2X7HA

Crystal structure of the human mgc45594 gene product in complex with fenoprofen
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
343
structure length
343
Chain Sequence
IPQAMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZINC-BINDING ALCOHOL DEHYDROGENASE DOMAIN-CONTAINING PROTEIN
publication title Crystal Structure of the Human Mgc45594 Gene Product in Complex with Fenoprofen
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 117
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x7hA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2x7hA01
4MINA 4FJ1A 3D4PA 4WLUA 5F1PA 5JLAA 2PA3A 3EC7A 3GY0A 1H94A 3R0IA 3FTPA 5KKCA 1K2WA 2EJVA 2O3SA 4EI2A 1YH3A 2H1SA 2QQ5A 3STHA 1A7AA 3W4IA 4AG3A 1VL0A 1PZFA 1Y7TA 4GSKA 3INGA 2GYYA 3DDNA 4K26A 5EL0A 4IZIA 3K6JA 4OJNA 4RDHA 3ADPA 5A3VA 4CMAA 3K5PA 4BKPA 2IZ1A 3ZN2A 3DBVO 4XGNA 1DAOA 4ZGWA 2VZ0A 2GN6A 3TL2A 3JYNA 3ZNQA 2G0TA 1CJCA 4CMKA 2ZB8A 3NDJA 4OIMA 2D8AA 2Y1DA 1NQ5A 5CDGA 4AJ2A 2PWZA 3LVFO 4J4BA 2NVUA 3RFXA 4U5QA 3D64A 4URFA 4RPHA 2Q2VA 3JQ7B 1GY8A 2D5AA 2AE1A 2VYVA 3WBBA 3H2SA 3WXBA 4CQMB 4P4GA 4E31A 1NWHA 2A35A 4N5MA 4FJ0A 2VHVA 2PD6A 5JMPA 2Y1CA 2FR1A 1Q7CA 3X2EA 1EUZA 3TZQA 4LVUA 4YYZA 4YAJA 2EKLA 3D3EA 4BKUA 2JAHA 5FF9A 4YWJA 1M6WA 4KTVE 3PHLA 3ZI0A 4NPCA 3JQ6A 4GH5A 4UVHA 3FWNA 1XSEA 4IJKA 4OL9A 3PJEA 2NV6A 4R9RA 4TRNA 1FXSA 1YXMA 2WSBA 3CZMA 3RUFA 2ZK7A 1C3VA 1F0YA 1T25A 3R6DA 5ILGA 5L7YA 2Q1TA 3AY6A 4IMRA 5JDCC 3RU7A 4BB5A 1YONA 1VRWA 1Q0LA 1DLIA 2RHRA 3B1FA 3ZV6A 4BV8A 3RC7A 1BSVA 5A02A 3PWZA 3F47A 1DLJA 2YHUA 1ISFA 3OFSA 5AVOA 3S2IA 3GA0A 3GUCA 4CQLA 3ANMA 1WVGA 1XEAA 2OGUA 1UAGA 1KVQA 3RUEA 4EZBA 3LC1O 1J6UA 1DXYA 2IEDA 2WMDA 2PZMA 3LT4A 3W6ZA 3SJ7A 3W8DA 1ZMTA 3S55A 2BH9A 4CPDA 4EJMA 2OZPA 1QYVA 4GWKA 1P45A 1R4MA 3FNEA 4OXNA 1RYDA 3HZZA 1ZXLA 3KTDA 1LRKA 2GGSA 4AJPA 1TI7A 5TRTA 5IF3A 1YJQA 3UGKA 1XKQA 5I7SA 5DF1A 1AN9A 4WCFB 1BMDA 2DAPA 3RQSA 3WDSA 1JWBB 4XB2A 1LDGA 4HBGA 4JX8A 4I8XA 3K73O 3K30A 3RUDA 2Q45A 2X6TA 3MJSA 4YT8A 5B4UA 4TKLA 2C07A 5G4KB 3WGTA 2C2YA 2G82A 4RQTA 5HBRA 5AQ1A 3OHSX 5HM8A 1ARZA 2E6UX 2AEFA 4ROSA 4F3YA 1U3WA 3GHYA 4KDFA 1FF9A 3ETDA 2EGGA 1E3SA 4B3JA 1PJQA 4BO4A 4FFOA 3H7AA 4LW8A 2VRBA 2FPIA 1IZ0A 1A5ZA 3A1NA 3HUDA 3VTFA 1WDMA 1XQ1A 2ZTUA 3A14A 4KTTE 2Q4BA 3BMOB 9LDBA 4Y6SA 3TWOA 1NFRA 3KBOA 4CM9A 3V2GA 2VRCD 4RVFA 3G3EA 3GG9A 3S2GA 1LSSA 1UR5A 1I10A 3PWKA 3QVSA 1V3TA 1ZKMA 1ISGA 3PGJA 1HWYA 3IUPA 5I7EA 2BFPA 4ZD6A 4OKIA 1G1AA 1U4SA 4GPD1 3GAZA 5G2OA 3ETGA 4JJFA 1D8AA 1EE2A 2DC1A 2OP1A 1HF3A 2O23A 3GEMA 3L6EA 3NYWA 3IUSA 3FNFA 1I3MA 1V6AA 2OUIA 1UP7A 3NT4A 3DAGA 3OA2A 3U4DA 3ZWCA 2O3QA 1SNYA 2EJWA 2Q99A 3OJOA 4JQCA 4OQYA 4WLOA 5IN4A 4WLNA 3PTZA 3JQGB 5BR7A 4BNKA 2WYVA 1X1TA 4E4YA 3OA0A 3ZWXA 3IQDB 1Q0HA 4TMFA 4AJNA 1YBAA 4PLCA 1WPQA 1R0KA 4PG7A 4BHTA 1B0AA 1JW9B 4ZU3A 4BIIA 4O1MA 4Z9FA 3SBOA 4CLOB 4E6PA 1WP4A 1JLLA 2CY0A 2FZEA 5I9LA 1DO8A 5JW6A 3SC6A 3HN2A 1JTVA 4A27A 1NPTO 1P44A 2Z1MA 4PCVA 3MJVA 1NAIA 1SB8A 3NT5A 4WEQA 3AOEA 4G65A 1YWGO 1QORA 3NDIA 5JAQA 4G5HA 1K6XA 5F1OA 3E5MA 4DLLA 5T64A 2HU2A 1P1HA 4E0BA 3H9GA 3P2YA 4XR9A 4FSHA 5DBFA 3N7UA 2V6FA 3OJFA 2YZ7A 1TEHA 4R3WA 1GFSA 3NGXA 4A10A 5F5NA 1SPXA 2DT5A 4KZPA 4ZQEA 2XOXA 4RF4A 3O9ZA 2FOIA 1F17A 1MC4A 3JD2A 1U2DA 2B4QA 1ID1A 3WTBA 1YOVA 3UW3A 1Q7GA 3EZLA 1A72A 2Y0CA 3DZGA 3OQ6A 2Y1FA 4J90A 2VT3A 4D3SA 2NQ8A 4W9NA 5B37A 3ICCA 4GQAA 4MVJF 1U7HA 2PD3A 3OICA 2ZB3A 3ORFA 4WUVA 1Y5MA 1PJLA 1BG6A 5DZSA 3B1JA 4CMIB 3JQAB 1GR0A 3D3WA 2V6GA 3AY3A 3RCBA 3ONDA 2GO1A 3W8EA 4CQLB 4W4TA 2DTDA 3KYBA 1UXKA 1XU9A 4OXKA 1HDRA 4GX1A 4CQMD 3CZRA 4QO8A 2AEJA 1PWZA 5A03A 2QX7A 1LC3A 4JN6B 3DXFA 5BQFA 4UUNA 3TF5A 5L4SA 4IUYA 4PVCA 1WMBA 5A5FA 3COSA 3INTA 4NZ9A 4IJWA 3VH4A 2J3HA 4CM8A 5L53A 1TLTA 1X0VA 5BSFA 5DBGA 2GR9A 3BHJA 3I1JA 3L9XA 3WSWA 1H2HA 3EHEA 4HFMA 2FSSA 3DR3A 4MVJG 1V3UA 1Y8RB 4O0LA 3UAGA 3ZDFA 4U8GA 1DIAA 4YBZA 1EQUA 1I5RA 3HQ4O 5KNLA 4WLVA 4XQCA 4E5MA 3M2PA 3PLRA 4YAEA 3AM3A 3BMCA 3WG9A 4B7XA 1W4ZA 4F45A 1U5CA 2POQX 3S2EA 3UCEA 1NFFA 2DQ4A 4NFHA 2HQ1A 3I5MA 3ZWVA 4R1NA 4RPKA 1K6IA 2JHGA 4FGWA 3GMSA 4MJLA 3WB9A 4D46A 3DOCA 1ONNA 3KLMX 2AG5A 3GPIA 4RVUA 4Y9DA 2CDAA 3E9QA 3FBGA 4AJEA 2O50A 4WOKA 4CUKA 1LEHA 5JE8A 2W98A 4C7JA 3KM0A 1UZLA 4XX0A 3OP4A 2RH8A 4PLWA 4ZQFA 4E2WA 1ZK3A 4HNHA 4KP7A 3EDMA 4J9UE 3OJ0A 5TIIA 5CDYA 2WD7B 2X58A 5G0UA 3TSCA 3C85A 2YV2A 2G17A 4IDBA 4GLOA 4FIZA 4MKRA 4RVHA 3RC1A 1HLPA 4DXHA 5F5LA 5JC8A 5IDYA 1BW9B 4DPMA 1LTHR 2QRLA 1LSOA 4RLSA 5CHEA 4IQ8A 1GDHA 4QSMA 4W6ZA 1GQQA 2DTXA 5G4LA 9LDTA 3V8BA 3HWRA 3DB2A 2YV1A 1G0NA 2P9CA 5B12A 2O3RA 3ONFA 1PJTA 1D1TA 1DIBA 2ILTA 4C4OA 4QTZA 5H83A 1GCUA 5KJFA 2HLPA 4XGKA 4HFJA 4YRDA 1O8CA 1OC4A 5DCUA 5EPOA 4M87A 5LCXA 2EHDA 2QZZA 1PQWA 4JIGA 3ULKA 4ZQBA 4J7UA 4JJGA 1WWKA 4J3FA 3F4LA 4CL8A 3E9NA 1HZJA 3GDFA 3T7CA 1H6CA 2IDZA 2NTNA 4CMEC 1JQBA 1BXGA 1X0XA 4MVJM 3WGYA 3ZU5A 3M1AA 4NI5A 4E32A 4L75A 2E48A 1TT5B 5TS3A 1IY8A 1T1SA 4NJMB 2R00A 2R6JA 3QVWA 1CF2O 3HE3A 4E30A 1P3DA 2J5QA 4BL5A 4FFRA 1SAYA 3TZCA 3RUAA 1HYGA 1C1XA 2JKVA 4Q3NA 4E2YA 1WAMA 2WE8A 1HTBA 4BO3A 2IZ0A 1SZJG 1DDOA 4OOFA 4RF2A 5K0ZA 3GVHA 5L7TA 2WEKA 2OORA 2Q4EA 1LDMA 3RIHA 2D3TA 4N7RA 3MCVA 2W90A 3PIIA 5JCXA 3WMXA 1VSUA 1PL8A 3GNTA 3R3JA 4MP8A 2DVMA 1GAEO 3NTOA 1L1FA 2O4UX 3PYXA 4R4JA 1A9YA 4QECA 4XIJA 5I7FA 3DFUA 2FPPA 1Q2XA 1VJTA 3AW9A 2VUSA 1N8KA 3GZNA 4RV9A 1I2BA 2DBQA 4R1TA 4EDFA 1BVUA 3IKTA 4AFNA 1IB6A 3JQ8A 2XXJA 3INRA 4ZQHA 4DLBA 3DOOA 4JK3A 2X5KO 2PFGA 1MB4A 4CM5A 3LZ6A 2PLAA 2E82A 1E7YA 1QLJA 4NBVA 1HT0A 5U1PA 4KWHA 3ABIA 3WIEA 2CNBA 4TVOA 2I6TA 5EN4A 1UH5A 2X1HA 1ISIA 3FBTA 2QZ9A 3GEDA 4UVIA 4ALMA 3QVOA 3CEAA 3ROQA 4E21A 5K1SA 3LF2A 1HYHA 4IXTA 4ALLA 3E48A 3JQBC 5I8WA 5ITWA 2BELA 3GN1A 1GQYA 4B7UA 4DMMA 1IYZA 4AJLA 1SB9A 3JQAD 2LDXA 3QWAA 4IDDA 3O4RA 3C1OA 2QYSA 1E3EA 4JROA 1HLDA 4PZDA 4FOSA 4WOJA 4Z3DA 1QXSA 4E5NA 1RJWA 4GX5A 1LQUA 4L0QA 1KEWA 2Q1WA 4M49A 3RFTA 1PGNA 3IP1A 4PLPA 4TVBA 1B3BA 3GZ4A 5KJCA 1J4AA 1QG6A 1E6EA 5TJ9A 1DIGA 2SCUA 1O6ZA 4OAQA 4XDZA 4Z9YA 3TNLA 3W1VA 1DAPA 3ASVA 3VHRA 5THQA 3HSKA 1HDCA 4CL3A 3LT1A 1KVTA 2BFAA 2YUTA 1DB3A 3QQPA 3ANNA 2CSUA 1K6JA 2E49A 3LT0A 4FFMA 4ND2A 3SX2A 2IXBA 1FMCA 3PYMA 3FTNA 3ROPA 4CV1A 4B4VA 4ID9A 4GBJA 1EZ4A 1K3TA 2VZ8A 5ENVA 4UUPA 4DQUA 1S7CA 3PJDA 4Z9XA 5L4NA 1T1RA 2QYTA 4KUEA 3VAZA 4BO0A 3ENKA 3WX0A 1E7RA 4C7KA 2Q2QA 1QSGA 2H63A 2C0CA 2WYWA 1VSVA 3DBRA 1LUAA 5TC4A 4DPLA 4DQVA 1FDTA 3H3FA 4DWVA 3NV9A 2ZIZA 3QY9A 4LRTB 5HTOA 4FN4A 2D59A 1C1DA 3I23A 2JFGA 1T24A 2CMDA 4FJ2A 4NFYA 2Z95A 3LC7O 1XYGA 4NIMA 2CD9A 3I9LA 1MG0A 2BFMA 3PFFA 4HP8A 4ND3A 3UKOA 5ICSA 3KOUA 4CLXA 3KHUA 4K6CA 4W7IA 5JCJA 5K6AA 3MTJA 1ADFA 4PG6A 1UP4A 2Q49A 3MZ0A 1P0FA 1GYRA 2X86A 4NJOA 4YAIA 4BB6A 3GG2A 3Q11A 3D4OA 3NUGA 1YGYA 3NKLA 3OH8A 4GL4A 1F8GA 3DFZA 1KY4A 3V1TC 1LXCA 3Q0EA 4NBUA 4XEHA 3KLPX 3AWDA 1KVRA 4IPTA 2X0RA 1HDZA 1NVMB 2P9GA 1LQTA 1NP3A 4BNJA 4PG5A 3GRKA 5A9SA 2BGKA 3D4NA 3JQ9A 3ZW9A 2YHIA 4RDIA 3VH2A 3I83A 5A05A 3KEQA 2BMAA 2DTEA 2UUPA 1V0JA 4MVJI 3OEWA 4XRRA 4W7HA 1WDKA 1PL7A 1P9LA 3FCOA 3OJLA 4R16A 2HMSA 3EAGA 3N74A 1SEVA 3GRPA 2GCGA 3P7MA 3Q2KA 4ESOA 1ZFNA 2Y66A 5IXYA 2B37A 1PJCA 4XWYA 3OECA 4WLFA 4DQXA 4R1UA 3KYDA 3QW2A 2H9IA 3UF0A 4XJSA 4DTIA 4QFDA 2FP4A 1GPJA 2UVDA 4YACA 2GERA 4B3HA 1C14A 2VHYA 2GLXA 2RBEA 4DA9A 5GZ1A 1E7QA 2I99A 1LRJA 1XHLA 2V6MA 1NQOA 5DP1A 5JC1A 1EDOA 1Z74A 2PKQP 5CP8A 1HYEA 5CEEA 1E1NA 5I7VA 4EGFA 5IZCC 3MTGA 3O26A 1H5QA 3M6IA 3MOIA 3F4BA 3RUCA 3JYPA 2UAGA 3GGOA 3PPIA 4CMHA 1ISJA 2RIRA 2QRJA 4WGGA 2VHWA 3AI3A 1P74A 4U0JA 4A03A 3H8VA 4IM7A 4TZTA 3GDOA 3KXDA 4FQ8A 3BMQA 4KQWA 1J0XO 5IDWA 4PN3A 5C5IA 1PR9A 1TB4A 1CRWG 3G79A 2FPGA 1LU9A 1ENYA 2X8LA 2GRAA 4LVCA 1I36A 2EERA 1WNTA 1RM0A 2GNAA 1PQPA 3TPCA 1MFZA 1ZH8A 3EYWA 1H93A 3GF4A 4I5FA 3UICA 3U0BA 4B8ZA 5MDHA 4M1QA 4Z0PA 4BNVA 1W73A 2JD0A 3ZV5A 2HMVA 3TL3A 1Q7BA 4BNNA 4L73A 4HFNA 4J9VA 5IG2A 4Z6KA 1DHTA 2HRZA 4GX2A 3WGQA 3DZIA 1IULA 4WCFC 3C1TA 3JD0A 4KMSA 4CM3A 4CV0A 5DCYA 1H6AA 4IDEA 3WQRA 2QG4A 4DC1A 4WJZA 4IJVA 4A5OA 3UN1A 1E5LA 1YDWA 2NVWA 2Y67A 3ZU2A 2GZ1A 1YS4A 1YB5A 5COBA 1NPYA 5DNAA 1DPGA 1J49A 5JDIC 1I3KA 1M67A 4I08A 3O03A 3KVOA 3U4CA 2VT2A 1DRUA 3PFWO 1E6UA 3DAPA 1F06A 4FCCA 2VOEA 5I8ZA 3ZNPA 3E6AA 1MFPA 1SMKA 1X7HA 3S2FA 2I3AA 3GFBA 1LC0A 1DBVO 1KERA 2G1UA 3HG7A 4D43A 1XLTA 1NAHA 1ZEJA 4BGEA 3LC2O 1Z75A 4AJOA 4DGSA 4MVJD 1DC5A 1GUFA 1HRDA 1L7DA 4IGEA 5JSFA 4QX6A 1BWSA 1BXKA 2WE7A 3K9QO 4FBGA 5AXBA 3RBVA 3RROA 1OOEA 1Z6ZA 5KVQA 4FD3A 3DOJA 2AHRA 2D1YA 3WLFA 4TZKA 2ZTMA 4BKOA 4J1QA 3DTTA 4MP3A 4EW6A 5BSEA 4GSLA 3WICA 5G0VA 2NADA 2ZQZA 1IHYA 4D42A 4HADA 3BHMA 3MJTA 2NTJA 3EMKA 3QWBA 2NWQA 1ML3A 4I9HA 4A26A 4DLAA 1LJ8A 1E3JA 2X5JO 1YB4A 3IC5A 3IJRA 3V2UA 3F1LA 1F12A 1NFQA 3EY4A 2YV3A 4P22A 3ZWPA 3LSYA 4BGVA 3IDSA 1Z45A 1O9BA 4D45A 4RPLA 3WGOA 4D7AA 4B8WA 4YAKA 4ZVVA 2HO5A 3VPHA 4K28A 1LDBA 2FSVA 2X9NA 4NQZA 5IDXA 4P8RA 3E5RA 4K9DA 4UEKA 3I4FA 1I24A 4DYVA 5G0WA 2X4GA 2B69A 3ONEA 3SEFA 3KO8A 4EJ0A 1ORRA 1EMDA 1O0SA 3HB4X 5JAIA 1NTOA 1GZ3A 3C8MA 2NLOA 5HS4A 1LBEA 2C7VA 3H5AA 4ZN6A 3AUSA 3WJAA 2O3TA 4FB5A 1GTMA 3BMNB 3WWYA 3UH1A 1W0CA 3PXXA 4JJIA 1WXDA 4DPKA 1R4NA 4DRYA 1ZK1A 4E5PA 2XF8A 4BNIA 1GYPA 1G0OA 3DMYA 4AICA 3QV1A 1UXHA 3JQEA 3GHHA 2OMEA 3PDJA 4TSKA 1GQ2A 3KYCB 5CG2A 1H0KA 4PG8A 4WASA 3JYOA 3VDRA 1XQ6A 2NU8A 4Q3BA 2QHXA 3WGGA 1Y9EA 5H81A 2HJSA 2FR0A 4R68A 2O2SA 3SC4A 4BOYA 2GUGA 3ANLA 4NDNE 3F6YA 4MVJE 3BTSA 3I9OA 4MKXA 5T8KC 3QP9A 1E92A 4IQ0A 1KY5A 2W2LA 2BFOA 3FR8A 5IFLA 4JGBA 3I6QA 5JY6A 4D3DA 4B7CA 1FJHA 1PS8A 1Y81A 4XYBA 1N1GA 1ZO8A 3BHIA 4ALJA 1A7KA 1X7GA 2CDBA 4N5LA 2X0JA 2D4AA 1UZNA 1U9JA 4AJ4A 2D0IA 1PJSA 4G2NA 4OQZA 2OFPA 2WTBA 2PKQO 3G49A 5TT0A 3TQHA 5ENDA 1RWBA 2EEZA 3A4VA 4KDEA 4B4UA 3JQFC 2OO5A 3WYEA 2NVUB 4PZEA 4II3A 1AUPA 1GADO 1I01A 4RPGA 1HZZA 2DU8A 1U1IA 5CPBA 1JKFA 2VNSA 3G1TA 1DRVA 1JVSA 2FZWA 4WE3A 1LDYA 2J8ZA 1NR1A 2IE0A 4J2HA 2EF1A 5COQA 2X0IA 1GPDG 3AJRA 1E3LA 2LDBA 1BRMA 4R5MA 5KIAA 2VYNA 3FHLA 4Y67A 1GV1A 3EW7A 4WECA 1T4DA 3FPCA 1A9ZA 3L4BA 4Q9NA 3UCFA 1XR3A 4CLDA 4F46A 2WD8A 4XYEA 2CDCA 4PLFA 1HDGO 3KRTA 2VQ3A 3FN4A 2NQTA 3ZHXA 4CM7A 1B3RA 4XGIA 1B14A 3SJUA 4J43A 1YO6A 1PWXA 2J3KA 2NSDA 4BKRA 3TFQA 4CM6A 3PDUA 3LT2A 5T5QA 1R6DA 3LF1A 2NU9A 4H16A 3CXRA 4KOAA 1KC1A 5AXAA 1H9AA 5LDHA 5JS6A 1H2BA 4Y6PA 1CWUA 3G1UA 4ND1A 2Y0DA 4ZRNA 4CLRA 4PVDA 5FWNA 2QRKA 3GR6A 1ONOA 4TRJA 3ZGYA 1N9GA 4BNWA 3LDHA 1R4MB 5L95A 4YT4A 2Q50A 3PQDA 3IL2A 7MDHA 1CIVA 4CR7A 5DULA 2OHXA 1M6HA 4QEDA 4QT0A 3WR5A 2O2YA 5EMHA 1RM5A 3A28A 3NX4A 4IDCA 1LLCA 4FFLA 1YL5A 4HX5A 1CQIA 4OKNA 3JYQA 3VDQA 4YJHA 1ENPA 1R12A 3DQPA 3N58A 3AM5A 3GT0A 2BLLA 3C24A 5BT9A 5BNFA 1E1LA 4OMUA 4XDYA 3AUAA 3D5TA 2BGMA 4JBHA 4N5NA 4MKZA 2P68A 3TJRA 3DZFA 4GKBA 1GYQA 1GEGA 1SO8A 1KIFA 3PZRA 5KJ6A 1IPEA 4XYGA 2DFVA 3I9NA 3Q9NA 1CDOA 1PL6A 4AVYA 5JO0A 5DP2A 4YDRA 5J23A 1A27A 4IBOA 1Y6JA 2OOSA 4YTEA 4B4WA 3EGOA 1R4NB 2NU6A 3DONA 1U8XX 3NJ8A 1BXZA 4H3VA 2DUUA 4XJTA 3QJ5A 1HXHA 4YRAA 3GN2A 1OC2A 1M2WA 2Y1OA 4HNGA 3TDKA 4CM4A 1GEEA 4H15A 4OXYA 2IODA 4J0FA 4UVDA 2C20A 2UV8A 2IRWA 1EFLA 3D0OA 5EQDA 2ZYAA 1WDLA 4BNUA 4D0SA 2V7PA 2ZJ1A 3AUTA 4BKQA 1LSUA 4EUFA 3B70A 1KETA 2WDZA 3QA9A 2I5PO 1HDXA 1KOLA 4BNYA 3IP3A 3VPSA 1PU2A 1HE2A 4BO9A 4LGVA 5ILOA 2WYUA 2VHXA 4YJDA 1EFKA 1ULUA 3PLNA 3ZU3A 2ET6A 1IHXA 1C0PA 3OMLA 4BGIA 2JL1A 3AI1A 5FEUA 3B20A 1MP0A 4BMSA 4UULA 3CINA 5ER9A 3E03A 3EK2A 4O59O 3F5QA 1UDAA 3P2OA 3U5TA 3V1UA 3WLEA 4AL4A 4NMHA 3U4IA 1NQTA 1SOVA 1PEDA 4PLTA 2BHLA 5A1TA 2XPCA 3RJ5A 1ONPA 5CEJA 1X7DA 4EJ6A 4OOEA 3RU9A 5EIOA 2I66A 3WSVA 2RCYA 4M86A 1UXJA 1Y8QA 4R01A 2EW8A 4CMJA 3MJEA 1PZHA 1ZW1A 3CH6A 5I9NA 1RM4A 2VN8A 2J5KA 5JXWA 1TA4A 1N5DA 1I3NA 3RI3A 4GGOA 1O95A 4XD2A 3ETEA 1ZNQO 5F21A 1Y5RA 2BKAA 4CUZA 2GPTA 2R2GA 3ON5A 1VI2A 4TQGA 3WNQA 2VOJA 4DIFA 4ZICA 3IKVA 1LX6A 4LSMA 1YOVB 2JHFA 5CDTA 2E4AA 2GN9A 2Z5LA 5U9CA 4U0KA 3DBLA 1JAXA 2I65A 1NVTA 3G17A 4FFPA 2P5YA 5COAA 1O89A 3V5NA 1YL7A 2UYYA 2O3JA 2PH3A 3UUWA 4NHEA 4BV9A 3D3WB 3OIGA 1UXGA 3FSRA 1NXQA 1UP6A 2JD2A 1I30A 2VYVD 3E18A 1YL6A 3H2ZA 4ND4A 5L40A 4PFJA 5KTKA 1PJBA 4L4SA 3R1IA 1T2EA 2I9PA 3B1KA 2DKNA 4IDGA 1HE4A 4ZQGA 4YJFA 4L76A 2VNAA 4NK4A 1DC4A 4RL6A 5C3MA 2VRCA 1GZ6A 3DBHA 1N9GB 1DIRA 3H9UA 5TGDA 4WKGA 4CM8B 5C37A 3BXXA 2DBZA 4OGWA 1U7TA 3QWFA 4IS2A 5KJ1A 3JSAA 3AOGA 1WZIA 3E82A 1TT7A 1X1EA 1JDJA 4BO6A 4BNMA 4P38A 4YPOA 4HKTA 5I9MA 4E5KA 5HS6A 1EBFA 1MX3A 3BMCB 1B2LA 1EEHA 4ITUA 1KVSA 4YEDA 4H7PA 1KEUA 1OFGA 1UDBA 5DOZA 3P19A 3H9EO 3QHAA 4E3ZA 3P5SA 3Q1LA 2O3UA 1ZMOA 3ST7A 1N2SA 1P1FA 4MOWA 2R00C 1NQAO 2HAEA 4TROA 3KV3O 5JY1A 5DDIP 4J1SA 4BS9A 1NR7A 1PGPA 1QMGA 2B36A 2YFHA 3BTUA 3PHJA 4GGPA 4Z0TA 2HSDA 4YJGA 3T4XA 4CJXA 1C0KA 1QLHA 2DBRA 3O38A 3PHGA 1E3WA 2GZ3A 4OYRA 2EW2A 2PKRA 4HUJA 3ZU4A 3OJEA 2YQ5A 2C82A 3C7AA 3PZBA 4BVAA 4CLHA 4RJTA 1DHRA 1P77A 5A4DA 4J16A 3OBBA 3VZRA 1W6UA 2P91A 4FW8A 3JQCA 3Q9UA 3NEPX 3PJFA 2WJPA 1ADBA 2UUOA 1PTJA 2A92A 4QXMA 1QP8A 4ALNA 1C0LA 1CQJA 1P31A 3DMTA 5EERA 2EKPA 3RD5A 4DYDA 4WPGA 2AQIA 1MXFA 4ZRMA 4J6FA 1EUCA 4Y8VA 3CMMA 4RORA 2G76A 2W4QA 4EITA 4JP2A 3ZWOA 2B0JA 4EEZA 3JV7A 3K96A 1XGKA 1IUKA 2H6EA 4CM9D 1N7HA 4XYMA 2HRBA 4R54A 5F1KA 2EP7A 4M8SA 3PGXA 3TN7A 3UHAA 1Z7EA 3GOHA 4IJUA 4WLEA 2VWGA 4L8VA 4Q3AA 3VKUA 3V1YA 3PQFA 4JBIA 1XELA 4I9NA 3VH3A 2BRUA 3I6IA 3JQ7A 4XCVA 4I5GA 4LMRA 4TRRA 3ZW8A 2DPHA 1HKUA 1NYTA 1TVEA 4AJKA 1QYCA 4UUOA 4CQMA 4WNIA 2PGDA 2VWPA 4F6LA 1BXGB 4NR0A 1PJ2A 2C59A 4CODB 2PTGA 3VZQA 1MG5A 4OSOA 4RF3A 4LK3A 4ILKA 3FPLA 3W6UA 4OO3A 2GSDA 4FDAA 4DL9A 4W99A 2PGJA 3ZNNA 3CTMA 3MJ4A 1C1XB 4S3MA 2HMTA 2ZQYA 2AW5A 4BQPA 4BNLA 4XQEA 5CPFA 5BNTA 4TWRA 3RJ9A 5TJHA 3AM4A 5H82A 5EQFA 5IZCA 4PLHA 2HK9A 4HFRA 1MUUA 3I9JA 1NHGA 4BNXA 3K2BA 1TXGA 2HMWA 2J3JA 1E1KA 2VCYA 3VPFA 3PJGA 4DMLA 5HRUA 4JCOA 1ZK0A 4YXFA 1VKOA 1VPDA 4Z0HO 4LCJA 3F46A 1PR3A 4LCEA 4NU5A 1X15A 4RZIA 3S1LA 1E7SA 4RVDA 1IPFA 4ALKA 3GGPA 1RM3A 3HFSA 2IZZA 4II2A 3GZNB 1UDCA 2C5EA 4NK5A 4BNGA 1B26A 5BSGA 4CMCA 1VL6A 4MVJP 3OSUA 3JQ8B 1PQUA 1ZCJA 3G0OA 4LSWA 5C7IO 2E37A 1T26A 1KS9A 3JQDA 3OF2A 1JU9A 8LDHA 2YJZA 5L9AA 1GUZA 1EQ2A 1R15A 2YDXA 3OM9A 3FF4A 4YCAA 1GV0A 4J49A 3MJCA 4MO2A 2FRDA 4WCFA 3RC9A 3QSGA 4Y6RA 3TOXA 2UDPA 2GN8A 2PZLA 1M76A 3WFJA 1PGQA 3HN7A 3I4CA 1U8FO 5KVSA 4PLZA 1R66A 1FDUA 5G4KA 3BAZA 1B15A 2P9EA 1DC6A 1BTOA 3O8QA 2B35A 4UEOA 5AYVA 1Z7BA 4F6CA 1JAYA 3CKYA 1YJ8A 2Y1EA 3HDHA 4RGBA 5EESA 2CUKA 1U3TA 4JXKA 1OI7A 4J1NA 4NBTA 3RKUA 4GI2A 2BI7A 4RVSA 3I9KA 4MDHA 1WW8A 3WQQA 3BMOA 1N1EA 2VUUA 4DUPA 1BDBA 2BF7A 2FN7A 2V65A 3AFMA 5BNIA 4J1TA 4RVGA 5TX7A 5K6AC 1GD1O 4HWKA 3EZYA 2FY8A 1HE3A 3UXYA 4EYEA 5JDCA 3JYLA 2X5OA 5DOVA 1NASA 3GNSA 4UVEA 3QWIA 2DBVO 4YJGB 2CZCA 5ER6A 3MEQA 3GFGA 2OBYA 5THKA 4YRBA 2OP0A 1K89A 5F3RA 1QV6A 1A4IA 3ZNOA 3I52A 3DTYA 1KEPA 1IOLA 2DLDA 4J0EA 1V8BA 2NVBA 2VHZA 2OXIA 3X2FA 1KC3A 1LA2A 1P1RA 2Y05A 5A04A 1T2DA 2FWMX 1PS0A 2AQHA 5HWSA 2P5UA 1QR6A 1R16A 4B79A 4S1VA 3GMDA 1D4FA 2HDHA 4BO1A 1UAYA 1DFIA 3JQ9C 3JQGA 1Y9AA 3ZHBA 3VVCA 2ZATA 2EP5A 4TKMA 3U62A 1Z82A 5TF4A 1Q0QA 1JWAB 4EEXA 3IAHA 1P1KA 1S6YA 1ZSVA 3WS7A 1OMOA 3CUKA 4PLYA 4CLOA 5EINA 3KZVA 1XU7A 2AMFA 5IXSA 3D1LA 3DBRB 4XZ3A 4HXYA 1HL3A 1T2FA 3DZKA 1I2ZA 4CM1A 1V9LA 4E2ZA 1A71A 1C1DB 4A7PA 4I1IA 1PJ4A 4AJHA 1SBYA 1KVUA 3WQSB 5ICMA 2VTEA 4DIOA 5A3JA 2W8ZA 3NT2A 4CV2A 1NNUA 3F9IA 4RCVA 3OQBA 2EWMA 2PZKA 1XIVA 2JCXA 4BNHA 3L6OO 1J5PA 1GU7A 3ROMA 3VTZA 1UJMA 2Y1GA 2W2KA 2CVQA 3FNGA 2D2IA 4Y98A 3WOHA 3GVIA 4JLWA 1AGNA 4RF5A 4GMFA 1CEQA 3QLJA 1HETA 1B7GO 1LLQA 3ZHZA 1HEUA 1YQGA 4NH4A 2X9GA 3JD4A 4CMIA 3JQAA 5T8KA 3H9QA 3DHEA 3PHIA 5KOIA 3PHHA 1GL3A 5A9SB 3WFIA 1LSJA 1JN0A 2YHIB 3UCXA 4I5EA 4DC0A 2ZTLA 3ENNA 8ADHA 2JCYA 3DC2A 4JBGA 2JCVA 4LMPA 5JYEA 4B3IA 1MV8A 1CYDA 1WZEA 3IOYA 3NRCA 3NTQA 5FI3A 3VKVA 2JFHA 3KSDO 3L4SO 4U6SA 1EBUA 1PGJA 2VZ9A 3TZKA 2NACA 3KYDB 1O5IA 3ITKA 3BYZA 2DPGA 1NPDA 1QYWA 1Y8RA 3JQFA 5T67A 1NHWA 4Z3KA 1BGVA 3PP8A 4D79A 5MGBA 3AUUA 1R0SA 4IDFA 5TT1A 4NFSA 3GVXA 3K2EA 4RO0A 1ENOA 3Q3CA 1CETA 4IS3A 4L4XA 1DJQA 2BD0A 3O8QB 1AHIA 3PQEA 1U3UA 4MP6A 4CR6A 4BUCA 3JCZA 1LLDA 1E6WA 3GEGA 1PZGA 5DN9A 4CMGA 2EV9A 5FI5A 2YW9A 3BA1A 1A4UA 3H5NA 3KUXA 4YQZA 4IMPA 3GC6A 4Q3CA 1E1MA 3LK7A 3FNHA 3BMQB 4BO8A 3FWZA 3EVNA 4G81A 4I5DA 3QE3A 2WD7A 1ZK4A 5KCZA 4RQUA 3ZCXA 4IGFA 5A9TA 4P4LA 4FR5A 6LDHA 1T2CA 4OSPA 2A9FA 3CIFA 3ZH2A 2JAPA 3WWZA 4BMNA 1BW9A 5TSDA 1N7GA 1FDSA 3R3SA 3DAFA 2DUWA 3UOGA 3FRJA 1F14A 3RWBA 3SLGA 2EXXA 2HMUA 1VC2A 3RAJA 3ZWAA 4U7WA 1JVBA 3QVTA 5IZ4A 5FFFA 3ITDA 1FDWA 1H6DA 2XXBA 3DEYX 1T4BA 1I0ZA 1HDYA 3OEYA 1VM6A 3K92A 3SVTA 1D1SA 1BHSA 4UREA 1ISHA 2YY7A 3KSZO 4MPDA 4JNKA 1I8TA 2Z1NA 1XDWA 4ONEA 1U2GA 2CF6A 1UUFA 1DC3A 1P33A 3KEOA 4YB8A 4AJ1A 4DVJA 1JA9A 3TRIA 1ZSNA 4IY1A 1Z73A 4PG4A 3WBFA 5FYDA 1KEVA 4GMGA 4M54A 3TFOA 2YFQA 1ZJYA 3D5QA 4YA6A 2JJYA 2X22A 1W8DA 1PX0A 3F3SA 2PV7A 4IQGA 1L7EA 5DCWA 2GASA 4BGUA 4RZHA 1TT5A 4BNFA 3KSUA 1KBZA 4NJMA 2O7QA 3GH3A 1PJ3A 4LRSB 1EK6A 4XYLA 3JTMA 2A4KA 2B4TO 4N54A 4CMBA 1YB1A 3C3XA 3M2TA 4RPJA 4CUJA 4ND5A 3HDJA 4L4RA 2XAAA 5TNXA 1DFGA 3ZWYA 4GAEA 1JKJA 2GF2A 1EVJA 2PD4A 3AI2A 4J4HA 4CR8A 3BTOA 1U28A 1LNQA 3PVZA 4D0RA 4GLLA 1VKNA 3WTCA 1G6KA 3PEFA 2P4HX 3UVEA 3VOSA 4PGFA 3HADA 3RC2A 2W2KB 5IDQA 2H5LA 3ZWMA 1D7OA 1B8VA 2O48X 1YVEI 4IINA 3NJ4A 3ZWBA 2VUTA 1AE1A 3DWFA 5EJ2A 2B5WA 1VE9A 1O94A 2NUAA 3RSHA 2OBNA 3OIDA 3NAQA 3DHYA 2GN4A 4XIYA 2IYOA 1R37A 3HNPA 5G0TA 2ZB4A 1AHHA 2C2XA 3JD1A 3ASUA 1RPNA 4CLEA 1K5HA 4MVJH 2BGLA 4KUGA 3QVXA 2GD1O 5B4VA 4EBFA 5G0SA 1N92A 1E77A 4FS3A 3QIVA 3IJPA 3PIDA 3HDYA 1DJNA 1E5QA 1EE9A 5JCJD 5L51A 1YRLA 1D3AA 4KUHA 4MIYA 1C0IA 1ZEMA 2AQ8A 3AOEC 1NX6A 4J2OA 5C7LO 2PK3A 1LI4A 2I3GA 3VH1A 3K31A 3DHNA 1EVYA 5AXCA 2O7SA 4FC7A 5HA5A 4CMEA 2DFDA 5L3ZA 1ADGA 2F1KA 3E9MA 4TRMA 4D3FA 1H9BA 3LU1A 1DSSG 1H6BA 1HE5A 1UXIA 2WM3A 3U4HA 3EVTA 1PIWA 4GWGA 1ADCA 2PH5A 3L4BC 1P0CA 3VPGA 3SLKA 4ALIA 4L74A 3WYBA 2B4RO 2FMUA 4FGSA 2BI8A 3H3JA 1I2CA 1XG5A 4XA8A 3OIFA 4W9NC 2ZYGA 4QFCA 2IYPA 3L9WA 2EG9A 2YQ4A 3L07A 1QYDA 1EVZA 2GZ2A 4PLVA 1MXHA 4FOOA 5DT9A 3CE6A 4FC6A 4I9UA 2FR8A 3GAFA 1LRLA 3ZZNA 1KYQA 1LLUA 4AJIA 3HDQA 5L4LA 4Q39A 2EIHA 2J3IA 4HV4A 2OL4A 1NM5A 2O4CA 1SC6A 2X23A 3GGGA 4XRGA 1HDOA 5CEFA 1YQXA 1QV7A 3T4EA 1E3IA 1PGOA 1UZMA 3QWHA 1ULSA 5JBIA 3T7EA 1P1IA 4MVJA 4BO2A 4NBWA 2NM0A 2RAFA 2WWRA 2JFFA 4R3NA 1EDZA 3KB6A 5TQVA 3L0DA 3WGZA 5CFZA 2IEBA 3GVPA 3C1AA 4RLHA 3W4KA 4J91A 3PK0A 3A06A 3PWSA 1I3LA 4NNJA 3A9WA 4O63O 3GUYA 3VC7A 4A73A 1ZXBA 2Q46A 3C7DB 3ZHYA 5GMOA 2C54A 5KJEA 4AJJA 5JO9A 3JQBA 4IIVA 4BQRA 4GVLA 3CPSA 4R69A 3FD8A 5GZ6A 4YAGA 4YT2A 1GUYA 5AXDA 1X14A 2Q1UA 1XA0A 2AQKA 2X7HA 4BO7A 4PZCA 2AXQA 4UVGA 2J6IA 4YVFA 1YQDA 1E7WA 1T2AA 2HKIA 1U3VA 1IE3A 3RFVA 2Q2WA 4MIOA 1NBOA 3DZHA 2A94A 1MLDA 1RKXA 3CMCO 4WNCA 2HK8A 3BTVA 2PZJA 1HSZA 3Q6IA 4BNTA 4PRKA 4J7CA 1JKIA 2DM6A 2YYYA 4W82A 2PGLA 3ROKA 1ZSYA 2ZCVA 3NGLA 3GPDG 4X54A 2HUNA 2ZJ0A 1IZ9A 5JPIA 1ZBQA 2J5RA 3ZWNA 3ADOA 3C7CB 4BNZA 1R0LA 1VL8A 3PYLA 7ADHA 2B5VA 2TMDA 3H5RA 4WEOA 4CLRB 4R41A 3NTRA 2AA3A 2D5CA 2QIOA 1MA0A 2ZB7A 2C7GA 3WGHA 2YDYA 3U09A 3OETA 4YQYA 4QQRA 2EKQA 5A9RA 1YKFA 2ZTVA 1RYEA 1V3VA 2ZYDA 3BIOA 4UEJA 5JAMA 4ZHSA 3RUIA 1ZVMA 4YJHB 4EUHA 1ENZA 1P1JA 3RUHA 3WYCA 3BZUA 2V6BA 5KKAA 4XB1A 3H9JA 1YBVA 3RBZA 1NVGA 3VVBA 4UAGA 1DRWA 4OHUA 2I76A 1ISMA 3RASA 2PY6A 3ZWWA 2Y93A 2AEMA 5IJZA 1VLLA 1ZJZA 2VWQA 3ICPA 2C5AA 4XR4A 1DOHA 1EVIA 1OAAA 2Q1SA 3D7LA 3RKRA 3MWEB 2EGHA 1XWFA 3HHPA 4D41A 3HJAA 3KETA 2VWHA 3AFNA 5CDSA 4U6QA 4IXWA 3SXPA 1DIHA 3B6ZA 4CM4B 4HY3A 4E5YA 3W8FA 4FPXA 1K0UA 3F5SA 1I33A 1FK8A 3OQ1A 1EUDA 4DBZA 4DREA 1DFHA 1WLYA 4PLGA 3W4JA 4UUMA 5LDGA 4P4NA 4M89A 2Y68A 3I3OA 2FHSA 3EUWA 4M55A 5JNLA 2P2SA 4JP3A 5JFOA 3H4VA 3L6DA 4Q3DA 4R1SA 5L7WA 1SOWA 3WGIA 5T6BA 2IXAA 5KVVA 1FDVA 1ZZEA 3U3XA 5T57A 3LLSA 2NNLD 5K9ZA 1E7MA 4GKVA 1LDEA 5L45A 1M66A 1F8FA 4NU6A 5JMWA 1QKIA 3AY7A 1B8UA 4KWIA 3GDGA 3GLQA 4XQGA 1VJ1A 3ZV4A 2NTVA 5JYDA 3DO5A 4J7XA 1IL0A 3MOGA 2RHCA 4A0SA 5IN5A 3DZJA 3LQFA 1EK5A 3LLVA 4OH1A 2I67A 1ZIDA 4B4OA 4MIEA 2HJRA 1QRRA 3IIEA 3QRWA 5AOVA 3U49A 1Y8QB 5KVCA 4QUKA 2X0NA 4YT5A 5CAEA 2HCTA 4D44A 3FR7A 4NBRA 1DEHA 4BO5A 3RVDA 3F1KA 5CDUA 3WMWA 6ADHA 2ZKLA 3LYLA 3TZHA 4J4TA 2W2LD 4INAA 3VZPA 1PS9A 1ZK2A 5B4TA 3FI9A 1Q1NA 1GCOA 1MC5A 3CSDA 3VZSA 4E12A 4WK6A 4Q3EA 1VJ0A 2NU7A 4E33A 1Y1PA 3IS3A 3M1LA 4ZA2A 4DIBA 5CG1A 4N18A 1ZUD1 5IAAA 2X9VA 3S8MA 4PIVA 5JAZA 4L9RA 1MGOA 3VPXA 3ZV3A 3DBLB 4PRLA 4WCDA 4GX0A 1WMAA 1HSOA 3JD3A 4CV3A 2CF5A 1B8PA 3RBXA 3GK3A 3GVCA 4O5OA 1GZ4A 3UFXA 1AXGA 2AG8A 2Q3EA 1B16A 5TLSA 1M75A 4K6FA 1OZAA 5ITVA 1AXEA 2C29D 3I9MA 2TMGA 2Y0EA 1E0DA 2B83A 3DMTC 4QO7A 3AU9A 1U4OA 3IMFA 4OM8A 3WIDA 2HK7A 4YJFB 5A5EA 4R5HA 3DBHB 2PNFA 2VYND 4XQ9A 2QW8A 1BDMA 3NDRA 5BSHA 1SEPA 2AE2A 3MWDB 4ZJUA 4K1LA 4IIUA 3WNVA 2P4QA 3PI7A 4NG5A 3U9LA 3V2HA 1QYXA 4GVXA 5LC1A 3Q2IA 3WJ7A 1I32A 1CERA 4KQXA 4E2XA 2CFCA 2ZCUA 5GZ3A 2PR2A 2RH4A 4IDAA 1V35A 4DBVO 3GNQA 3HB5X 1SCUA 5JDIA 5KWEA 3GQVA 1PSDA 1U5AA 1YE3A 3DZBA 1YDEA 2VTDA 3E1KA 4LN1A 3AK4A 1PZEA 5ES3A 5U4QA 5DBIA 5GY7A 3AU8A 4EUEA 2CVOA 4R9SA 5C7OO 3BMNA 3TOZA 2Y99A 3L77A 4O6VA 1LDNA 3TZ6A 2JD1A 3E8XA 2GDZA 5B1YA 2F00A 5ADHA 4LISA 1BVRA 4R51A 3HFGA 2G5CA 3H6KA 3DL2A 4E13A 5A06A 4XKJA 3K8ZA 3PRJA 1X13A 4FFNA 2CVZA 3KYCA 1E3WB 1YBMA 1XCBA 4IZHA 4BMVA 1OBFO 4A2CA 3H65A 1NWCA 4YR9A
chains in the Genus database with same CATH superfamily
1NUAA 3OY2A 3R8CA 2OXFA 3P52A 4FJ1A 4RZQA 4BBZA 1Z6YA 5F12A 2G09A 2VCHA 3JWHA 4RIHA 5JLAA 1IB0A 3U7FB 1RPZA 4JI2B 3FTPA 4JITA 3PRYA 4S12A 1U2SA 3E53A 5AICA 5I7RA 5KKCA 2O3SA 4X65B 3U3MA 1EUDB 1WHSB 2JGAA 1K5PA 1MAVA 2P9TA 1U81A 2IY7A 4OJNA 3DP9A 3TLAA 4RABA 2ALJA 2QMOA 2ZRGA 3I5YA 3RARA 1TD1A 3L8MA 2BFEA 5B2EA 1U7DA 2GBIA 3MBOA 1P3JA 4C03A 4ZGWA 2VZ0A 2AN4A 4M36A 1FZQA 4CGYA 2AFIA 3DUFB 1DIOB 2PEYA 3ZGVA 2G0TA 1CJCA 1E2IA 1GGEA 3BJZA 1X9IA 3NOQA 4OIMA 3R7LA 4H7HA 3CIOA 1HGXA 1CJKC 1XLVA 2PH7A 3IR7A 4L50A 1OILA 4D9KA 3LOUA 1R88A 2XQFA 5DX1A 1T4CB 4ZANA 3LVFO 1J21A 1T9CA 3E7FA 3LY5A 3P96A 4J4BA 1YZNA 4N40A 4Q1EA 4QHTA 5AHOA 4EW1A 4ECEA 3L46A 4LTDA 2JF0A 3JQ7B 1GY8A 2K6GA 4RPHA 2V97A 1H23A 2AE1A 1N25A 5HZHA 4QDOA 4FOPA 5J5VA 3H2SA 4UZEA 1ZM7A 2QAGB 1PBNA 1XQWA 2A35A 4JBNA 4KSBA 3OQMA 3GPLA 2DQZA 3H9BA 4RL4A 3D6NB 5JMPA 3RSGA 1Q7CA 4D9HA 2WPDD 2LKCA 3MT8A 3C45A 2E5WA 4IIYA 3TZQA 4YAJA 2EKLA 3N8DA 1DQZA 1M6WA 2KBEA 4MUIA 1VJRA 4AN0A 3PHLA 2CJYA 2HA4A 3N1UA 5AKJA 1XSEA 4IJKA 5DTRA 1SQFA 3PJEA 2NV6A 4TRNA 1OB5A 3FOBA 3OKCA 4ASUA 1P2GA 1POWA 5CB8A 2BONA 3RUFA 2BGTA 3W9UA 4BQQA 1C3VA 2QRVA 2QIPA 3EVCA 2WU1A 4C21A 2V7QD 5B7PA 5LJLA 3AY6A 3RU7A 1QQAA 3LUJA 2EFYA 5HIJA 4QARA 2V7BA 4BV8A 2WNIA 1BSVA 1H2WA 4FYWA 5A02A 5A62A 1ZCZA 5BRJA 1C8LA 1XTZA 4ZK6A 2GCPA 2GA8A 3GUCA 2Q27A 1XEFA 3U3DA 3ANMA 4BCDA 1XEAA 5A5VA 1EWKA 1ULAA 1M8PA 4EJSA 1OVGA 4NBLA 2NXCA 5ECGC 1UBHS 4EZBA 1GPH1 1Z9BA 4HDMB 1Q3KA 3MJFA 5KNBH 3VYVA 4PC1A 5CFNA 1XZMA 2QLFA 2RMKA 3VFDA 4G0UA 3R7FA 1UIRA 2IEDA 3MD9A 4YALA 3BZWA 2ZSKA 4QBKA 3MXTA 1C8VB 2BH9A 3EGVA 2OZPA 1R4MA 3VTKA 4OXNA 2BFWA 2CN1A 4RC9A 5E6SB 2XXAA 4PAOA 1LRKA 3U4GA 4OQLA 1UANA 5TRTA 4J94A 1YFZA 1HFKA 2WG0A 1AKQA 5AK0A 3S99A 4PSVA 4PWYA 2VDMB 2C97A 4LS3A 4XB2A 2FUEA 4L0CA 4I8XA 3K3PA 3K73O 5CU7A 3RUDA 3V9AA 2X6TA 3MG9A 2D5IA 2O2ZA 3AGQA 2VJPA 4FZRA 4RQTA 3R5FA 5AQ1A 5CIYA 3I37X 1LV8A 1NXPA 3FPJA 4HH1A 4X92A 1P4JA 4N41A 1SCUB 4KK3A 1L4KA 1TU3A 4DB2A 2Z1DA 5DT2A 2DFPA 3LQRA 2J3MA 2A1IA 1PJQA 4U6NA 1PR2A 3EGEA 4BO4A 4FFOA 5DEOA 3H7AA 4JYAB 3C3AA 1S89A 3MINB 2FPIA 1IZ0A 1ZIPA 2WT4A 4KVZA 3VTFA 3CNEA 2HJWA 1VKJA 1XQ1A 2EFHB 2VJNA 4MGEA 4R2HA 4Y6SA 4ZOBA 1Q0TA 1NOKA 5K4HA 3TWOA 1NFRA 5LIPA 2OG1A 4GM1A 3ZUPA 3QFRA 4IUBS 3ZOKA 1GTJ1 5K3DA 1E8DA 2AMJA 1MNAA 2HJVA 3MTDA 1UR5A 3PWKA 4W6QA 1V3TA 1FLAA 4HXGA 5AP9A 2ZR7A 3IUPA 2BFPA 4ZD6A 5BVGB 4OHRA 1OLXB 3GAZA 3KJZA 4ML3A 2EZ4A 2C1ZA 1ZD8A 2A1TS 3OA2A 1DAHA 3ZWCA 4EFKA 2RJ3A 5KYKA 2KPOA 4QE3A 4AQ7A 4JQCA 5IN4A 3AETB 3PQ6A 4PAMA 1WW3A 2UU9B 1N3YA 2CMKA 5BR7A 3IXLA 4BNKA 2ESRA 1U4NA 3P26A 4H0NA 5CLJA 1HT3A 2H4ZA 4G8CA 1U0LA 2M6RA 3ZWXA 2V8OA 2VK4A 1P19A 1C3JA 1M2EA 3AL2A 5CDFA 4NS1A 3CR7A 4AJNA 3GGSA 3MFYA 1B0AA 2BJVA 3EQZA 3T5PA 1JW9B 2R7LA 1FQOA 1URPA 2BSQA 1VJGA 4H60A 4MLDA 5ALTA 4Z9FA 1J23A 1THMA 4CLOB 1IPHA 1DG1G 1RQLA 2CYBA 2GARA 3F7NA 3A6GA 3O9VA 3PDIB 1Z2NX 2IYLD 3K2QA 1DO8A 4G8BA 1OWMA 4H77A 3UAXA 5DNWA 2R1VB 3JAKB 3UM9A 3IT0A 1P44A 3GRAA 1C0EA 4DSZA 3ICWA 1SB8A 1YAJA 3WO0A 3WGUA 3AOEA 4HVAA 1G6OA 3VNAA 1QORA 3NDIA 2XRMA 2N0SA 5JAQA 1EG2A 4G5HA 3SEQA 3L0CA 4E3WA 3U19A 4CCAA 4MUMA 3SF0A 1QGOA 4E0BA 1OXVA 4REQB 4B80A 3HXQA 2R62A 1RKUA 4IFEA 1JH9A 4RETA 2C4KA 5AW2A 1ZP6A 2WOJA 4K2HA 4P1ZA 3OJFA 4DR5B 2YZ7A 2BKEA 2NZVG 4MUGA 3DP7A 4HGZA 2FDRA 3FG9A 3NGXA 4LQ4A 4A23A 4ZQEA 3LDFA 5EIEA 3ZU6A 3ORYA 1ZGGA 1PF7E 3AEYA 4CT5A 3G0HA 2EIXA 4HG2A 2J9ZB 1MC4A 3IJ5A 2REXB 1V47A 1G8HA 3GFSA 3SYRA 3MMNA 2HREA 3G6KA 3JX9A 3IKLA 4ILEA 5EI5A 2WHRA 3Q3IA 3TAXA 3AHDA 3BSWA 2JEZA 3DZGA 1L5ZA 2Y1FA 4HYQA 1RYZA 1L7VC 4G0NA 1SWWA 3D6HA 1VGRA 3MUFA 1DE0A 1SCKA 4YY3B 4IUDS 1HQYE 1QFZA 2KWIA 3H5VA 4W9NA 3Q7TA 1QZUA 4YRMA 1M54A 1XUOA 5C8YB 1A9OA 1U7HA 3R9WA 5U4XA 3ORFA 4Q9AA 5DZSA 4F6RB 3D3WA 2V6GA 3AY3A 3KEGA 3W8EA 3NC1C 2IITA 3V2UA 5LP6F 4KHPB 4S04A 1XCPA 4MW7A 4W4TA 2BDTA 1GQRA 1PLJA 1F60A 2DTDA 1UXKA 2P4UA 3COWA 3L0SA 4GX1A 4L8WB 1E2QA 3I0ZA 4CQMD 2XMDA 1PWZA 5A1JA 5A03A 2XJ4A 1QPGA 5BQFA 4G1CA 4JN6B 3U3JA 4UUNA 4KVFA 3T3DA 4AZ3A 4DNXA 4PVCA 4X7BA 5DW3A 1QX4A 1QHXA 3LKBA 3S4YA 1HV8A 3MMZA 3V8NA 4BVEA 1YJXA 3TJMA 1O6GA 2I91A 4IVPA 4YCSA 2EFCB 5LMZA 3Q7QA 3CUYA 3ORSA 4ZCQA 5L53A 1OWOA 4URXR 3BHJA 1G8KA 3BULA 3CUEF 4IIGA 4NKRA 4QXQA 1H2HA 3EHEA 1GL7A 3IXMA 2XT6A 3OLCX 2LZ0A 3ICQB 3HP4A 4JJ4A 1SVMA 1XZJA 3DEHA 3FRHA 4U8GA 4JASB 4YBZA 3Q8LA 3HQ4O 3ET4A 5FPQA 4JOBA 2G1AA 2E85A 4OQDA 5CA0F 4MPRA 1M1NB 3BJMA 1OJLA 3BMCA 3IMEA 3WG9A 5C5EA 4BLWA 1MABB 2I2BA 2CV2A 1U8TA 1I7LA 2HV9A 4X3OA 3ZWVA 3FVTA 4DLKA 4POOA 5LXTB 3I5MA 3CWZA 3HEMA 2JHGA 4PYJA 5CH8A 4B4DA 4L08A 4S35A 2HHHB 4WZAB 4E22A 2IVZA 1KWGA 5BNZA 2AG5A 4BMXA 4BWFB 4RK1A 1AX9A 3OU6A 5C0OE 5DM60 4CUKA 1O96A 3C3PA 2RJNA 4ZYZA 3A11A 5LQMA 1JHMA 4NDZA 5JMTA 2W98A 4FDVA 3KM0A 4C4SA 4FWBA 3MS2A 2OFFA 4PLWA 4F2WA 3IAUA 3OSZA 4XQ0A 4E2WA 3LFTA 1N34B 1RQGA 4KP7A 2ZVQX 1RI4A 1GWNA 3M6AA 2Q2OA 4J9UE 4OA5A 3NTUA 1YZVA 5HF8A 1PW7A 2OYRA 2ZJ6A 3QKWA 5GJWC 2WD7B 5AUQA 3ERCA 2X2OA 4PAQA 4ZK2A 4V1CI 1JV2B 2GM3A 1SVSA 3T3NA 1XT6A 2YV2A 3DCIA 1TU0A 3A0UA 1B8OA 3NM5A 4MKRA 4KQMA 1Q20A 4UNPA 5JSYA 1V25A 4JX9A 3FIUA 1HLPA 4DXHA 4A8TA 1Q14A 4QPJC 5JC8A 4IH4A 4AQYB 2OHGA 4HYTA 5AH0A 3W3AD 2FWIA 3AFOA 3W9BA 1LTHR 3HB0A 4KAJA 3IMGA 5CHEA 3QOFA 4QSMA 4W6ZA 4N7JA 2F1RA 3RSOA 2WK1A 2P1RA 1AT1A 1MJ5A 1SCAA 2VA9A 2CLHB 3TW8B 2BUBA 3DB2A 3EGDA 3MMPA 1R9MA 3EDRA 5JSQA 5B12A 2Q3LA 2XQIA 2B6NA 1PFVA 4TMTA 5DHUA 5DISB 1ICEA 3HJNA 3I09A 2ILTA 1DIBA 2B30A 2C61A 4IKOA 4QTZA 5ALIA 4C4OA 1W35A 3K8YA 4MPJA 2JFWA 1G18A 3A1WA 1OC4A 2QJTA 3AV0B 3IB6A 4M87A 4RTRA 5LCXA 1ORIA 1YDFA 1JLLB 5JANA 2NYRA 4PX5A 4J7UA 1WWKA 3DCYA 3U26A 1M6NA 4DIDA 5EZSA 2QMEA 3HGQA 4C2TA 2WINI 5TPWB 2YWGA 4HL6A 3GDFA 4G24A 4BJ5A 4GT1A 3T7CA 5CXXA 5JXHA 2YJ6A 1JQBA 2D2EA 2PSJA 1BWQA 1X0XA 4M7PA 4MVJM 3GJZA 3ZE2B 3EVGA 2ZE5A 4B34A 2E48A 3BJIC 4D9BA 2QJWA 2RGUA 2XVAA 4NJMB 5DM4A 1Y1LA 2UXBB 2OVFA 1CF2O 2F1HA 4ZT3A 3VC2A 1P3DA 4BL5A 2YVQA 3ETJA 4FFRA 2PS0A 4GI3A 5FQOA 1LBIA 1U9CA 2P7HA 2WAOA 1RWKA 1Z0ZA 5IYZF 3RVNA 4DV4B 4Z4GA 4BAGA 4EHIA 2MINB 3FWYA 2IJGX 1L5WA 1HTBA 2I1WA 5C46F 1T6XA 5LQUA 2GPJA 1Q17A 1WPRA 2M2IA 5K0ZA 2D7DA 4HB2A 3KBBA 4P4TA 4OQPA 2KM1A 3ZDXB 2Q4EA 5SICE 1B1AA 2D3TA 4N7RA 1ZA2A 4C22A 1RHUA 4IV0A 5AWFC 2ZYRA 1A9XB 4RTMA 3WOVA 4KNYA 5FPSA 1U90A 3GB9A 4LBVA 2JGMA 3E8MA 1ULHA 4JT9A 4DQKA 4ENQA 4LWPA 4ND8B 5KHLB 3EOBI 1GSOA 1STOA 3LXUX 4TKUA 2BP7B 5G1OA 4PQRA 3OTIA 1PTKA 4OLHA 621PA 3NFYA 4KQEA 3PRKE 4QECA 3K20A 1D1QA 3QXHA 2ZWAA 3B60A 4AYTA 3VR3A 4N01A 4X7MA 5BR4A 1N8KA 3N28A 2DBQA 1EAMA 4EDFA 1GRQA 4M22A 3H05A 4DW8A 2IOYA 4FGJA 1JDPA 4AFNA 1R0RE 1CYEA 2QT9A 1JG4A 1AIPA 1PO7A 1RAIA 4OXXA 2VKQA 3N5CA 3PS9A 3TFWA 2CLKB 5EJ4A 1I9GA 4K6MA 2L18A 4NBVA 2KLHA 1HT0A 5IAKA 4KWHA 1TO2E 2FG7C 3ABIA 1Q77A 2CNBA 3EGXA 4G09A 5AI4A 1ZC3A 3EXEB 2WWHA 3T34A 3BT7A 3FBTA 2QZ9A 2JHAA 4ALMA 1BFUA 4DG8A 4XUDA 1VJCA 1WV1A 5FNZA 1YB7A 1AQJA 3NEAA 4D74A 5C7YA 2VTBB 1BQ4A 5KYVA 3CH5A 4QICA 1G8GA 2XGMA 3QYJA 3GN1A 1GQYA 1OI2A 4ES6A 3C6MA 1IYZA 3ND6A 4AJLA 1SB9A 2JANA 3MCTA 3HVUA 1QRDA 3ADCA 1DXHA 5H59A 5KU7A 2HEIA 5B7QA 5ECYA 3FY4A 1AG9A 2I7DA 4RULA 2PBFA 1E3EA 1G2IA 3D4BA 1FUYB 2ZI3A 4I9FA 3ILHA 4PZDA 1MB0A 2DSTA 1T0BA 1EB8A 2DMRA 3L7BA 4XM2A 3BXEA 1LQUA 3FSJX 4OJKA 3V8MA 1Z62A 1GAXA 3ZYCA 4S2EA 5FOVA 4PSAA 3VKFA 4ETWA 3GZ4A 4XUCA 3PWTA 1AH2A 3VHXB 1KP3A 4P84A 2QPOA 5B3LA 2I9KA 2DHEA 2DX7A 1Z39A 2IHTA 2PJUA 1JI3A 2MDTA 3K0BA 3OFKA 3EJWA 1W44A 4S0XA 1O6ZA 5ELMA 4XDZA 4TL6A 1AVTA 2H7XA 3ASVA 3NUQA 1XXHA 4A0FA 3A8TA 2VSYA 4CL3A 2BFAA 3G7UA 3PQ7A 2PZEA 2FQ1A 3D2BA 3DMFA 1U3GA 3JVVA 3QQPA 1XKLA 2GHQA 2O05A 4H31A 5K0EA 1MHTA 1J5XA 2YWXA 1D2RA 1KI2A 3WLIA 5HM6A 1W0JA 3QTLA 3KYIB 1FMCA 3OM8A 3P20A 1JJFA 2UZ3A 3L49A 4RY0A 4ID9A 1VYTA 4INJA 2P3LA 3NH9A 4JQZA 5JPDA 2D2XA 1IJEA 1H8ED 4AF6A 1IBMB 2OHFA 3KJFA 1UM8A 3O9MA 4XW2A 1S7CA 3VU9A 3GDWA 1G3UA 4ZCRA 4GOXA 2PSDA 1JBQA 1JHXA 3RRFA 5IKXA 1QYIA 4AZSA 4MQ6A 3WWDA 3T5DA 1U1GA 5B1HA 2Q2QA 3FMVA 3MUEA 1P72A 1QSGA 2G4LA 4RH1A 1QP7A 2H63A 2WYWA 3W5BA 1VSVA 5AJYA 5LQNA 2RGAA 1XD2A 3EPJA 3ROGA 2VQFB 2O19A 1FE8A 4DQVA 4DWVA 2F6RA 1CUEA 2POCA 3KKZA 1XTVA 4A0RA 2WJYA 4LRTB 5ESXA 4EYGA 4F12A 3ADKA 3ZE1B 2ZZNA 1JAZA 4FJ2A 4OD0A 4IOKA 5K8VA 1UMBB 2HT6A 1J70A 2BM1A 2Z95A 3C7KA 1XYGA 3C8ZA 3LC7O 4ND3A 4TSFA 2JH8A 4AP5A 2RSLA 3DULA 5EE1A 3TRKA 5J2UA 1QGUA 1H1LB 4PZZA 3R7NA 2PX0A 2Y6UA 4OPMA 3LYHA 3SMVA 4OQNA 3HU2A 3CEHA 1EA7A 3MTJA 3UWDA 3W7BA 1ULZA 2L2QA 4LA4A 3EZ2A 2WNHA 5FXMA 4ENTA 3OQNA 1RHMA 2ZM6B 4Y2HA 3FROA 4KIFA 1P0FA 1GG5A 4DZTA 3OESA 4AMZA 3H1PA 4YAIA 3GG2A 2BN4A 4N39A 3Q11A 4YHHB 4J03A 3CVJA 5UKDA 5I7OA 3RHFA 4RFVA 5EEHA 2IQ5A 3D8NA 4YRRA 1XEWX 3QBVA 3SSMA 4XEHA 2NX2A 3RVSA 3PC8C 3OT1A 1BX0A 1H8HD 3UB3A 2ZUSA 1NSTA 4GBMA 2QZJA 3F6BX 1NIJA 3GUZA 1PBTA 1HDZA 1NVMB 1SQ5A 2QLBA 5A2QA 5F9FA 1LQTA 1PE0A 1RR6A 1ZHOA 1U2TA 2BE9A 4DKJA 1GRCA 1JFFA 4HF7A 3VSCA 5A9SA 2X6RA 4IO1A 4XI9A 2JIBA 3RFFA 3ZW9A 2C83A 3I12A 1KZYC 2RHTA 4KGZA 3K6RA 4EGAA 4WBNA 1PFWA 3I83A 4DSTA 4DLUA 1T0IA 3DEAA 1NC3A 1BYIA 2BDEA 4GUDA 3E0QA 5EXSA 1RAEA 1T5BA 2ZCJA 1VE1A 2V5AA 1T13A 2F17A 3IEUA 1P9LA 1VKZA 2RK4A 3N74A 3V32A 4KQ9A 1AGYA 4OUDA 2V0CA 4DA6A 2GM4A 2GCGA 3E23A 1RYNA 3MB5A 2XDAA 4HBZA 5D86A 1R8JA 4Y1RA 4KGVA 4DQXA 1WMDA 3G2PA 3KYDA 3E9ZA 3SHFA 2E18A 5CIQA 3WLNA 4DTIA 2BGGA 1ZH0A 2D1TA 2QG9A 4DMFA 1GPJA 1SVNA 5CGQB 3M3PA 4RGYA 2OFOA 1U3FA 1R0CA 1FUKA 1VKRA 3W5UA 4OMFG 4N8SA 3T1VA 2GK7A 3QM1A 1E7QA 1SM4A 1L5KA 5LMCA 4WXEA 1C3EA 4I1VA 3WB1A 1G6HA 1LBTA 5DP1A 4C4YA 1L5HB 1RLMA 3HJTA 4QQNA 2IS4A 3GWGA 2PXXA 3BIJA 4P80A 4M88A 4Q47A 1HYEA 3LUBA 2ATCA 3ZQ4A 4YQEA 3M34A 1YR7A 1GA4A 3MTGA 5IZCC 4DADA 1JJVA 1MRNA 3O26A 3T15A 3NB0A 2A0WA 3F4BA 3R7WB 3WYFA 1JR3A 2EJUA 4YCCA 1HK7A 4J2TA 2BHTA 3N7AA 3I2GA 1T35A 2WAXA 1YJBA 2O0KA 2VHWA 3AI3A 3FYTA 5DLYA 4A03A 1FYDA 5KQRA 2IK8A 2ZTSA 2TMYA 3DTVA 4KB5A 3EXIA 5BMVF 2AXPA 4PN3A 4LUCA 4CKCB 1G8AA 5IYZB 1TB4A 2XADA 1W4RA 4PR0A 1CRWG 1IDN1 4XJVA 3QXXA 3FWPA 1WX1A 4G0ZA 4D8UA 3ZLUA 2X8LA 2GRAA 3FH0A 4HQLA 4LVCA 2WF7A 1AUVA 1Y5NA 3B36A 1ZD3A 2V9CA 3BQNB 3H04A 4KQIA 3GH1A 1MFZA 2WTUA 3IODA 1H93A 3OAAA 4X9XA 1Q19A 1XEXB 1NT2A 1OWPA 4TT3D 1BD3A 4EAAA 2Q6TA 4MAFA 3JSXA 1SCQA 3R9XB 1AO3A 1F48A 4K6HA 5T6MA 3G88A 2OO3A 2XCUA 4QNMA 2EKZA 3IXQA 1ACLA 1NVVR 4O4HF 4IQFA 4W5QA 1CP3A 1Z4IA 4Z6KA 3X1DA 2WBLC 3ONWA 2HRZA 3H8JA 2GLTA 2O6HA 2FRDC 3C1TA 3JD0A 4DLZA 5HYVA 3HN6A 5DCYA 1H6AA 1Y1SA 2XECA 4IDEA 4QAJA 4BMPB 2WP0A 4RVNA 1AQYA 1DBSA 1VLJA 2IUEA 4WJZA 1G19A 2M6KA 2A0UA 3GAMA 5KUTA 3UN1A 4R71A 2Y67A 1BN6A 2Q6OA 3TCNA 4LJSA 1EFCA 1U0TA 3OZBA 1QBGA 4IVNA 1G16A 4ZVMA 3W5JA 1A5BB 4HAOA 4BPRA 3THXA 1KRWA 3NIWA 1J49A 4NONA 4JELA 2P2CA 1DQSA 1C5KA 5CAEB 5B53A 3GRRA 1I3KA 4C4TA 4ZXPA 2H1CA 2ONZA 1YVRA 3IP7A 5IBPA 3KVOA 2DERA 1DRUA 2HSGA 2MYUA 3PFWO 1F06A 4LRYA 3VSDA 2BMDA 3E6AA 1IN5A 2BUAA 2PBLA 4J75A 3MUNA 3H75A 3OOSA 1W1UA 2NU7B 1JHUA 1XTUA 3HG7A 3PFBA 2VJDA 5J1TB 4HZUB 1QE3A 2C4VA 3LC2O 1Z75A 4N82A 1C7JA 2YWFA 4NCKA 3UBTA 2EKBA 4MVJD 3VSEA 1DC5A 1L7DA 4IGEA 4IG4A 5JSFA 4QX6A 3RSQA 3LZCA 1J06A 3KJNA 3PR3A 4ZI5A 3H1TA 3HCBA 1RPTA 2EKDA 1P2SA 2Q9BA 3RBVA 1TUEA 5JAUA 5K8UA 1NOJA 2P9YA 4Z4IA 4WA8A 2UZIR 5FLXA 3X44A 3DOJA 1UPXA 3EZGA 1Z8HA 1OQAA 1P7WA 3NHFA 4WFIA 3QEJA 1CDZA 1E1QD 2O06A 4JT4A 1COZA 4HTFB 3PSAA 3UJ8A 2LIVA 4J1QA 4JI4B 3NHMA 1P1BA 2AZXA 4ZV4A 4NF2A 3LP6A 5G0VA 3QF4A 1Z28A 5CRIA 3N8KA 1IHYA 1FBTA 3N05A 4HADA 3BHMA 1L3BA 1S3SA 4FS8A 4LHVA 5KX5F 3QWBA 2NWQA 1MQ9A 4I9HA 5B4UA 2JPDA 3IC5A 1YB4A 4QELA 3T3EA 1JG7A 3IVGA 3UA4A 5ARDA 4LDPA 1V9CA 1F12A 1NFQA 3JALA 3OPMA 3OZEA 4P22A 4P98A 3D6AA 4P32A 3IDSA 1K86A 4D45A 4Z4CA 1KARA 1W96A 4FE4A 4LOJA 4M0LA 3WGOA 5A4MS 3TOSA 1SKQA 5ALFA 2HO5A 4ZKDA 1IH8A 2H59A 2P40A 3ONNA 4P58A 1UFOA 5F51A 4ZMBA 2B7LA 5IDXA 3PX3A 1XE3A 1WPGA 2JBAA 4R1OA 4KAFA 4NL4H 3TZLA 1I24A 4EGQA 2ZI7A 1L4BA 1D5WA 3L0YA 4KQ6A 4C0HA 1ZWLA 1QHHA 3LQKA 2BEUA 3U37A 3PUZA 1I4WA 3SEFA 3FUVA 3T7JA 3B12A 1JWLA 3GD5A 3HBAA 1W2GA 1Y8AA 3BC1A 4G6ZA 1Z5PA 5EOVA 4ZEOA 3Q98A 3QEMB 3NKFA 1H3FA 4H1VA 1S0UA 2BFBA 2YHBA 3FYUB 3MUOA 4OIFA 3AUSA 4F92B 2YRXA 5KS2A 5KBYA 4QRIA 1JDUA 2PEZA 1BQEA 1HQCA 1OIWA 3BMNB 3QEOA 4MA5A 3UH1A 5B55A 4KXXA 1A5TA 4PYIA 5JZBA 3ER8A 1TKRA 1UK7A 2J4FA 2QY6A 2SECE 3CLRC 3ZTTA 1JQJC 4CFYA 2BTQB 4JA0A 2K2QB 1Z36A 1GYPA 4BMCA 2R2AA 4AICA 1QRUA 5BN1A 3RODA 3H0EA 1NDHA 1QHNA 1W59A 1P6XA 3DFFA 3D6JA 1GQ2A 3KYCB 1L1QA 3X2SA 3D2LA 3P0EA 1H0KA 2ZITA 4WASA 3JYOA 4GI7A 3B6IA 5KAPA 3VDRA 2JDIA 5B58C 3C43A 3UKJA 1G17A 3VR2D 2QMUA 5AKZA 2HJSA 5GV8A 4R68A 1N5OX 3U1BA 2HT1A 2JH9A 2O2SA 3L04A 5HQ3B 4QBIA 2C1XA 3E2MA 5J4HA 3F6YA 2ECKA 4HMPA 4DT1A 1W29A 4N4AA 3BGDA 2XB2A 3CX4A 1E92A 3P2JA 2G77B 1DZ3A 2I87A 3V46A 1NLMA 4FGZA 5J63A 1DAFA 3CKKA 1LWOA 3LBYA 2W2LA 1Y3DE 5IFLA 1NN5A 3MN1A 4QD3A 4Z7QB 1LBHA 2BGWA 3I6QA 2XRZA 4PO8A 4JEIA 4GF5A 3IPXA 5LA6A 1FJHA 1E2UA 1EHCA 1PS8A 2DOKA 2BFEB 2PUVA 1JKXA 2FF5A 3BHIA 3LDAA 4ALJA 1N0WA 4US2R 4TZ6A 3CWCA 1QFMA 4GIBA 2AFIB 4OQZA 3B3JA 2SKCA 2OFPA 3HJBA 3AG5A 1JQAA 1YULA 2M98A 3NHSA 3FPHA 2RHBA 3G49A 4K9NA 1JJAA 5TT0A 2IPOA 5ENDA 3TQHA 3WGMA 3CB4A 2BKXA 4B4UA 2OO5A 1YZYA 3RH0A 4OGGA 5A4IS 3FOWA 1I01A 4RPGA 3T3HA 4YRGA 4OP1A 1W49A 2HIGA 1JKFA 1Q3TA 1SVUA 3S81A 1DRVA 2PJRA 1EM6A 2J8ZA 2PWPA 1EH5A 4FP9A 5CT8A 5FA6A 1F2DA 4O2BF 1BGWA 4YAOA 5WRFA 1EHYA 1XNHA 1VSTA 2HI0A 4MR7A 4NAHA 4YV1A 3H2HA 3L7MA 1K4KA 3TS1A 2C5GA 2VYNA 1C9JA 2PUHA 3D6VA 1EFDN 4J0KA 2L42A 1IVNA 3ASYA 1TIPA 4UFPA 5DBEX 4MRAA 1TK2A 1XR3A 2GEJA 4F56A 2AC2A 2QRUA 3KZKA 4YN3A 4RTOA 4C7OA 5FORA 2QSYA 3KRTA 5FWAA 1K06A 2G6TA 3CEMA 5M34A 2HHAA 3DTNA 3LVQE 2QRVB 4DA0A 1MQ8B 1RKVA 1TUGA 3AQ4A 4MYHA 3GBSA 4O4IF 1Z4LA 5JQWA 1B3RA 2FK8A 2FPUA 3GMTA 2WHYA 1JA1A 3OEED 3UMJA 4B73A 4BQSA 3HCEA 1P2VA 2EFEB 2NSDA 3HCNA 2PSFA 1K63A 3CPEA 3L02A 2IDJA 2XNKA 3I2FA 3OLYA 4QJ5A 4DR6B 3LT2A 4HNUA 4X62B 3UG6A 3KSMA 3IMKA 4KQJA 1MB9A 2VHQA 2R1UA 3FCSB 4IZOA 5AXAA 3TPFA 4NV3A 3P9QA 4ZO7A 3C3EA 1HOTA 3RVMA 4DWOA 4EF6A 5DNCA 5KYWA 3UOAB 2ZJ5A 1A95A 1SUWA 2Y0DA 1OT5A 4ID3A 1Q5PA 1BHO1 1ETUA 1AQNA 3STTA 3HBNA 2A0YA 2R5FA 4F85A 1AGXA 4B2LA 4E03A 2OM2A 3OZCA 2C31A 1R6BX 1I4OA 5FTKA 1R4MB 4FDTA 3NBFA 4Y6GB 1YRQA 1ZCFA 3CNBA 1M8KA 3E7PA 3PXAA 1M74A 3ET5A 2FZVA 3KP1A 5DULA 2OHXA 4L5AA 1WLSA 1M6HA 3P9ZA 4QEDA 4QFMA 1KQGA 2XXAB 2GILA 2O2YA 3ABRB 4Q9LA 4ZI7A 3A28A 1H3NA 1DL5A 2B82A 3IKMB 4IDCA 4PNPA 3M8KA 1U2GC 4LF7B 4Z86A 2HPZA 3S40A 1TJ3A 3V7YA 4MUNA 2P6MA 4IDHA 3F3MA 1L4LA 4BJ1A 4F21A 4A0HA 3RYCA 4L72A 3U13A 3HBLA 1EX7A 2CNOA 2JFOA 2WUEA 4G56A 3ZX4A 4C0QC 4O4HB 1Q6YA 1V26A 5BNFA 5DGTA 2ATVA 3CLTD 2CDNA 2ZXEA 3QUTA 4JL6A 3WV5A 2QRHA 2FEPA 3AUAA 3D5TA 1UPCA 3KEFA 1HE8B 4O33A 2XKJE 5CK4A 4D2IA 2PMEA 2OXEA 3ZJYA 3I04M 1TVKA 4B4KA 5DEIA 1PT8A 1GEGA 2GD6A 3JVUA 4XYGA 2I22A 3MGGA 2H1OA 1CDOA 4YPFA 2FPIB 4EL5A 3B13B 2WUGA 3ZXYA 4YDRA 2OOSA 4UTZA 3E3NA 3ZXXA 2PKWA 4N0EA 5AVRA 4OI4A 3UW3A 1Y5IA 2H1FA 2JI9A 1HX7A 5HQJA 4D9IA 3ABZA 3KPWA 5JT1A 4AS1A 1EDDA 1QGAA 3BJEA 4CRWB 3D8SA 4YRAA 1GL6A 1U2DC 4G97A 2Y1OA 4HNGA 5TEVA 4LY6A 4D4MA 1RLTA 4F5WA 5C5DA 4CM4A 1OREA 3C3JA 1TLFA 3GJSA 1JTEA 4JLBA 4OXYA 4PYKA 2J4DA 4C89A 4L85A 1ZBDA 1WDLA 4OV6B 5AHKA 1KDRA 4BCCA 3KPUA 4K8RB 5AIAA 5EFZA 4EFLA 3USCS 3B70A 5D85A 5TY0A 1VP3A 3HBMA 1QF6A 4ER3A 2GZHA 1HDXA 5D3MB 1N2IA 1R0YA 2WPDA 4YJKA 3TRDA 1OYYA 3KE9A 3M5PA 1QH1A 1PYDA 1MORA 5JWRA 3CRVA 4GMHA 1HE2A 1U65A 3FYSA 1L5MA 1P29A 4LYGA 4RSMA 5ABPA 1WQ1R 3RSZA 1W7AA 1WKBA 1G4AE 1EFKA 1GKUB 1ULUA 2OV4A 2XCTB 4RD3A 4EQ6A 2VXCA 1QB8A 3WE7A 4BGIA 3BWMA 1I7NA 2EZUA 2QT0A 3TIIA 3TUZC 5KC9A 1U0BB 3FHCB 3E03A 4W1SA 1UDAA 1XRNA 2IUFA 3HUTA 5E3IA 2G72A 5EE9A 3T06B 5AVVA 2JK0A 2H4WA 4YHBA 1U8CB 1CDDA 1JZQA 2XB9A 2X14A 1PEDA 4KO2S 2BHLA 2VQDA 3OCVA 5CEJA 1CUZA 3OQIA 3PE6A 3O91A 1DARA 3KHKA 2XE4A 1L5LA 2EGUA 5FTMA 5HM8A 1O9HA 5H9WA 2RCYA 4ISCA 3PENA 4L27A 4R01A 2PMBA 2PUAA 5IH3A 1R27A 1TQDA 5I9NA 1L5FA 1YR2A 1TA4A 2EJBA 4YS6A 4DFDA 3ETEA 2AJCA 3L6RA 4HSGA 4ATNA 2UYGA 4Y2VA 2XR1A 4CUZA 2PS1A 1MPXA 2OBFA 1L5OA 3EXFA 4YMIA 3G89A 4V2IA 4EHLA 4HGOA 2IYFA 4JGGA 1W76A 1BKYA 3MRXA 1LX6A 1LPSA 1T5LA 3A0RB 5IAOA 3SYLA 2JHFA 4S1NA 5JYCA 5M2QA 1JQKA 3BSFA 2Z5LA 2GN9A 2WVAA 2A78A 4WK4B 5HZMA 1Q2UA 1W5FA 1Y7IA 2I65A 3N75A 3T1NA 1NVTA 2YVKA 1A4RA 5LQAA 3K32A 1EX9A 3NHJA 3OKFA 1GXSA 1O89A 2PMFA 3AHHA 1YMUA 2PQ0A 3V5NA 3GFVA 2UYYA 2O3JA 1IMOA 3BGWA 4MV4A 5EP4A 5TGZA 3A32A 3UMRA 3UUWA 3SFVA 3M4YA 2WYIA 3D3WB 4FCVA 4CCYA 2IEIA 1NM5C 1UXGA 3DEIA 5B7NA 5AW3A 4B3TB 4LF6B 3WWEA 2WHXA 2F1IA 3FKSD 4DDMA 2VYVD 3I62A 1YZ3A 4M76B 3O94A 4ND4A 4GEKA 3B7PA 3HFJA 3PXGA 1J0AA 1PJBA 1Z08A 2H2WA 4F4UA 4IH1A 1RVDA 1VIDA 2I9PA 2QLLA 3OHMA 1RYFA 1UJ4A 4YI3A 4W9MC 4AZ3B 3FX2A 4YJFA 1O8BA 1YHYA 1VYHA 3GEBA 1G7TA 3TGWA 1TJYA 3IELA 3EGWA 5LVAA 1L8LA 3DOFA 1F0NA 3KU4A 5ALKA 4WKGA 4U9IS 2BGRA 5C37A 4PO3X 2PJZA 4PPGA 4WHMA 5EE0A 5IPFA 5MN6A 3QWFA 2GXAA 3JSAA 1S5PA 4L4UA 1S2NA 1WZIA 3E82A 1V7QA 4M8LA 4F38A 2GESA 1X1EA 3B85A 1Z0IA 3KFXA 1JDJA 1PX2A 4GLBA 5IM4A 1JUDA 4ZGBA 3B52X 1MF7A 2VNKA 3BD9A 3LXMA 3VJLA 4P38A 1QC5B 3IH5A 3A4YA 2FW0A 2FWRA 2JJ8A 4HKTA 4AB1A 5MN5A 1SKYB 4JT8A 2JH3A 3W1WA 3BFPA 5H0IA 3CE9A 4PHHA 3BMCB 1S3GA 2JI7A 5IZ4A 4FVTA 1RRCA 4H7PA 5FOQA 3OQHA 13PKA 1G4UR 3VO2A 4QNNA 2CWDA 2VBFA 3P5SA 3Q1LA 2VDRB 5GP1A 5KOIA 3ST7A 1N2SA 1VLQA 2AOTA 2QA5A 4QYSA 5EUQB 5A4AA 1QQ6A 4MOWA 4RKEA 1JG3A 3WL7A 8ABPA 4UTOA 3CF4A 2H1WA 1LZKA 1OXKB 3ZJ4A 4TROA 4HEJA 4KLNA 4M9RA 5EXTA 3PC3A 1O96B 4YCDA 4RVOA 4TMYA 1U0GA 5FPHA 4EP1A 4ZYVA 2YFHA 3PHJA 3BTUA 4GGPA 4J0DA 2FF7A 3Q8KA 5I4BA 4URVR 1C0KA 1QLHA 4F8JA 4C7VA 1LI5A 1KSJA 5KYYB 4D4KA 4EGJA 1KI8A 5BR1A 4HUJA 2AC7A 5FBVB 4MGKR 1JYEA 2M9MA 2OORC 5HKOA 3ZJTA 4RJTA 4BVAA 4AY2A 4X64B 1P77A 1O3YA 4J16A 2A9OA 1EXWA 4Q18A 1W6UA 4E1BA 3MLBA 1P60A 3HI6A 2RBKA 3JQCA 1D4AA 3Q9UA 4JLKA 2AFIE 1MHPA 4IZ6A 2WJPA 2UYCA 1E2DA 4ALNA 3WBJA 3WNCA 4AW9A 1U8UA 1VBFA 2J07A 3DMTA 3LQ2A 3A9CA 3WRYA 3RS9A 3C3MA 1KAMA 3S7ZA 1TZBA 2IU0A 3IQZA 1KNXA 2H11A 3VR1A 1G21A 2C0PA 5H8WA 1ORWA 4DYDA 4Z4EA 4OHWA 3GNLA 2AQIA 2AJ8A 4MO9A 3TE6A 4ZRMA 3EGDB 4J6FA 3ZHQA 1EUCA 2BBSA 3FHJA 4E4RA 3R5HA 3U56A 3CMMA 4RORA 2G76A 4EITA 3KKKA 4V39A 4GR4A 4TSRA 3M89A 5F5XA 1XGKA 2ZVPX 1TYAE 4TVSA 1UFVA 3OEHD 5FB3A 4CM9D 2F67A 4IGIA 4MW2A 1UADA 3T3PB 2Z2IA 4KX3A 2EP7A 4M8SA 3UHAA 5JTTA 4NZMA 3EW9A 4NOMA 4WLEA 5DASA 4Q3AA 2XRFA 5DW0A 2NO4A 3V1YA 2QTVA 4X60A 5K6AC 2FN4A 1IEWA 4TRRA 2HNBA 3ZW8A 4JXZA 5BPFA 3ZY5A 1NN0A 2DPHA 4TYQA 4MITA 3QNMA 5EZ6B 2QJFA 5BY2A 1NYTA 4AJKA 1QYCA 4CQMA 4G4JA 2VWPA 3THXB 5BSKA 4NR0A 5DYGA 4CODB 4DJTA 3VZQA 1MG5A 4JI8B 3W5HA 4B75A 1EINA 5DX8A 5K03A 4RH0A 1O58A 4ILKA 3TCKA 1ISSA 1XQVA 3FCUB 3W6UA 2GSDA 4FDAA 4LVNA 4W99A 5FADA 1CS4C 2Q3MA 3CTMA 3MJ4A 1F7UA 3KDSE 3C98A 4S3MA 3JATA 2QT1A 4IFBA 4BQPA 4DG9A 1RZRD 5BNTA 2VBCA 4XIGS 5E7QA 1GJRA 1ZHFA 2J3DA 4MVWA 1Z4QA 5H82A 5EQFA 5BWLA 4RE6A 1FMLA 3HKDA 2HK9A 1MUUA 3I9JA 1NHGA 1Z6XA 1CY4A 2ENWA 4BNXA 1OFUA 1E1KA 3OJCA 1Q74A 2QLNA 3WV4A 3PJGA 2F48A 2EOAA 2YV5A 1BX3A 2GEFA 2VP2A 4FR0A 3Q0TA 5CMLA 1JDSA 4ZC1A 1K5DA 3CLSD 1VPDA 3FVRA 3R41A 2PUFA 1CEEA 1G98A 4JDPA 5JS2A 1NBIA 4Z0HO 2JRLA 3L7JA 3LBFA 1RRKA 3K8QA 3LPMA 3RDPA 1ZM4A 1KZ9A 2C9CA 3CFYA 3I4L