2X7PA

The conserved candida albicans ca3427 gene product defines a new family of proteins exhibiting the generic periplasmic binding protein structural fold
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
306
structure length
306
Chain Sequence
LPTLKVAYIPEHFSTPLFFAQQQGYYKAHDLSIEFVKVPEGSGRLINLLNSNEVDIAIGLTEAFIADIAKGNENIHVLDTYVKSPLLWAVSTGSNRDDVTDAKQLKRIGVSRIGSGSYVMSFVLAHQLGVPSFDQFQVLSNFKNLRDSVNLKDGVEGSDAFMWEYFTSKKYYDNHEIKQIDQIYTPWSSWVVATSSDSLQAKSDVIKNFIDAVNQGIQYYNEHVDEAIEYISSNLDYSAEDAKEWTKTVEFNSRIGKTPLDWDTIVVKTKDTLKLAGVLAESDDVILKRLNSNVKKTNLQLDGDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POSSIBLE THIAMINE BIOSYNTHESIS ENZYME
publication title The Conserved Candida Albicans Ca3427 Gene Product Defines a New Family of Proteins Exhibiting the Generic Periplasmic Binding Protein Structural Fold
pubmed doi rcsb
source organism Candida albicans
molecule tags Unknown function
total genus 107
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2x7pA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2x7pA01
2LAOA 3CSGA 4M4GA 3OO6A 4ZE8A 4ZEFA 1B52A 3R6UA 1M5BA 1ZJLA 2QSXA 4F31B 2DP8A 2HAUA 1I6QA 3MPKA 3G7WA 3OEKA 2UVJA 4GWOA 4O3AA 3Q29A 2G29A 2IEEA 3QUJA 1FTKA 1MXZA 2RCAA 3HV1A 3PPNA 3LSXA 3HN0A 4PETA 1BKAA 3A09A 4BDLA 3KOSA 4X48A 2H99A 3RLFE 1SYIA 5JTYB 4H67A 4IO6A 3BFUA 1SD3A 3PUXE 5I2NA 2XXHA 3K0VA 1OIBA 3E3KA 5KZTA 3RTFB 2PBWA 4F22A 5AA2B 3KJTA 3TEPA 4H8IA 2I0BA 5ICQA 1SI0A 1FTJA 1JEUA 3THIA 1RKMA 1B3LA 2F34A 2O7IA 4JXIA 5F7VA 1S7YA 4QSCA 1LFIA 1LLSA 2F6PA 4Q30B 5CI5A 5B7DA 2XXXA 4OQOA 2P2AA 2ESNA 1SW1A 3TELA 1QUIA 3MVYA 2YLNA 4EDPA 2XXTA 3CR9A 2A5TB 2ZNTA 4F1VA 3K1MA 3CSBA 3MP8A 5F1QA 2Q88A 5I59B 3OOAA 4TLLB 4OVJA 2R6GE 1LAFE 2D5WA 1EU8A 3TMGA 1MQDA 2UYFA 1PDAA 4JB7A 4JSOA 2O6AA 4RPOA 2VHAA 1ZKBA 1O64A 3N6TA 5A5XA 4QFOA 4KYSA 1QJMA 2Z22A 4IO4A 1SW4A 3P7IA 4H8JA 1LSTA 1IIWA 3WAFA 2HZKA 3IOTA 5DYHA 4OERA 1MXXA 4JBZA 3C31A 1MQIA 3TTLA 3SKPA 1ATGA 2V25A 2DXRA 4KCDA 4NF6B 3RUMA 3MVXA 2XXIA 1B5IA 2V93A 4ZE9A 2AYSA 2Y7RA 2ZYMA 4AB5A 1B0HA 3OMBA 4KQPA 4GOTA 3PD9A 1LBCA 3G3KA 3IOUA 4NWDA 2OLBA 2RINA 2Q9TA 3KZGA 4R6YA 4QSEA 3KFMA 2Q89A 4MH5A 4QHQA 1II5A 4BDQA 3K6WA 3PV0E 1B58A 1B2HA 4F3SA 5TP9A 4OXVA 3S9NC 4NF5A 2AIXA 5FTHA 2F35A 3IK6B 4NE4A 4IY5A 3TZAA 1B6HA 2F7BA 2HFBA 4IO3A 1Q1KA 4LQ5A 4EQ7A 4YMAA 3MP1A 3AXFA 3KN8A 3S2VA 4PE5B 5KCJB 1XT8A 2XXUA 3B6WA 5DEXA 3VLUA 3JYRA 3V83A 4O3BA 1RYOA 3MZ9A 1PBPA 1D9VA 3Q27A 3SEUA 3G3HA 4P0GA 4R73A 4RNSA 4ZEIA 2OZZA 4G68B 4LZ8A 3CVGA 1MXVA 5DVIA 4R9FA 2H9BA 1R6ZA 3W15C 4ZEBA 4KYEA 1B4ZA 1VFDA 5EHMA 2O7UA 2DSFA 4F3PA 4EXKA 2OWSA 3KN3A 2O68A 1B5HA 3O66A 4IY6A 4ELQA 2HQ0A 1N3WA 1IUDA 3ZS6A 3VVFA 1YCJA 1URSA 4EXLA 2DVZA 4DE8A 3SEXA 2HXWA 3F11A 2B3BA 2QS1A 4X1BA 4ESXA 3C35A 4JSDA 3GXAA 4THIA 4U4SA 5BUUA 3G3JA 2BJJX 3ODBA 4ELOA 2PX1A 1B5JA 2RC8A 2QMXA 4DDDA 2XXYA 3BKIB 3K1PA 1L5TA 3IOVA 3MVZA 1F9BA 1GR2A 1USYH 5TPAA 3B7DA 4OENA 1MDQA 3FZVA 3T66A 1PC3A 4WEDA 3UA8A 1PB7A 1IQ7A 2F8DA 3FV1A 3IORA 3OENA 4ONYA 3U93A 3T9HB 1I69A 4YB7A 1XVXA 5FTIA 4EQ9A 2O69A 4UA8A 1ZIUA 3V8XB 4FAJA 2XXPA 3PPQA 1MM7A 3B6TA 1QKBA 1HSLA 4IO7A 1J1NA 4R75A 5H8FB 2XXVA 3QXMA 5AA4B 2DVCA 5H8QB 5CMBA 1P1WA 4G68C 1FQCA 1WDNA 3MJNA 3VLWA 1LCTA 4BDNA 1XOCA 4KCCA 2X7PA 4KFQA 1JVYA 4M1VA 1XVYA 1UIUA 5H8HB 5H8NB 1T0KA 2XD3A 5CC2A 5HBCA 1IEJA 3TPAA 4AQ4A 3FVOA 4R6HA 1D9YA 1QUKA 1MY3A 1O63A 2XXQA 4DXUA 5ITOA 3H7MA 5H8SA 3OSRA 2P0SA 3TCFA 3DLNA 2Y7PA 3Q25A 3UN6A 1MS7A 3H06B 1AL3A 1NNPA 1N3XA 1LB8A 3QK6A 1VR5A 2B65A 2O1MA 3MW0A 2F7CA 3O6HA 1P1QA 1P1UA 4GD5A 4BDRA 4GVOA 5I58B 3RT6B 4PP0A 1DSNA 3TDJA 3MAMA 4RK2A 1OQHA 2ALUA 2I3VA 5ELVA 5FHNA 1XHYA 1LCFA 3FVNA 2ZYNA 3CG1A 3GLBA 4OMBA 1JW4A 1SDXA 2GHAA 4JWOA 4YKKA 4YAHX 2E0SA 3I3VA 2QL3A 4POWA 1OVTA 3K01A 1Y9UA 4H5GA 2DWAA 4TOZA 1SI1A 3BFTA 4XTCQ 1MXWA 3RTWB 2ZNUA 4ELPA 3TODA 2QJEA 1TFAA 2OK2A 5J1DA 3T9XB 4F19A 3K6VA 2V84A 4Z0IA 1NL5A 3EHSA 3FASA 3W9WA 3W9VA 1BLFA 4U2RA 4DCXA 1B0LA 2CMOA 3HCQA 1URDA 5LOMA 1UQWA 4U22A 1FQDA 3FIRA 5M2VA 3O6GA 4TLMB 4E0XA 5FHOA 4F3BA 1CE2A 3CRBA 3VVEA 4JWYA 4F18A 4RXLA 4DLDA 5I2NB 5HPQA 4YKIA 5CRYA 3VE1B 4PFYA 2F97A 2F6GA 3K4UA 4U1ZA 4R9GA 4NF4A 3V5AA 3FVGA 2V3UA 1B7UA 3HO7A 1B51A 3MPLA 2UVGA 5DVFA 4HCYA 3H6WA 1NNTA 3OD7A 3FJMA 1Y3PA 4HS7A 1MH3A 2NUVA 4I1DA 1Y3QA 2F78A 2D3IA 3HSTA 1JQFA 4QFLA 1N84A 1P99A 4NEDA 2QS4A 1I6BA 4OWDA 4XIGQ 3OO9A 5AA2D 3MWBA 3UORA 1MPDA 4NWCA 3KSJA 5A5XB 4XKPA 4OFJA 3M8UA 1HSJA 1DPEA 3USDA 4ZEKA 3ZKKA 3N26A 1MQHA 3EN3A 5I59A 1Z7NE 4KHZE 4E0WA 4X1DA 4FIMA 1FQBA 4H1XA 3IO4A 1MY0A 3FV2A 4I8CA 2M8CA 1M5CA 3IL1B 3CI8A 3TCGA 1JW5A 4RPNA 2UXAA 4GXAA 4EQBA 1MY2A 4POXA 1N7XA 2XX7A 4GXSB 2QRYA 4KPTA 4FATA 3RY3A 3VDFA 1R9LA 1N7WA 1KWHA 5K2YA 3GZGA 5HM4B 3IOWA 5I57B 4EUOA 4LONB 1ELJA 3UP9A 5TP9B 4XKQA 3GBBA 4UACA 1A7LA 3C33A 2HEUA 4NF5B 1MY4A 3IB0A 3SEYA 4QFNA 1D3KA 1Q35A 4G2ZA 2DE3A 5ISUA 5IKBA 1LGBC 3TAJA 1MXUA 3S9EA 3PUWE 1P1OA 1QVSA 3EPEA 4PFWA 1Y3NA 2XXWA 1LAHE 4IGTA 2DQVA 3CG3A 5DEXB 4ZS9A 3S4UA 5DTBA 1JNFA 1NMUA 1NNFA 1OLAA 3M3FA 4AB6A 4C0RA 3E13X 5KDTA 3FXUA 3MC2A 1H44A 3SEWA 4ZEDA 3TKDA 2I3WA 3LUYA 1AIVA 3C36A 1JEVA 3UK4A 4L17A 5I2KA 2XX8A 1A55A 4YKJA 1A54A 2G93A 4ZZAA 5AE4A 4NF8A 2REGA 4Z7EA 1AOVA 3VXBA 2ZNSA 3SDFA 3BBRA 2DE2A 4QRZA 1B4HA 4LZ5A 3S9LC 4OHNA 5ICTA 3R26A 1B3HA 1MDP1 5TU0A 4PQJA 5CMMA 4G77A 4F29A 1M5DA 4HW8A 5DT6A 4O3CA 4R6KA 3M3LA 1NH8A 4YU0A 1MRPA 1DMBA 4DXBA 1MXYA 1N0TA 3QIMA 3H6VA 1IXHA 3TTKA 3PD8A 5TPAB 3WAEA 2XX9A 4JWXA 1N76A 1US4A 3T22A 3PMXA 3L6HA 5CMCA 5CBSA 3TTMA 3PPRA 4ZZEA 2F36A 2ZMBA 3O97A 2RF1A 4GQOA 2DWJA 1B1HA 3U72A 3RPWA 2PYYA 1URGA 4LZ7A 2RCBA 1NH7A 2B3FA 2FA7A 1B7HA 4F1UA 3PPPA 2I58A 3MUQA 4KI0E 3O9PA 4NTLA 1B46A 1B1XA 3JV9A 4HTGA 1SW5A 3MZBA 4EF2A 4H65A 1H45A 3IO6A 5CMKA 3MZ1A 1EH3A 3C34A 2GHBA 2ABHA 3MQ9A 3Q28A 4LATA 3SERA 4I9DA 3K6UA 4WEPA 4IO2A 1POTA 3UIFA 3L6GA 1IXGA 2I0CA 3U8QA 2X7QA 3KGCA 1FTOA 4QSDA 2I4CA 1LB9A 1Y1ZA 1MM6A 1LFGA 1MH4A 3OSQA 1SQYA 1IXCA 3TCHA 3FXQA 5I56B 4F1YA 4OESA 3RGYA 5AA4A 1GVCA 3OO7A 2ONKE 1UTBB 4QFPA 2P1SA 2NWJA 4OEUA 3OO8A 2ONSA 1LBBA 1BTJA 2DWIA 3O29A 5H8HA 3SEVA 1HSEA 5FHMA 4R2FA 2F7AA 5AA3A 1B40A 3K00A 3FVKA 3IB1A 3LSWA 2Y7WA 3KBRA 4FE8A 3CFZA 4P0IA 4RK9A 3DP6A 2Z8FA 3DP4A 2F5XA 2AL5A 1EZPA 1BIYA 3LSLA 1Y4TA 3SETA 3TFLA 4XXUA 1UTHA 3VFJA 3G3FA 1ZLQA 3T9VA 4ND9A 4XKRA 3VLVA 2HZLA 4ELRA 3LC8A 4FORA 3PMVA 2O51A 4C1TA 1B05A 3VVDA 2THIA 1TT1A 3MVWA 4F2QA 2OWTA 3OXNA 1UIVA 4Q0CA 3IAZA 1QKAA 3HHGA 3FGSA 3FUZA 4FEBA 4GIZA 4MFIA 1TWYA 1ZTYA 4Q8RA 3IR1A 3C9HA 3H6UA 1SW2A 1POY1 2DE4A 3LBSA 2DXYA 1JVXA 2QPQA 4R2BA 1WODA 1ZMGA 1SVXB 3ILUB 1YPNA 2Y84A 5EHSA 2H98A 1P1NA 1VE4A 1LAXA 4LUBA 3DELB 4LP2B 4OFLA 2XD2A 2NXOA 1US5A 1Z7ME 2H4IA 3A3CA 3TYHA 3V89B 3IB2A 1S9TA 4LA9A 1ZBMA 4K3FA 4YKPA 1FQAA 3T9UA 2OJTA 2GFEA 4G8MA 4LQ2A 1SBPA 4NF4B 1VFEA 1OQGA 4PFTA 2V3QA 2V3TA 4YICA 2Z8DA 2Y7IA 3PUVE 3RT8A 1O7TA 1PBQA 1I6AA 1GV8A 2DOJA 1XC1A 4YMBA 2RC7A 3KEIA 3PGFA 1GTKA 3LSFB 1M5EA 3QYTA 5JTYA 3O2AA 4IGRA 4KR5A 3TUSA 3SESA 3CFLA 1A8FA 4FECA 4OFOA 4ECFA 3R7XA 5AA2A 4R74A 5K2XA 1RYXA 5AA1A 2KLFA 2VOZA 3ONMA 1YTVA 3M3KA 3KG2A 1AMFA 1QUJA 2NOOA 3QAXA 2RC9A 2HCAA 4BDOA 4ZECA 1H3DA 2O1LA 1ANFA 3OEMA 2FYIA 3U1OA 2RKMA 4YZZA 1JW1A 2Z23A 4F2OA 1IXIA 2CZLA 3IJOB 4DZ1A 2A5TA 1AH5A 1NNKA 3HHFA 4C1UA 3MBPA 4QFKA 4NMYA 1DOTA 4ZDMA 3RNNA 4IB2A 3K2DA 1PB9A 1Y4CA 2O84X 2XXRA 3GBAA 4XKNA 4R72A 1ZU0A 2I49A 2PMSA 3KN7A 1QW0A 5B70A 1TFDA 3B6QA 5L8DA 3PPOA 1A99A 3EHTA 1TXFA 3Q26A 4MBPA 3RN8A 3PMWA 2VD3A 4OYVA 1S50A 3JZJA 2I48A 4GF8A 4NF6A 2HAVA 4F39A 4F3GA 4LVQA 4TQUQ 3S9MC 3EHUA 2Q2CA 5CM6A 3QUFA 3D4CA 3FD3A 1OVBA 4FEDA 4ISUA 3I5OA 5DVJA 2I6EA 2W7YA 4G4PA 2QMWA 1WVJA 1R9QA 5I57A 2VD2A 1LAGE 2I4BA 3CFXA 2ONRA 4RYAA 4DXCA 4KD5A 5KDTB 2Q8JA 3ZSFA 4GRKA 4OEVA 3DM0A 4HCWA 3FJ7A 1DTZA 4JDFA 5I84A 1FW0A 5I2KB 4U21A 4BDMA 3ILTB 4KYDA 1XS5A 4DIGA 4NF8B 1USYE 4GLIA 3IX1A 4OTEA 5KCJA 2QS3A 3O28A 1JETA 1OLCA 3QSLA 1A40A 3U92A 4RJZA 3KJ7A 1FTLA 4EF1A 2UVIA 1B3FA 1B32A 4G68A 2ZXTA 3G3IA 4N07A 3VXCA 2OCUA 1FTMA 5CBRA 2QS2A 3U94A 4X9TA 2Y7KA 2UYEA 5JEIA 3EF7A 2D21A 4P11A 4PFUA 3FATA 1D4NA 2GH9A 3FXRA 3KSXA 2R9JA 1B9JA 4BLAA 4WKMA 2E1SA 1Y20A 3CIJA 4MLVA 1A8EA 1N04A 3MP6A 3K02A 3K6XA 5ITPA 2NVUB 1M5FA 4GL8A 2X26A 4U1OA 1MPBA 3HPIA 2FNCA 3TQWA 1NFTA 2DS9A 3H3GA 1H76A 3DP8A 2H25A 3H4ZA 5L9SA 5IAIA 2XHDA 1OMPA 1MPCA 4H6DA 2WKYA 3TTNA 1MQJA 1MY1A 2DYXA 4MF3A 3FJGA 5BWJA 2DWHA 4ESWA 4N13A 2R71A 3PU5A 1H43A 2UVHA 5JK4A 2ZYOA 4DCYA 2PT2A 1PB8A 4N6PA 1VSOA 4OZ9A 2IA4A 2ANJA 1DTGA 1B3GA 3T93B 3ZKLA 1B7ZA 1PEBA 4RA1A 1FQEA 3TTRA 3C4MA 2PT1A 2VP1A 5EYFA 5H8FA 1FQFA 1BP5A 3T96B 2Q2AA 4YB5A 5H8QA 2AL4A 1R1NA 3K1NA 4RY1A 5L9MA 2YJPA 4OETA 1NKXA 3TQLA 1YAEA 1EZ9A 4YB6A 3EQ1A 2A5SA 1GGGA 3I6VA 4U4XA 2OBGA 5H8NA 3UGWA 3OELA 5I56A 2Z8EA 4Q5TA 3VV5A 3N5LA 3N94A 1B3EA 1QULA 1UTBA 3PUZE 2YPNA 4GL0A 4GFRA 1UTHB 2PVUA 1IZ1A 1FCKA 1Y1MA 4H5FA 4IO5A 4MLQA 3LR1A 1DPPA 3O6IA 1LFHA 3H6TA 2VGQA 2ZYKA 2REJA 3A3UA 3IJXB 4FJPA 3E4RA 3G3GA 1IITA 3H03A 1MG1A 4U23A 2GRVA 5I58A 1MQGA 1CB6A 1EZOA 4WXJA 3RQTA 3N6UA 4G8NA 3PUYE 3C32A 5L9OA 3ECRA 3D4GA 4QF9A 1SYHA 3E9XA 4I62A 4G8HA 4H0WA 3KOTA 2H5YA
chains in the Genus database with same CATH superfamily
2LAOA 3CSGA 4M4GA 3OO6A 4ZE8A 4ZEFA 5IM2A 3U65A 1B52A 3R6UA 1M5BA 1ZJLA 1YYZA 2QSXA 2HXRA 5EQAA 4F31B 2DP8A 2HAUA 1I6QA 4JVDA 3MPKA 2B4LA 3G7WA 1EYIA 3OEKA 2UVJA 4PTKA 4GWOA 4QBAA 4O3AA 2WBBA 3Q29A 2G29A 2IEEA 3QUJA 2Y5LA 1FTKA 1MXZA 2RCAA 4X04A 3HV1A 3PPNA 3LSXA 4OVPA 3HN0A 4GBWA 4PETA 1BKAA 3A09A 4PDHA 4BDLA 4N15A 3KOSA 4X48A 2H99A 3ISPA 3RLFE 1SYIA 3GYYA 5JTYB 4H67A 4IO6A 3BFUA 1SD3A 3PUXE 5I2NA 1IMCA 2XXHA 3K0VA 2CEXA 1OIBA 3E3KA 5KZTA 3EKIA 3RTFB 2PBWA 4F22A 5AA2B 3KJTA 3TEPA 4H8IA 2I0BA 5ICQA 1SI0A 1FTJA 1JEUA 3THIA 1RKMA 1KA1A 1B3LA 2F34A 2O7IA 4JXIA 5F7VA 1S7YA 4QSCA 1LFIA 1LLSA 4NF0A 2F6PA 4Q30B 5CI5A 3KBZA 5B7DA 2XXXA 4OQOA 2P2AA 2ESNA 1SW1A 3KC0A 3TELA 1QUIA 3MVYA 2YLNA 4EDPA 1FBPA 2XXTA 2KR0A 2A5TB 3CR9A 2F3DA 4AS4A 5I7IA 2ZNTA 4F1VA 4NN3A 4P1LA 3K1MA 3CSBA 3MP8A 5F1QA 2Q88A 2CEYA 5I59B 3OOAA 4TLLB 4OVJA 2R6GE 1LAFE 2D5WA 1EU8A 3TMGA 1MQDA 2UYFA 1PDAA 4JB7A 4JSOA 2O6AA 4RPOA 2VHAA 1ZKBA 1XI6A 1O64A 3N6TA 5A5XA 4QFOA 4KYSA 1QJMA 2Z22A 4IO4A 1SW4A 3P7IA 4H8JA 1LSTA 1IIWA 4N6DA 3WAFA 2HZKA 3IOTA 5DYHA 4OERA 1MXXA 4JBZA 3C31A 1MQIA 4PFIA 3TTLA 3SKPA 2XA5A 1ATGA 2V25A 2DXRA 4KCDA 4NF6B 3RUMA 3MVXA 2XXIA 1B5IA 2V93A 4ZE9A 2AYSA 2Y7RA 2ZYMA 4AB5A 1B0HA 3OMBA 4KQPA 5ET7A 4GOTA 3PD9A 1LBCA 3G3KA 3IOUA 4NWDA 2OLBA 2RINA 5IZ3A 2Q9TA 3KZGA 4R6YA 4QSEA 3KFMA 2Q89A 4MH5A 4QHQA 1II5A 4BDQA 4OA4A 3K6WA 3PV0E 4JVCA 1B58A 1B2HA 4F3SA 5TP9A 4OXVA 3S9NC 4FBPA 4NF5A 2AIXA 5FTHA 2F35A 3IK6B 4NE4A 4IY5A 4GWXA 3TZAA 1B6HA 2F7BA 2HFBA 1FRPA 4IO3A 1Q1KA 4LQ5A 4EQ7A 4YMAA 3MP1A 3QMFA 3AXFA 3KN8A 3S2VA 4PE5B 4XFEA 5KCJB 1XT8A 2XXUA 3B6WA 4N8YA 5DEXA 3VLUA 3JYRA 3V83A 4O3BA 1RYOA 1FPKA 1PBPA 3MZ9A 1D9VA 4N4UA 3Q27A 3SEUA 3G3HA 4P0GA 3RYDA 2XXKA 4R73A 4RNSA 4ZEIA 2OZZA 4G68B 4LZ8A 3CVGA 1MXVA 5DVIA 4R9FA 1BK4A 2H9BA 1R6ZA 4MNPA 3W15C 4ZEBA 1SPIA 4KYEA 1B4ZA 1VFDA 5EHMA 2O7UA 2DSFA 4F3PA 5I3SA 4EXKA 1LBXA 2OWSA 1NV5A 3KN3A 4N81A 2O68A 1B5HA 3O66A 4IY6A 2HQ0A 4ELQA 1N3WA 1IUDA 3ZS6A 3VVFA 1YCJA 4HE1A 1URSA 4EXLA 2BJIA 2DVZA 4DE8A 3SEXA 2HXWA 3F11A 2B3BA 2VT5A 4O94A 2QS1A 4X1BA 4ESXA 1JP4A 3C35A 4JSDA 3GXAA 2WYPA 4THIA 4U4SA 5BUUA 2QVRA 3G3JA 4P1EA 2BJJX 3ODBA 4ELOA 2PX1A 1B5JA 2RC8A 2QMXA 4DDDA 2XXYA 3BKIB 1LBZA 3K1PA 1L5TA 1FBGA 3IOVA 3MVZA 1F9BA 1GR2A 3IFAA 1USYH 5TPAA 4PCDA 1FBCA 3B7DA 4OENA 1MDQA 3FZVA 3T66A 1PC3A 4WEDA 3UA8A 1PB7A 3T1BA 1IQ7A 2F8DA 3FV1A 3IORA 3OENA 4I40A 3MYUA 4ONYA 5LTCA 3U93A 3T9HB 1I69A 4YB7A 1XVXA 5FTIA 4EQ9A 2O69A 4UA8A 1ZIUA 3V8XB 4GX4A 4FAJA 2XXPA 3PPQA 1MM7A 3B6TA 1QKBA 1HSLA 4IO7A 3T0JA 5EQ7A 1J1NA 4R75A 1LEVA 5H8FB 2XXVA 3QXMA 5AA4B 2DVCA 5H8QB 5CMBA 1P1WA 4PC9A 4G68C 4NG7A 2P3VA 1FQCA 1WDNA 3MJNA 3VLWA 1LCTA 4BDNA 1XOCA 4KCCA 2X7PA 4KFQA 1JVYA 4M1VA 5IZ1A 1XVYA 1UIUA 2PCRA 5H8HB 5H8NB 1T0KA 2L5VA 2XD3A 5ESYA 5CC2A 5HBCA 1IEJA 2FIEA 3TPAA 1NV0A 4AQ4A 3FVOA 4R6HA 1D9YA 1QUKA 4NQ8A 1MY3A 1O63A 4HE2A 2XXQA 4DXUA 5ITOA 3H7MA 5H8SA 3OSRA 2P0SA 3TCFA 3DLNA 2Y7PA 3Q25A 3UN6A 1MS7A 4PDDA 1FPBA 3H06B 1AL3A 1NNPA 1N3XA 1LB8A 4N17A 3QK6A 1VR5A 2B65A 2O1MA 3MW0A 2F7CA 3O6HA 1P1QA 1P1UA 4GD5A 4BDRA 4GVOA 4UABA 3RT6B 4PP0A 5I58B 1DSNA 1NV4A 3TDJA 3MAMA 4RK2A 1OQHA 2FBPA 2ALUA 2I3VA 5ELVA 5FHNA 1XHYA 1LCFA 3FVNA 2ZYNA 3CG1A 2PFZA 3GLBA 4OMBA 1JW4A 4N6KA 1SDXA 2GHAA 4JWOA 4YKKA 4YAHX 2E0SA 3I3VA 4NX1A 2QL3A 4POWA 1FBHA 1OVTA 1FBEA 3K01A 1Y9UA 4H5GA 1IMFA 2DWAA 4TOZA 1SI1A 3BFTA 3CHGA 2V4CA 2VPNA 4XTCQ 1MXWA 3RTWB 2ZNUA 4ELPA 3TODA 2QJEA 2ZZXA 1TFAA 3LV0A 2OK2A 2MKZA 5J1DA 3T9XB 4F19A 3K6VA 2V84A 4Z0IA 4PAIA 1NL5A 3EHSA 3FASA 3W9WA 4G61A 3W9VA 1BLFA 4U2RA 4DCXA 1B0LA 4I3EA 2CMOA 3HCQA 1URDA 5LOMA 1UQWA 4LN5A 2ZZWA 4U22A 4MX6A 1FQDA 1FJ9A 3FIRA 5M2VA 3O6GA 4TLMB 4E0XA 5FHOA 4F3BA 1CE2A 3CRBA 3VVEA 4JWYA 4F18A 4RXLA 4DLDA 5I2NB 5HPQA 4YKIA 5CRYA 3VE1B 4PFYA 2F97A 2F6GA 5F24A 5LDZA 3K4UA 4U1ZA 1NV7A 4R9GA 4NF4A 3V5AA 3FVGA 2V3UA 1B7UA 3HO7A 1B51A 3MPLA 2UVGA 5DVFA 3HFUA 4HCYA 4I3YA 3H6WA 1NNTA 3OD7A 3FJMA 1Y3PA 1CNQA 4HS7A 1MH3A 2NUVA 2XWOA 4I1DA 1Y3QA 2F78A 2D3IA 3HSTA 1JQFA 1FPFA 4QFLA 4X8RA 1N84A 1P99A 4NEDA 2QS4A 1I6BA 4OWDA 2CZKA 1K9ZA 4PAKA 4XIGQ 3OO9A 5AA2D 3MWBA 3UORA 1MPDA 4NWCA 3KSJA 5A5XB 1NV1A 4XKPA 4OFJA 3M8UA 3A29A 1HSJA 1DPEA 3USDA 4NAPA 2GQ1A 3IFCA 4ZEKA 3ZKKA 3N26A 1MQHA 3EN3A 4HE0A 2ZZVA 5I59A 1Z7NE 4KHZE 4E0WA 4X1DA 4FIMA 1FPGA 1FQBA 4H1XA 3IO4A 1MY0A 3FV2A 3LUZA 4I8CA 2M8CA 1M5CA 1IMEA 3IL1B 4N91A 3CI8A 3TCGA 1JW5A 4RPNA 2UXAA 4GXAA 4EQBA 1MY2A 3B8BA 3NOHA 4POXA 1N7XA 2XX7A 4GXSB 5IZ3B 2QRYA 4KPTA 4FATA 3RY3A 3VDFA 1R9LA 1N7WA 1KWHA 5K2YA 3GZGA 5HM4B 3IOWA 5I57B 4EUOA 4LONB 1ELJA 3UP9A 5TP9B 4XKQA 3GBBA 4UACA 1A7LA 3C33A 2HEUA 4NF5B 5FBPA 1MY4A 3IB0A 3SEYA 4QFNA 4DI4B 1D3KA 1Q35A 4G2ZA 5ET5A 2DE3A 5ISUA 5IKBA 1LGBC 3TAJA 1MXUA 2QFLA 3B50A 3S9EA 3PUWE 1P1OA 4QXDA 1QVSA 3EPEA 4GBVA 2JJKA 4PFWA 1Y3NA 2XXWA 1LAHE 4IGTA 2DQVA 3CG3A 5DEXB 4ZS9A 2WEFA 3S4UA 5DTBA 1JNFA 1NMUA 1NNFA 1OLAA 3M3FA 4AB6A 4C0RA 3E13X 5KDTA 3FXUA 3MC2A 1H44A 3SEWA 4ZEDA 3TKDA 2I3WA 3LUYA 1AIVA 3C36A 1JEVA 3UK4A 4L17A 5I2KA 2XX8A 1A55A 4YKJA 1A54A 2G93A 4ZZAA 5AE4A 4NF8A 2REGA 4Z7EA 1AOVA 3VXBA 2ZNSA 3SDFA 3BBRA 2DE2A 4QRZA 1B4HA 1EYJA 4LZ5A 3S9LC 4OHNA 5ICTA 3R26A 1B3HA 1YXIA 1MDP1 5TU0A 4PQJA 5CMMA 4G77A 1FPIA 4F29A 1M5DA 4HW8A 5DT6A 4GWSA 4O3CA 3RPLA 4R6KA 3M3LA 1NH8A 4YU0A 4PBHA 1MRPA 1DMBA 4DXBA 1NUXA 1MXYA 1N0TA 3QIMA 3H6VA 1IXHA 3TTKA 3PD8A 5TPAB 3WAEA 2XX9A 2F3BA 4JWXA 1N76A 1US4A 1DBZA 3T22A 3PMXA 3L6HA 5CMCA 5CBSA 3TTMA 3PPRA 4ZZEA 2F36A 2ZMBA 4PE3A 3O97A 2RF1A 4GQOA 2DWJA 1B1HA 3U72A 3RPWA 2PYYA 1URGA 4LZ7A 2RCBA 1NH7A 2B3FA 2FA7A 1B7HA 4F1UA 3PPPA 2I58A 3MUQA 2FVZA 4KI0E 3O9PA 4NTLA 1B46A 1B1XA 3JV9A 4HTGA 1SW5A 3MZBA 3FBPA 4EF2A 4H65A 1H45A 3IO6A 5CMKA 3MZ1A 1FBDA 1EH3A 3C34A 2GHBA 4MNCA 2ABHA 2QVVA 3MQ9A 3Q28A 4LATA 3SERA 4I9DA 3K6UA 4WEPA 4IO2A 4MMPA 1POTA 4IR8A 3UIFA 3L6GA 1IXGA 2I0CA 3U8QA 2B4MA 2X7QA 1FJ6A 3KGCA 1FTOA 1VDWA 4QSDA 2I4CA 1LB9A 4GWWA 1Y1ZA 1MM6A 1LFGA 1G0HA 1MH4A 3OSQA 1SQYA 1IXCA 2XWVA 3TCHA 3FXQA 1FPLA 1NV6A 5I56B 4F1YA 4OESA 3RGYA 5AA4A 3PTYA 1GVCA 3OO7A 2ONKE 1UTBB 4QFPA 5EYGA 2P1SA 2NWJA 4OEUA 1FSAA 3OO8A 2ONSA 1LBBA 4OVTA 1BTJA 2DWIA 1NI9A 3O29A 5H8HA 3SEVA 1HSEA 5FHMA 4R2FA 2F7AA 5AA3A 1B40A 3K00A 1NV2A 3FVKA 3IB1A 3LSWA 2Y7WA 3KBRA 4FE8A 3CFZA 4P0IA 4RK9A 4GX6A 3DP6A 2Z8FA 3DP4A 2F5XA 2AL5A 1EZPA 1BIYA 3LSLA 5DW8A 1Y4TA 3SETA 3TFLA 4XXUA 1UTHA 4H45A 3VFJA 3G3FA 1ZLQA 4MHFA 3T9VA 4ND9A 4XKRA 3VLVA 2HZLA 4ELRA 3LC8A 4FORA 5EQ9A 4DI3D 3PMVA 2O51A 4C1TA 4H46A 1B05A 3VVDA 2THIA 3FXBA 1TT1A 3MVWA 4F2QA 2OWTA 3OXNA 1UIVA 5J16A 4Q0CA 3IAZA 1QKAA 4P47A 3HHGA 2HHMA 1YZ0A 3FGSA 4O7MA 3FUZA 4FEBA 4GIZA 1NUZA 3MSTA 4MFIA 1TWYA 1ZTYA 2P3NA 4Q8RA 3IR1A 3C9HA 3H6UA 1SW2A 4MAGA 1POY1 2DE4A 3LBSA 2DXYA 1JVXA 2QPQA 4R2BA 1WODA 1ZMGA 1SVXB 3ILUB 1YPNA 2Y84A 5EHSA 2H98A 2HPGA 1P1NA 1VE4A 1LAXA 4LUBA 4PGNA 3DELB 4LP2B 4OFLA 2XD2A 2NXOA 1US5A 2KQZA 4MEVA 1RDXA 1Z7ME 2H4IA 3A3CA 3TYHA 1FPEA 3V89B 1LBYA 1D9QA 2WBDA 3IB2A 4JVIA 4NGUA 1FPDA 2CZHA 1LBWA 1S9TA 2VPOA 4LA9A 1ZBMA 4K3FA 1NV3A 4YKPA 1FQAA 3KC1A 4KXPA 2QVUA 3T9UA 2OJTA 2GFEA 4G8MA 4LQ2A 1SBPA 4NF4B 1VFEA 1OQGA 2CZIA 2V3QA 2V3TA 4PFTA 4YICA 4GWZA 2Z8DA 2Y7IA 3PUVE 2FHYA 4XF5A 3RT8A 1O7TA 1PBQA 5IGAA 1I6AA 4P56A 1GV8A 4OVRA 2DOJA 1XC1A 4YMBA 2RC7A 3KEIA 3PGFA 1GTKA 2WX9A 3LSFB 4O8MA 1M5EA 3QYTA 4OVQA 5JTYA 3O2AA 4IGRA 4KR5A 3TUSA 3SESA 3CFLA 1A8FA 4FECA 4OFOA 4ECFA 3R7XA 1AWBA 5AA2A 4R74A 3BIGA 5K2XA 1RYXA 5AA1A 2KLFA 2VOZA 1K9YA 4GX3A 3ONMA 1YTVA 1FTAA 3M3KA 1FPJA 3KG2A 4AS5A 1AMFA 1QUJA 2NOOA 3QAXA 2RC9A 2HCAA 4BDOA 4ZECA 1H3DA 2O1LA 1ANFA 3OEMA 2FYIA 3U1OA 2RKMA 4YZZA 1JW1A 2Z23A 4F2OA 1IXIA 2CZLA 3IJOB 4DZ1A 2A5TA 1AH5A 1NNKA 3HHFA 4C1UA 3MBPA 4QFKA 2WYKA 2Q8MA 4NMYA 1DOTA 4ZDMA 3RNNA 4IB2A 3K2DA 1PB9A 1Y4CA 2O84X 4MCOA 2XXRA 3GBAA 4XKNA 5A5LA 4R72A 1ZU0A 4GWYA 2I49A 2PMSA 3KN7A 1QW0A 5B70A 1TFDA 3B6QA 5L8DA 3PPOA 1A99A 3EHTA 1TXFA 3Q26A 4MBPA 3RN8A 3PMWA 2Q74A 2VD3A 4OYVA 1S50A 3JZJA 2I48A 4GF8A 5ET6A 4P8BA 4NF6A 1NUYA 2HAVA 4F39A 4F3GA 4LVQA 4TQUQ 3S9MC 3EHUA 2Q2CA 5CM6A 3QUFA 3D4CA 4MJOA 3FD3A 1OVBA 4FEDA 4HXVA 4ISUA 3I5OA 5DVJA 2I6EA 2W7YA 4G4PA 2QMWA 1WVJA 1R9QA 5I57A 2VD2A 4MIJA 5EQ8A 1LAGE 2I4BA 3CFXA 4P3LA 2ONRA 4RYAA 4DXCA 4KD5A 5KDTB 2Q8JA 1KA0A 3ZSFA 4GRKA 1INPA 4OEVA 3DM0A 4HCWA 3FJ7A 1DTZA 4JDFA 5I84A 2OX3A 1FW0A 2XWIA 5I2KB 4U21A 4BDMA 4P9KA 3ILTB 4PF8A 4KYDA 1XS5A 2FIXA 2DDKA 4DIGA 4NF8B 1USYE 4GLIA 3IX1A 4OTEA 5KCJA 3D1RA 2QS3A 3O28A 1JETA 1OLCA 5T3JA 3QSLA 1A40A 4PBQA 3U92A 4OVSA 4RJZA 3KJ7A 1FTLA 4EF1A 2UVIA 1B3FA 1B32A 2Y5KA 1LBVA 2XWKA 4G68A 2ZXTA 3G3IA 4N07A 3VXCA 3RPLB 3E78A 2OCUA 3E79A 1FTMA 5CBRA 2QS2A 3U94A 5EYHA 3BIHA 4X9TA 2Y7KA 2UYEA 5JEIA 3EF7A 2D21A 4P11A 4PFUA 3SZPA 3FATA 1D4NA 2GH9A 3FXRA 3KSXA 2R9JA 1B9JA 1IMDA 4BLAA 1DCUA 4WKMA 2E1SA 1Y20A 2OWZA 3CIJA 4NHBA 4MLVA 2PFYA 1A8EA 1N04A 3MP6A 3K02A 3K6XA 5ITPA 2NVUB 4GWUA 1M5FA 4GL8A 2X26A 4U1OA 1MPBA 3HPIA 2FNCA 3TQWA 1NFTA 2DS9A 3H3GA 1H76A 2R8TA 3DP8A 4OANA 2H25A 3H4ZA 5L9SA 5IAIA 2XHDA 1OMPA 1MPCA 4H6DA 2WKYA 3TTNA 5IZZA 4PF6A 1MQJA 1MY1A 2DYXA 4MF3A 3FJGA 5BWJA 2DWHA 4ESWA 4N13A 2R71A 3PU5A 1H43A 2UVHA 5JK4A 2ZYOA 4DCYA 2PT2A 1PB8A 4N6PA 1VSOA 4OZ9A 1IMAA 2IA4A 1NUWA 2ANJA 1DTGA 1B3GA 3T93B 3ZKLA 4PAFA 1B7ZA 1PEBA 4RA1A 1FQEA 3TTRA 3C4MA 2PT1A 2VP1A 5EYFA 5H8FA 1FQFA 1BP5A 3T96B 2Q2AA 4YB5A 5H8QA 2AL4A 1R1NA 4XEQA 3K1NA 4RY1A 5L9MA 2YJPA 4OETA 1NKXA 3TQLA 1YAEA 1EZ9A 4YB6A 3EQ1A 4PFBA 2A5SA 1GGGA 1RDZA 3I6VA 4PGPA 4U4XA 2OBGA 1KZ8A 5H8NA 4N8GA 3UGWA 3OELA 5I56A 2Z8EA 4Q5TA 3VV5A 3N5LA 1RDYA 3N94A 1B3EA 1QULA 1UTBA 3PUZE 2YPNA 4GL0A 1DK4A 1EYKA 1QGXA 4GFRA 1G0IA 1UTHB 2PVUA 1IZ1A 1FCKA 1Y1MA 4H5FA 4IO5A 4MLQA 1FBFA 3LR1A 1DPPA 3O6IA 1LFHA 3H6TA 2VGQA 2ZYKA 5ET8A 2REJA 1Q9DA 3A3UA 3IJXB 4FJPA 3E4RA 3G3GA 1IITA 3H03A 1MG1A 4U23A 2GRVA 5I58A 1MQGA 5I5PA 1CB6A 1EZOA 4WXJA 3RQTA 3N6UA 4G8NA 3PUYE 3C32A 5L9OA 3ECRA 3D4GA 4QF9A 1SYHA 3E9XA 4I62A 4MNIA 4PFRA 4G8HA 4O7IA 3ROJA 4H0WA 3KOTA 2H5YA 1IMBA
chains in the Genus database with same CATH topology
2LAOA 3CSGA 4M4GA 3OO6A 4ZE8A 4ZEFA 1B52A 3R6UA 1M5BA 1ZJLA 2QSXA 4F31B 2DP8A 2HAUA 1I6QA 3MPKA 3G7WA 3OEKA 2UVJA 4GWOA 4O3AA 3Q29A 2G29A 2IEEA 3QUJA 1FTKA 1MXZA 2RCAA 3HV1A 3PPNA 3LSXA 3HN0A 4PETA 1BKAA 3A09A 4BDLA 3KOSA 4X48A 2H99A 3RLFE 1SYIA 5JTYB 4H67A 4IO6A 3BFUA 1SD3A 3PUXE 5I2NA 2XXHA 3K0VA 1OIBA 3E3KA 5KZTA 3RTFB 2PBWA 4F22A 5AA2B 3KJTA 3TEPA 4H8IA 2I0BA 5ICQA 1SI0A 1FTJA 1JEUA 3THIA 1RKMA 1B3LA 2F34A 2O7IA 4JXIA 5F7VA 1S7YA 4QSCA 1LFIA 1LLSA 2F6PA 4Q30B 5CI5A 5B7DA 2XXXA 4OQOA 2P2AA 2ESNA 1SW1A 3TELA 1QUIA 3MVYA 2YLNA 4EDPA 2XXTA 3CR9A 2A5TB 2ZNTA 4F1VA 3K1MA 3CSBA 3MP8A 5F1QA 2Q88A 5I59B 3OOAA 4TLLB 4OVJA 2R6GE 1LAFE 2D5WA 1EU8A 3TMGA 1MQDA 2UYFA 1PDAA 4JB7A 4JSOA 2O6AA 4RPOA 2VHAA 1ZKBA 1O64A 3N6TA 5A5XA 4QFOA 4KYSA 1QJMA 2Z22A 4IO4A 1SW4A 3P7IA 4H8JA 1LSTA 1IIWA 3WAFA 2HZKA 3IOTA 5DYHA 4OERA 1MXXA 4JBZA 3C31A 1MQIA 3TTLA 3SKPA 1ATGA 2V25A 2DXRA 4KCDA 4NF6B 3RUMA 3MVXA 2XXIA 1B5IA 2V93A 4ZE9A 2AYSA 2Y7RA 2ZYMA 4AB5A 1B0HA 3OMBA 4KQPA 4GOTA 3PD9A 1LBCA 3G3KA 3IOUA 4NWDA 2OLBA 2RINA 2Q9TA 3KZGA 4R6YA 4QSEA 3KFMA 2Q89A 4MH5A 4QHQA 1II5A 4BDQA 3K6WA 3PV0E 1B58A 1B2HA 4F3SA 5TP9A 4OXVA 3S9NC 4NF5A 2AIXA 5FTHA 2F35A 3IK6B 4NE4A 4IY5A 3TZAA 1B6HA 2F7BA 2HFBA 4IO3A 1Q1KA 4LQ5A 4EQ7A 4YMAA 3MP1A 3AXFA 3KN8A 3S2VA 4PE5B 5KCJB 1XT8A 2XXUA 3B6WA 5DEXA 3VLUA 3JYRA 3V83A 4O3BA 1RYOA 3MZ9A 1PBPA 1D9VA 3Q27A 3SEUA 3G3HA 4P0GA 4R73A 4RNSA 4ZEIA 2OZZA 4G68B 4LZ8A 3CVGA 1MXVA 5DVIA 4R9FA 2H9BA 1R6ZA 3W15C 4ZEBA 4KYEA 1B4ZA 1VFDA 5EHMA 2O7UA 2DSFA 4F3PA 4EXKA 2OWSA 3KN3A 2O68A 1B5HA 3O66A 4IY6A 4ELQA 2HQ0A 1N3WA 1IUDA 3ZS6A 3VVFA 1YCJA 1URSA 4EXLA 2DVZA 4DE8A 3SEXA 2HXWA 3F11A 2B3BA 2QS1A 4X1BA 4ESXA 3C35A 4JSDA 3GXAA 4THIA 4U4SA 5BUUA 3G3JA 2BJJX 3ODBA 4ELOA 2PX1A 1B5JA 2RC8A 2QMXA 4DDDA 2XXYA 3BKIB 3K1PA 1L5TA 3IOVA 3MVZA 1F9BA 1GR2A 1USYH 5TPAA 3B7DA 4OENA 1MDQA 3FZVA 3T66A 1PC3A 4WEDA 3UA8A 1PB7A 1IQ7A 2F8DA 3FV1A 3IORA 3OENA 4ONYA 3U93A 3T9HB 1I69A 4YB7A 1XVXA 5FTIA 4EQ9A 2O69A 4UA8A 1ZIUA 3V8XB 4FAJA 2XXPA 3PPQA 1MM7A 3B6TA 1QKBA 1HSLA 4IO7A 1J1NA 4R75A 5H8FB 2XXVA 3QXMA 5AA4B 2DVCA 5H8QB 5CMBA 1P1WA 4G68C 1FQCA 1WDNA 3MJNA 3VLWA 1LCTA 4BDNA 1XOCA 4KCCA 2X7PA 4KFQA 1JVYA 4M1VA 1XVYA 1UIUA 5H8HB 5H8NB 1T0KA 2XD3A 5CC2A 5HBCA 1IEJA 3TPAA 4AQ4A 3FVOA 4R6HA 1D9YA 1QUKA 1MY3A 1O63A 2XXQA 4DXUA 5ITOA 3H7MA 5H8SA 3OSRA 2P0SA 3TCFA 3DLNA 2Y7PA 3Q25A 3UN6A 1MS7A 3H06B 1AL3A 1NNPA 1N3XA 1LB8A 3QK6A 1VR5A 2B65A 2O1MA 3MW0A 2F7CA 3O6HA 1P1QA 1P1UA 4GD5A 4BDRA 4GVOA 5I58B 3RT6B 4PP0A 1DSNA 3TDJA 3MAMA 4RK2A 1OQHA 2ALUA 2I3VA 5ELVA 5FHNA 1XHYA 1LCFA 3FVNA 2ZYNA 3CG1A 3GLBA 4OMBA 1JW4A 1SDXA 2GHAA 4JWOA 4YKKA 4YAHX 2E0SA 3I3VA 2QL3A 4POWA 1OVTA 3K01A 1Y9UA 4H5GA 2DWAA 4TOZA 1SI1A 3BFTA 4XTCQ 1MXWA 3RTWB 2ZNUA 4ELPA 3TODA 2QJEA 1TFAA 2OK2A 5J1DA 3T9XB 4F19A 3K6VA 2V84A 4Z0IA 1NL5A 3EHSA 3FASA 3W9WA 3W9VA 1BLFA 4U2RA 4DCXA 1B0LA 2CMOA 3HCQA 1URDA 5LOMA 1UQWA 4U22A 1FQDA 3FIRA 5M2VA 3O6GA 4TLMB 4E0XA 5FHOA 4F3BA 1CE2A 3CRBA 3VVEA 4JWYA 4F18A 4RXLA 4DLDA 5I2NB 5HPQA 4YKIA 5CRYA 3VE1B 4PFYA 2F97A 2F6GA 3K4UA 4U1ZA 4R9GA 4NF4A 3V5AA 3FVGA 2V3UA 1B7UA 3HO7A 1B51A 3MPLA 2UVGA 5DVFA 4HCYA 3H6WA 1NNTA 3OD7A 3FJMA 1Y3PA 4HS7A 1MH3A 2NUVA 4I1DA 1Y3QA 2F78A 2D3IA 3HSTA 1JQFA 4QFLA 1N84A 1P99A 4NEDA 2QS4A 1I6BA 4OWDA 4XIGQ 3OO9A 5AA2D 3MWBA 3UORA 1MPDA 4NWCA 3KSJA 5A5XB 4XKPA 4OFJA 3M8UA 1HSJA 1DPEA 3USDA 4ZEKA 3ZKKA 3N26A 1MQHA 3EN3A 5I59A 1Z7NE 4KHZE 4E0WA 4X1DA 4FIMA 1FQBA 4H1XA 3IO4A 1MY0A 3FV2A 4I8CA 2M8CA 1M5CA 3IL1B 3CI8A 3TCGA 1JW5A 4RPNA 2UXAA 4GXAA 4EQBA 1MY2A 4POXA 1N7XA 2XX7A 4GXSB 2QRYA 4KPTA 4FATA 3RY3A 3VDFA 1R9LA 1N7WA 1KWHA 5K2YA 3GZGA 5HM4B 3IOWA 5I57B 4EUOA 4LONB 1ELJA 3UP9A 5TP9B 4XKQA 3GBBA 4UACA 1A7LA 3C33A 2HEUA 4NF5B 1MY4A 3IB0A 3SEYA 4QFNA 1D3KA 1Q35A 4G2ZA 2DE3A 5ISUA 5IKBA 1LGBC 3TAJA 1MXUA 3S9EA 3PUWE 1P1OA 1QVSA 3EPEA 4PFWA 1Y3NA 2XXWA 1LAHE 4IGTA 2DQVA 3CG3A 5DEXB 4ZS9A 3S4UA 5DTBA 1JNFA 1NMUA 1NNFA 1OLAA 3M3FA 4AB6A 4C0RA 3E13X 5KDTA 3FXUA 3MC2A 1H44A 3SEWA 4ZEDA 3TKDA 2I3WA 3LUYA 1AIVA 3C36A 1JEVA 3UK4A 4L17A 5I2KA 2XX8A 1A55A 4YKJA 1A54A 2G93A 4ZZAA 5AE4A 4NF8A 2REGA 4Z7EA 1AOVA 3VXBA 2ZNSA 3SDFA 3BBRA 2DE2A 4QRZA 1B4HA 4LZ5A 3S9LC 4OHNA 5ICTA 3R26A 1B3HA 1MDP1 5TU0A 4PQJA 5CMMA 4G77A 4F29A 1M5DA 4HW8A 5DT6A 4O3CA 4R6KA 3M3LA 1NH8A 4YU0A 1MRPA 1DMBA 4DXBA 1MXYA 1N0TA 3QIMA 3H6VA 1IXHA 3TTKA 3PD8A 5TPAB 3WAEA 2XX9A 4JWXA 1N76A 1US4A 3T22A 3PMXA 3L6HA 5CMCA 5CBSA 3TTMA 3PPRA 4ZZEA 2F36A 2ZMBA 3O97A 2RF1A 4GQOA 2DWJA 1B1HA 3U72A 3RPWA 2PYYA 1URGA 4LZ7A 2RCBA 1NH7A 2B3FA 2FA7A 1B7HA 4F1UA 3PPPA 2I58A 3MUQA 4KI0E 3O9PA 4NTLA 1B46A 1B1XA 3JV9A 4HTGA 1SW5A 3MZBA 4EF2A 4H65A 1H45A 3IO6A 5CMKA 3MZ1A 1EH3A 3C34A 2GHBA 2ABHA 3MQ9A 3Q28A 4LATA 3SERA 4I9DA 3K6UA 4WEPA 4IO2A 1POTA 3UIFA 3L6GA 1IXGA 2I0CA 3U8QA 2X7QA 3KGCA 1FTOA 4QSDA 2I4CA 1LB9A 1Y1ZA 1MM6A 1LFGA 1MH4A 3OSQA 1SQYA 1IXCA 3TCHA 3FXQA 5I56B 4F1YA 4OESA 3RGYA 5AA4A 1GVCA 3OO7A 2ONKE 1UTBB 4QFPA 2P1SA 2NWJA 4OEUA 3OO8A 2ONSA 1LBBA 1BTJA 2DWIA 3O29A 5H8HA 3SEVA 1HSEA 5FHMA 4R2FA 2F7AA 5AA3A 1B40A 3K00A 3FVKA 3IB1A 3LSWA 2Y7WA 3KBRA 4FE8A 3CFZA 4P0IA 4RK9A 3DP6A 2Z8FA 3DP4A 2F5XA 2AL5A 1EZPA 1BIYA 3LSLA 1Y4TA 3SETA 3TFLA 4XXUA 1UTHA 3VFJA 3G3FA 1ZLQA 3T9VA 4ND9A 4XKRA 3VLVA 2HZLA 4ELRA 3LC8A 4FORA 3PMVA 2O51A 4C1TA 1B05A 3VVDA 2THIA 1TT1A 3MVWA 4F2QA 2OWTA 3OXNA 1UIVA 4Q0CA 3IAZA 1QKAA 3HHGA 3FGSA 3FUZA 4FEBA 4GIZA 4MFIA 1TWYA 1ZTYA 4Q8RA 3IR1A 3C9HA 3H6UA 1SW2A 1POY1 2DE4A 3LBSA 2DXYA 1JVXA 2QPQA 4R2BA 1WODA 1ZMGA 1SVXB 3ILUB 1YPNA 2Y84A 5EHSA 2H98A 1P1NA 1VE4A 1LAXA 4LUBA 3DELB 4LP2B 4OFLA 2XD2A 2NXOA 1US5A 1Z7ME 2H4IA 3A3CA 3TYHA 3V89B 3IB2A 1S9TA 4LA9A 1ZBMA 4K3FA 4YKPA 1FQAA 3T9UA 2OJTA 2GFEA 4G8MA 4LQ2A 1SBPA 4NF4B 1VFEA 1OQGA 4PFTA 2V3QA 2V3TA 4YICA 2Z8DA 2Y7IA 3PUVE 3RT8A 1O7TA 1PBQA 1I6AA 1GV8A 2DOJA 1XC1A 4YMBA 2RC7A 3KEIA 3PGFA 1GTKA 3LSFB 1M5EA 3QYTA 5JTYA 3O2AA 4IGRA 4KR5A 3TUSA 3SESA 3CFLA 1A8FA 4FECA 4OFOA 4ECFA 3R7XA 5AA2A 4R74A 5K2XA 1RYXA 5AA1A 2KLFA 2VOZA 3ONMA 1YTVA 3M3KA 3KG2A 1AMFA 1QUJA 2NOOA 3QAXA 2RC9A 2HCAA 4BDOA 4ZECA 1H3DA 2O1LA 1ANFA 3OEMA 2FYIA 3U1OA 2RKMA 4YZZA 1JW1A 2Z23A 4F2OA 1IXIA 2CZLA 3IJOB 4DZ1A 2A5TA 1AH5A 1NNKA 3HHFA 4C1UA 3MBPA 4QFKA 4NMYA 1DOTA 4ZDMA 3RNNA 4IB2A 3K2DA 1PB9A 1Y4CA 2O84X 2XXRA 3GBAA 4XKNA 4R72A 1ZU0A 2I49A 2PMSA 3KN7A 1QW0A 5B70A 1TFDA 3B6QA 5L8DA 3PPOA 1A99A 3EHTA 1TXFA 3Q26A 4MBPA 3RN8A 3PMWA 2VD3A 4OYVA 1S50A 3JZJA 2I48A 4GF8A 4NF6A 2HAVA 4F39A 4F3GA 4LVQA 4TQUQ 3S9MC 3EHUA 2Q2CA 5CM6A 3QUFA 3D4CA 3FD3A 1OVBA 4FEDA 4ISUA 3I5OA 5DVJA 2I6EA 2W7YA 4G4PA 2QMWA 1WVJA 1R9QA 5I57A 2VD2A 1LAGE 2I4BA 3CFXA 2ONRA 4RYAA 4DXCA 4KD5A 5KDTB 2Q8JA 3ZSFA 4GRKA 4OEVA 3DM0A 4HCWA 3FJ7A 1DTZA 4JDFA 5I84A 1FW0A 5I2KB 4U21A 4BDMA 3ILTB 4KYDA 1XS5A 4DIGA 4NF8B 1USYE 4GLIA 3IX1A 4OTEA 5KCJA 2QS3A 3O28A 1JETA 1OLCA 3QSLA 1A40A 3U92A 4RJZA 3KJ7A 1FTLA 4EF1A 2UVIA 1B3FA 1B32A 4G68A 2ZXTA 3G3IA 4N07A 3VXCA 2OCUA 1FTMA 5CBRA 2QS2A 3U94A 4X9TA 2Y7KA 2UYEA 5JEIA 3EF7A 2D21A 4P11A 4PFUA 3FATA 1D4NA 2GH9A 3FXRA 3KSXA 2R9JA 1B9JA 4BLAA 4WKMA 2E1SA 1Y20A 3CIJA 4MLVA 1A8EA 1N04A 3MP6A 3K02A 3K6XA 5ITPA 2NVUB 1M5FA 4GL8A 2X26A 4U1OA 1MPBA 3HPIA 2FNCA 3TQWA 1NFTA 2DS9A 3H3GA 1H76A 3DP8A 2H25A 3H4ZA 5L9SA 5IAIA 2XHDA 1OMPA 1MPCA 4H6DA 2WKYA 3TTNA 1MQJA 1MY1A 2DYXA 4MF3A 3FJGA 5BWJA 2DWHA 4ESWA 4N13A 2R71A 3PU5A 1H43A 2UVHA 5JK4A 2ZYOA 4DCYA 2PT2A 1PB8A 4N6PA 1VSOA 4OZ9A 2IA4A 2ANJA 1DTGA 1B3GA 3T93B 3ZKLA 1B7ZA 1PEBA 4RA1A 1FQEA 3TTRA 3C4MA 2PT1A 2VP1A 5EYFA 5H8FA 1FQFA 1BP5A 3T96B 2Q2AA 4YB5A 5H8QA 2AL4A 1R1NA 3K1NA 4RY1A 5L9MA 2YJPA 4OETA 1NKXA 3TQLA 1YAEA 1EZ9A 4YB6A 3EQ1A 2A5SA 1GGGA 3I6VA 4U4XA 2OBGA 5H8NA 3UGWA 3OELA 5I56A 2Z8EA 4Q5TA 3VV5A 3N5LA 3N94A 1B3EA 1QULA 1UTBA 3PUZE 2YPNA 4GL0A 4GFRA 1UTHB 2PVUA 1IZ1A 1FCKA 1Y1MA 4H5FA 4IO5A 4MLQA 3LR1A 1DPPA 3O6IA 1LFHA 3H6TA 2VGQA 2ZYKA 2REJA 3A3UA 3IJXB 4FJPA 3E4RA 3G3GA 1IITA 3H03A 1MG1A 4U23A 2GRVA 5I58A 1MQGA 1CB6A 1EZOA 4WXJA 3RQTA 3N6UA 4G8NA 3PUYE 3C32A 5L9OA 3ECRA 3D4GA 4QF9A 1SYHA 3E9XA 4I62A 4G8HA 4H0WA 3KOTA 2H5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAO A;  3CSG A;  4M4G A;  3OO6 A;  4ZE8 A;  4ZEF A;  1B52 A;  3R6U A;  1M5B A;  1ZJL A;  2QSX A;  4F31 B;  2DP8 A;  2HAU A;  1I6Q A;  3MPK A;  3G7W A;  3OEK A;  2UVJ A;  4GWO A;  4O3A A;  3Q29 A;  2G29 A;  2IEE A;  3QUJ A;  1FTK A;  1MXZ A;  2RCA A;  3HV1 A;  3PPN A;  3LSX A;  3HN0 A;  4PET A;  1BKA A;  3A09 A;  4BDL A;  3KOS A;  4X48 A;  2H99 A;  3RLF E;  1SYI A;  5JTY B;  4H67 A;  4IO6 A;  3BFU A;  1SD3 A;  3PUX E;  5I2N A;  2XXH A;  3K0V A;  1OIB A;  3E3K A;  5KZT A;  3RTF B;  2PBW A;  4F22 A;  5AA2 B;  3KJT A;  3TEP A;  4H8I A;  2I0B A;  5ICQ A;  1SI0 A;  1FTJ A;  1JEU A;  3THI A;  1RKM A;  1B3L A;  2F34 A;  2O7I A;  4JXI A;  5F7V A;  1S7Y A;  4QSC A;  1LFI A;  1LLS A;  2F6P A;  4Q30 B;  5CI5 A;  5B7D A;  2XXX A;  4OQO A;  2P2A A;  2ESN A;  1SW1 A;  3TEL A;  1QUI A;  3MVY A;  2YLN A;  4EDP A;  2XXT A;  3CR9 A;  2A5T B;  2ZNT A;  4F1V A;  3K1M A;  3CSB A;  3MP8 A;  5F1Q A;  2Q88 A;  5I59 B;  3OOA A;  4TLL B;  4OVJ A;  2R6G E;  1LAF E;  2D5W A;  1EU8 A;  3TMG A;  1MQD A;  2UYF A;  1PDA A;  4JB7 A;  4JSO A;  2O6A A;  4RPO A;  2VHA A;  1ZKB A;  1O64 A;  3N6T A;  5A5X A;  4QFO A;  4KYS A;  1QJM A;  2Z22 A;  4IO4 A;  1SW4 A;  3P7I A;  4H8J A;  1LST A;  1IIW A;  3WAF A;  2HZK A;  3IOT A;  5DYH A;  4OER A;  1MXX A;  4JBZ A;  3C31 A;  1MQI A;  3TTL A;  3SKP A;  1ATG A;  2V25 A;  2DXR A;  4KCD A;  4NF6 B;  3RUM A;  3MVX A;  2XXI A;  1B5I A;  2V93 A;  4ZE9 A;  2AYS A;  2Y7R A;  2ZYM A;  4AB5 A;  1B0H A;  3OMB A;  4KQP A;  4GOT A;  3PD9 A;  1LBC A;  3G3K A;  3IOU A;  4NWD A;  2OLB A;  2RIN A;  2Q9T A;  3KZG A;  4R6Y A;  4QSE A;  3KFM A;  2Q89 A;  4MH5 A;  4QHQ A;  1II5 A;  4BDQ A;  3K6W A;  3PV0 E;  1B58 A;  1B2H A;  4F3S A;  5TP9 A;  4OXV A;  3S9N C;  4NF5 A;  2AIX A;  5FTH A;  2F35 A;  3IK6 B;  4NE4 A;  4IY5 A;  3TZA A;  1B6H A;  2F7B A;  2HFB A;  4IO3 A;  1Q1K A;  4LQ5 A;  4EQ7 A;  4YMA A;  3MP1 A;  3AXF A;  3KN8 A;  3S2V A;  4PE5 B;  5KCJ B;  1XT8 A;  2XXU A;  3B6W A;  5DEX A;  3VLU A;  3JYR A;  3V83 A;  4O3B A;  1RYO A;  3MZ9 A;  1PBP A;  1D9V A;  3Q27 A;  3SEU A;  3G3H A;  4P0G A;  4R73 A;  4RNS A;  4ZEI A;  2OZZ A;  4G68 B;  4LZ8 A;  3CVG A;  1MXV A;  5DVI A;  4R9F A;  2H9B A;  1R6Z A;  3W15 C;  4ZEB A;  4KYE A;  1B4Z A;  1VFD A;  5EHM A;  2O7U A;  2DSF A;  4F3P A;  4EXK A;  2OWS A;  3KN3 A;  2O68 A;  1B5H A;  3O66 A;  4IY6 A;  4ELQ A;  2HQ0 A;  1N3W A;  1IUD A;  3ZS6 A;  3VVF A;  1YCJ A;  1URS A;  4EXL A;  2DVZ A;  4DE8 A;  3SEX A;  2HXW A;  3F11 A;  2B3B A;  2QS1 A;  4X1B A;  4ESX A;  3C35 A;  4JSD A;  3GXA A;  4THI A;  4U4S A;  5BUU A;  3G3J A;  2BJJ X;  3ODB A;  4ELO A;  2PX1 A;  1B5J A;  2RC8 A;  2QMX A;  4DDD A;  2XXY A;  3BKI B;  3K1P A;  1L5T A;  3IOV A;  3MVZ A;  1F9B A;  1GR2 A;  1USY H;  5TPA A;  3B7D A;  4OEN A;  1MDQ A;  3FZV A;  3T66 A;  1PC3 A;  4WED A;  3UA8 A;  1PB7 A;  1IQ7 A;  2F8D A;  3FV1 A;  3IOR A;  3OEN A;  4ONY A;  3U93 A;  3T9H B;  1I69 A;  4YB7 A;  1XVX A;  5FTI A;  4EQ9 A;  2O69 A;  4UA8 A;  1ZIU A;  3V8X B;  4FAJ A;  2XXP A;  3PPQ A;  1MM7 A;  3B6T A;  1QKB A;  1HSL A;  4IO7 A;  1J1N A;  4R75 A;  5H8F B;  2XXV A;  3QXM A;  5AA4 B;  2DVC A;  5H8Q B;  5CMB A;  1P1W A;  4G68 C;  1FQC A;  1WDN A;  3MJN A;  3VLW A;  1LCT A;  4BDN A;  1XOC A;  4KCC A;  2X7P A;  4KFQ A;  1JVY A;  4M1V A;  1XVY A;  1UIU A;  5H8H B;  5H8N B;  1T0K A;  2XD3 A;  5CC2 A;  5HBC A;  1IEJ A;  3TPA A;  4AQ4 A;  3FVO A;  4R6H A;  1D9Y A;  1QUK A;  1MY3 A;  1O63 A;  2XXQ A;  4DXU A;  5ITO A;  3H7M A;  5H8S A;  3OSR A;  2P0S A;  3TCF A;  3DLN A;  2Y7P A;  3Q25 A;  3UN6 A;  1MS7 A;  3H06 B;  1AL3 A;  1NNP A;  1N3X A;  1LB8 A;  3QK6 A;  1VR5 A;  2B65 A;  2O1M A;  3MW0 A;  2F7C A;  3O6H A;  1P1Q A;  1P1U A;  4GD5 A;  4BDR A;  4GVO A;  5I58 B;  3RT6 B;  4PP0 A;  1DSN A;  3TDJ A;  3MAM A;  4RK2 A;  1OQH A;  2ALU A;  2I3V A;  5ELV A;  5FHN A;  1XHY A;  1LCF A;  3FVN A;  2ZYN A;  3CG1 A;  3GLB A;  4OMB A;  1JW4 A;  1SDX A;  2GHA A;  4JWO A;  4YKK A;  4YAH X;  2E0S A;  3I3V A;  2QL3 A;  4POW A;  1OVT A;  3K01 A;  1Y9U A;  4H5G A;  2DWA A;  4TOZ A;  1SI1 A;  3BFT A;  4XTC Q;  1MXW A;  3RTW B;  2ZNU A;  4ELP A;  3TOD A;  2QJE A;  1TFA A;  2OK2 A;  5J1D A;  3T9X B;  4F19 A;  3K6V A;  2V84 A;  4Z0I A;  1NL5 A;  3EHS A;  3FAS A;  3W9W A;  3W9V A;  1BLF A;  4U2R A;  4DCX A;  1B0L A;  2CMO A;  3HCQ A;  1URD A;  5LOM A;  1UQW A;  4U22 A;  1FQD A;  3FIR A;  5M2V A;  3O6G A;  4TLM B;  4E0X A;  5FHO A;  4F3B A;  1CE2 A;  3CRB A;  3VVE A;  4JWY A;  4F18 A;  4RXL A;  4DLD A;  5I2N B;  5HPQ A;  4YKI A;  5CRY A;  3VE1 B;  4PFY A;  2F97 A;  2F6G A;  3K4U A;  4U1Z A;  4R9G A;  4NF4 A;  3V5A A;  3FVG A;  2V3U A;  1B7U A;  3HO7 A;  1B51 A;  3MPL A;  2UVG A;  5DVF A;  4HCY A;  3H6W A;  1NNT A;  3OD7 A;  3FJM A;  1Y3P A;  4HS7 A;  1MH3 A;  2NUV A;  4I1D A;  1Y3Q A;  2F78 A;  2D3I A;  3HST A;  1JQF A;  4QFL A;  1N84 A;  1P99 A;  4NED A;  2QS4 A;  1I6B A;  4OWD A;  4XIG Q;  3OO9 A;  5AA2 D;  3MWB A;  3UOR A;  1MPD A;  4NWC A;  3KSJ A;  5A5X B;  4XKP A;  4OFJ A;  3M8U A;  1HSJ A;  1DPE A;  3USD A;  4ZEK A;  3ZKK A;  3N26 A;  1MQH A;  3EN3 A;  5I59 A;  1Z7N E;  4KHZ E;  4E0W A;  4X1D A;  4FIM A;  1FQB A;  4H1X A;  3IO4 A;  1MY0 A;  3FV2 A;  4I8C A;  2M8C A;  1M5C A;  3IL1 B;  3CI8 A;  3TCG A;  1JW5 A;  4RPN A;  2UXA A;  4GXA A;  4EQB A;  1MY2 A;  4POX A;  1N7X A;  2XX7 A;  4GXS B;  2QRY A;  4KPT A;  4FAT A;  3RY3 A;  3VDF A;  1R9L A;  1N7W A;  1KWH A;  5K2Y A;  3GZG A;  5HM4 B;  3IOW A;  5I57 B;  4EUO A;  4LON B;  1ELJ A;  3UP9 A;  5TP9 B;  4XKQ A;  3GBB A;  4UAC A;  1A7L A;  3C33 A;  2HEU A;  4NF5 B;  1MY4 A;  3IB0 A;  3SEY A;  4QFN A;  1D3K A;  1Q35 A;  4G2Z A;  2DE3 A;  5ISU A;  5IKB A;  1LGB C;  3TAJ A;  1MXU A;  3S9E A;  3PUW E;  1P1O A;  1QVS A;  3EPE A;  4PFW A;  1Y3N A;  2XXW A;  1LAH E;  4IGT A;  2DQV A;  3CG3 A;  5DEX B;  4ZS9 A;  3S4U A;  5DTB A;  1JNF A;  1NMU A;  1NNF A;  1OLA A;  3M3F A;  4AB6 A;  4C0R A;  3E13 X;  5KDT A;  3FXU A;  3MC2 A;  1H44 A;  3SEW A;  4ZED A;  3TKD A;  2I3W A;  3LUY A;  1AIV A;  3C36 A;  1JEV A;  3UK4 A;  4L17 A;  5I2K A;  2XX8 A;  1A55 A;  4YKJ A;  1A54 A;  2G93 A;  4ZZA A;  5AE4 A;  4NF8 A;  2REG A;  4Z7E A;  1AOV A;  3VXB A;  2ZNS A;  3SDF A;  3BBR A;  2DE2 A;  4QRZ A;  1B4H A;  4LZ5 A;  3S9L C;  4OHN A;  5ICT A;  3R26 A;  1B3H A;  1MDP 1;  5TU0 A;  4PQJ A;  5CMM A;  4G77 A;  4F29 A;  1M5D A;  4HW8 A;  5DT6 A;  4O3C A;  4R6K A;  3M3L A;  1NH8 A;  4YU0 A;  1MRP A;  1DMB A;  4DXB A;  1MXY A;  1N0T A;  3QIM A;  3H6V A;  1IXH A;  3TTK A;  3PD8 A;  5TPA B;  3WAE A;  2XX9 A;  4JWX A;  1N76 A;  1US4 A;  3T22 A;  3PMX A;  3L6H A;  5CMC A;  5CBS A;  3TTM A;  3PPR A;  4ZZE A;  2F36 A;  2ZMB A;  3O97 A;  2RF1 A;  4GQO A;  2DWJ A;  1B1H A;  3U72 A;  3RPW A;  2PYY A;  1URG A;  4LZ7 A;  2RCB A;  1NH7 A;  2B3F A;  2FA7 A;  1B7H A;  4F1U A;  3PPP A;  2I58 A;  3MUQ A;  4KI0 E;  3O9P A;  4NTL A;  1B46 A;  1B1X A;  3JV9 A;  4HTG A;  1SW5 A;  3MZB A;  4EF2 A;  4H65 A;  1H45 A;  3IO6 A;  5CMK A;  3MZ1 A;  1EH3 A;  3C34 A;  2GHB A;  2ABH A;  3MQ9 A;  3Q28 A;  4LAT A;  3SER A;  4I9D A;  3K6U A;  4WEP A;  4IO2 A;  1POT A;  3UIF A;  3L6G A;  1IXG A;  2I0C A;  3U8Q A;  2X7Q A;  3KGC A;  1FTO A;  4QSD A;  2I4C A;  1LB9 A;  1Y1Z A;  1MM6 A;  1LFG A;  1MH4 A;  3OSQ A;  1SQY A;  1IXC A;  3TCH A;  3FXQ A;  5I56 B;  4F1Y A;  4OES A;  3RGY A;  5AA4 A;  1GVC A;  3OO7 A;  2ONK E;  1UTB B;  4QFP A;  2P1S A;  2NWJ A;  4OEU A;  3OO8 A;  2ONS A;  1LBB A;  1BTJ A;  2DWI A;  3O29 A;  5H8H A;  3SEV A;  1HSE A;  5FHM A;  4R2F A;  2F7A A;  5AA3 A;  1B40 A;  3K00 A;  3FVK A;  3IB1 A;  3LSW A;  2Y7W A;  3KBR A;  4FE8 A;  3CFZ A;  4P0I A;  4RK9 A;  3DP6 A;  2Z8F A;  3DP4 A;  2F5X A;  2AL5 A;  1EZP A;  1BIY A;  3LSL A;  1Y4T A;  3SET A;  3TFL A;  4XXU A;  1UTH A;  3VFJ A;  3G3F A;  1ZLQ A;  3T9V A;  4ND9 A;  4XKR A;  3VLV A;  2HZL A;  4ELR A;  3LC8 A;  4FOR A;  3PMV A;  2O51 A;  4C1T A;  1B05 A;  3VVD A;  2THI A;  1TT1 A;  3MVW A;  4F2Q A;  2OWT A;  3OXN A;  1UIV A;  4Q0C A;  3IAZ A;  1QKA A;  3HHG A;  3FGS A;  3FUZ A;  4FEB A;  4GIZ A;  4MFI A;  1TWY A;  1ZTY A;  4Q8R A;  3IR1 A;  3C9H A;  3H6U A;  1SW2 A;  1POY 1;  2DE4 A;  3LBS A;  2DXY A;  1JVX A;  2QPQ A;  4R2B A;  1WOD A;  1ZMG A;  1SVX B;  3ILU B;  1YPN A;  2Y84 A;  5EHS A;  2H98 A;  1P1N A;  1VE4 A;  1LAX A;  4LUB A;  3DEL B;  4LP2 B;  4OFL A;  2XD2 A;  2NXO A;  1US5 A;  1Z7M E;  2H4I A;  3A3C A;  3TYH A;  3V89 B;  3IB2 A;  1S9T A;  4LA9 A;  1ZBM A;  4K3F A;  4YKP A;  1FQA A;  3T9U A;  2OJT A;  2GFE A;  4G8M A;  4LQ2 A;  1SBP A;  4NF4 B;  1VFE A;  1OQG A;  4PFT A;  2V3Q A;  2V3T A;  4YIC A;  2Z8D A;  2Y7I A;  3PUV E;  3RT8 A;  1O7T A;  1PBQ A;  1I6A A;  1GV8 A;  2DOJ A;  1XC1 A;  4YMB A;  2RC7 A;  3KEI A;  3PGF A;  1GTK A;  3LSF B;  1M5E A;  3QYT A;  5JTY A;  3O2A A;  4IGR A;  4KR5 A;  3TUS A;  3SES A;  3CFL A;  1A8F A;  4FEC A;  4OFO A;  4ECF A;  3R7X A;  5AA2 A;  4R74 A;  5K2X A;  1RYX A;  5AA1 A;  2KLF A;  2VOZ A;  3ONM A;  1YTV A;  3M3K A;  3KG2 A;  1AMF A;  1QUJ A;  2NOO A;  3QAX A;  2RC9 A;  2HCA A;  4BDO A;  4ZEC A;  1H3D A;  2O1L A;  1ANF A;  3OEM A;  2FYI A;  3U1O A;  2RKM A;  4YZZ A;  1JW1 A;  2Z23 A;  4F2O A;  1IXI A;  2CZL A;  3IJO B;  4DZ1 A;  2A5T A;  1AH5 A;  1NNK A;  3HHF A;  4C1U A;  3MBP A;  4QFK A;  4NMY A;  1DOT A;  4ZDM A;  3RNN A;  4IB2 A;  3K2D A;  1PB9 A;  1Y4C A;  2O84 X;  2XXR A;  3GBA A;  4XKN A;  4R72 A;  1ZU0 A;  2I49 A;  2PMS A;  3KN7 A;  1QW0 A;  5B70 A;  1TFD A;  3B6Q A;  5L8D A;  3PPO A;  1A99 A;  3EHT A;  1TXF A;  3Q26 A;  4MBP A;  3RN8 A;  3PMW A;  2VD3 A;  4OYV A;  1S50 A;  3JZJ A;  2I48 A;  4GF8 A;  4NF6 A;  2HAV A;  4F39 A;  4F3G A;  4LVQ A;  4TQU Q;  3S9M C;  3EHU A;  2Q2C A;  5CM6 A;  3QUF A;  3D4C A;  3FD3 A;  1OVB A;  4FED A;  4ISU A;  3I5O A;  5DVJ A;  2I6E A;  2W7Y A;  4G4P A;  2QMW A;  1WVJ A;  1R9Q A;  5I57 A;  2VD2 A;  1LAG E;  2I4B A;  3CFX A;  2ONR A;  4RYA A;  4DXC A;  4KD5 A;  5KDT B;  2Q8J A;  3ZSF A;  4GRK A;  4OEV A;  3DM0 A;  4HCW A;  3FJ7 A;  1DTZ A;  4JDF A;  5I84 A;  1FW0 A;  5I2K B;  4U21 A;  4BDM A;  3ILT B;  4KYD A;  1XS5 A;  4DIG A;  4NF8 B;  1USY E;  4GLI A;  3IX1 A;  4OTE A;  5KCJ A;  2QS3 A;  3O28 A;  1JET A;  1OLC A;  3QSL A;  1A40 A;  3U92 A;  4RJZ A;  3KJ7 A;  1FTL A;  4EF1 A;  2UVI A;  1B3F A;  1B32 A;  4G68 A;  2ZXT A;  3G3I A;  4N07 A;  3VXC A;  2OCU A;  1FTM A;  5CBR A;  2QS2 A;  3U94 A;  4X9T A;  2Y7K A;  2UYE A;  5JEI A;  3EF7 A;  2D21 A;  4P11 A;  4PFU A;  3FAT A;  1D4N A;  2GH9 A;  3FXR A;  3KSX A;  2R9J A;  1B9J A;  4BLA A;  4WKM A;  2E1S A;  1Y20 A;  3CIJ A;  4MLV A;  1A8E A;  1N04 A;  3MP6 A;  3K02 A;  3K6X A;  5ITP A;  2NVU B;  1M5F A;  4GL8 A;  2X26 A;  4U1O A;  1MPB A;  3HPI A;  2FNC A;  3TQW A;  1NFT A;  2DS9 A;  3H3G A;  1H76 A;  3DP8 A;  2H25 A;  3H4Z A;  5L9S A;  5IAI A;  2XHD A;  1OMP A;  1MPC A;  4H6D A;  2WKY A;  3TTN A;  1MQJ A;  1MY1 A;  2DYX A;  4MF3 A;  3FJG A;  5BWJ A;  2DWH A;  4ESW A;  4N13 A;  2R71 A;  3PU5 A;  1H43 A;  2UVH A;  5JK4 A;  2ZYO A;  4DCY A;  2PT2 A;  1PB8 A;  4N6P A;  1VSO A;  4OZ9 A;  2IA4 A;  2ANJ A;  1DTG A;  1B3G A;  3T93 B;  3ZKL A;  1B7Z A;  1PEB A;  4RA1 A;  1FQE A;  3TTR A;  3C4M A;  2PT1 A;  2VP1 A;  5EYF A;  5H8F A;  1FQF A;  1BP5 A;  3T96 B;  2Q2A A;  4YB5 A;  5H8Q A;  2AL4 A;  1R1N A;  3K1N A;  4RY1 A;  5L9M A;  2YJP A;  4OET A;  1NKX A;  3TQL A;  1YAE A;  1EZ9 A;  4YB6 A;  3EQ1 A;  2A5S A;  1GGG A;  3I6V A;  4U4X A;  2OBG A;  5H8N A;  3UGW A;  3OEL A;  5I56 A;  2Z8E A;  4Q5T A;  3VV5 A;  3N5L A;  3N94 A;  1B3E A;  1QUL A;  1UTB A;  3PUZ E;  2YPN A;  4GL0 A;  4GFR A;  1UTH B;  2PVU A;  1IZ1 A;  1FCK A;  1Y1M A;  4H5F A;  4IO5 A;  4MLQ A;  3LR1 A;  1DPP A;  3O6I A;  1LFH A;  3H6T A;  2VGQ A;  2ZYK A;  2REJ A;  3A3U A;  3IJX B;  4FJP A;  3E4R A;  3G3G A;  1IIT A;  3H03 A;  1MG1 A;  4U23 A;  2GRV A;  5I58 A;  1MQG A;  1CB6 A;  1EZO A;  4WXJ A;  3RQT A;  3N6U A;  4G8N A;  3PUY E;  3C32 A;  5L9O A;  3ECR A;  3D4G A;  4QF9 A;  1SYH A;  3E9X A;  4I62 A;  4G8H A;  4H0W A;  3KOT A;  2H5Y A; 
#chains in the Genus database with same CATH topology
 2LAO A;  3CSG A;  4M4G A;  3OO6 A;  4ZE8 A;  4ZEF A;  5IM2 A;  3U65 A;  1B52 A;  3R6U A;  1M5B A;  1ZJL A;  1YYZ A;  2QSX A;  2HXR A;  5EQA A;  4F31 B;  2DP8 A;  2HAU A;  1I6Q A;  4JVD A;  3MPK A;  2B4L A;  3G7W A;  1EYI A;  3OEK A;  2UVJ A;  4PTK A;  4GWO A;  4QBA A;  4O3A A;  2WBB A;  3Q29 A;  2G29 A;  2IEE A;  3QUJ A;  2Y5L A;  1FTK A;  1MXZ A;  2RCA A;  4X04 A;  3HV1 A;  3PPN A;  3LSX A;  4OVP A;  3HN0 A;  4GBW A;  4PET A;  1BKA A;  3A09 A;  4PDH A;  4BDL A;  4N15 A;  3KOS A;  4X48 A;  2H99 A;  3ISP A;  3RLF E;  1SYI A;  3GYY A;  5JTY B;  4H67 A;  4IO6 A;  3BFU A;  1SD3 A;  3PUX E;  5I2N A;  1IMC A;  2XXH A;  3K0V A;  2CEX A;  1OIB A;  3E3K A;  5KZT A;  3EKI A;  3RTF B;  2PBW A;  4F22 A;  5AA2 B;  3KJT A;  3TEP A;  4H8I A;  2I0B A;  5ICQ A;  1SI0 A;  1FTJ A;  1JEU A;  3THI A;  1RKM A;  1KA1 A;  1B3L A;  2F34 A;  2O7I A;  4JXI A;  5F7V A;  1S7Y A;  4QSC A;  1LFI A;  1LLS A;  4NF0 A;  2F6P A;  4Q30 B;  5CI5 A;  3KBZ A;  5B7D A;  2XXX A;  4OQO A;  2P2A A;  2ESN A;  1SW1 A;  3KC0 A;  3TEL A;  1QUI A;  3MVY A;  2YLN A;  4EDP A;  1FBP A;  2XXT A;  2KR0 A;  2A5T B;  3CR9 A;  2F3D A;  4AS4 A;  5I7I A;  2ZNT A;  4F1V A;  4NN3 A;  4P1L A;  3K1M A;  3CSB A;  3MP8 A;  5F1Q A;  2Q88 A;  2CEY A;  5I59 B;  3OOA A;  4TLL B;  4OVJ A;  2R6G E;  1LAF E;  2D5W A;  1EU8 A;  3TMG A;  1MQD A;  2UYF A;  1PDA A;  4JB7 A;  4JSO A;  2O6A A;  4RPO A;  2VHA A;  1ZKB A;  1XI6 A;  1O64 A;  3N6T A;  5A5X A;  4QFO A;  4KYS A;  1QJM A;  2Z22 A;  4IO4 A;  1SW4 A;  3P7I A;  4H8J A;  1LST A;  1IIW A;  4N6D A;  3WAF A;  2HZK A;  3IOT A;  5DYH A;  4OER A;  1MXX A;  4JBZ A;  3C31 A;  1MQI A;  4PFI A;  3TTL A;  3SKP A;  2XA5 A;  1ATG A;  2V25 A;  2DXR A;  4KCD A;  4NF6 B;  3RUM A;  3MVX A;  2XXI A;  1B5I A;  2V93 A;  4ZE9 A;  2AYS A;  2Y7R A;  2ZYM A;  4AB5 A;  1B0H A;  3OMB A;  4KQP A;  5ET7 A;  4GOT A;  3PD9 A;  1LBC A;  3G3K A;  3IOU A;  4NWD A;  2OLB A;  2RIN A;  5IZ3 A;  2Q9T A;  3KZG A;  4R6Y A;  4QSE A;  3KFM A;  2Q89 A;  4MH5 A;  4QHQ A;  1II5 A;  4BDQ A;  4OA4 A;  3K6W A;  3PV0 E;  4JVC A;  1B58 A;  1B2H A;  4F3S A;  5TP9 A;  4OXV A;  3S9N C;  4FBP A;  4NF5 A;  2AIX A;  5FTH A;  2F35 A;  3IK6 B;  4NE4 A;  4IY5 A;  4GWX A;  3TZA A;  1B6H A;  2F7B A;  2HFB A;  1FRP A;  4IO3 A;  1Q1K A;  4LQ5 A;  4EQ7 A;  4YMA A;  3MP1 A;  3QMF A;  3AXF A;  3KN8 A;  3S2V A;  4PE5 B;  4XFE A;  5KCJ B;  1XT8 A;  2XXU A;  3B6W A;  4N8Y A;  5DEX A;  3VLU A;  3JYR A;  3V83 A;  4O3B A;  1RYO A;  1FPK A;  1PBP A;  3MZ9 A;  1D9V A;  4N4U A;  3Q27 A;  3SEU A;  3G3H A;  4P0G A;  3RYD A;  2XXK A;  4R73 A;  4RNS A;  4ZEI A;  2OZZ A;  4G68 B;  4LZ8 A;  3CVG A;  1MXV A;  5DVI A;  4R9F A;  1BK4 A;  2H9B A;  1R6Z A;  4MNP A;  3W15 C;  4ZEB A;  1SPI A;  4KYE A;  1B4Z A;  1VFD A;  5EHM A;  2O7U A;  2DSF A;  4F3P A;  5I3S A;  4EXK A;  1LBX A;  2OWS A;  1NV5 A;  3KN3 A;  4N81 A;  2O68 A;  1B5H A;  3O66 A;  4IY6 A;  2HQ0 A;  4ELQ A;  1N3W A;  1IUD A;  3ZS6 A;  3VVF A;  1YCJ A;  4HE1 A;  1URS A;  4EXL A;  2BJI A;  2DVZ A;  4DE8 A;  3SEX A;  2HXW A;  3F11 A;  2B3B A;  2VT5 A;  4O94 A;  2QS1 A;  4X1B A;  4ESX A;  1JP4 A;  3C35 A;  4JSD A;  3GXA A;  2WYP A;  4THI A;  4U4S A;  5BUU A;  2QVR A;  3G3J A;  4P1E A;  2BJJ X;  3ODB A;  4ELO A;  2PX1 A;  1B5J A;  2RC8 A;  2QMX A;  4DDD A;  2XXY A;  3BKI B;  1LBZ A;  3K1P A;  1L5T A;  1FBG A;  3IOV A;  3MVZ A;  1F9B A;  1GR2 A;  3IFA A;  1USY H;  5TPA A;  4PCD A;  1FBC A;  3B7D A;  4OEN A;  1MDQ A;  3FZV A;  3T66 A;  1PC3 A;  4WED A;  3UA8 A;  1PB7 A;  3T1B A;  1IQ7 A;  2F8D A;  3FV1 A;  3IOR A;  3OEN A;  4I40 A;  3MYU A;  4ONY A;  5LTC A;  3U93 A;  3T9H B;  1I69 A;  4YB7 A;  1XVX A;  5FTI A;  4EQ9 A;  2O69 A;  4UA8 A;  1ZIU A;  3V8X B;  4GX4 A;  4FAJ A;  2XXP A;  3PPQ A;  1MM7 A;  3B6T A;  1QKB A;  1HSL A;  4IO7 A;  3T0J A;  5EQ7 A;  1J1N A;  4R75 A;  1LEV A;  5H8F B;  2XXV A;  3QXM A;  5AA4 B;  2DVC A;  5H8Q B;  5CMB A;  1P1W A;  4PC9 A;  4G68 C;  4NG7 A;  2P3V A;  1FQC A;  1WDN A;  3MJN A;  3VLW A;  1LCT A;  4BDN A;  1XOC A;  4KCC A;  2X7P A;  4KFQ A;  1JVY A;  4M1V A;  5IZ1 A;  1XVY A;  1UIU A;  2PCR A;  5H8H B;  5H8N B;  1T0K A;  2L5V A;  2XD3 A;  5ESY A;  5CC2 A;  5HBC A;  1IEJ A;  2FIE A;  3TPA A;  1NV0 A;  4AQ4 A;  3FVO A;  4R6H A;  1D9Y A;  1QUK A;  4NQ8 A;  1MY3 A;  1O63 A;  4HE2 A;  2XXQ A;  4DXU A;  5ITO A;  3H7M A;  5H8S A;  3OSR A;  2P0S A;  3TCF A;  3DLN A;  2Y7P A;  3Q25 A;  3UN6 A;  1MS7 A;  4PDD A;  1FPB A;  3H06 B;  1AL3 A;  1NNP A;  1N3X A;  1LB8 A;  4N17 A;  3QK6 A;  1VR5 A;  2B65 A;  2O1M A;  3MW0 A;  2F7C A;  3O6H A;  1P1Q A;  1P1U A;  4GD5 A;  4BDR A;  4GVO A;  4UAB A;  3RT6 B;  4PP0 A;  5I58 B;  1DSN A;  1NV4 A;  3TDJ A;  3MAM A;  4RK2 A;  1OQH A;  2FBP A;  2ALU A;  2I3V A;  5ELV A;  5FHN A;  1XHY A;  1LCF A;  3FVN A;  2ZYN A;  3CG1 A;  2PFZ A;  3GLB A;  4OMB A;  1JW4 A;  4N6K A;  1SDX A;  2GHA A;  4JWO A;  4YKK A;  4YAH X;  2E0S A;  3I3V A;  4NX1 A;  2QL3 A;  4POW A;  1FBH A;  1OVT A;  1FBE A;  3K01 A;  1Y9U A;  4H5G A;  1IMF A;  2DWA A;  4TOZ A;  1SI1 A;  3BFT A;  3CHG A;  2V4C A;  2VPN A;  4XTC Q;  1MXW A;  3RTW B;  2ZNU A;  4ELP A;  3TOD A;  2QJE A;  2ZZX A;  1TFA A;  3LV0 A;  2OK2 A;  2MKZ A;  5J1D A;  3T9X B;  4F19 A;  3K6V A;  2V84 A;  4Z0I A;  4PAI A;  1NL5 A;  3EHS A;  3FAS A;  3W9W A;  4G61 A;  3W9V A;  1BLF A;  4U2R A;  4DCX A;  1B0L A;  4I3E A;  2CMO A;  3HCQ A;  1URD A;  5LOM A;  1UQW A;  4LN5 A;  2ZZW A;  4U22 A;  4MX6 A;  1FQD A;  1FJ9 A;  3FIR A;  5M2V A;  3O6G A;  4TLM B;  4E0X A;  5FHO A;  4F3B A;  1CE2 A;  3CRB A;  3VVE A;  4JWY A;  4F18 A;  4RXL A;  4DLD A;  5I2N B;  5HPQ A;  4YKI A;  5CRY A;  3VE1 B;  4PFY A;  2F97 A;  2F6G A;  5F24 A;  5LDZ A;  3K4U A;  4U1Z A;  1NV7 A;  4R9G A;  4NF4 A;  3V5A A;  3FVG A;  2V3U A;  1B7U A;  3HO7 A;  1B51 A;  3MPL A;  2UVG A;  5DVF A;  3HFU A;  4HCY A;  4I3Y A;  3H6W A;  1NNT A;  3OD7 A;  3FJM A;  1Y3P A;  1CNQ A;  4HS7 A;  1MH3 A;  2NUV A;  2XWO A;  4I1D A;  1Y3Q A;  2F78 A;  2D3I A;  3HST A;  1JQF A;  1FPF A;  4QFL A;  4X8R A;  1N84 A;  1P99 A;  4NED A;  2QS4 A;  1I6B A;  4OWD A;  2CZK A;  1K9Z A;  4PAK A;  4XIG Q;  3OO9 A;  5AA2 D;  3MWB A;  3UOR A;  1MPD A;  4NWC A;  3KSJ A;  5A5X B;  1NV1 A;  4XKP A;  4OFJ A;  3M8U A;  3A29 A;  1HSJ A;  1DPE A;  3USD A;  4NAP A;  2GQ1 A;  3IFC A;  4ZEK A;  3ZKK A;  3N26 A;  1MQH A;  3EN3 A;  4HE0 A;  2ZZV A;  5I59 A;  1Z7N E;  4KHZ E;  4E0W A;  4X1D A;  4FIM A;  1FPG A;  1FQB A;  4H1X A;  3IO4 A;  1MY0 A;  3FV2 A;  3LUZ A;  4I8C A;  2M8C A;  1M5C A;  1IME A;  3IL1 B;  4N91 A;  3CI8 A;  3TCG A;  1JW5 A;  4RPN A;  2UXA A;  4GXA A;  4EQB A;  1MY2 A;  3B8B A;  3NOH A;  4POX A;  1N7X A;  2XX7 A;  4GXS B;  5IZ3 B;  2QRY A;  4KPT A;  4FAT A;  3RY3 A;  3VDF A;  1R9L A;  1N7W A;  1KWH A;  5K2Y A;  3GZG A;  5HM4 B;  3IOW A;  5I57 B;  4EUO A;  4LON B;  1ELJ A;  3UP9 A;  5TP9 B;  4XKQ A;  3GBB A;  4UAC A;  1A7L A;  3C33 A;  2HEU A;  4NF5 B;  5FBP A;  1MY4 A;  3IB0 A;  3SEY A;  4QFN A;  4DI4 B;  1D3K A;  1Q35 A;  4G2Z A;  5ET5 A;  2DE3 A;  5ISU A;  5IKB A;  1LGB C;  3TAJ A;  1MXU A;  2QFL A;  3B50 A;  3S9E A;  3PUW E;  1P1O A;  4QXD A;  1QVS A;  3EPE A;  4GBV A;  2JJK A;  4PFW A;  1Y3N A;  2XXW A;  1LAH E;  4IGT A;  2DQV A;  3CG3 A;  5DEX B;  4ZS9 A;  2WEF A;  3S4U A;  5DTB A;  1JNF A;  1NMU A;  1NNF A;  1OLA A;  3M3F A;  4AB6 A;  4C0R A;  3E13 X;  5KDT A;  3FXU A;  3MC2 A;  1H44 A;  3SEW A;  4ZED A;  3TKD A;  2I3W A;  3LUY A;  1AIV A;  3C36 A;  1JEV A;  3UK4 A;  4L17 A;  5I2K A;  2XX8 A;  1A55 A;  4YKJ A;  1A54 A;  2G93 A;  4ZZA A;  5AE4 A;  4NF8 A;  2REG A;  4Z7E A;  1AOV A;  3VXB A;  2ZNS A;  3SDF A;  3BBR A;  2DE2 A;  4QRZ A;  1B4H A;  1EYJ A;  4LZ5 A;  3S9L C;  4OHN A;  5ICT A;  3R26 A;  1B3H A;  1YXI A;  1MDP 1;  5TU0 A;  4PQJ A;  5CMM A;  4G77 A;  1FPI A;  4F29 A;  1M5D A;  4HW8 A;  5DT6 A;  4GWS A;  4O3C A;  3RPL A;  4R6K A;  3M3L A;  1NH8 A;  4YU0 A;  4PBH A;  1MRP A;  1DMB A;  4DXB A;  1NUX A;  1MXY A;  1N0T A;  3QIM A;  3H6V A;  1IXH A;  3TTK A;  3PD8 A;  5TPA B;  3WAE A;  2XX9 A;  2F3B A;  4JWX A;  1N76 A;  1US4 A;  1DBZ A;  3T22 A;  3PMX A;  3L6H A;  5CMC A;  5CBS A;  3TTM A;  3PPR A;  4ZZE A;  2F36 A;  2ZMB A;  4PE3 A;  3O97 A;  2RF1 A;  4GQO A;  2DWJ A;  1B1H A;  3U72 A;  3RPW A;  2PYY A;  1URG A;  4LZ7 A;  2RCB A;  1NH7 A;  2B3F A;  2FA7 A;  1B7H A;  4F1U A;  3PPP A;  2I58 A;  3MUQ A;  2FVZ A;  4KI0 E;  3O9P A;  4NTL A;  1B46 A;  1B1X A;  3JV9 A;  4HTG A;  1SW5 A;  3MZB A;  3FBP A;  4EF2 A;  4H65 A;  1H45 A;  3IO6 A;  5CMK A;  3MZ1 A;  1FBD A;  1EH3 A;  3C34 A;  2GHB A;  4MNC A;  2ABH A;  2QVV A;  3MQ9 A;  3Q28 A;  4LAT A;  3SER A;  4I9D A;  3K6U A;  4WEP A;  4IO2 A;  4MMP A;  1POT A;  4IR8 A;  3UIF A;  3L6G A;  1IXG A;  2I0C A;  3U8Q A;  2B4M A;  2X7Q A;  1FJ6 A;  3KGC A;  1FTO A;  1VDW A;  4QSD A;  2I4C A;  1LB9 A;  4GWW A;  1Y1Z A;  1MM6 A;  1LFG A;  1G0H A;  1MH4 A;  3OSQ A;  1SQY A;  1IXC A;  2XWV A;  3TCH A;  3FXQ A;  1FPL A;  1NV6 A;  5I56 B;  4F1Y A;  4OES A;  3RGY A;  5AA4 A;  3PTY A;  1GVC A;  3OO7 A;  2ONK E;  1UTB B;  4QFP A;  5EYG A;  2P1S A;  2NWJ A;  4OEU A;  1FSA A;  3OO8 A;  2ONS A;  1LBB A;  4OVT A;  1BTJ A;  2DWI A;  1NI9 A;  3O29 A;  5H8H A;  3SEV A;  1HSE A;  5FHM A;  4R2F A;  2F7A A;  5AA3 A;  1B40 A;  3K00 A;  1NV2 A;  3FVK A;  3IB1 A;  3LSW A;  2Y7W A;  3KBR A;  4FE8 A;  3CFZ A;  4P0I A;  4RK9 A;  4GX6 A;  3DP6 A;  2Z8F A;  3DP4 A;  2F5X A;  2AL5 A;  1EZP A;  1BIY A;  3LSL A;  5DW8 A;  1Y4T A;  3SET A;  3TFL A;  4XXU A;  1UTH A;  4H45 A;  3VFJ A;  3G3F A;  1ZLQ A;  4MHF A;  3T9V A;  4ND9 A;  4XKR A;  3VLV A;  2HZL A;  4ELR A;  3LC8 A;  4FOR A;  5EQ9 A;  4DI3 D;  3PMV A;  2O51 A;  4C1T A;  4H46 A;  1B05 A;  3VVD A;  2THI A;  3FXB A;  1TT1 A;  3MVW A;  4F2Q A;  2OWT A;  3OXN A;  1UIV A;  5J16 A;  4Q0C A;  3IAZ A;  1QKA A;  4P47 A;  3HHG A;  2HHM A;  1YZ0 A;  3FGS A;  4O7M A;  3FUZ A;  4FEB A;  4GIZ A;  1NUZ A;  3MST A;  4MFI A;  1TWY A;  1ZTY A;  2P3N A;  4Q8R A;  3IR1 A;  3C9H A;  3H6U A;  1SW2 A;  4MAG A;  1POY 1;  2DE4 A;  3LBS A;  2DXY A;  1JVX A;  2QPQ A;  4R2B A;  1WOD A;  1ZMG A;  1SVX B;  3ILU B;  1YPN A;  2Y84 A;  5EHS A;  2H98 A;  2HPG A;  1P1N A;  1VE4 A;  1LAX A;  4LUB A;  4PGN A;  3DEL B;  4LP2 B;  4OFL A;  2XD2 A;  2NXO A;  1US5 A;  2KQZ A;  4MEV A;  1RDX A;  1Z7M E;  2H4I A;  3A3C A;  3TYH A;  1FPE A;  3V89 B;  1LBY A;  1D9Q A;  2WBD A;  3IB2 A;  4JVI A;  4NGU A;  1FPD A;  2CZH A;  1LBW A;  1S9T A;  2VPO A;  4LA9 A;  1ZBM A;  4K3F A;  1NV3 A;  4YKP A;  1FQA A;  3KC1 A;  4KXP A;  2QVU A;  3T9U A;  2OJT A;  2GFE A;  4G8M A;  4LQ2 A;  1SBP A;  4NF4 B;  1VFE A;  1OQG A;  2CZI A;  2V3Q A;  2V3T A;  4PFT A;  4YIC A;  4GWZ A;  2Z8D A;  2Y7I A;  3PUV E;  2FHY A;  4XF5 A;  3RT8 A;  1O7T A;  1PBQ A;  5IGA A;  1I6A A;  4P56 A;  1GV8 A;  4OVR A;  2DOJ A;  1XC1 A;  4YMB A;  2RC7 A;  3KEI A;  3PGF A;  1GTK A;  2WX9 A;  3LSF B;  4O8M A;  1M5E A;  3QYT A;  4OVQ A;  5JTY A;  3O2A A;  4IGR A;  4KR5 A;  3TUS A;  3SES A;  3CFL A;  1A8F A;  4FEC A;  4OFO A;  4ECF A;  3R7X A;  1AWB A;  5AA2 A;  4R74 A;  3BIG A;  5K2X A;  1RYX A;  5AA1 A;  2KLF A;  2VOZ A;  1K9Y A;  4GX3 A;  3ONM A;  1YTV A;  1FTA A;  3M3K A;  1FPJ A;  3KG2 A;  4AS5 A;  1AMF A;  1QUJ A;  2NOO A;  3QAX A;  2RC9 A;  2HCA A;  4BDO A;  4ZEC A;  1H3D A;  2O1L A;  1ANF A;  3OEM A;  2FYI A;  3U1O A;  2RKM A;  4YZZ A;  1JW1 A;  2Z23 A;  4F2O A;  1IXI A;  2CZL A;  3IJO B;  4DZ1 A;  2A5T A;  1AH5 A;  1NNK A;  3HHF A;  4C1U A;  3MBP A;  4QFK A;  2WYK A;  2Q8M A;  4NMY A;  1DOT A;  4ZDM A;  3RNN A;  4IB2 A;  3K2D A;  1PB9 A;  1Y4C A;  2O84 X;  4MCO A;  2XXR A;  3GBA A;  4XKN A;  5A5L A;  4R72 A;  1ZU0 A;  4GWY A;  2I49 A;  2PMS A;  3KN7 A;  1QW0 A;  5B70 A;  1TFD A;  3B6Q A;  5L8D A;  3PPO A;  1A99 A;  3EHT A;  1TXF A;  3Q26 A;  4MBP A;  3RN8 A;  3PMW A;  2Q74 A;  2VD3 A;  4OYV A;  1S50 A;  3JZJ A;  2I48 A;  4GF8 A;  5ET6 A;  4P8B A;  4NF6 A;  1NUY A;  2HAV A;  4F39 A;  4F3G A;  4LVQ A;  4TQU Q;  3S9M C;  3EHU A;  2Q2C A;  5CM6 A;  3QUF A;  3D4C A;  4MJO A;  3FD3 A;  1OVB A;  4FED A;  4HXV A;  4ISU A;  3I5O A;  5DVJ A;  2I6E A;  2W7Y A;  4G4P A;  2QMW A;  1WVJ A;  1R9Q A;  5I57 A;  2VD2 A;  4MIJ A;  5EQ8 A;  1LAG E;  2I4B A;  3CFX A;  4P3L A;  2ONR A;  4RYA A;  4DXC A;  4KD5 A;  5KDT B;  2Q8J A;  1KA0 A;  3ZSF A;  4GRK A;  1INP A;  4OEV A;  3DM0 A;  4HCW A;  3FJ7 A;  1DTZ A;  4JDF A;  5I84 A;  2OX3 A;  1FW0 A;  2XWI A;  5I2K B;  4U21 A;  4BDM A;  4P9K A;  3ILT B;  4PF8 A;  4KYD A;  1XS5 A;  2FIX A;  2DDK A;  4DIG A;  4NF8 B;  1USY E;  4GLI A;  3IX1 A;  4OTE A;  5KCJ A;  3D1R A;  2QS3 A;  3O28 A;  1JET A;  1OLC A;  5T3J A;  3QSL A;  1A40 A;  4PBQ A;  3U92 A;  4OVS A;  4RJZ A;  3KJ7 A;  1FTL A;  4EF1 A;  2UVI A;  1B3F A;  1B32 A;  2Y5K A;  1LBV A;  2XWK A;  4G68 A;  2ZXT A;  3G3I A;  4N07 A;  3VXC A;  3RPL B;  3E78 A;  2OCU A;  3E79 A;  1FTM A;  5CBR A;  2QS2 A;  3U94 A;  5EYH A;  3BIH A;  4X9T A;  2Y7K A;  2UYE A;  5JEI A;  3EF7 A;  2D21 A;  4P11 A;  4PFU A;  3SZP A;  3FAT A;  1D4N A;  2GH9 A;  3FXR A;  3KSX A;  2R9J A;  1B9J A;  1IMD A;  4BLA A;  1DCU A;  4WKM A;  2E1S A;  1Y20 A;  2OWZ A;  3CIJ A;  4NHB A;  4MLV A;  2PFY A;  1A8E A;  1N04 A;  3MP6 A;  3K02 A;  3K6X A;  5ITP A;  2NVU B;  4GWU A;  1M5F A;  4GL8 A;  2X26 A;  4U1O A;  1MPB A;  3HPI A;  2FNC A;  3TQW A;  1NFT A;  2DS9 A;  3H3G A;  1H76 A;  2R8T A;  3DP8 A;  4OAN A;  2H25 A;  3H4Z A;  5L9S A;  5IAI A;  2XHD A;  1OMP A;  1MPC A;  4H6D A;  2WKY A;  3TTN A;  5IZZ A;  4PF6 A;  1MQJ A;  1MY1 A;  2DYX A;  4MF3 A;  3FJG A;  5BWJ A;  2DWH A;  4ESW A;  4N13 A;  2R71 A;  3PU5 A;  1H43 A;  2UVH A;  5JK4 A;  2ZYO A;  4DCY A;  2PT2 A;  1PB8 A;  4N6P A;  1VSO A;  4OZ9 A;  1IMA A;  2IA4 A;  1NUW A;  2ANJ A;  1DTG A;  1B3G A;  3T93 B;  3ZKL A;  4PAF A;  1B7Z A;  1PEB A;  4RA1 A;  1FQE A;  3TTR A;  3C4M A;  2PT1 A;  2VP1 A;  5EYF A;  5H8F A;  1FQF A;  1BP5 A;  3T96 B;  2Q2A A;  4YB5 A;  5H8Q A;  2AL4 A;  1R1N A;  4XEQ A;  3K1N A;  4RY1 A;  5L9M A;  2YJP A;  4OET A;  1NKX A;  3TQL A;  1YAE A;  1EZ9 A;  4YB6 A;  3EQ1 A;  4PFB A;  2A5S A;  1GGG A;  1RDZ A;  3I6V A;  4PGP A;  4U4X A;  2OBG A;  1KZ8 A;  5H8N A;  4N8G A;  3UGW A;  3OEL A;  5I56 A;  2Z8E A;  4Q5T A;  3VV5 A;  3N5L A;  1RDY A;  3N94 A;  1B3E A;  1QUL A;  1UTB A;  3PUZ E;  2YPN A;  4GL0 A;  1DK4 A;  1EYK A;  1QGX A;  4GFR A;  1G0I A;  1UTH B;  2PVU A;  1IZ1 A;  1FCK A;  1Y1M A;  4H5F A;  4IO5 A;  4MLQ A;  1FBF A;  3LR1 A;  1DPP A;  3O6I A;  1LFH A;  3H6T A;  2VGQ A;  2ZYK A;  5ET8 A;  2REJ A;  1Q9D A;  3A3U A;  3IJX B;  4FJP A;  3E4R A;  3G3G A;  1IIT A;  3H03 A;  1MG1 A;  4U23 A;  2GRV A;  5I58 A;  1MQG A;  5I5P A;  1CB6 A;  1EZO A;  4WXJ A;  3RQT A;  3N6U A;  4G8N A;  3PUY E;  3C32 A;  5L9O A;  3ECR A;  3D4G A;  4QF9 A;  1SYH A;  3E9X A;  4I62 A;  4MNI A;  4PFR A;  4G8H A;  4O7I A;  3ROJ A;  4H0W A;  3KOT A;  2H5Y A;  1IMB A; 
#chains in the Genus database with same CATH homology
 2LAO A;  3CSG A;  4M4G A;  3OO6 A;  4ZE8 A;  4ZEF A;  1B52 A;  3R6U A;  1M5B A;  1ZJL A;  2QSX A;  4F31 B;  2DP8 A;  2HAU A;  1I6Q A;  3MPK A;  3G7W A;  3OEK A;  2UVJ A;  4GWO A;  4O3A A;  3Q29 A;  2G29 A;  2IEE A;  3QUJ A;  1FTK A;  1MXZ A;  2RCA A;  3HV1 A;  3PPN A;  3LSX A;  3HN0 A;  4PET A;  1BKA A;  3A09 A;  4BDL A;  3KOS A;  4X48 A;  2H99 A;  3RLF E;  1SYI A;  5JTY B;  4H67 A;  4IO6 A;  3BFU A;  1SD3 A;  3PUX E;  5I2N A;  2XXH A;  3K0V A;  1OIB A;  3E3K A;  5KZT A;  3RTF B;  2PBW A;  4F22 A;  5AA2 B;  3KJT A;  3TEP A;  4H8I A;  2I0B A;  5ICQ A;  1SI0 A;  1FTJ A;  1JEU A;  3THI A;  1RKM A;  1B3L A;  2F34 A;  2O7I A;  4JXI A;  5F7V A;  1S7Y A;  4QSC A;  1LFI A;  1LLS A;  2F6P A;  4Q30 B;  5CI5 A;  5B7D A;  2XXX A;  4OQO A;  2P2A A;  2ESN A;  1SW1 A;  3TEL A;  1QUI A;  3MVY A;  2YLN A;  4EDP A;  2XXT A;  3CR9 A;  2A5T B;  2ZNT A;  4F1V A;  3K1M A;  3CSB A;  3MP8 A;  5F1Q A;  2Q88 A;  5I59 B;  3OOA A;  4TLL B;  4OVJ A;  2R6G E;  1LAF E;  2D5W A;  1EU8 A;  3TMG A;  1MQD A;  2UYF A;  1PDA A;  4JB7 A;  4JSO A;  2O6A A;  4RPO A;  2VHA A;  1ZKB A;  1O64 A;  3N6T A;  5A5X A;  4QFO A;  4KYS A;  1QJM A;  2Z22 A;  4IO4 A;  1SW4 A;  3P7I A;  4H8J A;  1LST A;  1IIW A;  3WAF A;  2HZK A;  3IOT A;  5DYH A;  4OER A;  1MXX A;  4JBZ A;  3C31 A;  1MQI A;  3TTL A;  3SKP A;  1ATG A;  2V25 A;  2DXR A;  4KCD A;  4NF6 B;  3RUM A;  3MVX A;  2XXI A;  1B5I A;  2V93 A;  4ZE9 A;  2AYS A;  2Y7R A;  2ZYM A;  4AB5 A;  1B0H A;  3OMB A;  4KQP A;  4GOT A;  3PD9 A;  1LBC A;  3G3K A;  3IOU A;  4NWD A;  2OLB A;  2RIN A;  2Q9T A;  3KZG A;  4R6Y A;  4QSE A;  3KFM A;  2Q89 A;  4MH5 A;  4QHQ A;  1II5 A;  4BDQ A;  3K6W A;  3PV0 E;  1B58 A;  1B2H A;  4F3S A;  5TP9 A;  4OXV A;  3S9N C;  4NF5 A;  2AIX A;  5FTH A;  2F35 A;  3IK6 B;  4NE4 A;  4IY5 A;  3TZA A;  1B6H A;  2F7B A;  2HFB A;  4IO3 A;  1Q1K A;  4LQ5 A;  4EQ7 A;  4YMA A;  3MP1 A;  3AXF A;  3KN8 A;  3S2V A;  4PE5 B;  5KCJ B;  1XT8 A;  2XXU A;  3B6W A;  5DEX A;  3VLU A;  3JYR A;  3V83 A;  4O3B A;  1RYO A;  3MZ9 A;  1PBP A;  1D9V A;  3Q27 A;  3SEU A;  3G3H A;  4P0G A;  4R73 A;  4RNS A;  4ZEI A;  2OZZ A;  4G68 B;  4LZ8 A;  3CVG A;  1MXV A;  5DVI A;  4R9F A;  2H9B A;  1R6Z A;  3W15 C;  4ZEB A;  4KYE A;  1B4Z A;  1VFD A;  5EHM A;  2O7U A;  2DSF A;  4F3P A;  4EXK A;  2OWS A;  3KN3 A;  2O68 A;  1B5H A;  3O66 A;  4IY6 A;  4ELQ A;  2HQ0 A;  1N3W A;  1IUD A;  3ZS6 A;  3VVF A;  1YCJ A;  1URS A;  4EXL A;  2DVZ A;  4DE8 A;  3SEX A;  2HXW A;  3F11 A;  2B3B A;  2QS1 A;  4X1B A;  4ESX A;  3C35 A;  4JSD A;  3GXA A;  4THI A;  4U4S A;  5BUU A;  3G3J A;  2BJJ X;  3ODB A;  4ELO A;  2PX1 A;  1B5J A;  2RC8 A;  2QMX A;  4DDD A;  2XXY A;  3BKI B;  3K1P A;  1L5T A;  3IOV A;  3MVZ A;  1F9B A;  1GR2 A;  1USY H;  5TPA A;  3B7D A;  4OEN A;  1MDQ A;  3FZV A;  3T66 A;  1PC3 A;  4WED A;  3UA8 A;  1PB7 A;  1IQ7 A;  2F8D A;  3FV1 A;  3IOR A;  3OEN A;  4ONY A;  3U93 A;  3T9H B;  1I69 A;  4YB7 A;  1XVX A;  5FTI A;  4EQ9 A;  2O69 A;  4UA8 A;  1ZIU A;  3V8X B;  4FAJ A;  2XXP A;  3PPQ A;  1MM7 A;  3B6T A;  1QKB A;  1HSL A;  4IO7 A;  1J1N A;  4R75 A;  5H8F B;  2XXV A;  3QXM A;  5AA4 B;  2DVC A;  5H8Q B;  5CMB A;  1P1W A;  4G68 C;  1FQC A;  1WDN A;  3MJN A;  3VLW A;  1LCT A;  4BDN A;  1XOC A;  4KCC A;  2X7P A;  4KFQ A;  1JVY A;  4M1V A;  1XVY A;  1UIU A;  5H8H B;  5H8N B;  1T0K A;  2XD3 A;  5CC2 A;  5HBC A;  1IEJ A;  3TPA A;  4AQ4 A;  3FVO A;  4R6H A;  1D9Y A;  1QUK A;  1MY3 A;  1O63 A;  2XXQ A;  4DXU A;  5ITO A;  3H7M A;  5H8S A;  3OSR A;  2P0S A;  3TCF A;  3DLN A;  2Y7P A;  3Q25 A;  3UN6 A;  1MS7 A;  3H06 B;  1AL3 A;  1NNP A;  1N3X A;  1LB8 A;  3QK6 A;  1VR5 A;  2B65 A;  2O1M A;  3MW0 A;  2F7C A;  3O6H A;  1P1Q A;  1P1U A;  4GD5 A;  4BDR A;  4GVO A;  5I58 B;  3RT6 B;  4PP0 A;  1DSN A;  3TDJ A;  3MAM A;  4RK2 A;  1OQH A;  2ALU A;  2I3V A;  5ELV A;  5FHN A;  1XHY A;  1LCF A;  3FVN A;  2ZYN A;  3CG1 A;  3GLB A;  4OMB A;  1JW4 A;  1SDX A;  2GHA A;  4JWO A;  4YKK A;  4YAH X;  2E0S A;  3I3V A;  2QL3 A;  4POW A;  1OVT A;  3K01 A;  1Y9U A;  4H5G A;  2DWA A;  4TOZ A;  1SI1 A;  3BFT A;  4XTC Q;  1MXW A;  3RTW B;  2ZNU A;  4ELP A;  3TOD A;  2QJE A;  1TFA A;  2OK2 A;  5J1D A;  3T9X B;  4F19 A;  3K6V A;  2V84 A;  4Z0I A;  1NL5 A;  3EHS A;  3FAS A;  3W9W A;  3W9V A;  1BLF A;  4U2R A;  4DCX A;  1B0L A;  2CMO A;  3HCQ A;  1URD A;  5LOM A;  1UQW A;  4U22 A;  1FQD A;  3FIR A;  5M2V A;  3O6G A;  4TLM B;  4E0X A;  5FHO A;  4F3B A;  1CE2 A;  3CRB A;  3VVE A;  4JWY A;  4F18 A;  4RXL A;  4DLD A;  5I2N B;  5HPQ A;  4YKI A;  5CRY A;  3VE1 B;  4PFY A;  2F97 A;  2F6G A;  3K4U A;  4U1Z A;  4R9G A;  4NF4 A;  3V5A A;  3FVG A;  2V3U A;  1B7U A;  3HO7 A;  1B51 A;  3MPL A;  2UVG A;  5DVF A;  4HCY A;  3H6W A;  1NNT A;  3OD7 A;  3FJM A;  1Y3P A;  4HS7 A;  1MH3 A;  2NUV A;  4I1D A;  1Y3Q A;  2F78 A;  2D3I A;  3HST A;  1JQF A;  4QFL A;  1N84 A;  1P99 A;  4NED A;  2QS4 A;  1I6B A;  4OWD A;  4XIG Q;  3OO9 A;  5AA2 D;  3MWB A;  3UOR A;  1MPD A;  4NWC A;  3KSJ A;  5A5X B;  4XKP A;  4OFJ A;  3M8U A;  1HSJ A;  1DPE A;  3USD A;  4ZEK A;  3ZKK A;  3N26 A;  1MQH A;  3EN3 A;  5I59 A;  1Z7N E;  4KHZ E;  4E0W A;  4X1D A;  4FIM A;  1FQB A;  4H1X A;  3IO4 A;  1MY0 A;  3FV2 A;  4I8C A;  2M8C A;  1M5C A;  3IL1 B;  3CI8 A;  3TCG A;  1JW5 A;  4RPN A;  2UXA A;  4GXA A;  4EQB A;  1MY2 A;  4POX A;  1N7X A;  2XX7 A;  4GXS B;  2QRY A;  4KPT A;  4FAT A;  3RY3 A;  3VDF A;  1R9L A;  1N7W A;  1KWH A;  5K2Y A;  3GZG A;  5HM4 B;  3IOW A;  5I57 B;  4EUO A;  4LON B;  1ELJ A;  3UP9 A;  5TP9 B;  4XKQ A;  3GBB A;  4UAC A;  1A7L A;  3C33 A;  2HEU A;  4NF5 B;  1MY4 A;  3IB0 A;  3SEY A;  4QFN A;  1D3K A;  1Q35 A;  4G2Z A;  2DE3 A;  5ISU A;  5IKB A;  1LGB C;  3TAJ A;  1MXU A;  3S9E A;  3PUW E;  1P1O A;  1QVS A;  3EPE A;  4PFW A;  1Y3N A;  2XXW A;  1LAH E;  4IGT A;  2DQV A;  3CG3 A;  5DEX B;  4ZS9 A;  3S4U A;  5DTB A;  1JNF A;  1NMU A;  1NNF A;  1OLA A;  3M3F A;  4AB6 A;  4C0R A;  3E13 X;  5KDT A;  3FXU A;  3MC2 A;  1H44 A;  3SEW A;  4ZED A;  3TKD A;  2I3W A;  3LUY A;  1AIV A;  3C36 A;  1JEV A;  3UK4 A;  4L17 A;  5I2K A;  2XX8 A;  1A55 A;  4YKJ A;  1A54 A;  2G93 A;  4ZZA A;  5AE4 A;  4NF8 A;  2REG A;  4Z7E A;  1AOV A;  3VXB A;  2ZNS A;  3SDF A;  3BBR A;  2DE2 A;  4QRZ A;  1B4H A;  4LZ5 A;  3S9L C;  4OHN A;  5ICT A;  3R26 A;  1B3H A;  1MDP 1;  5TU0 A;  4PQJ A;  5CMM A;  4G77 A;  4F29 A;  1M5D A;  4HW8 A;  5DT6 A;  4O3C A;  4R6K A;  3M3L A;  1NH8 A;  4YU0 A;  1MRP A;  1DMB A;  4DXB A;  1MXY A;  1N0T A;  3QIM A;  3H6V A;  1IXH A;  3TTK A;  3PD8 A;  5TPA B;  3WAE A;  2XX9 A;  4JWX A;  1N76 A;  1US4 A;  3T22 A;  3PMX A;  3L6H A;  5CMC A;  5CBS A;  3TTM A;  3PPR A;  4ZZE A;  2F36 A;  2ZMB A;  3O97 A;  2RF1 A;  4GQO A;  2DWJ A;  1B1H A;  3U72 A;  3RPW A;  2PYY A;  1URG A;  4LZ7 A;  2RCB A;  1NH7 A;  2B3F A;  2FA7 A;  1B7H A;  4F1U A;  3PPP A;  2I58 A;  3MUQ A;  4KI0 E;  3O9P A;  4NTL A;  1B46 A;  1B1X A;  3JV9 A;  4HTG A;  1SW5 A;  3MZB A;  4EF2 A;  4H65 A;  1H45 A;  3IO6 A;  5CMK A;  3MZ1 A;  1EH3 A;  3C34 A;  2GHB A;  2ABH A;  3MQ9 A;  3Q28 A;  4LAT A;  3SER A;  4I9D A;  3K6U A;  4WEP A;  4IO2 A;  1POT A;  3UIF A;  3L6G A;  1IXG A;  2I0C A;  3U8Q A;  2X7Q A;  3KGC A;  1FTO A;  4QSD A;  2I4C A;  1LB9 A;  1Y1Z A;  1MM6 A;  1LFG A;  1MH4 A;  3OSQ A;  1SQY A;  1IXC A;  3TCH A;  3FXQ A;  5I56 B;  4F1Y A;  4OES A;  3RGY A;  5AA4 A;  1GVC A;  3OO7 A;  2ONK E;  1UTB B;  4QFP A;  2P1S A;  2NWJ A;  4OEU A;  3OO8 A;  2ONS A;  1LBB A;  1BTJ A;  2DWI A;  3O29 A;  5H8H A;  3SEV A;  1HSE A;  5FHM A;  4R2F A;  2F7A A;  5AA3 A;  1B40 A;  3K00 A;  3FVK A;  3IB1 A;  3LSW A;  2Y7W A;  3KBR A;  4FE8 A;  3CFZ A;  4P0I A;  4RK9 A;  3DP6 A;  2Z8F A;  3DP4 A;  2F5X A;  2AL5 A;  1EZP A;  1BIY A;  3LSL A;  1Y4T A;  3SET A;  3TFL A;  4XXU A;  1UTH A;  3VFJ A;  3G3F A;  1ZLQ A;  3T9V A;  4ND9 A;  4XKR A;  3VLV A;  2HZL A;  4ELR A;  3LC8 A;  4FOR A;  3PMV A;  2O51 A;  4C1T A;  1B05 A;  3VVD A;  2THI A;  1TT1 A;  3MVW A;  4F2Q A;  2OWT A;  3OXN A;  1UIV A;  4Q0C A;  3IAZ A;  1QKA A;  3HHG A;  3FGS A;  3FUZ A;  4FEB A;  4GIZ A;  4MFI A;  1TWY A;  1ZTY A;  4Q8R A;  3IR1 A;  3C9H A;  3H6U A;  1SW2 A;  1POY 1;  2DE4 A;  3LBS A;  2DXY A;  1JVX A;  2QPQ A;  4R2B A;  1WOD A;  1ZMG A;  1SVX B;  3ILU B;  1YPN A;  2Y84 A;  5EHS A;  2H98 A;  1P1N A;  1VE4 A;  1LAX A;  4LUB A;  3DEL B;  4LP2 B;  4OFL A;  2XD2 A;  2NXO A;  1US5 A;  1Z7M E;  2H4I A;  3A3C A;  3TYH A;  3V89 B;  3IB2 A;  1S9T A;  4LA9 A;  1ZBM A;  4K3F A;  4YKP A;  1FQA A;  3T9U A;  2OJT A;  2GFE A;  4G8M A;  4LQ2 A;  1SBP A;  4NF4 B;  1VFE A;  1OQG A;  4PFT A;  2V3Q A;  2V3T A;  4YIC A;  2Z8D A;  2Y7I A;  3PUV E;  3RT8 A;  1O7T A;  1PBQ A;  1I6A A;  1GV8 A;  2DOJ A;  1XC1 A;  4YMB A;  2RC7 A;  3KEI A;  3PGF A;  1GTK A;  3LSF B;  1M5E A;  3QYT A;  5JTY A;  3O2A A;  4IGR A;  4KR5 A;  3TUS A;  3SES A;  3CFL A;  1A8F A;  4FEC A;  4OFO A;  4ECF A;  3R7X A;  5AA2 A;  4R74 A;  5K2X A;  1RYX A;  5AA1 A;  2KLF A;  2VOZ A;  3ONM A;  1YTV A;  3M3K A;  3KG2 A;  1AMF A;  1QUJ A;  2NOO A;  3QAX A;  2RC9 A;  2HCA A;  4BDO A;  4ZEC A;  1H3D A;  2O1L A;  1ANF A;  3OEM A;  2FYI A;  3U1O A;  2RKM A;  4YZZ A;  1JW1 A;  2Z23 A;  4F2O A;  1IXI A;  2CZL A;  3IJO B;  4DZ1 A;  2A5T A;  1AH5 A;  1NNK A;  3HHF A;  4C1U A;  3MBP A;  4QFK A;  4NMY A;  1DOT A;  4ZDM A;  3RNN A;  4IB2 A;  3K2D A;  1PB9 A;  1Y4C A;  2O84 X;  2XXR A;  3GBA A;  4XKN A;  4R72 A;  1ZU0 A;  2I49 A;  2PMS A;  3KN7 A;  1QW0 A;  5B70 A;  1TFD A;  3B6Q A;  5L8D A;  3PPO A;  1A99 A;  3EHT A;  1TXF A;  3Q26 A;  4MBP A;  3RN8 A;  3PMW A;  2VD3 A;  4OYV A;  1S50 A;  3JZJ A;  2I48 A;  4GF8 A;  4NF6 A;  2HAV A;  4F39 A;  4F3G A;  4LVQ A;  4TQU Q;  3S9M C;  3EHU A;  2Q2C A;  5CM6 A;  3QUF A;  3D4C A;  3FD3 A;  1OVB A;  4FED A;  4ISU A;  3I5O A;  5DVJ A;  2I6E A;  2W7Y A;  4G4P A;  2QMW A;  1WVJ A;  1R9Q A;  5I57 A;  2VD2 A;  1LAG E;  2I4B A;  3CFX A;  2ONR A;  4RYA A;  4DXC A;  4KD5 A;  5KDT B;  2Q8J A;  3ZSF A;  4GRK A;  4OEV A;  3DM0 A;  4HCW A;  3FJ7 A;  1DTZ A;  4JDF A;  5I84 A;  1FW0 A;  5I2K B;  4U21 A;  4BDM A;  3ILT B;  4KYD A;  1XS5 A;  4DIG A;  4NF8 B;  1USY E;  4GLI A;  3IX1 A;  4OTE A;  5KCJ A;  2QS3 A;  3O28 A;  1JET A;  1OLC A;  3QSL A;  1A40 A;  3U92 A;  4RJZ A;  3KJ7 A;  1FTL A;  4EF1 A;  2UVI A;  1B3F A;  1B32 A;  4G68 A;  2ZXT A;  3G3I A;  4N07 A;  3VXC A;  2OCU A;  1FTM A;  5CBR A;  2QS2 A;  3U94 A;  4X9T A;  2Y7K A;  2UYE A;  5JEI A;  3EF7 A;  2D21 A;  4P11 A;  4PFU A;  3FAT A;  1D4N A;  2GH9 A;  3FXR A;  3KSX A;  2R9J A;  1B9J A;  4BLA A;  4WKM A;  2E1S A;  1Y20 A;  3CIJ A;  4MLV A;  1A8E A;  1N04 A;  3MP6 A;  3K02 A;  3K6X A;  5ITP A;  2NVU B;  1M5F A;  4GL8 A;  2X26 A;  4U1O A;  1MPB A;  3HPI A;  2FNC A;  3TQW A;  1NFT A;  2DS9 A;  3H3G A;  1H76 A;  3DP8 A;  2H25 A;  3H4Z A;  5L9S A;  5IAI A;  2XHD A;  1OMP A;  1MPC A;  4H6D A;  2WKY A;  3TTN A;  1MQJ A;  1MY1 A;  2DYX A;  4MF3 A;  3FJG A;  5BWJ A;  2DWH A;  4ESW A;  4N13 A;  2R71 A;  3PU5 A;  1H43 A;  2UVH A;  5JK4 A;  2ZYO A;  4DCY A;  2PT2 A;  1PB8 A;  4N6P A;  1VSO A;  4OZ9 A;  2IA4 A;  2ANJ A;  1DTG A;  1B3G A;  3T93 B;  3ZKL A;  1B7Z A;  1PEB A;  4RA1 A;  1FQE A;  3TTR A;  3C4M A;  2PT1 A;  2VP1 A;  5EYF A;  5H8F A;  1FQF A;  1BP5 A;  3T96 B;  2Q2A A;  4YB5 A;  5H8Q A;  2AL4 A;  1R1N A;  3K1N A;  4RY1 A;  5L9M A;  2YJP A;  4OET A;  1NKX A;  3TQL A;  1YAE A;  1EZ9 A;  4YB6 A;  3EQ1 A;  2A5S A;  1GGG A;  3I6V A;  4U4X A;  2OBG A;  5H8N A;  3UGW A;  3OEL A;  5I56 A;  2Z8E A;  4Q5T A;  3VV5 A;  3N5L A;  3N94 A;  1B3E A;  1QUL A;  1UTB A;  3PUZ E;  2YPN A;  4GL0 A;  4GFR A;  1UTH B;  2PVU A;  1IZ1 A;  1FCK A;  1Y1M A;  4H5F A;  4IO5 A;  4MLQ A;  3LR1 A;  1DPP A;  3O6I A;  1LFH A;  3H6T A;  2VGQ A;  2ZYK A;  2REJ A;  3A3U A;  3IJX B;  4FJP A;  3E4R A;  3G3G A;  1IIT A;  3H03 A;  1MG1 A;  4U23 A;  2GRV A;  5I58 A;  1MQG A;  1CB6 A;  1EZO A;  4WXJ A;  3RQT A;  3N6U A;  4G8N A;  3PUY E;  3C32 A;  5L9O A;  3ECR A;  3D4G A;  4QF9 A;  1SYH A;  3E9X A;  4I62 A;  4G8H A;  4H0W A;  3KOT A;  2H5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...