2X89A

Structure of the beta2_microglobulin involved in amyloidogenesis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
QVQLQESGGGSVQAGGSLRLSCAASGYTDSRYCMAWFRQAPGKEREWVARINSGRDITYYADSVKGRFTFSQDNAKNTVYLQMDSLEPEDTATYYCATDIPLRCRDIVAKGGDGFRYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY
publication title Atomic Structure of a Nanobody-Trapped Domain-Swapped Dimer of an Amyloidogenic {Beta}2-Microglobulin Variant.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x89A00
4LCWE 4KY1H 1JFQH 4HS3B 1LK2B 5IFHH 3RDTA 3S34H 3EDFA 5E5UB 2FLBT 1KPUB 2OK0L 3WFCL 2YD2A 3EJZD 3VFGH 4JRXB 5D71H 4OD2A 3CU1A 1D5IL 1DBAH 1F6AA 4F7PA 2WINB 4S0SD 2J6EA 3BW9B 4HD9A 5JHDB 2ZJSH 3FFCA 3DYPA 4NN6C 1BMGA 2JELH 4NN5B 5TFSH 5ESQA 2CO7B 5B21A 4GKNA 3LRGA 3DVNA 3S88L 1BOYA 5JW4Q 1E4KA 4X4ZA 3B83A 3DGGA 3WFDH 2AJVH 1EAPB 4QKXB 1NJ9B 5DWUH 1VFMA 3BN3B 1A64A 4OFYD 2A9NL 5F7KC 4K55A 4RWYL 3T3PF 2DQUL 2FCBA 4NP4H 3CZFB 3L3KB 3TYFA 2P24B 3NFSL 1RZJH 2GW5A 1MHCA 4JRXE 1R0AL 3ARSA 1P4BH 2AABH 4ELMB 3P30H 4OBSA 4WWKB 1F42A 3MRLB 4GKZB 5B38G 4JN2B 1KC5H 5JHDE 2KQMA 1Z0MA 3VFRA 4ZUUA 5J1AB 1HH9A 3U0PB 4F37K 3TN0A 3MNVA 1PG7L 3HZKB 4I0PA 4NCC1 1A9BA 3ZE2F 4I48B 2X4QB 4IDJH 3CVHA 5SWZB 2APTA 5FCUL 2YC1B 3IDGA 3REVB 3W82A 3OX8A 4R2GD 3SKOA 3WKML 4GG6A 4NRYA 1BEYH 3BO8A 3O3EA 1OTTC 3WCYA 4MA8L 3R8BB 4M61B 3CCHB 1IZKA 4HWZB 4OFPA 4ELME 2PF6A 3MGOB 1FYHB 4POUB 1J0IA 4LARL 5ESVB 5HHQB 1GXEA 2EXWD 5C6WH 2ICWI 1CF8L 1CTNA 4ODHL 5FKPA 1J8HB 3O3BB 3CNKA 3LB6D 3LKOB 4A6YL 3PWPD 5D2NC 2DLHA 5SWZE 2V7NB 4IHOA 4E0RA 3MLTA 1SMOA 4RFEB 3FRPG 4XCYA 5HGHA 2UY7A 2UZIL 5KZCB 4AEEA 3O4LB 3N1PC 4AH2A 5MHSE 4BFGA 4XPTH 4HKZB 1MPAH 1RZIA 3OKEA 3NACL 4JM4H 3TFKD 4I3RH 1Y6MR 5HYJA 4AIZA 2R29H 4LLYB 4UDUB 3G9AB 5I1AB 4YHKL 5ISZB 5D6DC 1HN1A 4O5LH 1BFVH 4J3TA 1J8HE 4HK0A 1NLBH 1G7JA 1KXTB 3AS3A 4ZOBA 4M6NL 4EI5A 2XTJB 3UDWC 4N5EC 3MCLL 3VFPA 1JRHL 4XHQA 4UV4H 2Q76A 3LN5B 4EXKA 2VZ3A 3MRRB 1CDCA 2NNAB 5GS0L 4JREC 4RGMB 1BVLA 3O4LE 4HC1H 4GRLD 3TA3B 4BFIB 3EJYC 4R9HA 3GI9H 3MV9B 4BQCA 4AG4H 3KPNB 4C56B 1F8TL 2EKSA 3MR9B 5ISZE 1MFEL 4K9EC 1D9KA 1FVDB 1LWRA 1GC1H 4FFWC 4J1UB 1A2YA 4X99B 1HCFX 3S37X 4PRDA 5DC9B 2E27H 1VFAA 5I1JH 2XTJE 2X42A 4KKAD 4WW1A 3QDJD 3WE6A 4AENB 4C57C 4DZBA 1GYAA 3ZDXE 1TVBA 1JCKA 4RGOL 5CHNA 5KVFL 1YDPB 4OM0H 3AREA 1T1ZB 2VDLL 4IMLB 1U92A 4LSTL 5I8KL 2VQ1B 3QCUH 3MV9E 4P99A 5EFIA 4X98A 4C56E 3P0VL 1ZSDB 1A0QH 1KNOA 3HKFA 4MNHA 3QI9A 1VKXA 2AERT 5HJ3A 3V6ZB 4NKQB 2P5ED 2VUOA 5E8OB 4OFKA 3NZ8B 1I7RA 1OPGL 3VMOA 4CMHC 2GT9A 3W9DB 2BNRA 3DECA 4WUUA 4A6YA 1NMAH 1FNEA 4HBQA 2HYMA 2AJ3A 1TJIH 1TITA 3KYMB 5TGBB 1D5BB 4EQ2A 4WFHD 1KJVB 4JFQB 1AGCA 4F33B 1FZJB 1MELA 3BUYB 2X05A 2A83A 1G9NC 2Q7YB 1YEDA 3FOLB 4D8PB 1J0JA 5DRNB 1DE4B 1YN6A 4PGEB 5K9KB 5GS3A 1Q72H 3PV6B 3QPXH 5IW1B 4K3HA 4UQ3A 4HCRH 4JZOA 2PW1B 1XF3B 1BBJA 2OL3H 3BN9D 4L29A 1IGJB 4Y4KB 5FFLA 4WW2B 4YFLF 2YS4A 5DJDA 4L3CA 1K85A 3C5SB 3DX8B 3MRKB 1J05B 4MLIA 3QEQD 2LU4A 2BY3A 4L4VA 3ECBA 1RIUH 2QR0B 4HT1H 4DGYH 5DXWA 1EO8H 4U1HA 3GGWA 4HBCH 4H88L 5EOCH 4OF6A 1MY5A 4KMQA 3VA6A 4ETYA 4HIHA 4XPHL 5M7QA 3TLRA 3L9RB 3VGHA 4JO3L 4ZNCD 3QUXC 3JVGC 4NO0B 4YQXH 3M17A 1F97A 2WWMC 2PR4H 1GGIH 2FGWL 3GKWH 2COQA 2IANB 1YJDC 3QEGL 3V7AG 2YPVL 2MPAL 5FEBA 4ONOA 1AD9A 1CGSH 1UJ3A 1OF2B 2WQ8A 4P3CL 4NNYA 3HC4L 3WS3B 3QCTH 1ZT7B 4F37F 4UILL 3ME0A 3HZVB 2X4OA 2HN7A 1YQVH 2LV4A 5C0ND 1NCAH 3PF2A 3BP6B 3MRBA 1P6AB 2FR4A 4Z7OF 3QHFH 3QIWD 1YEKH 4XPFH 1MLCB 2Y06L 4LSQH 5GRUL 3O3DA 3OPZL 4NGHH 2R2BB 5BS0B 3LDBC 3PABA 2P48B 4OI8A 4QXTA 5D7SH 1J1PH 5T5FH 4F58H 1IE5A 3S6CA 1WEJH 4BZ1L 3K4ZA 1N64H 1TCMA 4XNMA 1MQKL 2IANE 4DGIL 2YD7A 3LN4B 5CZKA 1U41A 5EZJA 5DJ8B 1RULL 1Q1JH 3EOAB 3FB8B 4JQIH 4QTHB 2M8XA 4LHQB 1K4CB 3F7YB 2VLLB 4PGDA 5J12C 2DQFA 4JFFA 3NIDE 5JORB 4DKFL 3MRGA 4PJIF 3VXUD 2ZWLT 3B5TA 1LO3L 1FV1B 1KN4H 1T5XB 2JIXB 3ILPB 2MQ0A 5BS0E 4UAOC 4IRJD 4XB7A 2WW8A 2FATL 3L3IB 4ZYKB 1JWUA 3JV6B 1IZJA 2FECI 4ONHA 1YECL 5IFAL 1U8LB 3P4MA 1KYOJ 4GS7C 2VDML 4LQ1A 5DHVA 5DGQA 3GHBL 4M9PA 1D6VH 1A7NH 2IPTH 1ACYL 3MLWL 4U6HA 1OY3B 5GQBA 3WIHH 4FFVC 5I9QB 2F5AL 2RIKA 5KS9A 4FN0A 4P5MA 4JB9H 4LBEA 2PUQT 2Y5TA 2ZCHH 4PJHA 5IB5A 3S36L 2F8OA 3SGJC 1EH9A 5J4MA 1NFIA 3QXWA 3FQWB 5CGYD 3ZKND 3BQUD 1B0WA 2OQJB 1DSFH 1FCGA 2ZCKH 3W9EA 4X5XA 1MRFH 3VJ6A 3BKCH 5C0CA 2Q8AL 1JGEB 2IPUG 5FA4B 3OBAA 4HUVA 2EDNA 3V7MA 3OKOB 3BP7A 1UH4A 2BVTA 3QG7H 4PR5B 5A3IC 1A7PL 1FG9C 2IBGA 2NR6D 3WL9B 4OCMC 2AP2A 4FQXD 4G6JH 3CXDL 4U3XA 4ZXBA 3SE4C 1C12A 3U4BL 3DV6B 3WNOA 5K33A 1LO4L 2QKIB 5FF6A 4HKBB 5D1ZC 5IEKB 2YR3A 1TVHA 1OTSD 2VE6B 3DHJA 1M1SA 3MFFA 4DFIA 2ADJB 4WI4A 5HGAA 5JA9A 5GJSL 5D8JL 4G8FA 3MRNB 3RDTB 2JB5L 5I18L 5IB1A 2NW3A 3RAJH 3FT3A 3EZJB 3PHOA 4O2EA 4OD2B 1AO7D 1QLFA 5HHOB 4MNQB 1F6AB 5B22A 2OR7A 1K2DA 1JPTL 2W60A 2JJVA 3FFCB 5EUOF 4WENB 3MLZH 4HAFA 3VXPA 4OUOA 1BJMA 1CXHA 1DLHB 1C5CH 4X6CF 4GKNB 3DVNB 1RD6A 5JW4N 2XXMB 1KPRB 3W5MA 2PW2A 5E24E 2E9JA 2NX5D 5ICYA 3D9AH 1WZ1H 4B0MM 2ORBH 2EE2A 3D18B 3TYFB 2XQYK 4Y16D 4PV8B 1MHCB 5ALCH 5F9DC 5D7JC 2P42B 3V8OA 2R0LH 2BMKA 4L9LC 5HHOE 4MNQE 5FDYA 4XTRD 3KJ4B 1BREA 1YEIL 5ITFA 1LDPL 1FRGL 1DVFA 3FFCE 3VFRB 1HH9B 1IKNC 1FC1A 3T3MF 1MCKA 4NC1C 1F3DH 5FM5M 3MNVB 1NL0H 3FAXA 2B1HL 4LP4A 5E5RB 5HYQA 4I0PB 1FAIH 1CZ8L 2HFGL 1L7IH 4E41A 5A16A 1N0LA 5KG9A 3LSOB 3VWJB 1V3MA 3CVHB 1UWEL 3RI5F 2EYTA 4RIRA 3U2SA 3S3SA 2R0ZH 3OX8B 5AD0A 3SKOB 4NRYB 4A2MA 1LP9A 2QADB 2VDKH 3V7AE 2I5YL 3CAFA 3WUZA 5BO1L 1GGUA 5BOPA 5KAQF 1T03H 1S7UA 4R90L 3RVUC 4QHUA 4H8WL 1CU4L 1OWWA 2C3GA 4HH9A 5T1LD 1X6LA 4WI8A 4PGJA 4QWWC 5CILL 4WO4C 1G9ML 1OAKH 5TE6H 4GMSH 1IKFL 5FKPB 1FG2B 3I9GH 3KJ6L 4P23C 1RUAL 3WHE0 4PJ5A 4LOUD 1ADQL 5ALBL 5FUZH 4R7DA 3MLTB 1J0YA 1CDYA 1RHHA 4LSVH 5TH2A 4E0RB 1Q94A 4NKOA 5HGHB 3RU8H 3L1OH 4MD5A 3RUGF 4APQA 3GZKA 3NA9L 1KULA 1FFPA 4OZIA 4KTEH 5E2VL 1ZWIA 2DQJL 5AWNL 4KI5D 4KRPB 1AHWA 1RZIB 1F5WA 3OKEB 1UA6L 3M45A 1ZVSA 2FHCA 3MRPA 1ZMYA 5HYJB 2CMRH 2ZUQC 1JPGA 3SOBL 4AIZB 5I30H 3UJJH 1ES0A 3JWNC 4JE4B 2DQGL 2X4SA 1X4XA 4UOW0 3G04A 1E6OH 4QRRD 5GGRA 5FO8B 3O2DL 3ORJA 1QEWA 2BOBB 1G7JB 1P84J 4U0RC 3VFMA 3AGVA 3FRUB 3ULUC 3SDCC 4EI5B 4HHAA 1NSNH 1BFSA 1RZGB 3VFPB 5FGBC 5JZ7D 4J3WA 4NZJA 5C7XL 1J5OL 4JFEA 3H9YA 1J9CT 3MLPA 3F7QA 4V1DB 1BVLB 2FEDC 4PB0L 3K3QA 2XY1A 1IGTA 3IGAA 4LCWD 4O58L 3TYGH 5CJOL 2EKSB 1VEOA 3H3PH 5HYJE 5FK9A 3MLXH 1UCBL 4QT5A 2A6IA 4MQSB 4LU5L 3QQ9C 5FYKL 5GGQH 4EDWH 3GSRA 2H3NA 2VXQH 3QNXA 5FM4A 1S5IL 1FJ1A 4PRDB 4M43H 1CFTA 4M7ZC 3GMQA 1ETZA 4MS8D 1B3JA 1NCUA 1QRNB 4WW1B 4TUJA 4DZBB 2HJKB 4I77L 1T3FA 2FEEL 4V1DE 1EZVX 2ILLA 5DFVD 2GSIA 3AREB 4NHUB 2Y4SA 1Y0LA 5FOBB 5JPNA 3QSKB 1Q9OA 4XMLH 3NN8A 5F3HA 4NQCB 4JO1L 4X98B 5EFIB 4LGPB 4JRXD 1EIBA 3EZ8A 4MNHB 3QI9B 4UT9L 5HJ3B 1U3HC 1VB9A 2QL1A 3DX7B 1TTFA 5FGSA 3EAKA 1I7RB 3NOIA 1WLHA 2GT9B 1OW0A 1F45A 5GIRB 1JTOA 4LNRA 5IMMA 4KKLC 2BNRB 4LRNL 1T66D 2AK1H 4WUUB 1ADQA 3NCBB 1FNEB 5GGRY 3CXHK 3QWOA 2AJ3B 1B90A 3B2UC 4S1RH 3S3JA 3BAEH 2BJMH 2JJUA 2OP4L 3N85H 3DRTA 1QP1A 1J0ZA 1IM9A 1FVEB 1X5KA 4LCCA 1OAQH 1BIIA 2A83B 3MFGB 5BZDB 1YN6B 5HHXH 3VD4A 1KENH 4JM2C 3VRLF 1A14L 4JZOB 1JGUL 3L7EA 1QFUL 3ZT7A 1E4XL 4HX1A 4NNXA 4O2CB 1EGJH 1UWGL 4WWKD 1I9JL 3TWCH 5DJDB 5CEYA 1SHMA 2VDQH 3KS0H 3PWNA 3O2DA 3QP3A 4X7EC 3V5DB 2BNRE 2DJ4A 1OSPL 4WUUE 1IC1A 2ZCLL 2GK2A 3I2CL 4U1HB 3GGWB 4DZ8A 2VWEE 4HIHB 1I9EA 3C2AH 3CZJA 4U6VH 5SWZD 4D9LH 4HFUH 1AGDB 3ARFA 4NKIL 1B6UA 3T2NH 3M17B 5D70H 1AC0A 3T1FA 4UTAH 3EO1A 4HAGA 4Q9QL 4G8GA 1CDUA 3OKKA 4XXCA 2AGJL 1C7SA 4DTGL 2XKSA 4NNYB 3MRMA 3ULVC 3WXVL 1TETL 5I19H 2X4OB 2ZG3A 4GW1A 4F7CA 2HN7B 5GRVK 3HCVB 4PTUB 3AM8A 3MRBB 4R97B 2FR4B 5EORH 5FUCC 3G6JF 1L7TL 4XVJL 3O3DB 4I13B 2APWA 2BVEA 3O45A 3SDAA 1MCFA 4FQHA 3CLFL 4EEEA 4NFDA 4QXTB 4P4KC 4JJ5A 3TZVB 2CDEB 1MI5A 1J12A 1ZOXA 3STLA 1IAIH 3EJZC 5KZCD 2W9EH 3O4LD 4F57H 1ZGLA 2GEEA 2VDOL 4XNMB 2I60L 4OKDA 5T3XH 3T09A 4GAJL 4AIOA 1DLFL 4KZDH 5EZJB 5ISZD 1H15B 4QLRA 4OF8A 4KK8D 4HUUA 3BH8A 2DQFB 4JFFB 4UB0L 4GXVH 3Q0HA 2DTML 3QDMD 5TE4L 3MRGB 3OF6D 3CVIH 5I74C 4LPYA 2PCPA 4YX2L 3TJHD 1JWUB 4ONHB 4FQJL 3TO2B 4CAGA 3V8CA 4MXWH 2LFGA 5J3HD 3RGVD 1F3JA 1FL6A 5T3ZL 1I3GL 2P7TA 2VLME 4U6HB 4WY7L 1J86A 1IGFH 1IC7H 5KS9B 4ZFZA 1J0KA 3E6HA 4AL8H 1HQ4A 1WUNT 3OWEA 4LBEB 1JRHI 3G5XA 5IB5B 3MLUH 1E28A 1NFIB 1NH6A 1INQA 3C6LA 4JFFE 3B2VL 2DLFH 1HEZA 3FO2A 1ITBB 4DFHA 3BZFA 3BPLC 4OFIA 3REWA 2XACC 2A2QT 1FN4A 2JB6A 3W9EB 4R2GC 4X5XB 2NY1B 4GUPB 3B43A 3QBTB 3KDMA 3VJ6B 4Q9RL 5C0CB 5DJXB 1MEXL 1PX3A 5EZIL 5HHMB 2AVGA 1M7IA 2YA2A 1AKJA 5BQ7A 2OK0H 5GS1C 3FN9A 4OV5A 3LEYH 4HKXB 3KYKL 1GGBH 2Z8RA 1FIEA 2OI9C 1NBVL 3V4PH 5KS9E 4ODUA 1V3KA 3HE6B 4YC2C 1MCNA 4GSDH 2C7UA 12E8L 3B9KD 1EVTC 1JTTA 4P49A 1AGBA 3LB6C 4ZXBB 4DAGH 3OZ9H 1C12B 3S88H 2CSPA 3QHZL 1QNZH 5HY9A 4M7JH 2VABA 4PJXB 3S37L 2GY7B 4IMKA 1VFUA 5DD0L 3PGDA 5FF6B 3TNMA 5IBTH 2MCG1 3DXAB 3VRIB 3E8UL 5C0CE 1TVHB 4NHCL 5GRYA 5HHME 1RJYA 3KR3L 4WJ5A 5HGAB 3PHQA 3TFKC 1ZA3B 1MIML 4G8FB 2O61A 3WHE1 1R0AH 4RBPH 1KCVL 1V3JA 1JV5B 4G7YL 3PHOB 3U46A 4O2EB 2VXVL 4LLQB 5JO5A 1QLFB 1PD6A 4G8EA 5GRJH 1A4KB 1QHPA 4EZMA 1K2DB 3QRFM 4NSKB 2NLJA 4KQ3H 1URLA 2PXYD 1DFBH 4Y5YA 1IAOA 1QSFB 2HH0H 4LF3B 3VXPB 5DJ0A 1G9EA 2FYYA 3TO4C 1ZLVK 6CGTA 5J8OA 2F9BT 3DXAE 3WKMH 3NPSC 4GRLC 4MA7L 4UOW1 1RZKL 3MNZB 3HE7A 3MJ8A 1M71A 1HK6A 2APVA 4ZAKB 3C6SA 5I2IA 3Q2CA 2FHBA 2PN5A 3HG1A 4KTDH 2IH3A 4PP1D 2BHZA 2BMKB 4YAQA 4MAYA 3K7UA 3PGFH 5ICXA 1IT9L 5ITFB 2NY2B 1MF2L 1DVFB 4G6AC 3H9SD 5F1NA 4OCXL 1N3NB 1P7QB 4KKAC 4IOIA 1S78D 1MCPL 5HYQB 4MB4A 1WF5A 2CUHA 5A16B 3SGEH 3RWFA 2UZIH 3KVQA 5KG9B 4NBYB 3BT2H 1MJ7H 1PQZA 3U2SB 5AD0B 1NLDH 2DDQL 1DUYA 3T8XA 4F9PC 3NACH 4K23L 1LP9B 4XWGH 4LLWA 2EH8H 3CSYA 5E99H 2BHYA 2W65B 2ZZUT 3V9FA 2FL5A 1YN7A 4PJBF 2FZ3A 4PLKD 4L9DA 4HG4K 2R4RH 1NUNB 1TZGL 3FL7A 1S7UB 2AV7A 2NY4B 2XZQL 3DSFL 5BXFA 4HH9B 4YDVA 3T1WA 4IRSA 3I6KB 5B4MD 3V0WH 5IVXA 4ESKA 5FDWB 1CFSB 5FHAL 3EOBA 4HK3N 4MXVF 1N5YH 1RJZA 4XRCA 3MCLH 3T0EA 1VGEL 2OS7A 5D93C 4OLUH 3LQAC 3SDDB 3BJLA 2EECA 5DEZA 1NFKA 1AD0A 4MYWB 3I84A 3R1GL 3DX9B 5SV3A 4JPVL 2C3XA 4NKOB 5CLTA 3RL2B 5H8DA 3FFDA 4MD5B 4APQB 3BDYH 1LP9E 3KG5A 1FFPB 4OZIB 1ZWIB 1OAXL 2CH8A 4M6MH 1AHWB 5AZ2H 2YZ1A 3MQIA 1MFEH 1NCBL 1ZVSB 1S9YA 3MRPB 1A6VH 1PLGL 1JPGB 1VACB 1VSCA 3QIUB 1DN2A 4PJ9D 5I17A 2X4SB 4QF1B 3G04B 5CSBA 4YHYB 3ARDB 3B8SA 5GGRB 4ZFOL 4QCIB 4NN7C 4CU7A 3HMXH 4ZG1A 1QEWB 2AAVA 3RX7A 1RUMH 5LXGH 3VFMB 3QR2A 3GIZL 4RGOH 4HHAB 5KVFH 3BKJL 1CFQB 3K0WA 4HK3J 8FABA 2VDLH 1UACL 3RWGB 4ZD3L 4JFEB 1XF4B 5I0ZA 3RVVD 3H3KA 4OZIE 4Z6AT 1IGTB 3IGAB 5IHBA 3LVEA 3CD4A 2DKUA 5TPWL 5FK9B 1F90H 5MERA 2WUBL 5C6PB 2B4CH 4QT5B 3SKJL 2FD6L 3FN3A 5C0NC 3GSRB 2H3NB 3QIWC 4RRPA 1T04A 3QNXB 4HJGA 4EBQH 3ZE0F 1FJ1B 3VGAB 3GMQB 2M1KA 3KHQA 1ETZB 3BHBB 1EO7A 1CDHA 4OLVL 4TUJB 3IJHA 5BZWA 2Q8BL 2ZOKB 4OLEA 5AAMA 2HLAB 4J8RA 4JFEE 4LEOA 3D0VA 4Y5XC 3BPOB 2QQLL 1Y0LB 1LO2L 3AY4A 5JPNB 3OAYH 3QDGB 4C83B 5LGHL 3NN8B 5F3HB 3GBNL 1WC7A 3QUKA 5JIPA 4O9HL 2EDOA 5DZOA 1KIPA 1S7TA 5E8NA 1X5ZA 4XPGH 1JF5A 1QFOA 2E7MA 3IAPA 5HHOD 3L3HB 1QYGL 4MNQD 4ZS6D 3MUHL 5I8CA 1C1EH 2VRAA 3FFCD 1IC4H 4D3CL 2ZG1A 2VL5A 1UZ6E 4ALAL 2DYPB 3UYRL 4ORZC 2CLRB 5IMMB 2I24N 4H88H 1T2XA 3QWOB 3MJGX 3O6LL 4KAQH 3RPIA 3N06B 5J6GA 4G3YH 1Q0XL 3QRGL 1MH5A 4LFHD 4YWGL 5FM5O 1IM9B 5F3BA 3VWKA 3MBEC 3V4UL 5B8CC 3QDGE 4LCCB 3QIBA 1OD7A 1BIIB 4EIGB 3WN5A 1MJJA 1PKQA 3K1KC 3QEGH 2YPVH 2ZUXA 4NZUL 5DFTA 1REIA 3WFBL 4NJ9L 1MCHA 3MLSH 1BQUA 2PYFB 3X11A 1WAAF 4KV5F 4I3GA 1NBQA 3TIDA 1EHNA 2X4NB 1JIBA 5CGYC 5T3XD 4I8DA 3ZKNC 2NY7H 5CEYB 3BQUC 3CDYA 3IAQA 4ZFOA 2X9YA 3PWNB 2UVFA 2MOVA 3SGDI 2ZSWB 2HFTA 5HVWA 5J13C 5GRUH 3C9NB 2Y23A 4DZ8B 5L7XH 2VXTL 3VWJD 3LS4L 2E8ZA 4M1DL 2RGSA 4S1QL 4L4TB 2JJSC 5IOPB 3PQYA 1RZJC 2QADD 2NR6C 2J5LB 2J7LA 2ADIB 3LIZH 4V2BA 4PYGA 4FQXC 3EO1B 3QFJA 2E8YA 3BE1H 4G8GB 2W0KA 4OCWH 3OKKB 3UP1A 1W0YT 3X3GH 1HH6A 1KIQA 3Q6GL 1AXTL 5D96B 2QTEA 1CBVL 5CJ8A 4DKFH 4GW1B 1HI6B 5DVLA 5EOQH 4F7CB 2N7BA 2IH1B 1OTSC 3H9HB 2F58L 3PWUA 5IW3A 1WIUA 3LRHA 1KBGH 3FQXA 5GJTH 4YZFE 2O93L 4JJ5B 3RBGA 1FLTX 1MI5B 4L4TE 3STLB 2YD9A 3BYTA 1ZGLB 1KJ3H 4ZTPL 4KRPD 4G8GE 1AE6L 2RB8A 3MOAL 3PWVA 1S9XA 35C8H 5DJYB 3WS6A 4FFYH 4JQXA 1OP5H 5FV2A 3I6LE 2ADGA 3V6BR 1JZ7A 5CUSH 4HUUB 2Z31B 2J88H 4U1GC 3KLAB 1N2RA 5DZNA 5L8KB 1DQLL 1F4AA 4GW5A 5JHLL 5DJ6A 1CL7H 1RZ8A 3K74B 5T5NF 4ODVH 4HWEL 1S7WA 4Z7WA 4Y16C 1MI5E 4EUPA 1AP2A 3FMGL 4V1DD 4QXGH 5EWIL 4K7FB 3IFPB 3VGBA 1PZ5A 4DQOL 3GMMA 3UX9B 1A7PH 4XTRC 2P7TB 4XVUD 2C3WA 1T7VA 5L2JA 5CZVL 4JZJB 5EBGA 2VQTA 3CXDH 3VU2A 1U6AL 3E6HB 3NCCB 3D3VA 4P2OA 3RIFF 2A6KA 4N90E 4OF0A 3D6GA 3CK0L 5F7YC 3FO2B 1HEZB 3BZFB 1KN2L 1S9VB 3REWB 3WO4C 1EFXA 1FN4B 4ELMF 2BY0A 1QRND 3KDMB 5FCSH 5ITBL 5GJSH 1KLGA 4NO2B 2FX9H 2MNUA 1YNTA 1X5IA 3ARED 1BVKB 5I18H 2V17L 1M7IB 1AKJB 3PGCB 4YE4L 5BQ7B 4ZPTA 1WJ3A 2EDLA 2WZPD 4OV5B 4NQCD 3FB6A 1FLRH 4MB3A 4L1DA 4I9WD 2CKBL 5D72L 1JPTH 4UOJA 1MCLA 2C7UB 1AGEA 3MXWL 4PP2A 3VDCA 3MRDA 2YN3A 3OG6B 2PTUA 2X70A 2XFXA 4IIQA 2FEEI 4LOUC 4P5KA 2GJ6A 4Z78A 1AFVL 5HY9B 3NCYS 4HIIB 4RRPG 3IKCA 1GAFL 5JOPE 2VABB 3UTQA 3PGDB 3TNMB 4EN3D 1IBGH 4JPIB 3ZTJG 4HQQH 3VA2C 1A9EA 5HVHB 5IR1B 3HAEA 3I3DA 1NCDH 4KI5C 4OZHA 4F80A 1IILE 1RJYB 4WJ5B 1EHLL 3PHQB 4OQTH 1GHFH 1YEJL 1YMMB 3BIAX 1B2WL 1ZS8A 4LSSH 5IMLB 1M7DA 4DK6A 1LDPH 5JO5B 3VCLB 4N8VA 2ICES 1HWHB 1EA9C 4S10A 1IGMH 4FZEH 2NLJB 4LSUH 5ACZA 4Y5YB 1IAOB 3QEUA 4M93B 1S9KC 4QRPD 4FQ1H 5JZ7C 4GH7B 2FYYB 4MDIA 4F3FA 1YEEL 5IIEA 1YYML 1CFVL 5IBLD 5KVGH 4ZUWA 3OAUL 5DR5H 1CGUA 1TFHA 2BOCA 3HE7B 3MJ8B 1CYGA 1M71B 3O9WC 1FNFA 2V6HA 3C6SB 1AXSA 2J4WL 1YMME 4R3SA 2UWEA 3HG1B 3PL6A 2W0FA 1N4XH 5FO9A 3D1MC 2VXSL 3BJ91 4OV6F 1BBDH 3SCMD 3ZDXF 2QSTA 1ZK9A 2VUYA 4YAQB 4MAYB 3UBXA 1U8JA 2I9LB 3MUGA 5GGVH 5I8OH 5F7LB 2DB8A 2BVQA 5FOJA 1A4JA 1GL4B 2Y07L 4KU1A 3IS1X 1CG9A 5JLZA 4I18A 4MS8C 2DMBA 1NGXA 5ALBH 3N1QC 3G6DL 5CBAA 4UIKH 2C4XA 3MC0A 5D2LA 4Z0XA 5CD5D 2X1XR 3ZL4H 1SEBB 1JHKH 3RWFB 3GHEL 5DURB 4JFDA 1PQZB 1MWAL 1MCWM 3C5ZA 4QY8A 1DUYB 3TZVD 5CP7A 3T8XB 5I1HL 3HG1E 4U6TA 4LLWB 5T3ZE 4YHNA 4RMSA 2FL5B 1RFDL 5I76A 5KSBA 5IHUL 3AAZA 4WHTB 2CKBA 1S7VA 2AV7B 5BXFB 4W68A 4M3KB 4YDVB 2VLMD 4UT6H 5BCAA 4G6ML 4IRSB 4NN5C 4CKVX 1YYLL 2R15A 3TF7C 3GBML 3MXVH 5IVXB 1T66C 3EOBB 4JG1H 2HTLC 1KELL 4KROD 1CGTA 1RJZB 2AI0H 4XRCB 1VGKA 5DMJB 3T0EB 4XI5C 5JXEA 3U9PH 1XF1A 3TPUA 4GKSA 4FHBD 1AD0B 5C08A 1EK3A 4L8CB 1HKLH 5ADPL 4WFGD 1EMTL 5HHVH 1DQDL 4PB0H 4LSDA 3FFDB 3O4OC 5HSFA 2AEWA 2X89A 4O58H 5FUOL 5C0DA 5SWSA 3V5HA 4J7RA 3GMNA 4Q9BA 3QQ3B 1N0XH 1T2QL 4WWKC 3MJ7A 1S9YB 4J3OC 5IHZA 4HH8A 4LU5H 1AJ7H 43C9B 4H8WC 3C08L 5I17B 4XVTH 3GSNL 3WXWL 5IVXE 1S5IH 3IVKA 4ONFH 5DLMH 4NKMA 3T0EE 4JCLA 2D7PA 5CP3A 2XWJA 2FDBP 1C5BH 1A47A 3LQZA 2CUMA 3OJVC 1E6JL 4WW2F 2NY1D 2W07A 4BM7A 3PDOA 4OLZH 4Y5VA 4U49A 5C0CD 3EUUA 1AGFA 2YPLA 5HHMD 4R4FH 1QQDA 1I3RA 4EUPG 5DYOA 4LCIH 3FB5B 4GRWF 1NAML 5MERB 3D87B 3HE6D 4L3EA 5IG7A 3T0WA 5I71C 3CFCL 3SO3B 3RY6A 1NBYA 5DDHA 4OZFA 3CFKA 1R3HA 3EYOA 3FZUD 1D5ZB 2ICEB 4QHLB 5BRZA 3IJHB 2HP4A 4ZO9A 1HINL 3DXAD 1MWAA 4LEOB 3D0VB 3INUH 1I1CA 4LEXL 5EBWA 4P2RD 3QUYA 5KANG 5T1DL 4AIXA 2L7UA 5IQ9B 3NIDF 2R9HC 5I6XB 1WC7B 2V5MA 3QUKB 2E3VA 1QFUH 1C16A 1E4XH 4HLZH 5J06A 1KIPB 3HNSL 1LE9B 1MY7A 1EZVY 4E42A 1MAMH 4LSRH 1UWGH 2DLGA 5E8NB 3D85B 1CLYL 4KK8C 3TT1L 3HFML 3X3FH 4M6OL 1JGLL 4XPBH 5D1XC 3O41A 4KDVA 2NTFA 1QSFD 1XR8B 2VL5B 1FZOA 3I2CH 5C9KA 1RIVL 1RUKL 5HDQH 3RPIB 1A3RH 3JWOH 5J6GB 4XCNA 5J3HC 1MH5B 2IPKB 3RGVC 2FX7H 3VWKB 5F3BB 5C0GA 3BFOA 3QIBB 5F88A 3WN5B 5JIIA 4ZAKD 3G9VA 1HOCA 4UQ2B 1YC7A 3CMOH 4XNYL 3HMWH 4G5ZH 2VKWA 1G0YR 2X4TA 3X11B 2IPUK 3GSNA 3WXVH 3OV6A 4M5YH 4N8VG 5FA3A 1CLOH 2NY2D 1DVFD 4TSCH 1RY7B 3LOWA 1P7QD 3CH1A 3ISWA 1EBAA 3BKYL 4MSWA 3QWQB 3QZWA 4H20L 1MFDH 4X8JA 4RBPK 3CLFH 3DTXA 3ZKMD 3LKRA 3ZE1E 2XIDA 1H8NA 4M3JA 4CRPA 2XN9D 4CMMA 2XKNA 3GO1H 3EJJX 2D7OA 1MIEH 3PQYB 4GAJH 1DLFH 1KCSL 3B9KC 4HUWA 1NAMA 1IGIL 5BVJA 3NCEB 1HH6B 1KIQB 4NQDA 1EPFA 3UBXG 4UB0H 4GMTH 4NZTL 2JCCA 1YY8A 3P40A 2GTWA 3SBWA 2CDFA 5IQ7H 5EO0A 4OIAA 2BVPB 3DRQB 1EX0A 5EDXA 4B7LA 4NWTH 3SDDD 3PWUB 3FQXB 4PY8I 2PKDA 2DJSA 2V5TA 4M7KL 1QR1A 4X80L 2XZAL 1Z9MA 3T65A 3PQYE 4XPAL 4XBPA 1KCUH 3IU3A 4WY7H 5I73C 2R0KL 4NFBA 4K94L 2C5DC 1RIHH 3C09C 3PWVB 1S9XB 3W81A 2JKXA 5HGGS 2WP3O 2PXYC 2X1WL 4P2QA 3WHXA 4P9HL 4CW1B 5K9JH 3QIUD 3GM0A 2ITCA 1CGYA 1T0NA 4QHKJ 3LS5L 2ADGB 2DM4A 4HV8B 3ARDD 3NZHH 4LGRB 4GRMB 3IU4H 4PD4K 3D25A 4GAYA 3S3PA 2F5BL 2Q7NA 1XEDA 1N2RB 4D9RE 1MEXH 1BX2A 5MP6L 1I7TA 3Q6FA 4GW5B 1RZ8B 5DS8B 3IDYB 4OI9A 1JZ3A 2LU3A 4YK4C 5E8DH 2XKUA 3PIQA 5CBEB 1S7WB 1Q38A 4Z7WB 4JFED 5C0IB 4EUPB 1AP2B 5E7FA 3O6KL 5EUKA 3O0RH 4KMTL 1JYXA 4PP1C 1RMFH 1PZ5B 1HE7A 3TGXA 3P9MA 4TSBH 4AY0A 5L2JB 5E6IA 1ZLSH 1FAKT 3QCVH 4L8SB 4HFWA 3FT4B 4NNPL 3S37H 2RCSL 3VRJA 5IMKA 5LCVH 2O26U 1UM4H 1DL7L 2EC8A 3P2TA 4TSAL 1JWSB 4IS6A 4LVNB 1EFXB 3GUTA 5F89A 1TNMA 4CGTA 4OLYL 5DQDH 5C07A 3UPRA 2DQTL 5DVNA 3M1BA 1BIHA 4Z7WE 1U91B 2VZTA 1YNTB 4PLKC 3VFWA 2OJZH 2B0SH 2ENYA 3EOTH 1A3LL 4L5FH 4ZPTB 3NCMA 3OKLB 3QDGD 4U05A 1DDHA 1UWXH 1QBMH 5B4MC 3G5ZA 4BZ2L 3ARGA 3EGSB 1YNKL 4K2UL 1XFPA 4PP2B 1D5MA 4MQTB 4GG6F 4XP6H 2YD3A 1KIUA 4HGMA 4Y2DD 2XFXB 2NMSA 2OJEA 2XZZA 4GT7A 4P5KB 3VFNA 4Z78B 3VD5A 4Z7OE 4MJ5A 1A1MA 3MO1A 3VXMA 2DYPD 3LZFL 4PJIB 3T04D 3P0YL 4OZFG 3L3JB 4MA7H 4JKPL 1J1XH 5L88L 1NEUA 1OLZA 1G7PA 5A2IH 1JPSL 3G08A 4H0IA 2EICA 5ID1A 4OZHB 1RJLA 1XGYL 3BPCA 4HMCA 4KPHH 2VDRH 5DC0A 1G6RB 5CJXA 4TQEH 4N9GA 3HI6L 2GK0A 1H3VA 4S11A 4X6EA 5EIVA 5EIIA 5EA0L 1M7DB 4PJ9C 1JZ5A 4YIQA 1OSZB 5IHLB 1IT9H 4H0GA 1FO0L 2X7LA 5E94A 3GSUA 5IESH 1MF2H 4N8VB 4OCXH 4I3SH 1CXEA 5SX4I 4RZCA 3HC3H 1CT8A 3OG4B 4WRLA 4B5EA 5ACZB 2GJ6E 3QEUB 3ZTJH 4MDIB 3PDGA 4PJIE 4JO2L 4R8WL 1BM3H 1QLRA 1GH7A 3VMNA 1OL0A 1ZE3C 4ZUWB 4OZHE 2BOCB 4LPUA 3K46A 2A1WL 1AXSB 4G6KH 4JG0H 1NDGA 4L4TD 4R3SB 1TZGH 4N9OB 2W0FB 1OGAB 1VADB 3RL1B 4YBLB 5L8JB 3QG6A 1DQML 2ICWJ 2Q6WA 2VSCA 2ITDA 3GJFK 1U8JB 1A8JH 3MUGB 3UBXB 5CCKL 4JRYB 5EOCJ 2BVQB 1A4JB 2WM0A 1DEEB 3UZVB 1VGEH 1CG9B 3VXRA 4CVXB 5JLZB 4Z8FH 1WK0A 3I6LD 4G42A 1NGXB 2P5WB 2ATKA 4HMEA 5C0JA 1A7RH 4HJ0D 4CVWA 1QBBA 2FRGP 4Z0XB 1ZHBB 3RNKA 5T1MA 1K3ZA 3QZWG 1X44A 4J3UA 4NUJA 4WHDA 4NQSA 3LY6A 4M02A 3MMEA 2AS5M 1OAXH 5A2FA 2EDJA 3C5ZB 3KYOA 4X6FA 4QY8B 1OARL 5CP7B 5FYJL 1PG7W 1OGAE 4I2XB 3F62A 4YHNB 1W0WA 4XHJC 4KKBD 5I76B 5KSBB 3S7GA 3AAZB 4ZS6C 5CJQL 3WNMA 3S35H 4TULL 1KTRL 4JRYE 3V6FA 1EEZA 4AM0B 2Y9RT 1T1WA 3NMEA 2XZCL 3SHSA 2BNUA 1SVZA 3HNVL 2X1OA 5C8JA 2XQBH 3QH3B 4N90D 2Z31D 4K9EL 1WICA 4R4BB 4BQ9A 3TPUB 4GKSB 1EJOH 2NXYB 4FQ2L 1INDH 5AG8A 4J2XA 2DI9A 4LVOC 1S5HA 1R3LA 5C0DB 3VFVB 4OBRA 5SWSB 1NPUA 3V5HB 3GMNB 4PGBA 5TPWH 3R8QA 5KSBE 5F21B 4D0BA 3MJ7B 2YPKB 1HILB 1FO0A 4RMWA 3HPLA 2DD8H 5IHZB 3C8DA 5DMIH 25C8L 1U8KA 1FPTL 4RAUA 2AJZA 4UZGA 4CU6A 3RVWD 4NKMB 5I75C 3UTOA 2EDBA 3VWJC 2W9DL 1CD9B 3UXFA 2XWJB 2ZUYA 3TIEA 3LKQA 5JOPD 3FQNB 3SDYL 4POZD 1GGCL 1PW3A 2BNQB 2UV3A 4GAGH 4FG6D 1GPOL 3HPJA 5KSAB 4Y5VB 2DRUA 2AK4D 2FWOA 5HDOA 4J23A 5ADOL 1AGFB 5D2NA 2YPLB 1OP5K 5SWSE 1L6XA 1QQDB 1I3RB 2VLRA 1AKJD 5JW4M 4FZ8L 1CGXA 1JZ2A 5JW4R 5DYOB 4OJFL 3ILQD 1G9NL 3WFZA 4L3EB 4O02H 2C4FU 2A9ML 4D3CH 3LD8B 1ZAGA 5I1CL 4WU7A 3ZKSD 3UYRH 1EO5A 1NBYB 4JHAL 4OZFB 5GISL 3KPRD 3CFKB 1R3HB 3KPSA 1NMBH 3O6LH 5D6DA 2VSDA 3GI8H 5C6TH 2OR9H 1Q0XH 5BRZB 2L4OA 5ID0A 4XP9L 2F8XC 3OR7A 4LSPH 2BNQE 3WLBA 3MX0A 4EUPH 2BZDA 1MWAB 2YPLE 4X7FC 2HVKA 3UDWA 5EBWB 5I1DA 2K9UA 3QUYB 5DRWB 1YZZA 2EC9U 3WFBH 2XG4A 2H6PA 1J0HA 3DVGB 4GQ9L 2IADA 3MYJA 1C16B 1YMMD 1MJ8H 2CK0H 2R0WH 3MLRH 4PREB 1MOEA 3VG0H 4PS4H 5FYLL 4RSVA 4L3EE 1H3TA 4DGVL 5INCA 4P3WA 4XCFH 3O41B 1YJDL 1I3UA 1QPPA 2NTFB 5DD6A 4F15B 1FZOB 4O51A 5BRZE 1MFBL 4M1DH 1FSKC 4QEGA 2ZSVA 2ESVA 1FFOA 5C0GB 4N0YH 4FXKB 4XVUC 1MCIA 1U8IA 2W91A 4D94A 4ZFFA 2NY5H 3LV3A 2ZKHH 1A7BA 1D7FA 2J8UA 2CIIA 4X5WA 4S0TD 3GSNB 3QQNA 4MAYD 1CBVH 5FA3B 1P7KA 4RGNB 1W2KT 1IC5L 4UIMB 2NY6B 4UINH 4KJQD 2F58H 4MSWB 5L9DL 2IFFL 4TNVK 3QZWB 5C2BH 2VL4A 5KS9F 3ZKXC 1C7TA 3DTXB 1OAZL 5A2JH 3CSBA 3LKRB 4PJHF 1I9IH 4HULB 1G6RH 2IAMC 5CFHA 4RMRA 2D4FA 5DURD 2DIBA 4FQIH 1WSST 1NGPL 1HZHH 2HTKD 4OB5L 5DD1H 3S4SG 2XKNB 1AE6H 3MOAH 4XZUA 3UTPE 5CINL 3DUUA 4XC3L 1JGVH 2MHAB 5HGBA 1YEGH 1AY1L 4JFPA 2F54A 5BVJB 4NQDB 4RGNE 2ARJQ 1DBMH 2AJUL 2MSPA 3F5WB 2JCCB 1E4WH 1YY8B 4EN3C 5JNYB 1WFTA 3MJ9H 2GTWB 5KW9L 4HDIA 5IP4A 1DQLH 3T0ED 4X6DA 5JHLH 4N8CL 1X5AA 3KPOA 5DI8A 5F9WB 3WIIL 4OGYL 2VDNH 1QOKA 5A43C 5GS2H 4BH7A 4QOKB 1XGTA 3RWEA 1QR1B 4U3CA 2H9GB 3OHXA 3U0TA 3P77A 3DIFB 2F53A 1KTDA 4UV7L 4Y8DC 4OLWH 5FAAA 3MOBL 4K71B 3KPPB 3QUXA 3JVGA 3NCJH 1K6QL 1P4IL 4ODBD 5DMYA 5T33L 1CL7I 3VH8A 4Q6IB 5LGJA 1BPVA 4P3DB 1T4KA 4NQDE 2XA3A 3CK0H 3K2UL 3VFSB 2ITCB 2P45B 1RJCA 1T0NB 2JCCE 1NC2D 4OCYL 2R2HA 5IBLC 4MQXC 4FTVD 1FDLL 4LLMA 4PY7A 3HUJA 3Q6FB 5TE7H 5I1IH 4JDVA 3U83A 4GFTB 5ACMA 2V17H 4QOKE 4YE4H 2GJZA 2P8MA 3PIQB 2R4SL 4QXUH 5C0AA 3I75A 4PLJD 5EUKB 2FJFB 3SCMC 4K07A 4KQ4L 3P9MB 1WFOA 3D0LA 2V9TA 1AQKH 4P4RA 4NIKB 3BGFB 1PBYA 1SYSB 4IRZH 2VH5L 1QPXA 4P5TB 2Z0BA 3RX8A 5K9OB 5E6IB 1CGVA 2C3VA 4MDJA 3GK8L 1KYOK 5CD5C 4HFWB 2VZ1A 1DBBL 3C60D 3GFUA 4NQUA 3TJEH 2DQCL 4IS6B 3AB0C 3GUTB 3RFZC 1NGYA 2JLLA 5JR1L 4U1KA 3TZVC 3UPRB 3M1BB 4NQVA 4R4ND 1CXLA 4JN1L 4J3VA 5C0RL 1YEJH 1B2WH 5INDA 1MCJA 3VFWB 5GRZA 4E5XA 1K4DA 1QO3A 3O8XD 3UJTL 3WSQL 3FAWA 3T77A 1DDHB 3A67L 4FQQB 1RHFA 3G5ZB 3ARGB 3MA9L 1DUZA 2DQEL 4RISH 3QDHA 4ONGH 4KROC 3D85D 5KVDL 3BD3A 3X12A 1T7YA 1EHXA 1LP9F 4K3DL 5DFWH 4WI6A 4XP4H 2OJEB 3VFNB 1JYNA 1YEEH 2APXA 4MJ5B 1A1MB 1SY6L 3GSWA 3MO1B 3MV7D 3VXMB 5DT1L 1MHPL 3SGJA 4Y19D 3BXNA 2XPGB 4C54A 5C07E 1OTUD 3AS0A 1QLEL 1G7PB 2JJTC 1CK0H 4C55A 4DK3A 3QT2A 4Y89A 5ID1B 1NMCC 3RHWK 3BPCB 1PSKH 1V7NH 2O5YL 4R96B 4U1NA 3VWKD 2WQRA 1TQBB 4NM4H 3TV3L 4H1LB 4N9GB 2GK0B 4X6EB 1MHEB 5CEZE 3W0WD 4YIQB 2PO6B 2V5RA 2B5IB 1EEYB 2X7LB 2Y07H 5E94B 4FRWA 4DEPB 5I1KH 1FYTA 4DJMA 1QFWH 4K3JL 4OZIF 2R69H 2AXGB 1J7VR 4WCYH 3VXME 2NY1C 4XC1L 4PRIA 4WEBL 2ERJB 3U0WL 4PLNC 1QLRB 3BZEB 3BIKB 1IQWL 4OGXH 4YPGA 3SE4A 2HT3D 3I3BA 1MWAH 4WGWB 3NA4A 4WIQA 5HI3D 1FGVH 2A74A 3VXOA 5EZOL 1UXWA 5E2JA 3LHPL 3S4SB 5D1ZA 3P0GB 2Y6SD 1NDGB 3KS0J 1IEAA 3OKYA 3HE6C 2NY0B 4KZEL 3SKNA 3QUZC 1H8SA 4PGCB 3VXSA 2Q6WB 3RTQD 4F7EA 5KN5A 2ITDB 3OJDA 4CVZA 5DTFA 1KELH 4QRQA 4YHIA 3FZUC 2FBJH 3DX6A 4A2LA 2CRYA 4G42B 2ATKB 1U8MA 1ITCA 4X4YB 4NOBA 4HWUA 3RNKB 5BVPL 1FORH 5LAXB 1LO0H 1MFAL 4NN6B 4AT6A 2F19L 1T0PB 4NQSB 2K3TA 2X9XA 3VDBA 5FUOH 1NFDA 1LVEA 5F96H 3KYOB 2NCMA 1LK3H 3GJEA 2AQ1A 1UZ6F 3FO1A 3U6RA 2WMPA 3ROOA 4ZS7H 1CD1A 1H3WM 1TXKA 1IMHC 3L5XH 5GZND 2AEQL 2B7DT 1EEZB 1T1WB 1J1OH 2BNUB 2Y7QA 2GFBB 5D7JA 4XBGA 4OZGA 4L9LA 5C8JB 4IJ3C 1L6ZA 3NABL 3VW3L 1SY6A 3MBXL 4MD0A 4N68A 2D7TL 4BH8A 4PRPA 1IKNA 2R39A 2RBLA 4U1SA 2VZUA 3BKML 4HPYH 1CD8A 4DN3L 4ZAKC 3EO9L 3A6CL 3ESVF 3P11L 1S5HB 3EYQD 4P46D 2V9RA 3R0MA 3UYPA 1JNHB 4FS0A 1A6TB 1XH3A 4NCC2 4PGBB 5JUEL 2D0GA 3RWIA 5DO2D 1KACB 4FQLH 1M6OB 4BA8A 2JE8A 4BKLA 3PUCA 4RAUB 3SO5A 2AJZB 5D9SA 3EKCA 5IFJA 5AEAA 2ZUTA 3UJIL 4S1SH 3QQ4A 4WO4A 2OSLA 1QKZL 3LKQB 3ULSA 5LGKA 3DMMC 1KTLB 3HN3A 2H26A 4CVUA 2ZPKL 2Z35A 4P23A 3HPJB 1T1YA 2CIKA 2BFVH 4UDTA 4KI1A 5D2NB 1I1AB 3HNSH 1P84K 3OQ3B 4CN1A 4R0LC 1A6WL 4PJBB 4BUHA 1CLYH 1QZ1A 4YHZH 1X4YA 3IFLH 1JGLH 4K7PX 5IBUB 5LWYH 4YZFF 2HMID 3F6IA 4AYFA 4WU7B 1TJGH 3N1FC 3S96B 3MODL 4GQPH 3SDDC 1Z3GH 2Z8VC 4MLSA 1T0MA 4MJID 3V0AC 4PV9A 1XCQB 3CFIC 3OR7B 4Z0BL 4MAUL 1KLUA 4MJ6A 3WD5L 3V95A 3SDCA 5D2NE 8CGTA 5I1DB 2HVKB 1FNSH 1S9WB 5DMGC 5FGBA 2VLRE 1FNAA 1RVFL 5CMAA 3E2HB 3NFNA 3WUWA 3FT2A 3FCTA 3MYJB 3QIUC 5EN2A 4JREB 1UADC 2OXHA 2Z93A 4QHNA 2X6MA 1JWMA 4DVRL 1K8DB 2GITA 4YHYC 3ARDC 3JV5A 4KXZI 4Z7NE 1V3LA 4L3AA 4N1CA 2H8PA 2R2EA 5INCB 1X5HA 4LASL 4HXAL 3ARPA 3MGTA 1I8MA 1U93A 5JDJA 2BSRB 4CN6A 2HRLA 1DQTA 4O51B 1UWXK 1G7HA 3ULVL 3B6SA 1H3GA 1YEFH 1QBLL 1I7ZB 2ZSVB 2ESVB 4WNQA 1FFOB 1ZV5A 5GS2D 1MREL 3AXLA 3MV8D 5CEZH 1KCSH 1JNNH 2KZ1B 1E0OB 3OXSA 1OGAD 3LV3B 3WJLC 5E8PB 1DBJL 3HS0A 1UM5L 1TQCB 2J8UB 1XIWD 4X5WB 4MWFA 5F9OL 4HIXL 3DROA 1HHHA 4JRYD 3MREA 1CFBA 1P7KB 1G7IA 1ZLWH 2VZVA 2UUDK 2YBRA 2P5WD 4RA3A 1U3HA 1H3XA 3U4EA 3ALXA 3OL2A 4M7KH 4X80H 2XZAH 4KVNL 1U3JA 1EEUA 3IJSB 4H1LH 2ESVE 3RIAF 3C5ZD 4K94H 4N8PA 2GQHA 4XZUB 2X10A 3V52L 1MNUL 1R3KB 3DUUB 4FFZH 4HGKC 4G43A 2J8UE 5EOTA 5C09B 5HGBB 1MCOH 1NGWA 4Y2DC 3TH4T 4PJGA 3VGGA 4ZPVA 5H35A 4JM2A 4BSWA 2Y36H 4NKDA 2BSSA 2MFNA 2MTPA 2YWYA 1KXVC 3G6AB 1TCRA 1KEGH 3CDFA 5MP6H 4YHLH 4HDIB 4X6DB 1PAMA 5JXED 4M5ZH 2EO9A 2NXYD 1J10A 2GJJA 1RURH 3I50L 3O6KH 1CLCA 2EH7L 1UENA 3O2VH 2GAZA 2LVCA 5D6CA 3RWEB 5TQ2L 3TVMC 3OHXB 3U0TB 3QUMH 3P77B 2F53B 5C09E 1T22A 3QUXB 4XNUL 1ZEAL 1SBBA 3HI5H 4X5LA 5LGJB 3BP4A 5MEOA 1T4KB 3QXAA 1KGCE 3ET9F 4NNPH 3VI3F 3I02A 1CD0A 4GBXD 4PRNA 1BQHG 4XNZC 1Z0NA 1U2HA 3FN0L 4O2FA 1DL7H 5EBLA 2WAHA 1G7LA 3PWJA 5TQ0H 5ABDE 5L6YL 5D7IA 4X6DE 2XWBA 1X5YA 4J4PC 2VLKA 1LO5A 1N6QH 4JDVB 1H3PL 2BNQD 3ARQA 2FGZA 2GJZB 2P8MB 2WUCH 5KSAD 3U7YH 3IFOA 5C0AB 2LE9A 3SKMA 3UTSD 4TUOA 2F53E 2YPLD 4OIIH 1F4YL 3OB0H 3PWLA 3LDBB 1SQ2N 1JNLL 4P4KA 3JTTA 3UC0H 1V7ML 2P1YA 4P4RB 3UYOD 2AW2A 4ZO7A 1OVZA 2R1WB 3I85A 5T1KA 4PRHD 3F12A 1N7MH 5D96C 1YNLL 4U1IB 4L3ED 3MUZ1 1UG9A 2A77L 2C3VB 4MDJB 1OOAA 4HJ0C 4YO0B 2HKHL 4LDEB 4M7LH 1N5AA 3UO1L 4UT7H 3IDNA 1PFCA 5FHBH 3QFDA 4QRTA 5DA0B 1Z6JT 4PB9L 4Y2OA 1XGUA 1NGYB 5M95B 2WBJB 4HZLA 5J12B 5MEPA 1A7QL 4HGWB 3U82B 4BQ8A 4XBEL 5C0AE 3L3GA 2WBKA 5INDB 4M6AA 3LEXB 4E5XB 1QO3B 3H7BA 2EEAA 4LDLB 3T77B 4UAOB 2ICWB 1DUZB 2FH6A 4KHTH 4JFZH 1KB5B 4GG8A 2V2XA 4X4ME 1K8IA 1A7OH 2Z31C 1GCFA 2CLZA 2QV2A 4B7IA 2EIBA 4LRIC 3RVTD 2JK5A 4OCNC 3WJJC 6FABL 3QO1A 5BV7B 4TPRH 2EDHA 3BPNC 2D0HA 2J2ZA 1WGOA 3BXNB 1ZHLA 1D5XA 5IVXF 2A1WH 1NANI 3THML 1UQSA 4U1NB 1N8ZA 2ADFL 1S3KL 4JZJC 1T89C 4QGTA 4U2ZA 4KJYB 5CCKH 1ND0A 5LBSL 3UEZA 2Q20A 2YSSA 1GOFA 4B50A 5JW3L 5GS1A 1S7RA 2ID5A 3QULA 3RVWC 5HD8D 3DARA 4OD1L 1FYTB 1JHTB 1L0XA 3R0NA 4NO5B 4LLVB 2DOCA 5JIKA 4RGND 5KVMC 3IJYA 4PJEA 5DQ9A 2YOCA 4POZC 2OMNA 1UKSA 1CGWA 5I1EL 4FG6C 1OCWL 2O5XL 4YPGB 1CVRA 1W0VB 3MLYL 5TDOB 3JWOC 3T4AA 3P4NB 2CR3A 1IFHH 2A74B 1A5FL 2X5PA 3VXOB 1UXWB 4YHOL 3LEVL 3LQAL 3ABZA 5D1ZB 1VHPA 3JTSA 1R5IA 3UTTA 3D39B 1SEQL 5CD3A 1ZTXL 3IDUA 3SKNB 4CADA 1CQKA 2QQNH 3VXSB 2XZCH 5KN5B 1PDKA 2AJYL 3OJDB 5CSZB 1FYTE 5DTFB 2AJXH 4YHIB 3CJJA 2WLYA 3DX6B 1NBZA 5IF0A 1I9RL 1U8MB 5I15H 1Z9SA 1IGYA 3KXFB 4PJ7A 1SM3L 3OAZH 4NWUL 3L7FA 5J0BA 1NAKL 2B1AL 2E6QA 5IMOA 4P59L 2XWTB 5GGSB 3VFTB 4GKOA 4R6UA 3TO4A 4WU5B 1KV3A 1NFDB 2F15A 5KOMC 3F65A 4QOKD 2IGFL 4PJ8D 3FO1B 4Y4FA 1UM6L 3IS0X 4GRLA 3D39E 3VXTA 1KJ2L 3ROOB 2YRPA 3GMPB 3U1SH 3BESR 3VXSE 2DLIA 1BQHB 4JR9H 3IYLW 4AMKL 3U36A 1A6UL 3SN6N 5JPMA 4LHUG 5D7JB 2IG2H 4XBGB 2BXZA 2W9DH 1G7QA 4L9LB 1I8LC 1R3IL 1G7MA 3KXFE 4JCMA 4BH8B 1WQVT 2DQIH 1U42A 3HRPA 4PRPB 1LE5A 4ISVA 3X14A 3QDJA 2SEBA 4KK5D 3SDXA 4DKEH 1NFDE 2W0LA 2G60H 2MKLC 3N0PB 2FJGA 4NBXB 5JOFB 1R5VA 3V4VH 1XH3B 2Y72A 2ZG2A 4PRAA 4BFEA 1D6EA 1CICB 2A9MH 4J6RL 4F9PA 3PJSB 3RWIB 3U79A 3ZE1F 1F3RB 3QNYA 1HHKB 3RA7L 4X9IA 4P5TD 5E2WL 4KJQC 4BKLB 4Q0XH 3DJ9A 5E6ID 2P5EA 4NQXB 1UCTA 5D9SB 3NFPA 4ODSH 5F97E 2DQHL 4XP9H 1OP9A 4PRPE 3QQ4B 3SQOH 5JDSB 4YFLI 3ULSB 4NC1E 4HF5L 2H26B 5DJAA 2HTKC 2IQAA 4Z7UA 4P23B 1RUPL 1INEL 1T1YB 3FQTA 4K8RC 3BWUC 3H6JA 2HAZA 4OLXH 4KJWD 4X9FA 3VGDA 1BQLH 3DSNA 5CEZD 4JO4H 1YEHL 4KK9D 3ARGD 4EI6A 5HPOA 1KT2A 5L2KD 2YEZA 1JFQL 5IFHL 2VIRA 1AQDB 1KG0B 2UZXB 3S34L 4M48H 1NCCH 2HA1A 5IKCA 1B9ZA 1HHIA 3RZCD 2FO4A 1H9VA 4Y8AA 1HNFA 3VFGL 5D71L 4M62H 4YDIL 5TDPA 3QEQA 4DUXA 1DBAL 1T0MB 4TOYL 1FFQA 3KYNB 5CGMA 1FGNL 3VXMD 3B5GA 5MEQB 2ZJSL 3S98A 2CJUH 4H0HB 2JELL 1KLUB 1UH3A 4MJ6B 4LK4A 3A6BH 4U0RB 1WIOA 4LPWA 3GIVA 2MCPH 4HMDA 3SDCB 1WBYA 5DA4A 2Z4QA 1F58H 3WFDL 2AJVL 3WDHA 4M1CC 1KJ2A 5CMAB 3NFNB 3FCTB 5IUSA 3GSXA 5EN2B 2VLJB 5GRVL 2Z93B 4QHNB 2PO6D 5E2TH 1X4ZA 5E2UL 3N1MC 1OB1A 5FGCB 2X9WA 1B4JL 1NCWH 1RZJL 1P7HL 2CLVA 5D7LD 1F11A 2R2EB 4Z5RA 5IB4A 5A2LH 1P4BL 3MGTB 2AABL 5DJ2B 1A6AA 1U93B 5B38B 1KC5L 1BZ7A 2P49B 3VI4E 4YH6A 5DVOA 3QIWA 3TBVA 3ZKQD 3BH9A 3V79C 3ULUE 3JSSA 4WNQB 3CLEH 3AXLB 4IDJL 3RWJA 1WCBB 4MJ4A 1U8QB 1AY1H 1FL5A 1KB5H 1M7XA 2R2CA 4H5SA 3IRPX 2VLJE 5KSUB 4Y5XA 3CSPA 3HS0B 4GRWB 2NY0D 3VG9C 3OR6A 5FGCE 3BP5A 1YC8A 2DJUA 4MWFB 3RI5K 1OQOA 2AJUH 2FHFA 3N9GH 4MX7A 3C60C 3SO3C 4Z7WF 3KPQA 1IM3B 2PTTA 3DROB 1HHHB 5BJTA 1EEQA 3MREB 2HKFH 5ELIA 5BV7H 5B3JE 4IOFD 1G7IB 1MRDH 4MXQC 4N8CH 3ZO0A 1U8OA 3RWHA 3V5KA 2YBRB 1P9MC 3TESA 1U3HB 1AC6A 4R4NC 4PBXA 2B8OT 3VXUA 3MV11 3VMPA 3O8XC 3HI1B 5DEGA 5KBNC 1FH5L 2FBOJ 4HWBH 5EO9B 5FO7A 4FMKA 4I0KA 3MLVL 2GCYA 1W72B 2E7BA 2CDGA 3ZT6A 2I07A 1P4IH 4M1GL 4GRWE 5EOTB 5CKGA 3MBEA 4V2CB 5B8CA 2AEPL 3WIFA 1F4WH 2VAAA 3GMLA 1YUHB 4Q6YA 4LHUB 1HHGA 4XPTL 4D0DA 1FFNB 2D7NA 1KJMA 2VB5A 4P48A 4JM4L 1OM3H 4NKDB 3IETA 1EDQA 4I3RL 4JAMA 4PJAA 1FE8H 2YMXL 3V6OC 1FDLH 2WLZA 3AU1A 5D1QD 2J8HA 1OTUC 1Q9LA 1KSRA 3OKNA 1DBKH 1WWAX 3BQUA 4ETQA 4O5LL 1RUQH 2F74A 1BFVL 4QRSA 3ZDZE 2XQYG 1NLBL 4U7SA 1TJHL 3FO9A 2GI7A 2GAZB 2VN4A 5D6CB 4KQ4H 5HTSA 2XA8H 2HWZH 4UV4L 2HFFB 1JP5A 2HRPL 4FQCH 5E0QA 3HA0A 2E7LC 2QJDA 2FJHA 3BRGC 1T22B 3LCYA 3PE9A 5AYUH 4HC1L 4PJGE 4XNXL 2JJSA 4OZHF 5MEOB 3QXAB 3GI9L 3I02B 2KBGA 4AG4L 2DKSA 4PRNB 4FQXA 3Q5OA 1JHLH 4O2FB 1DANT 2DQCH 1G0XA 4XP1L 3PWJB 2HT3C 2R56H 3ELAT 3CX5J 4ODWA 5D7IB 5HI3C 2XWBB 5TDNB 2DKMA 3P9LB 4KFZC 2RAMA 1F4XH 1GC1L 2D7QA 2VLKB 1P5VA 4JN1H 2YKLH 1I1YA 5I8EA 5I1JL 5C70A 3GSQA 1HYRC 4EQ3A 4NQEA 3FB7B 4TUOB 2AJSH 4F7MA 1I1AD 3RTQC 1RK0A 1KEML 4JJHA 1LD9A 3PWLB 4P4KB 3JTTB 4BFBD 4WI5A 5T1KB 1LGVA 5IROC 2GYSA 1O7VA 3QCUL 4K3DH 1AO7A 2JTDA 3H2WA 4JDTH 3VGFA 3FJTA 1CE1H 2UWEF 2YA1A 1N5AB 1QTYT 5ILTL 5D7IE 2GKIA 3IDNB 4CDHA 4ERSH 1RU9L 1WBXA 4JZNA 4QRTB 3ULVE 2VLKE 5EO1A 1DQQB 4QHMB 3T0AA 3DI3B 1XGUB 4JFOB 4HIJB 4XGZA 4FABH 4CNIA 4KRLB 4HZLB 5KTEH 1XAUA 4Z76A 4JY5H 5MEPB 2WWKT 1B4RA 1MVUA 2NX5A 2IEPA 2BDNH 5FUCE 1MCWW 4H26A 1TJIL 4U1MA 3RRQA 3H7BB 1RK1A 2V9QA 4URTB 5GZNC 1F02I 5D2LF 4NC2B 1I4FB 5I74B 4Y16A 2DWEA 4OAWA 4GG8B 3HZMA 3IXAA 1K8IB 3H9ZA 4Z7VA 1UKQA 4K7PL 1Q72L 3EBAA 2YUZA 2CLZB 3QPXL 4TUKL 1U9KA 2JK5B 4HCRL 3QO1B 3C87A 3BYYA 5KSBF 3QISA 4ZNEA 3IDYC 4F7PB 3DHMA 3EYQC 4P46C 4FFWD 1D5XB 3BPLB 4I4WA 4M4RA 2VR5A 1Q9KA 4LCYA 4HT1L 5EBMA 5ESQB 1Z2KA 2QQKL 4TRPL 1UQSB 1C08A 1EO8L 3EFDH 2ESVD 4R2GB 4HBCL 2V2TA 4L8DA 1N8ZB 3KPMA 1OAYH 3QPQD 1MCSA 2PYEA 3DGGB 1MJUH 1GIGL 5AUMA 1NC4D 4HC1A 4YQXL 3CU7A 1ND0B 2BX5A 2PR4L 1GGIL 4YHMH 5GS1B 1WFNA 4L8SC 5T1LA 5DUPH 3GKWL 1DANU 2VNCA 1QG3A 2E6PA 1OLLA 4YC2B 3IJYB 4LVNC 4PJEB 1MCDA 5DQ9B 2CGRH 1CGSL 4M8VA 5E4IA 1JZ6A 2VXUH 2F19H 3VXNA 1VPOL 4HUNB 1I85C 4B53A 4WHYG 3T4AB 1ZT1A 3ULUH 4ZUUB 1NCAL 2GSGA 1T6VN 4YXLL 2VITA 3TN0B 3VE0A 1YEKL 4NBZB 4XPFL 2CRZA 3EYVA 4LSQL 4Q7DA 1N26A 3PP3H 4JQVC 1A9BB 1R5IB 4NGHL 3UTTB 2EEBA 5BMFL 2DLEA 2HMIC 4CADB 4XMPH 5T5FL 4F58L 2OTPA 5C09D 3IDGB 5HDLA 5EB9A 4GG6B 1GZPA 4HUXA 5FYKU 3BO8B 1ZT4A 4JPKH 3O3EB 1KGCD 2VC2L 3VW3H 4PJEE 1TNNA 1NBZB 4H25A 4QRRA 1H5BC 5IF0B 1CIUA 1QBAA 1Q1JL 1IGYB 4Q97A 4LKCA 4PGZA 1J87A 4YDLC 4Z18A 3EO9H 3TBSA 3LMJL 5IMOB 3CDGA 3TO4B 5B3NA 4OM1L 2APFA 2IALA 4Y4FB 3W11D 3UTTE 3NPSB 3VXTB 4GRWH 1C5DA 2F53D 4ZUTA 5IV2A 4IHOB 3W2DH 1SJVA 3QUXD 3O9WA 4XAKE 4XCYB 4GG6E 3O6FD 4PIRF 2GHWB 1IEBA 4LL9A 1BZQK 4DN4H 3U36B 1D6VL 1A7NL 4AH2B 2IPTL 4JB9L 4M9OA 1G7MB 4X4XA 3ARBD 2ZCHL 4Y0GA 3HZYA 1PZUB 1LE5B 4ISVB 4RFOH 3X14B 3D2UA 2SEBB 3NH7L 2PTVA 4HK0B 1DSFL 1TZHA 1W72H 2ZCKL 1A6WH 3RWCA 4YBLC 1KFAH 1XIWC 1MRFL 1R5VB 3BKCL 1CLZH 4X7SH 2RQ8A 2Q76B 4PRAB 1AR1D 1BGXH 3KNBA 1D6EB 2BCKA 5F6IC 5AZEL 5DUBA 3TT3L 3QNYB 4Q2ZA 4JRXA 4ZFGH 3K2MC 3L5WA 1WTGT 3AVEA 3QG7L 2WINA 4NM8H 3MZGB 4FP8L 5CJ5A 4G9DA 1KCLA 4Z0BH 4MAUH 4G6JL 3ZHLA 2DICA 1D9KB 1RZFL 1GGYA 5DJAB 2WBJD 4HPOH 2IQAB 4Z7UB 5D93B 1ONQA 1A2YB 1NJ9A 3SPVA 4Y4HC 1VFAB 3WYRA 3CIQA 3TH3T 1LQSR 2EDYA 4ZOAA 3BD4A 4NOFA 2NZ9D 3WE6B 5IGXL 2GUOA 3CZFA 1TVBB 1T7ZA 5FXCH 1CVSC 4K3EH 5CHNB 3O6MH 1HQRA 2YEZB 2W0PA 2VIRB 3ARYA 4LKXA 3A6OA 1U92B 5IKCB 1HHIB 3WLWC 3RAJL 4WWKA 2FO4B 4JN2A 5HPMA 1A3QA 3QEQB 4K7PY 5FECA 4OCRH 1KNOB 5DVKA 3ULVH 3U0PA 4MNGA 1VKXB 1LEGA 4XAWH 5DHYA 4NN7B 1OAUH 3CFBA 5EU7C 4Z7UE 4I48A 4PJCA 1MREH 2X4QA 4WFHE 1C5CL 5JHDD 2JCCF 5SWZA 3GIVB 1WBYB 3SY0A 2YC1A 5KJRH 3E3QC 4JKWA 1Z9OA 3U9UA 4A6YB 1FCCA 1KJ2B 3IDXH 4ZOCA 3D9AL 4HS8H 3JWDC 2GTZA 3GSXB 4YUEH 3SE8L 4GBXC 5GPRA 1AGCB 4YEFA 3DNKA 1OB1B 5EH1A 2X2YA 1YEDB 2CKNA 1FYTD 2CLVB 5ESVA 4WGVB 1F11B 3DETD 4Z5RB 2R0LL 3QEQE 2KL6A 1JN6A 2D9CA 4UQ3B 4NPYA 1BBJB 1BZ7B 4X9GA 2UZYB 4L29B 5J7CC 4KVNH 3ES6A 1MCEA 3WDIA 5KSAC 3QIWB 4L3CB 2CR6A 3BH9B 4JVWA 5JW5A 1NL0L 1YY9C 4L4VB 1FAIL 5TF1L 1TPXC 3BI9X 3ECBB 1L7IL 3AS1A 1BHGA 2ARWA 3FQUA 5D1ZD 1FL5B 1MHHA 2R0ZL 3D39D 3ETBF 5C2UB 5DD3L 2YUVA 4KRMB 3LD8C 1CFNA 3OR6B 3BP5B 2VDKL 4MX7B 4LLYA 4UDUA 4WUKH 3SGKC 5I1AA 5SX5H 1BWWA 5MHSD 3LRSA 1U8OB 3RWHB 5EULV 3V5KB 3QXUA 2DLTA 2YN5A 1IGCL 2J6EH 4PY8J 1AD9B 3QDMA 1OAKL 3KXFD 5TE6L 5D1XA 2EH7H 4GMSL 1UJ3B 1FBIH 3OF6A 3VXUB 1SBSH 5TQ2H 4HZAA 5LQBH 3C5JA 4L4VE 5DEGB 1UYWH 5FO7B 4UUJA 3MRRA 4OI7A 1J8HD 4FXGA 5FUZL 4LSVL 4GOSA 1PEZA 4XNUH 2I07B 1J11A 4LP5A 3RU8L 4BFIA 3L1OL 3RGVA 5JQ6L 3MBEB 2VAAB 3DLQR 3GMLB 3RVTC 3IT8D 1CDGA 3PABB 4KTEL 1HHGB 3FN0H 3OJMB 2YRLA 4F15C 4U1JA 2R8SH 3IETB 5L6YH 4G7VL 4JAMB 4PJAB 2CMRL 4ZO6A 5I30L 1FVDA 3AU1B 1PYWA 1Q9LB 5JIHA 4X99A 3E6FA 4C4KO 3BQUB 1E6OL 4ETQB 3VXUE 2F74B 4KVCH 4OD3H 4QRSB 4JY6A 4AEFA 4AENA 3FO9B 2P43B 4PGDB 1VEMA 1NSNL 2ATPA 1ZLUH 4XMKL 3O2WL 1F4YH 1JF6A 1YDPA 3CVHH 1V7MH 2XTJD 4KUZH 2VISA 2DBLH 4RAHA 1YNLH 2BY2A 2FIRT 4AEIH 5F7FA 1AXIB 3TM6A 1CICD 4XP5L 1ZSDA 1NEZA 2FLRT 3L3OA 4JPWH 2FX8H 4TTDD 3TYGL 3P4MB 3B9KA 4S1DD 1T83C 3H3PL 4FQXB 4PJAE 5DHVB 3TA3D 3V6ZA 3MLXL 1Q9WA 5F6HJ 3RVUD 3MV9D 4PB9H 4C56D 3NZ8A 4ODWB 4NUGH 3Q3GA 4W6WB 3RWDA 1B0RA 5CGTA 4EDWL 1AR2A 4P5MB 2VXQL 2Y5TB 4PJHB 4XBEH 4Z7QE 1GSMA 1I1YB 2YUXA 5I8EB 1PY9A 4WVRA 4M43L 4NQEB 4OKVA 3IFNH 2VN7A 3NIGE 5EZLA 5IB2A 3BUYA 4F7MB 1RK0B 4CJ0A 2Q7YA 3MACH 4MVBD 4BK4A 5ESAA 3FOLA 4D8PA 3TC9A 1DE4A 2XRAL 5E6ZA 2P4AB 1ORSA 3PV6A 5IW1A 1AO7B 1XF3A 3OKMA 5J11B 3JBG7 3WFCH 3CDCA 5E03A 4UTBL 1IGJA 4HUVB 3G5YA 2AQ2A 3ARRA 5CJBA 3BP7B 1D5IH 2G2RA 2EXWC 2PXYA 3C5SA 3IXTA 4QXWA 1J05A 2K1MA 3IRZA 5MENA 2YUWA 1WBXB 1NGZA 2UYLA 4JZNB 4PG2C 4N0UA 5EO1B 1PX4A 2J12B 4PJHE 4XGZB 4PJ8C 4CNIB 4YBQD 3OXRA 4Z76B 4U1GB 2AK1L 4NQEE 2EZ0D 1S3KH 5C92A 3ULUD 4H26B 5J1SC 4S1RL 4W4OC 3KLHD 4EXPX 2V5YA 5LBSH 3S9DB 4Q6IC 4XCCL 5EPMA 1CS6A 4Y16B 2A9NH 2DWEB 4RWYH 4OAWB 2VLJD 2DQUH 4RX4A 3IXAB 3MFFB 2OZ4L 1AO7E 3NFSH 4Q58C 1KENL 2EDXA 4Z7VB 3B8YA 4P9ML 1QA9A 4HXBL 1OF2A 5I1EH 5IB1B 3H9SA 2NW3B 3BX7C 1ZT7A 3FT3B 2LTQC 4KK5C 3TWCL 5TJWK 3IAGC 5HGDA 4Y4KD 2VDQL 3UZEA 2W60B 1PG7H 4I4WB 2NX5E 2VQUA 1Q9KB 4LCYB 4ZDHA 1C08B 2R2BA 2V2TB 4L8DB 1SJHA 3KPMB 3BGFC 3C2AL 4X9HA 2W38A 5FCUH 4QNPE 2PYEB 2A6JA 4D9LL 4HFUL 3MTRA 4P5TC 5AUMB 4DCQA 5IJVA 2PW2B 3T2NL 3BSZL 5ICYB 2E7HA 4U6YA 4Z7VE 5T1LB 4MA8H 4MCYA 5E95B 4NO0D 4UTAL 5L0QC 3QAZC 5ICZA 4AJ0A 4Y7MA 3T0XA 3EOAA 3FB8A 4G6FB 4LARH 2CO6B 2EXYD 2IAND 1CF8H 1ZKAA 4ODHH 1U3HD 5I19L 4PJFA 1ZT1B 2IGFH 1R5WA 1FV1A 2GSGB 1UH2A 4A6YH 5EORL 3UROR 4KK9C 3EYVB 3DOSA 2PYEE 3L3IA 3DV4A 2MMXA 1U8LA 4E41B 1KPVA 1N6VA 3BGMA 1X5LA 3MRFA 2EYTB 1RSFA 3RZCC 3WKNA 1IAIL 4RIRB 5BS0D 3VDAA 1GZPB 4LHUD 4ZUVA 4PJ9A 1ZT4B 4JFHE 3T2QA 4FA8A 5T3XL 4KZDL 4H25B 1NKRA 4YHKH 4QHUB 1QSEA 3FQWA 2W9LA 4QHKI 3TBSB 2CPCA 4Z9KB 1HXMA 3CDGB 4JANA 4RAVA 3WNNA 4Z7NF 1WWCA 4WV1C 2P47B 4M6NH 2E9WA 4PJDA 5HDBF 2IALB 1JRHH 3EYSL 2PO6C 3CVIL 4PJ5B 3STZA 2B5IC 4E41E 1O0VA 1C5DB 4J6RH 4ZUTB 5IV2B 5GS0H 4R7DB 2JIXD 2QHLA 3DVFA 1RHHB 5TH2B 4DEPC 3RA7H 1Q94B 5IVZA 1T7XA 2OZ4A 3O9WB 4MXWL 2X1QA 1HSBA 4ODTL 1F8TH 2DQHH 3BN9C 2YHGA 4QRRE 1IGFL 1MCQA 1IC7L 4AL8L 2Y1VA 4WFEE 3RVXD 4X4XB 2VZOA 1ES0B 3HZYB 4KC3B 2JF1A 3ULVD 1RUPH 3D2UB 2BP3A 4HKBA 4EOWL 4CUCA 3RIFK 4WI7A 1TZHB 4PJ5E 2B2XL 1I8IA 1WT5C 4MMXC 3MRNA 5GHWL 5HYFA 3KNBB 4LSTH 4P4KD 5I8KH 2BCKB 4IOFC 5DUBB 5T1KD 3AS2A 3NVQA 4Q2ZB 2BVYA 1UXSA 3LEYL 4JEGB 4YDIH 5HHOA 3L5WB 3P0VH 1NEZG 4MNQA 3ZHKA 4D9QE 1GGBL 4TOYH 3V4PL 1FGNH 4G9DB 4GSDL 5TF0A 2J8UF 3W39A 4WEUD 2A6IB 1DLHA 1OPGH 1BWMA 2NXZB 4DAGL 3OZ9L 4KJPD 1QNZL 4M7JL 4NRXA 1S7SA 1ONQB 1KPRA 3SPVB 4LPCA 5IBTL 1CFTB 3JXAA 2EEDA 2YD8A 5E2UH 4YGAB 2GUOB 4TTGA 3D18A 2EYRA 1B4JH 1T3FB 3O4OB 1HQRB 4PV8A 5MI0B 2GSIB 4JVUA 4NZRL 4LKXB 5D1QC 5DHVH 1Q9OB 4ZO8A 4LLAA 3TBTA 3RDTD 1DCLA 5HPMB 2MWCA 4TVPL 5GRJL 5FECB 1YQ2A 3TH2T 1IAIM 4W70A 4MNGB 4HLJA 1P5UA 4KQ3L 1DFBL 1LEGB 5DHYB 5DSCA 2HH0L 3TPKA 3CFBB 3D5OF 4PJCB 1ZHKA 3LSOA 3VWJA 2DM7A 3SY0B 1A6ZA 3WNLA 1NCTA 4LNRB 3RGHA 3C8KA 3U9UB 4R7NA 4XPHH 4IRJC 4X6DF 3GSVA 5CLWA 3IF1A 4NYLA 4JO3H 2GTZB 4CU8A 1A02N 3DRTB 1WZKA 1P4LA 3CH8A 4KTDL 2FGWH 1JL8A 4G8IA 1K3IA 2MPAH 3AUVA 1JN6B 4JHBA 5I66A 3PGFL 4NPYB 4MNGE 3BVNA 3PHSA 1FG2A 1K9TA 3L7EB 4P3CH 3HC4H 2QQQA 4HX1B 4NNXB 5J9PA 5I71B 3ES6B 4UILH 1FH5H 1GVIA 4UNVA 2HG5A 4PJCE 5JW5B 3MLVH 1I1AC 2FSEA 4JDZA 3FQUB 3TN0D 2Y06H 4M1GH 3OPZH 3AC0A 4YXHL 5I1LA 4RMTA 3BT2L 4I0PD 2AEPH 1MJ7L 1MHHB 3UTTD 4I0CC 3HUJF 1NLDL 1MAKA 1CFNB 5IM7A 4XWGL 4BZ1H 3ARFB 2EH8L 2J3SA 5E99L 4XAKD 3VD3A 2YMXH 1MQKH 4DGIH 2BRRL 1XCTA 2R4RL 3T1FB 3LRSB 1RULH 5FO8A 3V0WL 4XCEA 2BOBA 1BFTA 3QDMB 1TJHH 5D1XB 3FRUA 1T80A 1N5YL 1RZGA 3MRMB 3C5JB 2KZWA 3ZT5A 4OLUL 3TO4D 4YLQT 3E2HC 2HRPH 4UUJB 1KB9J 1LO3H 4UU9A 1BF8A 3U30B 4FXGB 4V1DA 3ARXA 1ODAA 4Y4FD 2IFGA 4XNXH 3O45B 2FATH 4LAQL 3RGVB 3SDAB 3WEXA 4FQHB 1YECH 3BDYL 5IFAH 5E08L 1UVQA 2VDMH 1A22B 3GHBH 4XP1H 4M6ML 4WWID 4U1JB 5AZ2L 1ACYH 1FFRA 3MLWH 4RDQG 2EE9A 2F5AH 1A6VL 1PKOA 3BOVA 3NPZB 1PYWB 4AEHL 4LVHB 3E6FB 3QDME 3PP3K 5HYJD 3S36H 3VFUA 5JOEA 2CD0A 5FYKE 4G6AD 2G75A 3HMXL 1QRNA 4JY6B 1RUML 3BWAA 5LXGL 3QPQC 2HJKA 3BH8B 2ATPB 1KIRA 1KEMH 4TNWF 4X8XA 3ZTNL 4NHUA 5F9AC 1TQCC 5FOBA 3SE3C 1ZLVH 4EI5D 2IAMA 2Q8AH 2VISB 1XGQA 4NQCA 3NAAL 4IM8A 2PCPB 1NEZB 5H94A 4J3SA 3L3OB 1WTLA 4F8QA 5ILTH 3B9KB 1F3JB 1F90L 1FL6B 1Q9WB 1RU9H 2KDGA 2B4CL 3DX7A 4LDOB 1J18A 1F2QA 3Q3GB 3RWDB 3OMZA 4ZFZB 1B0RB 2EDKA 2Q87A 5GIRA 1HQ4B 1JZ4A 3G5XB 3U4BH 4EBQL 1D9KD 4EN3A 1LO4H 1E28B 2AKRA 1INQB 3TCXA 3C6LB 4UNUA 4OF7A 4OKVB 1LMKA 5EZLB 4E9LA 5IB2B 1X5GA 3DVIA 1FVEA 2JB6B 1B0GA 2OCFD 5BZDA 5ESAB 3BMWA 4W81A 5D8JH 4K7PH 1ORSB 4TUKH 2JB5H 3MJ6A 5I73B 3OKMB 4O2CA 2VJXA 3C09B 3G5YB 4XPGL 2G2RB 2PXYB 3IXTB 4O4YL 2BY1A 5MENB 4QRPA 4ODUB 1W8NA 1EBPA 3J8F7 2UYLB 1NGZB 3V5DA 4N0UB 3QI9D 1C1EL 1IC4L 1GC1C 1NKOA 4JLRA 1AGBB 2QQKH 4TRPH 3OXRB 4P2CG 3HR6A 3W11C 4MHHI 2LU7A 1Z5LA 4Y1AA 2EIZA 3P73A 4KAQL 4RFNC 1GIGH 2BNRD 1AGDA 1F6LL 3B9DA 4G3YL 4LFHG 4WUUD 1MRCL 4YK4B 3O6FC 5EPMB 3SGDH 5K9QI 3SCMA 3NCFB 3UAJD 1TZIA 1NFDF 5DMKA 2VZSA 2ARJA 1JZ8A 3LKSA 1QA9B 3ARBC 2O61B 4YFDB 1FP5A 3WV0A 4ORGA 3PDDA 5CWSA 4RQQA 3H9SB 3MLSL 2Q3AA 5MENE 1VPOH 2BC4A 1L9MA 1YEIH 3U46B 4N0UE 1FRGH 2NY7L 4G8EB 1LHZA 5HGDB 3HCVA 3KYAA 4FNLL 4PTUA 3HMXA 4YXLH 1ACZA 2B1HH 3MROA 4OZGF 4BJLA 1WISA 4ZDHB 1CZ8H 5DJ0B 2HFGH 4L4VD 1BJ8A 1AR1C 1ZA6A 5BMFH 5L7XL 1IEHA 1SJHB 1UWEH 3TZVA 1VEPA 2CDEA 2IWGA 2A6JB 5IJVB 4DCQB 2X4UA 2VC2H 3VI3E 4U6YB 5GS0D 2I5YH 4MCYB 3LIZL 5IWLC 5BO1H 3S35X 5I2IB 5ICZB 4R90H 2HT2D 3BE1L 4H8WH 1CU4H 1H15A 3H9SE 3HTLX 2IH3B 3MRJA 5FGRA 4OCWL 3PXHA 5I1GL 5HHPA 5CILH 2WBJC 3LMJH 3X3GL 4HSQA 1FNHA 1P2CA 1G9MH 1XGPA 5ICXB 1IKFH 3AFLA 4OM1H 4PJFB 5EOQL 4OCLC 5ENWA 3KJ6H 5F1OB 5F1NB 1RUAH 1R5WB 2NZ9C 4OIBA 1ADQH 1F2XK 4IOIB 4ZTOL 3CGTA 2ED7A 2JJTA 1KBGL 5DFVC 3TO2A 3DV4B 1KPVB 5GJTL 4Z95L 1T7WA 3I6GA 3BGMB 3NA9H 2M2DA 3MRFB 2Z8WC 3RKPA 1Y18A 3MBED 3G5VA 5E2VH 2DQJH 1CXFA 5AWNH 2EDDA 4M03A 1KJ3L 4ZUVB 5EU6A 4PJ9B 1UA6H 5F93C 5BV7C 3EFFA 2BXYA 3CSYB 5D7KE 3SOBH 35C8L 1OT1A 3RBSA 4D2NA 1YN7B 2FZ3B 4FFYL 2DQGH 1QSEB 1II4E 1LNUA 2ICCA 3NH7H 2R1XA 1EVUA 4PJFE 5CUSL 2WANA 3O2DH 4OSUL 1HXMB 2J88L 4JANB 4RAVB 4GUPA 3IDMA 1DZBA 4PJDB 3GJFA 1BLNA 5DJXA 5E5MA 4JFFD 4KDTC 2YWZA 5C7XH 3STZB 5E4EB 1CL7L 4POYA 1J5OH 1UJTA 5SX5K 3VI4F 4ODVL 5AZEH 3TT3H 4QXGL 5IVZB 1YMHA 4HKXA 3DETC 3U7AA 2N1KA 1QSZA 4LHJB 3ULUF 4FP8H 1HSBB 3HE6A 5CJOH 3EHBD 4HS6A 3QUZA 4LGSB 1UCBH 3QNZA 4YDKL 2I27N 1QSEE 4Q74A 4YXKL 5FYKH 1RZFH 2BVOA 4PJXA 4OT1L 4S2SA 2BSTA 4FOMA 3IKKA 4PJDE 3DXAA 3VRIA 5B3JF 3GMRA 5IGXH 4NQED 4P2RA 4I77H 1XMWA 1I8IB 1ZA3A 2FX9L 8FABB 1FIGL 2DI8A 5F7WC 4P57A 4RNRA 4JO1H 3EYFA 1JV5A 1UXSB 4LLQA 1FLRL 3A0OA 1A4KA 1DN0A 3N1GC 1MCBA