2X7HA

Crystal structure of the human mgc45594 gene product in complex with fenoprofen
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
343
structure length
343
Chain Sequence
IPQAMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Mgc45594 Gene Product in Complex with Fenoprofen
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ZINC-BINDING ALCOHOL DEHYDROGENASE DOMAIN-CONTAINING PROTEIN
total genus 117
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x7hA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2x7hA01
2VNAA 1EVYA 2I65A 4GAEA 2VN8A 3AM3A 3Q0EA 4LN1A 5JCXA 1DLJA 2AW5A 4M86A 5DOVA 3FRJA 3MJ4A 4DGSA 1KY5A 4KUGA 3WICA 4ZN6A 4ZJUA 4CQMD 1TT5B 2RCYA 1C0LA 2YW9A 5THKA 2G82A 3DAPA 2ILTA 4AG3A 3VDRA 4MVJD 4ZD6A 4QQRA 5JDCA 4CQLB 3TJRA 2Z95A 2D0IA 4DC0A 1VPDA 4EI2A 5JW6A 2XXJA 3KOUA 4NQZA 4S3MA 3STHA 3BIOA 4XQEA 3L9XA 2DUWA 4U5QA 4GQAA 3KLMX 5L7YA 2CMDA 4C4OA 3RFTA 3PEFA 4CMIB 1ADCA 2UUPA 3KSZO 3WNQA 1U1IA 4WOKA 5LDHA 4RF3A 4MINA 2E48A 2VHVA 4DA9A 4GPD1 2B37A 4DTIA 3KSUA 4JP3A 1T4DA 3OJ0A 1QG6A 1XQ1A 4II3A 4TVOA 2Q99A 2P9GA 4R3WA 1IHYA 4TVBA 1NFQA 1UDBA 3RD5A 4YYZA 1T25A 1Q1NA 3Q11A 3VAZA 1HSZA 4XWYA 3JQ8A 1HDOA 4JCOA 3V2GA 3AUSA 4FCCA 4HP8A 1WW8A 2IXBA 4YRBA 3EC7A 2GSDA 3O8QA 5LC1A 2OZPA 3WJ7A 1NBOA 3MJCA 3FPLA 1ZH8A 1V35A 2VHWA 5KJEA 2CZCA 3BMCB 5L53A 1WAMA 1R0LA 5DP1A 1RPNA 4J1SA 2JD0A 2PKQO 4IDAA 4I9NA 1QLJA 1EFLA 5KKCA 5IDWA 1C3VA 3G49A 5MGBA 1EMDA 1DOHA 2DFVA 3C1OA 2VZ9A 3TFQA 4Y98A 1YQGA 1TI7A 5TGDA 4ND4A 3DZFA 2EW8A 3B1FA 4MIEA 4FFRA 3GPDG 1UP4A 3AI2A 4RVHA 4GKBA 4CV2A 1X7DA 3K92A 1K5HA 3NGLA 3WGHA 3OICA 3ASVA 3MJVA 4YA6A 4MP8A 2BKAA 4BL5A 3GNQA 3P2OA 3C7CB 3VH1A 4K26A 1NX6A 1NXQA 3PYMA 1EFKA 1P1JA 1U9JA 1DAPA 3VVBA 3DC2A 2NADA 1BGVA 4FFOA 4L74A 2FPPA 5THQA 2NTJA 2NWQA 2CFCA 5F1KA 2C54A 4R16A 3OA0A 4E3ZA 4DUPA 1E3LA 3R1IA 3N7UA 1HDCA 3W8DA 1E1NA 1K6IA 3JQGB 3ASUA 2WEKA 4Q3BA 4BMNA 3DMYA 3WYEA 3B20A 3H6KA 4IZIA 1PL8A 5L4LA 2WE7A 2YYYA 4E4YA 3AM4A 3WQQA 1E3JA 4ZGWA 2P68A 4RORA 3EY4A 1E7WA 4GVXA 2RHRA 2X9VA 1GD1O 4WECA 3WGYA 5EINA 2X0JA 3HNPA 1YBMA 4J9UE 2IRWA 4ZRNA 2O50A 2Y0DA 1KEUA 4IDBA 1N8KA 3ST7A 3TZQA 3MWDB 4Q3AA 4KQXA 4XYMA 3D64A 3KV3O 3PP8A 3BTSA 4N18A 1M6HA 4PLZA 3EAGA 1FMCA 1E1KA 2Q1UA 1R6DA 4XYBA 3TWOA 4DPKA 2HUNA 1JQBA 4R9SA 1PS0A 1YL7A 5BR7A 1B8PA 1NM5A 4IMRA 1RWBA 3EMKA 3TDKA 4CLHA 3KXDA 4MDHA 4EITA 1XGKA 1A7AA 2W8ZA 3U4HA 2YV1A 4JGBA 2X8LA 1FDVA 2VZ8A 1F06A 3V1UA 2UV8A 5G4LA 2P9CA 2DQ4A 3UN1A 2YHUA 5K9ZA 4B7CA 4RDIA 5BSGA 4GBJA 1AGNA 3GG2A 2R2GA 1GUYA 2I66A 2EXXA 4J2OA 4J6FA 4CLEA 1SB8A 4A0SA 4FOOA 3FBTA 4FN4A 2XPCA 4TQGA 3PYLA 2AG5A 1T1RA 4XYGA 2BF7A 3UOGA 3LT0A 3E48A 1NVGA 3AY3A 1KVQA 2WDZA 3LF1A 4MVJF 5EERA 4E13A 1EBFA 1T2AA 1ADBA 1W0CA 4M87A 4WCFB 2EKPA 2BHLA 1D1TA 2PFGA 1DLIA 1BMDA 1UXGA 1EDOA 1YVEI 3E1KA 4IDFA 4YJDA 2NM0A 5L7WA 4XDYA 4YRAA 4TRNA 1U7HA 2XOXA 3HDYA 3RC7A 4XX0A 4ZA2A 3QWIA 4Z9YA 3AI1A 4P8RA 4CV1A 5JC8A 2JAHA 3Q9NA 1V3VA 4GWGA 3CE6A 4NPCA 1XSEA 1ISIA 2CD9A 2IZ1A 3ETEA 4ALNA 3JCZA 3WFJA 1HDGO 1VE9A 2A94A 4MKZA 1HL3A 3S2IA 5HRUA 3ANMA 1Y1PA 2VRBA 1DEHA 1PJQA 3HB5X 3C85A 4G2NA 1B14A 4FPXA 3QP9A 2DLDA 1HE2A 2DTDA 4INAA 1UJMA 4IDGA 1M75A 3GVCA 4IMPA 4WLNA 1R66A 2HK9A 3GFBA 4R3NA 4BHTA 3FBGA 5ENVA 2EKLA 3HDHA 1SAYA 1U7TA 2A9FA 4XA8A 2AQKA 2Q49A 4ALLA 2NVBA 5TJHA 4HKTA 4BNMA 4A27A 4FFLA 4AJNA 4YAIA 1I24A 4NJOA 5GZ6A 1HRDA 4IDEA 5DDIP 5IN4A 1WPQA 4CM9A 2HMSA 2E49A 4PG5A 4A03A 3OQ1A 3CUKA 2H5LA 3LLVA 1R37A 3SX2A 1U3UA 3BMNA 1WWKA 1XDWA 2C59A 2NUAA 3G1UA 3BTVA 3Q2IA 4BKUA 1ZMOA 4HY3A 1X14A 5ICSA 1M6WA 2QRLA 5B4TA 3A06A 2EG9A 1U4SA 2I6TA 4K28A 2NVUB 3AW9A 4YJGB 4D7AA 5F5LA 5FWNA 2DBQA 3BA1A 3MOIA 5ITWA 3UHAA 3E8XA 5JCJA 4RGBA 4I8XA 4FGSA 3PXXA 1E3WA 4J49A 1KETA 2BLLA 4LCJA 3C3XA 4UVHA 4KWHA 2GN9A 2YZ7A 1PGPA 4P4LA 3RBVA 3ONEA 3QW2A 4PLGA 2GGSA 2X4GA 3JQ8B 3W4KA 3OMLA 5IAAA 3BMQB 1LLQA 2PD4A 3DL2A 2DC1A 3PGJA 3OJLA 4CV3A 4XQCA 5JYDA 2GRAA 1R12A 4CODB 4OOFA 3KYDA 4R1NA 5FI5A 2ZTMA 1LSJA 1B7GO 3EDMA 2VHXA 2Y0EA 1UXKA 3NAQA 1KIFA 4NIMA 1WXDA 3RFVA 3JYLA 1XA0A 1LQUA 2CF5A 2D1YA 3DOJA 3I9OA 4ID9A 4Y8VA 5DULA 1OBFO 6LDHA 5JE8A 1BXKA 1PEDA 3OIGA 2LDBA 2QZZA 3AOEA 4EJMA 3DBHB 1C0PA 2BELA 3DBRA 5JAZA 3I52A 2B0JA 3JQDA 1E7MA 3NTRA 4BMVA 1VL0A 4P4GA 1GUZA 1TLTA 2RBEA 2O4CA 5ENDA 4DYDA 1PJTA 3G0OA 3AUTA 1DAOA 1ZNQO 5L95A 1LX6A 5I9LA 2PH5A 2O3TA 3PPIA 2Q1SA 1LEHA 1T2FA 4CM8A 2Y1CA 1EE9A 3PK0A 1LU9A 2J3KA 1O0SA 4ESOA 1TXGA 3FHLA 4XJSA 2J3IA 3KBOA 3ZZNA 3I1JA 1PJ4A 1NYTA 3GVXA 3L6EA 5CG2A 4ONEA 3TN7A 4B7XA 4GKVA 3I4FA 3VZSA 4F6CA 4RVGA 5TX7A 2XXBA 2V6BA 3OQBA 1GY8A 3RKUA 3PWKA 5A9SB 1WDKA 4BNHA 4PIVA 2W2KA 3B70A 1OOEA 2GN4A 3MOGA 1YKFA 1PJ3A 1YQXA 1HETA 4N5NA 3ULKA 4AJJA 4R9RA 2NACA 2O7SA 4PG4A 5DCYA 2NU9A 1U8XX 4R4JA 3BYZA 5TF4A 8ADHA 2D2IA 3UVEA 2D4AA 4LK3A 5KCZA 2HMWA 3DBRB 5JMWA 3MWEB 5B12A 1GTMA 4Q3NA 2AEFA 2V6MA 1DC4A 1SB9A 2UYYA 4QT0A 5EPOA 1H6BA 2OBNA 5JC1A 1CETA 1KOLA 2V7PA 3R0IA 3QWFA 3GPIA 1X1EA 4YACA 1ISJA 1E6EA 1NAIA 2VNSA 1LDYA 3MJSA 2POQX 1BW9B 5G4KB 1N1EA 2PNFA 4MOWA 4R01A 2WD8A 2ZJ1A 2BH9A 4IS3A 1OZAA 1QYVA 1YXMA 4WK6A 4L8VA 1EVJA 2FSVA 4PLHA 1PWXA 2P5UA 1V3UA 2DKNA 4FJ1A 4YAJA 4FJ0A 3S8MA 4YQYA 5CPFA 4KDFA 2WYUA 1WNTA 3L4BC 4LGVA 4RQTA 4CMEC 4BO5A 3JQAB 4YVFA 4FB5A 5JY6A 4CMGA 3WNVA 4JQCA 1F8FA 3RU7A 1ULUA 1VSUA 4BO7A 2GZ3A 4A5OA 1LDMA 3ZNQA 3FD8A 5JDIC 3H2SA 1P45A 4GL4A 5L3ZA 4DLLA 4PN3A 1A9YA 3TQHA 4E5NA 2VYVD 2NU8A 5CHEA 4AFNA 1HKUA 3ZHYA 1QYCA 4K1LA 3A4VA 3PJFA 4BNXA 3VPGA 1DIBA 3NRCA 2Y99A 1GL3A 5AVOA 4BGIA 3GH3A 4R1UA 3IQDB 4S1VA 3L6DA 2RAFA 1AUPA 2I99A 1R4NA 3JYPA 3PZBA 5I7EA 2A4KA 1QR6A 3BMCA 4NJMA 5JSFA 3F9IA 3U0BA 2G76A 3ZWYA 2O2YA 2AE1A 3RUAA 1QYWA 4NZ9A 3RC2A 3PYXA 2CNBA 3IP3A 2Z5LA 3AK4A 1XG5A 2YV2A 1IYZA 2FMUA 3KTDA 3OETA 4A10A 8LDHA 1CJCA 4CV0A 2DM6A 2PK3A 1XQ6A 3JQCA 3NGXA 1RM5A 4HNGA 5A04A 4AJ4A 3B1KA 3K30A 1NQTA 3EW7A 3MTGA 5CAEA 3AFMA 2VQ3A 4L0QA 5IXSA 2BD0A 2HMUA 1I8TA 1M76A 1EZ4A 2DFDA 4BO2A 3D3WB 4DIOA 4D3DA 2DTXA 1F14A 4RF4A 5DP2A 2HDHA 3R3SA 4WGGA 4CLOA 4J4BA 2B36A 1HDZA 3GT0A 2O23A 1HYEA 2YHIA 1B8UA 2YHIB 1E3EA 1MFZA 4RV9A 4RPHA 4BKOA 4O1MA 4YB8A 3VDQA 5KOIA 1NQ5A 1DPGA 2OP0A 4UEKA 3KYBA 3ZW9A 1O95A 4D44A 1L1FA 4E5YA 1ONNA 2GN8A 3FWNA 4CLOB 2W4QA 2PH3A 3E82A 2HO5A 5HBRA 5JO0A 4QTZA 3SJ7A 1YO6A 3GGPA 1IPFA 1NQAO 4Z9XA 2PKRA 4C7JA 3DZKA 3H9JA 4PLCA 3L4SO 4DIFA 1H5QA 1EK5A 4EJ6A 1T2CA 3HJAA 4R1SA 4UREA 4CLDA 3JQ9C 5ILGA 2B5VA 1DC6A 1U2DA 2AMFA 3OJOA 3T7CA 2FN7A 3IL2A 1YB4A 5EL0A 1LNQA 4OO3A 4FD3A 4H15A 2EP5A 1NHGA 3INTA 1QORA 1P1FA 2OHXA 1EUZA 2Y67A 5FYDA 4EDFA 4I5EA 4TMFA 2NTVA 1H9AA 4E2YA 2RH4A 1JWAB 1EDZA 1DIHA 4CM3A 2HLPA 4YR9A 1WDMA 4UEOA 1VLLA 2YUTA 4CM8B 1BDBA 3N58A 1I01A 5JO9A 1YL5A 2EEZA 3HFSA 2FZWA 5C7OO 4GLLA 4HFJA 2O3RA 1KVUA 2O3SA 3DOCA 3QRWA 5A3VA 4B4WA 3HQ4O 4DL9A 4E5MA 1KYQA 3ZU5A 4NMHA 1IPEA 2GN6A 5C5IA 1AXGA 1H2BA 3D0OA 3PJGA 2HKIA 3AUAA 3EVTA 5A9TA 3U3XA 4EEXA 2Y68A 4YWJA 1YOVA 1PGJA 3GN1A 4J91A 4HX5A 3PJDA 4DBZA 1CF2O 3IUPA 4IJKA 1A5ZA 4BV8A 4WASA 4XRGA 1H93A 2PY6A 3WBBA 2OMEA 4IQ8A 4FGWA 1X0VA 3H8VA 4LSWA 1J5PA 3VPHA 3NDIA 3IKTA 3GUCA 5A1TA 2WJPA 2I3GA 3OIDA 2XAAA 4FC7A 4OMUA 3ZW8A 4CMAA 4E30A 1E6WA 4DIBA 1C0KA 2V6GA 4KMSA 3U4DA 2NV6A 3SLKA 1RKXA 1R16A 2AA3A 4JN6B 2AQ8A 4TRMA 5BNFA 1GQYA 1FF9A 3UCXA 4MKRA 1R0SA 1JAXA 1K3TA 4ZRMA 5JY1A 3PFWO 3IP1A 4J4TA 5T8KC 4HUJA 5AXDA 2EHDA 3ZNNA 4ITUA 2X6TA 4XRRA 4DVJA 2VUTA 1Q0LA 2BFMA 1DC5A 2CDBA 3M1LA 3U5TA 2QX7A 3K9QO 4XGIA 2HRBA 3K2EA 4PCVA 4JX8A 1D4FA 1PU2A 4W4TA 4LISA 4QFDA 2WSBA 2X1HA 2C5EA 4GH5A 5IDXA 3HN2A 1I3LA 4IS2A 2PA3A 3F4BA 5G2OA 4JIGA 3WGQA 1CYDA 3B1JA 1IHXA 4XD2A 5CDSA 1I32A 4GX0A 1K89A 4EW6A 3ZWPA 5T57A 3SJUA 3OJFA 2C29D 2F00A 3ZDFA 1MG5A 1X7HA 3H5NA 1Y81A 3BXXA 1E6UA 4QSMA 5KTKA 1GADO 3LF2A 7ADHA 3PLNA 4CM6A 3I23A 5FF9A 1X0XA 1Y8QA 3GHYA 3FNFA 1ZW1A 1U3WA 3L4BA 3OSUA 4A2CA 5A9RA 1GDHA 4DMLA 1JDJA 2Y1DA 4BGUA 5IFLA 3IS3A 3PFFA 1N9GA 1SBYA 1LXCA 2E4AA 1EUCA 4Y6PA 4TSKA 1KVRA 3BHJA 1PQWA 5BSHA 1HT0A 4JJFA 3I9JA 3JTMA 3RUHA 3AWDA 5BNTA 1XEAA 1AXEA 3TNLA 4CMCA 4WLEA 4W7IA 4WLOA 4RJTA 1GQ2A 3HDQA 3KHUA 3ETDA 5HS6A 1CQJA 4CR8A 1YS4A 2ZIZA 1ZSYA 3D4NA 3WQSB 3VH3A 4B4OA 4XYEA 3O38A 2ZB8A 3GDOA 1LA2A 5EESA 4GMFA 5GZ3A 1Z73A 3DZIA 2FPIA 4CQMA 3UW3A 3AJRA 3ZN2A 5C7LO 1XYGA 5I9NA 3TOXA 3V2UA 2Q3EA 2X0RA 2HK8A 1E1LA 3SEFA 4UVIA 5BNIA 1CIVA 4U0JA 4D0SA 1ID1A 3DHEA 4F45A 5A4DA 4AJOA 1ISHA 2DT5A 3GG9A 4Z3KA 3AI3A 4XYLA 4G65A 4YJGA 3QWBA 1YJ8A 4CUJA 4RLSA 1RYEA 4BIIA 3DZBA 3IUSA 5B37A 3MTJA 3M6IA 3PWSA 1WLYA 3W1VA 2Y0CA 3RQSA 3H5AA 1KS9A 3DR3A 1Z75A 3AY6A 4YXFA 1FDSA 3H2ZA 1XHLA 5AXCA 4R68A 4CM4A 1HTBA 5CEEA 4TZTA 1GFSA 1T4BA 3Q9UA 1IZ9A 3U4IA 2NVUA 1JTVA 4U0KA 3FN4A 3I83A 2Y1FA 4MVJP 1V6AA 1BG6A 1BXGA 1MV8A 3F1LA 2DPHA 1H94A 1K2WA 5EQDA 4HFMA 2FP4A 4GI2A 4MO2A 1YOVB 3WGIA 3P5SA 5AOVA 1GZ3A 1DB3A 1NR7A 1PS8A 3QVSA 1RM0A 4P38A 2NSDA 4IZHA 3W4IA 1I36A 2JCVA 2NLOA 1GR0A 1B0AA 1B16A 3FNGA 4PZEA 1QV7A 5JBIA 4UUOA 4WCFC 4Z0HO 1Y7TA 5IG2A 2GO1A 1F17A 1UXJA 4U8GA 3JQFC 3VZRA 1ARZA 3PHLA 5G0TA 3H9QA 3GHHA 1X15A 4ILKA 4YAKA 2C7VA 5A02A 5TT0A 4PFJA 1SEVA 2O7QA 1ZBQA 1SOVA 1HYGA 2X9NA 2A92A 2VYND 3KVOA 3ZV4A 4B4VA 4FW8A 3RUCA 3KLPX 5AQ1A 4AJHA 5IF3A 1E92A 3ANNA 3WSVA 2BMAA 3RUDA 2V65A 1A71A 4BGEA 1ZSVA 1DO8A 5ADHA 5COQA 1WDLA 4P4NA 3SVTA 2PWZA 2HK7A 4XQGA 4AICA 1NQOA 1R4NB 1PZHA 3JD0A 3WG9A 1V0JA 2OXIA 3H7AA 2TMGA 1PGOA 3NYWA 3GR6A 2BGMA 4E31A 3RBXA 1BTOA 6ADHA 3ICPA 1CRWG 1Q7BA 2HJSA 4ND2A 1VKNA 4IJWA 3ZWAA 2WTBA 3JYOA 4EJ0A 4D0RA 1I5RA 1VJ0A 2VT3A 4QFCA 3P2YA 2C2XA 1QKIA 5ER9A 1VC2A 1A72A 2LDXA 3DMTA 5T8KA 4PRKA 2P91A 1QP8A 2WMDA 2W2KB 1Y9EA 1DJQA 1ULSA 1MXHA 3GEMA 4ND1A 2D8AA 2VUUA 4RVDA 2Y66A 3QA9A 1DRWA 1I30A 1AN9A 1K0UA 4YRDA 1GEGA 4MVJM 3E9MA 4FDAA 5HA5A 2QG4A 4ND3A 1GPJA 3GGOA 3OBBA 4YQZA 3K5PA 3ZU3A 2YJZA 4PLYA 2BFPA 3E6AA 4MVJG 4E2ZA 4R41A 3KYDB 3LQFA 4J90A 4ZQFA 3IMFA 3JQ9A 4DPLA 4PLFA 4DRYA 3KYCA 2DVMA 3VZQA 1ZJZA 1KVTA 5CEJA 2G17A 1LUAA 3H3FA 3RC1A 2VRCD 3BMQA 3VTZA 3LT4A 2GERA 4K6CA 4EYEA 1HZJA 1MA0A 2G0TA 2OUIA 1PWZA 1SCUA 1T1SA 1ENYA 1PGQA 4GGPA 1Y8QB 1VKOA 1MG0A 2Z1MA 2EV9A 1J4AA 2H1SA 4XIJA 1YRLA 1EQUA 4OAQA 5EN4A 3OIFA 3NEPX 2W90A 2DAPA 4MJLA 3L6OO 2HMTA 1IE3A 1M66A 3T4EA 3EHEA 4WEQA 4B3IA 4KZPA 3FNHA 3Q1LA 2DBRA 4IJVA 4OH1A 1UDCA 3E03A 3JSAA 1O5IA 3E9QA 4UAGA 2PGLA 4TRRA 3ZWBA 3DXFA 4FJ2A 1Q0QA 3LT1A 4LRSB 3GAFA 1NVMB 5TQVA 2E37A 3IJRA 1LC3A 3IOYA 1B2LA 2ZB7A 3I3OA 3CMMA 3F46A 3ZGYA 3GDGA 4LW8A 4ZU3A 2HRZA 4LMRA 4IDDA 4YT5A 3ETGA 2BI8A 2CSUA 4NU5A 4J0EA 2DTEA 3PHHA 4BNVA 4L76A 4PLVA 3HUDA 1ADFA 2PLAA 4IDCA 4NJMB 4DQXA 1VSVA 1PJBA 1UZNA 3AU8A 4MPDA 3F4LA 3DAGA 1A7KA 4RPLA 4NDNE 5A05A 3S2FA 1L7EA 3M2TA 4XB2A 4TKMA 1PS9A 2QQ5A 4XEHA 3ZWVA 4YEDA 1DHTA 3WR5A 1G6KA 3LT2A 1UZMA 3TL2A 2GUGA 4J7XA 1ZZEA 1U4OA 3GN2A 2OORA 2WYVA 4L4XA 5JPIA 4BS9A 1ZEMA 4ZQEA 1MLDA 1FXSA 2Y05A 4H16A 2IXAA 4OQYA 3C7DB 3GZNA 1DFHA 2VHZA 5A03A 1I3NA 2X22A 3WGZA 5BT9A 1AE1A 5KJFA 2QZ9A 1VL6A 1E5LA 1K6JA 4FOSA 4N54A 3CPSA 1EEHA 1GYRA 1B8VA 3I9LA 4NHEA 5T6BA 1YBAA 1VM6A 5F5NA 3F47A 4E6PA 5K6AA 4UVDA 3JQ6A 3ENKA 3QIVA 5T5QA 2I76A 1LDGA 4CR6A 2YDXA 3JD1A 4CMIA 3HDJA 4XGKA 2C07A 3PIDA 5L9AA 3R3JA 2B83A 2AQIA 3DHNA 3LYLA 4NFHA 2X86A 3UFXA 1I2ZA 4D3SA 2FZEA 2FOIA 4GGOA 1ZK4A 4GVLA 2NVWA 3SC6A 4GSLA 2GF2A 3EZLA 4OM8A 1MP0A 1F12A 2WD7B 3WLEA 5EMHA 3CXRA 4IIUA 1I2CA 3SXPA 1T24A 4UULA 1NAHA 3GQVA 4CL3A 3A14A 2JHGA 3ZU2A 2W2LD 1SC6A 3VC7A 1JKFA 4HBGA 4M55A 3W4JA 5C3MA 4CQLA 2J3JA 2GDZA 4OKIA 1QV6A 2X7HA 3L07A 4K6FA 4CL8A 2VWQA 1Q2XA 2D5AA 2UVDA 3ZWWA 3TL3A 2GPTA 4L4RA 2PZKA 4RCVA 3GEDA 2W2LA 1HF3A 4RVUA 3AOEC 3GZ4A 3H3JA 4OIMA 2GLXA 4OXYA 9LDBA 1LC0A 1NWHA 3K31A 4D46A 4J2HA 3DFZA 2J5QA 1PL7A 3DBHA 4LCEA 3WYBA 5GZ1A 4HFRA 1IZ0A 4NBRA 1Z7BA 1JKIA 2WM3A 4F46A 3JQBC 2BGLA 1LDNA 4E21A 3RU9A 1E7QA 3D1LA 2NQTA 2O2SA 2CUKA 3GRKA 2PZJA 4A7PA 4BO9A 3PRJA 3HADA 4ALIA 5CDGA 1UR5A 1Y5RA 5FEUA 3LK7A 1HDRA 3NJ4A 1Z74A 4MVJH 2GYYA 1YWGO 3C8MA 1D8AA 5I9MA 2QHXA 4N5MA 1U5CA 2VTEA 2YV3A 2PZMA 2J5KA 2VHYA 4AJIA 5JMPA 3K2BA 1VRWA 2AE2A 5A5FA 4NU6A 4CMBA 4FFMA 1XKQA 2B4TO 1K6XA 4BQRA 3ITKA 4QO8A 4EBFA 1ONOA 5DF1A 1Z45A 5KJ1A 3LLSA 3GC6A 5U1PA 2DBZA 2RHCA 1JWBB 3K73O 4R54A 4E33A 1O6ZA 4GX2A 4DC1A 5JYEA 2J5RA 1NR1A 3WWZA 4BO8A 4L9RA 2B4RO 3BTOA 3PVZA 5G0SA 4Z6KA 3QJ5A 4OSPA 3SC4A 1QXSA 4FS3A 3CEAA 3RUFA 1PQPA 4URFA 5F3RA 1E5QA 1ZVMA 4RF2A 4L73A 3WX0A 4BB5A 3S2EA 4W6ZA 2YQ5A 1U5AA 4M89A 3BHMA 3GVIA 2HMVA 1AHIA 1C14A 4J43A 5T67A 1ZK2A 4D3FA 1KERA 1UUFA 5AXBA 3QE3A 4ZQHA 3SLGA 2ZCVA 1B26A 3PHGA 4BKPA 2JD1A 2F1KA 4BO3A 4AJEA 3ROPA 1EVIA 5B4UA 5EQFA 1QYDA 2A35A 2Q1TA 3N74A 1GQQA 2G5CA 4J4HA 2IZ0A 1ZXBA 5F1OA 5GY7A 3X2FA 2QW8A 4BQPA 3EYWA 1KC1A 5TS3A 1ADGA 1NTOA 5I7VA 3BTUA 3VKUA 4Q3DA 1OFGA 3ZWOA 1QLHA 1P1RA 3D5QA 2Y1GA 3WGGA 1ONPA 9LDTA 3QVOA 3EK2A 4YPOA 4JNKA 4BKRA 4QECA 1I0ZA 4I5DA 3GNTA 2EGGA 3DTYA 3WMXA 3WTCA 3WS7A 1PL6A 4MVJI 1W6UA 3GEGA 4YCAA 4BMSA 1JAYA 3QWAA 5FFFA 3WIDA 3F1KA 1M2WA 4ZVVA 1ISFA 3K8ZA 1DJNA 2AEJA 2E6UX 3HG7A 4WCDA 2YY7A 3R6DA 4E2XA 1Y8RA 2CF6A 3ORFA 5LCXA 1XU9A 4XB1A 1HE3A 5BSFA 1YDEA 3D3WA 5JAMA 1YDWA 3HZZA 2ZYGA 4JLWA 1HDYA 5G4KA 4NK5A 3NJ8A 5DBFA 4IXTA 5A9SA 1ISGA 3UUWA 1LDBA 3Q3CA 5G0UA 1GZ6A 1MC4A 5L40A 4PVCA 4UUMA 4CM9D 3L0DA 1T2EA 3RUIA 3DO5A 3DQPA 3U49A 1BVUA 3O4RA 1ZMTA 4AJPA 4GX1A 3BHIA 4FFPA 3V5NA 3WGTA 4RQUA 4Z9FA 2ZJ0A 1JW9B 1ZUD1 5IZCA 4RVSA 5C37A 1XCBA 1DIRA 3GUYA 4JXKA 4WNCA 3WQRA 5CDTA 1E77A 4O5OA 4HV4A 5IZCC 5L45A 1KC3A 5IN5A 4ZHSA 4PGFA 4BO4A 1S7CA 1I10A 3W8FA 5CDYA 2E82A 2QRKA 1BHSA 1DC3A 2D5CA 3KEOA 2C20A 4LVUA 5DOZA 1MUUA 3ZNOA 2EW2A 1N92A 2R6JA 2GASA 2J8ZA 4IXWA 5JAQA 4PLPA 5F1PA 3ZWXA 3QHAA 4OHUA 3QQPA 4UUPA 5IDQA 4XR9A 4F6LA 4RVFA 3QY9A 2O48X 1VJTA 1KEWA 5TLSA 3IC5A 3E5MA 4CJXA 3QVXA 1YQDA 2OGUA 3O9ZA 3TFOA 1PQUA 1LLUA 1OMOA 1P0CA 5B1YA 3VPXA 3MJTA 2WE8A 1IB6A 2IYOA 1H2HA 1YBVA 4W99A 1I3KA 4O59O 4PVDA 3EUWA 5J23A 3DZHA 2VZ0A 2QIOA 4BO6A 4IQGA 1E0DA 3PJEA 1P77A 4XKJA 2C5AA 1NFFA 5KVSA 3Q6IA 3T4XA 4II2A 4W9NA 1DSSG 1G0OA 3AY7A 2JFHA 3DMTC 1Y8RB 3KYCB 4FSHA 3SBOA 4B7UA 3WDSA 3UKOA 4I5FA 1J49A 3ADPA 3FSRA 1LTHR 1VL8A 4L4SA 2YFQA 3FTPA 1XWFA 1ENOA 2FRDA 4O0LA 1NPDA 1HYHA 4KQWA 3DONA 3WBFA 4RDHA 1YONA 3UCFA 3A28A 1N1GA 1ML3A 1GCUA 5F21A 3KEQA 4RPKA 4IIVA 4QO7A 5L4SA 3INRA 4WLUA 4OKNA 4U7WA 1G1AA 1PIWA 1SZJG 4E2WA 3TOZA 4F3YA 3VTFA 3QSGA 1LSOA 4AJLA 1SNYA 1TVEA 4EGFA 1LQTA 4OOEA 1O94A 3DBLB 5H83A 4MKXA 1WMBA 2OBYA 5TSDA 3FWZA 1W73A 3H5RA 1RJWA 3JD2A 2ZQYA 3PZRA 4JP2A 1FJHA 2IODA 4I9UA 2AQHA 4O63O 3NT5A 2HJRA 3OF2A 3LSYA 4OXKA 1B3RA 4QEDA 5G0VA 2B4QA 1DIGA 3WB9A 4N5LA 1C0IA 1Y9AA 3WTBA 2VTDA 3JQFA 3H9EO 3ENNA 4XZ3A 2EJWA 1M67A 3CKYA 4BO0A 4NNJA 3O8QB 4YAEA 2WYWA 3QLJA 3VH2A 5AYVA 3ICCA 3WGOA 2EKQA 3P19A 3GDFA 4OGWA 1BRMA 5JS6A 3HSKA 3PGXA 2OL4A 4BNWA 4YBZA 4EEZA 3OHSX 2GZ1A 3DWFA 3NV9A 3CIFA 4D43A 5I7SA 3VKVA 2O3UA 3QVWA 2OOSA 2Q46A 2RIRA 1N5DA 5IJZA 2ZTLA 2ZYDA 5DCUA 1GUFA 3ON5A 1U3VA 4HADA 5LDGA 5KVVA 3MJEA 4A73A 3F5SA 5U9CA 1Q7GA 4NI5A 4CM5A 3UCEA 3H65A 3PDJA 1J0XO 4M49A 3P7MA 3TZ6A 1PZFA 2IE0A 4JBIA 3NX4A 3OFSA 1ZCJA 2VRCA 3PTZA 1HWYA 1DHRA 1R4MA 3JQBA 1SMKA 1NWCA 3GZNB 3ZI0A 1BXGB 4UUNA 3AM5A 2YDYA 2IEDA 1UXHA 7MDHA 2QYTA 3U4CA 4AVYA 5K6AC 4CM4B 2P4QA 1XU7A 4P22A 4D79A 4BNLA 4ZQGA 3H9UA 2CDAA 4JJGA 4WEOA 4KTTE 3OQ6A 3ZV3A 4E5KA 4EUEA 1X1TA 4IJUA 5DCWA 5I8WA 1PR3A 3K96A 3GA0A 4BKQA 3U9LA 2PGDA 1A4IA 3ZH2A 2EWMA 2PZLA 4J9VA 1A9ZA 3UXYA 1XLTA 2JCXA 1NPTO 1XR3A 1HXHA 4QXMA 3OP4A 4A26A 2VYVA 3F6YA 5BQFA 1ENPA 1LRKA 3I6QA 4LSMA 3ANLA 4L75A 4CLRA 2FR0A 1YH3A 3TSCA 4CQMB 4B8ZA 4NFSA 1E1MA 4XJTA 1KY4A 2RH8A 1RM3A 5A06A 3RI3A 3I5MA 2HQ1A 3CINA 3NTOA 1PJLA 3KUXA 1CEQA 3F3SA 4WLFA 5ES3A 3I9NA 1FDWA 3JQAD 3EVNA 3M2PA 4UEJA 3JYQA 2CY0A 5K0ZA 3S55A 1B15A 5L51A 4TROA 3WWYA 1ZK1A 3RUEA 4DQVA 1YL6A 5JAIA 1FDTA 3GNSA 4XCVA 4YT2A 1KBZA 1UDAA 2XF8A 4YJHB 3ZHXA 1EQ2A 3RASA 1DXYA 1JVSA 4E32A 3O03A 1B3BA 1HSOA 3OJEA 2ZQZA 3WYCA 3DHYA 3WFIA 4DXHA 5T64A 3ZWCA 1HLPA 3F5QA 1QRRA 2JL1A 2AEMA 3DAFA 1I2BA 1GCOA 2X0IA 3JQ7A 3CTMA 2Y1EA 1ZO8A 4YDRA 4TWRA 4DMMA 1N9GB 4ALKA 4BV9A 2VCYA 4CR7A 1Y5MA 4Q9NA 1EK6A 1FDUA 3FI9A 3FR8A 2BGKA 4AJ2A 1I3MA 1NVTA 3HHPA 3JQEA 4LMPA 3CMCO 4AJ1A 4NBVA 3LC7O 2FR1A 1P1KA 4J1TA 5DT9A 1NNUA 4QX6A 4MP6A 4CMKA 1ZFNA 1ZXLA 3NTQA 2Q4BA 1ZKMA 2VT2A 3GMDA 1BDMA 3GGGA 3RROA 2O3QA 3V8BA 4X54A 4BGVA 4H3VA 1HLDA 2TMDA 3EZYA 3A9WA 4ZICA 5CDUA 5KNLA 3AUUA 4BNGA 2GNAA 3A1NA 3INGA 4NR0A 5JXWA 4XGNA 3EGOA 3DDNA 2NU7A 4TKLA 4B3JA 1LSUA 2I67A 3HE3A 2Q2VA 3PQDA 5A3JA 1UXIA 3NUGA 5CFZA 2OP1A 4XR4A 3FF4A 3OECA 3LU1A 4OL9A 2R00A 4U6SA 4NFYA 1H9BA 3LDHA 1GZ4A 1P0FA 1MGOA 5TC4A 2B69A 2VWGA 4NH4A 2Q2WA 4WE3A 1YGYA 4FBGA 3UAGA 3KSDO 1HZZA 4RLHA 4UVEA 1LDEA 4JJIA 4RPJA 1QMGA 3ROMA 1BXZA 1PJ2A 1WMAA 2Z1NA 4GLOA 5IXYA 2ZCUA 4CUKA 1LRJA 2X5OA 3IIEA 4GSKA 1ENZA 3PIIA 2VYNA 3WXBA 3ZV5A 3ZNPA 2X23A 4BNFA 1LLDA 2P5YA 4WKGA 3ROKA 1UH5A 1X13A 2AHRA 4Q3EA 2UUOA 5COAA 3RWBA 2X9GA 4I1IA 4CM1A 1CQIA 1MB4A 3GF4A 1EBUA 4O6VA 4PG7A 1E7RA 1IY8A 2C7GA 3X2EA 2GCGA 4EUFA 2CVQA 5CPBA 1TT5A 4FFNA 3FCOA 4M8SA 3S2GA 1GYPA 3CZMA 3C1TA 4BB6A 4XQ9A 1MX3A 2ZK7A 4IM7A 2FSSA 1W4ZA 2X0NA 4DLBA 2ZTUA 4DLAA 4RF5A 4YAGA 4E5PA 1RM4A 3D4OA 4CM7A 2ZB3A 4WPGA 3GVPA 3H4VA 1SOWA 4IUYA 4W82A 1H6AA 3WIEA 1UAYA 3GOHA 3QV1A 4IINA 5TRTA 4C7KA 1TB4A 4PLWA 2B5WA 5JCJD 3UGKA 4OJNA 2JJYA 3KM0A 5DN9A 1R0KA 4Z0TA 3MCVA 3KB6A 3ZHBA 3TRIA 2C2YA 3FNEA 2P9EA 3PWZA 1NASA 4E0BA 3FTNA 3OM9A 4NBWA 1QYXA 4WUVA 1P74A 4H7PA 1YB5A 1OI7A 3HB4X 5KWEA 3UH1A 4B8WA 1DIAA 4M1QA 1WZIA 4DQUA 2IZZA 2PV7A 1EUDA 2HAEA 5HWSA 4BNKA 2X5JO 3OA2A 5COBA 2Y93A 4I5GA 1HEUA 4R1TA 2NTNA 3TF5A 1JKJA 1JA9A 4RO0A 4ND5A 1GV0A 2ZATA 5DZSA 1JU9A 1IULA 1MXFA 5JLAA 1PSDA 2I5PO 3PLRA 1NP3A 4D41A 4CUZA 1Z82A 5IDYA 3DFUA 2DU8A 1MC5A 5ILOA 4TZKA 5K1SA 3RJ9A 1S6YA 3HWRA 4QUKA 3AFNA 1WP4A 5I7FA 2VUSA 2NNLD 2GZ2A 2VWHA 3COSA 2HCTA 4YJFA 1CDOA 1W8DA 3I9MA 2Q2QA 2JFGA 1EE2A 1PTJA 1E7SA 1GEEA 2WWRA 3FPCA 1SEPA 4OSOA 3JYNA 3I9KA 2IDZA 4W9NC 3RC9A 3ADOA 2CVZA 4G5HA 4J7CA 5ICMA 1A27A 3RFXA 5JDCC 2JHFA 1BWSA 4IBOA 3GMSA 1NFRA 1U3TA 4OYRA 1MFPA 2EP7A 2I9PA 3L9WA 5KJCA 4HWKA 3VHRA 3CSDA 2H6EA 3NKLA 2UDPA 3K6JA 5HS4A 1DFGA 2AG8A 1UP7A 3ZHZA 2IYPA 3DB2A 5DBIA 2G1UA 1PGNA 1N7HA 1R15A 2FY8A 4KTVE 4KP7A 2SCUA 3LZ6A 1J6UA 4Y6RA 2PR2A 4B4UA 4ALJA 1PR9A 3FR7A 1F0YA 2ZKLA 3JD4A 4WCFA 2BI7A 5TNXA 4FIZA 4GWKA 1A4UA 1DBVO 2I3AA 2X58A 3UF0A 4MIOA 5FI3A 1VI2A 1YE3A 1TEHA 4XDZA 1D3AA 3WJAA 3ITDA 3VPSA 3O26A 4KDEA 1HDXA 1C1DB 2BFAA 3JQAA 4R5HA 5ER6A 4DYVA 1C1DA 1ZK0A 3G1TA 3U09A 4YT8A 2PGJA 1ZIDA 2V6FA 5KJ6A 5MDHA 3GRPA 3DBVO 5JFOA 1GU7A 3NT4A 1LSSA 1BVRA 1DRUA 4GX5A 5DBGA 3KO8A 4BOYA 2JCYA 4CMHA 1IUKA 1VJ1A 2GD1O 1NHWA 1H6DA 4PZDA 5C7IO 2W98A 4WOJA 1G0NA 2QYSA 3S1LA 1N2SA 4LRTB 5JDIA 3JD3A 1LLCA 1JN0A 4PZCA 2QRJA 2FPGA 3GAZA 3UICA 1DRVA 1TA4A 4NBUA 5H81A 2JKVA 3Q2KA 1D1SA 4Y67A 4E12A 1U28A 2P2SA 4K9DA 3RSHA 3RKRA 1IL0A 4MIYA 4MP3A 4R51A 4CMEA 2D59A 3BMOA 3OEYA 1CERA 3NDRA 5I8ZA 5BSEA 1HE4A 3JQGA 1GV1A 2ZYAA 2BFOA 3RIHA 5GMOA 4OQZA 3BZUA 3IKVA 3ROQA 3G3EA 1AHHA 2DUUA 4KUHA 5L7TA 4IGEA 4BO1A 4WNIA 4YJFB 2PTGA 3VH4A 1V8BA 4Q39A 3HFGA 3D3EA 2B35A 3ZWNA 1PZGA 1O9BA 1P33A 4IY1A 4NBTA 5KIAA 4J3FA 3KETA 5TJ9A 3ONFA 4RL6A 2OO5A 5AXAA 3PQEA 4D42A 4JBGA 4NK4A 3RJ5A 1OC2A 4YJHA 5JNLA 4GMGA 1P1IA 1E3WB 3V1YA 1Y6JA 4BNZA 1F8GA 4DWVA 3AOGA 1H6CA 4BNUA 2NU6A 1UZLA 3W8EA 4EZBA 1ZJYA 3PHJA 4ROSA 3D4PA 1V9LA 3PI7A 3WMWA 3ONDA 4DBVO 5TIIA 4BNTA 3VOSA 4PLTA 1T26A 3DOOA 4MVJE 5DNAA 3DBLA 1D7OA 5TT1A 3GVHA 1ISMA 5HTOA 4PG8A 2ZTVA 1E3IA 2EJVA 1N7GA 5CP8A 3IAHA 4DPMA 1PJCA 5G0WA 1WVGA 1P1HA 2Q45A 3BMOB 2BRUA 3C24A 3E18A 3KRTA 4EUHA 4TRJA 1X7GA 2Y1OA 1JVBA 3LVFO 1XELA 3VPFA 1T2DA 1JLLA 1P9LA 1SPXA 2EF1A 5IZ4A 3W6UA 3GLQA 5KVQA 3ABIA 5A5EA 4I08A 1WZEA 3IDSA 4JK3A 4JBHA 3H9GA 3PDUA 5U4QA 4B79A 4W7HA 1LBEA 5EIOA 1EVZA 3VVCA 4DREA 3ZCXA 5CEFA 2ZB4A 2HU2A 3D5TA 2FHSA 1ZSNA 2D3TA 1ORRA 1RYDA 1UAGA 2CDCA 3NT2A 3QVTA 2FWMX 4J1NA 3W6ZA 3CH6A 1BW9A 2EERA 2H63A 2PD3A 3KZVA 4WLVA 4KUEA 3RBZA 4CLXA 2AXQA 3E5RA 2O3JA 3ZWMA 4KOAA 1PX0A 2VOJA 3DZGA 3PHIA 1GYQA 1L7DA 4FC6A 3WOHA 2VWPA 2EGHA 3G17A 2J6IA 1E7YA 1R4MB 4Q3CA 4FQ8A 3I6IA 1KEPA 2VOEA 4ALMA 3TPCA 2GR9A 1Q7CA 1HE5A 3WLFA 2IEBA 3HN7A 1YJQA 4J1QA 1H0KA 5KKAA 4BNJA 4PG6A 1PZEA 1PJSA 2J3HA 1P31A 1ZK3A 2Q1WA 2OFPA 1GPDG 1O8CA 4AJKA 2YFHA 4G81A 4Y6SA 2H9IA 2Q50A 1LRLA 4BUCA 4BNNA 2O4UX 3WSWA 4CMJA 3M1AA 3BAZA 2EIHA 4B3HA 4JROA 2DPGA 1UP6A 4R5MA 3GY0A 4WJZA 4N7RA 3TZKA 1KEVA 4R69A 3BMNB 1O89A 4YT4A 4LVCA 2JD2A 4BNIA 3PQFA 2WD7A 3E9NA 4XIYA 4CLRB 2NQ8A 2C82A 2FR8A 5CG1A 1YB1A 2R00C 4J0FA 2P4HX 4D45A 5H82A 4ZQBA 4BNYA 4FR5A 4Z0PA 4RZIA 3ZV6A 5KVCA 3RVDA 5EJ2A 4MVJA 3QWHA 2C0CA 4IQ0A 1LJ8A 3D7LA 1QSGA 3T7EA 5L4NA 2HSDA 2JFFA 3IJPA 1CWUA 4M54A 1LI4A 1C1XA 3VZPA 3OEWA 1Z7EA 4AL4A 3DTTA 5HM8A 4U6QA 2UAGA 3NDJA 1V3TA 4J16A 3TZHA 1DFIA 4BVAA 3JV7A 2PD6A 4Y9DA 3V1TC 3GK3A 4HNHA 1GAEO 5ITVA 1OC4A 3MZ0A 4KWIA 1KVSA 3RAJA 3GFGA 4YTEA 4IPTA 1Z6ZA 3TZCA 3DEYX 3U62A 1C1XB 3C1AA 3CZRA 2YQ4A 4I9HA 3DZJA 2JAPA 1BSVA 4HXYA 4RPGA 4RZHA 1U8FO 3ZU4A 1FK8A 1I33A 1Q0HA 1U2GA 3JQ7B 1IOLA 2DBVO 4NG5A 1OAAA 1XIVA 1ZEJA 3G79A 1P3DA 3LC1O 1DDOA 2X5KO 4PRLA 1P44A 3C7AA 4IGFA 4UVGA 1E3SA 4Z3DA 3L77A 1SO8A 5B4VA 3LC2O 4HFNA 3I4CA 3AU9A 4OXNA 2ET6A 1NPYA 2Q4EA 2CVOA 3MEQA 4J7UA 3OH8A 3V2HA 2PKQP 1TT7A 3RCBA 3B6ZA 4CPDA
chains in the Genus database with same CATH superfamily
3D31A 3PQ2A 3RG8A 2VNAA 1WB4A 4EYGA 3TRFA 2ZYVX 1FEZA 4GAEA 2JKZA 3L7LA 5JCXA 1TCAA 2I62A 2GM4A 2IFTA 4IEEA 3FRJA 4WDRA 5I01A 3K0SA 1OBCA 1OUMA 3I9V6 4QODA 2I4TA 2QSJA 4QXAA 4CQMD 4GI7A 2RCYA 5J1TB 3ISJA 3KELA 4TXNA 4XOUA 2ESRA 5THKA 1QBGA 2PVSA 1ST3A 3BL8A 1N5OX 3DAPA 3FTCA 4I5IA 4MICA 4PO9A 3AL2A 4D8UA 2DQZA 3FDZA 4ZD6A 5KQMA 1E98A 5ERYA 4GDFA 1II9A 3MWFA 1P7VA 1OH6A 4QPNA 1VPDA 2DPMA 4IH9A 2WWIA 4IXMA 4EI2A 1C9KA 4C05A 4OHOA 1NXPA 5JCOC 2D0PB 2Y0PA 1M6NA 2PYZA 2QTBA 1W5EA 4U5QA 3KLMX 3OM1A 1W59A 3GP3A 1DEOA 2RG1A 1OXVA 1ADCA 4KLCA 1E8DA 2A1TR 4QOFA 4BN4A 5G1NA 1FA9A 2NZWA 5FKJA 4RF3A 4BVKA 1JDSA 4EHIA 2JIMA 2E48A 2VHVA 1RWMA 3BC1A 3BWEA 1DP4A 4GP9A 3QBEA 4DA9A 3OQOA 4GPD1 1S02A 2B5OA 4B43A 1CNMA 1D4OA 4D4MA 2Q28A 2OV8A 1T4DA 4K3VA 1QG6A 1KRHA 1XQ1A 4II3A 3TSOA 2Q99A 2ZR0A 4IFTA 3QYJA 3BGIA 3BEOA 1XNHA 2AR9A 4MPPA 1VIYA 3JAMA 2P4UA 2G40A 1CEYA 3V2GA 1XMOB 2C31A 2H7XA 4TM8A 1XFDA 5AKXA 3EC7A 3IOEA 3U4QB 3O8QA 1N8TA 2OZPA 5F2KA 1NBOA 1T13A 5KZMB 1SUAA 1PNVA 1V35A 3DG9A 4Q5IA 2V7GA 2CZCA 5DGHA 3RSQA 5IRCD 1EP3B 1SN7A 2JFYA 2QRZA 2EZTA 1WAMA 3GWZA 3SDSA 1Z5ZA 4M83A 4ABYA 1N5JA 3T5BA 3U4AA 1OJLA 2IK8A 3B36A 3GL9A 4G0XA 2BKUA 1Q1AA 2ES4A 4O5AA 4I9NA 4P4TA 3EXFB 4ES6A 4RSGA 3WLTA 5HVNA 2GEDA 1EFLA 3RBAA 2KBFA 3SZGA 1OU4A 3WQBA 4OP3A 4AF7A 2TYSB 1C3VA 4GP7A 4AG5A 5M29A 2Z0MA 2BKXA 3JALA 2IV7A 5MGBA 1EMDA 2CXOA 2RGBA 3B89A 4QXQA 1AY0A 3BFXA 4FP9A 5TGDA 4ND4A 1QAOA 3DZFA 3EOBI 4X1KA 4KQKA 2OE2A 4CCWA 10MHA 2QQFA 4M46A 1JR3E 1T4GA 4FFRA 3FGZA 1UAAA 3EPRA 5ICEA 4GKBA 1C8LA 5AW9A 4PE5B 2RGWA 2NZJA 3K92A 5FL7A 3OICA 3L5KA 1PVOA 3GJ6A 3ASVA 4YA6A 1KRWA 4WJLA 2ZUUA 1WR8A 2HIGA 2Y9PB 3C7CB 5EHGA 1X1DA 4IXDA 2ADFA 1P5HA 4K26A 1R8QA 3U3JA 4W6QA 1F0KA 1NX6A 1NXQA 3PYMA 3NHZA 1U9JA 1P1JA 3Q15C 1AK9A 3VHXA 5AK3A 5HF8A 1FVFA 5KOYA 3CGWA 1GNTA 4B6RA 4X7RA 4JQYA 3PNOA 2Q29A 4L74A 4DT1B 1EUYA 1YC2A 2NWQA 3A3OA 4K0KB 4QUAA 2C54A 3UK7A 3MRXA 4BEVA 4HLUA 5AM2A 5L8VA 4D25A 4MV8A 2WV7A 3HGQA 3S2SA 5BO5A 4ARVA 3ABQB 3ZGNA 2V7VA 4J0IA 4RMHA 5TPZD 4BMDA 1XZQA 3AQ4A 4RA6A 3VO1A 4X24A 4HDQB 3RYIA 4BXOA 4UTOA 3EBOA 3G8YA 2JLVA 4PFSA 3TS1A 3BIXA 2KB0A 3WYEA 4IZIA 5L4LA 2PKEA 1YI8A 4E03A 3U7QB 1UINA 3MLBA 3HUFA 2O0JA 1E3JA 1GPAA 1NC1A 2P68A 3EY4A 4LJYA 4UM9D 2RHRA 2AL7A 4MAAA 1C3OA 2X9VA 4MR8A 1UJ2A 5G41A 1UANA 3LXRA 3WGYA 2QT0A 4WOCA 2P6MA 4A6PA 5LQAA 1JPNA 4TMTA 3OC6A 1N8KA 5FDFA 2A5JA 3MWDB 3D64A 4O2LA 3IKLA 3H11B 3PP8A 4Q21A 3WWPA 1FUIA 2MYUA 3GQBB 3RABA 2ETXA 2JGDA 4ANFA 2Q0HA 1XAIA 2R6ZA 4Y1RA 2YKGA 2B3TA 3RHTA 1KMMA 3TWOA 4C4RA 1RBQA 1V1MA 1YL7A 1PT9A 3CZAA 4IMRA 2V03A 3K9LA 1WPXA 1XTKA 2XUHA 3LQKA 4NOJA 4Z53A 4UDOA 3G5UA 2KI5A 4MDHA 1QYRA 1GNVA 2XMZA 3BM5A 2X0DA 5FUBA 3L0IB 3FMGA 2WFLA 3D8UA 1LVHA 2YV1A 3TX6A 1DJPA 2Q21A 1RJEA 1GZSA 5FT9A 3V1UA 1TU4A 1OT3A 1Q7EA 3GAAA 4IHKA 2P9CA 2DQ4A 3QKRA 3M3DA 2V3VA 3VR4A 3ZZ0A 4EPTA 4CEHA 3E7FA 4EQ6B 1T8YA 4B7CA 1Q22A 1AGNA 2QM0A 1YKGA 2R2GA 3TQQA 5JCPA 2I66A 2EXXA 5CM9C 1TVCA 4MIKA 4US1R 2VQEB 2PZGA 1N0VC 1TYZA 3DVQX 2ZSKA 3PYLA 4TL7A 5FPTA 4ERNA 2YINC 2AG5A 2PGXA 3FCUB 2JVKA 1HNNA 1Y3AA 2WOJA 2PRJA 3UOGA 1N6OA 2UVPB 3CWZA 1T9BA 1F4VA 4TTAA 5DASA 1VSQA 1U28C 4KXYA 4EVRA 3RS7A 4JVOA 2LCIA 4HF7A 3LTNC 2BHLA 1D1TA 2PFGA 1YVEI 1C0EA 4YJDA 1V3QE 4LV8B 4GMKA 3CB4A 2HWKA 2HJGA 3CRZA 4WNAB 1NTRA 2A9KA 1J00A 3H99A 1GKIA 2XOXA 3QFFA 4L51A 5JMTA 3G82C 1HQYE 3OZDA 4DDUA 4DCTA 4XX0A 1O96A 5JSUA 2CV2A 1EP2B 1UMBB 4F2GA 5AW6A 3VPBA 5JC8A 2FW0A 3R6LA 5BYJA 3T7TA 3L0PA 4C0XA 1RI4A 2WD9A 3CE6A 3F6EX 1ISIA 2CD9A 2IZ1A 3ETEA 3OF3A 4MRMA 2H5EA 3R75A 1U1GA 3WFJA 1HDGO 1VE9A 2I7VA 3BH7A 4PHGA 1XD8A 1YK1A 3LWBA 1KMHA 1KZ4A 3CGGA 3LVQE 1XE3A 1HL3A 2HU7A 4MKZA 5EYPB 3NHPA 1JG6A 3Q40A 1XO1A 4BMZA 1E2LA 3MUFA 3HBJA 3HR4A 4GT1A 3KT6A 3LM8A 1KS2A 1UIMA 1ZH0A 3D4IA 3G89A 4G2NA 5J63A 1HE2A 4WZAE 4JHLA 3RIGA 2WIJA 2AWOA 4C76A 3FUVA 1M75A 1QGZA 4EJSA 5DGIA 5JSYA 4WLNA 3LUPA 4ZOEA 2YS6A 3V42A 3G8AA 1Q0ZA 2EKLA 2GPYA 3FNRA 1S3IA 4ZT2A 3SSMA 2BP7B 4H0NA 3GPCA 1UC8A 3SYRA 3E3LA 1MC8A 1MX9A 4ALLA 1L4KA 4Z7NB 5JI2E 4TYNA 3LVRE 5TJHA 3I01M 4R9NA 1DE0A 1B76A 1XZLA 3BX1A 4FFLA 3EQ2A 3RK1A 1VMAA 2PT7A 4FI3C 3WAKA 1MPTA 5EXXA 3SHVA 2JLRA 2XNKA 5JHHB 2WP0A 5I4KA 1E2DA 1JU4A 4AUMA 2GEVA 1QCCA 1GPNA 5LMNB 4MGEA 3MN1A 4A03A 1VIMA 2OM2A 3A6ZA 3OQ1A 3IQXA 3M5PA 1Y3CE 2ZYIA 1IWOA 1G3IA 3LLVA 1R37A 1S8OA 2V6IA 4IZOA 1WWKA 3G1UA 2XQJA 4S35A 1YTUA 4BKUA 4HY3A 4IUDS 1EUDB 3PNQA 4G23A 3ZLBA 1M6WA 3RADC 2QRLA 5B4TA 1PCXA 2YIJA 3A06A 4ZVOA 4B44A 1QFYA 1NNSA 1CTQA 2Z5GA 4K28A 2IPLA 4Q1BA 2IZOA 4KKXB 2NVUB 3VBCA 1RYZA 3D3QA 4O4LF 4Q9IA 5BW4A 5KTRA 4PR3A 1W85A 4M0FA 4LNHA 3AHFA 4YJGB 4JHXA 2W48A 5F5LA 2D1SA 1MB9A 3ZDRA 3JS5A 3UHAA 2HLDA 1U3CA 1DARA 4XFKA 2VS1A 4IILA 3D6NB 4J49A 4NEHB 3T7JA 3C3XA 4JS0A 1I4DD 4UVHA 2D1FA 5P8WA 3I5XA 2CL5A 4V1CB 3ONEA 2DWPA 3RRFA 3WP1B 3N5KA 2GGSA 2X4GA 1SVMA 1WW2A 3CKMA 3IE0A 3OMLA 1KYZA 4MUMA 5I48A 1TIKA 1KEKA 1DKUA 2PD4A 3IBSA 3L8MA 3N8GA 5UKDA 2QZ4A 3JZMA 4ZOCA 5JYDA 2O8EA 1NNEA 4U2DA 2GPNA 5CIQA 1LI5A 1OZ0A 1DCKA 3GA7A 4ND7A 2Y2VA 1W52X 4NMMA 4B3GA 5KWSA 2ODPA 3CZPA 1D2HA 2D4HA 5FI5A 4ASUD 5JQGF 4RYLA 4NIMA 2XX3A 4FHZA 1KIFA 1C3OB 3B2QA 3OPNA 1MAWA 1UJBA 2HY7A 1LQUA 3AR6A 3JYLA 4GGMX 3LLMA 3ISTA 1NMEA 2J67A 4YRJA 4G8DA 1H3EA 2H5IA 3GJ4A 4B2LA 4G0WA 1PEDA 2UZ1B 4XSGA 5CW1A 4DIEA 4OEHA 2G9ZA 4HAIA 2B0JA 5EEHA 5LB4A 1E7MA 3V8PA 3ZD8A 1GFIA 3A37A 3QFRA 3WNDA 4Q4CA 2FR8C 4OFWA 2PX5A 5ENDA 3PXUA 1HORA 4DYDA 3OQNA 3DT8A 2OA0A 1CZLA 1FP6A 3PFGA 1DAOA 2IC5A 4HTAA 4YJ2F 1OTHA 3QF4A 1R8XA 1RLMA 1FX1A 1CU1A 3X1KA 1HT3A 5HF9A 1EE9A 1YHYA 3VSEA 1TCUA 3PK0A 2J3KA 3VR2A 3WRYC 2VDWA 4GLJA 1XHEA 1TXGA 3FHLA 2WK1A 4DE5A 5FBRB 3AIIA 4JUCA 4N7MA 4YUYA 2XSZA 1KJZA 4P84A 4M8NE 1PJ4A 3GVXA 1BJTA 2A58A 2H06A 1DOZA 3AEUB 3EEQA 4ONEA 1QKKA 3LHFA 1FFHA 4KQ6A 3SJZA 4DSZA 1B42A 1DWQA 2XYRA 1A7UA 4TWIA 2J1LA 1NZFA 2WUDA 3B48A 4PYMA 1CFJA 4I7EA 1E0KA 3C3YA 3FFXA 4PGMA 1O6CA 1WDKA 4D9EA 4BNHA 5LU9A 2W2KA 4KCGA 3A4MA 3M0EA 4R2WA 2DQSA 4MHTA 2GN4A 3D6TB 4IIJF 3U3DA 5IVDA 2RHHA 2DH5A 1UBKS 1WG8A 2BTQB 3BRWA 2XUZA 3W5AA 5BN1A 4TYPA 2OCAA 3A1CA 2NACA 3QEJA 3U7EB 5AHXA 1Y7LA 3RV3A 2O59A 4M2LA 1NSFA 1NV9A 3BE4A 3DMDA 1PFKA 3BB3A 1MB0A 1RKUA 2GWRA 4JLVA 4C0HA 2HMWA 1NRJB 3DBRB 4IFEA 1UODA 2BFFA 1GTMA 3FPGA 1Z4IA 3MSCA 2VPIA 4KE8A 1DVRA 3C6MA 4LUCA 4XUEA 4F4FA 1EU1A 1RQPA 2XOKA 16PKA 1DC4A 1FNNA 1SB9A 2BFDA 2UYYA 3NDPA 1P4JA 3QYFA 4MJ3A 4QT0A 4MJ7A 3DKIA 3QPBA 5EPOA 1DJOA 3U7QA 2ZAYA 5EI5A 2V7PA 3QWFA 3GPIA 1X1EA 2QA5A 4B35A 2A9VA 2WKRA 1NMYA 3JWGA 5LIPA 3HLTA 2G9UA 3NJRA 4QYWA 4RVOA 1P7YA 3MJSA 4RA6B 1O5OA 5HF6A 2PUJA 1BW9B 4ENWA 3UQYS 1N1EA 4R01A 1UDRA 1P17A 2VHQA 3AGQA 3KPYA 2WD8A 4M53A 3TLAA 4BLWA 2BH9A 1KU6A 3O73A 3ZK7A 4C7XA 2VP9A 2WJZB 1F8UA 3LWZA 3OOSA 2IH5A 2P5UA 3CF4A 2A0XA 3B3FA 3C0KA 1XEWY 4FJ1A 2C2BA 4RYDA 4FJ0A 4TLEA 1P4AA 5CPFA 3UXHA 2W9XA 2HHLA 3PQ8A 4MMXB 2HV8A 2IYAA 3L4BC 4LGVA 4ZAVA 3ZD9A 4BO5A 4RLFA 2GKSA 3BWBA 1BHJA 4C1BA 3FSEA 3OKAA 1W0KD 2FSHA 2VQDA 1NXTA 1R4ZA 3JAWB 2QVCA 3PNSA 4RJIA 2CZQA 3FETA 3U19A 3PNMA 3UMBA 3PDIA 1Z0AA 4YIHA 2DETA 2XHEA 2CFIA 2QUZA 2WQ6A 1TVMA 1LDMA 3ICEA 3TQTA 2IBTA 2WJWA 2FKNA 2BFCA 3GU3A 1APBA 4XSVA 3VAYA 4AFNA 4DUZB 1F7VA 3QENA 4O2AB 1J24A 3MFYA 3N76A 1Y0BA 3WWDA 2PO5A 2OHFA 3A2LA 2PL5A 5AVOA 3TVYA 1SGWA 2XRFA 4L8WB 1J97A 3BN3A 2WM2A 1JAHA 4D57A 1ZI9A 1RSZA 3RSCA 5IJAA 1OI2A 1MW8X 3ROZA 1ZGZA 3PXCX 4ZZ0A 2QN3A 1AUPA 2I99A 1R4NA 3PXGA 5D51S 2I87A 2A84A 3BMCA 4NJMA 4BGDA 1DXHA 1ONBA 2FN3A 2GPJA 3JSXA 4AX8A 1E32A 3F9IA 3U0BA 2Q0SA 1RHUA 4G26A 4C0AC 1SRRA 4K1XA 2JIZA 1ICEA 1L7AA 2Z83A 3ZLUA 1J33A 3OETA 1O9GA 3RVPA 4ADSG 3KTDA 3AHCA 1T8SA 4ZOLA 2WILA 2GFQA 3SYNA 4I4TB 1LNZA 2EEPA 3MMXA 5B5SA 1T3LA 2RH5A 3NGXA 4HNGA 2MYPA 5A04A 2H4HA 3DF7A 2FG6C 1U7WA 3A8TA 3KUUA 4G8BA 5FLKA 3U16A 3K30A 1N8SA 1JPUA 1NQTA 5EJ5A 5CB4B 3CRMA 1TU3A 3KQQA 5IXSA 3H87A 3CTPA 3Q7TA 5EJIA 3RNOA 1Y4DE 4CKBB 3EZFA 5AVVA 4EW3A 5F64A 1MENA 3G9XA 4D3DA 1KI8A 1PR0A 1F14A 4QG7A 5DP2A 2ID8A 1TQDA 2ORED 5FBZA 5IBQA 1ZVVA 2FWIA 3R3SA 3OZ7A 3UK0A 4CLOA 4WFQA 3T0FA 2B36A 2ZBRA 1E9EA 2O23A 1SZPA 1X19A 2ZAOA 1MR3F 3CX8A 5EYPA 5HILA 3FLMA 3K1AB 4OIFA 2X2OA 2IHVA 4JOCA 5AOCA 1TM3E 3HFJA 4RPHA 4QKQA 1NRXA 5EIHA 1FMJA 1Z2PX 3BD9A 4WXHA 4YB8A 5KTNA 3AVYA 3EULA 4QGAA 4NCJA 4FZRA 1EWKA 2OP0A 1B6RA 2VR1A 4HQLA 4O2BB 5G02A 3HVRA 4OHXA 3ZW9A 2FTKE 4OXRA 1O95A 1SQ5A 4OVKA 4RH1A 3Q9LA 5LUBA 1L1FA 5AVXA 4Q9HA 4B2YA 2QRGA 4C5AA 2W4QA 2PH3A 2XVYA 5JO0A 2ZJYA 2R8YA 3QZUA 3GGPA 1Z33A 1NQAO 2KM1A 2PKRA 1NOIA 1Y1TA 2FX3A 2Q5QA 1H5QA 2YY6A 1JEQB 3L4SO 4HH3C 4PAMA 1OI3A 2FVYA 1QGED 3BBLA 3TAUA 5LM3A 4UREA 4JMLA 4CLDA 2DG2A 3AVXA 1MZPA 4L5CA 3D2CA 2YRWA 4QOHA 1YB4A 1RLOA 2E0IA 1CJMA 1LNQA 3W34A 3WB2A 5F7OA 1N0IA 2BM9A 4MS1A 4C78A 4HVCA 3UTCA 1DQYA 2EP5A 2W83A 5B7NA 3IOBA 3WADA 3OZAA 3INTA 4P0PB 3GLIE 4A82A 3MJHA 3C43A 5CYOA 1J2RA 1IBLB 2PUGA 1H9AA 4RWZA 4IIDA 4E5VA 5ADVA 1TUBA 1U6JA 1Y63A 2I4OA 4UJ5A 2XMSA 5FEMA 4CVNA 1Z4OA 1TD1A 4E2YA 4MAFA 3OCJA 1DIHA 2HLPA 1Y1RA 3QEBZ 1E60A 4EMUA 4RAQA 1Z5GA 5EP3A 1P75A 1VLLA 5ITSA 1A3CA 2HFJA 2VAXA 2DR0A 5DNCA 4URZR 3N58A 1H4TA 1V4NA 4BTLA 4GYKA 3SZRA 1SBCA 1RTTA 2FZWA 5FOTA 2A9JA 2AJDA 3DO6A 1ORIA 3PUVA 2JBAA 3W8EA 4R6WA 1ECCA 4H4DA 2O3SA 4GBMA 4PYKA 2Q62A 2HSWA 5DWVA 4JSYA 4NMHA 1IPEA 1H5NA 2Z2ZA 2FUEA 3UMFA 3UT6A 3ZI4A 1QAQA 4AULA 4D98A 2Z08A 4HEHA 2P2LA 3U3XA 3TTYA 2WW8A 4EEXA 4I1SA 1VZ3A 1NMSA 3CY6A 3WL4A 1PGJA 4RD0A 1W2WB 5FNVB 3GLKA 3IPYA 3WL5A 5LQJA 3L1UA 2NYVA 1A4RA 1WF6A 4WDQA 3VR5D 4BV8A 5DYNA 2AFHB 4A23A 3SBXA 4INJA 4DJDC 1C2TA 1DUSA 1KZ7B 3UA4A 4G3XA 1GUAA 1N6RA 1T0BA 4Q9AA 1TYBE 4IIGA 1NKTA 5LL6P 4KO2S 4O02B 4H31A 2D1TA 4GPAA 1Z4JA 5A1TA 3HN6A 1P80A 2I3GA 4C4ZA 4LC1A 1G8AA 4TS1A 1FRQA 2IT1A 3H97A 4ER7A 7REQB 1RZVA 2PUAA 4EGSA 4ZT3A 3VDXA 1ZGGA 1JZQA 1ZX1A 4DIBA 1BEZA 3U4DA 2WMYA 3PE4A 2FPPB 1X7ZB 1JYSA 3QFTA 1XZIA 2AA3A 1P61B 4JN6B 1PK9A 2AQ8A 4QYIB 1WJGA 4H6XA 1FF9A 3PF8A 4HAWA 3CPJB 3C3EA 2QP3A 4D80A 1F9AA 2R4TA 4D0GA 1Y1KE 5T8KC 1ZQ1A 1RLJA 5EJEA 1UBCA 3IVMA 2BIFA 2DWQA 4FYPA 4MS1B 5AM5A 1DL5A 2NN3C 1RXVA 4KSBA 4D5EA 5B53A 1Q0LA 1DV1A 2OO5C 1IEXA 1TNDA 2CDBA 3K0CA 4H17A 3DKPA 2FSFA 4JODA 2VP6A 1VIVA 4JX8A 1SM4A 5EIFA 3V97A 4TMYA 4M60A 4DG8A 2X1HA 2C5EA 4GH5A 1SD5A 4OM7A 5IDXA 1EXVA 4OB7A 4BEWA 5CLLA 2V98A 4B0PA 2H2DA 1KJQA 1LX7A 1O3YA 2D54A 4JIGA 4JYMA 1RWXA 4P0TA 4XD2A 1XQXA 5CDSA 1E1RA 4KYIB 1RC1A 3ELUA 4EW6A 3GDHA 2GZHA 3SJUA 4F5YA 3OJFA 5LMCA 4NE9A 2FEKA 1VCNA 1IATA 1MG5A 1X7HA 1DRJA 2EW1A 2QZSA 2ZT7A 4Q02A 1Y81A 3O75A 2XCUA 4D9HA 1GADO 2ZSUA 1OWMA 1YR1A 3I23A 3VVLA 4B48A 1PO7A 4ZO6A 1WQ1R 1X0XA 2NZYA 1GGHA 2WBLC 1T4CA 3W2TA 4C0LA 1FTQA 1ZW1A 3MQ4A 3SNKA 2XE7A 2J0QA 4LTMA 5A9RA 5HJEA 1GDHA 1USKA 2FFQA 3AHGA 3ESZA 4UHBA 4YP1A 5LPNA 2YV5A 3N8HA 3OURA 1AMNA 4KO1S 1EUCA 2E4AA 3W0LB 2IU4A 2QLBA 4H1WA 1BCSA 3S68A 2VXCA 5ADUS 4LX8A 3L7NA 1PQ4A 4Q15A 3B5EA 3S5JA 1HT0A 1XVTA 3RK4A 1WVIA 4AXXA 1XPRA 1CPYA 4JITA 4V0QA 1Z2EA 1K7SN 4LXXA 2J9FA 2CDRA 4CMCA 1E1YA 4RWEA 1FXWA 4W7IA 2ZPTX 3OZVA 4AMYA 1GQ2A 3KHUA 1U7ZA 4N41A 2KQUA 1NJ6A 4HAYA 4QOIA 1YU9A 1JF8A 1VP3A 3E3AA 4RQBA 3VNAA 4Y1EA 4N3GA 1KYWA 2RD2A 3L49A 1E59A 3D4NA 1TTPB 1XU4A 2FCRA 4G84A 1GKLA 5LOVB 1Y5NA 2HTEA 3I1YA 4JEMA 1Z13A 5C0OE 3VH3A 4B4OA 3GDOA 3ZDEA 2C3PA 2M6SA 3G6KA 4GMFA 3DZIA 3RVRA 5JS2A 1KQGA 3CRW1 3Q8MA 4QDUA 2O8FA 3UW3A 2VUHB 1YR7A 1XYGA 2D1QA 5I9NA 1FE8A 2V45A 5DIZA 1AKTA 2GAIA 1RMTA 2ZAMA 1KARA 5C34B 2HK8A 1E1LA 2HZBA 3QGMA 4MW1A 4QOJA 3SEFA 5AESA 1PNQA 1G66A 2ACVA 1W4BA 2CHGA 3KZMA 3DHWC 1SIOA 1VKJA 4BX0A 3FLEA 3HABA 3HM2A 1LH0A 5EJFA 3IEVA 2JKYA 1XNGA 2LP4Y 4Z3KA 3UH0A 4XYLA 3ZGOA 4YJGA 3QWBA 5ALUA 6GPBA 3HGMA 1TX4B 1HQDA 3FPJA 1D0IA 3IUSA 3UB2A 2QZPA 3N6RA 1JJBA 4TMXA 4ZU6X 3X1WA 2QY6A 3DVAA 1J39A 1XHLA 4RGYA 2CZGA 5LLSA 4EABA 5HE9A 5DE3A 1T4BA 3FUUA 3NBXX 2ZWPA 4U0KA 4JDUA 5F2NA 3DYVA 3SS9X 4BUZA 4K9QA 1IEQA 2QN7A 3I83A 4BMCA 2Y1FA 3EZ2A 4K9OA 1DJLA 1NBWB 2WU0A 5EE1A 2WHXA 3SE0A 1K2WA 4C0SA 3ZJTA 4MDFA 4F86A 2I80A 4GI2A 1K75A 1ZJ4A 2NUAB 5CJJA 2PXXA 1NR7A 1PS8A 2ZYHA 4P38A 4GQIA 2PUEA 1FU8A 1RVV1 2BZ0A 3EIFA 2OBFA 1QP0A 3R40A 3MC1A 4MDEA 3GLFB 2BY4A 3DV9A 2ZZKA 1JG1A 3AQIA 1J09A 1Z2OX 3EFOB 3ONVA 5CJPA 3F0TA 2GO1A 1F17A 3GLRA 1V6SA 3EEIA 4CE6A 4EJSB 1EG7A 4QM6A 3CT4A 3CEPB 3LFHA 1C3JA 3PHLA 1R74A 3N8IA 5G0TA 2XMRA 3H9QA 4TLMB 1BN6A 4ZZ2A 5KOHB 1X15A 3B3QA 5BR1A 4FNOA 5A02A 3Q10A 1GPKA 4ZMRA 4PZ9A 2IUYA 2ZT6A 1II8A 1N2CE 4HN2A 1HYGA 2X9NA 3KVOA 2VYND 3AKYA 4R05A 3ZV4A 5J2UF 3KKEA 4ICIA 3RUCA 4HNVA 2AJTA 5KTMA 3IJ5A 3QX8A 5IF3A 1PYOA 1E92A 3WSVA 3WMFA 3PX3A 3I61A 1N2IA 1F9EA 3HHEA 4JZYA 5ESXA 3K9FC 1N0WA 4JB3A 1JXOA 1CY4A 3ZZ1A 4AUKA 1ZSVA 1DO8A 3WRXC 5ADHA 3SVTA 3DEAA 2C00A 1SA0B 2BSXA 1FCJA 4LWPA 5KU7A 1KZ9A 1SUCA 4TTJA 3WG9A 1V0JA 2BJHA 2FQQA 2OXIA 3ZUGA 4TLBA 5GP1A 2BGMA 1Z2DA 3ABSB 3EC1A 4GIBA 1OIWA 2FW9A 3RBXA 4F11A 5CLJA 6ADHA 1NNLA 3WB0A 2W42A 4ND2A 2WSLA 1VKNA 5E1DA 1EFPB 1QIGA 1T5TA 2C5FA 2AHOA 2C9MA 4IJWA 3JYOA 4PBSA 4TS4A 3WNBA 1JLSA 4D0RA 4O2AA 4OK3A 1I5RA 3DPIA 1VJ0A 4MV6A 5IU6A 5ER9A 2VDJA 1LQ2A 3C14C 4KO3S 2AN9A 3EE6A 1WZCA 4C2TA 5I3CA 4QJ5A 2IBSA 2W2KB 2HCRA 3TRKA 5I45A 2YZMA 1DJQA 3LXUX 5LZ4A 1MXHA 3GEMA 3SQWA 1ZHOA 2X0KA 2VUUA 3NHFA 3EY9A 4RVDA 4QG3A 3NBKA 3QA9A 1ZUNA 3NIGB 3IMKA 1M9NA 4LZLA 1U1CA 2HSEA 3FPFA 3PIRA 1WOYA 5CRIA 1BE1A 1FFXB 3KU1A 1GEGA 3HCAA 3TLGA 5HIKA 3QE2A 4GPIB 4QXRA 4EG4A 1AMOA 1KEEA 3MM4A 5HA5A 2CB0A 5KVAA 3OM0A 1Y3IA 2QG4A 4A8HA 1J8FA 3HR8A 3PC4A 4C4YA 5IJWA 5LNK1 3SE7A 2YJZA 1J1IA 3JWIA 1WKBA 4Q7EA 4PLYA 1ODLA 2GBPA 4MVJG 4J0DA 4R40A 5I7UA 1HH4A 1OZGA 1RPTA 1U8EA 4D82A 4ARUA 1MAVA 4YONB 3AV0B 3A9CA 2OCYC 3OQIA 5CAEB 3G59A 4BWGA 2XLCA 1ZIYA 4PLFA 4OGGA 2PGIA 1KVTA 4TYMA 5CEJA 2WJGA 2VRCD 2ZJ5A 3LT4A 2F9LA 1DCFA 2HSGA 3NTXA 5F12A 1NSYA 5BN3B 1VCOA 2G7MC 2OCIA 4K6CA 4QJIA 1LPOA 2OUIA 3ABOB 2JVJA 1KTVA 3E1SA 5GOZA 1SXJB 3VSBA 5SY4A 1A9XB 5D6OA 1MG0A 2Q5LA 2Z1MA 1IXZA 2DCMA 5AIAA 5IM4A 2H1SA 2JDID 3Q4GA 4XIJA 3GLIB 2ERXA 3UA3A 4OAQA 2YV4A 3V7UA 2C7QA 4LDZA 2W90A 2DAPA 3NTUA 4F6RB 3TGPA 3HKDB 3ZOKA 1GZ5A 1QGUB 3I5UA 1UC5B 2O0LA 2SHKA 2E6KA 3QUSA 4IJVA 2NO9A 4OH1A 3JVUA 4MUNA 1O5IA 2ATEA 2D5BA 4CEJA 1SU4A 4B81A 2PGLA 3N2ZB 3L82B 4PIMA 1UMKA 3KOMA 3S3TA 3COJA 2H0QA 1MJFA 1A98A 3DXFA 4ZAGA 1MKYA 3C5HA 2PJRA 3HEAA 1Q0QA 2Q8NA 3ABRB 1WV0A 3GAFA 5H1YA 1NLZA 3IJRA 3IOYA 3WOVA 1B2LA 3I3OA 5JZ9A 3RVSA 2I8AA 5B64A 2H0RA 4LMRA 2FXIA 3FVTA 4UOQA 3LUDA 1PD0A 2BI8A 4NU5A 4RVCA 3IVCA 3M4XA 1RCUA 1QCDA 1FDIA 3WIVA 4H4CA 4TLLB 5JASA 2GYUA 1OTYA 4KODA 4NJMB 3O1IC 1KI6A 1TUGA 1VSVA 5K01A 1AZWA 2FOXA 4WAUA 2NPOA 5FXMA 4QPDA 5JI3E 4DV1B 3F4LA 1FW6A 3ZCTA 1A7KA 5F33A 1M8JA 1OFHA 4GNKA 1IHPA 3HYCA 1W1IA 2NYRA 3T94A 3AEQA 4GE0A 3SJBA 4LFBB 4YUVA 4RMJA 2XNDD 4FKBA 2VPXA 4G8CA 2QM3A 4TTSA 2AJBA 4TVSA 5TQ0A 4FK8A 2BV3A 3BBPA 4KZKA 4X1IB 3MJFA 3ZWVA 3R3VA 4FEEA 1SG6A 4M3NA 2X40A 2IHTA 3U3OA 3TK1A 1XF9A 1JVNA 4MS4A 4P86A 3EC2A 1NXWA 5K3FB 1VG8A 1IMOA 3FHJA 3PNVA 4QUHA 3AR3A 2QE6A 3ADDA 3O82A 4UZFA 2AFHA 1MLDA 1S2IA 4TV8F 4H16A 3HVJA 3OD1A 4MR8B 4EO7A 1YVRA 1NVFA 1L5FA 5IF9A 3GZNA 1X1BA 1W35A 4TGLA 1DFHA 5A03A 5D3KA 2D7DA 4YMIA 1MN6A 1AE1A 5BT9A 4LZZA 3SM9A 3UMGA 4Z4HA 1DBPA 1NW7A 3GJ3A 2QN2A 2CCGA 1FQOA 3D7MA 3CPSA 4FOSA 4N54A 5HQ3B 2FFAA 2IEAA 2TMKA 3GO4A 4RV4A 4D99A 1HFEL 2WLTA 3KTAB 2Q6IA 1R27A 1PFGA 4E6PA 3L84A 1BJRE 4EGCB 2E4YA 3O94A 1KSFX 1UWLA 4BLVA 1R5JA 4IDHA 2YDXA 2ZSJA 1UK7A 2HEIA 2E4WA 4HMPA 4IKOA 4RTMA 3OCWA 3FVQA 3V8EA 3T1YB 3PIDA 3BUSA 2B83A 3DHNA 3IXMA 3LYLA 5KOJB 4NFHA 1P73A 5EJ7A 1YBFA 3CVUA 1ETUA 2WHQA 3NC0C 2QTTA 1GHTA 4GVLA 3VPAA 1V11A 4GSLA 5B2FA 2ZI3A 5D3QA 3UAYA 1MP0A 2J9RA 2ZSDA 1V96A 1EAMA 2GSWA 4F2HA 3CXRA 1LPAB 2G1PA 1P81A 4GOXA 4JUFA 1T24A 4UULA 3KHSA 1YULA 3KCQA 1TF7A 3EXEA 3A14A 3ZU2A 2W2LD 2K6GA 4F4DA 1GSIA 3VC7A 1JKFA 5JJ5A 4HBGA 1X2BA 4M55A 3C7KA 3P4UA 1FIUA 3GB9A 1QV6A 3CZ5A 3O3MB 4K6FA 4BB9A 4KE9A 1DTWA 4JLOA 4ZPJA 1UBJS 1DTWB 2R2AA 2HNKA 2Z9BA 4JJKA 1Q20A 3USES 3ZWWA 3TL3A 1K06A 3SWWA 3TNFA 3GEDA 3RFUA 1HF3A 1IN6A 3H3JA 2N1BA 4INZA 4MRRA 4OIMA 5C1BA 4DZRA 2YXEA 4MRPA 4JP5A 3O92A 4CKZA 1LC0A 4CCYB 4TKVA 5B3JC 2ZT8A 4J2HA 4F4JA 1PL7A 2QEQA 3DBHA 1V25A 3N0XA 3WYBA 3LE8A 5DRTA 1FQKA 5FPSA 1Z4PX 2WM3A 4O3MA 3AVUA 2J7KA 2BGLA 3JQBC 1VLVA 5EKDA 1E7QA 1QE3A 5JD6A 4BO9A 1DRKA 3PRJA 3SXUA 2G9QA 3T3GA 2GZMA 3P9RA 2QUIA 1IN1A 1ZCZA 2QSZA 4QYSA 1O6BA 5CUQA 1HDRA 4LYGA 1C7EA 1CD5A 2KW5A 1OYVA 3LV8A 4YRKA 4L27A 1RBZA 2W2VA 1YWGO 2OAP1 5C51B 1D8AA 1AGYA 5I9MA 3BH6A 5CB6A 1VFNA 1A82A 2VTEA 2BCEA 2NNWB 1YRAA 2V5AA 4D3YA 3KQHA 2PNJA 5JMPA 3K2BA 2ZSAA 1SUBA 1VRWA 2XWQA 3PCTA 2AE2A 1V5EA 2CLHB 5BQOA 4PSCA 3NP7A 1EI9A 2I2AA 4IW3B 1IAQA 3LWDA 1HGXA 3ET5A 1K6XA 2G07A 5K0SA 1M74A 1C1HA 1O54A 2CBZA 1U9CA 4PZZA 3A26A 5LKRA 4QBTA 3K0FA 2BEVB 4AW9A 5C8DA 1WX1A 1O97D 4KR9A 3D6FA 3BD6A 4NICA 5U1PA 1NVUQ 2EQAA 4ODIA 3OM8A 2F8MA 1L8AA 3QHQA 4L16A 3K73O 4IWXA 2QBYA 1L5QA 1O6ZA 3CCBA 1WM1A 2QTMA 2J5RA 4IJQA 5D3MB 2UZ0A 1I5OA 3WWZA 3PVZA 3V4VB 4Z6KA 3QJ5A 4WESB 3WRXA 3FOCA 3BKWA 1W96A 2HDNB 1S1MA 1L0BA 3N2NA 3H4MA 4GM1A 3WE7A 3RTCA 3CLRC 4DNOA 4L73A 1YU6A 2Y3IA 2YQ5A 1U5AA 4PSKA 4OQDA 5C4MA 4FMBB 3BHMA 4M89A 3BOSA 5A0TA 4M4SA 1SIUA 1C14A 2VP0A 2WUVA 3CVOA 4Y1GA 5T67A 4B09A 5GVRA 5C18A 2MR6A 3O4HA 4D3FA 1UT6A 4WWHA 4RHEA 4ZI3A 2H7CA 2YZNA 1FFBA 1UUFA 5DM2A 3SLGA 3T3PB 4RHFA 4LECA 4RJ2A 2QPOA 2HYDA 1H8HA 2CNWD 3MCZA 4X91A 1QYIA 1KI1A 1UPBA 1YS6A 2XIQA 4N03A 4AJEA 1KAMA 3ROPA 4F8JA 3UIEA 3T9AA 1EVIA 1CR2A 2QRMA 2JIRA 2Q1TA 4A1FA 1GQQA 5TQJA 1WULS 4HK4A 5GY7A 4RPGA 2QW8A 3NWBA 5H0IA 3M1YA 3EYWA 3MCTA 1I4WA 5HW0A 1J0DA 5TS3A 3UFXB 2V3WA 1RT9A 1U7UA 1NTOA 3IUYA 3UO8B 3BTUA 1A9RA 3FF1A 2OXFA 3OJXA 3A4LA 3LQRA 4Q3DA 1P2TA 2PCLA 2F67A 3VNSA 4MNTA 3SSAA 1BJKA 3LLUA 5TS2A 1G9TA 3EK2A 1AUQA 1HM5A 1I0ZA 1OWPA 4QECA 5ALXA 4K2AA 4RHCA 1KFEB 3IT1A 2EGGA 4J75A 4Y2GA 1YUBA 4WZBB 3UANA 4W8OA 3WS7A 2OILA 4EHKA 1WBBA 1W6UA 4M1KA 3MWDA 1E2NA 3GEGA 5FNVA 3AESB 4G0PA 1JAYA 4NS1A 5CBKA 1ZCBA 5HK8A 3CX3A 5CTAA 3WIDA 5FV4A 5IEJA 2C7PA 3WLJA 1CQIB 4CIWA 4ZVVA 1ISFA 3K8ZA 4JLDA 2E6UX 2FAXA 3HG7A 4FB4A 1XMXA 2P0EA 1ZW6A 4OMCA 2YY7A 1G9XA 4JV5B 1XU9A 3KVYA 4XB1A 1KJWA 1AG9A 3BGSA 2ZYGA 4JLWA 1HDYA 2XE8A 5BQPA 4NK5A 3NJ8A 4IXTA 3DDSA 1Z3IX 2JGNA 1P5RA 3IQFA 3WSTA 3ZZTA 5A9SA 5DTQA 1RI1A 3UUWA 4R0NA 3BF8A 1GZ6A 4ZV4A 1RLUA 2PO7A 5CNMA 1K63A 3R6GA 1K66A 4K0RA 5ALZA 4F2WA 3S1SA 5BSTA 2HO4A 1O57A 2W6IA 1SKAA 2ZE6A 3DQPA 2I7CA 4MRSA 3U49A 2Q3FA 3LPAA 2B94A 2AUTA 2GK4A 3O4RA 1NRIA 3PEVA 4FFPA 4GX1A 4L9SA 4UBOA 1A1VA 2B82A 3AKZA 2O8CB 4L2IB 4EATA 1P2GA 3T41A 1RHRA 1G291 1JW9B 4DW8A 3KWFA 5CA0F 5CDFA 4RVSA 1BU5A 2WTNA 1RRKA 4WNCA 3GUYA 5C37A 1TTHA 3INYA 1ZD8A 2VHUA 2TS1A 4O5OA 1JP7A 4RIFA 5CDTA 5L45A 4YDHB 2VJKA 3SFTA 3WGNA 4UPDA 5IN5A 3T3EA 4ZHSA 3U37A 4LGCA 4XWAA 3W8FA 1E4VA 3W5VA 5ERGB 5JCOA 2E82A 4ZIRB 5JANA 5DN6A 1Q15A 1MUUA 2ODAA 2DH6A 2XADA 3ZNOA 3L8HA 1N92A 1ORVA 1OWNA 1U0SY 1L5WA 2NXWA 1OF1A 2R6JA 2J8ZA 3G7NA 3GD7A 1AK1A 3RS9A 3IBYA 4PLPA 3ZWXA 1A5BB 2BEUA 3IKMB 4OHUA 3QQPA 4NKRA 4YRLA 3WYFA 4EMBA 4I2VA 4F6LA 4I14A 2OAGA 2UYOA 4RVFA 4JI6B 1QO0A 3CLVA 1G98A 1VJTA 1ECBA 4QATA 3USCS 4AZVA 5BSKA 3BQMB 3FZEA 1Y6GA 2XDQA 2QVZX