2X78A

Human foamy virus integrase - catalytic core.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
171
Chain Sequence
QKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTSKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDTLDLTREEELSLLQEIRTSLYHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein
total genus 53
structure length 171
sequence length 187
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x78A00
4AHSA 1TK8A 1IG9A 4LY7A 4M3ZA 4QCLA 4IKFA 3TAFA 4DG1A 4CFAA 5D3GA 4FM2A 3DLBA 3CG7A 5CZ1A 4AHRA 4OPJA 4CGIA 3HSTB 1BIUA 4J2DA 4CK3A 3QERA 1KSPA 3AA5X 4F8RA 3LAMA 1LWCA 2O4IA 4B9VA 3KLHA 4FLWA 1RT7A 4QAGA 1W0HA 4PY5A 4KV8A 1NK6A 1KLMA 1ZBIA 4CEZA 1ZYQA 5FROA 4DQIA 5JS2A 1J53A 4HHTA 4DTJA 2PZSA 4KI6A 3B6OA 2LSNA 3K59A 1YTAA 1Q9XA 2Q3SA 3OYNA 4PA1A 4FLXA 3CM6A 5KI6A 4DQRA 4DSEA 2VG5A 1RTJA 4PQUA 4ZTFA 1YVUA 2Z1IA 3NF8A 3IAYA 4B9NA 1KFSA 1L3SA 4OKJA 3SCXA 1D9FA 1ZBFA 2G8VA 3T19A 3ZT0A 4DTXA 1CZ9A 1TKZA 1WNSA 2OPPA 2YNHA 4DU4A 1QSLA 3K2PA 1UAXA 4CJVA 2HB5A 4C8NA 3S3OA 1XC9A 2G8KA 1FK9A 3HPHA 4LSNA 1T7PA 4CGFA 2DY4A 1BIZA 4KTZA 4CGDA 4CHYA 3KK3A 1NOYA 3HP9A 1FXXA 1KFDA 1JL1A 4HVJA 4FLZA 2XY5A 1IKWA 3VQPA 5CZ2A 2QKBA 4AHUA 1BI4A 3SV4A 1IKXA 4H4MA 4KPYA 3IS9A 1S1XA 1VSJA 5J2QA 3MAQA 3MEEA 3VQEA 1SV5A 2HNZA 2YV0X 4FZZA 3RRGA 3AV9A 1U47A 4DU1A 1JLBA 3DLRA 3S3MA 1R0AA 4CJRA 4CJ5A 2KTQA 1FKPA 3DLGA 3SQ1A 4ELVA 2ATQA 3H08A 1DTQA 4FCYA 1DLOA 3BDPA 1BHLA 1GOBA 1ASVA 2RF2A 4KB1A 5SZTA 5HLFA 1S6PA 2D0CA 3WNFA 3LDSA 3JSMA 3OYBA 4FJ9A 3I8DA 4JLHA 1IH7A 3NH0A 2RKIA 1BISA 4AHCA 5CYQA 4CHNA 5KGWA 4FLYA 3V9SA 4RG8A 3VQAA 3L2UA 1TK5A 1WSHA 3S3NA 1T8EA 4M3YA 3KK2A 1J9AA 4CGHA 3OYMA 3TAPA 1NJXA 3SUQA 2KZZA 4JRPA 1RDCA 4QOZB 1RDBA 1A5XA 3NE6A 2DFHA 2HHVA 1VK0A 3LP3A 4LD0A 2IAJA 3L8BA 5J2MA 1GOAA 4KO0A 4RW9A 2HW3A 4AHTA 4BWJA 4B9SA 5FDLA 1HQUA 3WNEA 2XY8A 3LANA 3KLIA 1U48A 3L2WA 1JLAA 3RR8A 4DTUA 1HYSA 2OPQA 4GVMA 1D5AA 3AVCA 1WAFA 1VSHA 2P1JA 4LH4A 4N47A 2FBYA 1X9WA 4Z4FA 3U3YA 1REVA 3PX0A 2HHXA 3PV8A 4K8XA 3K58A 4CIGA 3V9XA 3SQ0A 3THVA 1L5UA 2XY6A 3AA3A 3AVHA 3SNNA 4M42A 4FK4A 3C6UA 4CHZA 2YKNA 3SQ4A 1S1VA 3VA3A 3VQ4A 3K5LA 2RN2A 3RMCA 3SPZA 4YNQA 1I39A 2G8HA 4CFDA 4O0JA 3RTVA 3L2RA 1TAQA 3QEVA 1C0UA 2VG6A 3HO1A 1WAJA 3VQ7A 3VQ9A 3QIPA 4KB0A 1RTHA 3CM5A 3OJSA 3LWLA 1RNHA 1C1BA 4CJPA 3K5MA 1VRTA 3SYZA 3I0RA 1RT1A 4CHQA 5I3UA 3O4QA 3T3FA 1RT4A 1JXEA 1RCHA 1TKTA 5DK5A 2IOCA 2ETJA 3AVKA 4CF1A 4IBNA 4BDZA 2X78A 4FJIA 4DSIA 4KHWA 1RBVA 1RTDA 1RBUA 5HRNA 4DTRA 1JLEA 3NDKA 1D9DA 2OYQA 3WNHA 3AA4A 2QXFA 4B8CA 4WE1A 3DRPA 2IS3A 4I9LA 3RMDA 4E7IA 3PO5A 3E01A 4FZYA 4B3OA 1RDAA 2KFZA 4DSJA 3ZSYA 1X1PA 4DF8A 1UA1A 3HL8A 4W5TA 4J2BA 3QIOA 2PYLA 4W5OA 4I2PA 2F8TA 1VRUA 3D45A 4HUGA 4FJLA 4HCCA 2IGIA 1C0TA 1MU2A 4YFUA 3OYHA 4DF4A 1HYZA 1KVBA 1TVRA 3ZSXA 4KKOA 3EY1A 3ZT3A 3KTQA 1BI4B 3AVGA 4DS4A 4CJQA 4RW6A 1VSFA 1B92A 4CF0A 1N6QA 4CF8A 4EZ6A 3UIQA 4B8AB 3B6PA 4FJMA 4N76A 3HVRA 4FM1A 1NK9A 3QETA 1LAWA 3TAMA 1QS4A 2YNFA 3DI6A 1VSMA 3HVTA 3EZ5A 1Q8IA 3RRHA 1JLGA 1NJWA 4FJGA 1SL1A 4OLAA 4FYDA 5J1EA 3DRSA 4UQGA 3DOLA 1J54A 1LW2A 2VWJA 5HROA 3ZSQA 1NK5A 5C24A 3MXMA 2GUIA 3L2QA 3QLHA 3O3GA 1NKBA 3AVJA 2BGGA 2E4LA 3OS0A 2YNIA 5CY4A 5HBMA 3ZT1A 4FZXC 4CF2A 5HRRA 3CQ8A 4GMJB 3AVNA 3ZSWA 4CJEA 3C95A 2ZQBA 3NGZA 1TKDA 1VSKA 3RR7A 4KHYA 3HJFA 3HXMA 4KREA 1S9EA 3DM2A 5C42A 4E89A 1S6QA 3VQDA 4DU3A 1BCOA 3ZSRA 3ZT2A 4KI4A 1NOZA 2OPSA 1U49A 1J5OA 4N41A 4CEAA 4KHQA 2HHWA 3KLEA 3HM9A 3P83D 2XY7A 3KKRA 1FKOA 3TWHA 4ZHRA 4Q0BA 4E1MA 3F9KA 3NH1A 3SZ2A 3OYKA 2EX3A 3V6DA 1NKEA 4KHUA 4CFBA 4DQSA 3C94A 1HYVA 3K5NA 4C8OA 4M3XA 3LALA 4Y1DA 3TAGA 1NK4A 4B9MA 1ZBLA 3OYAA 1RTIA 1U04A 1W9HA 2B5JA 3QNOA 1S1UA 4AH9A 2B6AA 4CECA 4CK2A 3DYAA 1QE1A 2XRIA 4FJ5A 1S9GA 4OLBA 2ITGA 1SKRA 4AHVA 5T7BA 2BE2A 4IFYA 3QEIA 4E0DA 4CIFA 1VSIA 1SKSA 2WONA 2GBZA 1BQNA 2KQ2A 1LAVA 1S1TA 1Z26A 3NBPA 3WNGA 2HNYA 1S5JA 3U6FA 1C1AA 2ZD1A 4FW2A 3OYFA 2D5RA 3PUFA 4CCHA 3V1QA 4CERA 3QEXA 4E3SA 2G8IA 3IRXA 5KRSA 1A5VA 2RPIA 3AVLA 3MXJA 1KCFA 4NYNA 4E7LA 1X9SA 1CLQA 4DSLA 1HPZA 3NF7A 4M41A 1YTUA 1EP4A 4KFBA 4DTMA 3TAQA 4FJJA 4KHSA 4IDKA 4OKKA 4FJXA 3AVIA 1KVAA 3LPTA 3K5OA 3V81A 2D0BA 4W5NA 1UOCA 2YKMA 1KRPA 3VQCA 3MXIA 3LAKA 4M3TA 1HJRA 5JS1A 3SPYA 4C8KA 4B9LA 4Z4HA 3TABA 3NF9A 4OKEA 1NKCA 4FW1A 4B9TA 4DFJA 2QK9A 2Y1IA 4I9QA 1WSJA 4GW6A 1NK8A 3VQQA 4Q5VA 2OA8A 4J2AA 1WSEA 3OYGA 1QQCA 4DTOA 3L3UA 5KGXA 3RWUA 4CGJA 4FJHA 4B08A 3KJVA 3QESA 4Z0UA 4O0IA 3L3VA 4Y1CA 4CEEA 1SKWA 3ULDA 1ZBUA 1EKEA 1TGOA 4L8RB 3VQ6A 2P5GA 4FJ8A 1WSFA 4DTNA 1SL0A 4I7FA 1KVCA 3TR8A 2DFFA 3LZJA 2D0AA 1HNIA 3M8PA 4H4OA 3ZT4A 2P51A 3ZSOA 1IO2A 2WOMA 3LWMA 1NJYA 4G1QA 3HK2A 3LP1A 4H8KA 3OYCA 3OVNA 2E6LA 3OYLA 4CE9A 2EHGA 4BWMA 4CEFA 4CIEA 4BE0A 3V9UA 1D8YA 4DWIA 1ZBHA 2GV9A 3AVMA 3IG1A 1BGXT 4I2QA 4JS5A 3DRRA 4BACA 3PO4A 4F3TA 4M3RA 1QTMA 3SI6A 2FBXA 2IDOA 2OZSA 1U4BA 3ZCMA 4CESA 2B4JA 3HPGA 4OGEA 1IKYA 5CYMA 3OYDA 3HP6A 4E7HA 4DTSA 3VQBA 1XHZA 3AA2A 3M8SA 3MEDA 4DLEA 2HVIA 1HRHA 4RW8A 4O44A 1LWEA 2FBVA 3NF6A 4NCGA 3TARA 1JXBA 4XIUA 3L2VA 3RMAA 4ICLA 4Z4EA 4KTQA 3NHGA 1VSLA 5J2NA 3AO1A 4CHOA 2AJQA 2XHBA 1LV5A 3TI0A 1L3VA 4EZ9A 1UWBA 2HHQA 1KTQA 1TL3A 4CJLA 1DTTA 3G10A 3D0PA 4LH5A 2HHSA 1EXQA 1CZBA 3NH2A 4Z4GA 2HHTA 2X6SA 2R7YA 1L3UA 1Y97A 3SJJA 4BDYA 3HPOA 3G0ZA 1C1CA 1RILA 1CXQA 2Z1JA 1JKHA 1RT5A 4IFVA 5FRMA 4FLTA 3PY8A 2I5JA 4OVLA 3OYJA 1CXUA 1YT3A 4CJUA 4F2RA 3KLFA 1VSEA 2Z1HA 1LWFA 3V1OA 4CHPA 4E1NA 4TSXA 2YNGA 4CJFA 4DFKA 1B9FA 1VSDA 2YHAA 4M45A 5SWMA 4FLUA 1GOCA 3KD1E 3EYZA 4FVMA 4CEQA 4PUOA 2FC0A 1SL2A 2F8SA 3TAEA 3DLKA 1EX4A 4EP5A 2XO7A 4HUEA 2HVHA 4CGGA 1XWLA 3NGYA 4DS5A 4CJWA 4FM0A 4DQQA 3NGIA 1C6VA 1RDDA 3VQ8A 3OY9A 4KTWA 3AO4A 1BQMA 4BE1A 4FLVA 4FJNA 4KRFA 3ALYA 3NCIA 4DLGA 1XI1A 2BDPA 4AILC 5HP1A 1WN7A 2YHBA 3ISNC 4DFPA 1T03A 2F96A 1WLJA 2VG7A 4DMNA 4DSFA 1Q9YA 1BL3A 4JS4A 1JLQA 4Z4CA 1JLCA 2PY5A 3OYEA 4FK0A 3KD5E 4C8MA 1C0MA 3NFAA 2IC3A 2X6NA 3ZSVA 4CF9A 5KTQA 2A1SA 1TKXA 2O4GA 4ZTJA 2DFEA 4NYFA 3QNNA 2KZMA 1HMVA 1I3AA 1UA0A 3DOKA 1ASUA 3BGRA 3M8RA 3PX4A 3M8QA 4OJRA 3ASMA 5I42A 3TANA 2KFNA 1ITGA 2Z1GA 3A2FA 5E41A 4NCBA 1A5WA 2A1RA 3KIOA 3RMBA 3V9WA 4W5RA 3ZSZA 1QSYA 4RW4A 3VN5A 4OGCA 5DMRA 4E19A 4HTUA 2W42A 4E7KA 4CEDA 4ID5A 3U3GA 2G8UA 1HNVA 4M3UA 4O4GA 3KK1A 2QKKA 3LP2A 4W5QA 4RW7A 1O1WA 2VWKA 3T1AA 2JLEA 4HCBA 3QEWA 4BE2A 3VA0A 3PX6A 3O4NA 4KAZA 4C8LA 4BDPA 3FFIA 4IG0A 1IKVA 3SUNA 2PYJA 1K6YA 4CJ4A 5KRTA 2FBTA 3AVAA 4KHNA 3LZIA 3HT3A 2JGUA 4CJKA 3CFRA 4N5SA 4F4KA 2Y1JA 3AVBA 1QSSA 1KLNA 1JLFA 4J2EA 4N56A 2DTUA 4CK1A 3LP0A 2E6MA 2KW4A 4O55A 3OJUA 1RT2A 2ZE2A 3AO5A 3DMJA 3F73A 4PWDA 5J2PA 4MFBA 3ITHA 3DLEA 4MQ3A 3HYFA 3DLHA 4B9UA 4FK2A 4ID1A 1F21A 3OS1A 3C6TA 3NAEA 1U45A 1S1WA 2G8FA 3QEPA 4NCAA 1N5YA 4CFCA 3O3FA 1QHTA 1TAUA 3KLGA 3CFPA 3AVFA 3SQ2A 4DQPA 1SUQA 4EP4A 5EU7A 3KKSA 3QINA 1TK0A 2HHUA 1XHXA 1LW0A 3V1RA 5HRPA 1BCMA 2OZMA 1WSIA 1L3TA 5C25A 1T05A 2X74A 1HQEA 4LSLA 4CJSA 3OYIA 3JYTA 1NJZA 4ELTA 3CFOA 4ELUA 1ASWA 3SV3A 4JRQA 3V9ZA 1G15A 1Z25A 3AO3A 4CJTA 4DSKA 1TL1A 3I0SA 3SUPA 1JL2A 1WSGA 4FJKA 4DTPA 3O3HA 3CYMA 4CEOA 2NUBA 4Z4IA 3QO9A 4OPKA 3VQ5A 5K14A 4O5BA 4IG3A 4FJ7A 1TV6A 2OPRA 3AO2A 4R5PA 3MECA 1RBSA 3P5JA 1NK7A 1NK0A 2P5OA 1EETA 2BANA 4F2SA 4K8ZA 2HNDA 4CJ3A 1RT3A 1B9DA 3S9HA 3OS2A 4F3OA 3MEGA 4CEBA 4HUFA 4DFMA 5HRSA 4FXDA 4M3WA 3K57A 3SUOA 1RT6A 4E7JA 1X9MA 2G8WA 3V4IA 5FRNA 3P1GA 2HMIA 1RBRA 3LPUA 1RBTA
chains in the Genus database with same CATH superfamily
3WUHA 4LY7A 2A3ZA 3BUZB 4CFAA 5D3GA 3J81O 4FWOA 2D0PA 4PHTX 5DM6L 3AA5X 3LAMA 1LWCA 3LDOA 1BA1A 4FLWA 1RT7A 4KV8A 1NK6A 4WQ4A 1TYQA 4OPAA 4CEZA 5AQVA 4BRPA 3U4LA 2QXLA 1QZ6A 4DTJA 2PZSA 4BRKA 4K43A 1YTAA 1Q9XA 2Q3SA 3BZKA 5KI6A 5F0XA 4FL9A 1RTJA 5CR4A 1L3SA 2A5XA 2G8VA 3C7NA 3T19A 3ZT0A 2QWMA 4BRMA 1CZ9A 1TKZA 3SK3A 1UAXA 4CJVA 1FK9A 2P9KA 3OTOK 2HF4A 1T7PA 2F4VK 4KTZA 1NOYA 1H1VA 2FSKA 1FXXA 4BVOA 2P9SA 3VESA 1GLCG 5GAHP 3SV4A 3CC7N 5LJVA 1S1XA 3MAQA 3VQEA 3QMLA 2YV0X 3RRGA 5FLXO 3DLRA 4JKGB 4FCYA 2UXBK 2P9UA 4JI4K 2RF2A 4KB1A 2D0CA 3WNFA 4BR2A 3I33A 3OYBA 1QZ5A 4IZ9A 4AHCA 4B1VA 4CHNA 5KGWA 4RG8A 3S3NA 3KK2A 3HZ6A 3SUQA 1NLVA 4BR0A 3NE6A 2HHVA 3LP3A 2W6LA 2HW3A 3VETA 4BWJA 1N33K 1IG8A 1HQUA 3FGUA 2XY8A 3G25A 3KLIA 2NNWA 5AZJB 3L2WA 1EQYA 2OPQA 1WAFA 2P9LA 4N47A 2FBYA 4Z4FA 3EO3A 4J8FA 5EVZA 3U3YA 4JAXA 3NMUA 1GLDG 1NGCA 5HOOA 3PV8A 3IFRA 3K58A 4YORA 2QWLA 3A0IX 1GLFO 3AVHA 4XH5A 4DV5K 4FK4A 4DV7K 3A8YA 4RWTA 3QBWA 3VA3A 3KWIA 3C6AA 3SPZA 2RN2A 1I39A 4CFDA 4O0JA 3L2RA 4BR4A 1VQ5N 1HUXA 3SBTA 5BR8K 1WAJA 2GEMA 3VQ7A 2O8FB 2E2PA 3E9LA 3CD6N 1VRTA 1YXQA 4CHQA 3T3FA 5DK5A 4FOIA 3AVKA 1RBVA 5LY3A 1RTDA 5HRNA 4DTRA 1VQMN 5M1KA 1JLEA 5JMVA 1D9DA 3WNHA 4FZYA 4I9LA 2IS3A 5AQMA 2KFZA 4XEIA 4PKGA 1X1PA 1EWQA 3HL8A 2FXUA 3CPEA 4CZEA 3QIOA 4W5OA 1C0TA 4YFUA 3OYHA 4DF4A 3ZSXA 1KVBA 4H5TA 3ZT3A 4RW6A 2ZGZA 4CF8A 4B8AB 3HVRA 1NK9A 3GDQA 3EKSA 3QETA 2YNFA 3SAHA 1SL1A 3PSIA 4FYDA 5J1EA 3LDPA 1S3XA 1LW2A 2GTDA 2UUCK 4DV3K 4JEPA 3H1VX 5AQJA 4PL7A 3L2QA 3QLHA 2BGGA 4CZFA 2BH1A 4BROA 2WBNA 4CJEA 2WTUA 1KC8O 5FPDA 3HXMA 1ILYA 4BREA 3B8AX 3KKRA 4Q0BA 5AQNA 5LMNK 1NKEA 4KH4A 1VQPN 3VGKA 1XC3A 4CFBA 3NVKA 3LALA 4GKKK 4QS9A 3OYAA 1W9HA 3DXMA 2RHKA 1S9GA 4OLBA 5AQUA 1DEJA 2BE2A 4IFYA 1SKSA 1S1TA 3U6FA 3BF1A 4KHPK 3VGMA 3OYFA 2D5RA 4CERA 3QEXA 2HBJA 4GY2B 3C65A 3MN5A 3AVLA 3I56N 1HPZA 3NF7A 4MDBA 3ZETA 3L4QA 4EAHD 4ILGB 3AVIA 3CCMN 4H0YB 4O5FA 3K5OA 2D0BA 4W5NA 4UY8O 2P9NA 5C2DA 4BRGA 4B9LA 3ID6A 1IV0A 2NRXA 4V19S 2Y1IA 1NK8A 3L3UA 4MO5A 4FJHA 3WEEB 1MWKA 3ATUA 4Z0UA 4CEEA 2VCPA 1SKWA 1EKEA 4DUZK 2CGKA 1WSFA 4KBOA 2ASPA 2DFFA 3M8PA 5EY4A 2P51A 3ZSOA 1IO2A 4NLCA 3EL2A 4G1QA 1RDUA 4H0OA 4RTFD 1Q7YO 3V9UA 4CE9A 4DWIA 4BE0A 2ASMA 3IG1A 4F3TA 1QTMA 5AQLA 1HJOA 2FBXA 3O80A 3H45C 3OYDA 3TSPA 4JKAA 3HP6A 1N34K 1QVGM 4M7YA 4RW8A 1HNWK 2FBVA 3EZWA 4NCGA 5GAEP 2YHXA 1NGFA 1L3VA 1LV5A 1UWBA 3G10A 4EFHA 5M1OA 3L6QA 3OW2M 3CQXA 3ULEA 1C1CA 1CXQA 5CE3A 2RE2A 4DCHA 3A5LC 4F2RA 1VSEA 4CHPA 1OKJA 5KQDA 3AGKA 2YHAA 1NMDA 5JLHA 2QWRA 3EYZA 1ATSA 1E3MA 4PUOA 1Q81O 3TAEA 3GBTA 1XWLA 4FM0A 5TKWA 1M90O 3NGIA 3QB0A 5JVGL 4BE1A 1K8KB 1NU0A 1XI1A 2BDPA 1WN7A 1KAXA 1T03A 1XMQK 2AA4A 1BL3A 3CIPA 1JLCA 3NFAA 4CF9A 1TKXA 3C6HA 2KZMA 1UA0A 3BGRA 3PX4A 4NCBA 1VHXA 2GUPA 3KIOA 3RMBA 4K41A 4W5RA 4RW4A 3LM2A 5DMRA 4E19A 1VQKN 3GE1A 1T6DA 3WXMB 3U3GA 2G8UA 4M3UA 4O4GA 5C2FA 4YHHK 2QKKA 2V51B 3HOTA 4BE2A 4KAZA 5EXWA 5BPLA 4FWPA 1HKCA 2PYJA 1K6YA 3R1XA 4DR4K 3A5OC 4N5SA 2HMPA 3IDHA 5GIOA 5FPEA 2DTUA 2E6MA 2KW4A 4O55A 4WQ4C 1RT2A 2ZE2A 3AO5A 4H5VA 4MFBA 4B9UA 3OS1A 2O8BA 3E9PA 2E8AA 3C6TA 1U45A 1T6CA 2G8FA 4X65K 4WQ5A 2A40A 3ENOA 1BUPA 4Z94A 5EU7A 4JK9A 3MN9A 4CVNE 4WFBL 2JWLA 4CJSA 1HKGA 3SV3A 2PFUA 2QA4N 4ISFA 4DSKA 4GV6A 1JL2A 1BOTO 3AAQA 1N8RO 5C0YA 4Z4IA 3VQ5A 5K14A 4O5BA 4X62K 4FJ7A 4FWKA 4F2SA 5BR9A 4K8ZA 2HNDA 1RT3A 4DFMA 4FXDA 4IJNA 2NLXA 3SUOA 1RT6A 5FRNA 5AZJA 3P1GA 3LPUA 1RBTA 3CCLN 2VQEK 1IG9A 2KLAA 4QCLA 1WBDA 4IKFA 3TAFA 4DG1A 5CZ1A 4H0PA 3D2FA 3AAPA 2NRHA 2Q2RA 2O4IA 4QAGA 4PY5A 1ZYQA 4DQIA 4HHTA 4KI6A 2O8FA 3K59A 2O8EB 4BVPA 1NGDA 3LDLA 3MK6A 4FLXA 2VWBA 3CM6A 5AQSA 4ZTFA 1YVUA 4WFNL 3NF8A 2FSJA 4OKJA 3SCXA 2GWJA 4DTXA 4FJ9A 3K2PA 3S3OA 1XC9A 4LSNA 2DY4A 5AQYA 4CHYA 3KK3A 1JL1A 2XY5A 1NG9A 1HR0K 4CZIA 4DV6K 2BUPA 1VQ8N 4B3SK 1BDGA 5H1SQ 1IKXA 4KPYA 3IS9A 3IUCA 3S3MA 1R0AA 4CJRA 1P8ZA 3DLGA 3SQ1A 2ATQA 4ELVA 1GLAG 4CW7B 4YOUA 4QS8A 4HWIA 1GOBA 4FPAA 3LDSA 3JSMA 3I8DA 4JLHA 5CYQA 3V9SA 4FLYA 4NXNK 4GNIA 1TK5A 1J9AA 3MWTA 4CGHA 3D2EB 3OYMA 3TAPA 2OTLN 2KZZA 1Q82O 4QS7A 3A5NC 4JHDB 4KO0A 4RW9A 5FDLA 4JI2K 5FPMA 1BA0A 3LANA 3RR8A 1JLAA 4FWRA 3O08A 3AVCA 1VSHA 3SMSA 4B1ZA 2F9WA 2HHXA 3HBTA 4K8XA 1CZAN 4E1JA 4FSVA 3ZX2A 3C6UA 4CHZA 2IVNA 3VQ4A 3K5LA 3RMCA 2G8HA 1JJ2M 3QEVA 1XNQK 3RTVA 1GLLO 3HO1A 3CCEN 3JAMO 4LF5K 1RTHA 3OJSA 3LWLA 1RNHA 1C1BA 1JCFA 1RT1A 3O4QA 2A42A 1RCHA 3MCAB 4KHWA 2ETJA 4CF1A 4BDZA 5FPNA 4FJIA 2X78A 2P9PB 3CCUN 3AA4A 3RMDA 3ZYYX 3PO5A 4E7IA 3H46O 1M1KO 4DF8A 3AGRA 2QEXN 1BO5O 2PYLA 3D45A 4BC3A 3WEEA 4HCCA 2IGIA 3OHRA 5AQRA 1HYZA 1XNRK 4KH6A 4EZ6A 4B1UB 1VSFA 3H3OB 4CF0A 4LF8K 1NGIA 2PBDA 3O5BA 1LAWA 3TAMA 3DI6A 3RRHA 3EZ5A 1Q8IA 1HNZK 3DOLA 1J54A 3IKMA 4WCEL 5ADXA 3DWLA 3O3GA 1NGGA 3LDQA 2YNIA 5CY4A 3OS0A 4CF2A 3CQ8A 4GMJB 2E1ZA 2O8DB 2PAVA 1TKDA 3NGZA 2NRZA 4KREA 5C42A 3DM2A 3FZFA 2V7ZA 3OBYA 1S6QA 3VQDA 4E89A 1BCOA 5KPZA 1J6ZA 2H3GX 3ZT2A 4DU3A 4KI4A 2ASOA 1U49A 1RGIA 2HHWA 2QW9A 3RSEB 2XY7A 3AARA 3OYKA 4BG8A 4DQSA 3ATVA 3C94A 4M3XA 4B9MA 3KHYA 1RTIA 3BZCA 4AH9A 3DYAA 4JKFA 2W40A 4FJ5A 4FWMA 4AF1A 3VEVA 4R79A 1NK4A 3NBPA 1LAVA 4DR6K 4BRHA 2HNYA 1W7AA 3SAGA 3Q7BA 1T3VA 2A41A 3THXA 3IRXA 5KRSA 2F7TA 1A5VA 1KQSM 2RPIA 3MXJA 4NYNA 4E7LA 3WXIA 4M41A 1YTUA 5AQTA 4X66K 4DTMA 3TAQA 4FJJA 1KVAA 2W41A 3LPTA 3WQTA 1UOCA 1K8KA 3HTVA 3MXIA 4Z4HA 3NF9A 2E1YA 1WSJA 4J2AA 3VQQA 3M1FA 4CZMA 2OA8A 4IOXA 3RWUA 3N4QA 3KJVA 4H5NA 4O0IA 1DKGD 3O1WA 3VQ6A 4I7FA 2E88A 3FZKA 4B9QA 5F1XA 3ZT4A 5BN8A 4GV9A 2Q0RA 3DXKB 3LWMA 3HK2A 3Q7CA 3J7ZO 4C1NI 2E6LA 4CEFA 1IJJA 2VQFK 3PO4A 4I2QA 3J7AP 4IEIA 2VGNA 5DM7L 4DV1K 1P90A 2OZSA 3ZCMA 5CYMA 2YJEA 4DTSA 3ZX0A 5JICA 1XHZA 3AA2A 4BGAA 4O44A 1Z05A 3TARA 1JXBA 3L4IA 5BPNA 4KTQA 2DPNA 3G4SN 3AO1A 3U9DA 1BWFO 4CHOA 2XHBA 1OH7A 1S22A 2O8CA 1CZBA 3ENHA 4Z4GA 4B1YB 3VOVA 4DR5K 2X6SA 2R7YA 3BF3A 2QM1A 3G0ZA 1RT5A 4IEEA 4WF9L 4FLTA 3PY8A 4HTLA 4JI8K 2UXCK 4OX9K 4YDUC 2I5JA 4OVLA 3MMVA 1XUPO 3KLFA 3VEZA 1N36K 4CJFA 1B9FA 4FLUA 3KD1E 1GOCA 1Z6RA 4WQ5C 4FVMA 4K0KK 3VEXA 2FC0A 1SL2A 4EP5A 2XO7A 4HUEA 4DHYA 2OANA 3TU5A 3NGYA 3THWB 3OA9A 4CBWA 3OY9A 2CGLA 5AZIB 3AO4A 3ALYA 3QICA 2ZF5O 3ISNC 2F96A 3CC2N 2VG7A 1Q9YA 5IWAK 3FZMA 4CD3A 4JS4A 3OYEA 4FK0A 3CCVN 4C8MA 3KD5E 1YF5L 3ZSVA 3G6EN 3FFKB 2O4GA 4ZTJA 4NYFA 4F9OA 3E9OA 3EKUA 1I3AA 1NJIO 3L0QA 5I42A 3M8RA 3ASMA 3TANA 1A5WA 3ZSZA 2D4WA 1YJWN 4A5BA 1QSYA 3VN5A 4OGCA 4HTUA 3VEOA 4LFAK 3LP2A 4A62A 4W5QA 2VWKA 2JLEA 4HCBA 3O4NA 3F5TA 4IG0A 4YOWA 1WBBA 3H6EA 4DV4K 4CJ4A 2FBTA 4KHNA 3HT3A 2JGUA 4CJKA 4IO9L 4F4KA 1QSSA 3F73A 4YOYA 5AQGA 3CF5L 4NLBA 3ITHA 3HYFA 5M1NA 4ID1A 1F21A 4BQLA 4AM7A 1FJGK 4NCAA 4BR5A 5BRFA 1N5YA 1OVYA 4CFCA 1QHTA 1TAUA 3CFPA 3AVFA 4EP4A 1DGKN 3QINA 4GV3A 1XHXA 1RFQA 3V1RA 5M1PA 1BCMA 5HRPA 4NXMK 4MDAA 1X3MA 1HQEA 4ELTA 3E66A 2QTDA 1NJZA 2UU9K 3CFOA 4JRQA 3EN9A 3AO3A 1RDWX 3SUPA 1WSGA 4I6MB 1TYQB 3GG4A 3QO9A 4JKEA 1V4TA 4OPKA 5TKYA 4OO1J 3HSCA 3CJ7A 1WB9A 3AO2A 4R5PA 3CCSN 1D4XA 3P5JA 1EETA 2Q0UA 5GAGP 4JHDA 1JCEA 4M3WA 4A5AA 1X9MA 3V4IA 1J5EK 4LC9B 4FW1A 2D0OA 3S41A 4M3ZA 3C7NB 4FM2A 2YHYA 1HLUA 3WT0A 1NWKA 4FWQA 4CGIA 4OPJA 4J2DA 4CK3A 1EWRA 3QERA 1KSPA 4F8RA 4B9VA 3KLHA 2NZTA 3BEXA 1BU6O 4H5WA 1KLMA 5FROA 4BRAA 2Q36A 1BG3A 4PL8A 3PIPL 4DR3K 3OYNA 4JNEA 4U67L 2P9UB 1ESVA 1E4FT 2P9PA 4PQUA 3TPQA 2Z1IA 4B9NA 3FZHA 1D9FA 1ZBFA 3MCPA 2CGJA 1WNSA 4CI6A 2OPPA 2YNHA 4DU4A 4C8NA 4EHTA 3HPHA 1BIZA 3HP9A 1KFDA 4JKDA 1MWMA 1O13A 3VQPA 1R59O 2QKBA 4AHUA 4H4MA 3O6WA 1ATRA 3MEEA 2HNZA 4FZZA 4BRFA 1NGJA 4BRNA 4DU1A 2P9LB 5ADXH 3H08A 1DTQA 5LMUK 1XMOK 1DLOA 3O9TA 1BHLA 1ASVA 1QQNA 3R9PA 5GINA 2O8DA 3NH0A 3OBWA 1BISA 3VQAA 4M3YA 1KD1O 3WQUA 3C0BA 1RDCA 4QOZB 1RDBA 2DFHA 2IAJA 5J2MA 4AM6A 4B9SA 1U48A 2E20A 4DTUA 4GVMA 2P1JA 1X9WA 1REVA 4JKGA 3THVA 2XY6A 3AA3A 4WFAL 4FVUA 3VEYA 3SQ4A 1S1VA 5B8HA 4YNQA 5KPRA 4OPHA 1TAQA 4DKWA 2VG6A 1TUUA 3VQ9A 5BPMA 4KH5A 3CM5A 4CJPA 3K5MA 3SYZA 3I0RA 2FF6A 4FWSA 2IOCA 2OTJN 1QHAA 1SQKA 5JLFA 3SAFA 3CC4N 3TSUA 5A2QO 3HI0A 3VEWA 4BG9A 4AQYK 4IJAA 4B8CA 4JI6K 4B3OA 3E01A 2E2OA 1UA1A 4J2BA 3QFUA 4I2PA 1VRUA 4HUGA 4FJLA 1MU2A 2YHWA 1YJNN 3EY1A 3KTQA 1X3NA 1BI4B 2IVOA 1N6QA 4FJMA 1B92A 3UIQA 3B6PA 3DXMB 4FM1A 4FJGA 1VSMA 4OLAA 3DXKA 4UQGA 2V7YA 3MN6A 2VWJA 2W6KA 1NK5A 3RVCA 5C24A 3MXMA 4CZGA 2GUIA 5AQXA 3CHWA 4FZXC 5HBMA 4YY3K 5HRRA 3AVNA 2ZQBA 3HJFA 1VSKA 4KHYA 2Q97A 4JI0K 2HBKA 2OPSA 4N41A 3P83D 2J4RA 1FKOA 3TWHA 1EO1A 4E1MA 5AFUA 3V6DA 4K42A 2EX3A 4LFBK 4BY9C 3GL1A 3VMFB 3K5NA 4BRCA 3TAGA 4WYBA 4Y1DA 2B5JA 5AQPA 4CECA 2XRIA 3ZLJA 5AQZA 2ITGA 3D6RA 3KZBA 2YI1A 3P38A 2WONA 1Z26A 1C1AA 3CXCM 2ZD1A 3PUFA 4E3SA 1SS6A 2G8IA 5GADP 4DSLA 3J7YP 4FWLA 3LM9A 1EP4A 4KHSA 4IDKA 4OKKA 4FJXA 1KRPA 3VQCA 3LAKA 3UB5A 4M3TA 1HJRA 2P9IB 4CJ7A 1KAYA 4C8KA 4FOEA 3TABA 3F2KA 2NRVA 3O8MA 2QK9A 2ZM6K 4Q5VA 2HOEA 4DTOA 1QQCA 5KGXA 3FLCO 4FWNA 5CHIA 4CGJA 4B08A 3CCQN 2Q31A 4BC4A 5LL6Z 3QESA 3IMXA 4MLEA 2FF3B 3L3VA 4Y1CA 3ULDA 4L8RB 1TGOA 3LL3A 4IDHA 1YVNA 1NM1A 3LZJA 4H4OA 4PKIA 4RCHA 4CD1A 3THYB 4H8KA 3ULEB 4ISGA 3OVNA 3OYLA 1ZBHA 2EHGA 3MN7A 4CIEA 3MWPA 1D8YA 3AVMA 1N32K 3DRRA 4IXCA 3SI6A 3DAWA 1MDUB 4GVEA 5C10A 4ELUA 2HHHK 3K9JA 4DR7K 3VF2A 3WXKA 2FLOA 3VQBA 5KPTA 1E4GT 2HVIA 3MEDA 4DLEA 2NRRA 2HF3A 3O1BA 1LWEA 5AR0A 1C0FA 4JD2B 3RMAA 4ICLA 4Z4EA 3K9KA 5AQOA 3NHGA 1VSLA 5J2NA 5E84A 2AJQA 2HHQA 3TI0A 4IOCL 1KTQA 1TL3A 3D0PA 4LH5A 2HHSA 3M5RA 1EXQA 4Y0WA 1Q18A 1JKHA 1NBWA 2Z1JA 4MLHA 2E2QA 4JYAK 3OYJA 1CXUA 4CJUA 3K0SA 1LWFA 3V1OA 2YNGA 4I6MA 4DFKA 1VSDA 3H1QA 4M45A 1HKBA 4CEQA 3HRGA 2F8SA 4CZHA 1ZXOA 3DLKA 3FZLA 3WXLA 3TTDA 2NRTA 4CGGA 4CJWA 4DQQA 3I8BA 3H3NO 3VPZA 1BQMA 1OH5A 4KRFA 3NCIA 1T44A 3EE9A 4AILC 5HP1A 4GKJK 4DFPA 4IO8A 3R6MA 1WLJA 4DSFA 2ZWHA 4DMNA 4BQZA 1VQON 3ZEUB 4Z4CA 5HL7L 5I9EB 5BN9A 2IC3A 2X6NA 2O8BB 3D7EO 2A1SA 2DFEA 4A2BA 3DOKA 1ASUA 2KFNA 3M8QA 4OJRA 1ITGA 3A2FA 4XH4A 3V9WA 4JI1K 3T1HK 4E7KA 3EE8A 1HNVA 2QWNA 3MX2A 1XQSC 2IIRA 1O1WA 4RW7A 3QEWA 4H0XB 4C8LA 3FFIA 3UKRB 3GOIA 4DB3A 2UUAK 3AVAA 3LZIA 4J2EA 1JLFA 5M1QA 3J8AA 3OJUA 4B1WB 4PWDA 2CH6A 1VQ9N 2WFBA 5J2PA 4BRIA 3TTCA 4MQ3A 4FK2A 3CMEN 3NAEA 3QEPA 4A2AA 3O3FA 3KLGA 3SQ2A 4DQPA 1TK0A 5ELZA 3BY5A 1LW0A 1VAZA 5AQWA 2X74A 3JYTA 1K73O 1ASWA 3U8XA 1IBMK 3U9ZA 3D2FB 3V9ZA 4CJTA 1Z25A 1YI2N 1YHQN 1NGEA 4FO0A 4FJKA 3FR0A 3O3HA 3R8EA 2NUBA 3ENBA 2I7PA 4IG3A 2UUBK 2OPRA 3N4PA 1NK0A 1NK7A 2P5OA 2BANA 4HUFA 4C1NK 2OCEA 4FPBA 3VF6A 3K57A 2G8WA 4E7JA 2UYTA 3R3LA 2HMIA 2VYPA 3CMAN 4AHSA 1TK8A 1GLEG 5JVHL 2JWKA 4A57A 4B1XB 3HOSA 1IBKK 4LF7K 1VQ6N 3DLBA 3CG7A 1U2VB 4AHRA 3E1YA 3HSTB 4L3QA 1BIUA 1GLBG 1Y64A 3TSQA 2QI2A 1W0HA 1ZBIA 5JS2A 1J53A 5KQ8A 5AQKA 3B6OA 2LSNA 5BRDA 4M7XA 4PA1A 4DQRA 3KVGA 4DSEA 2VG5A 3IAYA 1KFSA 3CERA 2E5LK 4N76A 1QSLA 4JKHA 2HB5A 2G8KA 4CGFA 1V4SA 4CBXA 2EWSA 1DT9A 4CGDA 1YAGA 4HVJA 5AJ3K 4FLZA 4JV5K 1IKWA 5CZ2A 1BI4A 1K9MO 1VSJA 4ILJA 5J2QA 5AQFA 1QQMA 1SV5A 4JI3K 1QQOA 3AV9A 1S72N 1U47A 3UKUB 1JLBA 3VTIA 3VTHA 2KTQA 4CJ5A 1FKPA 2O8EA 5BRHA 3BDPA 3T7ZA 2QWQA 1SAZA 5SZTA 5E26A 1S6PA 1HPMA 1YUWA 2WUSA 5HLFA 4X64K 3EEQA 1IH7A 3MX5A 2RKIA 3L2UA 5EOYA 1WSHA 1T8EA 5AFUH 1NJXA 4CZLA 4JRPA 1A5XA 1VK0A 3P39A 4LD0A 3F9MA 3L8BA 1GOAA 4AHTA 1YIJN 2E2NA 3WNEA 4BR7A 1HYSA 3BP8A 1D5AA 4M63C 4LH4A 3PX0A 3TTFA 4CIGA 3V9XA 3SQ0A 1L5UA 2GX9A 3SNNA 4M42A 3VGLA 1C0GA 2YKNA 5AQIA 3SMPA 3O4WA 4JN4A 1C0UA 3D2EA 3QIPA 4KB0A 5I3UA 1NGHA 1RT4A 4IFEA 1JXEA 1TKTA 3DLHA 4IBNA 2D1KA 5GIPA 4DSIA 1RBUA 3NDKA 2P9IA 2OYQA 2QXFA 4WE1A 3DRPA 1RDAA 4DSJA 3ZSYA 5C12A 1NMNA 4W5TA 2P9KB 1SZ2A 4H0TB 2F8TA 2F9TA 2HBLA 2P9SB 1TVRA 3SLCA 4KKOA 3CCJN 3AVGA 4DS4A 1ATNA 4CJQA 4BRLA 4YOTA 4JKCA 1QS4A 1NJWA 3HVTA 1NNEA 4LF9K 3M6GA 4EIAA 1JLGA 2BTFA 2KKZA 3DRSA 3THYA 4JK7A 5HROA 3ZSQA 1NKBA 3AVJA 2E4LA 3ZT1A 2GELA 3QBXA 3THXB 4DUYK 3ZSWA 3C95A 3RR7A 4XH1A 1S9EA 1LCUA 4JI5K 3HM8A 3ZSRA 4BRDA 1NOZA 3LDNA 1J5OA 4CEAA 4KHQA 3KLEA 3HM9A 4A61A 4JD2A 4ZHRA 3F9KA 1ZBSA 3NH1A 3JXUA 3SZ2A 4KHUA 4NB4A 4C8OA 1HYVA 3CCRN 1VQ7N 1ZBLA 1U04A 3QNOA 1S1UA 2B6AA 4EHUA 4DR1K 4CK2A 1QE1A 5AQHA 3T69A 1SKRA 4IOAL 1ZC6A 4AHVA 2YCHA 5T7BA 3QEIA 4E0DA 1VSIA 1VQ4N 1BQNA 2GBZA 3WNGA 2KQ2A 1YJ9N 1S5JA 4NO7A 4BGBA 3CETA 4FW2A 4CCHA 3V1QA 2KHOA 5IT9O 1KCFA 1X9SA 1CLQA 3A5MC 3O9SA 2ZGYA 3RSEA 4KFBA 4YOXA 2A6AA 3V81A 3O9RA 2YKMA 4IWVA 2VGMA 4JKBA 3KK7A 5JS1A 2HSTA 1NGAA 4BR9A 3SPYA 4OKEA 1NKCA 4B9TA 4DFJA 4I9QA 3ZEUA 4GW6A 1WSEA 1WUAA 3CJBA 4YDUA 3VF4A 4DQ8A 3OYGA 1W2BM 2ZJQL 1HX1A 4CZJA 1ZBUA 3O9QA 1MA9B 1X9JA 2P5GA 4LFCK 4FJ8A 4DTNA 1SL0A 1KVCA 3TR8A 2O8CB 1G99A 2D0AA 1HNIA 3O9UA 5EX5A 1GLJO 3SJHA 2WOMA 1NJYA 3LP1A 3OYCA 1HNXK 4BWMA 1KAZA 2GV9A 3UKRA 1BGXT 4JS5A 4BACA 4M3RA 1W97L 2IDOA 1U4BA 4CESA 4H5RA 2B4JA 3CJ9A 3HPGA 1IKYA 1OVQA 4OGEA 4E7HA 2V52B 3M8SA 1HRHA 3NF6A 3L2VA 5F2RA 4XIUA 2UXDK 1OH6A 4U7BA 4H0VB 4EZ9A 1VQLN 4CJLA 2IVPA 3KWGA 1DTTA 4DV0K 4O8KA 3NH2A 2HHTA 3CJAA 1FW6A 3QFPA 1L3UA 3WXJA 1Y97A 3SJJA 4LF4K 4BDYA 3HPOA 1RILA 2YX6A 3DJCA 4IFVA 5FRMA 3ID8A 3W0LA 1YT3A 4PKHA 2Z1HA 2ZJRL 1K8AO 4E1NA 4TSXA 5SWMA 1YITN 3VERA 3CJCA 3P4IA 4ISEA 2FSNA 3ZETB 1I94K 1EX4A 4O8UA 2HVHA 4DS5A 3VENA 1C6VA 1RDDA 3M3ZA 3VQ8A 1QVFM 4KTWA 3CJ1A 4B3RK 4BC2A 4FLVA 4BC5A 5MLCQ 4FJNA 1LOTB 4DLGA 2YHBA 2P9NB 2QWPA 2QWOA 4CZKA 1U2VA 4DR2K 1NGBA 1JLQA 2PY5A 2Q1NA 1C0MA 5KTQA 1VQNN 4YOVA 4JK8A 3QNNA 1HMVA 4JI7K 2Z1GA 5E41A 2A1RA 4CBUA 2WC9A 3ZX3A 4C23A 2W42A 4CEDA 4ID5A 3THWA 3KK1A 3CPWM 3PSFA 2I7NA 3T1AA 5AZIA 2YJFA 3I55N 3VA0A 3PX6A 4BDPA 1IKVA 3SUNA 1KXPA 5KRTA 3CFRA 2Y1JA 3AVBA 1OH8A 1KLNA 1JCGA 4N56A 4CK1A 2AP1A 3LP0A 3DMJA 3MDQA 3DLLL 3P31A 3FE1A 3DLEA 3PIOL 1U6ZA 1S1WA 2NRWA 4DV2K 4B3TK 4G9ZA 2ITMA 1TUYA 1SUQA 3KKSA 1Q86O 4B3MK 4K25A 4MO4A 3UKUA 2HHUA 2OZMA 5M1FA 1WSIA 1L3TA 5C25A 4H03B 5C15A 1T05A 3UE5A 3AY9A 4LSLA 4ILHA 3OYIA 4A59A 1WOQA 2HBMA 3QDKA 2ZJPL 3T1YK 1G15A 2CH5A 1TL1A 3I0SA 4BRQA 3CI5A 4DTPA 5LJWA 3CYMA 4CEOA 3CQYA 1TV6A 3MECA 5BREA 1RBSA 3J80O 3PLAA 3NVMA 4CJ3A 1B9DA 1IBLK 3S9HA 3OS2A 2GWKA 3MEGA 4CEBA 3G71N 4F3OA 4LF6K 5HRSA 3SBGA 5AQQA 3JS6A 4CIFA 1RBRA 3W3DA
chains in the Genus database with same CATH topology
4AHSA 1TK8A 1IG9A 4LY7A 4M3ZA 4QCLA 4IKFA 3TAFA 4DG1A 4CFAA 5D3GA 4FM2A 3DLBA 3CG7A 5CZ1A 4AHRA 4OPJA 4CGIA 3HSTB 1BIUA 4J2DA 4CK3A 3QERA 1KSPA 3AA5X 4F8RA 3LAMA 1LWCA 2O4IA 4B9VA 3KLHA 4FLWA 1RT7A 4QAGA 1W0HA 4PY5A 4KV8A 1NK6A 1KLMA 1ZBIA 4CEZA 1ZYQA 5FROA 4DQIA 5JS2A 1J53A 4HHTA 4DTJA 2PZSA 4KI6A 3B6OA 2LSNA 3K59A 1YTAA 1Q9XA 2Q3SA 3OYNA 4PA1A 4FLXA 3CM6A 5KI6A 4DQRA 4DSEA 2VG5A 1RTJA 4PQUA 4ZTFA 1YVUA 2Z1IA 3NF8A 3IAYA 4B9NA 1KFSA 1L3SA 4OKJA 3SCXA 1D9FA 1ZBFA 2G8VA 3T19A 3ZT0A 4DTXA 1CZ9A 1TKZA 1WNSA 2OPPA 2YNHA 4DU4A 1QSLA 3K2PA 1UAXA 4CJVA 2HB5A 4C8NA 3S3OA 1XC9A 2G8KA 1FK9A 3HPHA 4LSNA 1T7PA 4CGFA 2DY4A 1BIZA 4KTZA 4CGDA 4CHYA 3KK3A 1NOYA 3HP9A 1FXXA 1KFDA 1JL1A 4HVJA 4FLZA 2XY5A 1IKWA 3VQPA 5CZ2A 2QKBA 4AHUA 1BI4A 3SV4A 1IKXA 4H4MA 4KPYA 3IS9A 1S1XA 1VSJA 5J2QA 3MAQA 3MEEA 3VQEA 1SV5A 2HNZA 2YV0X 4FZZA 3RRGA 3AV9A 1U47A 4DU1A 1JLBA 3DLRA 3S3MA 1R0AA 4CJRA 4CJ5A 2KTQA 1FKPA 3DLGA 3SQ1A 4ELVA 2ATQA 3H08A 1DTQA 4FCYA 1DLOA 3BDPA 1BHLA 1GOBA 1ASVA 2RF2A 4KB1A 5SZTA 5HLFA 1S6PA 2D0CA 3WNFA 3LDSA 3JSMA 3OYBA 4FJ9A 3I8DA 4JLHA 1IH7A 3NH0A 2RKIA 1BISA 4AHCA 5CYQA 4CHNA 5KGWA 4FLYA 3V9SA 4RG8A 3VQAA 3L2UA 1TK5A 1WSHA 3S3NA 1T8EA 4M3YA 3KK2A 1J9AA 4CGHA 3OYMA 3TAPA 1NJXA 3SUQA 2KZZA 4JRPA 1RDCA 4QOZB 1RDBA 1A5XA 3NE6A 2DFHA 2HHVA 1VK0A 3LP3A 4LD0A 2IAJA 3L8BA 5J2MA 1GOAA 4KO0A 4RW9A 2HW3A 4AHTA 4BWJA 4B9SA 5FDLA 1HQUA 3WNEA 2XY8A 3LANA 3KLIA 1U48A 3L2WA 1JLAA 3RR8A 4DTUA 1HYSA 2OPQA 4GVMA 1D5AA 3AVCA 1WAFA 1VSHA 2P1JA 4LH4A 4N47A 2FBYA 1X9WA 4Z4FA 3U3YA 1REVA 3PX0A 2HHXA 3PV8A 4K8XA 3K58A 4CIGA 3V9XA 3SQ0A 3THVA 1L5UA 2XY6A 3AA3A 3AVHA 3SNNA 4M42A 4FK4A 3C6UA 4CHZA 2YKNA 3SQ4A 1S1VA 3VA3A 3VQ4A 3K5LA 2RN2A 3RMCA 3SPZA 4YNQA 1I39A 2G8HA 4CFDA 4O0JA 3RTVA 3L2RA 1TAQA 3QEVA 1C0UA 2VG6A 3HO1A 1WAJA 3VQ7A 3VQ9A 3QIPA 4KB0A 1RTHA 3CM5A 3OJSA 3LWLA 1RNHA 1C1BA 4CJPA 3K5MA 1VRTA 3SYZA 3I0RA 1RT1A 4CHQA 5I3UA 3O4QA 3T3FA 1RT4A 1JXEA 1RCHA 1TKTA 5DK5A 2IOCA 2ETJA 3AVKA 4CF1A 4IBNA 4BDZA 2X78A 4FJIA 4DSIA 4KHWA 1RBVA 1RTDA 1RBUA 5HRNA 4DTRA 1JLEA 3NDKA 1D9DA 2OYQA 3WNHA 3AA4A 2QXFA 4B8CA 4WE1A 3DRPA 2IS3A 4I9LA 3RMDA 4E7IA 3PO5A 3E01A 4FZYA 4B3OA 1RDAA 2KFZA 4DSJA 3ZSYA 1X1PA 4DF8A 1UA1A 3HL8A 4W5TA 4J2BA 3QIOA 2PYLA 4W5OA 4I2PA 2F8TA 1VRUA 3D45A 4HUGA 4FJLA 4HCCA 2IGIA 1C0TA 1MU2A 4YFUA 3OYHA 4DF4A 1HYZA 1KVBA 1TVRA 3ZSXA 4KKOA 3EY1A 3ZT3A 3KTQA 1BI4B 3AVGA 4DS4A 4CJQA 4RW6A 1VSFA 1B92A 4CF0A 1N6QA 4CF8A 4EZ6A 3UIQA 4B8AB 3B6PA 4FJMA 4N76A 3HVRA 4FM1A 1NK9A 3QETA 1LAWA 3TAMA 1QS4A 2YNFA 3DI6A 1VSMA 3HVTA 3EZ5A 1Q8IA 3RRHA 1JLGA 1NJWA 4FJGA 1SL1A 4OLAA 4FYDA 5J1EA 3DRSA 4UQGA 3DOLA 1J54A 1LW2A 2VWJA 5HROA 3ZSQA 1NK5A 5C24A 3MXMA 2GUIA 3L2QA 3QLHA 3O3GA 1NKBA 3AVJA 2BGGA 2E4LA 3OS0A 2YNIA 5CY4A 5HBMA 3ZT1A 4FZXC 4CF2A 5HRRA 3CQ8A 4GMJB 3AVNA 3ZSWA 4CJEA 3C95A 2ZQBA 3NGZA 1TKDA 1VSKA 3RR7A 4KHYA 3HJFA 3HXMA 4KREA 1S9EA 3DM2A 5C42A 4E89A 1S6QA 3VQDA 4DU3A 1BCOA 3ZSRA 3ZT2A 4KI4A 1NOZA 2OPSA 1U49A 1J5OA 4N41A 4CEAA 4KHQA 2HHWA 3KLEA 3HM9A 3P83D 2XY7A 3KKRA 1FKOA 3TWHA 4ZHRA 4Q0BA 4E1MA 3F9KA 3NH1A 3SZ2A 3OYKA 2EX3A 3V6DA 1NKEA 4KHUA 4CFBA 4DQSA 3C94A 1HYVA 3K5NA 4C8OA 4M3XA 3LALA 4Y1DA 3TAGA 1NK4A 4B9MA 1ZBLA 3OYAA 1RTIA 1U04A 1W9HA 2B5JA 3QNOA 1S1UA 4AH9A 2B6AA 4CECA 4CK2A 3DYAA 1QE1A 2XRIA 4FJ5A 1S9GA 4OLBA 2ITGA 1SKRA 4AHVA 5T7BA 2BE2A 4IFYA 3QEIA 4E0DA 4CIFA 1VSIA 1SKSA 2WONA 2GBZA 1BQNA 2KQ2A 1LAVA 1S1TA 1Z26A 3NBPA 3WNGA 2HNYA 1S5JA 3U6FA 1C1AA 2ZD1A 4FW2A 3OYFA 2D5RA 3PUFA 4CCHA 3V1QA 4CERA 3QEXA 4E3SA 2G8IA 3IRXA 5KRSA 1A5VA 2RPIA 3AVLA 3MXJA 1KCFA 4NYNA 4E7LA 1X9SA 1CLQA 4DSLA 1HPZA 3NF7A 4M41A 1YTUA 1EP4A 4KFBA 4DTMA 3TAQA 4FJJA 4KHSA 4IDKA 4OKKA 4FJXA 3AVIA 1KVAA 3LPTA 3K5OA 3V81A 2D0BA 4W5NA 1UOCA 2YKMA 1KRPA 3VQCA 3MXIA 3LAKA 4M3TA 1HJRA 5JS1A 3SPYA 4C8KA 4B9LA 4Z4HA 3TABA 3NF9A 4OKEA 1NKCA 4FW1A 4B9TA 4DFJA 2QK9A 2Y1IA 4I9QA 1WSJA 4GW6A 1NK8A 3VQQA 4Q5VA 2OA8A 4J2AA 1WSEA 3OYGA 1QQCA 4DTOA 3L3UA 5KGXA 3RWUA 4CGJA 4FJHA 4B08A 3KJVA 3QESA 4Z0UA 4O0IA 3L3VA 4Y1CA 4CEEA 1SKWA 3ULDA 1ZBUA 1EKEA 1TGOA 4L8RB 3VQ6A 2P5GA 4FJ8A 1WSFA 4DTNA 1SL0A 4I7FA 1KVCA 3TR8A 2DFFA 3LZJA 2D0AA 1HNIA 3M8PA 4H4OA 3ZT4A 2P51A 3ZSOA 1IO2A 2WOMA 3LWMA 1NJYA 4G1QA 3HK2A 3LP1A 4H8KA 3OYCA 3OVNA 2E6LA 3OYLA 4CE9A 2EHGA 4BWMA 4CEFA 4CIEA 4BE0A 3V9UA 1D8YA 4DWIA 1ZBHA 2GV9A 3AVMA 3IG1A 1BGXT 4I2QA 4JS5A 3DRRA 4BACA 3PO4A 4F3TA 4M3RA 1QTMA 3SI6A 2FBXA 2IDOA 2OZSA 1U4BA 3ZCMA 4CESA 2B4JA 3HPGA 4OGEA 1IKYA 5CYMA 3OYDA 3HP6A 4E7HA 4DTSA 3VQBA 1XHZA 3AA2A 3M8SA 3MEDA 4DLEA 2HVIA 1HRHA 4RW8A 4O44A 1LWEA 2FBVA 3NF6A 4NCGA 3TARA 1JXBA 4XIUA 3L2VA 3RMAA 4ICLA 4Z4EA 4KTQA 3NHGA 1VSLA 5J2NA 3AO1A 4CHOA 2AJQA 2XHBA 1LV5A 3TI0A 1L3VA 4EZ9A 1UWBA 2HHQA 1KTQA 1TL3A 4CJLA 1DTTA 3G10A 3D0PA 4LH5A 2HHSA 1EXQA 1CZBA 3NH2A 4Z4GA 2HHTA 2X6SA 2R7YA 1L3UA 1Y97A 3SJJA 4BDYA 3HPOA 3G0ZA 1C1CA 1RILA 1CXQA 2Z1JA 1JKHA 1RT5A 4IFVA 5FRMA 4FLTA 3PY8A 2I5JA 4OVLA 3OYJA 1CXUA 1YT3A 4CJUA 4F2RA 3KLFA 1VSEA 2Z1HA 1LWFA 3V1OA 4CHPA 4E1NA 4TSXA 2YNGA 4CJFA 4DFKA 1B9FA 1VSDA 2YHAA 4M45A 5SWMA 4FLUA 1GOCA 3KD1E 3EYZA 4FVMA 4CEQA 4PUOA 2FC0A 1SL2A 2F8SA 3TAEA 3DLKA 1EX4A 4EP5A 2XO7A 4HUEA 2HVHA 4CGGA 1XWLA 3NGYA 4DS5A 4CJWA 4FM0A 4DQQA 3NGIA 1C6VA 1RDDA 3VQ8A 3OY9A 4KTWA 3AO4A 1BQMA 4BE1A 4FLVA 4FJNA 4KRFA 3ALYA 3NCIA 4DLGA 1XI1A 2BDPA 4AILC 5HP1A 1WN7A 2YHBA 3ISNC 4DFPA 1T03A 2F96A 1WLJA 2VG7A 4DMNA 4DSFA 1Q9YA 1BL3A 4JS4A 1JLQA 4Z4CA 1JLCA 2PY5A 3OYEA 4FK0A 3KD5E 4C8MA 1C0MA 3NFAA 2IC3A 2X6NA 3ZSVA 4CF9A 5KTQA 2A1SA 1TKXA 2O4GA 4ZTJA 2DFEA 4NYFA 3QNNA 2KZMA 1HMVA 1I3AA 1UA0A 3DOKA 1ASUA 3BGRA 3M8RA 3PX4A 3M8QA 4OJRA 3ASMA 5I42A 3TANA 2KFNA 1ITGA 2Z1GA 3A2FA 5E41A 4NCBA 1A5WA 2A1RA 3KIOA 3RMBA 3V9WA 4W5RA 3ZSZA 1QSYA 4RW4A 3VN5A 4OGCA 5DMRA 4E19A 4HTUA 2W42A 4E7KA 4CEDA 4ID5A 3U3GA 2G8UA 1HNVA 4M3UA 4O4GA 3KK1A 2QKKA 3LP2A 4W5QA 4RW7A 1O1WA 2VWKA 3T1AA 2JLEA 4HCBA 3QEWA 4BE2A 3VA0A 3PX6A 3O4NA 4KAZA 4C8LA 4BDPA 3FFIA 4IG0A 1IKVA 3SUNA 2PYJA 1K6YA 4CJ4A 5KRTA 2FBTA 3AVAA 4KHNA 3LZIA 3HT3A 2JGUA 4CJKA 3CFRA 4N5SA 4F4KA 2Y1JA 3AVBA 1QSSA 1KLNA 1JLFA 4J2EA 4N56A 2DTUA 4CK1A 3LP0A 2E6MA 2KW4A 4O55A 3OJUA 1RT2A 2ZE2A 3AO5A 3DMJA 3F73A 4PWDA 5J2PA 4MFBA 3ITHA 3DLEA 4MQ3A 3HYFA 3DLHA 4B9UA 4FK2A 4ID1A 1F21A 3OS1A 3C6TA 3NAEA 1U45A 1S1WA 2G8FA 3QEPA 4NCAA 1N5YA 4CFCA 3O3FA 1QHTA 1TAUA 3KLGA 3CFPA 3AVFA 3SQ2A 4DQPA 1SUQA 4EP4A 5EU7A 3KKSA 3QINA 1TK0A 2HHUA 1XHXA 1LW0A 3V1RA 5HRPA 1BCMA 2OZMA 1WSIA 1L3TA 5C25A 1T05A 2X74A 1HQEA 4LSLA 4CJSA 3OYIA 3JYTA 1NJZA 4ELTA 3CFOA 4ELUA 1ASWA 3SV3A 4JRQA 3V9ZA 1G15A 1Z25A 3AO3A 4CJTA 4DSKA 1TL1A 3I0SA 3SUPA 1JL2A 1WSGA 4FJKA 4DTPA 3O3HA 3CYMA 4CEOA 2NUBA 4Z4IA 3QO9A 4OPKA 3VQ5A 5K14A 4O5BA 4IG3A 4FJ7A 1TV6A 2OPRA 3AO2A 4R5PA 3MECA 1RBSA 3P5JA 1NK7A 1NK0A 2P5OA 1EETA 2BANA 4F2SA 4K8ZA 2HNDA 4CJ3A 1RT3A 1B9DA 3S9HA 3OS2A 4F3OA 3MEGA 4CEBA 4HUFA 4DFMA 5HRSA 4FXDA 4M3WA 3K57A 3SUOA 1RT6A 4E7JA 1X9MA 2G8WA 3V4IA 5FRNA 3P1GA 2HMIA 1RBRA 3LPUA 1RBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AHS A;  1TK8 A;  1IG9 A;  4LY7 A;  4M3Z A;  4QCL A;  4IKF A;  3TAF A;  4DG1 A;  4CFA A;  5D3G A;  4FM2 A;  3DLB A;  3CG7 A;  5CZ1 A;  4AHR A;  4OPJ A;  4CGI A;  3HST B;  1BIU A;  4J2D A;  4CK3 A;  3QER A;  1KSP A;  3AA5 X;  4F8R A;  3LAM A;  1LWC A;  2O4I A;  4B9V A;  3KLH A;  4FLW A;  1RT7 A;  4QAG A;  1W0H A;  4PY5 A;  4KV8 A;  1NK6 A;  1KLM A;  1ZBI A;  4CEZ A;  1ZYQ A;  5FRO A;  4DQI A;  5JS2 A;  1J53 A;  4HHT A;  4DTJ A;  2PZS A;  4KI6 A;  3B6O A;  2LSN A;  3K59 A;  1YTA A;  1Q9X A;  2Q3S A;  3OYN A;  4PA1 A;  4FLX A;  3CM6 A;  5KI6 A;  4DQR A;  4DSE A;  2VG5 A;  1RTJ A;  4PQU A;  4ZTF A;  1YVU A;  2Z1I A;  3NF8 A;  3IAY A;  4B9N A;  1KFS A;  1L3S A;  4OKJ A;  3SCX A;  1D9F A;  1ZBF A;  2G8V A;  3T19 A;  3ZT0 A;  4DTX A;  1CZ9 A;  1TKZ A;  1WNS A;  2OPP A;  2YNH A;  4DU4 A;  1QSL A;  3K2P A;  1UAX A;  4CJV A;  2HB5 A;  4C8N A;  3S3O A;  1XC9 A;  2G8K A;  1FK9 A;  3HPH A;  4LSN A;  1T7P A;  4CGF A;  2DY4 A;  1BIZ A;  4KTZ A;  4CGD A;  4CHY A;  3KK3 A;  1NOY A;  3HP9 A;  1FXX A;  1KFD A;  1JL1 A;  4HVJ A;  4FLZ A;  2XY5 A;  1IKW A;  3VQP A;  5CZ2 A;  2QKB A;  4AHU A;  1BI4 A;  3SV4 A;  1IKX A;  4H4M A;  4KPY A;  3IS9 A;  1S1X A;  1VSJ A;  5J2Q A;  3MAQ A;  3MEE A;  3VQE A;  1SV5 A;  2HNZ A;  2YV0 X;  4FZZ A;  3RRG A;  3AV9 A;  1U47 A;  4DU1 A;  1JLB A;  3DLR A;  3S3M A;  1R0A A;  4CJR A;  4CJ5 A;  2KTQ A;  1FKP A;  3DLG A;  3SQ1 A;  4ELV A;  2ATQ A;  3H08 A;  1DTQ A;  4FCY A;  1DLO A;  3BDP A;  1BHL A;  1GOB A;  1ASV A;  2RF2 A;  4KB1 A;  5SZT A;  5HLF A;  1S6P A;  2D0C A;  3WNF A;  3LDS A;  3JSM A;  3OYB A;  4FJ9 A;  3I8D A;  4JLH A;  1IH7 A;  3NH0 A;  2RKI A;  1BIS A;  4AHC A;  5CYQ A;  4CHN A;  5KGW A;  4FLY A;  3V9S A;  4RG8 A;  3VQA A;  3L2U A;  1TK5 A;  1WSH A;  3S3N A;  1T8E A;  4M3Y A;  3KK2 A;  1J9A A;  4CGH A;  3OYM A;  3TAP A;  1NJX A;  3SUQ A;  2KZZ A;  4JRP A;  1RDC A;  4QOZ B;  1RDB A;  1A5X A;  3NE6 A;  2DFH A;  2HHV A;  1VK0 A;  3LP3 A;  4LD0 A;  2IAJ A;  3L8B A;  5J2M A;  1GOA A;  4KO0 A;  4RW9 A;  2HW3 A;  4AHT A;  4BWJ A;  4B9S A;  5FDL A;  1HQU A;  3WNE A;  2XY8 A;  3LAN A;  3KLI A;  1U48 A;  3L2W A;  1JLA A;  3RR8 A;  4DTU A;  1HYS A;  2OPQ A;  4GVM A;  1D5A A;  3AVC A;  1WAF A;  1VSH A;  2P1J A;  4LH4 A;  4N47 A;  2FBY A;  1X9W A;  4Z4F A;  3U3Y A;  1REV A;  3PX0 A;  2HHX A;  3PV8 A;  4K8X A;  3K58 A;  4CIG A;  3V9X A;  3SQ0 A;  3THV A;  1L5U A;  2XY6 A;  3AA3 A;  3AVH A;  3SNN A;  4M42 A;  4FK4 A;  3C6U A;  4CHZ A;  2YKN A;  3SQ4 A;  1S1V A;  3VA3 A;  3VQ4 A;  3K5L A;  2RN2 A;  3RMC A;  3SPZ A;  4YNQ A;  1I39 A;  2G8H A;  4CFD A;  4O0J A;  3RTV A;  3L2R A;  1TAQ A;  3QEV A;  1C0U A;  2VG6 A;  3HO1 A;  1WAJ A;  3VQ7 A;  3VQ9 A;  3QIP A;  4KB0 A;  1RTH A;  3CM5 A;  3OJS A;  3LWL A;  1RNH A;  1C1B A;  4CJP A;  3K5M A;  1VRT A;  3SYZ A;  3I0R A;  1RT1 A;  4CHQ A;  5I3U A;  3O4Q A;  3T3F A;  1RT4 A;  1JXE A;  1RCH A;  1TKT A;  5DK5 A;  2IOC A;  2ETJ A;  3AVK A;  4CF1 A;  4IBN A;  4BDZ A;  2X78 A;  4FJI A;  4DSI A;  4KHW A;  1RBV A;  1RTD A;  1RBU A;  5HRN A;  4DTR A;  1JLE A;  3NDK A;  1D9D A;  2OYQ A;  3WNH A;  3AA4 A;  2QXF A;  4B8C A;  4WE1 A;  3DRP A;  2IS3 A;  4I9L A;  3RMD A;  4E7I A;  3PO5 A;  3E01 A;  4FZY A;  4B3O A;  1RDA A;  2KFZ A;  4DSJ A;  3ZSY A;  1X1P A;  4DF8 A;  1UA1 A;  3HL8 A;  4W5T A;  4J2B A;  3QIO A;  2PYL A;  4W5O A;  4I2P A;  2F8T A;  1VRU A;  3D45 A;  4HUG A;  4FJL A;  4HCC A;  2IGI A;  1C0T A;  1MU2 A;  4YFU A;  3OYH A;  4DF4 A;  1HYZ A;  1KVB A;  1TVR A;  3ZSX A;  4KKO A;  3EY1 A;  3ZT3 A;  3KTQ A;  1BI4 B;  3AVG A;  4DS4 A;  4CJQ A;  4RW6 A;  1VSF A;  1B92 A;  4CF0 A;  1N6Q A;  4CF8 A;  4EZ6 A;  3UIQ A;  4B8A B;  3B6P A;  4FJM A;  4N76 A;  3HVR A;  4FM1 A;  1NK9 A;  3QET A;  1LAW A;  3TAM A;  1QS4 A;  2YNF A;  3DI6 A;  1VSM A;  3HVT A;  3EZ5 A;  1Q8I A;  3RRH A;  1JLG A;  1NJW A;  4FJG A;  1SL1 A;  4OLA A;  4FYD A;  5J1E A;  3DRS A;  4UQG A;  3DOL A;  1J54 A;  1LW2 A;  2VWJ A;  5HRO A;  3ZSQ A;  1NK5 A;  5C24 A;  3MXM A;  2GUI A;  3L2Q A;  3QLH A;  3O3G A;  1NKB A;  3AVJ A;  2BGG A;  2E4L A;  3OS0 A;  2YNI A;  5CY4 A;  5HBM A;  3ZT1 A;  4FZX C;  4CF2 A;  5HRR A;  3CQ8 A;  4GMJ B;  3AVN A;  3ZSW A;  4CJE A;  3C95 A;  2ZQB A;  3NGZ A;  1TKD A;  1VSK A;  3RR7 A;  4KHY A;  3HJF A;  3HXM A;  4KRE A;  1S9E A;  3DM2 A;  5C42 A;  4E89 A;  1S6Q A;  3VQD A;  4DU3 A;  1BCO A;  3ZSR A;  3ZT2 A;  4KI4 A;  1NOZ A;  2OPS A;  1U49 A;  1J5O A;  4N41 A;  4CEA A;  4KHQ A;  2HHW A;  3KLE A;  3HM9 A;  3P83 D;  2XY7 A;  3KKR A;  1FKO A;  3TWH A;  4ZHR A;  4Q0B A;  4E1M A;  3F9K A;  3NH1 A;  3SZ2 A;  3OYK A;  2EX3 A;  3V6D A;  1NKE A;  4KHU A;  4CFB A;  4DQS A;  3C94 A;  1HYV A;  3K5N A;  4C8O A;  4M3X A;  3LAL A;  4Y1D A;  3TAG A;  1NK4 A;  4B9M A;  1ZBL A;  3OYA A;  1RTI A;  1U04 A;  1W9H A;  2B5J A;  3QNO A;  1S1U A;  4AH9 A;  2B6A A;  4CEC A;  4CK2 A;  3DYA A;  1QE1 A;  2XRI A;  4FJ5 A;  1S9G A;  4OLB A;  2ITG A;  1SKR A;  4AHV A;  5T7B A;  2BE2 A;  4IFY A;  3QEI A;  4E0D A;  4CIF A;  1VSI A;  1SKS A;  2WON A;  2GBZ A;  1BQN A;  2KQ2 A;  1LAV A;  1S1T A;  1Z26 A;  3NBP A;  3WNG A;  2HNY A;  1S5J A;  3U6F A;  1C1A A;  2ZD1 A;  4FW2 A;  3OYF A;  2D5R A;  3PUF A;  4CCH A;  3V1Q A;  4CER A;  3QEX A;  4E3S A;  2G8I A;  3IRX A;  5KRS A;  1A5V A;  2RPI A;  3AVL A;  3MXJ A;  1KCF A;  4NYN A;  4E7L A;  1X9S A;  1CLQ A;  4DSL A;  1HPZ A;  3NF7 A;  4M41 A;  1YTU A;  1EP4 A;  4KFB A;  4DTM A;  3TAQ A;  4FJJ A;  4KHS A;  4IDK A;  4OKK A;  4FJX A;  3AVI A;  1KVA A;  3LPT A;  3K5O A;  3V81 A;  2D0B A;  4W5N A;  1UOC A;  2YKM A;  1KRP A;  3VQC A;  3MXI A;  3LAK A;  4M3T A;  1HJR A;  5JS1 A;  3SPY A;  4C8K A;  4B9L A;  4Z4H A;  3TAB A;  3NF9 A;  4OKE A;  1NKC A;  4FW1 A;  4B9T A;  4DFJ A;  2QK9 A;  2Y1I A;  4I9Q A;  1WSJ A;  4GW6 A;  1NK8 A;  3VQQ A;  4Q5V A;  2OA8 A;  4J2A A;  1WSE A;  3OYG A;  1QQC A;  4DTO A;  3L3U A;  5KGX A;  3RWU A;  4CGJ A;  4FJH A;  4B08 A;  3KJV A;  3QES A;  4Z0U A;  4O0I A;  3L3V A;  4Y1C A;  4CEE A;  1SKW A;  3ULD A;  1ZBU A;  1EKE A;  1TGO A;  4L8R B;  3VQ6 A;  2P5G A;  4FJ8 A;  1WSF A;  4DTN A;  1SL0 A;  4I7F A;  1KVC A;  3TR8 A;  2DFF A;  3LZJ A;  2D0A A;  1HNI A;  3M8P A;  4H4O A;  3ZT4 A;  2P51 A;  3ZSO A;  1IO2 A;  2WOM A;  3LWM A;  1NJY A;  4G1Q A;  3HK2 A;  3LP1 A;  4H8K A;  3OYC A;  3OVN A;  2E6L A;  3OYL A;  4CE9 A;  2EHG A;  4BWM A;  4CEF A;  4CIE A;  4BE0 A;  3V9U A;  1D8Y A;  4DWI A;  1ZBH A;  2GV9 A;  3AVM A;  3IG1 A;  1BGX T;  4I2Q A;  4JS5 A;  3DRR A;  4BAC A;  3PO4 A;  4F3T A;  4M3R A;  1QTM A;  3SI6 A;  2FBX A;  2IDO A;  2OZS A;  1U4B A;  3ZCM A;  4CES A;  2B4J A;  3HPG A;  4OGE A;  1IKY A;  5CYM A;  3OYD A;  3HP6 A;  4E7H A;  4DTS A;  3VQB A;  1XHZ A;  3AA2 A;  3M8S A;  3MED A;  4DLE A;  2HVI A;  1HRH A;  4RW8 A;  4O44 A;  1LWE A;  2FBV A;  3NF6 A;  4NCG A;  3TAR A;  1JXB A;  4XIU A;  3L2V A;  3RMA A;  4ICL A;  4Z4E A;  4KTQ A;  3NHG A;  1VSL A;  5J2N A;  3AO1 A;  4CHO A;  2AJQ A;  2XHB A;  1LV5 A;  3TI0 A;  1L3V A;  4EZ9 A;  1UWB A;  2HHQ A;  1KTQ A;  1TL3 A;  4CJL A;  1DTT A;  3G10 A;  3D0P A;  4LH5 A;  2HHS A;  1EXQ A;  1CZB A;  3NH2 A;  4Z4G A;  2HHT A;  2X6S A;  2R7Y A;  1L3U A;  1Y97 A;  3SJJ A;  4BDY A;  3HPO A;  3G0Z A;  1C1C A;  1RIL A;  1CXQ A;  2Z1J A;  1JKH A;  1RT5 A;  4IFV A;  5FRM A;  4FLT A;  3PY8 A;  2I5J A;  4OVL A;  3OYJ A;  1CXU A;  1YT3 A;  4CJU A;  4F2R A;  3KLF A;  1VSE A;  2Z1H A;  1LWF A;  3V1O A;  4CHP A;  4E1N A;  4TSX A;  2YNG A;  4CJF A;  4DFK A;  1B9F A;  1VSD A;  2YHA A;  4M45 A;  5SWM A;  4FLU A;  1GOC A;  3KD1 E;  3EYZ A;  4FVM A;  4CEQ A;  4PUO A;  2FC0 A;  1SL2 A;  2F8S A;  3TAE A;  3DLK A;  1EX4 A;  4EP5 A;  2XO7 A;  4HUE A;  2HVH A;  4CGG A;  1XWL A;  3NGY A;  4DS5 A;  4CJW A;  4FM0 A;  4DQQ A;  3NGI A;  1C6V A;  1RDD A;  3VQ8 A;  3OY9 A;  4KTW A;  3AO4 A;  1BQM A;  4BE1 A;  4FLV A;  4FJN A;  4KRF A;  3ALY A;  3NCI A;  4DLG A;  1XI1 A;  2BDP A;  4AIL C;  5HP1 A;  1WN7 A;  2YHB A;  3ISN C;  4DFP A;  1T03 A;  2F96 A;  1WLJ A;  2VG7 A;  4DMN A;  4DSF A;  1Q9Y A;  1BL3 A;  4JS4 A;  1JLQ A;  4Z4C A;  1JLC A;  2PY5 A;  3OYE A;  4FK0 A;  3KD5 E;  4C8M A;  1C0M A;  3NFA A;  2IC3 A;  2X6N A;  3ZSV A;  4CF9 A;  5KTQ A;  2A1S A;  1TKX A;  2O4G A;  4ZTJ A;  2DFE A;  4NYF A;  3QNN A;  2KZM A;  1HMV A;  1I3A A;  1UA0 A;  3DOK A;  1ASU A;  3BGR A;  3M8R A;  3PX4 A;  3M8Q A;  4OJR A;  3ASM A;  5I42 A;  3TAN A;  2KFN A;  1ITG A;  2Z1G A;  3A2F A;  5E41 A;  4NCB A;  1A5W A;  2A1R A;  3KIO A;  3RMB A;  3V9W A;  4W5R A;  3ZSZ A;  1QSY A;  4RW4 A;  3VN5 A;  4OGC A;  5DMR A;  4E19 A;  4HTU A;  2W42 A;  4E7K A;  4CED A;  4ID5 A;  3U3G A;  2G8U A;  1HNV A;  4M3U A;  4O4G A;  3KK1 A;  2QKK A;  3LP2 A;  4W5Q A;  4RW7 A;  1O1W A;  2VWK A;  3T1A A;  2JLE A;  4HCB A;  3QEW A;  4BE2 A;  3VA0 A;  3PX6 A;  3O4N A;  4KAZ A;  4C8L A;  4BDP A;  3FFI A;  4IG0 A;  1IKV A;  3SUN A;  2PYJ A;  1K6Y A;  4CJ4 A;  5KRT A;  2FBT A;  3AVA A;  4KHN A;  3LZI A;  3HT3 A;  2JGU A;  4CJK A;  3CFR A;  4N5S A;  4F4K A;  2Y1J A;  3AVB A;  1QSS A;  1KLN A;  1JLF A;  4J2E A;  4N56 A;  2DTU A;  4CK1 A;  3LP0 A;  2E6M A;  2KW4 A;  4O55 A;  3OJU A;  1RT2 A;  2ZE2 A;  3AO5 A;  3DMJ A;  3F73 A;  4PWD A;  5J2P A;  4MFB A;  3ITH A;  3DLE A;  4MQ3 A;  3HYF A;  3DLH A;  4B9U A;  4FK2 A;  4ID1 A;  1F21 A;  3OS1 A;  3C6T A;  3NAE A;  1U45 A;  1S1W A;  2G8F A;  3QEP A;  4NCA A;  1N5Y A;  4CFC A;  3O3F A;  1QHT A;  1TAU A;  3KLG A;  3CFP A;  3AVF A;  3SQ2 A;  4DQP A;  1SUQ A;  4EP4 A;  5EU7 A;  3KKS A;  3QIN A;  1TK0 A;  2HHU A;  1XHX A;  1LW0 A;  3V1R A;  5HRP A;  1BCM A;  2OZM A;  1WSI A;  1L3T A;  5C25 A;  1T05 A;  2X74 A;  1HQE A;  4LSL A;  4CJS A;  3OYI A;  3JYT A;  1NJZ A;  4ELT A;  3CFO A;  4ELU A;  1ASW A;  3SV3 A;  4JRQ A;  3V9Z A;  1G15 A;  1Z25 A;  3AO3 A;  4CJT A;  4DSK A;  1TL1 A;  3I0S A;  3SUP A;  1JL2 A;  1WSG A;  4FJK A;  4DTP A;  3O3H A;  3CYM A;  4CEO A;  2NUB A;  4Z4I A;  3QO9 A;  4OPK A;  3VQ5 A;  5K14 A;  4O5B A;  4IG3 A;  4FJ7 A;  1TV6 A;  2OPR A;  3AO2 A;  4R5P A;  3MEC A;  1RBS A;  3P5J A;  1NK7 A;  1NK0 A;  2P5O A;  1EET A;  2BAN A;  4F2S A;  4K8Z A;  2HND A;  4CJ3 A;  1RT3 A;  1B9D A;  3S9H A;  3OS2 A;  4F3O A;  3MEG A;  4CEB A;  4HUF A;  4DFM A;  5HRS A;  4FXD A;  4M3W A;  3K57 A;  3SUO A;  1RT6 A;  4E7J A;  1X9M A;  2G8W A;  3V4I A;  5FRN A;  3P1G A;  2HMI A;  1RBR A;  3LPU A;  1RBT A; 
#chains in the Genus database with same CATH topology
 3WUH A;  4LY7 A;  2A3Z A;  3BUZ B;  4CFA A;  5D3G A;  3J81 O;  4FWO A;  2D0P A;  4PHT X;  5DM6 L;  3AA5 X;  3LAM A;  1LWC A;  3LDO A;  1BA1 A;  4FLW A;  1RT7 A;  4KV8 A;  1NK6 A;  4WQ4 A;  1TYQ A;  4OPA A;  4CEZ A;  5AQV A;  4BRP A;  3U4L A;  2QXL A;  1QZ6 A;  4DTJ A;  2PZS A;  4BRK A;  4K43 A;  1YTA A;  1Q9X A;  2Q3S A;  3BZK A;  5KI6 A;  5F0X A;  4FL9 A;  1RTJ A;  5CR4 A;  1L3S A;  2A5X A;  2G8V A;  3C7N A;  3T19 A;  3ZT0 A;  2QWM A;  4BRM A;  1CZ9 A;  1TKZ A;  3SK3 A;  1UAX A;  4CJV A;  1FK9 A;  2P9K A;  3OTO K;  2HF4 A;  1T7P A;  2F4V K;  4KTZ A;  1NOY A;  1H1V A;  2FSK A;  1FXX A;  4BVO A;  2P9S A;  3VES A;  1GLC G;  5GAH P;  3SV4 A;  3CC7 N;  5LJV A;  1S1X A;  3MAQ A;  3VQE A;  3QML A;  2YV0 X;  3RRG A;  5FLX O;  3DLR A;  4JKG B;  4FCY A;  2UXB K;  2P9U A;  4JI4 K;  2RF2 A;  4KB1 A;  2D0C A;  3WNF A;  4BR2 A;  3I33 A;  3OYB A;  1QZ5 A;  4IZ9 A;  4AHC A;  4B1V A;  4CHN A;  5KGW A;  4RG8 A;  3S3N A;  3KK2 A;  3HZ6 A;  3SUQ A;  1NLV A;  4BR0 A;  3NE6 A;  2HHV A;  3LP3 A;  2W6L A;  2HW3 A;  3VET A;  4BWJ A;  1N33 K;  1IG8 A;  1HQU A;  3FGU A;  2XY8 A;  3G25 A;  3KLI A;  2NNW A;  5AZJ B;  3L2W A;  1EQY A;  2OPQ A;  1WAF A;  2P9L A;  4N47 A;  2FBY A;  4Z4F A;  3EO3 A;  4J8F A;  5EVZ A;  3U3Y A;  4JAX A;  3NMU A;  1GLD G;  1NGC A;  5HOO A;  3PV8 A;  3IFR A;  3K58 A;  4YOR A;  2QWL A;  3A0I X;  1GLF O;  3AVH A;  4XH5 A;  4DV5 K;  4FK4 A;  4DV7 K;  3A8Y A;  4RWT A;  3QBW A;  3VA3 A;  3KWI A;  3C6A A;  3SPZ A;  2RN2 A;  1I39 A;  4CFD A;  4O0J A;  3L2R A;  4BR4 A;  1VQ5 N;  1HUX A;  3SBT A;  5BR8 K;  1WAJ A;  2GEM A;  3VQ7 A;  2O8F B;  2E2P A;  3E9L A;  3CD6 N;  1VRT A;  1YXQ A;  4CHQ A;  3T3F A;  5DK5 A;  4FOI A;  3AVK A;  1RBV A;  5LY3 A;  1RTD A;  5HRN A;  4DTR A;  1VQM N;  5M1K A;  1JLE A;  5JMV A;  1D9D A;  3WNH A;  4FZY A;  4I9L A;  2IS3 A;  5AQM A;  2KFZ A;  4XEI A;  4PKG A;  1X1P A;  1EWQ A;  3HL8 A;  2FXU A;  3CPE A;  4CZE A;  3QIO A;  4W5O A;  1C0T A;  4YFU A;  3OYH A;  4DF4 A;  3ZSX A;  1KVB A;  4H5T A;  3ZT3 A;  4RW6 A;  2ZGZ A;  4CF8 A;  4B8A B;  3HVR A;  1NK9 A;  3GDQ A;  3EKS A;  3QET A;  2YNF A;  3SAH A;  1SL1 A;  3PSI A;  4FYD A;  5J1E A;  3LDP A;  1S3X A;  1LW2 A;  2GTD A;  2UUC K;  4DV3 K;  4JEP A;  3H1V X;  5AQJ A;  4PL7 A;  3L2Q A;  3QLH A;  2BGG A;  4CZF A;  2BH1 A;  4BRO A;  2WBN A;  4CJE A;  2WTU A;  1KC8 O;  5FPD A;  3HXM A;  1ILY A;  4BRE A;  3B8A X;  3KKR A;  4Q0B A;  5AQN A;  5LMN K;  1NKE A;  4KH4 A;  1VQP N;  3VGK A;  1XC3 A;  4CFB A;  3NVK A;  3LAL A;  4GKK K;  4QS9 A;  3OYA A;  1W9H A;  3DXM A;  2RHK A;  1S9G A;  4OLB A;  5AQU A;  1DEJ A;  2BE2 A;  4IFY A;  1SKS A;  1S1T A;  3U6F A;  3BF1 A;  4KHP K;  3VGM A;  3OYF A;  2D5R A;  4CER A;  3QEX A;  2HBJ A;  4GY2 B;  3C65 A;  3MN5 A;  3AVL A;  3I56 N;  1HPZ A;  3NF7 A;  4MDB A;  3ZET A;  3L4Q A;  4EAH D;  4ILG B;  3AVI A;  3CCM N;  4H0Y B;  4O5F A;  3K5O A;  2D0B A;  4W5N A;  4UY8 O;  2P9N A;  5C2D A;  4BRG A;  4B9L A;  3ID6 A;  1IV0 A;  2NRX A;  4V19 S;  2Y1I A;  1NK8 A;  3L3U A;  4MO5 A;  4FJH A;  3WEE B;  1MWK A;  3ATU A;  4Z0U A;  4CEE A;  2VCP A;  1SKW A;  1EKE A;  4DUZ K;  2CGK A;  1WSF A;  4KBO A;  2ASP A;  2DFF A;  3M8P A;  5EY4 A;  2P51 A;  3ZSO A;  1IO2 A;  4NLC A;  3EL2 A;  4G1Q A;  1RDU A;  4H0O A;  4RTF D;  1Q7Y O;  3V9U A;  4CE9 A;  4DWI A;  4BE0 A;  2ASM A;  3IG1 A;  4F3T A;  1QTM A;  5AQL A;  1HJO A;  2FBX A;  3O80 A;  3H45 C;  3OYD A;  3TSP A;  4JKA A;  3HP6 A;  1N34 K;  1QVG M;  4M7Y A;  4RW8 A;  1HNW K;  2FBV A;  3EZW A;  4NCG A;  5GAE P;  2YHX A;  1NGF A;  1L3V A;  1LV5 A;  1UWB A;  3G10 A;  4EFH A;  5M1O A;  3L6Q A;  3OW2 M;  3CQX A;  3ULE A;  1C1C A;  1CXQ A;  5CE3 A;  2RE2 A;  4DCH A;  3A5L C;  4F2R A;  1VSE A;  4CHP A;  1OKJ A;  5KQD A;  3AGK A;  2YHA A;  1NMD A;  5JLH A;  2QWR A;  3EYZ A;  1ATS A;  1E3M A;  4PUO A;  1Q81 O;  3TAE A;  3GBT A;  1XWL A;  4FM0 A;  5TKW A;  1M90 O;  3NGI A;  3QB0 A;  5JVG L;  4BE1 A;  1K8K B;  1NU0 A;  1XI1 A;  2BDP A;  1WN7 A;  1KAX A;  1T03 A;  1XMQ K;  2AA4 A;  1BL3 A;  3CIP A;  1JLC A;  3NFA A;  4CF9 A;  1TKX A;  3C6H A;  2KZM A;  1UA0 A;  3BGR A;  3PX4 A;  4NCB A;  1VHX A;  2GUP A;  3KIO A;  3RMB A;  4K41 A;  4W5R A;  4RW4 A;  3LM2 A;  5DMR A;  4E19 A;  1VQK N;  3GE1 A;  1T6D A;  3WXM B;  3U3G A;  2G8U A;  4M3U A;  4O4G A;  5C2F A;  4YHH K;  2QKK A;  2V51 B;  3HOT A;  4BE2 A;  4KAZ A;  5EXW A;  5BPL A;  4FWP A;  1HKC A;  2PYJ A;  1K6Y A;  3R1X A;  4DR4 K;  3A5O C;  4N5S A;  2HMP A;  3IDH A;  5GIO A;  5FPE A;  2DTU A;  2E6M A;  2KW4 A;  4O55 A;  4WQ4 C;  1RT2 A;  2ZE2 A;  3AO5 A;  4H5V A;  4MFB A;  4B9U A;  3OS1 A;  2O8B A;  3E9P A;  2E8A A;  3C6T A;  1U45 A;  1T6C A;  2G8F A;  4X65 K;  4WQ5 A;  2A40 A;  3ENO A;  1BUP A;  4Z94 A;  5EU7 A;  4JK9 A;  3MN9 A;  4CVN E;  4WFB L;  2JWL A;  4CJS A;  1HKG A;  3SV3 A;  2PFU A;  2QA4 N;  4ISF A;  4DSK A;  4GV6 A;  1JL2 A;  1BOT O;  3AAQ A;  1N8R O;  5C0Y A;  4Z4I A;  3VQ5 A;  5K14 A;  4O5B A;  4X62 K;  4FJ7 A;  4FWK A;  4F2S A;  5BR9 A;  4K8Z A;  2HND A;  1RT3 A;  4DFM A;  4FXD A;  4IJN A;  2NLX A;  3SUO A;  1RT6 A;  5FRN A;  5AZJ A;  3P1G A;  3LPU A;  1RBT A;  3CCL N;  2VQE K;  1IG9 A;  2KLA A;  4QCL A;  1WBD A;  4IKF A;  3TAF A;  4DG1 A;  5CZ1 A;  4H0P A;  3D2F A;  3AAP A;  2NRH A;  2Q2R A;  2O4I A;  4QAG A;  4PY5 A;  1ZYQ A;  4DQI A;  4HHT A;  4KI6 A;  2O8F A;  3K59 A;  2O8E B;  4BVP A;  1NGD A;  3LDL A;  3MK6 A;  4FLX A;  2VWB A;  3CM6 A;  5AQS A;  4ZTF A;  1YVU A;  4WFN L;  3NF8 A;  2FSJ A;  4OKJ A;  3SCX A;  2GWJ A;  4DTX A;  4FJ9 A;  3K2P A;  3S3O A;  1XC9 A;  4LSN A;  2DY4 A;  5AQY A;  4CHY A;  3KK3 A;  1JL1 A;  2XY5 A;  1NG9 A;  1HR0 K;  4CZI A;  4DV6 K;  2BUP A;  1VQ8 N;  4B3S K;  1BDG A;  5H1S Q;  1IKX A;  4KPY A;  3IS9 A;  3IUC A;  3S3M A;  1R0A A;  4CJR A;  1P8Z A;  3DLG A;  3SQ1 A;  2ATQ A;  4ELV A;  1GLA G;  4CW7 B;  4YOU A;  4QS8 A;  4HWI A;  1GOB A;  4FPA A;  3LDS A;  3JSM A;  3I8D A;  4JLH A;  5CYQ A;  3V9S A;  4FLY A;  4NXN K;  4GNI A;  1TK5 A;  1J9A A;  3MWT A;  4CGH A;  3D2E B;  3OYM A;  3TAP A;  2OTL N;  2KZZ A;  1Q82 O;  4QS7 A;  3A5N C;  4JHD B;  4KO0 A;  4RW9 A;  5FDL A;  4JI2 K;  5FPM A;  1BA0 A;  3LAN A;  3RR8 A;  1JLA A;  4FWR A;  3O08 A;  3AVC A;  1VSH A;  3SMS A;  4B1Z A;  2F9W A;  2HHX A;  3HBT A;  4K8X A;  1CZA N;  4E1J A;  4FSV A;  3ZX2 A;  3C6U A;  4CHZ A;  2IVN A;  3VQ4 A;  3K5L A;  3RMC A;  2G8H A;  1JJ2 M;  3QEV A;  1XNQ K;  3RTV A;  1GLL O;  3HO1 A;  3CCE N;  3JAM O;  4LF5 K;  1RTH A;  3OJS A;  3LWL A;  1RNH A;  1C1B A;  1JCF A;  1RT1 A;  3O4Q A;  2A42 A;  1RCH A;  3MCA B;  4KHW A;  2ETJ A;  4CF1 A;  4BDZ A;  5FPN A;  4FJI A;  2X78 A;  2P9P B;  3CCU N;  3AA4 A;  3RMD A;  3ZYY X;  3PO5 A;  4E7I A;  3H46 O;  1M1K O;  4DF8 A;  3AGR A;  2QEX N;  1BO5 O;  2PYL A;  3D45 A;  4BC3 A;  3WEE A;  4HCC A;  2IGI A;  3OHR A;  5AQR A;  1HYZ A;  1XNR K;  4KH6 A;  4EZ6 A;  4B1U B;  1VSF A;  3H3O B;  4CF0 A;  4LF8 K;  1NGI A;  2PBD A;  3O5B A;  1LAW A;  3TAM A;  3DI6 A;  3RRH A;  3EZ5 A;  1Q8I A;  1HNZ K;  3DOL A;  1J54 A;  3IKM A;  4WCE L;  5ADX A;  3DWL A;  3O3G A;  1NGG A;  3LDQ A;  2YNI A;  5CY4 A;  3OS0 A;  4CF2 A;  3CQ8 A;  4GMJ B;  2E1Z A;  2O8D B;  2PAV A;  1TKD A;  3NGZ A;  2NRZ A;  4KRE A;  5C42 A;  3DM2 A;  3FZF A;  2V7Z A;  3OBY A;  1S6Q A;  3VQD A;  4E89 A;  1BCO A;  5KPZ A;  1J6Z A;  2H3G X;  3ZT2 A;  4DU3 A;  4KI4 A;  2ASO A;  1U49 A;  1RGI A;  2HHW A;  2QW9 A;  3RSE B;  2XY7 A;  3AAR A;  3OYK A;  4BG8 A;  4DQS A;  3ATV A;  3C94 A;  4M3X A;  4B9M A;  3KHY A;  1RTI A;  3BZC A;  4AH9 A;  3DYA A;  4JKF A;  2W40 A;  4FJ5 A;  4FWM A;  4AF1 A;  3VEV A;  4R79 A;  1NK4 A;  3NBP A;  1LAV A;  4DR6 K;  4BRH A;  2HNY A;  1W7A A;  3SAG A;  3Q7B A;  1T3V A;  2A41 A;  3THX A;  3IRX A;  5KRS A;  2F7T A;  1A5V A;  1KQS M;  2RPI A;  3MXJ A;  4NYN A;  4E7L A;  3WXI A;  4M41 A;  1YTU A;  5AQT A;  4X66 K;  4DTM A;  3TAQ A;  4FJJ A;  1KVA A;  2W41 A;  3LPT A;  3WQT A;  1UOC A;  1K8K A;  3HTV A;  3MXI A;  4Z4H A;  3NF9 A;  2E1Y A;  1WSJ A;  4J2A A;  3VQQ A;  3M1F A;  4CZM A;  2OA8 A;  4IOX A;  3RWU A;  3N4Q A;  3KJV A;  4H5N A;  4O0I A;  1DKG D;  3O1W A;  3VQ6 A;  4I7F A;  2E88 A;  3FZK A;  4B9Q A;  5F1X A;  3ZT4 A;  5BN8 A;  4GV9 A;  2Q0R A;  3DXK B;  3LWM A;  3HK2 A;  3Q7C A;  3J7Z O;  4C1N I;  2E6L A;  4CEF A;  1IJJ A;  2VQF K;  3PO4 A;  4I2Q A;  3J7A P;  4IEI A;  2VGN A;  5DM7 L;  4DV1 K;  1P90 A;  2OZS A;  3ZCM A;  5CYM A;  2YJE A;  4DTS A;  3ZX0 A;  5JIC A;  1XHZ A;  3AA2 A;  4BGA A;  4O44 A;  1Z05 A;  3TAR A;  1JXB A;  3L4I A;  5BPN A;  4KTQ A;  2DPN A;  3G4S N;  3AO1 A;  3U9D A;  1BWF O;  4CHO A;  2XHB A;  1OH7 A;  1S22 A;  2O8C A;  1CZB A;  3ENH A;  4Z4G A;  4B1Y B;  3VOV A;  4DR5 K;  2X6S A;  2R7Y A;  3BF3 A;  2QM1 A;  3G0Z A;  1RT5 A;  4IEE A;  4WF9 L;  4FLT A;  3PY8 A;  4HTL A;  4JI8 K;  2UXC K;  4OX9 K;  4YDU C;  2I5J A;  4OVL A;  3MMV A;  1XUP O;  3KLF A;  3VEZ A;  1N36 K;  4CJF A;  1B9F A;  4FLU A;  3KD1 E;  1GOC A;  1Z6R A;  4WQ5 C;  4FVM A;  4K0K K;  3VEX A;  2FC0 A;  1SL2 A;  4EP5 A;  2XO7 A;  4HUE A;  4DHY A;  2OAN A;  3TU5 A;  3NGY A;  3THW B;  3OA9 A;  4CBW A;  3OY9 A;  2CGL A;  5AZI B;  3AO4 A;  3ALY A;  3QIC A;  2ZF5 O;  3ISN C;  2F96 A;  3CC2 N;  2VG7 A;  1Q9Y A;  5IWA K;  3FZM A;  4CD3 A;  4JS4 A;  3OYE A;  4FK0 A;  3CCV N;  4C8M A;  3KD5 E;  1YF5 L;  3ZSV A;  3G6E N;  3FFK B;  2O4G A;  4ZTJ A;  4NYF A;  4F9O A;  3E9O A;  3EKU A;  1I3A A;  1NJI O;  3L0Q A;  5I42 A;  3M8R A;  3ASM A;  3TAN A;  1A5W A;  3ZSZ A;  2D4W A;  1YJW N;  4A5B A;  1QSY A;  3VN5 A;  4OGC A;  4HTU A;  3VEO A;  4LFA K;  3LP2 A;  4A62 A;  4W5Q A;  2VWK A;  2JLE A;  4HCB A;  3O4N A;  3F5T A;  4IG0 A;  4YOW A;  1WBB A;  3H6E A;  4DV4 K;  4CJ4 A;  2FBT A;  4KHN A;  3HT3 A;  2JGU A;  4CJK A;  4IO9 L;  4F4K A;  1QSS A;  3F73 A;  4YOY A;  5AQG A;  3CF5 L;  4NLB A;  3ITH A;  3HYF A;  5M1N A;  4ID1 A;  1F21 A;  4BQL A;  4AM7 A;  1FJG K;  4NCA A;  4BR5 A;  5BRF A;  1N5Y A;  1OVY A;  4CFC A;  1QHT A;  1TAU A;  3CFP A;  3AVF A;  4EP4 A;  1DGK N;  3QIN A;  4GV3 A;  1XHX A;  1RFQ A;  3V1R A;  5M1P A;  1BCM A;  5HRP A;  4NXM K;  4MDA A;  1X3M A;  1HQE A;  4ELT A;  3E66 A;  2QTD A;  1NJZ A;  2UU9 K;  3CFO A;  4JRQ A;  3EN9 A;  3AO3 A;  1RDW X;  3SUP A;  1WSG A;  4I6M B;  1TYQ B;  3GG4 A;  3QO9 A;  4JKE A;  1V4T A;  4OPK A;  5TKY A;  4OO1 J;  3HSC A;  3CJ7 A;  1WB9 A;  3AO2 A;  4R5P A;  3CCS N;  1D4X A;  3P5J A;  1EET A;  2Q0U A;  5GAG P;  4JHD A;  1JCE A;  4M3W A;  4A5A A;  1X9M A;  3V4I A;  1J5E K;  4LC9 B;  4FW1 A;  2D0O A;  3S41 A;  4M3Z A;  3C7N B;  4FM2 A;  2YHY A;  1HLU A;  3WT0 A;  1NWK A;  4FWQ A;  4CGI A;  4OPJ A;  4J2D A;  4CK3 A;  1EWR A;  3QER A;  1KSP A;  4F8R A;  4B9V A;  3KLH A;  2NZT A;  3BEX A;  1BU6 O;  4H5W A;  1KLM A;  5FRO A;  4BRA A;  2Q36 A;  1BG3 A;  4PL8 A;  3PIP L;  4DR3 K;  3OYN A;  4JNE A;  4U67 L;  2P9U B;  1ESV A;  1E4F T;  2P9P A;  4PQU A;  3TPQ A;  2Z1I A;  4B9N A;  3FZH A;  1D9F A;  1ZBF A;  3MCP A;  2CGJ A;  1WNS A;  4CI6 A;  2OPP A;  2YNH A;  4DU4 A;  4C8N A;  4EHT A;  3HPH A;  1BIZ A;  3HP9 A;  1KFD A;  4JKD A;  1MWM A;  1O13 A;  3VQP A;  1R59 O;  2QKB A;  4AHU A;  4H4M A;  3O6W A;  1ATR A;  3MEE A;  2HNZ A;  4FZZ A;  4BRF A;  1NGJ A;  4BRN A;  4DU1 A;  2P9L B;  5ADX H;  3H08 A;  1DTQ A;  5LMU K;  1XMO K;  1DLO A;  3O9T A;  1BHL A;  1ASV A;  1QQN A;  3R9P A;  5GIN A;  2O8D A;  3NH0 A;  3OBW A;  1BIS A;  3VQA A;  4M3Y A;  1KD1 O;  3WQU A;  3C0B A;  1RDC A;  4QOZ B;  1RDB A;  2DFH A;  2IAJ A;  5J2M A;  4AM6 A;  4B9S A;  1U48 A;  2E20 A;  4DTU A;  4GVM A;  2P1J A;  1X9W A;  1REV A;  4JKG A;  3THV A;  2XY6 A;  3AA3 A;  4WFA L;  4FVU A;  3VEY A;  3SQ4 A;  1S1V A;  5B8H A;  4YNQ A;  5KPR A;  4OPH A;  1TAQ A;  4DKW A;  2VG6 A;  1TUU A;  3VQ9 A;  5BPM A;  4KH5 A;  3CM5 A;  4CJP A;  3K5M A;  3SYZ A;  3I0R A;  2FF6 A;  4FWS A;  2IOC A;  2OTJ N;  1QHA A;  1SQK A;  5JLF A;  3SAF A;  3CC4 N;  3TSU A;  5A2Q O;  3HI0 A;  3VEW A;  4BG9 A;  4AQY K;  4IJA A;  4B8C A;  4JI6 K;  4B3O A;  3E01 A;  2E2O A;  1UA1 A;  4J2B A;  3QFU A;  4I2P A;  1VRU A;  4HUG A;  4FJL A;  1MU2 A;  2YHW A;  1YJN N;  3EY1 A;  3KTQ A;  1X3N A;  1BI4 B;  2IVO A;  1N6Q A;  4FJM A;  1B92 A;  3UIQ A;  3B6P A;  3DXM B;  4FM1 A;  4FJG A;  1VSM A;  4OLA A;  3DXK A;  4UQG A;  2V7Y A;  3MN6 A;  2VWJ A;  2W6K A;  1NK5 A;  3RVC A;  5C24 A;  3MXM A;  4CZG A;  2GUI A;  5AQX A;  3CHW A;  4FZX C;  5HBM A;  4YY3 K;  5HRR A;  3AVN A;  2ZQB A;  3HJF A;  1VSK A;  4KHY A;  2Q97 A;  4JI0 K;  2HBK A;  2OPS A;  4N41 A;  3P83 D;  2J4R A;  1FKO A;  3TWH A;  1EO1 A;  4E1M A;  5AFU A;  3V6D A;  4K42 A;  2EX3 A;  4LFB K;  4BY9 C;  3GL1 A;  3VMF B;  3K5N A;  4BRC A;  3TAG A;  4WYB A;  4Y1D A;  2B5J A;  5AQP A;  4CEC A;  2XRI A;  3ZLJ A;  5AQZ A;  2ITG A;  3D6R A;  3KZB A;  2YI1 A;  3P38 A;  2WON A;  1Z26 A;  1C1A A;  3CXC M;  2ZD1 A;  3PUF A;  4E3S A;  1SS6 A;  2G8I A;  5GAD P;  4DSL A;  3J7Y P;  4FWL A;  3LM9 A;  1EP4 A;  4KHS A;  4IDK A;  4OKK A;  4FJX A;  1KRP A;  3VQC A;  3LAK A;  3UB5 A;  4M3T A;  1HJR A;  2P9I B;  4CJ7 A;  1KAY A;  4C8K A;  4FOE A;  3TAB A;  3F2K A;  2NRV A;  3O8M A;  2QK9 A;  2ZM6 K;  4Q5V A;  2HOE A;  4DTO A;  1QQC A;  5KGX A;  3FLC O;  4FWN A;  5CHI A;  4CGJ A;  4B08 A;  3CCQ N;  2Q31 A;  4BC4 A;  5LL6 Z;  3QES A;  3IMX A;  4MLE A;  2FF3 B;  3L3V A;  4Y1C A;  3ULD A;  4L8R B;  1TGO A;  3LL3 A;  4IDH A;  1YVN A;  1NM1 A;  3LZJ A;  4H4O A;  4PKI A;  4RCH A;  4CD1 A;  3THY B;  4H8K A;  3ULE B;  4ISG A;  3OVN A;  3OYL A;  1ZBH A;  2EHG A;  3MN7 A;  4CIE A;  3MWP A;  1D8Y A;  3AVM A;  1N32 K;  3DRR A;  4IXC A;  3SI6 A;  3DAW A;  1MDU B;  4GVE A;  5C10 A;  4ELU A;  2HHH K;  3K9J A;  4DR7 K;  3VF2 A;  3WXK A;  2FLO A;  3VQB A;  5KPT A;  1E4G T;  2HVI A;  3MED A;  4DLE A;  2NRR A;  2HF3 A;  3O1B A;  1LWE A;  5AR0 A;  1C0F A;  4JD2 B;  3RMA A;  4ICL A;  4Z4E A;  3K9K A;  5AQO A;  3NHG A;  1VSL A;  5J2N A;  5E84 A;  2AJQ A;  2HHQ A;  3TI0 A;  4IOC L;  1KTQ A;  1TL3 A;  3D0P A;  4LH5 A;  2HHS A;  3M5R A;  1EXQ A;  4Y0W A;  1Q18 A;  1JKH A;  1NBW A;  2Z1J A;  4MLH A;  2E2Q A;  4JYA K;  3OYJ A;  1CXU A;  4CJU A;  3K0S A;  1LWF A;  3V1O A;  2YNG A;  4I6M A;  4DFK A;  1VSD A;  3H1Q A;  4M45 A;  1HKB A;  4CEQ A;  3HRG A;  2F8S A;  4CZH A;  1ZXO A;  3DLK A;  3FZL A;  3WXL A;  3TTD A;  2NRT A;  4CGG A;  4CJW A;  4DQQ A;  3I8B A;  3H3N O;  3VPZ A;  1BQM A;  1OH5 A;  4KRF A;  3NCI A;  1T44 A;  3EE9 A;  4AIL C;  5HP1 A;  4GKJ K;  4DFP A;  4IO8 A;  3R6M A;  1WLJ A;  4DSF A;  2ZWH A;  4DMN A;  4BQZ A;  1VQO N;  3ZEU B;  4Z4C A;  5HL7 L;  5I9E B;  5BN9 A;  2IC3 A;  2X6N A;  2O8B B;  3D7E O;  2A1S A;  2DFE A;  4A2B A;  3DOK A;  1ASU A;  2KFN A;  3M8Q A;  4OJR A;  1ITG A;  3A2F A;  4XH4 A;  3V9W A;  4JI1 K;  3T1H K;  4E7K A;  3EE8 A;  1HNV A;  2QWN A;  3MX2 A;  1XQS C;  2IIR A;  1O1W A;  4RW7 A;  3QEW A;  4H0X B;  4C8L A;  3FFI A;  3UKR B;  3GOI A;  4DB3 A;  2UUA K;  3AVA A;  3LZI A;  4J2E A;  1JLF A;  5M1Q A;  3J8A A;  3OJU A;  4B1W B;  4PWD A;  2CH6 A;  1VQ9 N;  2WFB A;  5J2P A;  4BRI A;  3TTC A;  4MQ3 A;  4FK2 A;  3CME N;  3NAE A;  3QEP A;  4A2A A;  3O3F A;  3KLG A;  3SQ2 A;  4DQP A;  1TK0 A;  5ELZ A;  3BY5 A;  1LW0 A;  1VAZ A;  5AQW A;  2X74 A;  3JYT A;  1K73 O;  1ASW A;  3U8X A;  1IBM K;  3U9Z A;  3D2F B;  3V9Z A;  4CJT A;  1Z25 A;  1YI2 N;  1YHQ N;  1NGE A;  4FO0 A;  4FJK A;  3FR0 A;  3O3H A;  3R8E A;  2NUB A;  3ENB A;  2I7P A;  4IG3 A;  2UUB K;  2OPR A;  3N4P A;  1NK0 A;  1NK7 A;  2P5O A;  2BAN A;  4HUF A;  4C1N K;  2OCE A;  4FPB A;  3VF6 A;  3K57 A;  2G8W A;  4E7J A;  2UYT A;  3R3L A;  2HMI A;  2VYP A;  3CMA N;  4AHS A;  1TK8 A;  1GLE G;  5JVH L;  2JWK A;  4A57 A;  4B1X B;  3HOS A;  1IBK K;  4LF7 K;  1VQ6 N;  3DLB A;  3CG7 A;  1U2V B;  4AHR A;  3E1Y A;  3HST B;  4L3Q A;  1BIU A;  1GLB G;  1Y64 A;  3TSQ A;  2QI2 A;  1W0H A;  1ZBI A;  5JS2 A;  1J53 A;  5KQ8 A;  5AQK A;  3B6O A;  2LSN A;  5BRD A;  4M7X A;  4PA1 A;  4DQR A;  3KVG A;  4DSE A;  2VG5 A;  3IAY A;  1KFS A;  3CER A;  2E5L K;  4N76 A;  1QSL A;  4JKH A;  2HB5 A;  2G8K A;  4CGF A;  1V4S A;  4CBX A;  2EWS A;  1DT9 A;  4CGD A;  1YAG A;  4HVJ A;  5AJ3 K;  4FLZ A;  4JV5 K;  1IKW A;  5CZ2 A;  1BI4 A;  1K9M O;  1VSJ A;  4ILJ A;  5J2Q A;  5AQF A;  1QQM A;  1SV5 A;  4JI3 K;  1QQO A;  3AV9 A;  1S72 N;  1U47 A;  3UKU B;  1JLB A;  3VTI A;  3VTH A;  2KTQ A;  4CJ5 A;  1FKP A;  2O8E A;  5BRH A;  3BDP A;  3T7Z A;  2QWQ A;  1SAZ A;  5SZT A;  5E26 A;  1S6P A;  1HPM A;  1YUW A;  2WUS A;  5HLF A;  4X64 K;  3EEQ A;  1IH7 A;  3MX5 A;  2RKI A;  3L2U A;  5EOY A;  1WSH A;  1T8E A;  5AFU H;  1NJX A;  4CZL A;  4JRP A;  1A5X A;  1VK0 A;  3P39 A;  4LD0 A;  3F9M A;  3L8B A;  1GOA A;  4AHT A;  1YIJ N;  2E2N A;  3WNE A;  4BR7 A;  1HYS A;  3BP8 A;  1D5A A;  4M63 C;  4LH4 A;  3PX0 A;  3TTF A;  4CIG A;  3V9X A;  3SQ0 A;  1L5U A;  2GX9 A;  3SNN A;  4M42 A;  3VGL A;  1C0G A;  2YKN A;  5AQI A;  3SMP A;  3O4W A;  4JN4 A;  1C0U A;  3D2E A;  3QIP A;  4KB0 A;  5I3U A;  1NGH A;  1RT4 A;  4IFE A;  1JXE A;  1TKT A;  3DLH A;  4IBN A;  2D1K A;  5GIP A;  4DSI A;  1RBU A;  3NDK A;  2P9I A;  2OYQ A;  2QXF A;  4WE1 A;  3DRP A;  1RDA A;  4DSJ A;  3ZSY A;  5C12 A;  1NMN A;  4W5T A;  2P9K B;  1SZ2 A;  4H0T B;  2F8T A;  2F9T A;  2HBL A;  2P9S B;  1TVR A;  3SLC A;  4KKO A;  3CCJ N;  3AVG A;  4DS4 A;  1ATN A;  4CJQ A;  4BRL A;  4YOT A;  4JKC A;  1QS4 A;  1NJW A;  3HVT A;  1NNE A;  4LF9 K;  3M6G A;  4EIA A;  1JLG A;  2BTF A;  2KKZ A;  3DRS A;  3THY A;  4JK7 A;  5HRO A;  3ZSQ A;  1NKB A;  3AVJ A;  2E4L A;  3ZT1 A;  2GEL A;  3QBX A;  3THX B;  4DUY K;  3ZSW A;  3C95 A;  3RR7 A;  4XH1 A;  1S9E A;  1LCU A;  4JI5 K;  3HM8 A;  3ZSR A;  4BRD A;  1NOZ A;  3LDN A;  1J5O A;  4CEA A;  4KHQ A;  3KLE A;  3HM9 A;  4A61 A;  4JD2 A;  4ZHR A;  3F9K A;  1ZBS A;  3NH1 A;  3JXU A;  3SZ2 A;  4KHU A;  4NB4 A;  4C8O A;  1HYV A;  3CCR N;  1VQ7 N;  1ZBL A;  1U04 A;  3QNO A;  1S1U A;  2B6A A;  4EHU A;  4DR1 K;  4CK2 A;  1QE1 A;  5AQH A;  3T69 A;  1SKR A;  4IOA L;  1ZC6 A;  4AHV A;  2YCH A;  5T7B A;  3QEI A;  4E0D A;  1VSI A;  1VQ4 N;  1BQN A;  2GBZ A;  3WNG A;  2KQ2 A;  1YJ9 N;  1S5J A;  4NO7 A;  4BGB A;  3CET A;  4FW2 A;  4CCH A;  3V1Q A;  2KHO A;  5IT9 O;  1KCF A;  1X9S A;  1CLQ A;  3A5M C;  3O9S A;  2ZGY A;  3RSE A;  4KFB A;  4YOX A;  2A6A A;  3V81 A;  3O9R A;  2YKM A;  4IWV A;  2VGM A;  4JKB A;  3KK7 A;  5JS1 A;  2HST A;  1NGA A;  4BR9 A;  3SPY A;  4OKE A;  1NKC A;  4B9T A;  4DFJ A;  4I9Q A;  3ZEU A;  4GW6 A;  1WSE A;  1WUA A;  3CJB A;  4YDU A;  3VF4 A;  4DQ8 A;  3OYG A;  1W2B M;  2ZJQ L;  1HX1 A;  4CZJ A;  1ZBU A;  3O9Q A;  1MA9 B;  1X9J A;  2P5G A;  4LFC K;  4FJ8 A;  4DTN A;  1SL0 A;  1KVC A;  3TR8 A;  2O8C B;  1G99 A;  2D0A A;  1HNI A;  3O9U A;  5EX5 A;  1GLJ O;  3SJH A;  2WOM A;  1NJY A;  3LP1 A;  3OYC A;  1HNX K;  4BWM A;  1KAZ A;  2GV9 A;  3UKR A;  1BGX T;  4JS5 A;  4BAC A;  4M3R A;  1W97 L;  2IDO A;  1U4B A;  4CES A;  4H5R A;  2B4J A;  3CJ9 A;  3HPG A;  1IKY A;  1OVQ A;  4OGE A;  4E7H A;  2V52 B;  3M8S A;  1HRH A;  3NF6 A;  3L2V A;  5F2R A;  4XIU A;  2UXD K;  1OH6 A;  4U7B A;  4H0V B;  4EZ9 A;  1VQL N;  4CJL A;  2IVP A;  3KWG A;  1DTT A;  4DV0 K;  4O8K A;  3NH2 A;  2HHT A;  3CJA A;  1FW6 A;  3QFP A;  1L3U A;  3WXJ A;  1Y97 A;  3SJJ A;  4LF4 K;  4BDY A;  3HPO A;  1RIL A;  2YX6 A;  3DJC A;  4IFV A;  5FRM A;  3ID8 A;  3W0L A;  1YT3 A;  4PKH A;  2Z1H A;  2ZJR L;  1K8A O;  4E1N A;  4TSX A;  5SWM A;  1YIT N;  3VER A;  3CJC A;  3P4I A;  4ISE A;  2FSN A;  3ZET B;  1I94 K;  1EX4 A;  4O8U A;  2HVH A;  4DS5 A;  3VEN A;  1C6V A;  1RDD A;  3M3Z A;  3VQ8 A;  1QVF M;  4KTW A;  3CJ1 A;  4B3R K;  4BC2 A;  4FLV A;  4BC5 A;  5MLC Q;  4FJN A;  1LOT B;  4DLG A;  2YHB A;  2P9N B;  2QWP A;  2QWO A;  4CZK A;  1U2V A;  4DR2 K;  1NGB A;  1JLQ A;  2PY5 A;  2Q1N A;  1C0M A;  5KTQ A;  1VQN N;  4YOV A;  4JK8 A;  3QNN A;  1HMV A;  4JI7 K;  2Z1G A;  5E41 A;  2A1R A;  4CBU A;  2WC9 A;  3ZX3 A;  4C23 A;  2W42 A;  4CED A;  4ID5 A;  3THW A;  3KK1 A;  3CPW M;  3PSF A;  2I7N A;  3T1A A;  5AZI A;  2YJF A;  3I55 N;  3VA0 A;  3PX6 A;  4BDP A;  1IKV A;  3SUN A;  1KXP A;  5KRT A;  3CFR A;  2Y1J A;  3AVB A;  1OH8 A;  1KLN A;  1JCG A;  4N56 A;  4CK1 A;  2AP1 A;  3LP0 A;  3DMJ A;  3MDQ A;  3DLL L;  3P31 A;  3FE1 A;  3DLE A;  3PIO L;  1U6Z A;  1S1W A;  2NRW A;  4DV2 K;  4B3T K;  4G9Z A;  2ITM A;  1TUY A;  1SUQ A;  3KKS A;  1Q86 O;  4B3M K;  4K25 A;  4MO4 A;  3UKU A;  2HHU A;  2OZM A;  5M1F A;  1WSI A;  1L3T A;  5C25 A;  4H03 B;  5C15 A;  1T05 A;  3UE5 A;  3AY9 A;  4LSL A;  4ILH A;  3OYI A;  4A59 A;  1WOQ A;  2HBM A;  3QDK A;  2ZJP L;  3T1Y K;  1G15 A;  2CH5 A;  1TL1 A;  3I0S A;  4BRQ A;  3CI5 A;  4DTP A;  5LJW A;  3CYM A;  4CEO A;  3CQY A;  1TV6 A;  3MEC A;  5BRE A;  1RBS A;  3J80 O;  3PLA A;  3NVM A;  4CJ3 A;  1B9D A;  1IBL K;  3S9H A;  3OS2 A;  2GWK A;  3MEG A;  4CEB A;  3G71 N;  4F3O A;  4LF6 K;  5HRS A;  3SBG A;  5AQQ A;  3JS6 A;  4CIF A;  1RBR A;  3W3D A; 
#chains in the Genus database with same CATH homology
 4AHS A;  1TK8 A;  1IG9 A;  4LY7 A;  4M3Z A;  4QCL A;  4IKF A;  3TAF A;  4DG1 A;  4CFA A;  5D3G A;  4FM2 A;  3DLB A;  3CG7 A;  5CZ1 A;  4AHR A;  4OPJ A;  4CGI A;  3HST B;  1BIU A;  4J2D A;  4CK3 A;  3QER A;  1KSP A;  3AA5 X;  4F8R A;  3LAM A;  1LWC A;  2O4I A;  4B9V A;  3KLH A;  4FLW A;  1RT7 A;  4QAG A;  1W0H A;  4PY5 A;  4KV8 A;  1NK6 A;  1KLM A;  1ZBI A;  4CEZ A;  1ZYQ A;  5FRO A;  4DQI A;  5JS2 A;  1J53 A;  4HHT A;  4DTJ A;  2PZS A;  4KI6 A;  3B6O A;  2LSN A;  3K59 A;  1YTA A;  1Q9X A;  2Q3S A;  3OYN A;  4PA1 A;  4FLX A;  3CM6 A;  5KI6 A;  4DQR A;  4DSE A;  2VG5 A;  1RTJ A;  4PQU A;  4ZTF A;  1YVU A;  2Z1I A;  3NF8 A;  3IAY A;  4B9N A;  1KFS A;  1L3S A;  4OKJ A;  3SCX A;  1D9F A;  1ZBF A;  2G8V A;  3T19 A;  3ZT0 A;  4DTX A;  1CZ9 A;  1TKZ A;  1WNS A;  2OPP A;  2YNH A;  4DU4 A;  1QSL A;  3K2P A;  1UAX A;  4CJV A;  2HB5 A;  4C8N A;  3S3O A;  1XC9 A;  2G8K A;  1FK9 A;  3HPH A;  4LSN A;  1T7P A;  4CGF A;  2DY4 A;  1BIZ A;  4KTZ A;  4CGD A;  4CHY A;  3KK3 A;  1NOY A;  3HP9 A;  1FXX A;  1KFD A;  1JL1 A;  4HVJ A;  4FLZ A;  2XY5 A;  1IKW A;  3VQP A;  5CZ2 A;  2QKB A;  4AHU A;  1BI4 A;  3SV4 A;  1IKX A;  4H4M A;  4KPY A;  3IS9 A;  1S1X A;  1VSJ A;  5J2Q A;  3MAQ A;  3MEE A;  3VQE A;  1SV5 A;  2HNZ A;  2YV0 X;  4FZZ A;  3RRG A;  3AV9 A;  1U47 A;  4DU1 A;  1JLB A;  3DLR A;  3S3M A;  1R0A A;  4CJR A;  4CJ5 A;  2KTQ A;  1FKP A;  3DLG A;  3SQ1 A;  4ELV A;  2ATQ A;  3H08 A;  1DTQ A;  4FCY A;  1DLO A;  3BDP A;  1BHL A;  1GOB A;  1ASV A;  2RF2 A;  4KB1 A;  5SZT A;  5HLF A;  1S6P A;  2D0C A;  3WNF A;  3LDS A;  3JSM A;  3OYB A;  4FJ9 A;  3I8D A;  4JLH A;  1IH7 A;  3NH0 A;  2RKI A;  1BIS A;  4AHC A;  5CYQ A;  4CHN A;  5KGW A;  4FLY A;  3V9S A;  4RG8 A;  3VQA A;  3L2U A;  1TK5 A;  1WSH A;  3S3N A;  1T8E A;  4M3Y A;  3KK2 A;  1J9A A;  4CGH A;  3OYM A;  3TAP A;  1NJX A;  3SUQ A;  2KZZ A;  4JRP A;  1RDC A;  4QOZ B;  1RDB A;  1A5X A;  3NE6 A;  2DFH A;  2HHV A;  1VK0 A;  3LP3 A;  4LD0 A;  2IAJ A;  3L8B A;  5J2M A;  1GOA A;  4KO0 A;  4RW9 A;  2HW3 A;  4AHT A;  4BWJ A;  4B9S A;  5FDL A;  1HQU A;  3WNE A;  2XY8 A;  3LAN A;  3KLI A;  1U48 A;  3L2W A;  1JLA A;  3RR8 A;  4DTU A;  1HYS A;  2OPQ A;  4GVM A;  1D5A A;  3AVC A;  1WAF A;  1VSH A;  2P1J A;  4LH4 A;  4N47 A;  2FBY A;  1X9W A;  4Z4F A;  3U3Y A;  1REV A;  3PX0 A;  2HHX A;  3PV8 A;  4K8X A;  3K58 A;  4CIG A;  3V9X A;  3SQ0 A;  3THV A;  1L5U A;  2XY6 A;  3AA3 A;  3AVH A;  3SNN A;  4M42 A;  4FK4 A;  3C6U A;  4CHZ A;  2YKN A;  3SQ4 A;  1S1V A;  3VA3 A;  3VQ4 A;  3K5L A;  2RN2 A;  3RMC A;  3SPZ A;  4YNQ A;  1I39 A;  2G8H A;  4CFD A;  4O0J A;  3RTV A;  3L2R A;  1TAQ A;  3QEV A;  1C0U A;  2VG6 A;  3HO1 A;  1WAJ A;  3VQ7 A;  3VQ9 A;  3QIP A;  4KB0 A;  1RTH A;  3CM5 A;  3OJS A;  3LWL A;  1RNH A;  1C1B A;  4CJP A;  3K5M A;  1VRT A;  3SYZ A;  3I0R A;  1RT1 A;  4CHQ A;  5I3U A;  3O4Q A;  3T3F A;  1RT4 A;  1JXE A;  1RCH A;  1TKT A;  5DK5 A;  2IOC A;  2ETJ A;  3AVK A;  4CF1 A;  4IBN A;  4BDZ A;  2X78 A;  4FJI A;  4DSI A;  4KHW A;  1RBV A;  1RTD A;  1RBU A;  5HRN A;  4DTR A;  1JLE A;  3NDK A;  1D9D A;  2OYQ A;  3WNH A;  3AA4 A;  2QXF A;  4B8C A;  4WE1 A;  3DRP A;  2IS3 A;  4I9L A;  3RMD A;  4E7I A;  3PO5 A;  3E01 A;  4FZY A;  4B3O A;  1RDA A;  2KFZ A;  4DSJ A;  3ZSY A;  1X1P A;  4DF8 A;  1UA1 A;  3HL8 A;  4W5T A;  4J2B A;  3QIO A;  2PYL A;  4W5O A;  4I2P A;  2F8T A;  1VRU A;  3D45 A;  4HUG A;  4FJL A;  4HCC A;  2IGI A;  1C0T A;  1MU2 A;  4YFU A;  3OYH A;  4DF4 A;  1HYZ A;  1KVB A;  1TVR A;  3ZSX A;  4KKO A;  3EY1 A;  3ZT3 A;  3KTQ A;  1BI4 B;  3AVG A;  4DS4 A;  4CJQ A;  4RW6 A;  1VSF A;  1B92 A;  4CF0 A;  1N6Q A;  4CF8 A;  4EZ6 A;  3UIQ A;  4B8A B;  3B6P A;  4FJM A;  4N76 A;  3HVR A;  4FM1 A;  1NK9 A;  3QET A;  1LAW A;  3TAM A;  1QS4 A;  2YNF A;  3DI6 A;  1VSM A;  3HVT A;  3EZ5 A;  1Q8I A;  3RRH A;  1JLG A;  1NJW A;  4FJG A;  1SL1 A;  4OLA A;  4FYD A;  5J1E A;  3DRS A;  4UQG A;  3DOL A;  1J54 A;  1LW2 A;  2VWJ A;  5HRO A;  3ZSQ A;  1NK5 A;  5C24 A;  3MXM A;  2GUI A;  3L2Q A;  3QLH A;  3O3G A;  1NKB A;  3AVJ A;  2BGG A;  2E4L A;  3OS0 A;  2YNI A;  5CY4 A;  5HBM A;  3ZT1 A;  4FZX C;  4CF2 A;  5HRR A;  3CQ8 A;  4GMJ B;  3AVN A;  3ZSW A;  4CJE A;  3C95 A;  2ZQB A;  3NGZ A;  1TKD A;  1VSK A;  3RR7 A;  4KHY A;  3HJF A;  3HXM A;  4KRE A;  1S9E A;  3DM2 A;  5C42 A;  4E89 A;  1S6Q A;  3VQD A;  4DU3 A;  1BCO A;  3ZSR A;  3ZT2 A;  4KI4 A;  1NOZ A;  2OPS A;  1U49 A;  1J5O A;  4N41 A;  4CEA A;  4KHQ A;  2HHW A;  3KLE A;  3HM9 A;  3P83 D;  2XY7 A;  3KKR A;  1FKO A;  3TWH A;  4ZHR A;  4Q0B A;  4E1M A;  3F9K A;  3NH1 A;  3SZ2 A;  3OYK A;  2EX3 A;  3V6D A;  1NKE A;  4KHU A;  4CFB A;  4DQS A;  3C94 A;  1HYV A;  3K5N A;  4C8O A;  4M3X A;  3LAL A;  4Y1D A;  3TAG A;  1NK4 A;  4B9M A;  1ZBL A;  3OYA A;  1RTI A;  1U04 A;  1W9H A;  2B5J A;  3QNO A;  1S1U A;  4AH9 A;  2B6A A;  4CEC A;  4CK2 A;  3DYA A;  1QE1 A;  2XRI A;  4FJ5 A;  1S9G A;  4OLB A;  2ITG A;  1SKR A;  4AHV A;  5T7B A;  2BE2 A;  4IFY A;  3QEI A;  4E0D A;  4CIF A;  1VSI A;  1SKS A;  2WON A;  2GBZ A;  1BQN A;  2KQ2 A;  1LAV A;  1S1T A;  1Z26 A;  3NBP A;  3WNG A;  2HNY A;  1S5J A;  3U6F A;  1C1A A;  2ZD1 A;  4FW2 A;  3OYF A;  2D5R A;  3PUF A;  4CCH A;  3V1Q A;  4CER A;  3QEX A;  4E3S A;  2G8I A;  3IRX A;  5KRS A;  1A5V A;  2RPI A;  3AVL A;  3MXJ A;  1KCF A;  4NYN A;  4E7L A;  1X9S A;  1CLQ A;  4DSL A;  1HPZ A;  3NF7 A;  4M41 A;  1YTU A;  1EP4 A;  4KFB A;  4DTM A;  3TAQ A;  4FJJ A;  4KHS A;  4IDK A;  4OKK A;  4FJX A;  3AVI A;  1KVA A;  3LPT A;  3K5O A;  3V81 A;  2D0B A;  4W5N A;  1UOC A;  2YKM A;  1KRP A;  3VQC A;  3MXI A;  3LAK A;  4M3T A;  1HJR A;  5JS1 A;  3SPY A;  4C8K A;  4B9L A;  4Z4H A;  3TAB A;  3NF9 A;  4OKE A;  1NKC A;  4FW1 A;  4B9T A;  4DFJ A;  2QK9 A;  2Y1I A;  4I9Q A;  1WSJ A;  4GW6 A;  1NK8 A;  3VQQ A;  4Q5V A;  2OA8 A;  4J2A A;  1WSE A;  3OYG A;  1QQC A;  4DTO A;  3L3U A;  5KGX A;  3RWU A;  4CGJ A;  4FJH A;  4B08 A;  3KJV A;  3QES A;  4Z0U A;  4O0I A;  3L3V A;  4Y1C A;  4CEE A;  1SKW A;  3ULD A;  1ZBU A;  1EKE A;  1TGO A;  4L8R B;  3VQ6 A;  2P5G A;  4FJ8 A;  1WSF A;  4DTN A;  1SL0 A;  4I7F A;  1KVC A;  3TR8 A;  2DFF A;  3LZJ A;  2D0A A;  1HNI A;  3M8P A;  4H4O A;  3ZT4 A;  2P51 A;  3ZSO A;  1IO2 A;  2WOM A;  3LWM A;  1NJY A;  4G1Q A;  3HK2 A;  3LP1 A;  4H8K A;  3OYC A;  3OVN A;  2E6L A;  3OYL A;  4CE9 A;  2EHG A;  4BWM A;  4CEF A;  4CIE A;  4BE0 A;  3V9U A;  1D8Y A;  4DWI A;  1ZBH A;  2GV9 A;  3AVM A;  3IG1 A;  1BGX T;  4I2Q A;  4JS5 A;  3DRR A;  4BAC A;  3PO4 A;  4F3T A;  4M3R A;  1QTM A;  3SI6 A;  2FBX A;  2IDO A;  2OZS A;  1U4B A;  3ZCM A;  4CES A;  2B4J A;  3HPG A;  4OGE A;  1IKY A;  5CYM A;  3OYD A;  3HP6 A;  4E7H A;  4DTS A;  3VQB A;  1XHZ A;  3AA2 A;  3M8S A;  3MED A;  4DLE A;  2HVI A;  1HRH A;  4RW8 A;  4O44 A;  1LWE A;  2FBV A;  3NF6 A;  4NCG A;  3TAR A;  1JXB A;  4XIU A;  3L2V A;  3RMA A;  4ICL A;  4Z4E A;  4KTQ A;  3NHG A;  1VSL A;  5J2N A;  3AO1 A;  4CHO A;  2AJQ A;  2XHB A;  1LV5 A;  3TI0 A;  1L3V A;  4EZ9 A;  1UWB A;  2HHQ A;  1KTQ A;  1TL3 A;  4CJL A;  1DTT A;  3G10 A;  3D0P A;  4LH5 A;  2HHS A;  1EXQ A;  1CZB A;  3NH2 A;  4Z4G A;  2HHT A;  2X6S A;  2R7Y A;  1L3U A;  1Y97 A;  3SJJ A;  4BDY A;  3HPO A;  3G0Z A;  1C1C A;  1RIL A;  1CXQ A;  2Z1J A;  1JKH A;  1RT5 A;  4IFV A;  5FRM A;  4FLT A;  3PY8 A;  2I5J A;  4OVL A;  3OYJ A;  1CXU A;  1YT3 A;  4CJU A;  4F2R A;  3KLF A;  1VSE A;  2Z1H A;  1LWF A;  3V1O A;  4CHP A;  4E1N A;  4TSX A;  2YNG A;  4CJF A;  4DFK A;  1B9F A;  1VSD A;  2YHA A;  4M45 A;  5SWM A;  4FLU A;  1GOC A;  3KD1 E;  3EYZ A;  4FVM A;  4CEQ A;  4PUO A;  2FC0 A;  1SL2 A;  2F8S A;  3TAE A;  3DLK A;  1EX4 A;  4EP5 A;  2XO7 A;  4HUE A;  2HVH A;  4CGG A;  1XWL A;  3NGY A;  4DS5 A;  4CJW A;  4FM0 A;  4DQQ A;  3NGI A;  1C6V A;  1RDD A;  3VQ8 A;  3OY9 A;  4KTW A;  3AO4 A;  1BQM A;  4BE1 A;  4FLV A;  4FJN A;  4KRF A;  3ALY A;  3NCI A;  4DLG A;  1XI1 A;  2BDP A;  4AIL C;  5HP1 A;  1WN7 A;  2YHB A;  3ISN C;  4DFP A;  1T03 A;  2F96 A;  1WLJ A;  2VG7 A;  4DMN A;  4DSF A;  1Q9Y A;  1BL3 A;  4JS4 A;  1JLQ A;  4Z4C A;  1JLC A;  2PY5 A;  3OYE A;  4FK0 A;  3KD5 E;  4C8M A;  1C0M A;  3NFA A;  2IC3 A;  2X6N A;  3ZSV A;  4CF9 A;  5KTQ A;  2A1S A;  1TKX A;  2O4G A;  4ZTJ A;  2DFE A;  4NYF A;  3QNN A;  2KZM A;  1HMV A;  1I3A A;  1UA0 A;  3DOK A;  1ASU A;  3BGR A;  3M8R A;  3PX4 A;  3M8Q A;  4OJR A;  3ASM A;  5I42 A;  3TAN A;  2KFN A;  1ITG A;  2Z1G A;  3A2F A;  5E41 A;  4NCB A;  1A5W A;  2A1R A;  3KIO A;  3RMB A;  3V9W A;  4W5R A;  3ZSZ A;  1QSY A;  4RW4 A;  3VN5 A;  4OGC A;  5DMR A;  4E19 A;  4HTU A;  2W42 A;  4E7K A;  4CED A;  4ID5 A;  3U3G A;  2G8U A;  1HNV A;  4M3U A;  4O4G A;  3KK1 A;  2QKK A;  3LP2 A;  4W5Q A;  4RW7 A;  1O1W A;  2VWK A;  3T1A A;  2JLE A;  4HCB A;  3QEW A;  4BE2 A;  3VA0 A;  3PX6 A;  3O4N A;  4KAZ A;  4C8L A;  4BDP A;  3FFI A;  4IG0 A;  1IKV A;  3SUN A;  2PYJ A;  1K6Y A;  4CJ4 A;  5KRT A;  2FBT A;  3AVA A;  4KHN A;  3LZI A;  3HT3 A;  2JGU A;  4CJK A;  3CFR A;  4N5S A;  4F4K A;  2Y1J A;  3AVB A;  1QSS A;  1KLN A;  1JLF A;  4J2E A;  4N56 A;  2DTU A;  4CK1 A;  3LP0 A;  2E6M A;  2KW4 A;  4O55 A;  3OJU A;  1RT2 A;  2ZE2 A;  3AO5 A;  3DMJ A;  3F73 A;  4PWD A;  5J2P A;  4MFB A;  3ITH A;  3DLE A;  4MQ3 A;  3HYF A;  3DLH A;  4B9U A;  4FK2 A;  4ID1 A;  1F21 A;  3OS1 A;  3C6T A;  3NAE A;  1U45 A;  1S1W A;  2G8F A;  3QEP A;  4NCA A;  1N5Y A;  4CFC A;  3O3F A;  1QHT A;  1TAU A;  3KLG A;  3CFP A;  3AVF A;  3SQ2 A;  4DQP A;  1SUQ A;  4EP4 A;  5EU7 A;  3KKS A;  3QIN A;  1TK0 A;  2HHU A;  1XHX A;  1LW0 A;  3V1R A;  5HRP A;  1BCM A;  2OZM A;  1WSI A;  1L3T A;  5C25 A;  1T05 A;  2X74 A;  1HQE A;  4LSL A;  4CJS A;  3OYI A;  3JYT A;  1NJZ A;  4ELT A;  3CFO A;  4ELU A;  1ASW A;  3SV3 A;  4JRQ A;  3V9Z A;  1G15 A;  1Z25 A;  3AO3 A;  4CJT A;  4DSK A;  1TL1 A;  3I0S A;  3SUP A;  1JL2 A;  1WSG A;  4FJK A;  4DTP A;  3O3H A;  3CYM A;  4CEO A;  2NUB A;  4Z4I A;  3QO9 A;  4OPK A;  3VQ5 A;  5K14 A;  4O5B A;  4IG3 A;  4FJ7 A;  1TV6 A;  2OPR A;  3AO2 A;  4R5P A;  3MEC A;  1RBS A;  3P5J A;  1NK7 A;  1NK0 A;  2P5O A;  1EET A;  2BAN A;  4F2S A;  4K8Z A;  2HND A;  4CJ3 A;  1RT3 A;  1B9D A;  3S9H A;  3OS2 A;  4F3O A;  3MEG A;  4CEB A;  4HUF A;  4DFM A;  5HRS A;  4FXD A;  4M3W A;  3K57 A;  3SUO A;  1RT6 A;  4E7J A;  1X9M A;  2G8W A;  3V4I A;  5FRN A;  3P1G A;  2HMI A;  1RBR A;  3LPU A;  1RBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...