1SNYA 3PVCA 3M1IA 3E53A 3TZHA 3BMXA 4L7VA 3TYXA 1L8QA 2X9GA 2A33A 5FTLA 4DIUA 4J0CA 1XWFA 4CT5A 3B3QA 3E1GA 4ALJA 1R4NA 3CRRA 3RDPA 1VCHA 4UBJA 3TXYA 2REQB 3IFSA 5T4EA 4YJFA 4CKYA 2VJPA 3K4QA 1S2LA 3EC2A 2R6HA 3N7UA 1ZW6A 2OG1A 2R4TA 4J0EA 4C08A 3U80A 3H2HA 2XH8A 1EXDA 5BN3B 3F6RA 2VG8A 4WNAA 4F56A 3LGSA 1AVTA 1D04A 3I92A 4QHYA 3ZNQA 2H1OA 3GLFB 3L7KA 5MFPA 3GEEA 2IODA 4H3HB 5HCIA 2GVZC 4MUNA 3WGQA 3ZDEA 4ZI7F 3KTOA 2JBHA 4JLPA 2J32A 2HBZA 3FTFA 2QG6A 5IAEA 4LE2A 1KE1A 3K70B 1GCAA 1MA3A 1M1YB 1PK8A 2Z1MA 4TS1A 1TADA 4BX3A 4EABA 2O3JA 4YALA 2HMTA 2XTJA 3AEZA 1G17A 3DMTA 3F49S 4YGXB 4YQZA 2CB0A 1B0PA 5GM2A 4JLMA 1OV6A 3O4RA 5EFOA 2C9ZA 2EWVA 1TMYA 3PNOA 4BLSA 2NV6A 1QKJA 2P75A 1JFFB 4KYUA 1PV4A 3KYBA 2HXGA 2XTMA 5FUXA 3WWYA 3EXEB 2QMHA 4BLTA 2UXCB 1T3HA 5AW5A 4DQDA 2OA0A 4AJNA 5A9SA 2G77B 3ERCA 1J42A 1QDEA 1OHHA 1UEJA 2YX1A 3A11A 1UZMA 1E7SA 1JEDA 4Z0HO 1T29A 4R2MA 3F0TA 4WOBA 5HKKA 1E5TA 3UQZA 4HNTA 1UIMA 4W9MC 3LFTA 1L5HB 5CLLA 2G0AA 4EPXA 3H9JA 2ZWVA 2D7CA 2FXVA 1JHUA 4GDMA 3DP9A 2FZKA 3GA5A 2EZ8A 5AXAA 4G41A 2C5LA 4B6SA 1QRSA 2HT1A 1K7YA 3WBFA 5GP1A 3BTUA 4QPCA 4AJKA 1CUFA 3I8SA 1YA6A 5GOZA 2GF0A 4NXNB 2C4NA 1QS0A 1YB1A 3REFA 3H13A 1XKQA 2YDYA 2Z57A 2WJ4A 3ED1A 2XOXA 3QKSB 4NCIA 3SQDA 4DVJA 4NMHA 3OEEA 4BGDA 1KIAA 3H5NA 2H1LA 1WEHA 2QNRA 4MA0A 1ECFA 1K5GA 1KJ9A 1NMXA 2CFSA 3LBHA 3JQFA 4GPEA 4TKVB 1KSGA 3ZYZA 4B5LA 4RTPA 3FY4A 4CN9A 3VYUB 4JR0A 4R6WA 2IC5A 3D31A 1PL6A 1HETA 1Y48E 4X97A 4OSOA 4TKZA 4DSAA 3KX2A 2FPOA 3QIVA 4IRMA 2NOAA 1YRHA 2JIZA 4OQFA 4RF5A 4WA7A 3EPHA 1KC1A 2FW0A 1PZXA 1EHIA 1SBZA 1E7WA 5E6RA 3ZHQA 1TTPB 3CO0S 3FG9A 4JEMA 3NGLA 2IYEA 4TWBA 3JQPA 3TG8A 2JI4A 2YQZA 1ETHA 3ZTYA 5B1DA 5HPYB 5IYZB 4NMWA 4UDNA 1XXLA 4FFNA 1S4QA 2PZLA 4PS0A 3EQ6A 1W87A 2J0UA 2QTAA 3EPPA 2IPAB 1GARA 3AP1A 3DTVA 4KSBA 3IUPA 4E1AA 3KM0A 3Q5DA 3CSUA 2J48A 2A4MA 2YFYA 2EQ5A 3NM5A 4NG4A 1HOTA 2X2OA 3HXKA 5KKAA 1AT1A 3Q6MA 2XD9A 3NTUA 4X1YB 1ZGHA 1L5GB 3UXYA 3UYLA 5E9JA 2N46A 2VVTA 1YU6A 2BTOA 4Q37A 3TW0A 3WYBA 1T0UA 3ZE9A 1W49A 5HKOA 5LDHA 5JQGB 1Q15A 3QVSA 3W0LB 1K7SN 1FYFA 1BE1A 2ZRPA 2IEIA 2G72A 4U7FA 2QX4A 1T0HB 3ABSB 3ZXIA 4LF4B 1VA4A 1Y3HA 3IBTA 3R5HA 2NTYC 3BF7A 2DHEA 2XQGA 1UT8A 1H2ZA 2ERXA 3AI3A 2VXCA 3JATA 2ZI4A 4L28A 5DSZA 1O5TA 4U39A 5BN4B 3UANA 3C1OA 2GTIA 4FOLA 3RVJA 2VZ8A 2X2EA 1CVRA 1Q7TA 3IALA 2P3QA 3RS9A 4YV0A 4L78A 2HHLA 1GAQA 4ENSA 5KS2A 1VB5A 1RVV1 2Q5HA 3ROGA 2OV3A 4DRYA 3U5TA 4AS3A 2HA3A 2FPXA 2P7IA 5EL0A 4IL5A 2JGFA 5BXYA 5TQ2A 4GL2A 2PMCA 3CLSD 4WKPA 5BYKA 4LHSA 2J6BA 4XWYA 5DLDA 5G0WA 3VYSB 4EB3A 4JKOA 1CK4A 2JB9A 3BL6A 2GF9A 1OH8A 4J7AA 1QWSA 3NWBA 3ZE0B 4C4TA 2AC4A 5CIYA 4AICA 4BXOA 1DNPA 2HMUA 2IIPA 1Y7LA 3HKBB 4KZKA 2QEQA 1G8YA 4DJAA 3Q2KA 1OW3B 1SQ6A 5BN1A 1TYCA 5I8PA 4ENWA 1GNTA 1L4KA 4IUYA 1D09A 3BXXA 3CR7A 1N4DA 1C1HA 4JGBA 3RKRA 2PKXA 5EHZA 1O0BA 1FMLA 1JJVA 2ATIA 4PO3X 5JCOA 4DLZA 4E2ZA 5E38A 1EZZA 2YXPX 1XF1A 2C7RA 3OP4A 1US8A 4U5XA 2ORWA 2GN2A 1NYQA 1WKVA 4OQEA 3D2BA 1XF9A 2Z56A 1IBSA 3HXOA 1H4QA 2E37A 2VJOA 3PL5A 1ICEA 1NZFA 4JJ7A 1Z5WA 1NVVQ 4F6CA 1Z07A 5JNTA 3AFNA 4HEQA 4L9RA 2HRDA 1CW2B 1I33A 2VF4X 3LFHA 4L0QA 1LQUA 2AEJA 5B2FA 6GPBA 4M8NE 3STTA 4Y2UA 5TB5A 3GGOA 2NU6B 2A9QA 1S9DA 3BGIA 3A1DA 5KAMA 3S2ZA 4R81A 4F4JA 1JDVA 5LD2B 1TQ2A 2BMJA 2NNLD 1TKRA 2IU4A 3OT1A 4NPCA 3RB8A 2FSVA 4KFCA 3OY7A 4CRWB 2PL1A 3NCTA 4N5DA 2YS6A 4D8UA 2B8NA 1NW6A 2DG2A 5CLJA 5D3MA 4QUJA 4IHJB 1DXOA 1M34A 3CLUD 4JHLA 1VG0B 1QIKA 3TQSA 1MX5A 1O0CA 1K8YB 3I0MA 4HGZA 2GZAA 3PL1A 1RU3A 3RKSA 4DGQA 5AVXA 5HZMA 4J2TA 5KPJA 2QR2A 3QU7A 4KI7A 1NJGA 1GTMA 1HDZA 1VLQA 4YGYA 4J4BA 1T25A 3N3AC 4KO1S 3T3MB 4K8OA 2EARA 1DC4A 3NBXX 5B7NA 5IMBA 4UPDA 3BEOA 4RVGA 5CYFA 1N5RA 2B69A 3SEAA 4BKOA 1W96A 4PC7A 1R8JA 5BWNA 1YS1X 2P3OA 2PKYX 1OAKA 3C85A 3RJTA 5ESRA 4OQXA 3ZK7A 4TMXA 3T7TA 1BDMA 5LIPA 3ADBA 2FNAA 3A14A 3FUUA 4MW0A 1KPGA 1TVCA 3P27A 3GCWA 2FJ0A 4F8YA 5HZKA 3W5IA 4CW7A 3MG9A 1IJBA 1GSAA 4D0LB 1RRFA 5KEIA 3WNDA 1AGYA 4FYHA 5J59A 4E21A 2MTBA 3DKIA 2AG1A 2H1IA 3HU5A 4RH0A 3LT1A 2CHUA 5DCUA 5BSKA 5LP1A 5TF0A 5IKMA 4XM2A 4F96A 5D1NA 3ZBQA 3G13A 3KQTA 1SXJC 1I9CA 4I1RA 1A8HA 3KZOA 4CDRA 1XP5A 4R31A 2FZVA 3VKHA 3DE7X 1KWKA 4TUYA 2GK4A 4O4JF 4M8SA 3RUHA 1IVYA 4X1IB 3DZIA 1UAGA 2LZ0A 3AY3A 3H2BA 1G0OA 3O9ZA 3V5NA 1L7XA 3G5MA 1BKSB 4IVPA 1LDNA 3IXMA 4RZ3A 3TCNA 3GARA 4K3VA 1UBMS 3IQIX 3STYA 4N54A 4MMZB 4D3YA 5AD1A 4MQEA 4TMVA 5KQRA 4KIUA 4AI6A 5CYPA 1NBHA 3LCVB 3QMPA 3J7TA 1F9AA 2BUBA 3I9JA 3JU3A 2DQKA 1Y80A 1AS2A 1K0UA 3GLIB 5IK2D 3PUVA 4JGGA 4L95C 1TA4A 3KU4A 1KFBB 4IGKA 1XHFA 4DV4B 2CMGA 4CR6A 2RFLA 2YXLA 5A4MS 3MHTA 1R6BX 4C2UA 4COKA 4RBNA 1TT5A 2PVPA 3I83A 4IDNA 4XQCA 4Z3KA 1ISPA 1M5TA 2W2NA 3BH6A 5HEKA 1P31A 1PDVA 1Q12A 3R0ZA 3PKIA 4FFBA 3RHTA 4YXWA 4D98A 5KOHA 2QAJA 4Q6WA 2I3BA 5AR1A 3SHQA 1Y1TA 1L4BA 1T5BA 2G9QA 2RJ3A 2ZIVB 2E4YA 4FIZA 2RHMA 4ONEA 4PPGA 1G2IA 1XG5A 2C20A 3CEMA 3DTTA 3GI1A 3GMDA 1DXQA 3G8BA 4DS3A 1QG4A 1YQXA 1THMA 3WSTA 4PLYA 3LCUA 2W90A 3FIUA 4X1YA 4Q39A 3GGGA 1QRRA 2HBYA 3EGDA 5BVGB 5C34B 3L01A 3D43A 3L8MA 4IKEA 1OBCA 4GBMA 5A06A 2QV7A 2FQWA 4BNDA 3EFBA 4QGHA 3W1EA 1OIVA 1EBUA 1KTVA 1DXYA 1XR3A 3ORFA 4WTOA 1ZVVA 3SJBA 3ZGOA 1NJSA 1PV1A 4P3OA 1Z3CA 4WERA 5BRNA 1PO7A 1ORTA 1H3EA 3HBLA 1WIWA 2WIAA 3DNMA 1DADA 4M1QA 3AF2A 1IY9A 1I6LA 3ILYA 1DIOB 3NZEA 4UXHA 1Y3IA 2GJ4A 3D3EA 1U04A 4TL9A 3WZ2A 1JWAB 4P0QB 3NH9A 5MF6A 2X1MA 4QQRA 3AHGA 2HLDD 3MJDA 4BLQA 5CMLA 2ATEA 2PBFA 4IIUA 3EQ8A 4DCOA 4DCPA 2DCMA 4RFLA 4EJ2A 4JOBA 4QRDA 3IP6A 2J9ZB 2IXGA 3C3EA 3PIDA 4KAXA 3VQTA 1OPRA 4MDYA 1DKMA 1L5RA 2G67A 2Z4SA 3GW8A 4F1WA 3FDFA 3RS3A 3DQQA 3LBAA 3HB0A 2VO1A 4B6FA 5ITWA 1VLVA 5DVZA 4ASUA 4UDOA 4REOA 3TUIC 4ZAYA 4GYKA 3L0SA 3T3OA 1S2MA 4Z54A 4RJJA 4HDRB 2WDPA 4QGFA 1NHWA 1HEIA 2CKMA 4L6IA 3FBTA 4DSZA 4CWAA 1RT9A 1R0RE 1CNEA 2E6KA 2Q1TA 4P7JA 3CB4A 2V0GA 3DEFA 2HIGA 3VPCA 2VHWA 3LUHA 3EF3A 5HQTA 4JT4A 4HUJA 3M5WA 2IH2A 4FMCB 1D7OA 3TLJA 3O90A 2EIXA 2H4JA 3K70D 1K86A 2F1KA 1RWOA 2D4HA 4RMHA 4OF4A 4D43A 3M4JA 4GXTA 1M76A 2A88A 4TWIA 3TIGA 4C6HA 4EG0A 1ECGA 1H0HA 1Y4UA 3U39A 4X6UA 3HJUA 1IM5A 1HQKA 2IXTA 5JS6A 3P9KA 3DMPA 4K9DA 1RHKA 5AJYA 2WYOA 1UQRA 3V3TA 3F73A 3NT5A 1U8FO 2G6TA 3VPHA 3V4ZA 3R5KA 4KQ9A 5DBOA 2TSYB 1OWNA 3H8JA 3HZZA 9ATCA 4BTLA 5FT9A 3VBEA 1UBSB 2NU6A 2WD8A 3OJ0A 3ZXUB 3ZD7A 3G2OA 2HC9A 4UNRA 2H8KA 2Q3FA 3KQNA 1OFTA 3DXFA 1JBKA 3KE8A 3R9IA 5TR9A 3Q8KA 4WY2A 1FS6A 3HYTA 2OVBA 1BE8A 1W5EA 4YRNA 2XCTB 2CXSA 2VP6A 3PFWO 5M7EA 1P1CA 2N47A 3DDNA 1M34B 3ZW9A 4EMUA 1PUJA 5DWQA 1B42A 2FP4B 5CU7A 4MV9A 4PO8A 4BZXA 2A5LA 1XJWA 5LIRA 2WF7A 4BNJA 1N75A 2CMFA 5L3SA 1KXZA 4DM3A 4OK6A 4TV8A 4F5WA 3M4ZA 2V3CC 1HZZC 3HCEA 3AYZB 2AXEA 2VP3A 1BVUA 2OYSA 1X0XA 3HFGA 3CZ4A 2YQ4A 3NOXA 4LDNA 4OO3A 4INJA 4TTVA 4L72A 2IEZA 4GU5A 5I9NA 3FDJA 4IMJB 1EB9A 3M6VA 4DIKA 4TL6A 1N0UA 3MVEA 3WMEA 4P31A 3EGEA 3VZRA 4D9EA 3KS9A 1O97C 4JYPA 1TYDE 4KXQA 1N2SA 3DW1X 3MWEB 1M1XB 3EXFA 3EE6A 3GDGA 3ROPA 3ZX4A 4GKJB 2GJAA 4BFWA 5CR9A 2XMQA 1GN8A 2ZWMA 5LOVB 3G2MA 2DSNA 4U7HA 2HMSA 3UMBA 4KNYA 2Q0HA 3TBHA 1TECE 3FETA 2YUIA 3NXSA 1M6EX 3ECSA 3O1LA 4HRYA 4HVAA 3PQEA 1IUKA 3V55A 1N36B 4FNAA 1E1KA 5AKHA 1XELA 5JLAA 3PFGA 4KYVA 4BTEA 2G25A 2KMLA 3EFEA 1G66A 2EJBA 4HFRA 4M76B 2PKWA 3BE8A 4WA8A 4YT8A 2QQGA 1R4MB 3R0VA 3RVQA 1NIJA 3EIOA 4IDPA 4X1IA 4YJKA 4F1JA 4KE7A 1ULHA 4M49A 3B60A 3A6FA 3EIUA 2QUKA 2ROQA 2ZULA 1S3FA 1VJCA 3OECA 1YJBA 4F71A 1VL2A 1TTTA 3CUUA 2BOVA 2CVOA 3MAGA 2A59A 4IV5A 2BGWA 2YWRA 5BSUA 2O2EA 5DIZA 1ICIA 1XN4A 1VJTA 4QELA 4EJSC 2OT3B 3Q3GE 2X0DA 5BMVB 1PR2A 1SKBA 2IZ0A 4MEAA 1B0UA 4TTAA 4UE2A 1YVPA 3PJEA 4ZI7A 3D9QX 2YVAA 4OYLA 2XMCA 1HDIA 3QLJA 1TEZA 2V74B 4N76A 1GQQA 2QAIA 1Y89A 2WZCA 4J3FA 5IT9A 5JSHA 1IWOA 4YJ2B 3ZGLA 5J1TB 2VHXA 3A7EA 5F3WB 2E4XA 2P90A 1ULUA 4NZPA 3MTEA 1GPYA 4O4IF 4R2IA 2Y1LA 3T4XA 3WQSB 3BBPA 2YJGA 4LTDA 1VCMA 4HDQB 2NO6A 5AJUA 3F5SA 3HNOA 4LKOA 5CLHA 2ZUTA 4B85A 3G0HA 4INOA 5I47A 1QH1B 3HH8A 3R3HA 3VU9B 2ZJFA 4RTNA 2ZRAA 1Z0DA 3M9LA 1T9BA 5KTNA 4C06A 2WWHA 3JRWA 3LF2A 4LHXA 4D0SA 3Q7IA 2HHHB 3GWZA 1SD1A 4LDJA 3OEYA 1QRUA 1MG0A 1ZEJA 1Q83A 1WZEA 3OPYI 1UJ5A 1XTVA 4JP3A 1JSXA 4RZHA 1CUVA 4JA2A 1CFJA 1VKOA 3UC9A 1Z5VA 4R7GA 2GPTA 2GKOA 3FYUA 3BMQB 3ANSA 1UPAA 5CCDA 4Y8VA 3I8XA 1YZTA 1X9HA 1FLDA 2P9FA 3JD2A 1HDRA 3R0IA 1BDHA 1A5TA 4JP2A 1RXEA 1L5WA 1KDOA 4N0QA 1QCZA 1Z2AA 3VBCA 4JMLA 4B4OA 5C1BA 5IVHA 4UULA 3AM4A 3HCWA 3MERA 4PLTA 4YLYA 1O6BA 5HZGA 1PBTA 4ACAA 2QXTA 1X1CA 5E1BA 1ETUA 4QU5A 1PTJA 1NF2A 2R8PA 4MWOA 4MW4A 4R9RA 4DR7B 2CXHA 1ZZEA 4AMYA 3ZG6A 3WKAA 4CMAA 2AJLI 1FSGA 3MM4A 2AOUB 4E15A 1NSFA 2WHYA 3UY4A 3PNKA 1M2OB 2SKCA 3AJAA 4WFJA 4JOCA 4BKMA 5EWJB 3IAFA 1V1RB 4V02A 3QFHA 3SICE 4Z1OA 1F6BA 1S89A 2GEUA 2CNKA 3OC6A 4GI2A 4EB8A 4UTPA 3I76A 3WSVA 4AJ4A 4M7PA 1XRPA 4ZYYA 3VNBA 2ZRNA 3W5SA 2I0FA 2C2HA 4HXEB 1NFRA 4NI5A 1R6AA 3K4HA 5CM9C 4KBYA 1O94C 2RG1A 1WW3A 2W2TA 3LDUA 1AS3A 4J0FA 2FFAA 3HXQA 3ANLA 3A3YA 3CR3C 3JQEA 3IAM1 3RS8A 3KT6A 1SVIA 2VYND 4P0TA 2CCKA 4E5UA 4G1BA 2K87A 4JUCA 5ED0A 1UAAA 3KZXA 3A28A 3LBNA 3QHQA 3KOMA 4PXAA 3O3CA 1U8AA 4KBFA 2UDPA 4JODA 5CA0A 1DHTA 4JQZA 3DAFA 4DJTA 3A4LA 2Z5LA 3EASA 4B3JA 4EUEA 4NICA 1HFWA 2HYIC 4BVAA 4C7BA 2QUAA 1OLSB 2V8OA 3KUUA 3COZA 2PPLA 3O83A 4PYQA 4YO7A 4ARZA 1OUMA 4B2LA 1BJKA 4MV4A 2M6SA 5HK9A 4X65B 5J1SB 3H5WA 3AVTA 5IWCA 3F4LA 3HYSA 4Q4HB 3VR3A 3A10A 5A6VA 1AY0A 1WCYA 2HNAA 4AUMA 1FU7A 2IPLA 4AXXA 5FI0B 5FL3A 1DFHA 1VI2A 1IWBB 3IEMA 4RY0A 3VH2A 1R9NA 1L8LA 1U3GA 2WU8A 16PKA 1V4BA 4GBED 1JEEA 2FSHA 3DV0B 3M6MD 4BZWA 4E5NA 1RXVA 2VEDA 2J45A 5EE5B 3IESA 1WXWA 4K46A 1VBNA 1QTQA 3GLGA 2MSWA 4Y1RB 4LF8B 2I87A 4FYXA 1KJIA 4G81A 4KG7A 4OFXA 4OAPA 1JU4A 5AT1A 1KO1A 5H81A 1A7KA 3O9MA 1OQAA 4E5DA 4HG2A 4Q9JA 4G8JA 2DKNA 1ODCA 1P91A 3Q3VA 5FUVA 2PJUA 1VP9A 3RHSA 4CLEA 3QK7A 1IIRA 5DI3B 1BVYF 2B92A 5DT9A 4BMXA 5F2EA 4XX1A 1ZAKA 2AOTA 3W8RA 5EQDA 1VL8A 3RS4A 3K8OE 4OK3A 2W6QA 1N6PA 4FLEA 1A9QA 1ENYA 2P67A 2IOYA 5HF9A 3M3DA 2FR8C 3KFXA 3K9QO 3QBVA 4P2GA 3UMCA 4CCYB 2AFHA 3R7NA 5DEOA 5HUQA 2BP7B 4FSHA 2QZ9A 3KLNA 4OA8A 5AKZA 4HUTA 4BLVA 2H9AA 2A3NA 3QWIA 2RGYA 5A03A 2FK8A 2LVBA 1SZPA 2ZYWX 1CETA 1KARA 5KJEA 4ARBA 1JS1X 1FTNA 3OWXA 4J1NA 4CM8A 3M89A 3OUTA 2G1PA 1CQJA 3IPRA 3CFYA 3FHLA 4GI7A 4QUGA 4RMNA 5J2UB 3FHOA 1CJKC 2PG3A 3R20A 4JX9A 4P84A 4TPKA 3T9BA 1YI8A 3BDAA 1Y0BA 5TMPA 3Q3CA 1HQCA 2P27A 1H3FA 4LXYA 3OX4A 4YJDA 4Q1CA 1SKMA 5KNCA 3RE1A 2A8YA 3TJRA 4MDEA 1LC0A 2NSYA 4MQLA 4ZDKA 5EC8A 5TSDA 2YVQA 4NU5A 4DJEC 4URVR 3K20A 2QYOA 1ISGA 3ME5A 2E5FA 1ZPDA 3N2IA 3R3ZA 4UJ5A 1BMFD 4D3SA 4WH0A 3V4LA 3E8SA 1ZXBA 1N1DA 5CIWA 2FSPA 1ZNWA 5B1IA 4ND2A 4EJ0A 2I4OA 5KWEA 5MN4A 5GIOE 1SVWA 4GPTA 4KLAA 1RXCA 2NM0A 4H35A 5JANA 4B43A 1Z2EA 3BZUA 2ZRBA 2Z4TA 1L6IA 2PN1A 5CGZA 3QU2A 4H4DA 5LVAA 4BGEA 5TGTA 1JVBA 2Q2OA 4PTZA 3SX2A 2CHQA 3RAGA 2EEZA 5AP9A 3B5EA 2QVGA 4NQZA 3OQ6A 1XI2A 4MPDA 2C57A 2ST1A 3ANMA 3M34A 1E20A 2RHHA 4PLZA 1A7UA 4XYEA 1KAMA 4E22A 4IGFA 5H59A 4ZYZA 1FBTA 2YYYA 3DE5X 3UG6A 1XEAA 1NW3A 3L8FA 3HGMA 1MB2A 1VJGA 5E7MA 3SZUA 4MCHA 4ND3A 4Y2QA 3BWBA 3INRA 2ZIZA 4LYDA 3Q0TA 4QOIA 1I9GA 1N6NA 4XDGA 4IJQA 2CKDA 4MXDA 5JAIA 2X42A 2GZ1A 4QOEA 4BLPA 2BUCA 3AETB 4JH0A 1O87A 2XVZA 4MCJA 3BGWA 1J70A 1KU0A 1NP6A 3E22B 2IEGA 5JJIA 3AW8A 5ITZB 3UMGA 2XCLA 4MV3A 1SH7A 1ZK2A 4LFBB 2CLOB 4MLCA 2G4CA 3N70A 1T3TA 4IXMA 4RPGA 1FW6A 1WV1A 1T2CA 2FCAA 4H1HA 4V0KA 4YCSA 2R96A 3WG9A 1TRHA 3P45A 3UPUA 1DQZA 4G5XA 2HPVA 5H8WA 1O03A 3MXOA 1USIA 2W6ZA 1QVWA 1FFYA 3R3XA 1YJ5A 4B6QA 2PFKA 3JZAA 1QQAA 2HK7A 3RBAA 3N58A 1E89A 1V25A 1NVGA 1Z7GA 4CXMA 4QM7A 1E9AA 3E35A 1VJ5A 2EW2A 2PH7A 3W7BA 1JXQA 3EVNA 2OCDA 1G5HA 3NW9A 3EEQA 1UUFA 4GC9A 5ES3A 4OJQA 3ZPXA 1CF2O 1W1WA 2ONCA 1AKNA 2BJWA 4IIJF 1WP4A 1ZCAA 2DU8A 3X43A 2ACVA 3SIPA 3J81A 5KYNA 3QSYA 2G1UA 1Y42X 2PXCA 4A6PA 4AKSA 1A77A 2RGWA 4NABA 1IK6A 1KEUA 3MAJA 4I36A 1Z29A 1OVGA 4NEGA 4M0KA 3A2NA 4MRNA 4BLWA 4KUEA 5EIOA 1XRJA 2LIVA 4OL9A 5CFNA 3G2JA 3NM6B 1YKGA 3HGQA 3WGUA 3P9PA 2UXDB 2OB1A 4CMGA 5JLJA 3L40A 2XNJA 4EHHA 4F9EA 2X9VA 4I9GA 1TB4A 1NGSA 3I09A 3M7IA 4A82A 1JT9A 4Z9AA 4DC1A 4ISCA 4AMUA 1EVIA 5A3QA 3VZDA 1GUFA 4X7BA 2YRXA 2BKXA 2NZVG 2VJLA 3NOOA 4EEZA 5EJMA 4RV9A 3B3FA 4C4YA 4G0ZA 2JFWA 3CEAA 5DKFA 4RKEA 1L1EA 4RF2A 3VHXA 3ZWOA 3ZGXA 4M8IA 1U1DA 1XV5A 1WOMA 2GLTA 2ZUSA 3IKVA 3OF5A 3D3WB 3PUJA 3TX2A 3DM9B 2HKIA 4FKZA 5AQEA 1GYPA 3HADA 5EJEA 4C43A 1XZBA 4KQXA 5DGCA 1JYFA 4XSHA 4DZZA 2EJVA 4UQLA 4NESA 3OESA 4BQIA 3I1FA 1U4NA 3IV9A 4MJ7A 4UEJA 1AKTA 1N9KA 2PSDA 5MFZA 4YRBA 1R0KA 2AN3A 2VH1A 1VCIA 1V1MA 3DLIA 4UEQA 1X8KA 2EKPA 1C3JA 2WIBA 3ONDA 1DJPA 5LQUA 4U2BA 4D9FA 5CVTA 4RA6A 4C2TA 1NKVA 4MPPA 4BO6A 3TFOA 4K0KB 2FMUA 1FJXA 4XM0A 1GPLA 4CHGA 1DINA 5ER6A 1P1RA 1U7WA 1ADCA 3KZKA 2QTWB 3PNVA 1IM2A 5E7IA 5TIIA 1ORRA 1KZYC 3A58B 2KJQA 6CHYA 2O57A 5HZHA 1FW8A 5ABPA 2IXBA 3DBRB 1SQGA 3ABOB 1TYBE 2PWPA 3TGLA 1ZY2A 3ASZA 4I46A 5SV2A 4UKDA 2Q9BA 4M87A 4WECA 3ZWXA 1QC5B 5EJ5A 1OAOA 4LF5B 2QNIA 1J0CA 4YCAA 4BU0A 1UWLA 1QYVA 2PXAA 4WK6A 5U9CA 1P2SA 2FUEA 4GOMD 1UDBA 1W5AA 2OZVA 4H18A 3THYB 2V7BA 1XSEA 3L6DA 1T34A 1X1QA 2VYNA 1M2VB 1THGA 4HEJA 4EG5A 3OTOB 2D3TA 2N42A 3CLKA 4WDRA 5JVDA 1DAHA 4OIFA 3LTNC 3M0EA 4N01A 4UHHA 3KNZA 4G1UC 7REQB 5I6DA 2MJLA 4M9SA 3NHJA 2QSJA 5HOQA 5KSWB 4BO1A 1XQ9A 2FPWA 3OSZA 1CC1S 3BCSA 4NNJA 4XD2A 3V4PB 4AAYA 1DO0A 1OFVA 2C8KA 3S2GA 5K4HA 5DI9A 3O4JA 3DB2A 2A35A 1UC5B 2NACA 2AR7A 2CYCA 4HNVA 4P92A 5BNFA 4S1VA 3A05A 1PR1A 4DRXA 1W4CA 1G59A 4DSTA 1U4OA 2EBWA 1XL0A 3F9CA 2P2YA 1YJAA 4QGGA 3WIDA 2DWOA 5F1PA 1ZJ5A 1FDTA 1ML3A 2CVHA 3B6EA 3H7IA 3EAFA 4KVZA 4M1YA 1YTUA 4X45A 1II9A 2IV7A 1Z88A 1WQ3A 3Q5GA 3PITA 4L4XA 3BRSA 4FU0A 3KSDO 4CKCB 3TBFA 4C3ZA 4BUCA 5E1OA 3A9VA 2VUUA 2ZBVA 4UBNA 1DX6A 4C0XA 4LZJA 2IOHA 1VJRA 2FCRA 2FR0A 3I9KA 4JJKA 3K6SA 2GXAA 1MJGM 1G7RA 1U8YA 1VQ1A 4KYIB 4CMCA 5A2QA 4F92B 3L8CA 1NSYA 7ABPA 4E88A 3EY4A 4Q1FA 1EQUA 2H0QA 1PQYA 4BDTA 2M32A 3ICPA 3G85A 4TX1A 4MVXA 2Q49A 1RI5A 4BO0A 1NJ2A 3EQZA 3ORQA 4XEHA 4CFZA 1POXA 4GQBA 3UAYA 4AS2A 5BYAA 3BTOA 5IVKA 1IONA 2JEZA 2FDRA 5EXPA 2O4CA 1AKRA 3GPBA 2ZGVA 1GKYA 4LFCB 4Z6KA 5I48A 2UYHA 4GE0A 4O0LA 3L7AA 1EX9A 5CFLA 4F84A 3IUBA 4MJLA 1Z15A 1XMPA 3DKVA 2C04A 4HNHA 4OP2A 3ZIAA 4AWXA 3C97A 1I4EB 2C03A 3GZ4A 3FPSA 4WCFA 3ZWDA 2X41A 3LKDA 1Y5IA 2H4XA 3JVVA 3JQBA 3HO6A 3LX4A 3OE4A 4HVCA 4A1FA 3AILA 1KZ7B 5ETJA 4PONA 1LX7A 4QDKA 1V2HE 1RYEA 2GRUA 3X0DA 4RV4A 5MN6A 1EK6A 3UOWA 4Z8YA 2DH6A 2XYRA 5COQA 4D0GA 2JFZA 2VHYA 5COAA 1RBMA 5FFMA 3ZI0A 1AF7A 4C30A 2CF6A 2QZ4A 1CUUA 2W11A 3R0XA 1P77A 3DWGA 4JC8A 5C5DA 3F4BA 4BFCA 2GBCA 3V8RA 3A9WA 2QX7A 4GT1A 3C3JA 3DW3X 1T2DA 1IRXA 4M9ZA 4W1PA 3B1JA 4NOLA 3ZY3A 1AHIA 3MQ2A 4LYYA 4WBXC 5TE9A 2WWTA 1JH9A 4HDKB 4JQSA 1Z0IA 4IDAA 1HURA 3QOWA 5JISA 4KGDA 1RCFA 4ZVSA 2EG9A 1Z4IA 3BXPA 3FFXA 1QDLB 3BJRA 4TTJA 4W6QA 4GF5A 2EIHA 4A3SA 2J59A 4EIWA 2C83A 3GRVA 1OLXA 3ADPA 1MUUA 3TQIA 4A2WA 3OJFA 1NE7A 1X74A 1DRWA 1FC0A 2XTZA 4X9XA 2O8FB 3THXA 3G5UA 3RSCA 4AY3A 2BMDA 2XDYA 4IDHA 4D92A 2I2AA 5FI3A 4JB3A 1IYZA 4QFBA 1Q19A 2ZSAA 3JQBC 5H83A 4CZ2A 4XUCA 4LDZA 4FM9A 4H7JA 4P5DA 4NULA 4MHSA 5F2NA 3E4CA 5HTOA 4RKYA 2O8EB 3IOYA 1RQPA 4O1MA 2CZCA 3DP7A 1EUQA 1NZJA 1HG1A 4BVFA 3DE1X 3G3EA 4E1BA 3PGA1 2GH1A 4BEJA 1YL7A 4IAOA 4UBIA 2WT9A 4FIDA 2AKAB 3N8IA 4EI7A 2NIPA 4UQPA 1I0IA 4ABTA 1MOPA 4PZCA 3MGGA 1YONA 5F7JA 3RS5A 2ISQA 3GJZA 2CF5A 4NENB 4QASA 3ZY4A 4NQRA 3W05A 4AWBA 1C41A 2XHZA 3UV7A 1Q0UA 4N9WA 4XJTA 4OHBA 4JI5B 4CFYA 4MV7A 4ZJYA 1Q7EA 3PGVA 2XA2A 2BEUB 2HV9A 1A9XA 3CNHA 1U1CA 1L0BA 2I7CA 1IJFA 4R2XA 4EF5A 2QU7A 2DC1A 1A1SA 2W98A 4MKIA 5KWSA 2WA1A 1LJLA 2YIDA 1ML4A 2C94A 3GFBA 1ISSA 1WUTA 4WLUA 2GA9A 2OHJA 5ALFA 5DP2A 3QLTA 4H59A 2BFDB 1MGPA 4K8RB 4ENVA 1B8UA 4S0XA 3W5VA 1G8JA 1N2CB 1RRMA 2SCUB 1WD7A 5KYXB 3LGXA 5AI5A 4D97A 5EJIA 2C4WA 2FG5A 3G6KA 4DQKA 3DBHB 5L95A 3KXLA 3TF5A 5CLIA 1XYVA 3L46A 4BO5A 4E2FA 3DBRA 1ZJWA 1NAIA 5KYTA 4CIBA 1UBEA 2IIQA 3OIFA 2CV0A 2GBPA 4IO1A 2PS0A 4BJHB 1VI6A 2VT6A 4LI3X 4XA8A 4QD3A 1L5OA 3IJ5A 3W2FA 1P0FA 5AQ1A 2H29A 1LK7A 3DFMA 1C3OB 5A02A 2YY5A 2HU5A 3MCZA 3A06A 2H5LA 4LE0A 5KAPA 1E9FA 4ZVKA 1ATIA 2WABA 2KW5A 3OZXA 4QC2A 4DQVA 3PEWA 4YRFA 3JASB 1BOOA 3LLCA 3PSHA 3N0WA 3SC6A 1EP9A 1Z4MA 1GFIA 1GY8A 2EFJA 3WGYA 1I7LA 2VWGA 4KITB 4C29A 1SGWA 3K2BA 1RZRA 1JIKA 1W9MA 4W1SA 2IYWA 4ZK6A 4F72A 3CLHA 1GL7A 4WXRA 4QZVA 3V7YA 5K8LA 3NTQA 2QRNA 1COZA 2KWIA 2OFXA 3KAQA 3NBUA 2IRWA 3OO0A 2OGTA 1XMXA 3G9ZA 2NU9B 2YJ4A 3ABZA 1YI1A 2EW1A 4BB0A 1OXTA 5CITA 3PA8A 1KZ1A 4HEHA 4DNXA 2BTQA 3O95A 1KI9A 3WNBA 4P0PB 2QS9A 4B84A 1NVVR 5F9MA 3LTEA 5CJPA 2O06A 2R68A 1UPXA 2OZEA 4CUKA 3RRXA 4BNIA 1GGNA 1O57A 2WTUA 1T1GA 1K5PA 3U7RA 1E4EB 1SR8A 3LC1O 1H6AA 3OCJA 3ZHCA 3CU5A 2EQBA 3ND9A 4MAMA 4TWAA 2NX2A 6REQA 5K8IA 3AEKB 4FN5A 2OCAA 3ZWCA 3MCUA 5HDBB 4HWGA 3N07A 3LUBA 4J75A 3TTTA 1QF9A 1O5OA 2H1FA 1QFXA 2VF7A 4GKVA 4LJ5A 2FLKA 2VKQA 5E2BA 1TT7A 2VLIA 1G6KA 1E77A 2LKCA 3JSAA 3QU4A 4IBOA 4H27A 3RTCA 2ZIXB 4RVFA 2FX2A 2Q45A 2LGJA 3FTCA 3IQFA 3K8QA 4G07A 4GP7A 4XI9A 4B8ZA 1WEKA 4Z4IA 1MC5A 5A9TA 5FI1B 4IM7A 1HLDA 3DL0A 2G40A 2XE6A 3D0QA 3KD2A 3MLBA 1KE2A 4BAUA 5A4DA 5K9ZA 1NUQA 1JLHA 4WN9A 3IP1A 1G55A 1L2TA 3FB4A 1EGHA 2MT9A 2NVOA 3PQ3A 2NUAA 5BW5A 3KPVA 2IU0A 2Z09A 1ORHA 3BGOS 3DHYA 1G2PA 3OLZA 2HIHA 3PFCA 5F77A 5F3RA 3L8HA 2AK3A 2P2DA 4W8OA 1E3WB 2IXEA 4WK4B 3UMJA 1WV0A 5JQGA 3U09A 4UHEA 5KUTA 1U02A 3LV8A 3PV0A 1IDOA 3OUZA 1YL6A 3IQXA 3QPDA 1RIFA 3PGMA 4HAOA 3U7QB 4C4OA 3WIVA 5JS8A 1UBTS 4O4IB 3R8FA 1BSVA 1JAHA 3QXJA 4WZAB 3NEJA 2CUNA 5C2JB 2MSLA 3NIGB 1CQXA 4O4HB 1LVGA 3RUIA 1CXZA 3X1JA 1SG6A 2QJTA 4FOTA 2G09A 5FPKA 2IIBA 3DDSA 1J49A 1ZI9A 4GBGA 1E69A 3IUMA 3TOVA 4KNWA 3LC0A 3QPWA 3C3CA 4GX5A 1FRQA 3SXUB 4WKBA 5DZSA 4ZARA 1BE0A 2ZEJA 3RRNA 4FS8A 4GVLA 5HCNA 3CY6A 2OB2A 3T0IA 5I8WA 4X71A 1JQJC 4D9HA 5C37A 1QFSA 3IR6A 4FFPA 3AUXA 2RG7A 4RAQA 1P7WA 1E3JA 1E1QA 3H1EA 3ZU6A 4HAUA 4QJ3A 1O95D 4N47A 4M53A 5I9MA 4FJ1A 3GG2A 3EODA 2Q0XA 1QYRA 1RQ7A 1XZIA 2VUHB 3T7RA 4WNIA 3D7KA 3I1IA 4IDOA 1XCBA 4Z0PA 3UGKA 5I5EA 2VJAA 4KACA 4EJFA 1E98A 3CX3A 3IELA 4F4CA 4JI8B 1T36B 2KLBA 4US1R 3N8GA 1CNMA 1NVEA 2SBTA 3MF4A 2GJSA 3L84A 3OJEA 1A76A 2XECA 3UUEA 3HR4A 4NG5A 1FTQA 1JR3D 2TMKA 3C7KA 4KPUB 1QQTA 1RHMA 2AG5A 4L27A 3WQBA 3FSJX 1E3SA 1I4TD 1O1YA 1UJMA 5JW6A 2QDXA 4QBHA 3RC9A 3KOWA 4TMFA 1AGPA 2V7EA 4IOLA 1SXGA 3LNTA 1D5CA 3B9BA 4J3JA 4K86A 5LM3A 2VRNA 4OLFA 3W5CA 2IDKA 3GLRA 1JG1A 1UQUA 4C07A 1JJBA 4D41A 2GDJA 4AUNA 3BZBA 1MV5A 2CXNA 3MD0A 1LNSA 1Z8HA 2O6LA 1WUIS 4CMIA 3G2NA 1B4DA 3ISVA 4XX0A 2NN3C 3VFDA 1MW9X 2OYCA 3K0AA 5LSAA 3GDOA 1FX0B 2R86A 2CD9A 3GUVA 3IRUA 1MAUA 4D56A 2HJ9A 4QLAA 3CKKA 3KYCA 4OBEA 3RCBA 1N1GA 1JEJA 1HKHA 2QQ5A 2ZRFA 1XDZA 3QWAA 4MMYB 2R84A 4WT7A 4FXPA 2UZ4A 4JYBA 4WGFA 2IHBA 3C70A 3PPWA 4YRPA 3BWDD 3TINA 2W2PA 4AG5A 2OQIA 4XZ3A 1J22A 2YVLA 1KGSA 1SURA 1X8XA 4U2FA 1VE1A 3FYHA 1QQBA 1LTQA 5EZYA 4KW7A 2O52A 5CT8A 4KREA 4WOKA 2P0YA 1WY7A 4LQ4A 1MOQA 1M8PA 4Q3EA 3KQSA 3O93A 4B4KA 1H8ED 2C0PA 3EDYA 2HDNB 4HLDA 2JATA 1Q1EA 5FWDA 3PQ4A 2WA2A 3FYUC 3RYHA 1S96A 1C3OA 2WICA 4MWGA 2Q9AA 4N5LA 4CQLB 5C4MA 3G0DA 1LPNA 2HJSA 5C5CA 3DOCA 2JGRA 3CR8A 1CZNA 1LRLA 3VTKA 2JGJA 5JSYA 3OLQA 3SZ3A 5FD8A 1ZM4A 3EZ9A 3TIIA 1SUBA 3FPAA 4QE3A 3ZNNA 4C88A 3CWQA 4CCWA 1F7UA 3WQQA 3PRJA 4RLSA 1TU3A 1MF7A 3QE0A 4M2LA 1QBGA 2Q4EA 5ALSA 3FJ1A 1H1LB 1NY5A 4UREA 2I6TA 1C7JA 2BDTA 3GEMA 3PZRA 4G5SA 4A5OA 5IYZA 1DIAA 2O2XA 1AQNA 3I39X 1KOLA 1SJ9A 5GZ6A 4MIYA 1QIMA 2OZPA 1XAGA 2XV1A 1WXXA 2FW1A 3EXAA 3VDNB 3U81A 2DLCX 2OWDA 2ZUEA 1VBKA 1UCFA 1EM6A 2EBUA 3F6BX 4CCSA 4GVPA 2WJJA 4J7XA 3FIJA 3BIFA 4S1OA 1W0KA 2EZ4A 1IFXA 2BF4A 3TAXA 2Y1WA 3H84A 3K8YA 4ND5A 1E1NA 5GONA 2PD4A 2WM3A 3WYCA 7ADHA 3HDQA 1XZJA 3VZCA 1J21A 4O08A 1PZGA 3C0KA 4I4IA 5ALJA 4FBGA 3BQNB 1E4EA 5DB4A 4C7VA 2D7JA 2J31A 3AUAA 5CNIA 3T0FA 5AI6A 5JSUA 2F9FA 3PX2A 1DDIA 2O23A 1KIMA 4CKWB 1A8QA 2LPMA 2QZJA 3TZLA 5CG1A 1KKLA 5D3QA 4G4JA 3NTLA 4BNUA 3BORA 2F43A 3OU6A 5KZMB 3LBFA 3QJYA 3BA1A 4YI5A 3EW9A 3K72B 2Z2YA 3JWEA 4JU9A 1RADA 2NP7A 3LRXA 3IE2A 4EJSB 1HYGA 2HHJA 1U5AA 4JVOA 3GLGE 4J76A 3FCEA 2IF2A 2BMFA 3L06A 4BNTA 4MGEA 4MSUA 2O14A 4MQ5A 1ND5A 3GZNB 5L4LA 3VC1A 1YGYA 2O3QA 4JXXA 4EVRA 2CJXA 4DCNA 1KFKB 4AJHA 3OE7D 2GK6A 2HIAA 2OCGA 4R98A 2CK3A 3KQMA 5K8JB 2KB0A 3ECAA 2FYTA 5DH9A 3JARA 5E2IA 3V34A 4JU8A 3CA8A 4BZQA 3NRBA 3F6SA 3N2GB 5DEIA 5TVGA 4XYLA 4N39A 2Z3VA 1QNFA 3U4QB 1JJFA 1JNYA 2EEPA 1TJ3A 1IY8A 1OC4A 1RBZA 3G02A 3ID6C 2COKA 2RHBA 4TWRA 3SSAA 4DMLA 3W7AA 2QRUA 3Q85A 1MB3A 5HX7A 3OKPA 2POQX 3EVTA 4UAVA 4QU8A 5GJBA 2W58A 2GYYA 2R751 4FHEA 4EA7A 2ZU6A 5H9VA 5AKGA 3TD2A 1F2TB 3EGVA 1AH2A 1R0LA 2JGLA 4DABA 3FCAA 2PRKA 1QK3A 2EU8A 2VQSA 4Q1BA 1BS9A 2WFLA 4KPGA 2ICAA 2XA9A 3H19A 4WJLA 4P7GA 5E0OA 3H87A 5DO9A 1NVKA 1LV8A 2BEKA 3DF9A 1TAHA 1INLA 3GRYA 4QVGA 4REMA 2OSBA 3OLVA 4RZ2A 4N8EA 2JC3A 3TAHA 4QFCA 1W44A 5KJCA 3CF2A 3LOQA 4MI1A 1BXGA 1KA9H 1TZMA 1KDRA 1E4VA 2OCYC 3C14C 2G70A 2PUHA 3DTYA 4J43A 3V00A 4B7AA 4UMFA 2ODEA 1B2LA 3PG5A 4PR0A 2HCTA 1XOIA 1OU4A 5JWOA 1YR8A 3DEAA 3MBIA 4J03A 3TRJA 1T1EA 2ZPUA 4RK5A 1DKQA 3AERA 5FLEX 2C00A 4GM4A 5HCUA 4A6EA 4B34A 1OHHD 2ZIEA 5BV7A 1SC1A 5J47A 2ZG6A 3L6BA 2UVPA 1GR0A 4LSZA 1Q5PA 4A8HA 1V2GA 2TMGA 1EGVB 1LI7A 2KBEA 3CUSA 3CSSA 2DZDA 4YRLA 4RPHA 4NCXA 1KP3A 1YZKA 2GUWA 3EXG2 4ALIA 5IZ4A 1EUYA 4RW0A 3T34A 4BEVA 1M1NB 1R0XA 2G9ZA 1II8B 5H3LA 4D9MA 4DB2A 4KB5A 4YHHB 3LDFA 1T6YA 2IYOA 4PBSA 3UAOA 2KX7A 2FF5A 5JATA 3SVLA 2ZBEA 1I1HA 4ER5A 3SEFA 4ZODA 2KBFA 3STWA 1J8DA 1QGUB 1A2QA 2QTBA 3DJFA 4JJAA 5DT2A 2AFVA 3PXGA 3GUYA 4N49A 1QU3A 2IW1A 3I3SR 2R6CA 3NPAA 1GZ3A 2DTEA 3GPCA 3KKPA 4I4TF 4L22A 3ZEAA 5K3CA 1ZH2A 1FCJA 3P9NA 1XVAA 821PA 4KOAA 4HWPA 1IU9A 5ALOA 4Z9FA 4RTJA 5SYMA 1M7BA 2ZYHA 1JFFA 3QLVA 1RKQA 4TMZA 5KNDH 4ZZIA 4RCYA 2BFCA 2EZUA 1CRWG 2KSQA 5JJCA 2J9YB 3REQB 2JAPA 1E6KA 2UZ1A 4JI6B 1EIWA 3RYIA 1RYHA 4C4SA 2GNAA 4D4LA 2IOFK 5BWOA 1P7CA 1NTOA 1EVJA 4YMWA 5FHRA 4REQA 2ZYIA 4GMFA 3CLRD 2PIAA 3UJ3X 2AX4A 3ZZ1A 5BSHA 1MW8X 1GRVA 3QNUA 5IBQA 3D8TA 3EXHC 5BSEA 3P9CA 5JD6A 1I7NA 3OQMA 3K5IA 2VSOA 1FRNA 1B3BA 3GVCA 1UFQA 2V0NA 4OHFA 4BNZA 2EJCA 4DC0A 1PS8A 1BROA 1UJCA 1BXKA 1F8FA 4X84A 5HDQA 2CVFA 3E8MA 5EJ7A 4ETMA 1GNRA 1IATA 2V0CA 4Y30A 5J58A 2BEJA 2PR2A 1D2CA 3QF4B 4QAJA 3DLHA 2B20A 3QKSA 4RLHA 3RVMA 3OOSA 4MV8A 2DPYA 3FYUB 3N8HA 5DBHX 1KMMA 3QOYA 3SAJA 1YAHA 3UA4A 1J5EB 3H7AA 4ZJUA 3D6TB 2RIPA 1GVHA 2IYQA 4YMHA 3HJFA 3RREA 5F1KA 2CXXA 3HHPA 3N5KA 5IJAA 3T5DA 1OXVA 2HLHA 4RKQA 4RORA 4HNSA 2BBWA 2P1DA 3O5AA 3MBKA 3MWKA 1J56A 3IIKA 3RSQA 1Y6GA 1P33A 1J24A 1FJ2A 2QPOA 3HRKA 3L2OB 1KKUA 1QUFA 3RTDA 4H6VA 4NBSA 5FUYA 3Q7SA 2WVHA 2J9FB 4V2IA 3ZU2A 5EQFA 4CU2A 4RYLA 5J5VA 5H5JA 4FONA 2FPRA 1BNCA 1BWRA 1S7GA 1UK6A 3AHJA 3I4CA 2JD1A 4S2EA 1B74A 5JNVA 1X94A 2PJZA 3L77A 4URWR 5JVDF 1XN1A 2IQIA 3KR0A 2UYYA 2BHLA 1PZEA 3K0CC 4H9GA 4IGIA 5CVUA 4INZA 1HZZA 1NQAO 5JXGA 1IG3A 1WCV1 2H1RA 1TNDA 3AFGA 3T7EA 2WVAA 5AJVB 4L8GA 1D4FA 3SN6A 1PKXA 2OBXA 4AECA 3VV3A 1F17A 4RTMA 4CIWA 4QOFA 1FUEA 4LOAA 4OUKX 1ZHFA 1JPVA 1IPFA 5EP1A 1JEYB 1M0SA 1CS0B 1AQIA 4KLCA 1IEVA 1XRQA 2C4HA 1CY7A 3GROA 3L1JA 2AWNA 2GXSA 2OILA 4G86A 3TOSA 3JATB 4GMGA 1IPEA 4P7FA 3WJ7A 3MN1A 1U1IA 5IEJA 1N2IA 4YR9A 2HHAA 2OCXA 1XTIA 1RWBA 2GAJA 4YRJA 1SIBE 1SKAA 1VYVA 2WMNB 4O1HA 4XCQA 1YMVA 4MRPA 2ZB7A 3WX0A 3F7OA 4DR1B 4QSMA 2OE2A 1JW9B 4R68A 3WVNA 3NDJA 4DADA 1H4SA 4GX1A 5FBWB 1T3ZA 1XWIA 4KFSA 5D00A 3H65A 2GAAA 2AKYA 1ZKMA 2G88A 2J7PA 1CUAA 2DVMA 1FFDA 4OU5A 3UTDA 1NBWB 1C80A 1CYEA 1JXAA 4PNZA 4ABYA 1EDDA 4ERXA 1V3VA 1W47A 1JGTA 1Z5NA 2RDMA 2WJWA 4OQDA 4X6YA 1WZCA 3HO8A 1I10A 5FPSA 4EM6A 3GAMA 2BBSA 2GK3A 3CISA 3QYPA 2H63A 4FYWA 1CF4A 1R27A 2PUEA 3RSOA 3VTZA 4ACBA 1ACLA 3T5AA 1IHYA 4JLSA 2P9GA 1L3IA 4NATA 4I50A 4DCVA 3UYKA 1NW4A 2BFNA 4QWMA 2FMTA 1BCRB 2OYRA 3ZDBA 3OPVA 3MTJA 1Z0AA 1JKJA 1PSDA 2NZJA 2EWMA 1H6CA 1L4LA 3JTMA 1JB9A 3JV7A 3ORRA 3F3YA 4ZPJA 3TLMA 3W04A 3M2TA 1HNZB 5K0CA 1Y9EA 3EYAA 3TTSA 2MYNA 4CG0A 3R5FA 1XMOB 5LYJB 4WFIA 1ZIPA 2WU1A 1ZQ9A 5FBKA 4URHA 1SHLA 3NT4A 5JC1A 1WHTB 4N0EA 5LXTB 2QZZA 3CZPA 4X60A 4CN8A 3CNQS 2FI1A 2H4FA 3SS8A 3QQPA 5A5DA 5I7EA 3OOHA 1CZHA 2ZTVA 3QTBA 1RRPA 2QLNA 5FWAA 2PFSA 2JIPA 1QH0A 1E92A 5DHQA 5T3YA 4RXUA 2VEOA 4I0WB 3V7NA 2FPGB 3JWGA 1YC5A 3KAJA 3R23A 4IIJA 2AUTA 4FZ3A 4L5YA 4I2VA 4BRUA 1GZVA 4HK4A 3E03A 4J0QA 4XKJA 2EBFX 1K7XB 4TYPA 3ORYA 4E5SA 2J0QA 2YVUA 2IZOA 2CNWD 1WDTA 4TVBA 1DAFA 1OY1A 1SOAA 5AKIA 3UHFA 4I9UA 5I7AA 5KSYA 1C3XA 1QUEA 3AR5A 3IDFA 5BP7A 5CFMA 1CQIA 4PEVA 5IHXA 1W94A 3Q0IA 4N48A 1IAQA 4F91B 2B8JA 4D9CA 2VNKA 2W48A 5FO1A 5EQJB 4PX3A 3R4VA 4Q6BA 1ZONA 1VSQA 3ETEA 4KLRA 2IZ1A 2CLFB 4HN2A 5AVJA 1VPDA 3I9FA 2PDAA 5C31A 3RIEA 1XVUA 3SKVA 3BK7A 4Y9RA 3EX7C 1Q92A 1TAGA 1P7ZA 2Y1XA 3U6BA 4AZWA 4RKFA 3WC4A 3ZTWA 4II3A 1GAWA 1W9HA 1WDWB 2GVNA 4ALKA 2A1TR 3UGTA 2ZSKA 2EL7A 3KJNA 4YP0A 3ZDAA 4P82A 3U3XA 2XOEA 3OHMA 4PSCA 2QENA 2P4HX 2R8BA 4PWYA 1PT9A 5AUNB 2QRVA 4DZRA 1A82A 4GDFA 4LXIA 1YK0A 3HMKA 3QE4A 3V9AA 3RYIB 2L42A 4S3MA 3AM1A 2O7QA 1NRXA 2VNSA 4LNAA 4Q4CA 3DE2X 3ESRA 4TVSA 4ROSA 3UHAA 1U0SY 4C2AA 1I4OA 3L79A 5A3JA 1SB8A 4US2R 3ZIAD 5JNUA 3H99A 1WXGA 3C7TA 4L50A 1YZGA 2FP3A 1AGXA 4UCQA 4YBRA 4CTMA 1A2BA 1GGFA 1V4VA 4ZMRA 3QITA 5I9LA 1N5DA 5IZCA 4RS4A 3IAAA 3BXGA 3K7EA 3OZTA 4FOOA 2OMKA 2FMKA 2FPPB 3ACDA 1LSJA 4O3FA 5BVHA 1ISJA 2R2GA 3K6JA 2DT5A 2AFIE 4WXEA 4PQRA 3S40A 1E3MA 3AWDA 3OQJA 2IDJA 1EA7A 1G18A 2G5PA 2AR9A 2VJCA 3QF4A 3RADC 4EVQA 3ND7A 3TIXB 3QFTA 4CTNA 3L9WA 1M6VA 2WU3A 2ZUCA 5K0LA 3CPSA 2OR3A 4BZPA 4A8JC 5FOXA 2DX7A 4CM5A 4LRXA 3E9DA 1M72A 2O0LA 4KK4A 1UDAA 1SBHA 3VR5H 1REQA 1XZLA 4ZEMA 3A4IA 3A1VA 4J4TA 2W0MA 4FC7A 3FRIA 1TO1E 4FLFA 3EY9A 4CI0B 3A9UA 4DNFA 4Q7LA 1RJEA 2MR6A 4Y7CA 2H0AA 4M1SA 2FFHA 4NYMQ 1N3BA 4MUGA 3Q72A 4B3SB 1P6UA 5JSZB 1V71A 2OQ2A 3PTLA 4XUEA 2DKFA 1H2WA 1OBVA 1UP7A 3JX9A 4TZTA 3SF8B 1ZR4A 2RGCA 4G37A 4MIEA 4FMDB 2R65A 1NI4A 2V55B 3EULA 1QZ3A 2GD6A 1IMJA 1D0IA 3EEBA 3IAS1 4XGIA 3D6UA 3AI7A 1LLFA 4UDYX 3MRSA 1WMAA 3MEQA 3VU0A 5J4LA 4E4YA 1PJAA 1RKBA 1T6BY 2QLFA 2Y1DA 3AOGA 1CYDA 3TSCA 1RRVA 1YBMA 4EEXA 4NR0A 1NNLA 2R8EA 3DBIA 5A1JA 3FCUB 3IO5A 2ARKA 4QYIB 5KDLA 4HH4A 3BPSA 5CRIA 2NSLA 3DVAB 3HUEA 5B7PA 6Q21A 4FK8A 2HRRA 3AU9A 3GLQA 1VI5A 3KAPA 1XE3A 3ZCSA 1FFGA 2HQRA 3LX8A 1VMIA 2ZE5A 3IBGA 2DP4E 3G7NA 3IIEA 2OCIA 2XMRA 3EH1A 1KDVA 3KR1A 2GBGA 3V2UA 2BAGA 5GQSA 2I2DA 4CMEC 3IT3A 1IUPA 5A05A 2HPHA 2COUA 2PBZA 3TE6A 3INTA 3UWPA 3WKEA 1OTHA 4F3TA 2XB6A 4O29A 1N1MA 5IC6A 2G4LA 2O2JA 4JLBA 4PRLA 3CLTD 4IPTA 4O4LB 1K0FA 2O3TA 1Y6ZA 1IB6A 1OX6A 2P9ZA 3E7PA 3PSAA 2VFAA 3Q3JB 1FXWA 3HEMA 4NONA 5M3BA 4BBPA 3KELA 4BCDA 4D9BA 2QD1A 2PLNA 4IJKA 1FK8A 4IV0A 5KB3A 1JDZA 4KYTA 4IQFA 1PKEA 1XYYA 5TV2A 4UVGA 1QB7A 1GM5A 4FN4A 5EG5A 2H9YA 2AXQA 1RLUA 1TUBB 2FHPA 2PEYA 2PSSA 2QN3A 4EK9A 3UPTA 3LYUA 4DUZB 4WOPA 3S7ZA 5AVSA 1OB2A 2H08A 1E6EA 1P9OA 2OV4A 4E5YA 2O3SA 2XNHA 3VOSA 3H9GA 3AESB 3C45A 1MKYA 1Z0KA 2XMZA 1GZ7A 2ZRMA 4WLVA 4KI0A 3SBXA 3ZV3A 4CF5A 3KP1A 3B1XA 5EXXA 3ZY5A 4W5NA 1D07A 2MOKA 1G21E 3X1XA 4PYKA 4F60A 1GUDA 3SZOA 2Y1OA 4G01B 1D8TA 3HLKA 3FF4A 3HUFA 3N8NA 5EZ6B 1ILEA 1IZ8A 4KTVE 2J6HA 3D5EA 2ZJ3A 4II7A 5T8KC 2XUZA 1E18A 1MPXA 4A1OA 2C1XA 3DUFA 3ZD8A 3DL7A 2J07A 2X2PA 1R0CA 3B5JA 3NNSA 4Q9HA 2BGRA 3WMWA 1OZFA 2Z2ZA 4OHXA 3EAQA 1O94A 4DLAA 5KX5F 1VHDA 2Q7OE 4WOJA 4A9AA 5FWNA 1C7IA 5KCMA 1QV7A 1JF8A 4HH3C 4E11A 5L3VA 1WOYA 1LLDA 2J7PD 4MWDA 4W1RA 2EERA 4UUMA 1J07A 1D6SA 3TB4A 3P2EA 4Z53A 1ZVJA 3QPVA 4P38A 4RCZA 5E6SA 1DRVA 3E15A 2B5OA 3DLBA 2QN2A 5JFOA 4PX2A 1IZ0A 1TM2A 3NWEA 2QTLA 4BRSA 2XKAA 1IOVA 1YR3A 3NKFA 4K6HA 3WLTA 2AL7A 1H0SA 3Q40A 3G82C 5IEBA 3L7MA 3E5HA 3MMZA 4U63A 3AP2A 1RHRA 2QMUA 3QEJA 1GG5A 4RVCA 2RHCA 3FWNA 1GXSA 3WL7A 2D1TA 4PXYA 3VNVA 5CB6A 5JYDA 1U1EA 2HFJA 1J5XA 1DRKA 1RQGA 1KWGA 3FFAA 3PT5A 4Y1RA 3F46A 2XUJA 2I76A 1DJLA 1WZNA 3EXEA 1KVQA 2GERA 4RACA 4RHXA 2EP8A 2IOQA 2DBYA 2GJKA 4M21A 3PVZA 3GVHA 4J2OA 4R7TA 3A3KA 5BR7A 4CU5A 2CLSA 4RLFA 1Z5OA 1Z3IX 4HNAB 5ITSA 1GKKA 3M6IA 2JD0A 1DBVO 2DR0A 2G3YA 2MSKA 4UASA 3KUCA 4GR5A 1R37A 4UOQA 4CKXA 4ZVVA 1QAOA 4IW3B 4R4JA 5K99A 2AX3A 3NRJA 3F7TA 4F97A 1UT6A 4M7OA 3LWBA 2BZ0A 4OD0A 3B89A 2AHOA 2RBEA 3EXIB 3MMPA 4I99A 2EAUA 3P26A 4CCYA 4YX9A 4X61A 2Z6UA 1MQAA 2VIIA 4O25A 2VH2A 1JKXA 3VH1A 5GIPE 4G3XA 3VO1A 1SFRA 1XPRA 1XZAA 3MJVA 2ZI6A 2VHTA 2GYUA 2DPGA 2AN1A 1O6GA 1ZWKA 3LBYA 4WXPA 5FUBA 4QLBA 2Q6TA 3P7MA 3T7SA 1CUZA 3QM1A 1V1MB 3WIBA 3UBTA 1XVLA 3ZGNA 3ZVMA 4LSWA 1C7QA 2ZT8A 4WJKB 1Z12A 3KEOA 1MABB 2GZ2A 4FBLA 4KH0A 5CM2Z 4YJGA 3ITDA 5J40A 2PVCA 2HPAA 2QP9X 4PTLA 3DWFA 1FSPA 5KVQA 4P86A 4RA9B 4JI4B 4Y1EA 5E6RB 4B0PA 1ISMA 4XYGA 3OU2A 3T1TA 4UCFA 2V8BA 1JR6A 2CDCA 3EWAA 1OXSC 3MJRA 1KH3A 1ISHA 3EZ6A 5EESA 5TS2A 2JKZA 4D42A 3P20A 4HL6A 3VPAA 5AUOB 4B6JA 3QVKA 3M5CA 3RAFC 2VHZA 1PL7A 3IDAA 3KWJA 2YWHA 1XZCA 4DIFA 2C5AA 3FVRA 3R40A 3A1TA 4X24A 2F1OA 1U0GA 3SNKA 1PJQA 2JZOA 3N7TA 4C7XA 1GPNA 1LW7A 2VPTA 1YIAA 2D1YA 5C8YA 4B3FX 1LPBB 3F6CA 4RU1A 2I67A 1XAHA 2VPYA 4YRZA 2X1VA 2ZIWB 2AMLA 1WJGA 3H3FA 1GPMA 2CDBA 2NO4A 3NONA 2P6NA 3UK6A 4XR4A 1MRNA 3JWPA 4QPJC 3GEPA 1OBOA 4DL9A 4HDSA 1E4OA 4TWZA 5IS2A 2BH9A 3PDIB 4IHQA 1H2RS 2WF5A 4OHUA 5HIKA 2WR8A 2WD7B 3Q9LA 4HAIA 4PPFA 4IIFA 2CBXA 3LQKA 3LT5A 1LFAA 1OF1A 3CG4A 3IT2A 4KXLA 3DFZA 4RWEA 3RT9A 1YNOA 3NWJA 1VSBA 3G9UA 5G02A 1SXQA 4YP9A 1X86B 4L76A 5DCLA 3B3GA 3LUDA 4UM9D 2Y4NA 4PQYA 4RZSA 4YR7A 2QD4A 4I55A 1U7PA 4DB4A 1QP8A 4V3BA 3U3ZA 4QIHA 2CHFA 4