2X76A

The crystal structure of phaz7 at atomic (1.2 angstrom) resolution reveals details of the active site and suggests a substrate binding mode
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
342
structure length
342
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of PhaZ7 at atomic (1.2 A) resolution reveals details of the active site and suggests a substrate-binding mode.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
total genus 132
structure length 342
sequence length 342
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x76A00
5K3FB 1XZDA 3VKFA 3DOHA 2Y2VA 2XQIA 2WHPA 4FLEA 4E46A 3KD2A 2WSLA 1N1MA 4RPCA 5JYCA 1J1IA 4B81A 2PVSA 2VSQA 4DMFA 1XRRA 2YH2A 3FYUA 3WL6A 2Y1KA 5AKGA 3R3UA 1MX5A 3ICWA 4J7AA 3PICA 3KWFA 4XWGA 4BYMA 1VXRA 1PFQA 1XRMA 4CI9A 4C89A 2XLCA 5AH0A 2C5FA 2EDCA 1DWQA 1ZD3A 3FSGD 3I6ZA 5IVDA 1YS1X 5KWIA 1UK7A 5BOVA 4OUKX 3G9TA 1EB9A 4HRXA 4WY5A 3D5EA 4AZ3A 2I3ZA 4GDMA 3WK7A 3IDAA 2XUFA 3ZWQA 1BN7A 4GW3A 5IVIA 1MJ5A 4S0XA 1X2EA 5ALWA 1EI9A 4MYSA 4YK7A 3L1JA 1XZJA 2PBLA 1C4XA 4UBMA 4X6UA 1U65A 4U2BA 1ODTC 4UUQA 4P93A 3C5WP 1TIBA 2OGTA 3F96A 3PI6A 2E3JA 4PQEA 3AZQA 2QXUA 4Q1VA 3KOOA 4G8CA 4FNMA 1XZCA 3M81A 1EK2A 2CZQA 1UK9A 4AO6A 1VXOA 3F98A 2JGIA 3SK0A 1IUNA 1JI3A 4AX4A 5LZ9A 1CLEA 4KEAA 1FFBA 5LZ4A 1E89A 4LYEA 4BE9A 4OCZA 4H7JA 2OCIA 2XB6A 3C8DA 5ALXA 4X6YA 4EB0A 4BZWA 1CUZA 1NU6A 1J2EA 5EGNA 4E14A 1Q84A 2WIFA 3NGMA 1CFJA 5JD5A 4G8BA 5C8ZA 3SC2A 5HFAA 3AZPA 5AI0A 1FFCA 1SCQA 3PE6A 4PSDA 2QUBA 1LPBB 5AOCA 4JYPA 2QMQA 2QRUA 3R3VA 2ZYSA 4G9EA 1Q0ZA 1LGYA 5DJ5A 1B41A 1GPNA 5ALDA 1CUXA 4WCVA 4J0CA 1QE3A 5FPPA 4X71A 2HU5A 2DFPA 3DOIA 4QE3A 3R3ZA 4U2EA 4GXNA 2W6CX 5JADA 4H0CA 3L1IA 5DNVA 4PSUA 3IUQA 4W9RA 5JZBA 4U2FA 4C88A 2FUKA 1TKRA 1ETHA 1XLWA 2ORYA 1QIJA 1QGED 2WKWA 4YASA 3TJMA 3M3DA 4UBNA 5FLKA 2C7BA 3H2IA 3HJUA 2ZJ6A 2Z8ZA 4QA9A 1ZOIA 2OCLA 3GZJA 4XJVA 5LIPA 2DCMA 3EQ7A 2C0PA 1XZLA 3GUUA 4B9AA 5LZ7A 4Y2JA 2Z8XA 1M33A 1G42A 4UBKA 4J0JA 3WMRA 3UMJA 3DYIA 2GYWA 1ACJA 1MTZA 3WQHA 2JBWA 5HZGA 2OGSA 3BJMA 4HTAA 1LBSA 4WDRA 3ZPXA 5E4JA 2WHQA 1ACLA 2EEPA 3MUNA 4HXEB 1MNAA 1R9NA 4LXHA 3FYUC 2OCGA 3W04A 3ANSA 4OYYA 4CCYA 3STTA 2ROQA 4DSZA 3R3WA 5EHXA 3I2GA 2HHAA 1YASA 2XUOA 4WFJA 4CFSA 4H7HA 4W1PA 4ZV7A 2I03A 3CCCA 4G4IA 3WKEA 1MAHA 3DKKA 5AI8A 3LIIA 1CQWA 5AKEA 1LPSA 3EQ9A 3V9AA 1WOMA 3EQ8A 2C4HA 3CXUA 2FX5A 1UKAA 2WIGA 4ETWA 5SYMA 2AXEA 2O2IA 4BATA 4X91A 2Z3WA 3DEAA 2HRRA 1XLVA 3FOBA 3DYVA 1HLGA 2CMFA 4MWTA 4P08A 5CXXA 4BRZA 1L7RA 4Y2YA 3WK8A 5ALJA 2HA3A 1VE7A 1D07A 3T52A 2BUCA 1DX6A 1ZD4A 1H22A 3OPMA 4BC0A 1QIIA 2HA7A 4MWSA 3H0CA 5LYYA 1YAHA 5K3DA 2HU7A 4QEKA 4ZRDA 1YS2X 2YASA 4AZ0A 2XMDA 3BIWA 3EF3A 4QDUA 3H1BA 1FFAA 5CH8A 3WKDA 1AX9A 3QYJA 3LLCA 4FWBA 4Y2UA 5I9IA 4F60A 1N5MA 4DNOA 5DTIA 4KYVA 5JAHA 1K63A 2G4LA 5CT6A 4WY8A 3C6YA 1PV1A 5HF6A 4JH0A 3U1TA 3NWOA 2ZJFA 5JATA 1EA5A 2C58A 1ISPA 1CV2A 4FBMA 5AIBA 2J3QA 1BEEA 3W05A 1DINA 2PPLA 4DMKA 1XQXA 3HXKA 1QO9A 5ALYA 5ALMA 4RNCA 1LLFA 1CUAA 1XZMA 2OLEA 1UXOA 3BXPA 4MJ3A 1WHSA 4W1RA 3WLAA 1GKKA 4UHBA 5A71A 2HFKA 1XRNA 1YB6A 4PW0A 2O7VA 5JD4A 4PNZA 5JAUA 2XMCA 5CT8A 5A2GA 3N2ZB 3C5VA 5ALNA 1HL7A 4L72A 2WFMA 3D3NA 2QT9A 4ZXFA 1HPLA 5AI6A 3FSGA 5JZ9A 1E5TA 4OB7A 4BCCA 2VAVA 3VJMA 2QM0A 2WU4A 2BGNA 4AB1A 3I1YA 1YA4A 3F8SA 4H7KA 1U4NA 2HA5A 5DYTA 1YA8A 3O4GA 1A8QA 2V98A 1DT5A 1MU0A 4EY4A 4GI1A 4WFIA 4QDTA 4Q05A 2JGJA 4KAJA 4UFOA 5F4ZA 5D3ZA 4M0EA 5C8XA 1UT6A 1NU8A 3BWXA 5CURA 4DGQA 2XMQA 5CBKA 4L3WA 1EB8A 4A5SA 1O6GA 2C5GA 2WQZA 1VA5A 2WM2A 3FLEA 4J0DA 1Y37A 4DTCA 1P0MA 2GBFA 1QIFA 3KSRA 1QJ4A 5D3KA 6YASA 3DDUA 2EDAA 1LNSA 1R1DA 3AZOA 3CCBA 4EZIA 4HAIA 1G4HA 2WIKA 2G5TA 2Y6UA 3I2JA 2JGKA 2BFNA 5ALUA 2X8BA 2PSJA 3C6BA 1SCIA 5CMLA 5AKKA 3T4UA 4BVLA 4BP8A 3HEAA 5AM1A 3KXPA 2O2HA 2JEYA 1ZJ4A 4X92A 1XROA 1EX9A 3F67A 1IMJA 3WJ1A 3W2TA 3D2CA 5HK9A 5FKJA 1CQZA 1QFSA 3I6MA 1W75A 3IIIA 2XI4A 2WJ4A 2BAGA 4W1SA 4BDTA 2CBGA 1CUBA 4LIPD 1AKNA 3DL4A 1WB6A 4E15A 4B82A 4FFVA 3R3XA 1BE0A 3MGAA 4Y9SA 3H17A 2XUIA 1Y7IA 4U2GA 1WHTA 4H35A 3V1LA 5CH5A 1CVLA 4C87A 5FV4A 1CEXA 2V9ZA 1MN6A 4G9GA 3HSSA 4W1QA 4J0IA 4ARBA 2CB9A 1R4ZA 1EINA 4EY7A 3IULA 3OC0A 4FBLA 3LIPA 4QNNA 1JJIA 2C0QA 2OG1A 3E0XA 4RE5A 2VJDA 4LXIA 3BF7A 2GBIA 4EBBA 4FDMA 3WKBA 3FNBA 1JU4A 2PSFA 4CIBA 3H04A 5HF8A 2XUHA 3HRHA 4J0KA 2XQGA 3V48A 4KE6A 1KEZA 2VEOA 3ESCA 1TRHA 1XZGA 1AUOA 2XMSA 1OCEA 2I78A 3I2IA 2HA4A 1EDBA 4F0JA 3B12A 3ESDA 5FRDA 2CJPA 1CR6A 1QIEA 1H23A 5E2IA 2BUBA 4W63A 1VOTA 1UKBA 1JMYA 3FBWA 4Y2SA 4JNCA 2XUGA 5HKBA 4BTLA 3EIOA 5EHNA 3HC7A 3I2KA 4X7BA 2QVBA 1ORVA 5AKYA 4NZZA 1XLUA 1QFMA 4YX9A 5AK5A 1LBTA 3DS8A 5ALIA 1A7UA 3M82A 4QWWA 5JASA 1WB5A 2VT6A 1AMNA 2ZSIA 4ROTA 3H2GA 1I6WA 2J4CA 2BUAA 4Y2RA 4CG3A 4JEIA 3R40A 5T4HA 2FJ0A 2YXPX 3V1MA 1TK3A 1BROA 4OYLA 2PUJA 1HBJA 4K2AA 5EIEA 1ZD2P 2JGFA 5FP0A 1QTRA 3FAKA 5DLPA 1KU6A 1DTEA 2ACKA 2Z3ZA 3U0VA 3BE8A 1TQHA 1P0PA 1IZ7A 2PX6A 5AKHA 1YSCA 4BB0A 2ZSHA 2D0DA 5LP1A 3QM1A 1WB4A 3I1IA 4BRSA 3RARA 3WK9A 1ZJ5A 5K3FA 3E1GA 1F0NA 4K6GA 3OOSA 5CH3A 3A2LA 2GYUA 1RWQA 1ZD5A 4EY8A 2WTMA 3HYSA 3C6XA 5IKXA 2NW6A 3V1NA 5AM4A 5AM2A 5HQ3B 3E4DA 1QO7A 1RYYA 2ZVDA 4N8DA 3R41A 4KAFA 4NMWA 4P9NA 3IUJA 3QPAA 2ACEA 1TCAA 3QH4A 1Q83A 4LHEA 3FCXA 5A7GA 1R50A 4CG2A 4UHHA 3G0CA 2HFJA 1Y7HA 4N8EA 4KAAA 2V96A 3AIKA 2HL6A 3KWJA 2QKYA 5CTAA 2R8BA 2Q0XA 5AHXA 4KE9A 3DLTA 1CUGA 3H19A 5AK4A 2Y2UA 5EI5A 2AJDA 5JZSA 1R9MA 3WK4A 4FFWA 2WIJA 4GBGA 1E8DA 2H7CA 4DNQA 5HQ3A 4X00A 3WWOA 3G0IA 3O4IA 4Q34A 3A2MA 4ZI5A 3CN9A 1H2YA 2B61A 4BAUA 4C4XA 1SOMA 4FMPA 4UHDA 2J3DA 4C6HA 1DX4A 2OAEA 5D7BA 4UFPA 4P92A 2VF2A 4KE7A 5AM3A 4QWMA 5K3BA 3IURA 3DJYA 2AJ8A 4FHZA 2PKYX 5LZ5A 4H7IA 1DU4A 1XQVA 3P2MA 3QMWA 1AC5A 1JMKC 3V1KA 3R0VA 2QJWA 2VJBA 1XRPA 1F6WA 3PUHA 1BCSA 4J3JA 4HXFB 1E8MA 4X6XA 3WK6A 1UKCA 5HF9A 3FLAA 4EUSA 4CIAA 3IVMA 3QBJA 2J4FA 4Y7DA 2H9YA 2HA0A 4EY6A 3HLKA 4QZVA 2VT7A 2HA6A 4B83A 2Z5GA 5ALTA 3D4LA 4BP9A 2RGUA 4MYDA 2VAXA 5AI9A 5A7HA 3WK5A 3VVMA 2XUPA 3QZUA 2O7RA 4PV7A 3K2IA 1XQYA 2WU3A 2XUQA 4I3FA 5DYWA 1GZ7A 2V97A 3STVA 4HXGA 3HI4A 1QLWA 3FVTA 3O4HA 5ALOA 4A16A 5IH7A 3A70A 1UK6A 5DTJA 2WJ6A 1G5FA 4EHBA 3QPCA 4ZGBA 3IA2A 3WA7A 2G5PA 3NOXA 1FFDA 4X3CA 4BC1A 4Y2XA 1J07A 3WWEA 4TPKA 5ALLA 1W6RA 1MNQA 2WFLB 1UFOA 3KDAA 4V2IA 5BV7A 4JYMA 1A88A 4UFNA 1WM1A 2PU5A 1ZIXA 3WZLA 4UBIA 2Y6VA 5HCUA 3X3HA 1CUSA 1MPXA 3B3QA 5HF5A 3GROA 5LKAA 4IH4A 1DQYA 4Q3KA 2B4KA 1NX9A 3A2NA 2AJLI 4QLAA 5LLSA 2DHDA 3YASA 3A6ZA 1CUFA 1JFRA 4HZGA 2XLBA 2JGMA 3OTQA 5HK8A 4B0OA 4BDSA 1QIHA 4G4JA 1AURA 3FVRA 4Z49A 2VJCA 1LPAB 2FJPA 1UOQA 1VA4A 3C6ZA 1CUCA 1MAAA 3S8YA 1CUWA 2ZYRA 4E11A 5ALQA 1XZIA 1XZBA 1QIKA 3IB3A 1W76A 3UUFA 2QZPA 3Q0TA 5EIAA 5ALEA 1ZGBA 3LCRA 1DWOA 1F0PA 3HZOA 2GBGA 1CUVA 4N5HX 2VATA 3H2JA 4HS9A 1RP1A 1MO2A 4L9AA 2RI6A 1J06A 1A8SA 4DYHA 5DNWA 3D59A 4INZA 3AFIA 4FOLA 2HU8A 2XMRA 4H7EA 3RKSA 1XRQA 2P8SA 2R11A 3G9UA 2OCKA 3H18A 4H18A 5JAPA 1XZEA 5CT9A 3AINA 5EIHA 2PUHA 2UZ0A 1DWPA 5AI5A 3TEJA 1DT3A 5ALZA 1PJAA 3UUEA 4B0PA 1MX9A 3F9CA 1JU3A 4FKBA 1MT3A 2DHEA 5AM5A 4GLBA 1EHYA 3F97A 2QR5A 4Y2TA 4CCWA 5I8PA 1IUPA 4F5ZA 5AIAA 3I2HA 2XQKA 5H3HA 3G0BA 5ALFA 3LP5A 3PUIA 1FSSA 1KU0A 3WZMA 5AK6A 2PSDA 1VZ3A 4J0GA 4MQMA 5EHQA 4PF1A 2WFLA 1YAJA 3WWPA 3FWHA 4I4CA 2IIVA 4QDOA 1QONA 2DR0A 4AQDA 1HQDA 1GXSA 4EA6A 5ALRA 3QITA 1VJ5A 5A6VA 1FFEA 4IQ4A 5A62A 5ALGA 3S2ZA 2WJ3A 1K4YA 3ZLTA 4BCBA 1BS9A 4B9EA 3VXKA 2QUAA 1IVYA 4OB6A 4KRXA 4PO3X 1EK1A 4M0FA 4HRYA 3DL7A 4Q82A 4C01A 3MUOA 5AKZA 2GYVA 3OURA 4ITVA 4U2DA 4K5QA 1UZAA 2ZJ7A 3IUNA 5T4BA 3AJAA 4RGYA 4F21A 1GPKA 3HABA 2WILA 2ONCA 1CUDA 5AKLA 2PL5A 3WA6A 4DNPA 3C43A 1CUJA 3DQZA 3WKAA 4UBLA 3ANTA 2BCEA 3AIOA 5JARA 1TCBA 3JYHA 2WG0A 1P0IA 5ALKA 1OILA 3PF8A 5C7YA 4YPVA 1UOPA 5LKRA 1ODSA 4AO8A 4KE8A 5LZ2A 5EHZA 1OXMA 4J03A 2G63A 2XE4A 3PFCA 3WI7A 2H1IA 3IUMA 4H77A 1K6EA 2WUEA 3D0KA 3WJ2A 4AO7A 4IH1A 1U2EA 1DQZA 1WCYA 3VJKA 3D2BA 5ALPA 1SFRA 4G8DA 3WL8A 4ZWNA 2DQYA 3OM8A 4DNFA 5C8VA 2OPHA 3M83A 2ZYIA 5JD6A 1LPMA 4BCDA 3AUKA 4FLFA 4DSAA 3E3AA 4XIIA 1YR2A 2WLSA 1LPNA 3B5EA 5K5EA 5AK3A 1H2ZA 2WHPB 2XQJA 1XZAA 3K6KA 2CUTA 4B85A 4XVCA 2GZRA 3MVEA 3N0TA 5YASA 3QVMA 1WPRA 4K6HA 2WFZA 3JWEA 5I7UA 5FDFA 4OU5A 2VQ6A 5JIBA 3RK4A 2WHRA 4DIUA 1HDEA 3GBSA 4X85A 3DCNA 2HA2A 2JIDA 1P0QA 4GECA 1VKHA 5JAOA 5AI4A 5CT4A 4FNGA 1JJBA 4NS4A 5AM0A 2QJRA 5AICA 3OG9A 3NUZA 3FYUB 2GBCA 1C7IA 4DMCA 2X76A 5AO9A 4BTVA 4EY5A 4Y2QA 2JGLA 5A7FA 1T4MA 3D7RA 1F8UA 2XUAA 4Y2PA 3PF9A 1XQWA 2ZYHA 1THGA 2ECFA 1USWA 5K3CA 1ZIYA 4UHEA 4NVRA 4QDZA 5CW2A 3TRDA 4ARAA 2OXEA 3H1AA 1ODCA 2HADA 3GELA 4FLMA 1BN6A 1YCDA 4AMZA 4BVKA 3QPDA 5DYYA 2OQIA 2WG1A 1YB7A 5AKJA 3FLBA 4G4GA 3WIOA 1CUEA 3ILSA 1ZI9A 4G5XA 1R88A 1W52X 5ESRA 4UBJA 2RHWA 4UBOA 4BVJA 3PFBA 4X97A 1LPOA 1W4LA 3C8HA 1GGVA 1QIDA 3FCYA 1FJ2A 1TAHA 4MQLA 3IBTA 3I2FA 3D2AA 1S8OA 2XMGA 1T2NA 4XX1A 4OU4A 3SWWA 2X5XA 5ALSA 2ES4A 2RAUA 2XUJA 5E4TA 1X70A 2PM8A 4OSEA 2YYSA 1ZI8A 5HKAA 1BU8A 1MX1A 2HIHA 1QOZA 4TGLA 4C4YA 2D5LA 4Y2VA 2VJAA 1GPLA 5AJHA 3JW8A 2JGEA 2B9VA 4UHCA 2DSNA 1GT6A 4D9JA 2O2GA 2QS9A 3AIMA 2AJBA 2HM7A 3Q8WA 2QOEA 2B20A 3ZV7A 1L7AA 3O4JA 1G66A 5JANA 2XMZA 2BJHA 4GWLA 1AZWA 1EVQA 1O6FA 3WL5A 3RM3A 1B6GA 3BL8A 4QDXA 3BDVA 4TVKA 3C87A 4BAGA 4N8SA 5AOAA 1E66A 1EDDA 1CIJA 3BDIA 4DLNA 5E4YA 3FYTA 2DQZA 2PSHA 4M0MA 5ISMA 2H7XA 4K6KA 4FTWA 4C4ZA 4WJLA 5C81A 3WYDA 5HFNA 4QLOA 1L7QA 2CKMA 3HACA 4ZV9A 5FUMA 2HRQA 5K3AA 2XT0A 4LKOA 3W06A 4ZREA 4AMYA 1XZKA 3STXA 1K5PA 4CCYB 1XZFA 5AKIA 4X90A 1VLQA 1ZICA 1A8UA 1CPYA 4A23A 3ZI7A 1QTIA 4U2CA 3G02A 4UHFA 1JKMA 1E8NA 5KREA 1CUUA 3ZLUA 1R3DA 3QMMA 3W9BA 1LPPA 5ALVA 4KR0A 3CN7A 3H2HA 2RHTA 1H2WA 5IVHA 5LZ8A 4LXGA 4DMHA 5CXUA 1GQSA 3ESBA 3GFFA 3H2KA 1E3QA 5AP9A 4G1FA 3VJLA 5FPQA 2JF0A 7YASA 1SC9A 3WYNA 2VA9A 4X95A 3WKCA 3G9ZA 3G7NA 3G9XA 3WWDA 1XRLA 5DNUA 5ALHA 4GHWA 2WUGA 4Q3OA 1VE6A 2GZSA 3I6YA 5BWBA 2WIDA 1EDEA 4AN1A 1X2BA 4IH9A 3G0GA 4HVTA 1UOOA 3DNMA 3K9BA 3RLIA 1GKLA 2PU7A 2JEZA 5KWJA 1SCKA 1N8SA 5SYNA 3ICVA 1CUHA 4B7ZA 3EBLA 1GQRA 3G8YA 2WUFA 3WIBA 5BWCA 3BJRA 4MXDA 4CG1A 1LZKA 2H7YA 1CUYA 5KBYA 1AGYA 3GA7A 2I3DA 4J0HA 3STYA 2BKLA 3SX4A 4H7DA 2QXTA 1UK8A 1N5RA 2VTVA 3DKRA 2XDWA 1EH5A 5T4FA 4JUIA 1H2XA 2IX9A 1XKLA 4PSCA 4WFKA 3O9MA 1W1IA 4RE6A 2XUDA 4GEGA 2W22A 4BBZA 4L0CA 1LZLA 4KJXA 1XFDA 5JALA 5FXMA 1QIGA 2RIPA 4N5IX 3R3YA 3BIXA 4WDQA 5AOBA 5FOQA 3ZLVA 1QIMA 3O0DA 1EVEA 2HDWA 2CEKA 1UWCA 3VDXA 1JT2A 2IITA 4BAZA 5CRIA 1BCRA 1Q0RA 4Q3LA 3G0DA 4IO0A 4MEBA 3PDCA 1HKHA 1U8EA 3LS2A 3VVLA 2WTNA 3WL7A 2XQFA 2LIPA 1WPXA 1CRLA 2RONA 2PSEA 5IVKA 1ZGCA 1XKTA 1IUOA 3C45A 5CT5A 2XUKA 4BE4A 5J3JA 5DWDA 4IHAA 3STWA 3C70A 3STUA 3L1HA 1THTA 3O95A 3VISA 1ORWA 4DM7A 1Z68A 1VZ2A 4I19A 2OAGA 1JJFA 2DHCA 4MEAA 1BEZA 3ED1A 4OB8A 5T4EA 4OD0A 4KACA 4AXBA 1BRTA 4X94A 4OPMA 2QTBA 1ZI6A 4UPDA 2OGZA 1CUIA 3O9VA 4B6GA 2BGRA 1QZ3A 4AN0A 4KRYA 3I28A 4X93A 1TCCA 2XMBA 2K2QB 1K8QA 3QMVA 4B84A 2WG2A 4BZZA 1IZ8A 4O08A 5AKXA 5EFZA 3AILA 5D6OA 1EXWA 1AQLA 4B80A 1C7JA 3ESAA 3DD5A 3BF8A 4H7FA 3W9UA 4LYDA 3TGLA 2OQVA 2AJCA 3WWCA 1XZHA 5K3EA 2WUDA
chains in the Genus database with same CATH superfamily
3RTEA 4XB6B 3KIPA 2RHRA 1XZDA 3DOHA 2R8RA 1P2VA 1VIDA 2QIPA 1SMKA 4QTXA 2DUUA 2XQIA 1ESMA 3B9BA 4QOHA 3SU8A 1P5HA 2IFTA 2NZWA 3PNPA 2IVZA 4DIMA 4BLVA 2ZSUA 3KTOA 4J3NA 2Q9CA 2Z2YA 4IOLA 4JXZA 4HADA 3DO8A 1T2DA 1UL1X 3TJZA 3W5SA 1AA9A 3LPDA 1N1MA 3QPUA 4MR8A 5IC6A 2VNHA 3AG6A 3L43A 2ZB2A 1BQ3A 5K8CA 2XIJA 2B37A 4WD3A 1Z74A 4YP9A 5AXBA 1S2MA 1K7SN 4PCLA 1PCXA 3P0FA 1E6KA 2FWAA 2QE7A 3ET5A 4EFNA 2HEGA 2YH2A 2RG1A 2FNAA 4ZREA 3WL6A 1QPBA 2XYVA 5CR9A 3H2BA 3EXIB 4FYMA 2AV6A 2YWRA 3JRXA 4H4CA 5AKGA 3NNNA 5DTQA 3QG1A 2O07A 1J99A 3M34A 1MX5A 3R0QA 5KNDH 3MF4A 1T3ZA 3KE9A 4J7AA 4XYMA 3PWZA 1RAIA 3PICA 3JAWB 1XK7A 3AERA 5BN5B 4CKEB 1KOLA 2B8TA 1TYEB 3EWNA 4QYWA 5KOHB 3W90A 3NAGA 4XA8A 4D82A 1JILA 1M10A 2CMGA 1LV8A 3GUCA 5ESWA 1PT8A 1D2MA 1KBOA 4CI9A 3MRTA 4MMYB 1KZ4A 2WHEA 1MXHA 1Y3HA 4ZVRA 5A5EA 3WV5A 1EFPB 2EU8A 5EJ9A 4JP1A 3X1KA 2WAAA 4F2WA 1SIOA 1TM5E 5E9WA 1REQA 3RW9A 3AR8A 1YS1X 2ID4A 2O1XA 3A6HA 2X8AA 1NBEA 3H4VA 1ABFA 4LMPA 4LOKA 1C3VA 4NF2A 4ITRC 3T5BA 4B4UA 4ALNA 3G9TA 5KJEA 1FUEA 2QYTA 3NHWA 5LBUA 1G38A 2CNLA 4ZODA 5JSZA 1EQ2A 1RM3A 1UJNA 3IB6A 2GJKA 3PE4A 1EEXB 4HRXA 4Z9FA 3EWSA 4BMSA 1VSVA 3LT1A 3HFSA 1OX4B 3MM4A 4R51A 5D85A 4RSHA 3FDZB 2DE0X 3FFXA 3I2YX 2XUFA 5FI3A 2R8XA 4WUVA 1YFKA 1BN7A 4WXYB 2BW0A 1Z2EA 3L84A 3LUFA 3P9CA 3VGPA 4TT8A 3SYKA 1EXVA 3EDCA 5BSKA 5GOZA 3CZPA 2WD7A 1ECFA 2PKCA 2B5OA 2QI9C 3L1JA 4RF2A 2HMYB 3EPLA 1C4XA 2VCHA 3AKDA 1U65A 3LT5A 4D46A 1KDVA 721PA 4UUQA 1W4ZA 1ISFA 5DVZA 1ICIA 2Y4NA 3C5WP 1FP4A 4GYWA 4A8PA 3BA6A 3DV2A 1NM5C 1QV6A 4DDTA 4MLCA 5FPTA 1TIBA 3CV3A 2OGTA 1NXTA 4I08A 2ZT6A 3EZFA 3RJ5A 4PONA 3SJ7A 1DPGA 3ZNQA 3F3KA 5BN3B 4QG7A 3FFBA 3AZQA 4CG3A 4EDFA 1CXZA 2YJ3A 3A4TA 2AFHE 3O84A 4GEKA 1EUZA 4FU0A 3ZE9A 4I4TB 3U44B 1YR3A 3SYLA 2MYTA 3V80A 3TN7A 1KJZA 2IS1A 2F64A 4GICA 1EEHA 1UK9A 4AO6A 1LTQA 3MB5A 1VXOA 3S44A 4EB6A 2JGIA 3QKIA 4D4MA 5D5QA 3O5AA 4BNLA 2WF5A 5JNWA 4IRMA 5TNXA 5CB4F 1G8FA 3KBOA 2GXAA 3EXIA 2JFPA 2JJ1A 4KH0A 4LI3X 1CLEA 3GFBA 4R8SA 4OQEA 1SQGA 3EVAA 3C14C 1LLDA 1RPZA 4BE9A 1E6LA 1E98A 1PZHA 4II2A 3I5AA 3OA2A 2C07A 5DHPA 5JCOC 4HX2A 4H7JA 5ENVA 4EX7A 3G9QA 5ALXA 4QTYA 1AZTA 2D0OB 4X6YA 1Z7BA 3PVZA 2ZG6A 4P4TA 2CLLB 3LK7A 2Y71A 4OHFA 2E4AA 4OSOA 2C61A 3SXPA 4B45A 2FUEA 1PT6A 4JLDA 5CX1A 4CM5A 3GD5A 5C34B 1C9DB 4XI9A 4CMJA 1J2EA 3ZY5A 2UVPB 3FSJX 5IBRA 2AXQA 1CFJA 1Z5WA 3A14A 3FTDA 3LUAA 5HUJA 2QLJA 5JV5A 5JMOA 4B40A 4L4SA 5C8ZA 4DLAA 4OL0A 4U1RA 5L8VA 4JYBA 4HB0A 3SC2A 1JT9A 1RBMA 4P33A 5AI0A 2Q46A 1A4UA 3W6ZA 2IF0A 2XVYA 3EGDA 1SCQA 3O1HB 3PK0A 3P4YA 1SJ9A 1X1TA 3O91A 3PE6A 4LZWA 3DVAB 2REXB 2DB3A 2E5WA 1KQNA 2JHAA 2H18A 1QQTA 4FYIA 4L5JA 1DXQA 4OG2A 3TLGB 4EB3A 4EYKA 2J3HA 4LG1A 2ERCA 1TTQB 4P4LA 4G9EA 4PXAA 4TUYA 2SCUA 2XMPA 1X7GA 4BIMA 3PFWO 4LK2A 4CTNA 5IC4A 2FPLA 3CR3C 5MN4A 1U7WA 1Y4SA 2UZ4A 3ADPA 2PNJA 5EC8A 5D87A 1JDZA 4W7HA 2GXUA 2O0JA 1FIUA 2YJ4A 2FHPA 4JZYA 5JCPA 5HKKD 3TVDA 1MVOA 3I0NA 3K8YA 4U3JA 3FCEA 4B6QA 5K99A 4TV9A 4QT4A 3TB4A 4RPLA 5LR6A 4X71A 4I4IA 2WF8A 5IWCA 1Y9ZA 2JGDA 3QY9A 1T2CA 2W58A 5E2AA 4U2EA 5L6MB 3TCKA 4GXNA 4M3NA 2J3IA 1SVIA 5ERGB 4V0NA 3R8FA 3ITKA 4K26A 5CNMA 3UA4A 2R84A 2WHXA 5D51S 5DNVA 1VPVA 5HCNA 1H2RS 2FUKA 1ETHA 3JQFC 3UJCA 5E95A 4OIFA 4XD2A 2B4TO 2ORYA 2QT1A 1QIJA 2B3TA 3UA3A 2F00A 4X7RA 1QGED 1ZMTA 2GH1A 2ZE6A 3H75A 4R2HA 1TGVA 4FOOA 2YXBA 4UBNA 4QUBA 2YWEA 2IL1A 4PHFA 3H2IA 1KC1A 2NO6A 4NFHA 4WACA 2VDWB 3OE7D 4PVDA 1IK6A 1JPJA 1QLJA 1D0VA 2X6TA 4L76A 4Y9UA 1T6NA 3RTGA 3WE7A 5A9SB 4GLOA 2JIOA 3FX2A 4AJ9A 3ZIUA 4XJVA 1ISIA 3IT0A 2QAJA 2RCNA 2VHTA 3EQ7A 1NULA 5LWHA 1TK2A 4PG6A 2E4XA 4M21A 3DFIA 1X7WB 5C4GB 2YJ5A 4B48A 1LQTA 3CINA 4QUKA 2ZQZA 4HN4B 3FZGA 1ZM2A 1TQ4A 1KSJA 5LZ7A 4FMCB 4LFBB 4NZPA 1G42A 1VYUA 5LA6B 1MQ9A 1IHUA 4OM8A 3ETGA 4YJDA 1PT5A 1GNPA 4IJ6A 4BYGA 2H48A 1SWWA 3B3AA 3DYIA 1XWWA 3GLFB 1H94A 1HT1E 1RJWA 2GYWA 3NV7A 1FP1D 1MTZA 1OC4A 2BBOA 2BF7A 4J1SA 1RQRA 1G7TA 3VZRA 3WQHA 3ZY6A 4Z2AA 1FXWA 4QBFA 2C2ZA 1QUFA 4NOLA 3MBKA 2GEJA 4LQCA 2HR1A 2CNBA 3HUEA 2Q5CA 4PC7A 1OLSA 2KS6A 3LBNA 1BVYF 1WEKA 4EW6A 3KSAC 4M1EA 2F3QA 2WVGA 1NR5A 2WHQA 4HDCA 1N34B 2O8NA 1YQQA 4B3TB 1VHLA 1Z06A 1VJGA 4TTAA 2ZRMA 4UD2A 3RKRA 4OJTA 1YT5A 4BFWA 2BGIA 2Q1XA 2QN1A 2F90A 5G1NA 1Z73A 1H8HD 3BGOS 4IWNA 4AJ1A 2CYCA 3NKFA 2VTKA 3ANSA 3JATB 4CCYA 4IL5A 2DTDA 3STTA 2BZ1A 5ESXA 1P1RA 4NR0A 4YCAA 4DSZA 1FTWA 2HHCA 4WKNA 3W5UA 3B1VA 3RHSA 1S2NA 3R3WA 1EGQA 3NDPA 4RVUA 3V8RA 3ZBQA 5EHXA 4MR7A 4WCFC 3TINA 4MK4A 4UU1A 3QWIA 2IEYA 2JANA 4JQSA 5F73A 4CHTA 4FGUA 3BD6A 2O3JA 2HNBA 1V4BA 1YASA 3KPJA 3KQYA 4QGAA 2XZTA 1O2DA 5JVDF 4BPBA 3K70C 2XUOA 3L6DA 3SY8A 5I48A 2QTVB 1NW6A 4H7HA 1VGRA 4UAJA 3ZX4A 1Q21A 4TT3D 5HSGA 5JEDA 4GZ5A 4PM4A 4PX3A 2BBSA 4WZBA 3WKEA 1JTVA 1UXHA 3IPXA 2OE2A 1ZUD1 3NHZA 4GXRA 1JDJA 2DTXA 2XOKA 3WLSA 4QSHA 3O1LA 1IIRA 1IY0A 3LIIA 1L4EA 1KEVA 1RXYA 3QX3A 1BNCA 4BQIA 2Q3MA 2EERA 4CQJA 1EJBA 4GH5A 5AKEA 4EJ2A 4Q9KA 2ASVA 1JEAA 3T5AA 2GPSA 3ZW7A 1XVAA 4JHXA 4BIIA 2P9EA 4Q9JA 2VSNA 1JMVA 4M9RA 3RSQA 2J85A 1A76A 1WXDA 1CY1A 3UJ8A 1E2LA 2AXEA 4R3UC 1IPFA 3KZOA 4JL8A 1B3BA 2FN7A 4RDXA 1U1CA 4MLPA 3KVRA 1PK7A 1A9TA 4AM8A 2RH5A 1N1GA 3U17A 4OVKA 3DYVA 3W77A 3NBZC 3W3ZB 4Q6WA 2HWYA 2W48A 3DZDA 1I14A 4IWYA 2Q5OA 2JG3A 2QN2A 5F3WB 5ICSA 1L7RA 3G0HA 2WDPA 4AMGA 4G5QA 5K6RA 2IH2A 4I50A 2ZBDA 4PICA 4C4RA 1NZJA 1WXEA 4HVCA 1D07A 2VLIA 1VCMA 3P2IA 5AUQA 3T52A 5IZCA 1JI0A 1DX6A 2WJHA 4LNAA 3VR4H 4BVEA 2FHSA 2O5CA 3B9QA 4BBAA 3ZVNA 4RVDA 1P19A 1J2RA 1L5QA 4IYRA 4BC0A 4NFLA 1QIIA 3AR5A 5AHRA 3EVNA 3K20A 3ZZ1A 1ZL0A 2LVBA 4P4SB 1I4OA 5D3MB 4QEKA 3N9IA 1MOQA 2WWGA 5BPHA 3O3NB 4C6SA 4CN9A 3GAZA 4QFBA 2YKGA 4TXLA 1X1RA 4AZ0A 3DNPA 3FGNA 2OV1A 3ENQA 1SBNE 3IOBA 3IUSA 2XJ4A 4C2AA 1PQ4A 4CFYA 4CKWB 2RDMA 1V37A 1YRBA 3N0XA 3NM4A 4KIWA 4QDUA 4WA7A 3H1BA 1A77A 1VRWA 5GY7A 4GOOD 2JD2A 4RC9A 5HKOA 3QE9Y 2FV8A 3C8ZA 4KO1S 2ZT8A 1X8JA 1Y48E 4JUFA 3MQ2A 4RHCA 1WULS 1DKRA 4FI3C 2XA9A 4DRXB 3TEMA 2IE0A 1KWGA 2V4ZA 1KIAA 4C3VA 1D1SA 2B1GA 2HWUA 1N3BA 1A9SA 1QGOA 1G98A 3KZXA 3LT2A 1B73A 3VNRA 1OGJA 1ZN8A 2ZJ2A 1D0SA 3CMMA 1YRQA 4LE1A 1I01A 4UTPA 3FAZA 1N5MA 2DMRA 3SMVA 1PTKA 1GGNA 1MC4A 2A59A 3E2MA 3MT0A 3MS4A 3VVCA 4I55B 2PXAA 4NP6A 3DDWA 3JWHA 3NRCA 1V47A 5DTIA 4R1MA 2O0HA 1XDGA 5LMZA 1SHUX 3QOXA 3LY5A 5KX5F 4QTZA 3C6YA 4XCXA 4PRZA 5HF6A 1QZXA 2WUVA 3HNRA 5LXTF 1W36C 2GRUA 3WGHA 3KZNA 1X9GA 3F6YA 2VTBA 3U1TA 3Q1KA 5JZMA 3RDPA 1N3YA 4M1OA 2WPNA 1KQPA 3BXEA 2YZGA 1EA5A 1G9TA 4M1QA 1CV2A 1ICEA 4RQAA 1V48A 5CX1B 2BTQA 3OESA 3TYXA 3ACBA 3KU1A 2XZOA 4HN2A 5F5NA 4WXPA 3TW8A 4G56A 4RHUA 1ZMRA 2QQEA 2CK3D 2PV0A 5FA8A 2IQIA 3E48A 4K1LA 4RNCA 1NP6A 1JG7A 2PQMA 1T8YA 3BAZA 2R00C 3DTTA 3H4IA 5J5VA 3I9LA 1OYVA 5CA0F 3DCYA 2H2FA 3DVLA 3C7CB 2XVAA 3EFBA 4DQUA 4MJ3A 1XTUA 3Q8XB 4YWHA 1NVXQ 3TZEA 3BXGA 2PH3A 3UB4A 2QTMA 2QG6A 1T6ZA 1I51A 2ZAOA 2JKVA 3OQBA 4OMFG 4NWIA 3T3GA 4EKYA 5IVPA 4XOIA 4YP0A 4W5OA 5A71A 2PYIA 2BWJA 3NCHA 2GZHA 2HFKA 4I1IA 3GRYA 5GIOE 3FTEA 3C5HA 1GAQA 4I36A 2CCKA 3R7LA 2ECQA 1MIHA 2CLFB 3BAFA 1V8PA 2C9DA 4X3OA 1GQ2A 4AZ0B 1LJLA 4P84A 2XMCA 1M6HA 2AW5A 3KJXA 2IPMA 1Z0IA 3MJVA 3ITNA 5LP6F 4ZOCA 5B12A 3KDSE 3QTTA 4J7UA 2J7PD 2GO1A 3SQDA 3T5TA 3C5VA 4D43A 4DG5A 3JZDA 4YUXA 3U7QB 2O8BB 4K28A 2WVHA 3ZVRA 3DZGA 4B3SB 3GQBB 1YJAA 3L05A 4BRWA 2CWDA 2B1QA 1HL7A 4CV1A 4R16A 2WFMA 4BO7A 5A0TA 1MJGM 5JJKA 4NBLA 2FMXA 4M0UA 4EG3A 1KPGA 4XKJA 2QD2A 5K7SA 1HPLA 2ECPA 2XNDD 5AI6A 4PG8A 3LK6A 2P91A 3E7PA 5J2TF 1GSHA 3UMFA 3C15C 1H0HA 4DPLA 1PJ2A 1WQ1R 2IBSA 3GW8A 4OKNA 4TMFA 2VAVA 2X13A 4IGEA 4OK6A 3CBGA 1DEOA 3JD1A 3NC1C 3MRXA 4R81A 4QO7A 4AB1A 3CNBA 4ND2A 3RJMA 4P34A 4BV8A 1AT1A 4U8HA 4WGFA 2V8OA 1PL6A 2ZBEA 4JROA 1LB1B 2AFRA 1AV6A 2NACA 4TQUS 3PNYA 5KQLA 4OH1A 4CDGA 5DYTA 2I2DA 3IPYA 1KRXA 3ILXA 1SXJA 5DCUA 4J94A 3QP9A 1EMDA 2R7AA 5KTYA 3RUHA 1T5IA 3BB3A 3M5WA 2V98A 4ITUA 4MW7A 4OOEA 3TL6A 3ZXUB 4ZMBA 5A9RA 2XCTB 5DGIA 3VSDA 4F04A 1GTSA 4UEJA 4RULA 3K31A 5T41A 5CGQB 2AMJA 5KS2A 1NFQA 1YGPA 4QDTA 4ZO7A 1O3YA 2OXIA 5TT0A 4KAJA 5D01A 4PC6A 2PKWA 3RS8A 3BERA 4FQ5A 3T35A 5C8XA 2ZUEA 1BTOA 4XB2A 2QN9A 3ZY2A 1ZONA 4ZEVA 4G2NA 5J5AA 2Y92A 4Z1MD 4C0KA 2EBUA 1ONSA 3E7XA 4H3VA 2VWQA 1N5IA 1X7YB 1YDGA 2WQZA 3ECCA 3SEFA 5FCDA 2ZR0A 2VO1A 4HFNA 1EM8A 4MV9A 2FDXA 4X8OA 2ACWA 2C3YA 2P1DA 3IQGX 4IF6A 2XODA 2EKQA 5EAIA 2HPAA 2GBFA 1QIFA 3JZAA 5LOVB 3OBIA 3OQIB 2PMCA 2HN9A 1EHIA 1PBNA 3RF6A 1NXWA 3MMXA 2W8BB 4ZVSA 1T36A 2H17A 3K1TA 1V6CA 3I5YA 1R1DA 2B92A 4OREX 3WBBA 1RI1A 1D4ZA 1G4HA 4O1IA 1FA9A 1JQDA 3ANNA 2VSFA 3FWYA 3I45A 3VC1A 3I1FA 4E21A 5I9SA 1NW8A 3CRVA 5KAMA 3TUJC 3V4LA 2ZE5A 1FJHA 1FMLA 2PSJA 1S3SA 4B09A 3U40A 4QVIA 2ICAA 1N2IA 3QX8A 1JZSA 2OCYC 2IHVA 5BOSA 5BT8A 1FW6A 4CM8A 2YW9A 1P74A 2DJ5A 1NW5A 2FB9A 5TGZA 3VBCA 3RWBA 5EMHA 3JAKB 4Q01A 4FGSA 1SB8A 1VHWA 3HBAA 3HEAA 1TUBA 2FW7A 2GPTA 4PTLA 3KXPA 3O0TA 2O2HA 4S1PA 5AM1A 3SDBA 4EELA 4R3NA 2GCOB 5KSZA 2YJGA 4X92A 1XHLA 1Y6GA 3NOVA 3F67A 2OYRA 2QX7A 2GQ0A 1TDJA 1P9RA 2P2GA 2QV0A 1M83A 3D2CA 3PYLA 3ROMA 2NV2B 5E7MA 5HK9A 5JNSA 1P45A 2ZJAA 4Q4AB 5KYWA 3I6MA 1A9OA 2YZ7A 5FOTA 1Y9DA 1YQWA 4JGBA 3OWHA 2WJ4A 4LOIA 2QL7A 1ULBA 4UCQA 3ONEA 1L1QA 3JQ7A 4LIPD 2D7CA 1AKNA 1X92A 1PQUA 3EGCA 4Z8XA 3T7AA 2FDRA 1BJKA 4CM1A 2O2SA 3SSMA 3E15A 3P9SA 4GMFA 2IWRA 6GPBA 5FOSA 2PUDA 2SECE 4O2BA 4WSOA 2JLVA 4R31A 2BKEA 1Z8NA 4IDEA 3AI1A 3WQSB 2QX6A 2REQA 2Q45A 4Y9SA 1XTJA 1SQ5A 4UC0A 3PVSA 5IPFA 3GRZA 4U2GA 5G0SA 1NN1A 1JDSA 3F5SA 4I1YA 4ZDKA 1T2FA 2HO5A 3EEOA 4UARA 3KT3A 3PFNA 1OW3B 1U81A 1XZQA 4KZKA 4Q02A 5B3KA 5EMJA 2WWRA 3PQ7A 3K0FA 4C87A 1Y8RB 4YJHB 2RK3A 1CEXA 2VP9A 3ELYA 2HSDA 3CWZA 3GLHA 3L3BA 1W0KA 3SLKA 4QJBA 2A14A 3GK3A 3RVSA 3Q5GA 3KXIA 1M1UA 3BCUA 1RQPA 2RHHA 3AONB 3A3KA 5H3CA 4PLGA 3A32A 2QAIA 3HSSA 1J2TA 1A8HA 1NI4A 1TLLA 4J0IA 3T38A 1Z62A 1EINA 2RGWA 5JAMA 2Y1CA 5L7WA 2O05A 2YXDA 3PWTA 2YWCA 3A7EA 4EY7A 4JWKA 4YGXB 4JIMA 1MUUA 4QUAA 2HBZA 4JGGA 3T1NA 5JI2E 1LBEA 5KEIA 2Q1SA 2O3UA 3E0XA 3KQLA 4PX2A 4K81B 3TLBA 1G8PA 1IN7A 1G7SA 1XD8A 4BUCA 2JC3A 4FX2A 3RCBA 4CHGA 3A4IA 4PN3A 5IAGA 3JQPA 3FNBA 4FOPA 4F4IA 2B8WA 2NUTA 1JU4A 4J29A 4D3XA 1ZISA 2WYIA 2F3TA 3OTGA 2B5WA 3HV0A 2DUWA 2YXLA 2NO4A 4U5QA 5K1ZA 5HIIA 5EE0A 1G16A 1HORA 1MORA 2YHSA 1G8GA 3PQCA 3FETA 1ADCA 5FBQB 2NU9B 3FUVA 3H04A 4P3XA 1C9YA 5L45A 2IEDA 2ENWA 1QBGA 5A5GA 1PJCA 3PHBE 2XUHA 3F6RA 4J0QA 4CVNA 2V5AA 1XCBA 1KPIA 2XQGA 3NIFB 4RM3A 1PGOA 4FW9A 4ECAA 4LWZA 5EP3A 3LU1A 1K86A 1A7KA 3KQWA 1N9GA 5ANRB 2PGJA 3T99A 1VL0A 4BJ1A 3OD5A 5FT9A 1DFIA 1UBJS 3M3HA 2XMSA 3H9EO 5KHAA 5TGTA 5EMLA 3RF7A 5LU9A 1QR2A 1OT5A 3JQ9A 1QF9A 1UJ5A 2GFIA 3HA2A 3IT2A 2EZ9A 1OCEA 2J0VA 4YRKA 1OXVA 2HA4A 1EDBA 4WLFA 1AUXA 4F0JA 3ESDA 4BQQA 2HMAA 1SU4A 2YHIA 3CJRA 3I64A 3FPBA 3K0EA 1D2AA 3HKBB 2W6ZA 2P62A 1CHDA 1GLVA 1H23A 3BVPA 1EWQA 4W63A 1JIIA 2MIIA 4IG4A 4TV8F 4YROA 1RKBA 4LW8A 2SNIE 1LJ8A 3A1WA 1T9HA 2PX0A 2WD9A 2XQVA 2YRWA 3HRKA 4ZK6A 5H9VA 3DZBA 3IVXA 3JS5A 3RVKA 2R6ZA 4QDKA 2ABWA 4CEHB 1EFVB 3E9RA 3HFGA 4PNHA 5IM4F 3OX1A 4E5DA 4KN8A 4GD3Q 3IJEB 2ONZA 1AXGA 2HSZA 5C8YA 4EYSA 3I2KA 2FPRA 3RGGA 2HQOA 2QVBA 4R1UA 3ZZ0A 1I2AA 4US1R 1ISGA 4NZZA 4P5PA 3WY9A 3V00A 1WUIS 3EGOA 1VCIA 2NADA 1EGHA 2F1HA 2KBEA 3NBXX 2O3RA 3OP1A 5CLLA 5ER6A 1PO7A 5AK5A 3SZ3A 4B79A 4OO3A 4B73A 4D98A 2FG6C 5JVDA 4S04A 2QTNA 4QG3A 4GQIA 1JZQA 3SSOA 2IGTA 9ABPA 3J81A 5EINA 1V8ZA 2FFAA 1E5DA 3WQQA 5C46F 3K71B 1HR0B 1XTTA 2HHHB 5DHFA 2FPKA 2V6GA 2V9PA 4W8HA 1NDUA 4YAUA 2R2GA 2J4CA 2X42A 1Z7YA 3FPEA 1DJNA 2YFKA 1KJWA 3JQAD 2YV1A 5E2BA 3R9IA 4IKPA 3X1MA 4J75A 4BO2A 4AG6A 1CFZA 1OZFA 1DKOA 5CG1A 2JGRA 4MROA 3V1MA 1CR2A 3CQ9A 5BV8A 1ZH2A 1NXSA 4IJWA 1GPDG 2QN8A 4KR6A 1ZWLA 1J0CA 3R0XA 5KVCA 3LKVA 4Y9RA 1JF8A 4GZ3A 3UO8B 1CJUC 3WLIA 3IOCA 5B3AA 5C3UA 3VU8A 4CR6A 1DTWA 1BOFA 1PYGA 4DR5B 4ZT4A 1E5XA 1ZD2P 3HGTA 4URYR 4PANA 1FYWA 4JUDX 1WXGA 5FP0A 4O4JB 4XX0A 4KNYA 1SQFA 3AI2A 3FAKA 3DMDA 5FX2A 5L6LB 1OVMA 1LY1A 2D5BA 1A5SB 2IEAA 2IW1A 4YAFA 5HMLA 3RUPA 4A0GA 3D4NA 5B1EA 1Z47A 3KAKA 3U0VA 2N1MA 2PJDA 1H4VB 1TQHA 3BE8A 1JJAA 6ABPA 1Q12A 4DQKA 4PXYA 2QUHA 1CERA 1XXHB 2GJAA 1PS8A 1Q3HA 1XA3A 3PD7A 3RI3A 4F3CA 2QPTA 3IAHA 5JS8A 2D0DA 2I33A 3PJGA 1I0ZA 5JS2A 1TNDA 3C41J 3T3IA 5CEJA 1EFRD 4OMDA 2ZDGA 2JJ8A 1ZSNA 3VI4B 5BW6B 4HH0A 4K6GA 4TVSA 1XUOA 4CI0B 1M8FA 1ZJWA 4IV5A 2EJCA 2ZOSA 3CZ5A 2GYUA 4RPHA 1RWQA 4C03A 5HE8A 5CLFA 2ZVPX 4YDQA 3ZXSA 3EUWA 3K73O 5JYDA 4F4CA 1ZD5A 3DVAA 1Z2AA 3B7GA 3UTCA 1DDGA 2IDZA 2EWVA 2WU8A 3CSSA 1ODLA 4M7RA 5CFOA 3R9XA 3C6XA 5IKXA 4F96A 3V1NA 3UAVA 1W4CA 3HA3A 3ZDXB 5HQ3B 1P4RA 4KUHA 3ND8A 3E4DA 1F9EA 5TQ0B 2F1IA 4RH3A 2UZAA 3Q9UA 1GA6A 3T3NA 1EVIA 1PJBA 1RYYA 1U4OA 3GVXA 2BLNA 2G6TA 3A4NA 3UAOA 4P35A 2Q9BA 2VUTA 2QGNA 3R41A 3AF5A 4NMWA 4P9NA 3FDXA 1TCAA 3WGIA 2AYYA 2C2OA 5B57C 2H3EA 1QHEA 4DR1B 4MB6A 3K96A 1A1VA 1MX3A 4RY8A 1TAQA 4BN0A 2NG1A 1LV7A 3U1BA 1SG9A 2YVUA 2OBMA 2JI8A 4L8VA 3OFNA 1GXSB 4RADA 2FR8A 2W90A 2N42A 2F9LA 3HYNA 4CMGA 1SBTA 3F7OA 5CDFA 1F0KA 2Q0SA 2DH5A 3BZUA 1MB3A 3WMWA 4CG2A 2YRXA 4J6EA 4HPWA 3UT5B 4LAFA 4UJ5A 2BGKA 4N8EA 3A4YA 1H0SA 3IT1A 2Z6UA 4OXYA 5EJAA 3CSUA 1QYDA 4C7BA 2X8LA 1BVHA 5AHKA 1FNBA 2YHUA 1Y9JA 3CZAA 3LZ6A 3PNMA 4LOAA 4V1CB 5HRAA 5A3VA 3WYAA 4MQ6A 1PYOA 4J16C 5AK4A 2RK4A 2Y2UA 3RD5A 3T41A 3VSCA 2ZXEA 5JZSA 4KP7A 4UPEA 3U3DA 4BJ3A 2JH8A 2HMTA 4LC1A 2O8CB 1RWXA 4HDNB 1ZNYA 2XPCA 2ENUA 3L6UA 1N78A 3FBGA 2QGFA 2ZT5A 5FOXA 4YEDA 4AUKA 3E23A 5CTJA 3VOBA 4JBYA 1E2GA 3LYAA 4OHCA 1YE8A 2ZBVA 2GCNA 5JY1A 3NXSA 4ZYVA 3TCNA 4COKA 1JEJA 2XGSA 3AHJA 4L9SA 4V0MA 4YWJA 2OCAA 4IHQA 1NJFA 1HI9A 3CEAA 3DOOA 1I8TA 1GZVA 3DUFA 3ZD8A 3DW3X 5JZOA 1YVEI 1B43A 5IWAB 2XD9A 2K7ZA 5JRDS 5FUXA 1ILWA 5B1YA 5DM70 1YS9A 2QZSA 3CN9A 3OEHA 3TWOA 1Q19A 1Y8ZA 2FN4A 2VPZA 3PNKA 3F4KA 2UYQA 3NEPX 1WXIA 1M2FA 4HGRA 3RUEA 1ZYUA 3HYTA 3HJTA 3OI7A 1JVBA 4BAUA 1DIRA 5EWLB 1U98A 2A5DA 3C48A 2VJQA 4NTZA 4RFSB 2VDVE 2OHHA 3ESRA 1XCOA 2R5WA 2IBTA 4E94A 1XNQB 2B94A 3RB8A 3E05A 4Y0NA 5L3SB 1H6DA 2Q3DA 3VA7A 3FJYA 3HS3A 1XX6A 4KFUA 4CG0A 1S7CA 3VC3A 1G5RA 2JFWA 5T67A 5FBVB 3C5CA 1CDZA 2LBPA 1DX4A 1J5XA 3CONA 2OHJA 1V7QA 4D9FA 3V3TA 3FCUB 3BKWA 1JNXX 2GR9A 4PFSA 3AYXB 1U7TA 3PC7A 3ZUPA 1IXKA 2ZVJA 4GZ6A 2H3HA 4P92A 5CFPA 3QV1A 2PKEA 1MEEA 1N0UA 3R5FA 2EQAA 5AM3A 2OXCA 5REQA 3AVPA 1UZUA 1TIKA 4JOSA 2A1UB 1UWVA 4L02A 5K3BA 1LI7A 1NP7A 3IURA 3B53X 4H6VA 4E03A 4EHDA 1T1RA 2AJ8A 4ER5A 4WOCA 3KVNA 2PKYX 1CQPA 1OZ0A 3AL2A 4H7IA 1UP6A 2E87A 4G86A 2GDJA 1EYZA 1E2QA 4QJ4A 5DGDA 2J67A 3HBNA 3IP8A 1C1XB 3OBBA 5AUNB 3N2GA 5KVVA 4IDNA 2P5SA 4J0FA 1TTTA 3IIJA 1M7GA 2PT7A 1KETA 3QUAA 3HU5A 5BY2A 3ZKAA 2DVMA 5FWYA 2QJWA 3PHGA 4KZPA 2H2DA 5EA2A 4I6GA 4A10A 5GV7A 3GT4A 2QJTA 2OHXA 4ROSA 4AKTA 1Q20A 4FT2A 1XEAA 3TLGA 1E1LA 1Z25A 3RU7A 4FHCA 4O3MA 2ZIAA 3FVVA 4ZQBA 2NAFA 2RJNA 1JHQA 3U3OA 3NTVA 4KBGA 3JQBA 1ORHA 1F0YA 2ZI6A 2IPLA 2H9YA 2I2FA 3LHFA 5FAXA 3SQLA 2EOAA 2JAPA 4EY6A 1Z0DA 3HYCA 2H11A 1GUAA 1WP9A 4LHWA 4MQFA 3SC4A 1AGNA 3MIIA 4WLNA 3QWHA 1O95D 3NHJA 2Z5GA 4B83A 1B6SA 4I4TA 4DC0A 2YJZA 1UPXA 3CRRA 4MGEA 1BH6A 1SA0B 2FP4B 2MR6A 1GSAA 3OOWA 5E7IA 5EUCA 1NYRA 2AGVA 2RGUA 3KYDA 4NNOA 4RD2A 5F7JA 4AECA 2R2AA 3P19A 5ELLA 4D57A 3JZIA 5AD1A 4R2XA 6REQB 5JMWA 6Q21A 3DKVA 1F5SA 2MYPA 1KRWA 3NS7A 4MJ7A 3TSWA 4N76A 1X1AA 4LDZA 3GU3A 4D0SA 2WPDD 1O6CA 2QK4A 4KH1A 4OHUA 1MR3F 5CYOA 2IC5A 2Z09A 3KJFA 5DBHX 5DGTA 4CKZA 4XR9A 1X77A 3K30A 2O7RA 1GM5A 1W2WB 2QQ5A 3BHJA 4CMEA 1V4NA 2H92A 3KETA 2GA9A 1E1QD 2G0AA 1XQYA 2DM6A 2OFOA 3BYZA 1YACA 4Q37A 2IDJA 4R6WA 4URXR 4PLFA 2FN3A 5KQPA 3D8TA 2WKRA 4JKOA 3NV9A 4HEA1 2VPXA 2WC1A 4B87A 4UXIA 1QS0A 3KKLA 4HXGA 3HI4A 4A2WA 1GFIA 3SF8B 2AC4A 1KYYA 2GN0A 4PLHA 2EKBA 4F72A 5HWSA 5KC8A 3BCHA 1PFKA 1E2NA 3R3SA 1BFUA 3A70A 5IH7A 1M2EA 1UK6A 4QNMA 1K98A 3GGDA 2YOGA 4DUZB 3IIMA 1TD9A 3DXYA 1NUUA 3GGOA 2C3PA 3K8OE 1UXJA 4ZGBA 3IA2A 2OUIA 4N5DA 4C43A 1SY7A 4NK5A 2IUYA 2PBRA 2CXNA 3OPYI 3NOXA 1OAAA 2ADFA 2XDQA 3WGMA 3I9V1 2D2IA 3PLNA 3DTVA 4V0ME 3R7NA 2GHIA 4X3CA 3RIEA 3ZWAA 4ZPJA 5JCJD 3QVVA 1P2DA 1J07A 4AULA 3OQNA 3WWEA 2RJ3A 3LKBA 1RS0A 2A7XA 4PX5A 4TPKA 1PL0A 4CMCA 3NTQA 2W98A 4OQFA 4MHOA 1HETA 4CKEA 4DR7B 3QKTA 1UFOA 1P91A 1XAHA 3EDYA 3SHOA 4V2IA 4ZVNA 3TD2A 4HWRA 1E58A 3V6MA 2GNPA 2CLCX 3U4AA 2EWMA 2OHGA 4K9MA 1XEXA 3LDAA 4ZOEA 4BNFA 4ENSA 1NPDA 2NQ8A 2P4UA 3ZCTA 4BN4A 4YJ3B 5AVZA 4LTNA 4KXFB 1FDOA 1T0HB 3IEIA 3T5CA 1Z4JA 2Y6VA 4YCBA 2C31A 4TRJA 3BTOA 3U7JA 3X3HA 2CL7X 2FQ1A 2BV3A 3IOEA 1CUSA 4EHNA 1XP5A 2ZIWB 4W5HA 4YJGA 1LRLA 3JATA 4E2XA 2C78A 3PX3A 2C4WA 1SKAA 1MPXA 1L8OA 4GGMX 2PGNA 5DHAA 3ZYCA 4UNNA 5HF5A 3EFOA 2AUMA 4ONEA 4UAGA 4UNRA 5AW3A 4Y1RB 5FLEX 5LKAA 5ULLA 4IH4A 1DQYA 1RTKA 1U1EA 4LYYA 3W5VA 5KO2A 4UMFA 3OPQA 1D5WA 1KYZA 5LBIA 2CMDA 3KEQA 4LZNA 2VT2A 4RJIA 3A2NA 1VL2A 3A6JA 1PZNA 4P98A 2ZEJA 5LLSA 4BO4A 1PSDA 1PS9A 2ODAA 3P2EA 1C0PA 2JGMA 3PPXA 2NT3A 4MRPA 2QTVA 3E35A 3ULKA 2HJRA 4KMRA 2YZMA 1N25A 5HK8A 4QXMA 2D8MA 3OAAD 5FFNA 3M6VA 4WXMA 5KYWB 2FPSA 4JVNA 1AURA 3FVRA 3GFRA 3ZQKA 4YONB 2QRNA 1G3UA 4FGWA 5AR1A 4E5YA 1WPQA 3VO8A 1DBSA 1UOQA 1VA4A 1JDTA 3T34A 4HVAA 5G0TA 2GKOA 3TQOA 1FLAA 1MAAA 1O89A 1GV0A 2G08A 4IDQA 3P27A 4QRHA 3MRVA 1NBMD 3A36A 1U6IA 5FBWB 5BSRA 1CUWA 4L8GA 3TSCA 4KYUA 1UBMS 2HXGA 2ZBGA 4LJ4A 3TPZA 4HNVA 5JS7A 3F2IA 5ARDA 4IZIA 5TX7A 1TYCA 3KUUA 3AEQB 1NF9A 3ZDEA 4E11A 3C1UA 3KM0A 4I5DA 3TIVA 3KD3A 1JH8A 4EWLA 4TL7A 3OCYA 1ZO8A 5HJ5A 1JJ7A 1RAFA 1FYDA 2C5AA 2PKQO 1ZC4A 3G82C 4JVMA 4RKEA 4WLVA 1M6NA 1SHKA 2NUBA 5EG5A 1G2PA 1QIKA 3KALA 3LQ4A 4QBGB 3CNNA 3IB3A 1O0SA 1W76A 1Z56C 4HBZA 4WKOA 2FOLA 4UULA 1A8PA 4MUHA 4EW1A 2DPXA 3UUFA 3A1DA 2J3EA 3NASA 4EYOA 2GZDA 1CNEA 5EIAA 4CIDA 3U61B 3UIEA 1F06A 5ALEA 1RM4A 2QAGC 1DAKA 1Z6YA 3LCRA 3D6MA 1I33A 1TC2A 3GEPA 3MLBA 4PLTA 5GOTA 3IEMA 1F0PA 1EWTA 5CIWA 3EF1A 4BRUA 1H05A 3GYGA 3NORA 2C9BA 3N0VA 1M8PA 2A67A 5F5LA 1CUVA 2KLBA 4N5HX 1H1LB 4RXTA 4JJKA 1KMHB 5B5SA 4HKTA 1EXDA 1AGRA 3H2JA 2AUTA 1NN5A 3N58A 2TMYA 4HNAB 2JLQA 4L9AA 3AP1A 4MGZR 4O33A 3QW2A 4MUMA 2WJIA 1J06A 1SUFA 4PSVA 5I45A 1A8SA 1U8UA 1ZK0A 5E7JA 4DYHA 2J41A 1JA0A 3COYA 4KNVA 4XYGA 3HNPA 1TAUA 1M6WA 1P4HA 1U3CA 3BXFA 2HU8A 5BQOA 5EWMB 3FFTA 2JFZA 1ZM7A 2VCEA 2XZDA 3LC2O 4KCGA 1I4DD 2UUAB 5CVJA 3H1PA 3H8WA 3PI7A 4F3TA 4WN9B 3ZJYA 3LZDA 1VJDA 4HEJA 2R6AA 3H18A 1NQUA 4LFCB 4R84A 1H8EA 3PC3A 1F5NA 1U5CA 4EF4A 1IQPA 3OFKA 5FL7A 4CJXA 1OLXA 5CT9A 4GZMA 5GM2A 1YS4A 1JAYA 4IIJF 2UZ0A 1DWPA 1XCLA 1VHJA 4TKVB 3MJCA 4F5DA 1J5PA 3SEAA 3VDRA 3HBJA 4TV9B 2LV8A 4HDAA 5ALZA 1WBJB 4MB0A 1NNLA 1UFQA 3P97A 2I2AA 4CNQA 3HVKA 3IAS1 1B15A 2YWHA 3SN6A 4EZBA 4ISCA 1SUBA 1PJAA 1YR9A 121PA 4BO8A 5JRZA 5E3HA 2WJZB 4FKBA 1AF4A 3NMUF 3BIFA 1J90A 3LW7A 3SEQA 5AM5A 4GLBA 4MS1B 3R7FA 4Q7MB 1XPJA 4GNKA 3A1TA 1OB5A 1S5PA 3TD9A 3W3AD 5FTLA 2AN4A 3OKPA 4RHEA 3UOAB 2VJLA 3U26A 1IWOA 3MJ4A 5K4HA 2EJBA 3JQAB 1TD1A 1USIA 4MKHA 2O8DB 1ZNZA 1TIPA 1GRCA 3AY7A 4CTKA 3F97A 2QR5A 2Z8YA 4CCWA 4U02A 2FUCA 1LW7A 2ZXFA 3H6HA 3DWFA 1R0KA 2UXCB 1ZS9A 1YQDA 1OTHA 2QQGA 4D0NA 4ND8A 1CJCA 5K0ZA 3G0BA 1C1DA 4I1RA 4NJEA 4RIGA 5EEHA 1XTQA 3ND7A 3LP5A 3EIEA 5IAKA 1KDPA 5KNCA 4KBYA 3EXG2 5AK6A 3UATA 5HQTA 2AEMA 1L7NA 3C97A 3JQ7B 1NSFA 4KLRA 1JKXA 4K6FA 1OI4A 1ZLXA 1UDWA 4UVHA 1G8AA 3NVAA 3LC1O 1GQOA 5EHQA 4RV4A 2WFLA 1SXHA 1YAJA 1NVKA 3PPIA 1NURA 1U94A 5FTWA 4AP9A 1RYDA 2V4UA 2LWIA 2ZR7A 3I37X 1TZJA 2J31A 3OZBA 1NMZA 1UP7A 4DSTA 4FCTA 1QONA 4AJLA 2H54A 4AQDA 3KQUA 2WP8J 4RHYA 4CKBA 2DULA 4NLLA 2OORC 1NKVA 4MAFA 4HNTA 1KTVA 2VJMB 6REQA 4YRSA 1M1YB 4K0RA 3E81A 1WKBA 1Z82A 5D2CA 3ADKA 2QVXX 4EA6A 5LPNA 1DLJA 2E48A 3N6RA 2G72A 2QRZA 1PNTA 3Q41A 5LOVF 3WIEA 2Z98A 2C20A 2EKPA 4LBYA 4AC9A 3K05A 5A62A 3C16C 3ZS9A 4PZLA 3S2ZA 4M83A 3DV0A 3EIFA 3C3BA 1JECA 2FLWA 1ND6A 2DG2A 4IKOA 3ED5A 5LQMA 4QULA 5J40A 3TI9A 4FYWA 4EHLA 1MEJA 3AP2A 1ZMBA 3WNVA 5B4VA 3UG6A 1EBUA 2GFHA 3S8EA 2P2YA 1EK1A 3C24A 3KYCB 4M0FA 2GF2A 4HRYA 4PLPA 3IKJA 3LD9A 4GLFA 2EJTA 3UJDA 4B31A 1RQLA 1Q44A 3CKKA 4C01A 1AF7A 4XEUA 4MIOA 5AKZA 2GYVA 3MQ4A 3RRNA 3BJZA 4GIBA 4U2DA 4Z0NA 5TF0A 3I3SR 4DSNA 5AOVA 3HXPA 5KDOA 5H59A 5KWIA 1ELOA 3GJZA 3N39C 5EIBC 4AZWA 3IUNA 4U63A 2Z57A 2VDLB 4HQLA 1M7BA 1XKQA 2JH3A 2VYVD 5EKTA 2GARA 3DH0A 3S4YA 5HW0A 1E7MA 4RPIA 4GC9A 3H1GA 3U7GA 2IT1A 4OX9B 3GLGB 1U0HC 1V5WA 4UJ3A 5BYJA 4YUVA 4TYNA 4JQZA 4G5SA 1R8SA 1W581 3AJAA 4V3CA 1D0IA 1PSZA 1XV5A 2QYSA 2V7EA 4CU2A 2NQTA 4AUEA 4FGZA 4UHJA 3D8SA 4C4TA 1FUKA 1Z8DA 3GNQA 5LP6A 4KDRA 4JX8A 3G6KA 4BGVA 2J9ZB 1D4FA 2MMCA 2J9GA 2QW0X 2RHLA 1N7IA 4PGGA 4Q3BA 5BWNA 1Q57A 3RYTC 1Y4ZA 3OCXA 1CUJA 1NRWA 1PQYA 1Z88A 4H0NA 5E6UB 5GTDA 3OEEA 4OXNA 3TNLA 1ZBDA 5JCXA 1AKEA 5DTMA 1KK2A 4UCFA 4BMPB 1T1EA 1JBKA 3D6TB 2CVFA 4NECA 2BP7B 4UBLA 4DY6A 3FMIA 1K7CA 2R1VB 1PX2A 3AIOA 1UFRA 2XBUA 1QK5A 1TVMA 4RIEA 3C5EA 1TCBA 4MIYA 4YFYA 4JA0A 5BRNA 4Q4DA 2EX1A 2AF3C 2WG0A 3F5FA 1YMQA 4JJGA 1SO8A 3JD3A 4U7WA 1MC1A 4RSGA 4EVQA 3K16A 3AWDA 3MS2A 3UNXA 5HIAA 3F3SA 1M5RA 1YKSA 3SFTA 3RIXA 3KE8A 3O1JC 1BU5A 4ARSA 5DSXA 2Q5JA 3LWNA 2NUAA 3DJFA 3VNSA 1FJXA 2C2MA 5D84A 2I54A 2IZOA 1KQOA 1E3WB 5EYPB 5AQ1A 1F2VA 5EHZA 1CIPA 3MOSA 4C6TA 4D6XA 1T15A 3LOQA 3T1VA 4YAGA 5EEGA 4W9MC 4J03A 4ZOBA 1BQ4A 1L5KA 2OOSA 3IDSA 4U7JA 4I5EA 4NKRA 3FNFA 4URWR 4R7GA 5E6RB 2H1IA 4UOEA 2NPIA 1NT4A 3REQA 1CNMA 1Y82A 4R41A 1W4AA 2F8LA 3BDAA 3NBUA 1MAUA 1UXGA 2CXSA 4N82A 4BJ5A 1USVA 3AGQA 5F35A 1E7SA 4A15A 4GPEA 2ZRDA 1LLCA 1USKA 2D1SA 3L0ZA 3CUWA 1FFXA 4MR9A 3P2OA 4YTEA 4HZUB 4AO7A 3DE2X 1WCYA 3VJKA 5EFOA 4BFSA 4Q93A 4RSMA 5JDCA 5ALPA 1R0BA 2QX8A 4K9NA 5I9BA 3H86A 4Y6GB 1JR4A 1BYUA 5GVRA 4DV7B 4NBKA 1VC2A 3C7TA 4NOJA 2F9MA 3KB1A 2CSXA 2FF7A 3FXAA 4IKEA 4RY9A 2SKEA 1X87A 1FRQA 3KL4A 4F85A 5C35A 1QVAA 2BSXA 3BS4A 4GU5A 4JENA 3Q5DA 1DE0A 5PGMA 5BR4A 1GCUA 2PX2A 4K9SA 4M53A 1A95A 4DNFA 1YUMA 5C8VA 2O3TA 1D09A 1K6IA 3GDWA 2CE7A 3FNEA 1W5SA 1P9OA 4KDCA 5KINB 4LY3A 3BEOA 1KZ1A 2OFXA 1F48A 3BG5A 2HLHA 3EPPA 3OVMA 3KP1A 3SBXA 3UM9A 2RHOA 5IN5A 2HIAA 4YRFA 5LXTB 3PNLA 3TTWA 4TXNA 3HUUA 2E4UA 3V2GA 4B6FA 1F2UB 2WWFA 2O1EA 4R2JA 2LXNA 5ERYA 2GF0A 3JVVA 3THYA 2LDXA 3MBIA 4BX0A 4DSOA 4IAOA 4WA8A 2XVXA 4AS3A 4M54A 1ZZGA 1QNFA 2JIPA 2ECOA 3A9TA 1GNVA 4G67A 1F6BA 1BD3A 1U5AA 4IIUA 5K6TA 4DXDA 4F56A 3ORRA 3OD1A 3CRQA 4NAVA 2GZRA 2FW6A 4D4KA 3LH5A 4I99A 4JC0A 2NLOA 5H9WA 4XM1A 1L5WA 2C2BA 1Z2NX 2FQQA 3HJAA 1QG4A 3MWFA 4DMLA 1WPRA 4JJIA 2OKGA 3GZ4A 5JQGB 3HXLA 3JWEA 3TAXA 5KWVA 1WDLA 2JIQA 5FDFA 5G0UA 2YIDA 4OU5A 4BQEA 5A6SA 1TEHA 2Z1NA 4WZAA 4DG9A 1ENOA 1AKVA 2IXTA 1Z18A 2WHRA 4K0KB 1HDEA 1E4OA 2V6JA 3TQTA 2CJWA 4X85A 2R65A 4IVRA 1PX0A 3QBDA 4GECA 4D4HA 2FSGA 2NZUG 2YV4A 3HP4A 3KLOA 4F6CA 5FUQA 5BV2P 5G4LA 2QL6A 1X94A 4ZPXA 4QU9A 4RACA 2DKOA 5AI4A 1YZQA 2UAGA 4GOJA 4HRVA 3WIVA 1NXPA 3A9RA 4AD8A 2J9RA 2H2HA 4I2NA 5AM0A 3FDZA 1OZGA 1M73E 1SC1A 3IOYA 4TTIA 2NV6A 4DB2A 4P3KA 2D5CA 1ZNWA 2EKDA 3EA4A 3C3XA 2BM1A 3K2EA 3W2IA 2ZSFA 4PIMA 1Y8CA 3EXEB 4X64B 3DP7A 3C8UA 3QVGB 3MTIA 4M0PA 4WH0A 3FYUB 5FQNA 2GBCA 4Q4CA 1KS2A 3AJ8A 4K46A 4DMCA 2FWNA 1HM5A 1REQB 2X76A 3LDGA 1NW9B 1IDN1 4KXYA 2OV2A 4LYGA 5AO9A 4BTVA 5DN6A 4EY5A 4AMBA 4Y2QA 1RXCA 3LFUA 2Z6QA 2OXFA 2C7VA 4JLSA 2D5AA 4XWYA 4HGOA 3LVRE 4ES6A 2I76A 3LUDA 3JV7A 2FCAA 3S99A 4CM9A 1MP0A 1U0NA 2CLMB 1TA0A 4L4RA 1UDRA 3JTMA 2YV2A 2WWYA 4Y2PA 1J8VA 1DX9A 4Z9AA 1PRYA 1RQXA 1I36A 1B16A 1S9HA 3D6VA 3L0DA 3LO5A 3NP7A 1IN1A 1BQEA 4KMOA 3AC0A 5LD2C 1FRZA 1PTJA 2P3QA 5T3UA 5HOQA 3CGGA 1ZIYA 3DAOA 4BOYA 4C4OA 5DGHA 3AW8A 4O5OA 3P2JA 2FI1A 3TRDA 5K6AC 2PR2A 2HNKA 1NIJA 2K5UA 5CDSA 5D7NA 1L7MA 2Q5EA 5EKDA 4BASA 3KR2A 2HYDA 3H1AA 1JVNA 5IHPA 4XJTA 1OAOA 2HADA 2HWKA 4EHIA 4PVCA 5LM3A 1BN6A 2Z9DA 3G7SA 4AMZA 4REMA 4BVKA 2P0EA 2IUEA 2X9LA 1FXWF 2ZBFA 1DAPA 1YJCA 3EY4A 3IKVA 3QPDA 4HAWA 3O8QA 3TIIA 5JVDB 4EI7A 1XR3A 1YB7A 1C8KA 5HTKA 3W1VA 2GLUA 2OTCA 3E1KA 1U11A 3GZNA 3DZJA 1Y5NA 3IDFA 4YRBA 1H6CA 3LCMA 1Z5ZA 1C3LA 1ZI9A 4G5XA 1R88A 1Z07A 5ESRA 5AW8A 1RZRD 2MTBA 4DLSA 4TN5A 5CXSA 1EE1A 3V7WA 3SD7A 3E8SA 3DLIA 2PY6A 1JU9A 2QZZA 3KYBA 4UBOA 1YDHA 1Z4QA 3CEHA 4W82A 4QIHA 3MERA 2CLKB 2IA5A 3PFBA 4JJFA 1GHTA 2FPGB 5ARBA 2IS2A 2O0MA 3IELA 3O03A 4L0QA 3AY6A 4X41A 1U0SY 4ZI2A 1HG1A 5BV1A 4HD8A 1S8OA 2F17A 2XMGA 3QF7A 4MWOA 4XX1A 3REGA 4G5GA 5JJBA 2G9RA 2X5XA 3WV4A 4CTMA 5BRAA 4IUBS 4IS3A 3IX7A 2ES4A 1IFXA 2ZBQA 4MRAA 1F1BA 3GLRA 1HNXB 3P7MA 3K9HA 4JI3B 1DAHA 2RAUA 5EWJB 5C1PA 1G8YA 3ENZA 2BMEA 4HH3C 4LWQA 3COSA 2I7VA 2YS7A 4WRRA 4Q1CA 4OSEA 4TMYA 1FTNA 5IZCC 6NULA 1ZI8A 3PEUA 2X15A 4US2R 3W7AA 4XIGS 2C94A 4IVPA 4MUXA 1DFHA 4JLNA 4HJXA 3T06B 4E5KA 3FUXA 4JL5A 4ABTA 4AS2A 1T9KA 2CXTA 3NBYC 5BSMA 3A8TA 3TCXB 5TC4A 2H4XA 4M7OA 2AR9A 1L4GA 4BO1A 4ZQEA 2VDQB 2VJAA 1E18A 3FDIA 3JW8A 2JGEA 2PGIA 1IOVA 1N6LA 4WK0B 4Z9YA 3X1ZA 5G2OA 4Y1GA 1TLFA 1KFEB 2W6JD 2WF9A 1SKYB 3WG9A 1NBOA 1GPWB 2QS9A 4D42A 1EGAA 4MHSA 4G85A 3Q8WA 2F3PA 2QOEA 4TKUA 1VB3A 1GTRA 2IUFA 4NSNA 4KMSA 2B20A 5BR7A 3CLUC 4S1NA 3GT3A 3ZV7A 2FRDA 3LI2A 2I4OA 1SVMA 1E2EA 5TQ2A 1R8YA 1G66A 2WJPA 1T91A 1E0AA 3GJ8A 3LQ1A 3BREA 4Y30A 2BJHA 5IJAA 4RH0A 5I8ZA 4MUJA 3RTDA 2WZQA 1IN6A 1MRZA 5JY6A 3JARA 3WGOA 4WAUA 1EVQA 1O8BA 2VSYA 4LJYA 3NG1A 4WUTA 4KQWA 4Q9AA 3ZXYA 3BA1A 4C76A 3NI2A 2VDWA 1YQXA 3OCJA 4EO7A 1PF7E 2RH4A 1FMFA 1CB7A 1LSJA 1VSBA 2O8FA 2ZUBA 2G9UA 2AXNA 4DWWA 1NA5A 2HF9A 4D9CA 1MFZA 3OU2A 1O9GA 1QK3A 1FK8A 4D9NA 1C1YA 3C87A 4HAYA 4ZCIA 3CVXA 4XVHA 1BCRB 1E6WA 2QSJA 4F1WA 2YICA 4ESOA 2E82A 3W6UA 1X7HA 1E1QA 4KFTA 5KB3A 4IMPA 2ZRPA 1TU3A 3COZA 3WLOA 3RUFA 1WTAA 1EJ6A 2ST1A 1BOOA 2ACVA 3LL7A 1MH9A 5H1YA 5E4YA 5IFKA 1GSIA 2PLNA 2QAGB 1JALA 3UV6A 1DJMA 2PSHA 2ZCUA 3IP3A 5JAZA 2GZ1A 1ZK1A 3AHIA 3OMXA 4S1OA 2HOQA 4U0JA 5FTKA 3C3YA 3VHQA 2AI1A 3X2EA 1NI4B 5IJWA 1H1TA 5JRJA 3H6GA 4C4ZA 4WJLA 1TM3E 2FY8A 5KOHA 2Z2XA 1FDSA 4RTKA 5C1BA 4YUWA 3LDFA 2F43A 3VGJA 4HNGA 4QLOA 4JI7B 2XDAA 3IAM1 3W1EA 3GX1A 2BISA 1L7QA 2GN2A 2IEGA 2ZIXB 3A3NA 2CKMA 4GI2A 4RO0A 1HOTA 4JOCA 4JC8A 4KIFA 1GVHA 4ZV9A 3W5IA 1PJTA 1EPUA 1J9GA 2FZKA 3FCOA 1HT0A 3JYOA 3V32A 4EQZA 4MKXA 3QBTA 2FSPA 4ETMA 3PEWA 2A3NA 1NTRA 2OG2A 4ZVMA 1XB2A 3L5KA 3Q1LA 4P4NA 3LRPA 1FP6A 2XUZA 4CM4B 2AH5A 4KQEA 1P9LA 1JA1A 5I7VA 1XALA 4Z3KA 3ESQA 1G55A 2B2CA 4F3NA 1T5TA 1GN9A 4EA7A 3T7EA 3AVOA 4RJ2A 2ZYUX 2HQRA 4CM7A 5BUCA 1E1MA 1EUDB 3ONVA 3VPXA 4A23A 4YMHA 4Z4QA 1RDFA 2P9ZA 4TSRA 1A1SA 3I61A 3L7IA 3OEED 3VO9A 5JNTA 1VHTA 5GM1A 1OLSB 2ATCA 4TLCA 4D02A 2NZ8A 1KBZA 1JKMA 2VS1A 3ELUA 2VL7A 1EK6A 3I9KA 5B7PA 1IM8A 2JHPA 4A91A 2PUEA 4PPNA 1QCZA 1A2KC 1E2IA 3DZKA 3F5QA 3PC2A 4S1WA 2O6LA 3CLRD 5F64A 3JYLA 2P3OA 1L5HB 4LJAA 4AS1A 1GUDA 1E79A 2OZPA 3H2HA 5T6BA 4CL2A 2I6GA 3HWSA 3U4QA 4TMZA 2FMUA 3EN0A 3QIVA 2SCUB 4TMKA 1TO6A 2IELA 4QC2A 5DE3A 1KP2A 4LJSA 4ZEXA 4LPSA 3E3MA 3EISA 1Z29A 2QMUA 1I3OA 3ZBPA 5J4LA 3OKAA 1B8OA 3UJ6A 2O8BA 1WZUA 4KVGA 4TS3A 3EW9A 2B0JA 2RBKA 2DFNA 1XXLA 1RW4A 5DCWA 4GSLA 5F2OA 5FPQA 5G4KB 1UJMA 2ZUWA 3SNHA 3FFAA 5SZIA 1OFTA 2PL9A 3WLTA 4B3DA 5IDVA 3PD0A 1ML4A 4QHSA 1M34E 4WOJA 3L40A 4BE7B 1VSUA 2GNAA 3WYNA 3ER6A 3PGLA 3QE4A 3G7NA 4KMMA 4LY0A 3KT8A 4BMZA 4HWTA 2O4CA 1XRLA 2CLSA 4EEZA 1E61A 4DG8A 1FNMA 2GJ8A 2IS6A 4C04A 2VYCA 4JZKA 3WGQA 1M6VB 4CTJA 1KVSA 2GSDA 3I6YA 2JLBA 4X5OA 4KOAA 3F49S 3AXSA 4N41A 3DE1X 3E03A 4I1PA 3PFKA 4B4WA 3GJ0A 1NJGA 2GBLC 4M9QA 3TUIC 2C4MA 4R8MA 1FJGB 1HNWB 4KQ9A 3ETLA 1PR3A 3CUUA 3QNUA 3DAHA 1ZD9A 4MMZB 3OQHA 4NPCA 1QR6A 4HK4A 4NS1A 4UQPA 3MPOA 3LT4A 4IIEA 5HX7A 2ODEA 2ZQ5A 5A4DA 1QYRA 1VE1A 3M6WA 1ONOA 3B6EA 3LGSA 1TX4B 5A3QA 4H1VA 4DBLC 4RTNA 2A9OA 2X2EA 4URUR 3SE0A 1AHIA 2PU7A 3VTFA 4A1OA 2RAFA 4LJLA 5KWJA 5COQA 3UMSA 3ZIAD 3P9PA 1AB5A 2HRCA 2I2XB 4CUKA 1ZD1A 1SCKA 3U16A 3PJDA 5KOJA 2BMVA 2NU6B 1G5PA 2AFIB 2AYXA 4R9SA 4MRRA 4RWEA 3GIDA 4MRNA 3ICVA 4B7ZA 4MQBA 1JAIA 4LJ5A 1GQRA 3ENNA 4NXMB 3WIBA 3PKIA 1PE0A 3MJRA 5J5CA 2JEOA 3CU5A 1CDEA 5IXJA 4BVAA 1I6KA 3PCXA 3NM5A 3S28A 3W8DA 1ZJZA 2VK4A 1AGYA 1HFKA 4TM7A 4JY7A 1EM8B 1WW2A 2PUTA 1ZRNA 5MFPA 4HHEA 3UHAA 3U09A 4O4IB 2N3ZA 2VSOA 3I4CA 1V1RA 2W37A 3G17A 4M0KA 3ZKWA 1Y3FE 2C7PA 1E6UA 1N5RA 4NULA 4B5LA 1EH5A 1FTGA 3UXHA 3F7MA 1T5DX 5BNWA 2M6SA 5A9TA 5T4FA 1H2XA 3MAGA 3P9KA 4U3JB 4XJSA 3R7WA 2CVPA 1W1IA 4RE6A 1SCUA 3K5PA 3AR4A 3UN1A 1L4LA 5KTPA 4GXTA 1VG8A 1WEHA 2BEVA 2WEKA 2C03A 3DWEX 4L0CA 4I3HA 1HEUA 1QDLB 4BBZA 3R3HA 1FZQA 4D0GA 4Q1AA 3NFYA 1Q0SA 2G1UA 3HXTA 2FOXA 1QIGA 3B36A 5EIWA 1YQTA 1C4KA 5FXMA 1IOWA 5A4FS 3GLIB 4TV8A 1U3UA 1V1JA 3TBFA 4CEIB 3GGGA 4KR9A 1SHTX 3NH9A 1V5EA 3NOOA 2NVWA 2UZ1B 4U7GA 4W99A 3RYHB 4K6OA 5DZSA 1E2JA 1RRVA 2AK3A 4GR5A 4NYMR 4LXUA 5BO5A 4EPTA 4XIFA 3PQ4A 1EVEA 4LHSA 1DC3A 5FEUA 4B33A 1YBVA 3WDSA 4DCSA 1BJRE 2EJWA 2SKCA 1HC7A 3LG2A 4OL9A 3OEYA 1V7CA 5HJEA 3Q72A 1EUYA 1JT2A 4JLJA 4BAZA 5CRIA 3CTPA 4ZT5A 4IIHA 4PG7A 2IZ7A 1Q0RA 3EXHC 4LGMA 1A4IA 4IJQA 1UBTS 4D6PA 3FUUA 3VFDA 4DLVA 1W8IA 2CFSA 2H0AA 2FMKA 2W00A 2ZJ8A 5J43A 2DF8A 4IO0A 2YDXA 2C2KA 3H2ZA 4MI3A 4Q00A 3DLAA 3SOPA 3TX2A 5AJZA 1Y9EA 5KYYB 4GKJB 2LDBA 2ZRIA 4P86A 4OOFA 3D9QX 1F8YA 2I34A 2CKDA 2WTNA 4L6AA 1IIBA 3FJOA 1R6AA 4Y9TA 1Q7GA 2J08A 1IZYA 5FL3A 5DYGA 5BNTA 1FVHA 3L5OA 3L0SA 4R8KA 1POWA 3BZWA 3DP9A 2IH5A 4QGHA 1IG3A 1MOSA 2HQ1A 1NSTA 2YS6A 2GS9A 4RTQA 2X5OA 3CC8A 1Q0UA 1QQ6A 3C45A 3JWPA 4HGQA 1NG1A 4FWIB 3RS0A 1BRMA 2OM6A 5J3JA 4JBLA 3AFGA 3C70A 4XGNA 4CETA 4RKFA 4NCBA 3KJGA 3FI0A 1RBQA 3EGXA 1HLFA 2L17A 3LA8A 2P6MA 5A4AA 2O8CA 1M66A 3U39A 3BOSA 2EF1A 1RWMA 1ORWA 2C42A 2YCLA 3V8EA 2W2XA 4QJ3A 1VZ2A 3LY7A 1ZN7A 3LPCA 4I19A 4MEAA 5H02A 4HGYA 3RRMA 3UT0A 3QHPA 3VO2A 4CW7A 3BB4A 2DWOA 1BEZA 2NYRA 3ED1A 5CA0A 1U1GA 2WSSD 1NVDA 4MA0A 2OP0A 1NMSA 3IAEA 4YJKA 3L4BC 4UM5A 4N6OA 2DUMA 1TM1E 4