2X83A

Evolutionary basis of hiv restriction by the antiretroviral trimcyp
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID
publication title Conformational adaptation of Asian macaque TRIMCyp directs lineage specific antiviral activity.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 49
structure length 146
sequence length 146
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2x83A00
1M9XC 4NX4C 5HGMA 4PH2A 4U0AA 2M8PA 2LF4A 4XFYA 1GWPA 2XGUA 1E6JP 4U0BA 4PH3A 1EIAA 4U0EA 4U0DA 3MGEA 2WLVA 1EM9A 1M9CC 4XROA 4LQWC 2WLVB 3P05A 1AFVA 2GONA 4E91A 1P7NA 2XDEA 2M8LA 4PH0A 1M9EC 4INBA 3H47A 2V4XA 4E92A 2X82A 1G03A 1L6NA 4U0CA 5HGLA 2XGVA 4DGEC 2X2DD 2JPRA 2GOLB 2PWOA 4DGAC 4B4NA 2X83A 1D1DA 1M9FC 5HGNA 4WYMA 2XGYA 1QRJA 5HGOA 4HTWA 1M9YC 2KGFA 3H4EA 2EIAA 4XFXA 2PXRC 3NTEA 4QNBA 4XFZA 5JPAA 4U0FA 4XRQA 1U7KA 1AK4C 4J93A 2PWMA 1M9DC 2M8NA 2Y4ZA 3BP9A 5HGKA
chains in the Genus database with same CATH superfamily
1M9XC 4NX4C 5HGMA 4PH2A 4U0AA 2M8PA 2LF4A 4XFYA 1GWPA 2XGUA 1E6JP 4U0BA 4PH3A 1EIAA 4U0EA 4U0DA 3MGEA 2WLVA 1EM9A 1M9CC 4XROA 4LQWC 2WLVB 3P05A 1AFVA 2GONA 4E91A 1P7NA 2XDEA 2M8LA 4PH0A 1M9EC 4INBA 3H47A 2V4XA 4E92A 2X82A 1G03A 1L6NA 4U0CA 5HGLA 2XGVA 4DGEC 2X2DD 2JPRA 2GOLB 2PWOA 4DGAC 4B4NA 2X83A 1D1DA 1M9FC 5HGNA 4WYMA 2XGYA 1QRJA 5HGOA 4HTWA 1M9YC 2KGFA 3H4EA 2EIAA 4XFXA 2PXRC 3NTEA 4QNBA 4XFZA 5JPAA 4U0FA 4XRQA 1U7KA 1AK4C 4J93A 2PWMA 1M9DC 2M8NA 2Y4ZA 3BP9A 5HGKA
chains in the Genus database with same CATH topology
1M9XC 4NX4C 5HGMA 4PH2A 4U0AA 2M8PA 2LF4A 4XFYA 1GWPA 2XGUA 1E6JP 4U0BA 4PH3A 1EIAA 4U0EA 4U0DA 3MGEA 2WLVA 1EM9A 1M9CC 4XROA 4LQWC 2WLVB 3P05A 1AFVA 2GONA 4E91A 1P7NA 2XDEA 2M8LA 4PH0A 1M9EC 4INBA 3H47A 2V4XA 4E92A 2X82A 1G03A 1L6NA 4U0CA 5HGLA 2XGVA 4DGEC 2X2DD 2JPRA 2GOLB 2PWOA 4DGAC 4B4NA 2X83A 1D1DA 1M9FC 5HGNA 4WYMA 2XGYA 1QRJA 5HGOA 4HTWA 1M9YC 2KGFA 3H4EA 2EIAA 4XFXA 2PXRC 3NTEA 4QNBA 4XFZA 5JPAA 4U0FA 4XRQA 1U7KA 1AK4C 4J93A 2PWMA 1M9DC 2M8NA 2Y4ZA 3BP9A 5HGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9X C;  4NX4 C;  5HGM A;  4PH2 A;  4U0A A;  2M8P A;  2LF4 A;  4XFY A;  1GWP A;  2XGU A;  1E6J P;  4U0B A;  4PH3 A;  1EIA A;  4U0E A;  4U0D A;  3MGE A;  2WLV A;  1EM9 A;  1M9C C;  4XRO A;  4LQW C;  2WLV B;  3P05 A;  1AFV A;  2GON A;  4E91 A;  1P7N A;  2XDE A;  2M8L A;  4PH0 A;  1M9E C;  4INB A;  3H47 A;  2V4X A;  4E92 A;  2X82 A;  1G03 A;  1L6N A;  4U0C A;  5HGL A;  2XGV A;  4DGE C;  2X2D D;  2JPR A;  2GOL B;  2PWO A;  4DGA C;  4B4N A;  2X83 A;  1D1D A;  1M9F C;  5HGN A;  4WYM A;  2XGY A;  1QRJ A;  5HGO A;  4HTW A;  1M9Y C;  2KGF A;  3H4E A;  2EIA A;  4XFX A;  2PXR C;  3NTE A;  4QNB A;  4XFZ A;  5JPA A;  4U0F A;  4XRQ A;  1U7K A;  1AK4 C;  4J93 A;  2PWM A;  1M9D C;  2M8N A;  2Y4Z A;  3BP9 A;  5HGK A; 
#chains in the Genus database with same CATH topology
 1M9X C;  4NX4 C;  5HGM A;  4PH2 A;  4U0A A;  2M8P A;  2LF4 A;  4XFY A;  1GWP A;  2XGU A;  1E6J P;  4U0B A;  4PH3 A;  1EIA A;  4U0E A;  4U0D A;  3MGE A;  2WLV A;  1EM9 A;  1M9C C;  4XRO A;  4LQW C;  2WLV B;  3P05 A;  1AFV A;  2GON A;  4E91 A;  1P7N A;  2XDE A;  2M8L A;  4PH0 A;  1M9E C;  4INB A;  3H47 A;  2V4X A;  4E92 A;  2X82 A;  1G03 A;  1L6N A;  4U0C A;  5HGL A;  2XGV A;  4DGE C;  2X2D D;  2JPR A;  2GOL B;  2PWO A;  4DGA C;  4B4N A;  2X83 A;  1D1D A;  1M9F C;  5HGN A;  4WYM A;  2XGY A;  1QRJ A;  5HGO A;  4HTW A;  1M9Y C;  2KGF A;  3H4E A;  2EIA A;  4XFX A;  2PXR C;  3NTE A;  4QNB A;  4XFZ A;  5JPA A;  4U0F A;  4XRQ A;  1U7K A;  1AK4 C;  4J93 A;  2PWM A;  1M9D C;  2M8N A;  2Y4Z A;  3BP9 A;  5HGK A; 
#chains in the Genus database with same CATH homology
 1M9X C;  4NX4 C;  5HGM A;  4PH2 A;  4U0A A;  2M8P A;  2LF4 A;  4XFY A;  1GWP A;  2XGU A;  1E6J P;  4U0B A;  4PH3 A;  1EIA A;  4U0E A;  4U0D A;  3MGE A;  2WLV A;  1EM9 A;  1M9C C;  4XRO A;  4LQW C;  2WLV B;  3P05 A;  1AFV A;  2GON A;  4E91 A;  1P7N A;  2XDE A;  2M8L A;  4PH0 A;  1M9E C;  4INB A;  3H47 A;  2V4X A;  4E92 A;  2X82 A;  1G03 A;  1L6N A;  4U0C A;  5HGL A;  2XGV A;  4DGE C;  2X2D D;  2JPR A;  2GOL B;  2PWO A;  4DGA C;  4B4N A;  2X83 A;  1D1D A;  1M9F C;  5HGN A;  4WYM A;  2XGY A;  1QRJ A;  5HGO A;  4HTW A;  1M9Y C;  2KGF A;  3H4E A;  2EIA A;  4XFX A;  2PXR C;  3NTE A;  4QNB A;  4XFZ A;  5JPA A;  4U0F A;  4XRQ A;  1U7K A;  1AK4 C;  4J93 A;  2PWM A;  1M9D C;  2M8N A;  2Y4Z A;  3BP9 A;  5HGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...