2X7HA

Crystal structure of the human mgc45594 gene product in complex with fenoprofen
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
343
structure length
343
Chain Sequence
IPQAMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ZINC-BINDING ALCOHOL DEHYDROGENASE DOMAIN-CONTAINING PROTEIN
publication title Crystal Structure of the Human Mgc45594 Gene Product in Complex with Fenoprofen
rcsb
source organism Homo sapiens
total genus 117
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x7hA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2x7hA01
2POQX 4IIUA 3NX4A 3HWRA 3IJPA 2J6IA 3WIDA 1N7GA 4II2A 5TJ9A 1DLJA 4OXKA 2DU8A 3DZHA 4NBTA 1BRMA 3GPDG 4CMAA 4CV2A 4FW8A 3Q3CA 2Q1SA 1P9LA 4RVDA 5AXAA 3FR7A 3HNPA 3QE3A 1I01A 1MC5A 2GN4A 1QV7A 4XIJA 4NH4A 5FYDA 4DUPA 3D64A 4NPCA 4XDYA 1LSOA 4RORA 1NYTA 1EFKA 3LF2A 5JLAA 3EDMA 3PQDA 4A5OA 5K6AC 1U3WA 5CDGA 4BB5A 3ZHXA 5I9MA 1ZEMA 3GH3A 4URFA 1ENOA 2EGHA 1XR3A 3T4EA 3UOGA 4XGIA 1DIGA 1WZEA 5AYVA 3PK0A 1HDCA 2BH9A 4R1UA 3GGOA 3SJ7A 3OBBA 3D3WB 3LT2A 1YS4A 1R12A 2Y93A 3F1LA 5TC4A 4LRSB 1SOVA 4OXNA 5DCWA 5IZCA 3WGZA 3C7CB 2WYUA 1I24A 3FPLA 2OORA 1U4SA 4GX5A 4YRDA 1A71A 5HS4A 3RC9A 1M66A 1IY8A 3I6QA 4IQ0A 3RUAA 2P9GA 3CSDA 4DC1A 3HSKA 3WOHA 2X8LA 2Z1NA 1RPNA 3JQAB 2CMDA 1MA0A 4JBHA 1E3JA 1XU7A 3OH8A 3R1IA 5HWSA 2WEKA 4R9SA 3ABIA 5T5QA 3PHLA 4ZHSA 1LJ8A 1Y1PA 2QW8A 1DXYA 3DBRB 5I9NA 1QORA 1LQTA 1PQPA 3HDYA 4ITUA 3KETA 1GYPA 4INAA 1DFHA 2QRLA 2AQ8A 4BNTA 5BNIA 2H1SA 2PLAA 2VZ8A 4IQGA 1PS9A 1EE2A 5L95A 4J9VA 3PDJA 4R5HA 2EP5A 2ZJ1A 3LK7A 4FR5A 3S2EA 2QYTA 1DC3A 1SNYA 2Y0EA 5TJHA 1VC2A 4EGFA 3E5MA 3Q1LA 1BW9B 3TOZA 3ONDA 4NMHA 4BO5A 3H65A 4KDEA 4GAEA 4TWRA 5EPOA 4ONEA 5KIAA 1GAEO 2AQHA 1FDVA 3H5RA 5THKA 4BNXA 3GDOA 2JCVA 1GV0A 1GYRA 4J2HA 4TQGA 3ETDA 2F1KA 1I3NA 3DHNA 5CPFA 1RKXA 2YV3A 5FI3A 2OXIA 4P4NA 3E9MA 1DFGA 1BTOA 3OA0A 5COAA 4Z6KA 3PVZA 3WSWA 1Z73A 3NTRA 2DC1A 2FY8A 1A9ZA 4GGPA 1HZJA 2ZQYA 3HB4X 4JIGA 1X7HA 4GX1A 4CPDA 3DBHB 1VLLA 3KEQA 3DZKA 3QJ5A 4KMSA 1Z82A 4PG5A 5JCJD 2I65A 1GEGA 3PHJA 4F6LA 5BSHA 3RUFA 1HKUA 1PR3A 3FNFA 2Y1GA 4J0EA 4YQYA 4RO0A 3R3SA 4JX8A 3TOXA 1HYEA 1DC5A 4PLTA 1R0LA 4CUKA 4J0FA 3RROA 2VWPA 1HTBA 2EKQA 4MVJD 1KC3A 2JD1A 3KBOA 1UXKA 5TF4A 1A27A 3VZSA 4RPHA 1HDXA 4FSHA 2JHGA 3F4LA 4ROSA 3U3XA 2A9FA 4GX0A 3O8QB 4OMUA 3ADOA 2NQ8A 2JL1A 2V6BA 4CV0A 3UF0A 4A10A 4ZD6A 3NDIA 4LCJA 1GCOA 1F14A 1E3SA 3OQBA 3I9KA 3TFQA 3UAGA 4XWYA 2GDZA 4B4OA 4WCFB 3VOSA 3LT4A 1B14A 1E7SA 4DBZA 1F12A 4GVXA 2VOEA 5TGDA 4CQLA 3IJRA 2PA3A 4NJOA 1SB9A 3PFWO 3JQBC 1DC6A 4YJHA 4IY1A 3RAJA 4NBVA 2VNAA 3QV1A 4O59O 1BXKA 3JD0A 5TT1A 2QHXA 3BMQB 1GYQA 1YQGA 2J5KA 2IZZA 4YAIA 3VVCA 4JP3A 1PZGA 1EVZA 3HDJA 2ZATA 3GEDA 1XA0A 4R68A 1Y6JA 1XU9A 2IXBA 3Q2IA 3TZQA 4DPLA 1E5QA 4TZKA 1NVGA 4AJ1A 4B7UA 2PGDA 1HDZA 4MVJM 2YDXA 3O9ZA 4PZCA 3RASA 4N5NA 3KHUA 3AUUA 2B69A 3N58A 1NHGA 4NK5A 4DVJA 1YO6A 3JYQA 3VZPA 3RFVA 1U5AA 3QVOA 4I08A 5JCJA 4BOYA 2UYYA 4ND3A 3SLGA 4AJ2A 2V6MA 4HX5A 2NU8A 1NR1A 3NT5A 1H6BA 4ILKA 1CRWG 4MDHA 4Z0TA 1MB4A 3SC4A 1IZ0A 4IS2A 3DBLA 1DAPA 2Q46A 5CPBA 1H9AA 3QHAA 4MVJA 4RZHA 1J0XO 3GAFA 3DONA 4EYEA 2ZCVA 3L9XA 1SC6A 4XDZA 3RCBA 1WDLA 4FGWA 3V1UA 3BAZA 5A06A 2XF8A 4WECA 2GCGA 3BTSA 3GK3A 1GTMA 3C8MA 1SMKA 4JXKA 4D79A 1TEHA 3ZV6A 1CYDA 5K1SA 3JTMA 1MG5A 2HMTA 4DQXA 4EUHA 4J91A 1ID1A 2NVWA 1BG6A 1HYHA 2YHUA 3HDHA 1H6DA 3GVHA 2ZB3A 4O6VA 1VKNA 3PLNA 4RCVA 1UXGA 1PWZA 2A92A 3QVWA 4I5DA 2NADA 4MVJI 4R69A 3NGXA 4PFJA 5ICMA 2O50A 4TRRA 3BMOA 1VSUA 1BXZA 1GQYA 3AOEC 1R4MA 1X0VA 1PJTA 2X9GA 4CQLB 4PVCA 4XZ3A 4EW6A 1D8AA 3JV7A 4KTTE 1MXHA 3PLRA 1Q7CA 4BB6A 4YJFA 4PCVA 5IN4A 3EGOA 1LLCA 1P1FA 4FFNA 4RPKA 3ZWWA 1HDRA 1Y5MA 5A05A 1LRJA 3TRIA 3VTZA 3DMTA 1VJ1A 1JN0A 3AU9A 3RUHA 4K28A 4WEQA 3KYCA 1OC2A 1PJCA 2AEFA 3PQFA 2BRUA 3F6YA 1H94A 5C7LO 3JQ7A 3V2UA 3LC2O 4XB2A 1HDYA 3GHHA 5JC8A 3RUDA 5L4SA 5KOIA 1U28A 4B3HA 3R6DA 1HL3A 1PSDA 3CXRA 5KKAA 4YRAA 4CMJA 1BSVA 3ZV4A 5KNLA 2PD4A 1XEAA 1Y8QA 3I9OA 4N5MA 4W7HA 3E9QA 4XEHA 3K2EA 3KSZO 4G65A 4R3WA 1X7GA 4FGSA 2X0JA 3I9NA 3P5SA 4DIBA 5BNTA 1SEVA 4TMFA 3MJVA 2OP0A 3EK2A 3ZDFA 1XWFA 5G0TA 1GZ4A 5A9SA 4WOKA 1K89A 3PYMA 4BO0A 4RVUA 1YVEI 2P91A 4WGGA 2EW8A 3NV9A 2Z1MA 4YXFA 1EUZA 1LA2A 2PKQO 3SX2A 2W90A 4TKLA 1Y81A 4CMIA 3EAGA 1LLDA 3LC7O 4MVJH 5MDHA 1GADO 1C1DB 2V7PA 4B7CA 3OMLA 4PG7A 2C5EA 4DYVA 1D3AA 2HLPA 4PVDA 3ZWXA 3TL3A 2JJYA 4EITA 3GG2A 3PHIA 4I9HA 3GEMA 5EMHA 1PS0A 2TMGA 1IL0A 2VRBA 1K6JA 3SEFA 1XDWA 2BI7A 2NQTA 2HMUA 1NQTA 3G1TA 3NYWA 4JGBA 4L4XA 4P22A 4J43A 3OQ6A 4GL4A 4BGEA 1A7KA 2X0IA 2VUTA 5CDTA 4IGEA 2PH5A 1NWCA 1FXSA 2BF7A 5F5NA 3VPHA 4IPTA 1GCUA 4MP6A 1ZMTA 4QX6A 4UVGA 4Y67A 1IHYA 5DN9A 1J4AA 4E5MA 1YDEA 1D1SA 3RSHA 4H3VA 3SXPA 3K92A 3L07A 4CQMA 3L6EA 4E12A 5CDSA 1DIAA 4UULA 5IDQA 5JNLA 4IJWA 3NGLA 2P4HX 4FC6A 5AQ1A 3EMKA 4UEJA 3UKOA 2H9IA 5A1TA 3GY0A 1ZK1A 1LX6A 3GDFA 4C7KA 3MWDB 1JWAB 3DZBA 5DP1A 4XR4A 3PZRA 1NNUA 5IZCC 2AEMA 2EG9A 2FP4A 4J4BA 4CM3A 4R54A 6LDHA 1MUUA 2VZ9A 2NV6A 2Q50A 4WPGA 2EKLA 4XYLA 4E2ZA 1IOLA 5KWEA 3DZJA 2GUGA 1GUYA 3EZYA 1R66A 1YJQA 3WB9A 3JQGA 5IXYA 1C1XB 4CM6A 4RLSA 4YVFA 3ANLA 4LRTB 5A9RA 3L4SO 4PG4A 2EW2A 2HKIA 1TT5B 4S1VA 3GFBA 3C7AA 3H9GA 3TZ6A 3INRA 1LLUA 3PHGA 1XHLA 4WLUA 2O3QA 1SO8A 4AICA 4CMCA 4I8XA 5A9SB 1NQAO 4CLRA 4XB1A 3VH4A 4MINA 1UZNA 1M76A 4XJTA 4J49A 1KIFA 1UJMA 2UUPA 4FIZA 4E5NA 1EK5A 1E6EA 5K0ZA 2FRDA 1EQUA 5I7EA 3AWDA 1NWHA 2BGLA 1EMDA 2O7QA 2RCYA 2JCYA 4WLFA 5HRUA 1YWGO 4JNKA 3ZWYA 1Z7EA 2G1UA 2O4CA 3S2FA 2Y67A 3ROMA 3UHAA 1E3IA 2RIRA 4CODB 4HY3A 3MWEB 2J5QA 3WGYA 3OFSA 5GY7A 3WSVA 1WXDA 1DHRA 1PZHA 3OEYA 2Q1UA 2FPPA 1E1NA 1A5ZA 5DOVA 4J1NA 2GN8A 2I76A 1HYGA 2C7VA 2VYVD 2Q2QA 3EW7A 1JKIA 1R4NA 4W99A 4LGVA 4BO4A 2GZ3A 2O3RA 2FMUA 1LSJA 2QRJA 1LRKA 3WBBA 3W6ZA 2LDBA 1OBFO 1ONOA 1UP4A 1AE1A 1GL3A 3K9QO 3M1AA 4R01A 1T24A 1I3MA 3PFFA 2YDYA 2NVUB 1BVUA 4XRGA 4AJNA 3D1LA 1A7AA 2DTDA 2GLXA 3DZIA 2AA3A 4XA8A 4D41A 4E13A 3NDRA 1P1HA 1GV1A 2X23A 4MOWA 1FDWA 2OGUA 3CINA 2X86A 2D4AA 1LQUA 3EUWA 4XJSA 4YB8A 2RHCA 1ZKMA 3WYCA 3WNVA 2JHFA 4IDCA 5KTKA 2ZTUA 5DBGA 3WWZA 2HJRA 2PNFA 4OKNA 2V65A 3O03A 3LDHA 3BTUA 3ITKA 5HA5A 4PLZA 2Y0DA 3E1KA 4P8RA 4YT8A 1DEHA 2DTEA 4ALNA 1CQJA 3ZNOA 1IPEA 1E3WA 2IYPA 5JYDA 2LDXA 3IDSA 3W8DA 1FMCA 2FSVA 3FWZA 2VT2A 5DCYA 4FD3A 4Q9NA 1ZH8A 2UDPA 2BFPA 1TXGA 1V6AA 2NTVA 1T2DA 3O38A 4PZDA 4K26A 1DIRA 1ZO8A 4A26A 4AVYA 2C0CA 2BLLA 1UXHA 1ZUD1 3WQRA 4HFJA 3WWYA 4CLRB 1Y8RA 4ZQBA 3G3EA 1ONPA 1P1JA 1TB4A 5TX7A 5IG2A 4YBZA 3FR8A 4NHEA 1K5HA 1EK6A 1WLYA 3VKUA 1E6UA 4ZGWA 1H5QA 5EL0A 5IDXA 2VYVA 4AL4A 4NFSA 3B20A 4YT5A 3GZ4A 1GQ2A 3ZU5A 1WW8A 1UR5A 1E1LA 2D2IA 2B83A 1E3EA 4JROA 5EERA 3RJ9A 3DC2A 4GVLA 4I9UA 4J4TA 5KVSA 2Y66A 4YEDA 1K3TA 1O0SA 1RWBA 4FOSA 3DAFA 1OI7A 3LQFA 1R0SA 4WE3A 3KZVA 1F17A 1YB4A 3JQCA 1FF9A 3AUTA 1KOLA 4CLDA 2Q4EA 4PRLA 3F9IA 1KEVA 3LVFO 3BTOA 1SPXA 3FD8A 2CF6A 4PLGA 4AJPA 4OQZA 3D3WA 4TZTA 3HG7A 2WE7A 1GEEA 4LMPA 4OXYA 1ONNA 4BHTA 4WKGA 1Y9EA 1I3KA 3COSA 3QY9A 4FFPA 4TROA 3RC7A 1N2SA 1J6UA 3BHMA 3U4IA 2NU9A 2WTBA 4CV1A 2NU6A 5EINA 3GQVA 4OO3A 2CUKA 5JAMA 3JQ9A 3JQAA 3I9JA 2QZ9A 4HNHA 5FI5A 2W2KB 1GY8A 1MC4A 4IZIA 4UUMA 4DIFA 4Y8VA 4NZ9A 2I67A 2VUSA 4ZQEA 3DBRA 1DPGA 4EEZA 5L9AA 2Q1WA 3LC1O 3UCFA 1UH5A 4FFLA 1UZLA 3R0IA 1C3VA 3RBVA 1ADGA 3Q6IA 1KYQA 4M86A 2R00A 1X7DA 1WP4A 1V8BA 2B36A 1HETA 3DO5A 4FJ0A 3QW2A 2X0NA 4R51A 3I1JA 4ND1A 3A4VA 3E48A 3TNLA 3ONFA 1Y8RB 1RM5A 5KJCA 4AFNA 1W8DA 2CF5A 4D44A 4MVJG 1BW9A 3P19A 3U49A 1U2GA 3WYBA 3ZNQA 4BMSA 2GZ2A 4RQUA 4W82A 4BNGA 2BFOA 1PL7A 3AI1A 1O9BA 3RKUA 1ZCJA 1HXHA 3GVCA 1LSSA 1U3TA 1PGOA 4UEOA 5U9CA 2F00A 2VN8A 2AHRA 3M6IA 4TVOA 4OSPA 1S7CA 4LSMA 2VHXA 1K2WA 4XQEA 2I99A 2VT3A 1KY5A 4D43A 5I7FA 4XGKA 3U0BA 4ZICA 4IXTA 4M1QA 1VRWA 3VDQA 2EERA 4BKQA 3GHYA 2GGSA 2PZLA 4DMMA 3DMTC 4DXHA 4ZQFA 3EYWA 3PYXA 4R3NA 4AJIA 2YFQA 5EJ2A 3DR3A 5JBIA 3UW3A 3GGPA 1W4ZA 1P77A 1SBYA 3L77A 5H82A 3V1YA 3AOGA 3K8ZA 1WVGA 1LDYA 3H9JA 1N8KA 4JBIA 4ALJA 4FN4A 3NTOA 3DBHA 5C7OO 3ICPA 4N54A 1O89A 4PLPA 4CUZA 2ZKLA 4BNFA 2A4KA 2Y68A 3LSYA 3CZMA 2IEDA 2B5VA 2AMFA 4AJKA 4M89A 1ISMA 3JQDA 4JBGA 4GSKA 3DWFA 3QSGA 3RD5A 5A04A 3WFIA 3U62A 1Q0HA 4AJOA 2ZB7A 3MOGA 1K6XA 3GNSA 1Y5RA 2YY7A 3ZWNA 5AOVA 4NU6A 4GKVA 3OP4A 1T25A 2GPTA 3O8QA 5KVVA 3TSCA 3PIDA 4GPD1 4UUPA 3GT0A 3UUWA 2O2YA 4CM5A 2J3KA 3FBTA 4PGFA 4WCFA 4HFNA 3DFUA 3GMDA 5TRTA 2D0IA 3ZU4A 4XYEA 4IDAA 5AXCA 3SJUA 1MFZA 1E5LA 3FPCA 1IE3A 1VKOA 1YQDA 3DAPA 2ZB4A 4JLWA 1O95A 1R15A 3CE6A 2D59A 3ZHBA 4BKRA 1NPDA 3C1TA 3BMQA 1UAYA 1N7HA 1Q0QA 1EBFA 2O48X 1TT7A 3MTGA 1I2BA 2HJSA 3H3JA 5ER6A 1VL8A 5F1OA 4KQWA 1E1KA 4EI2A 4E5YA 2YHIB 1NFRA 3IQDB 4J7UA 5T57A 1T2FA 2D1YA 3MJEA 2VNSA 1KVSA 4LK3A 2YW9A 3TWOA 4BNHA 5A03A 2DPHA 1BMDA 4IINA 4O5OA 3WYEA 1X14A 3E5RA 3KV3O 1F8GA 3GOHA 3BMCA 5JY1A 3NKLA 1YBAA 2JAPA 1GD1O 1U5CA 4J7CA 3B1FA 3MCVA 1EQ2A 4BS9A 1BDMA 2HK9A 1Q2XA 2X9NA 2CVZA 3HE3A 4A2CA 4Y6SA 4LW8A 4DRYA 3U09A 3IKTA 2E37A 2X9VA 3UN1A 4PN3A 1Z6ZA 1TI7A 1EVJA 1KEUA 2ZTLA 3CH6A 3WQQA 1SB8A 4GGOA 4ZVVA 2RAFA 2X6TA 3VZRA 4YT4A 3RVDA 1QP8A 3QRWA 5K9ZA 1B26A 1HE3A 2C2XA 3DXFA 4P4LA 5HS6A 1ZSNA 4HFMA 4MP3A 3PP8A 4XYBA 3RU9A 4PLYA 3WS7A 3ZZNA 5DBFA 4LISA 3JQFA 2YZ7A 2ZB8A 3GZNB 1UXJA 2E6UX 5KJ6A 3GRPA 3H9QA 1CF2O 4NG5A 4R1NA 4U8GA 5COBA 3WQSB 4QXMA 3E8XA 4NFYA 1HE2A 4L73A 3AM5A 1XELA 1PX0A 1LBEA 4Z3KA 2Y99A 3W8FA 1A4IA 5ES3A 1FDSA 3D3EA 4XYMA 1ADCA 3FI9A 2G0TA 2GASA 4K6FA 2OUIA 3H3FA 5ILGA 3WLFA 4BNWA 1HSZA 1ZSVA 2DQ4A 3RJ5A 1GFSA 3OQ1A 3UGKA 1LDGA 1LSUA 3P7MA 3VH2A 3AFNA 2GRAA 4YAGA 3CEAA 2UUOA 3I6IA 1M2WA 3FNEA 2Q99A 3WXBA 1ISJA 3QWAA 3OM9A 3GLQA 5JAIA 3DTTA 4BQPA 2XAAA 3T7EA 3NEPX 3NT2A 4XYGA 4I9NA 5JPIA 3JYOA 4DTIA 4F46A 2IZ0A 3IUSA 2VWQA 4GSLA 3EVTA 2Q1TA 5CP8A 3WGQA 4BL5A 1JWBB 3RFXA 4B4VA 3UFXA 5KVCA 2YFHA 3ROKA 4IM7A 4NI5A 3GUYA 3S8MA 4BGUA 4DC0A 3MOIA 3ZHZA 3MJTA 3TJRA 4GMFA 4BNUA 1KVTA 4CM9D 1V0JA 3RBXA 4BGIA 3BMCB 4WJZA 2PV7A 2ZYDA 3HFGA 5IZ4A 1WMAA 1PGJA 1AGNA 1PZFA 3M1LA 3QIVA 1PZEA 4TVBA 4MP8A 3L9WA 3GEGA 2WD7B 1NFQA 1U7HA 3AJRA 4B3JA 3DOJA 4MKXA 1ENPA 2FPIA 3WX0A 1F8FA 3E9NA 2ZK7A 2P5YA 4HUJA 1LXCA 4B7XA 1S6YA 2BFAA 3SLKA 1XKQA 1YGYA 3KLPX 3ONEA 3B70A 4QEDA 3AUAA 2IODA 3HFSA 3ZWPA 2HO5A 3L4BA 3IKVA 4MKRA 4BKUA 3E03A 2Q45A 2I3GA 5G0VA 5T67A 1B8PA 1DOHA 1PJ3A 3NJ8A 1TA4A 4E5PA 4DYDA 1IPFA 4CL3A 1C1DA 3PEFA 1OAAA 4EZBA 2O2SA 2GF2A 4XD2A 3KVOA 4L4SA 4PZEA 2VWHA 1ZNQO 4KTVE 5B1YA 3IL2A 5CDYA 2HDHA 3OSUA 4U7WA 4Z9FA 4ALLA 3OJFA 3ZI0A 1I3LA 2C07A 2I5PO 4JJIA 1E0DA 4KZPA 4YWJA 3W4IA 5L3ZA 5DCUA 3TZKA 4A03A 4J4HA 1VJ0A 4PG8A 1YXMA 4Z9YA 3W8EA 5G4KB 3W4KA 2VQ3A 1QYWA 3K96A 4YDRA 1T4BA 1H2HA 1PS8A 2BKAA 3AI3A 3G1UA 4RL6A 1TLTA 2D5CA 3DDNA 2B4RO 3CUKA 2BELA 2Y1OA 3FWNA 3LF1A 5I8WA 2IZ1A 3NTQA 4QFDA 3BA1A 4CM9A 4N7RA 5L53A 1DFIA 2X5OA 4YAEA 4OH1A 5CG1A 1PEDA 4IGFA 4OOEA 2E48A 4PLFA 3GPIA 1NR7A 4OSOA 1I30A 3QA9A 1T2EA 3DQPA 4R1SA 3ST7A 4CMKA 4MJLA 5DBIA 4YA6A 1C0IA 1CDOA 3OJ0A 8LDHA 5ENDA 4BKOA 1BXGB 4FDAA 5HM8A 1ZJZA 2CVOA 1IUKA 2EJVA 3EHEA 3GVXA 4BV8A 2FOIA 2X4GA 1BHSA 2C20A 2X0RA 2YYYA 2QX7A 4W7IA 5JE8A 1XG5A 2Y1CA 2D8AA 4I1IA 1C1XA 3JQ9C 3TQHA 4RGBA 2P9EA 4DMLA 4CLOA 4MVJF 2W8ZA 3KEOA 3AY3A 4WNIA 2DBVO 1DIBA 1TT5A 2DFDA 1D4FA 4XGNA 5I7VA 3ENNA 1JAYA 3HN7A 5B4VA 3JYLA 2JFGA 1P33A 2A35A 4FPXA 1NXQA 2EHDA 4C4OA 2R00C 4PLHA 1SOWA 4G2NA 2GN9A 4QFCA 1L1FA 5JC1A 4M54A 1D7OA 2FR0A 2EF1A 3H4VA 2AG5A 1EUCA 3IOYA 4BO8A 4YRBA 5JSFA 1SEPA 4EDFA 5IF3A 3IIEA 2YJZA 3HN2A 4CLEA 2VUUA 4CL8A 4IMPA 5BR7A 4HKTA 3MEQA 3GN1A 4CR8A 4UUNA 5AVOA 4F3YA 4L0QA 3STHA 2VTDA 1YQXA 3C1AA 3F4BA 4HFRA 3ADPA 5F5LA 4D3FA 2EXXA 3PWKA 3ZV5A 3RWBA 1NVTA 4M55A 1Q0LA 2ZJ0A 4AJHA 4D0SA 1RM0A 1JA9A 1SCUA 4JJGA 2YV1A 1B8UA 2Y0CA 4CR6A 1KEPA 1PGPA 4Y98A 3WGTA 1P0CA 4ND5A 2R2GA 3ZN2A 3C24A 1LI4A 3PGXA 1G6KA 4BNJA 5JYEA 1G0OA 1DLIA 2WYVA 2PTGA 5L4NA 3BXXA 5JAQA 3VPFA 4PIVA 3F46A 1WAMA 4FBGA 7MDHA 1X1TA 2NVUA 3WFJA 3ZNPA 3DTYA 1CQIA 3RUIA 4B4UA 1V3UA 1N9GB 1A72A 4OKIA 3CMCO 1JKJA 4IZHA 4R4JA 2UAGA 1CJCA 2SCUA 1MGOA 2HQ1A 4TSKA 3X2EA 5C7IO 3H7AA 3SC6A 1YBMA 5EN4A 3F47A 1EUDA 1KBZA 3M2PA 9LDTA 4IDFA 2PWZA 5ICSA 1V3VA 5DZSA 3ZHYA 3DAGA 1HSOA 2QZZA 4ND4A 2NM0A 4MIEA 1HE5A 2BFMA 1OC4A 3VZQA 1SAYA 1FJHA 1NM5A 5I7SA 3WLEA 3HJAA 2I3AA 3QVXA 4IXWA 1NHWA 1YE3A 3ASVA 1GR0A 5JAZA 4Z0HO 4CLXA 1FDUA 2B0JA 5TNXA 1N1EA 5CHEA 2VZ0A 4CLOB 3D4PA 4AJJA 1ULUA 2X5JO 2RHRA 1DRUA 2E49A 1D1TA 1LDEA 3H6KA 4TRJA 2ZCUA 1RM3A 3OJOA 4WCFC 1GZ3A 4XCVA 4BNNA 1N1GA 4L74A 3MJSA 4J16A 1LDBA 4KQXA 4CUJA 2BGMA 3GF4A 4BIIA 4FFOA 1PTJA 2B37A 1NAHA 2C29D 4LVUA 1X13A 3RC2A 5LCXA 2P2SA 3ON5A 3JD1A 1N5DA 2NTNA 3DZFA 5IDYA 3BMNB 5C3MA 1AUPA 3JSAA 2P4QA 4XRRA 2PZJA 3FBGA 5A9TA 4BNKA 5TIIA 3U5TA 1JAXA 3ZWOA 1I2CA 4AG3A 3ANMA 1XCBA 2CDCA 2OMEA 4ZQHA 2C82A 5DF1A 2VRCD 4KOAA 4QT0A 2G82A 2RBEA 3WNQA 4BQRA 3TF5A 1MXFA 3WDSA 1PGNA 3VHRA 3RIHA 3BIOA 5TS3A 4FJ1A 4Z3DA 4P38A 2HRBA 3IUPA 5KJFA 3VAZA 4DWVA 2DAPA 1UUFA 1ZK0A 4B4WA 1ZSYA 4J90A 3V1TC 5DULA 1EVIA 3NRCA 3RUCA 5JDCA 4L75A 1E6WA 4RV9A 3A9WA 4GWGA 4CM4B 2C59A 1ZK2A 2PFGA 2W2KA 4K1LA 4X54A 2CVQA 4L76A 5CAEA 1ZBQA 1M67A 3QWBA 4IDBA 3RFTA 2EWMA 4BO3A 3OIFA 2I9PA 4OOFA 4YJGA 3WGHA 3WMXA 5BSFA 1O8CA 1KERA 3JQFC 3ZWAA 3N7UA 3DOOA 4OAQA 2NLOA 3GRKA 3JYPA 2C54A 2D3TA 4FS3A 5CEFA 2DTXA 4HADA 1I10A 2OBNA 3I5MA 1DO8A 3OA2A 2O3JA 3H5NA 2IDZA 4J9UE 1WDKA 3ICCA 3MTJA 4BNZA 3W6UA 3QVSA 3A28A 1NPYA 2PD3A 4RQTA 4DGSA 1JTVA 3GVPA 4W6ZA 4DBVO 1DC4A 3AUSA 3ORFA 3KLMX 2RH8A 1G0NA 2Z5LA 4D7AA 1O5IA 2VRCA 3OJEA 1W0CA 5JCXA 2OO5A 4GLLA 4JK3A 2QIOA 4K6CA 2FN7A 1EE9A 3NJ4A 3JQ6A 5FF9A 3S2GA 3UICA 4BV9A 1I32A 3PJDA 4JCOA 2PKRA 4H7PA 1YB5A 5B12A 1NVMB 1NASA 1MFPA 1XYGA 4RLHA 4RVGA 4CMEA 4CM8A 3RBZA 1K6IA 1MX3A 1I33A 3L6OO 2HUNA 4R41A 5EIOA 5KVQA 1U8FO 4FFRA 1Y9AA 2PY6A 1IZ9A 1YDWA 3SVTA 3WGIA 1XIVA 3Q11A 5CFZA 3UVEA 4J1SA 1QV6A 4DLLA 4WUVA 3GC6A 4N5LA 3AFMA 3D5QA 4A73A 1YL6A 3JD4A 4B3IA 2DM6A 2GR9A 2TMDA 3L0DA 1NAIA 1H93A 1YOVB 3JD3A 5LDHA 3GAZA 1BWSA 1E7RA 3PXXA 2DBZA 2ZTVA 2E4AA 4BNMA 4B79A 1R0KA 5BQFA 3JQ8B 4U0KA 4TRMA 4K9DA 1F0YA 3AW9A 4B8WA 1ZEJA 2H5LA 1Q1NA 3GDGA 3FSRA 2E82A 1V9LA 3JCZA 5IN5A 3AI2A 4IMRA 4Q3DA 1EVYA 3L4BC 3T4XA 2B4QA 4BMNA 2IEBA 1I5RA 3T7CA 3GN2A 2A94A 2OBYA 3RKRA 1R37A 3X2FA 4HP8A 4YJGB 1GDHA 3KUXA 3HQ4O 4IS3A 5DOZA 4XQGA 4R16A 4E30A 4E6PA 3QLJA 4GBJA 2O3TA 1NQOA 1WWKA 1IB6A 4ND2A 3ZWBA 4CMBA 1ZK3A 4HBGA 4RVHA 1GPDG 4YAJA 3OIGA 1LTHR 1DHTA 4YPOA 3TDKA 1J49A 3U4CA 3KYBA 5J23A 4YCAA 1X1EA 4W9NA 1H9BA 3IP1A 2GD1O 4Y9DA 5F21A 5T6BA 2OL4A 1F06A 1ZZEA 1PGQA 1C0KA 2PZKA 4PLCA 2YHIA 3HDQA 4EJ0A 2QQ5A 4O63O 4ZU3A 3LZ6A 1P31A 2GNAA 3Q9UA 4IBOA 5G0UA 3INGA 2C7GA 3VPXA 3CKYA 5G0SA 3I4FA 4WCDA 4CM8B 1PU2A 1QSGA 3KYDB 3PYLA 1AHIA 1HT0A 3EZLA 1E1MA 4Z9XA 4NR0A 4NNJA 2VHVA 1EBUA 1KEWA 3PTZA 2CDBA 1YONA 3BTVA 2BD0A 3H2SA 3ETGA 4EJ6A 1MP0A 4J3FA 2DUWA 2PR2A 3S55A 5A3JA 1X0XA 5IFLA 1B7GO 1HWYA 1O94A 1U1IA 3QQPA 3IP3A 1H0KA 5G0WA 2EEZA 3K2BA 1Z75A 4ZA2A 1PJSA 3VVBA 1HLPA 3D5TA 1E7QA 1JW9B 5JW6A 1UDCA 2EP7A 3CIFA 5L7YA 4FJ2A 4XQCA 4CV3A 3GZNA 5EQFA 3KO8A 2JFFA 1LUAA 3MZ0A 4BGVA 1ZMOA 3QWFA 3E82A 4GI2A 1HDGO 4H15A 5JMPA 4A0SA 2FHSA 4E31A 4PLVA 4HXYA 3I3OA 3ASUA 3B1KA 4OJNA 4R9RA 3MJCA 3FHLA 1WMBA 2VHZA 3D4NA 1FDTA 3ITDA 3FNGA 5COQA 3VC7A 4E33A 4E2YA 4G81A 4I5EA 3LT0A 4S3MA 4YR9A 1ADBA 2HMWA 3UCXA 4RF2A 1ENYA 2O7SA 1VM6A 2GERA 2P9CA 3Q9NA 5U1PA 3GNTA 5KCZA 1I8TA 3VPSA 4WEOA 2WD8A 2J3HA 2PD6A 3F5QA 4AJEA 5JXWA 4BUCA 3CTMA 4BVAA 2OP1A 4Q3AA 2HCTA 4E2WA 3GNQA 5C5IA 2AXQA 4ZRNA 1ZXBA 2R6JA 4WLOA 2XXJA 3JD2A 5A3VA 2CFCA 6ADHA 4NK4A 1V35A 2OHXA 3F5SA 5GMOA 2HSDA 1KY4A 4RPGA 3KSUA 4O1MA 4OYRA 4MKZA 1B8VA 2VHYA 3QVTA 1W6UA 2OOSA 1G1AA 1QKIA 3ZNNA 1HLDA 3HADA 4U6QA 3WG9A 3U9LA 1KC1A 3E6AA 5FWNA 2WD7A 4R1TA 3RQSA 4LSWA 4WASA 4J6FA 5KJEA 1AHHA 1HF3A 1H2BA 3I83A 4MIOA 5AXDA 4JP2A 3DHYA 4Q3NA 3DBVO 3PJFA 1LDNA 3WMWA 3PPIA 5IAAA 2NTJA 5L7TA 4CJXA 4NBUA 1PJLA 3LLSA 1N92A 1P1RA 5DT9A 5H83A 2H6EA 1ZFNA 3O26A 3TL2A 1YJ8A 5L51A 2PGJA 4HNGA 4QUKA 1P45A 1XGKA 4LMRA 3ZWVA 4Q3EA 2VYND 1NP3A 3D4OA 5T8KA 1JKFA 1YL7A 4I5FA 5LC1A 3V2GA 1OFGA 4NJMA 2FWMX 2HMSA 2XXBA 4Q39A 3GFGA 4ZQGA 4WK6A 3TN7A 1DRVA 3PWSA 3K30A 3WJ7A 1M75A 2UV8A 2JAHA 3AY6A 2DT5A 1P1KA 4OIMA 4UEKA 4RJTA 2YQ5A 2WMDA 3PJEA 5G4KA 3PHHA 3IAHA 4M8SA 1OZAA 1QG6A 1VL0A 5A02A 3G79A 4FC7A 4RDIA 1ISGA 4BNVA 4IDEA 2Q3EA 2UVDA 1DAOA 4UAGA 2CDAA 5TT0A 3JQEA 4EUEA 4GWKA 3SBOA 5TSDA 4BO9A 5JDIA 2PK3A 2WWRA 4UVDA 4ESOA 2V6GA 2YUTA 3DL2A 4RF5A 1I0ZA 1J5PA 2HAEA 5B37A 3F3SA 4EEXA 2B5WA 3VH3A 3LU1A 4RPJA 1IYZA 4E2XA 1Z45A 2Q2VA 4E0BA 5BSEA 1ZJYA 4CM7A 1P44A 1U3UA 1KVQA 1P74A 3FTPA 1GPJA 2DBRA 3TZHA 2BMAA 1MLDA 2AE1A 1BXGA 2QRKA 4NBRA 3IC5A 9LDBA 4CMGA 5JS6A 1XQ6A 1GU7A 1Q7GA 5JDCC 1MV8A 5BNFA 1U4OA 2AEJA 2JD0A 1RYDA 2AQKA 3KXDA 4WNCA 1EFLA 4LN1A 2GN6A 3PJGA 2P5UA 4QSMA 2WM3A 4KDFA 3KM0A 3DZGA 3UXYA 4QO8A 1JLLA 4J2OA 5B4TA 3I9MA 1UDBA 4P4GA 4F45A 3Q0EA 4BNYA 5JO0A 2VYNA 4UREA 2GO1A 3AM3A 2EKPA 3FN4A 1U8XX 2HRZA 5TLSA 3IMFA 3RUEA 3B6ZA 3Q2KA 3DB2A 4JQCA 4EUFA 1H6AA 2IXAA 2HK8A 4KUEA 2W4QA 2C5AA 4TKMA 1UAGA 1WPQA 2G17A 3WGOA 4II3A 5ADHA 3ZH2A 3NAQA 2FR8A 2X58A 1PR9A 4AJ4A 4NJMB 2Y1EA 2I6TA 2DUUA 4RF3A 3DFZA 1XSEA 3KRTA 4U6SA 4GKBA 3K5PA 3WICA 1QYVA 1T2CA 5CEJA 3RC1A 1KVUA 1ADFA 1MG0A 2DFVA 4IDDA 2GYYA 5L7WA 1T1SA 2WYWA 2ZIZA 1PL8A 1DIHA 2WE8A 4D45A 4R5MA 1LRLA 1RJWA 2Y05A 4CMEC 2G76A 3VPGA 4WLEA 1LU9A 2NSDA 2VTEA 3P2OA 4RVFA 4XIYA 1TVEA 1L7EA 1N9GA 1R16A 1Y7TA 1GUFA 2ZTMA 4F6CA 3N74A 2JFHA 2YV2A 3ZWMA 5KKCA 3QWHA 2IRWA 3A06A 1KVRA 1B2LA 1HZZA 1T1RA 3K73O 4NQZA 3JYNA 4QECA 3ROPA 3S1LA 3OHSX 3PIIA 3INTA 1PJ2A 2V6FA 3H5AA 4TRNA 4FFMA 1U9JA 4UUOA 3DMYA 4D3SA 4E32A 4HWKA 4YJHB 4E21A 3LYLA 3OF2A 4M87A 3WTBA 1NTOA 1AN9A 3FF4A 5DDIP 3ROQA 1OMOA 1P1IA 2FZWA 3OEWA 2VHWA 4EJMA 1QMGA 5T64A 5EQDA 1T4DA 2VCYA 4M49A 4OHUA 1LC3A 4LCEA 1CWUA 1OOEA 4JJFA 2WJPA 2ZYGA 5K6AA 3VTFA 2B4TO 3H9EO 1EDOA 1LEHA 1WZIA 3U4HA 3PQEA 1NFFA 1X15A 2DKNA 5A5EA 1LDMA 2CSUA 3DOCA 5IJZA 3F1KA 1IHXA 3VDRA 1LC0A 1FK8A 5F1PA 4C7JA 2O3SA 2JCXA 1YB1A 4OQYA 4CQMD 4YT2A 5KJ1A 3ETEA 5BT9A 5GZ1A 4ZN6A 1BDBA 2PGLA 4J1QA 3GGGA 3RU7A 3GVIA 4DPMA 1IULA 1W73A 2J3IA 2HMVA 1B3RA 2GSDA 3K6JA 3GG9A 5EESA 2BHLA 3DBLB 1ZK4A 4L4RA 5F1KA 4YYZA 3BMNA 4D3DA 5L40A 5GZ6A 4W9NC 1T2AA 1SZJG 1PJBA 1Q7BA 2Y1FA 4E4YA 1CEQA 5ILOA 4YACA 2W2LD 2X7HA 2AG8A 1C14A 1JDJA 3C85A 4DLAA 1T26A 5MGBA 1ISIA 2J8ZA 5JY6A 5FFFA 1UXIA 4Y6PA 1ZXLA 5HBRA 2AW5A 1C0LA 1WNTA 4XQ9A 3H9UA 3EVNA 3OJLA 4Q3CA 4CMHA 4PG6A 3ENKA 4DLBA 2DVMA 4QTZA 4XR9A 3PZBA 2BI8A 2CY0A 2H63A 1KS9A 4WLVA 3VH1A 4KUHA 1HRDA 2OFPA 4E3ZA 2G5CA 3A14A 1YKFA 4D42A 4YJDA 3PWZA 3BMOB 3UCEA 4MO2A 5ER9A 4LVCA 1R4MB 1C0PA 5GZ3A 4QO7A 4Q3BA 4QQRA 1JQBA 2NUAA 2O23A 3V8BA 3I23A 4FQ8A 4CM4A 3L6DA 4D0RA 1VL6A 4WLNA 1E7WA 4NDNE 4BMVA 5AXBA 4E5KA 4YJFB 3FCOA 1U3VA 1CETA 3IS3A 2ILTA 3TPCA 2EGGA 4D46A 1DDOA 5TQVA 3OETA 2Y1DA 1P0FA 4IUYA 3I9LA 5C37A 1M6HA 3TZCA 1E3LA 4G5HA 4U5QA 3WJAA 1ISFA 1DBVO 2PZMA 1B16A 2BGKA 3G17A 3HZZA 1ULSA 2J5RA 3OIDA 2EV9A 3KYCB 2DBQA 1ARZA 3H8VA 4BO7A 4BNLA 3JQ7B 5U4QA 5HTOA 2PKQP 2W98A 1HEUA 2WDZA 5FEUA 3G0OA 1A4UA 3ANNA 4KWIA 4PLWA 2W2LA 4NFHA 4Y6RA 3W1VA 3W4JA 3ZU2A 4BO6A 1BGVA 5I9LA 1P3DA 2Q49A 1QYXA 1Y8QB 2X22A 1HE4A 4DPKA 4NIMA 3D7LA 1R6DA 1RYEA 5ITVA 2IYOA 1AXGA 2JD2A 1QYDA 4IDGA 4FOOA 2C2YA 4Z0PA 8ADHA 4YAKA 5JFOA 2CD9A 1H6CA 1KETA 2HU2A 4J7XA 2DLDA 2FR1A 2O3UA 4EBFA 2QYSA 4RDHA 1ORRA 3C1OA 4ID9A 1DB3A 3S2IA 4CMIB 5CEEA 2XOXA 3HB5X 2J3JA 4DL9A 4FCCA 3GUCA 4I5GA 2ZYAA 1YH3A 1PIWA 3ZGYA 4BO1A 3WIEA 4KWHA 1I2ZA 2YQ4A 3A1NA 4UVIA 4U0JA 1UZMA 2EJWA 2WSBA 1E7YA 1VJTA 1YOVA 3AM4A 1E77A 1YRLA 1E7MA 3JQBA 4NBWA 2FPGA 2EIHA 4IJKA 2FSSA 1ZIDA 1NBOA 5A4DA 3GMSA 1PJ4A 3CPSA 3JQ8A 5JMWA 2PH3A 2QG4A 1I36A 4L9RA 3KB6A 5ENVA 3AY7A 1QXSA 5G2OA 4IQ8A 3C3XA 5H81A 3TFOA 1AXEA 1B0AA 3ZWCA 3I4CA 3FTNA 3B1JA 1VE9A 1QRRA 2NNLD 1V3TA 1U7TA 1QYCA 2DPGA 1DJNA 2ZQZA 4NU5A 4CQMB 4DREA 3V2HA 2NVBA 5T8KC 1O6ZA 1VI2A 1ZW1A 1NPTO 4A27A 1QR6A 4L8VA 1YL5A 1RM4A 1BVRA 4ZRMA 3V5NA 2Q4BA 2B35A 3BYZA 1XQ1A 4DA9A 2NU7A 2X1HA 3I52A 4IJUA 2NACA 3C7DB 1DSSG 4KUGA 3UH1A 4XKJA 1Z7BA 3WBFA 3KSDO 3KTDA 3QWIA 2Q2WA 3WR5A 4GX2A 5ITWA 1DJQA 3JQGB 2HK7A 3K31A 3RI3A 4MVJP 1B15A 3PI7A 3KOUA 4CM1A 3JQAD 1PL6A 1PWXA 4PRKA 5LDGA 4CLHA 2O4UX 4GH5A 4B8ZA 1PQWA 4GQAA 3LLVA 3GA0A 1ML3A 3ZW9A 3EC7A 5JDIC 7ADHA 2OZPA 3M2TA 3HHPA 4BKPA 1UDAA 3KYDA 4RZIA 1Z74A 4XX0A 2XPCA 4ZJUA 1GUZA 5BSGA 3GR6A 3FRJA 4RVSA 4OM8A 3OECA 3AK4A 1GZ6A 1EDZA 2FZEA 4A7PA 4HV4A 3PRJA 2JKVA 1LNQA 4OGWA 3AOEA 2VWGA 5IDWA 1NX6A 3MJ4A 3VKVA 5B4UA 5G4LA 3PGJA 1PQUA 1ZVMA 4H16A 3H2ZA 3DHEA 4DQUA 3ZW8A 3O4RA 3NUGA 1ISHA 3BHIA 5CDUA 2IE0A 3CMMA 5L4LA 4RPLA 2ET6A 5JO9A 5IXSA 4GMGA 4IIVA 5L45A 5THQA 1R4NB 2D5AA 4DQVA 1YBVA 2CNBA 1NQ5A 3BHJA 2P68A 1PJQA 1A9YA 5A5FA 2Z95A 1JVBA 4UVEA 5F3RA 3FNHA 1QLJA 4AJLA 5DP2A 4MPDA 3R3JA 1CIVA 3G49A 3DEYX 1VSVA 1WDMA 3NDJA 4ALIA 2VOJA 4DIOA 3QP9A 3AU8A 3EY4A 1VPDA 4IJVA 1CERA 1ENZA 2GZ1A 3HUDA 4KP7A 1EZ4A 3WTCA 4YQZA 2CZCA 3NT4A 1QLHA 2AE2A 2I66A 4N18A 3ZU3A 1JVSA 1EEHA 3CZRA 1M6WA 1JU9A 4BO2A 4MIYA 2AQIA 1UP6A 1UP7A 4OL9A 4UVHA 4JN6B 5I8ZA 3ZCXA 4ALKA 1K0UA 3WGGA 3U4DA 1XLTA 1B3BA 4CR7A 3BZUA 4W4TA 4FB5A 1E3WB 1E92A 1U2DA 4O0LA 3PDUA 1L7DA 4RF4A 5CG2A 3ULKA 3ZV3A 4GLOA 3OICA 3P2YA 2RH4A 3E18A 4MVJE 1LLQA 4YTEA 5DNAA 1GQQA 3LT1A 4WOJA 3D0OA 1DRWA 4ALMA 4BNIA 2X5KO 2NWQA 4J1TA 1HDOA
chains in the Genus database with same CATH superfamily
3K4HA 1Q3TA 4WY2A 1P4AA 2IKQA 4X7MA 3NX4A 4XEUA 4F2PA 1WO8A 4DJDC 1PVDA 2J6IA 4JP5A 4TXHA 2IEGA 1DLJA 1EESA 2DU8A 1ULZA 2Z5VA 3MNFA 2C99A 5DK4A 1EIWA 4PRYA 5J2UF 1WHSB 1NVKA 3NETA 3TDNA 4B4DA 3Q3CA 4RVNA 1YZFA 3EUAA 1P5HA 2C5LA 3KHTA 2EFGA 1MOQA 1YZNA 3FYUA 2HZ7A 3HNPA 1I01A 3EBLA 2J5XA 3IUYA 3JSXA 3PNQA 4LCBA 5ALMA 5DLPA 2JLYA 2ENUA 5CH8A 5JNUA 4HB4A 2R2AA 5J5VA 5A1JA 2IP4A 3STYA 4CN8A 3D6HA 2VK4A 3IR6A 1SQGA 3WL5A 4RORA 3H17A 4L78A 1EFKA 3WRVA 3EDMA 1TF2A 3PQDA 1UDWA 5K6AC 3MINB 3ADKA 2E3JA 3GROA 3CVUA 1U0LA 2R6ZA 2EJCA 1HURA 4BB5A 2C7BA 2B1IA 4NAUA 3T4EA 4Q4CA 1SC1A 4W5QA 1IN7A 4BJ5A 4GOJA 5BURA 5AK3A 5KOHA 4MYRA 1UINA 5EKSA 1PNOA 3OCCA 2BH9A 2FPUA 5EHZA 4DDHA 4PHHA 1KI6A 3GGOA 3PXBA 4KEAA 1PI3A 2AUMA 3D3WB 1Y8CA 4JEUA 3VYSB 2OCXA 1PR0A 1Z5NA 2R4TA 1JEEA 3J81A 4DMHA 2BM1A 4MHOA 1OH5A 3ICOA 5DSZA 1ODCA 2B1GA 3HA5A 1FU4A 3EE6A 5CU7A 1U4SA 4GX5A 4YRDA 1A71A 3QY0A 3R3WA 5JVDB 4EABA 4NYJQ 3RC9A 2CKDA 4KIFA 1IY8A 3I6QA 1G17A 4BV3A 1L3CA 2OHVA 2WJ3A 2DB3A 2B8TA 3TLJA 1RWPA 2V7BA 3ZBQA 1L9KA 2CMHA 1JSRA 2R11A 3U6KA 3JQAB 4OQFA 2I6XA 2IYAA 3P0HA 1NW3A 3R4VA 4N3NA 4UM9D 2C9DA 3D6UA 1WXHA 3MG9A 1RSZA 5HX7A 4UU0A 2W9XA 3R1IA 4FCTA 4H4EA 5T4EA 4C0LA 3ZCVA 4BZZA 4YMVA 3F3YA 3QJGA 1J5XA 4A15A 1JP7A 3WK4A 1Y1PA 4KVAA 4BAGA 3CWZA 3ICVA 1GA4A 1LQTA 3HDYA 4LWZA 4MJXA 2ZAGA 1CCWA 2Q21A 1PG0A 4INAA 1DFHA 1EI9A 5BWMA 5SV2A 3HO6A 3MRSA 3ZCRA 4BATA 2E21A 1UM9B 3L7AA 1PF7E 2JFBA 4OBXA 5BNIA 1NXWA 2VZ8A 3IEPA 1H69A 4CDRA 1K5PA 5C31A 1PS9A 3CJTA 1QHYA 1R4ZA 2P6NA 2VLIA 4OCZA 4KAXA 5K0CA 2A5YB 1XL1A 3G7NA 1M5UA 4G1BA 2PR7A 3LK7A 2FWAA 2XCOA 4JJ6A 2QYTA 1SZCA 4BX9A 1DC3A 2Y0EA 1L5FA 4Z4HA 2NO5A 5TJHA 1VC2A 3HABA 3CW2A 5IBRA 3EXFB 3E5MA 3C3JA 1AV7A 3Q10A 1VKHA 4FDTA 2XUAA 3EIXA 4ZWNA 5HKBA 4P32A 4NZYA 4IHJF 2ZR7A 4OHYA 3CEJA 2IYTA 1SU8A 1V6SA 5I4IA 3NBAA 4ONEA 2WHPA 3FUUA 2ZI9A 3B2NA 2AG6A 3H5RA 3DV0A 3DVRX 4R1MA 3RRYA 4FB4A 4P53A 1KI1A 1UXOA 2JCVA 2YRFA 3DLBA 1ZIYA 1GYRA 1RAIA 3LY5A 4TQGA 5CLLA 3HCFA 3QKSA 3ETDA 1YZUA 5CPFA 1KAGA 5LA6F 1RJDA 2K4MA 4EA6A 1CHNA 5F51A 4L0DA 3E9MA 3VNSA 3OA0A 1KF0A 4A2QA 4N1AA 1ECCA 3GLRA 3GRVA 1B6TA 1G63A 2PSSA 3LKZA 5COAA 1JEQA 2YWCA 3PVZA 1ZOSA 2I6SA 2PVPA 2NP6A 4DG5A 4MHTA 4AECA 1XTVA 2DC1A 2FY8A 4KVZA 1A9ZA 4D2IA 2ZQYA 4DCCA 4JIGA 3AERA 2O1XA 3DBHB 5E6RA 3KEQA 4PSAA 3DZKA 4F8YA 1NZDA 1T4CA 5CNKA 4I3HA 1C29B 1Z82A 2GM4A 4Y2UA 3AFHA 3IUMA 2WU8A 3EIUA 3B38A 1CDZA 4BVBA 5HILA 3AEUA 2QX8A 3EUFA 1KA9H 4Q24A 4B2PA 3F7TA 3W34A 4S2EA 4A0QA 4DY4A 1HKUA 2FDXA 4F6LA 4ENVA 2Y1GA 2G63A 3WKBA 5BV7A 3GFTA 5LN1A 4D9NA 3MUFA 3R3SA 4JX8A 3TOXA 3TZLA 5CBPA 1SWWA 4X92A 4CUKA 2A67A 3PNVA 2YIVX 5FUVA 2HHAA 1T5OA 4TGLA 1KQNA 4AZ0B 5DSTA 2G9UA 2WFZA 2YWJA 3AF4A 4RPHA 4FSHA 3F4LA 1UJBA 2WZDA 4P5PA 4DR3B 3C3AA 5AM0A 3U3XA 4F21A 3WAGA 4GX0A 1NATA 3OWOA 4URUR 1QHFA 3O8QB 4OBBA 3KL4A 2XWQA 4WN3A 3KKEA 3RT1A 3C6QA 4GRIA 4ANFA 3UF0A 2WWIA 4A10A 3TFQA 3FZYA 1T2VA 4JI7B 4PSCA 3KJNA 3IQHX 1OFVA 4XWYA 3ZVKA 1T9KA 4RY9A 1R9MA 1RC1A 2HJVA 5JCZA 1AJEA 4BBPA 4PSKA 5D3MB 5LYJB 4JXXA 3T3GA 2VOEA 2JH8A 4PGMA 6REQB 4NJOA 4ZK6A 2QN2A 3JQBC 1JXOA 4KQMA 2HA4A 4NL4H 1SUEA 3RAJA 3N2KB 4NBVA 5B6IA 2JGDA 1K4KA 2H0QA 4PQEA 4RHYA 3LHKA 3QA3E 4UMEA 2HSJA 4BB0A 5IVPA 4UKDA 1PKXA 2ZE7A 2JZNA 2QZSA 2C61A 4YUVA 3EQ6A 4MWOA 4YAIA 3O3MB 3VVCA 4RD6A 5HE9A 4YV1A 1EVZA 2H4XA 2FWBA 3GEDA 2C0PA 5HCIA 1THZA 4EUSA 4JNCA 2V7UA 4MQFA 4BYMA 1E5QA 4NABA 2QXYA 4IXDA 2JIMA 5DRYA 4AJ1A 4B17A 2VFAA 2GEUA 3HU1A 4RMHA 1U5BA 2PGDA 4UHBA 2CMGA 5FEMA 4PZCA 4LJ5A 4LF5B 2H1RA 1YHNA 1WD7A 3KHUA 4IHAA 1DBRA 2ZS7A 3OFVA 3P0FA 2QL5A 4DVJA 1BOFA 1V45E 2XQFA 5HIKA 4B75A 1RXVA 2O52A 4JS0A 3FYSA 1XTJA 1UBKS 2M6LA 1ZICA 4BE7B 4D8XA 1U5AA 4Z2AA 4G4SP 3AVTA 4GE3A 4C87A 5LB2A 3SLGA 1JU4A 4AJ2A 1B0ZA 3GV0A 3R76A 3QMVA 5LC1A 5H3LA 3DWEX 4HX5A 5C1DA 2W00A 1NR1A 3NT5A 1N1MA 4ILKA 4BPRA 5JS1A 4Q34A 4TN5A 3PUVA 3VR5A 4B85A 5TQ0A 1M2OB 1N2GA 1RP1A 1S2GA 2OBBA 4JQSA 2B20A 3MT7A 1M0EA 1BD3A 3EVGA 1H9AA 1IHPA 3QHAA 5CFQA 4MVJA 1XLUA 1UWCA 3KB1A 3KVVA 2R3SA 3UJ9A 5KQGA 3GJ6A 2PKWA 4YMTA 1JEDA 3LTNC 2WT9A 2FJPA 3L9XA 4BNDA 2FQYA 3JYHA 3I9V1 2RGAA 2A9JA 2I87A 1NG1A 1VLZA 3HBNA 1PT6A 4PSDA 5HQ3A 3TNFA 4TWAA 4NU8X 5A06A 4WECA 3UMBA 1Z9BA 3NH6A 3WL7A 3GK3A 4HEA6 4GKAA 4M0FA 1SMKA 2JLAA 2GZAA 1TEHA 1BVHA 2ZI7A 4X0EA 4EHAA 3JTMA 5F9MA 1PR4A 1TAGA 4V0RA 1ZBDA 3DPIA 1ID1A 1MGPA 2NVWA 1E98A 2PMFA 4IVNA 3F4KA 4V1CB 1WCWA 3U3OA 5KWVA 1UXGA 2A92A 5ICMA 4I5DA 3USCS 3L43A 4Q1CA 4M1KA 4TRRA 5JADA 5DN6A 3BMOA 1VSUA 1NBME 3OE1A 3TCNA 3NM4A 4ZU1X 1QRTA 1PYOA 2C4HA 1HX7A 5FULA 5BMVA 1EUYA 3D7RA 4YRCA 1X0VA 1PJTA 1JLKA 5IRCD 1TCVA 1MPTA 3SFZA 1OBHA 4XZ3A 2YJGA 2N9UA 1U0EA 1T5SA 3TE7A 1Q7CA 4R1PA 3BIXA 3NKFA 1MD9A 1R8YA 1CEXA 2PT6A 3GT4A 4Q4JA 5ALLA 3UJNA 2R6CA 1YE5A 1QKKA 3EWNA 3M1IA 3OCYA 2F1RA 1KAQA 3WKAA 2V0CA 3C3WA 4HQNA 3SBEA 1BH6A 1IUOA 1N6OA 1Y5MA 3VRHA 1HV8A 1LRJA 3SNKA 2EOAA 1RRCA 2PL3A 5CYPA 3UFXB 3BHNA 4DW8A 1IG0A 2J3LA 2OD7A 3GJTA 4N12A 3AU9A 1GPNA 4S1NA 5IJXA 3SNHA 4WEQA 3ETHA 2V7WA 1UMKA 2AEFA 2RHGB 2BRUA 4S04A 1H94A 4CODB 5C7LO 2VDOB 3JQ7A 3AEKB 2REQA 3P2JA 2P11A 2RJNA 4LC1A 1MB2A 3GHHA 3OPQA 4WRRA 1X1AA 3FPAA 1VKRA 4B3HA 3ZD7A 3R6DA 1HL3A 2A6PA 1J00A 1BCRA 1Z3CA 2VDWB 3E3AA 4H60A 4F4DA 4GKJB 1I4LD 3OPYI 1FA9A 2CDNA 3TQFA 4EYKA 3E9QA 4KIWA 4EY8A 1N7IA 2P7IA 1X7GA 3C8ZA 4FGSA 2O8EB 5KQSA 2FPIB 5FV7A 3RQIA 2NAFA 3P5SA 1ZVQA 3HDTA 1JKXA 4P54A 1A9XB 1MAVA 2OP0A 1YB7A 4RHTA 1U98A 2L0XA 2P9QA 3CVVA 5G0TA 5CIWA 1RLIA 1ZM9A 3Q40A 2WSLA 4UTZA 3TLXA 3TZEA 2QLNA 4UCFA 2O2GA 4ARUA 1Z2EA 4WGGA 2QMEA 1MR3F 3NV9A 2Z1MA 1JHYA 3G8AA 3QMPA 3UWDA 4TKLA 2D7DA 1JIJA 1Z25A 4QOHA 1FU8A 1PJ8A 3EF3A 4OLHA 1XRRA 4B7CA 4M9CA 2C5EA 4MPTA 3ZKAA 4DYVA 2ST1A 5KNCH 3H1FA 4EMUA 1CS0A 3TL3A 3IEMA 4IX1A 1PFVA 2J9FA 4RADA 1NXXA 2YIJA 4HNTA 3GEMA 1F2UA 4FMDB 2ZRAA 2FSFA 4Y9RA 2VRBA 1G64A 1XDWA 4TS3A 5C1BA 3G1TA 1W581 4MW7A 3ED5A 2ZUSA 4KE8A 4JI5B 4GL4A 4Y0NA 3SXJA 1GZ7A 1ZJ5A 2ISQA 4BGEA 2AN3A 1Z4MA 1Z2OX 4YMIA 5HZGA 4B3MB 1KH1A 3RVKA 5DXJA 3DD5A 2C2KA 2WNIA 5B57C 1EB9A 1UK6A 3FMPB 1TJYA 2NVOA 1FXSA 1OTXA 3TW4A 4F93B 3UJ8A 3EWIA 3WL3A 3VPHA 4R2HA 4I1YA 4HSGA 5U4XA 1KO5A 3ZDAA 1ZMTA 4QX6A 5DN9A 3L0BA 2CFSA 1C3LA 1J4AA 4MWSA 4GDMA 4Y67A 4D80A 1N8SA 4EYSA 2R6HA 3IEXA 5AUOB 1VBKA 3L7CA 3NS7A 4RANA 4RKYA 3D7KA 3RSHA 3L07A 1QTNA 4N3BA 2QLBA 2Q4TA 1DIAA 5CDSA 2YRXA 1IEXA 2NO1A 2H92A 4FYKA 4MCAA 1TECE 4MUJA 1F2TA 5FHRA 4F2DA 3GY0A 2CXNA 3IMGA 4KPEC 4RHUA 5FBLB 5BRNA 1JWAB 4C7KA 5EJ8A 1RFGE 2CXHA 4BCBA 2JGKA 5FTWA 2QM3A 2FSUA 1EFPB 3BXOA 3U19A 5IZCC 2EG9A 1C7JA 2OGZA 3D2CA 5HCUA 2QUIA 1G2PA 1MUUA 1NUUA 2NV6A 4KGZA 1FYVA 1TO2E 1UQRA 3MAAC 4XYLA 1NLUA 1VZ3A 4E2ZA 4ZXPA 3TXAA 1F1BA 1SKUA 3CUEF 3F5DA 4WXHA 1YRBA 3R8XA 4QYSA 1ATZA 2X0KA 4G89A 2XYRA 5IXYA 4AY4A 2EATA 1IVNA 1H2EA 4RLSA 1QZZA 4YVFA 4B5KA 4QDJA 2XTZA 5ITSA 1I6WA 5A9RA 2LZ0A 3H19A 3L4SO 1J2UA 4QGFA 3WVNA 4S1VA 5CLQA 3GFBA 2XDWA 5J1SB 3COJA 3KE9A 3H9GA 1P29A 3P9RA 3INRA 3TZ6A 4WLUA 4Y9UA 3IHTA 4RENA 3MN1A 3D6MA 3LTEA 4CLRA 4XB1A 3VH4A 2J4FA 4HGNA 2BFBA 2IU4A 1ICIA 4XJTA 2HX1A 1SVIA 3VHXB 3MGAA 3BL5A 4KFRA 5K0ZA 1EQUA 1ZOPA 3H1AA 1TQ4A 4P3KA 1NWHA 5I7EA 4X84A 3IBTA 2D8MA 2J7PD 4JKYA 1VHJA 5HRUA 4JNKA 4G37A 1Z7EA 3B48A 1Z62A 4PWZA 5LIRA 2KWIA 2RK4A 4KXQA 3PRKE 1WY5A 1WUTA 1CTQA 4GPIB 2P3SA 1VDZA 3EEQA 3OFSA 2ZRMA 4O0MA 1DHRA 4Y0VA 1VHQA 5ALJA 3LWZA 1IHOA 4QELA 1XRQA 1OYWA 4EMBA 1Y48E 1MVOA 2GBCA 2VJKA 1CF9A 1NMYA 5FI0B 3L3BA 4HYYA 2HPZA 2GN8A 4ZANA 4NAHA 2I76A 4DZTA 4GMHA 2EX0A 2VHQA 1SCUB 4NCKA 2X77A 3EW7A 2Q2QA 3EIFA 3KKQA 1R4NA 2Y1XA 4F3KA 5K6RA 3VR4H 1XUOA 2H2WA 2LDBA 5LSAA 5IMBA 5FKJA 4B3RB 2QXUA 2QI9C 1WZUA 1P9NA 3OC0A 3R8CA 4YRPA 5IWCA 1JJAA 3KQLA 3IO3A 5FRDA 3H99A 3TVTA 3UK7A 4XVCA 1XQXA 2IXGA 4R01A 1I3MA 3PFFA 2YDYA 3ELUA 2W0MA 4XRGA 2VAVA 3D1LA 1A7AA 3ORHA 5JAHA 3DZIA 4MLZA 1T9AA 4PAMA 4E13A 1JKJB 1C80A 4D0LB 1P1HA 2R5WA 4YV7A 3F6SA 3ELDA 1KZ4A 2PFKA 1IG3A 2X86A 1DX9A 5KYKA 3KTAA 4LOLA 1ZKMA 4HLUA 4PAGA 2JHFA 3DVAA 3LV8A 1CD5A 1IWPB 1P8JA 1NRWA 2ZTUA 3T41A 2WWYA 1DEKA 1JHRA 1UFVA 4KCGA 5ADUS 2V65A 1XJQA 2ORYA 5AW1A 3LDHA 3BTUA 3MUEA 4N01A 4PLZA 3RLIA 2Y0DA 3E1GA 4ZYZA 4CXMA 1ONBA 3OZCA 1CZRA 1NNEA 3PEEA 3E7WA 4FFBA 1IOWA 1RLTA 2DTEA 2PIAA 5ALWA 1CQJA 2VA9A 3ZNOA 1E3WA 2CK3D 4IFEA 2LDXA 1H5NA 5JQGB 4BRZA 1FMCA 2FPRA 2WT4A 1K63A 3I09A 3PDIB 5IDVA 2P90A 5CCXA 3MELA 2A86A 4Y2GA 2VPQA 1V6AA 2PYIA 4PZDA 1C9EA 4FI3F 2MT9A 2CHGA 3P4YA 1PSZA 4LWQA 1D2EA 3UW1A 4DLRA 1ZO8A 5TMPA 3BB1A 3PKIA 2D0DA 5ISMA 3LX5A 4N0MA 4PHGA 2D3WA 1A8QA 1Q7EA 3KEMA 2AI2A 4O1HA 3C8DA 3L7JA 1Y8RA 3WWYA 2H06A 1SXJB 4EELA 3G3EA 1ONPA 1P1JA 4X7BA 1VL5A 5GJVC 2ZYRA 5IBCA 3O2QB 2VNHA 1OFHA 1JALA 2AC4A 5JRDS 1JILA 3G6KA 4LTMA 1AGXA 1RXWA 1BMFD 1KI3A 3R3ZA 1BJRE 3QVLA 1GRNA 5CYOA 1KOGA 1UPCA 4WVLA 1WHSA 1YHYA 2P75A 2QG9A 2VYVA 4L22A 4AL4A 1VBFA 5FBWB 1J7KA 3CCBA 4D4HA 2XYQA 3M6FA 2B2NA 2Z2KA 2OV1A 1T8WA 4P3YA 1MAUA 3UMCA 4WW0A 1ZC4A 5EY5B 4KO4S 1SY7A 2VJMB 1E1LA 2D2IA 3FPKA 1E3EA 4FYPA 3UNXA 2NUTB 4QL3A 1GVHA 2R751 4J4TA 5AHRA 5L3QB 2NYRA 2BFWA 2O2JA 2FPPB 1O1YA 2CJYA 2MSCB 3PQ6A 4P33A 3VO2A 3D8HA 1P61B 1QVWA 3LY8A 2AZ4A 3DAFA 3MCWA 4QWMA 3MINA 4WE3A 1R0SA 3DM5A 4BVLA 2BSAA 1DXOA 2GTHA 3DVSX 1EFCA 1HORA 1Y4UA 1Z63A 4UFPA 1FF9A 3AHIA 1IY2A 3AUTA 3V1NA 3JR3A 1KAHA 2Q4EA 5ANRB 2VZEA 1KEVA 2BE7A 4CI9A 2V7QA 4DR7B 2Z83A 3BTOA 2Z9DA 3FD8A 2GUWA 4PLGA 4AJPA 1CR2A 4C7VA 1MENA 3D3WA 2P2GA 3I61A 2W22A 1MJHA 4C7XA 2XMRA 4NC9A 3OO0A 4OXYA 2WM8A 1ONNA 4PZPA 4QGBA 4WKGA 5JWHA 3ZJTA 3FDJA 1W5EA 4Z4QA 3D43A 3COSA 3EIQA 4BFYA 4XCXA 1UZUA 3FB1A 5CYGA 2DR0A 3CGWA 5JVDA 1J6UA 4QDZA 1PUXA 3FGNA 4POAA 2ZJ6A 3L8ZA 2FLKA 4TWBA 3PDHA 1VG1A 5EINA 3IKJA 3O3NB 3TTXA 2D5LA 2CUKA 4O2AF 5JAMA 3JQAA 4HNHA 3HB0A 3MS4A 3GLHB 5K3SA 5KQPA 5FO0A 4ME6A 3SDZA 4QBHA 5L3SB 3AINA 1P81A 4NZ9A 4QRHA 5CAEB 1J20A 2V4MA 3EWAA 2V5AA 5IVDA 1W4RA 1PAUA 4OQ4A 4ZVLA 2Q1WA 3KR1A 5LP6C 1KSHA 3WL8A 4XGRA 1UH5A 1M2VB 1VLHA 3OKPA 1E2QA 1XZAA 2WABA 2WNHA 4TLEA 5IUJC 2I1WA 5FLXA 3DXXA 2QW1A 1UM9A 5HIMA 3LUKA 1YIAA 2W71A 4KAJA 1L5KA 4N76A 1DBWA 3KFLA 3QEOA 3ZWQA 3CT6A 1QO0D 2RHTA 4B8YA 1O54A 2C77A 1V7ZA 3CB2A 4LMBA 4AWAA 4EEKA 4BP3A 4PU0A 3SWWA 1X39A 1Z8NA 4RSMA 2X0NA 2R8XA 4NZZA 3LW8A 2OENG 1ANKA 5KJCA 1Z6GA 1HKHA 4AFNA 3D59A 3EXFA 3IVCA 5DHPA 1ZVVA 3GDHA 3P19A 4ZEXA 3ZNQA 4U2DA 1XMVA 3I34X 5BUQA 4JI4B 1QHIA 2IYZA 1PL7A 3AI1A 4M37A 4QLAA 3RKUA 2W6NA 1U3TA 1UMCB 3IBCA 5AJWA 3IEKA 4MGIR 4E5SA 1OYVA 3ZOZA 1IIBA 3EBOA 3M6IA 2JARA 5EEGA 4LSMA 2ZS9A 1K2WA 3FXAA 4XQEA 3TNYA 2I99A 1LWNA 1KY5A 4D43A 3SZMA 3HZOA 4LBZA 4XGKA 4YRKA 5BPHA 4M1QA 5A7GA 1H8ED 2VXYA 2EERA 3J80A 2BFDA 4WGFA 4BKQA 4WIAA 3NBYC 4DMMA 3DMTC 4WXEA 4KRXA 5ALOA 3U56A 4CIVA 3PYXA 2O8BB 3HBFA 3TRFA 2Q9BA 5CA0F 2A88A 5JBIA 4B6RA 3FA2A 1NUPA 5CCBA 3VZDA 3H83A 1WQ4A 1XZIA 4BFSA 1YZGA 1R9JA 1R6TA 3A1UA 3A70A 3NCTA 3I5XA 3AOGA 4AB1A 1WVGA 1LDYA 2IHZA 3H9JA 2JAUA 5J47A 3LUCA 3T1TA 2Z6UA 3HJRA 3QTLA 3DBHA 1U28C 1RW4A 3ICPA 4DJJA 5B55A 4PLPA 2CMFA 2ZKLA 1V7PC 4RD2A 4W5JA 4BNFA 1TYZA 2VP4A 3AB8A 4E4TA 2JI4A 4TUYF 3AFIA 1ISMA 2XGOA 3HP4A 3JQDA 1JG2A 2WF9A 3CBGA 3QSGA 1F2DA 2DT8A 3RD5A 3TLGB 3WFIA 5KYYB 2BR5A 4MIKA 5BV8A 1XWWA 4OQDA 4B3SB 2ZSDA 1XNQB 3HWX1 1Q3HA 3FDZB 1XAJA 3R3XA 1ZITA 1CJVC 2HI0A 4D9IA 2PDAA 3K0FB 4AZ0A 2BW0A 3QFHA 4JR0A 4FXPA 4DARA 5GM1A 3FJOA 4PICA 4OREX 2IF2A 2VPTA 4RTRA 3PENA 3FIJA 5AOVA 1K98A 3OP4A 3R3HA 4O2BB 1JDNA 3DHVA 1OAKA 3MD9A 2PUVA 1KYVA 1JQDA 3O8QA 4ZVTA 1WBDA 1EU1A 1OGIA 3AP1A 3GCGA 4UUPA 3TPZA 4B2YA 1XPUA 5EIBC 3I9FA 5AH0A 1VXRA 4PGFA 4HFNA 3DFUA 4G26A 5T41A 1V7CA 4IEEA 2Z9CA 4F8EA 4NU0A 5TEVA 1GVNB 1YV9A 2AMJA 2D0IA 1XTIA 4IDAA 5D3MA 5LYJA 5TRTA 2R8PA 2Q9AA 4EDHA 1U2QA 6REQA 1MFZA 1E5LA 1OASA 1SUCA 1VKOA 1YQDA 3C5VA 3KPJA 1UFKA 4HAZA 2W2QA 3MC1A 2P9YA 1A5BB 3B9RA 3CE6A 3N2KA 4INZA 4C3VA 1EXVA 3ZHBA 2KHZA 3C1TA 5TS2A 3BL8A 1C9YA 2RKWA 1UAYA 3CZ9A 3EDOA 4JLPA 1Q0QA 1T8SA 4KN9S 1EBFA 3RR2A 3VYWA 4A6DA 2ONJA 4UFOA 3T3OA 1Y34E 2PXCA 3K0CC 2P4UA 1Q21A 3H3JA 3JQPA 1A5AB 1ABBA 3PUXA 4LZNA 1NVVR 4RX1A 2R8OA 2WIGA 4E5YA 2YHIB 2NX2A 4J7UA 1XZBA 4TYPA 2OQIA 3AIIA 3MJEA 3ZDEA 4LK3A 4Q19A 1SQFA 2YW9A 2OQRA 4BNHA 4UHHA 3AXSA 1PNTA 3QVVA 3WADA 5JAOA 1UIMA 5HF6A 5KREA 1O96B 3LUHA 3PXGA 3WYEA 5I48A 3NALA 1AO3A 1F8GA 4WFIA 2Z43A 3NOOA 3GOHA 2WTNA 1X19A 4LYEA 2OC9A 3Q6NA 3V7WA 2UYHA 2V0GA 1MZPA 1CUWA 5KOJA 1GD1O 1U5CA 3Q3IA 3D0RA 3QF4B 4BS9A 5LB4A 1Z5OA 2HK9A 1IAQA 3DWGA 4JEMA 3T38A 3UJBA 4F38A 1M2OA 3LPDA 3M9WA 2XECA 1QQ5A 3OCXA 1U9IC 4R1OA 5SYMA 3K0EA 4LW8A 4WY8A 4ABYA 4AMGA 1KJ9A 4BVFA 4LF9B 2MR5A 2E37A 3EASA 4IOLA 4MI3A 2O0MA 4UCXA 3UKJA 2FNAA 1FRNA 2GLTA 3UN1A 3IT3A 4CU2A 5BWLA 2O5RA 3RREA 3VYUB 1XKTA 1KEUA 3ANTA 3CH6A 3WQQA 1SB8A 1DAKA 3G88A 4RLQA 1Q0ZA 3I64A 3NC0C 2CVHA 4UDYX 3NM5A 1JFTA 1WSDA 4ERXA 3A2NA 2WAAA 4M0KA 4DAEA 4D9JA 2Z6AA 1B26A 1G98A 5HW0A 2G77B 2GPJA 3BD7A 1ZSNA 2JJQA 2DH5A 2QL9A 3HZHA 3PP8A 4XYBA 1NOKA 3RU9A 1Z6AA 3WS7A 4LIPD 3V8RA 5C4MA 6GPBA 3NHKA 3V34A 3GZNB 4JENA 2DFNA 3UG7A 1UXJA 4KK4A 3C6YA 5EKUA 4N5HX 4HZGA 1CF2O 4G5GA 5KJ6A 4JXZA 2GILA 3FZEA 2WVJA 3FVQA 4BC0A 1PK9A 2CD7A 4BFXA 1T8RA 4NFYA 5EZQA 4V1CA 4P6VF 5CFOA 4YP9A 1PZXA 3QLVA 1ULTA 3ZS9A 1YCHA 2Y99A 2ZANA 1A4IA 3DL4A 1FDSA 4MB6A 1HG1A 1R0RE 2G0TA 4WZ6A 2CLHB 1MC1A 2OUIA 3TD2A 1JMVA 1Y3DE 3RANA 4JVNA 3PSAA 5KKNB 3SS7X 1ZSVA 1JLRA 1AZSC 1JAIA 4I46A 5EYPB 3BZWA 4BVHA 3E5HA 3JASB 4WFQA 3OQ1A 4EG8A 4F04A 1LSUA 4DCMA 1E59A 3QG1A 1CRQA 3CEAA 2UUOA 3KQUA 3FNEA 4HI0E 5K0GA 3EA0A 3MTEA 2B0CA 4X3CA 4A9AA 5JAIA 1KPHA 4JT9A 3CM0A 2YOHA 3T7EA 3NT2A 1WB6A 1QGUB 2HGSA 4CEIA 1ZGHA 3GJXC 3JYOA 1XVTA 3T1VA 3SQWA 2D1TA 3OG9A 2Q1TA 1D9ZA 4BL5A 4B4VA 3GT3A 1TQ2A 4OA5A 2VPZA 3TX2A 1E0KA 2C84A 3UFXA 4D4IA 2KW5A 1BNCA 3F2IA 5AKXA 1GSIA 2YFHA 4L5YA 4IM7A 4NI5A 4DWWA 4FCWA 3S8MA 2BTEA 2H57A 5JI3E 4V0OA 4EB8A 2IQIA 3OCWA 5JXHA 4ENQA 3N8HA 1BAPA 1SGWA 4A8JB 1CQWA 4QPCA 3AEKA 3CRNA 1KVTA 2C4NA 2PO5A 1KO1A 2EZUA 2GBIA 2VEOA 4NDAA 5FI1B 1L4BA 3R5JA 2HH9A 1TYAE 4URZR 4E94A 3RBXA 3AKZA 2XOKD 3Q3VA 2ZYDA 3Q3HA 2Q27A 3E5NA 3RNOA 1WMAA 2I34A 4LX0A 2OE2A 1VCHA 1VYTA 3R3VA 2RJ3A 4DLPA 1PZEA 2QJRA 4TVBA 1KMMA 4QREA 3L9WA 3GEGA 2WD7B 4KFTA 4M3NA 4CF3A 4IXMA 3AJRA 1P4HA 3N1UA 4GI5A 3K32A 5EZYB 4W5WA 2O8EA 2F1HA 3BFPA 1HQCA 2FPIA 1BWPA 3CJRA 3FHJA 3WX0A 5F7ZA 1N5OX 3E9NA 2ZK7A 4HUJA 2BGJA 1I13A 3OTHA 4M9UA 1A9XA 4HJXA 1HL7A 1BU5A 1XMPA 3SLKA 4BQFA 3NHMA 1RRMA 1RKQA 2IODA 1ZA1A 2AN9A 2ZSKA 3AUAA 3HFSA 2HO5A 3TIFA 1RCUA 2DZDA 2P0EA 2VRNA 4X8OA 5DU2A 5SICE 3K9CA 3QTTA 1P1CA 4BEWA 5HRAA 5G0VA 5T67A 3SU8A 2RGGA 1DOHA 5H59A 4FYWA 1P72A 1TA4A 2NIPA 2QPTA 2XB6A 5M2QA 5JNSA 4F12A 3Q3GE 4CL3A 3FWHA 3PEFA 2B92A 3KLNA 2JKYA 3H2GA 1EDBA 1VPTA 4LZLA 2CSXA 4IKPA 1ZM7A 1VPLA 3STXA 4L4SA 1C2TA 2VWHA 2FE1A 3V7YA 1XLVA 1N7JA 2OCBA 4BEJA 1TYDE 4FFWA 4FK8A 4LXIA 2FMHA 2VAWA 2OHHA 2X3FA 3R8FA 1AA6A 1C81A 2I5PO 4KZPA 1NVFA 1AD2A 2AOUB 4GO1A 1GUDA 2WQ6A 1EM8B 1VJ0A 3M5DA 2D62A 2QOEA 4QXOA 1BIFA 3DNMA 4B71A 5C51B 2VQ3A 1GNSA 3WIBA 4F3TA 1GU0A 3HGTA 4ZZIA 2I4IA 5LNK1 1V47A 1PS8A 3G1UA 2FMKA 3O9MA 4GXQA 3KR2A 5KEIA 2Y0PA 4N3GA 3DDNA 2B4RO 2Y1LA 4PPYA 4XWAA 3ZCQA 2ODAA 2R8BA 4HL6A 4DIKA 2AT1A 2YZNA 1OUMA 3FWNA 4Q18A 7AT1A 5K8JB 3SYLA 3A36A 3K2QA 4EF4A 5CG1A 4J7AA 4AIRA 2PANA 1NV9A 1PEDA 3HVUA 4CHTA 2JIZA 3GPIA 4JP1A 4ZJPA 3QA9A 3C6MA 2O9JA 4R1SA 2Z0MA 2ZRQA 3ST7A 2TECE 3RYHB 3O4FA 3WNBA 4CMKA 3AUYA 2DHCA 1W85B 1CDOA 5ALRA 1EFPA 1M2JA 5HM8A 1XNJA 4AG6A 1ZJZA 2CVOA 2XNJA 2EJVA 2VUHB 3EHEA 1B4DA 3I1YA 5C1PA 4ETNA 2W2VA 1H1TA 2C20A 1A04A 1RS0A 2QX7A 2ZDGA 4W7IA 2A0WA 5EJ5A 1TEVA 1XG5A 4M8IA 3VOTA 2QUBA 2KMLA 5F4BA 2CCJA 2HL6A 2C5SA 3LSTA 5C1OA 1YBHA 1CSEE 3TQHA 1RPZA 1K88A 3U4AA 4DMLA 1WB4A 1CJSA 2Q3DA 1PYDA 3IAM1 4MVJF 2D1SA 3KR9A 3FX2A 2VS1A 3VNRA 4E51A 5I7VA 3T61A 2P67A 5CW2A 4NKRA 2A9VA 1CV2A 2TYSB 1JAYA 3V7NA 4OUDB 5C5DA 5FPKA 2QXTA 1KZYC 1XRPA 3JYLA 1A2BA 1DDIA 4MWZA 1Y9DA 1XTBA 3B3JA 4FPXA 1NXQA 2EHDA 4C4OA 2PU7A 2YJ3A 3L8YA 4HLDA 1W48A 3VHXA 2GN9A 4QFCA 4KWEA 4O29A 1I9GA 3IOYA 4BO8A 3H16A 1EUCA 2A33A 2H4ZA 2XTMA 3DE7X 4G85A 4MA0A 5DO9A 4X90A 1AKYA 1P6UA 3DUFB 2GEDA 4DV0B 1AURA 3QYFA 4CL8A 3EIWA 2Q5FA 3P26A 2FFRA 1GP2A 1E18A 5FTKA 3RRXA 5K8LA 2A3RA 1F3OA 3IR5A 4OUKX 3JWIA 3N8NA 3GZJA 3CNEA 4LJ9A 5F4ZA 4EZEA 3C1AA 1EFAA 1MV5A 1VE6A 2XBMA 5F5LA 1PVOA 2EXXA 2G3YA 5BMVF 3T1HB 2HBZA 3B7WA 4D0SA 1L7MA 3R5HA 1RM0A 1JA9A 1SCUA 4DNQA 2J9GA 4U2FA 4WHMA 4CR6A 4DBLE 1K6EA 4ND5A 1CFZA 4WXMA 2P8SA 3O8BA 1GHTA 5DGHA 1NMQA 1G6KA 1WCIB 3ZVNA 2RGRA 2MYUA 5LKAA 1NW9B 4KACA 1YULA 3LXRA 5TF0A 5TY0A 2B5OA 2IIVA 3GIDA 5K09A 2FWRA 1E2DA 1T9GR 3GLIE 3R44A 3BWCA 3PFBA 1GFWA 3M3PA 3RUIA 2XUJA 4B4UA 1N9GB 1TTHA 4OKIA 3P0IA 1JKJA 4GPTA 2CWDA 4DWOA 4R4JA 2UAGA 1CJCA 2J1LA 4IUDS 4UNIA 5J3JA 4TSKA 5AW3A 1XTRA 5C7IO 4LY0A 3OLCX 3RK4A 2XB4A 1IC6A 5E9JA 3F47A 4KYIB 4EPXA 1V2GA 2B21A 3W06A 5ICSA 2ZZKA 4Q00A 4D26A 3GBSA 1JPNA 5DZSA 4EA9A 3ZHYA 2QZZA 2JF0A 3BEDA 2IU3A 2ADFA 2F9FA 1DADA 3D4IA 3QKUA 1SAYA 1YKGA 4RA6B 5I7SA 1V4VA 2ZAYA 1XPRA 2RB5A 1E6LA 3MS2A 1Q92A 4L5CA 5JQGA 1L1QA 1P0PA 3QVXA 4M1EA 5AHOA 1CR1A 5DTRA 5E3IA 4L3WA 5JAZA 3PDIA 4Z0HO 3E27A 1FDUA 1XI2A 4CLXA 4Q6BA 1VXOA 3FM9A 1BGXT 3QENA 4UOEA 4FMCF 1R6BX 3D4PA 3IERA 3LFUA 4RMJA 1UJCA 2X5JO 2RHRA 2XCQA 1DRUA 2XY4A 2VF2A 2YXEA 3PFGA 4F92B 1NW7A 1XB2A 3NTVA 2ZLBA 3WLIA 5JNRA 1SC4A 1HE8B 4HLNA 4Y6QA 4TRJA 2ISCA 4HDRA 2ZVJA 1KWKA 2ODNA 4WCFC 1SXJA 4L74A 1ESZA 2ATIA 2EYUA 2P3QA 3PXDA 2D74A 4P1ZA 5BSRA 4KQXA 4RDCA 4G56A 4LJLA 4RHEA 1TJ5A 3UUFA 5F1YA 4EPVA 2C29D 1NBWB 1USWA 1JJ7A 1H0RA 2VTKA 5HCNA 3A3NA 3FMOB 5LCXA 3G9TA 1NJ8A 4QYXA 4ZJZA 1P91A 1KK0A 3V8MA 2CE2X 3ON5A 3PC2A 3DVQX 1DOAA 1BROA 3DZFA 3T6KA 2VJMA 3HU5A 3K9GA 2XMZA 5C8XA 4ZCPA 1T6NA 4RNCA 4YAOA 4XRRA 2NUTA 3I05A 1JDUA 1YQUA 5E95A 3U5TA 3ZGZA 1Y1LA 1GO2A 3E7DA 1KO4A 4AG3A 1TK3A 1IM2A 3ANMA 4Q15A 4UXJA 4FILA 2Z2ZA 4ZQHA 1XCGB 2QQ0A 3LBAA 3NNSA 4MPJA 1P2TA 5H4GA 3WB0A 4KOAA 3E2MA 3KZCA 4KW7A 4FKZA 4QT0A 5H02A 3T34A 4B81A 1BU8A 2FVYA 1MB9A 4IDNA 4KQ6A 3FWPA 4BIMA 2C4TA 2H51A 3BWDD 3BIOA 3IQWA 3K1AB 1WTAA 1XCJA 5DPMA 4C0JA 2FJ0A 4FJ1A 3RAEC 5AFSA 4Z3DA 3G1WA 1YR2A 5G3YA 1KI9A 2TRSB 4ZYLA 1Y33E 1BQ3A 1V7QA 1E1YA 3I0NA 4KQFA 2DAPA 2X13A 4J90A 5F76A 3V1TC 5NLLA 3H75A 4XPZA 1LQ2A 5ALQA 2YINC 4H7IA 3NRCA 3MIZA 4X20B 1GPLA 3SQMA 5KB3A 2ZUDA 3TB6A 5FHQA 3LPAA 4NBLA 4ZT6A 4GWGA 3QU2A 3PNBA 3GLHA 5PGMA 4X54A 2ZRCA 4M53A 2R25B 5L3SA 5CAEA 1ZBQA 3I58A 4DY6A 2PPLA 1VE3A 1M67A 4EYQA 2GCIA 1U6JA 1NYRA 2EWMA 3D3NA 3A7EA 4OOFA 3WGHA 2VG8A 2ONZA 3AVQA 4K7JA 1IJKA 5BSFA 1M2VA 1O8CA 3ITNA 2C8JA 3JQFC 3J7TA 2GKGA 1NURA 5C8ZA 3DOOA 1QFMA 3EPRA 2ZUCA 2FLVA 3A6FA 2O20A 3IHWA 3IURA 4OAQA 2NLOA 3CB4A 3GRKA 3JYPA 4GIBA 4KQ2A 4R8KA 3TK1A 4JR1A 3V4LA 2I9KA 4ZAZA 2D3TA 5FWXB 2PRIA 1GGFA 1PO7A 4CG2A 5JEDA 3IPLA 5FR1A 4LI0A 1X1CA 1ZG3A 2HNAA 1KDVA 2ZJBA 3OPVA 2O3JA 4FOPA 2IDZA 1IZ7A 5AJHA 3W6PA 4EWLA 1G1MA 2MJLA 4C7OB 3DDWA 5DNUA 5D5HA 5KINB 5KU1A 3ICCA 1WL8A 3W6UA 5DYTA 1IU9A 3MBOA 2QM8A 1NPYA 1TIPA 1Z0DA 4QQKA 4RQTA 3QSYA 1JTVA 2E6KA 1SKBA 4DBVO 4W6ZA 1W44A 2EFYA 3C39A 3UIEA 1VJCA 3UK2A 5BV0A 1BFKA 2ADMA 1ST3A 2H3HA 2VC2B 1FNNA 1G0NA 3KLMX 3NNNA 5ILQA 2VRCA 4JJ8A 3VBCA 1IXSB 2JZOA 2OO5A 2WC1A 4JDUA