2X89A

Structure of the beta2_microglobulin involved in amyloidogenesis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
b'QVQLQESGGGSVQAGGSLRLSCAASGYTDSRYCMAWFRQAPGKEREWVARINSGRDITYYADSVKGRFTFSQDNAKNTVYLQMDSLEPEDTATYYCATDIPLRCRDIVAKGGDGFRYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY
publication title Atomic Structure of a Nanobody-Trapped Domain-Swapped Dimer of an Amyloidogenic {Beta}2-Microglobulin Variant.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x89A00
2W59A 3P4OB 1IAIL 2AABL 2M2DA 4JG0L 2BOCA 3IXTA 4I18A 2OL3L 4UILL 3SKOB 2XZAH 3HNTL 5JXED 1DQLL 1N64H 4I3RH 1Z9OA 4JO3H 3BP6B 1F3RB 3DXAE 1S9YB 1SYSB 5DJ8B 4AT6B 4PJHE 4RQQA 4L3CA 4G8GA 4JHAH 3VFGL 5CLWA 3P9WB 2HVKB 1HXYA 1FNSH 4X6CE 3UYPA 1T66D 1IM9D 2IMMA 4HK3J 3MLVH 1RI8A 3HNVH 4YXKH 3V9FA 3DSNA 3CSYB 5DR5H 2IF7A 4GJTB 4A6YH 2IQAB 1JL8A 5J7CC 3LV3A 4M6ML 1YECL 1KNOB 3WS6C 2P8MA 3GGWA 3M45A 2OTWB 5BMFH 3NZHL 2H2PD 2YEZA 3QIWC 4C58B 4C59B 5DMIL 3ARBA 2VQUA 1C7TA 3AU1A 1T6VN 3FB6B 1WF5A 2BHYA 4PRAA 4YX2L 3ARWA 3BGMB 4UT7L 2ZCHH 3TM6A 1A6TA 1BM3L 5CWSA 5JQ6H 1N7MH 3MJ6A 1C1EH 1OB1B 4HK3N 2YUVA 3D39D 1NCCL 4YDKL 4KHTH 4ACPA 4RGMC 1H0DA 3OKOA 4O51A 2GYSA 4XNXH 2CRZA 2KZWA 4OUOA 3T77A 3UC0L 1XF2B 4NQSB 2XA8H 2XTJE 4YFEA 4WWKB 2VR5A 5FEBA 2VZUA 1AO7B 3UTZB 4LLWB 2VQ1B 4NM8L 1IAKA 5D6DA 1F6AB 5MEQB 4OAWA 1QLRA 5KSBA 2XTJB 2BC4B 5JW5A 2APXA 4HWEL 1U3YA 3N1FC 1DBBL 1JGUL 4ODWA 1WZMA 3RA7H 4E41A 4LSDA 4Z7OF 4YWGL 1A6AA 2ZUWA 2DQUL 2LE9A 3AAZB 5CCKH 3V4UL 1P4LB 1YMMB 1H3VA 4BJLA 5JW4Q 1G9ML 3KYNA 2X1QA 4M1CC 3U30B 2BRRH 4ODTH 3VWKB 1RD6A 4KAQL 4MCZA 3K74B 3FRPG 3VH8A 4JM4L 5INCB 3NH7H 5B38B 2Q8AH 1KFAH 1YEJL 3SY0B 4HKXA 4WTZA 5ACLA 2NY1D 1A6ZB 4LSRL 5I8OH 1EX0A 1MHEA 1U9KA 3RWIB 4KGJA 3X14A 1JMXA 4HJ0D 2CLVA 3EYUL 3KYOA 4I13B 2DLHA 2DLTA 2H2SD 1P4IL 4EN3A 1EHAA 2HT4C 2A38A 3NFSL 1PZ5A 1BWMA 4H26B 4J4PD 3WHE1 2DQTL 5IUSA 1UA6H 4NKMA 3MV8A 5KSUA 1TJHL 3UPRA 4ZXBA 5H37H 3FCTB 1X7QA 2C1PA 5GS2H 1X5LA 4YR6A 1UXWB 1TQCC 3HZVA 3LD8C 4NJAH 4OGYH 1U6AH 5I74C 5IB3B 4HG4J 1KEGH 1QSFD 2Z0BA 1NMAL 1NBZB 1N6QL 1UT9A 3K2UH 5CILL 4OGXH 2D4DA 5E4EB 2BNRB 2VNCA 1VADB 4Z7UF 2JJTC 4O2CB 4M6NL 2XXMB 4J1UA 4OCSL 1E6OL 4YZFE 5DK2A 3DXAA 4YAQA 5EBMB 5E2JA 1A7BA 1LNUB 2W91A 4G3YL 1RU9H 5D1QA 2DOCA 1F3JA 3VXTB 3JUYA 4FFWC 4ZS7H 5ICZA 4YHPA 4NRXA 4L3EE 3EGSA 3F7PC 4X6CA 4U6XA 4PY8I 1WBXA 2J8HA 1OAQL 4Q7DA 3F58H 1MI5E 4GRWF 4OD3H 4PLKC 5I1IL 4RMVA 3LRGA 1P7KB 2HYMA 5E8PB 1INEH 1KJMB 4P5MB 5EO1A 1FLRL 1WLHA 2VDKL 2QADC 5J12C 3WFEH 1MCQA 4H8WL 4TQEL 3DRTB 3RY6C 4HXBL 4JRYA 1YNLL 5DJXA 3V52H 5L0QB 4JY6A 2BHZA 2V7NB 2VC2H 1G7MB 5C0RH 2XY1A 2W0LA 2YKLL 2KKQA 1GGBL 2XNAA 4TSBH 3HA0A 3IAPA 3K46A 1MCOH 3WLBB 1QSEA 2V9RA 1QBML 5C09A 4GKNB 3IU4L 4X7DC 5E2VL 4NZRL 1NFDF 1KPRB 2VIRA 3GHEH 5FKPB 2CRYA 5KZCD 3ILPB 4TN9A 1GGCL 5J6GB 3RNKA 1BQHA 1MELA 2IPKA 3SDXB 2EICA 1OCWH 1F6LL 5EH1A 4HEME 4M43L 3QXTA 3GO1L 5K93A 2QSCH 5TF0A 7CGTA 3EDJA 2EDJA 3RI5F 4KJWD 1IGIH 3ULVL 1LQSR 1FIGH 1RZIA 2A77H 3U1SH 4EIGB 5MEND 4LLQB 1IFHL 4YGAB 5JUEH 2Q87A 4NQUA 4NC2B 4IDJL 4HX1A 4M1GH 4PJHF 3VFMB 3AXLB 2AI0L 2HTLC 2EO9A 1KCVH 1OP3K 4AJ0A 4JFFE 2R0LH 2PXYC 5CJXA 1CICD 1ZEAL 2MNUA 4S2SB 1EAPA 1WFUA 5CIPH 1TTGA 4QGTA 4F15C 1FZOA 3F7RA 2AJ3B 2IBGA 4HGMA 4WU5A 1QNZH 1TPXC 2GY5A 2N1KA 2BCKB 3RKDD 3R06A 2PW2A 1T1YA 4PGEA 1R0AL 3QUYD 1UYWH 5AZEL 5EU6B 1KCUL 5EORH 5IW6B 2XI9A 4ELME 3HNSH 1R5WA 3NPSC 5LWYH 3SE9H 2Z92A 2V2WB 12E8H 4IDLA 4XMPH 4Y5YC 4HIJA 1G9MC 3QNZA 3TA3D 2HG5B 3PHQA 3F7VB 4LVNB 5KSAD 1BZ9B 4X4ZA 2B0SH 4HH9B 4D0BA 3BWAA 1BX2A 1J0JA 4QT5A 5F44A 5FECB 1EGJA 1FG2B 4LNRA 3I6GB 1NEZB 2MOVA 1BEYH 3GRWA 4X80H 3P73A 3E6FB 3RGVA 2V17H 1SJVA 3KXFA 3IDGA 5INDB 5F3HA 2BNQE 4GW4B 2F74B 4U3CA 3I9GL 4FQCL 2NW2B 1LEIA 1CFTA 4KPHL 4JDZB 2HKHH 3BAEH 1J8HB 1ZT4A 3MRCA 3FFCE 5DTFA 5LGKA 1DUYB 1NBYA 4RMUA 4KKAC 1ZWIA 3GMPB 5DQJA 4ONFL 1EHLL 1QHPA 1AKJB 3CX2A 1I1YB 4NC0B 1TZIA 1IGJB 3UTTD 3ARGB 3FFCB 4N90D 4LLDB 4L3EA 2NY6B 1NGWA 4N0RA 5D7JD 4N8PA 1EJ6A 4IOIA 3MNZA 1MI5A 3IFLL 4ZOAA 2BOBA 1T22B 1HQ4A 2BZDA 2VITA 3NZ8B 5HVGB 5BJTA 1Q9OA 2NY0B 5E99L 4WI3A 4D0DB 4U6VH 2AK1L 2EIZB 2EIBA 2DD8H 4R3SB 3DX9A 4ZAKD 4OFIA 5C08D 3QEUA 4PJ7E 4N0YL 3GUTA 4UU9B 1OLLA 2OSLB 1T03H 3OGCB 4Q9RL 1BMGA 3CU7A 5C0JA 3U2SB 4QYOA 1ZHLB 2E7LA 3Q2CA 2D03H 1YPZA 5IB4A 3VXME 1H5BA 2OTPA 1DLHA 5D1XB 1EFQA 3LVEA 3B5TA 4DCQA 4K3EH 2GTZA 1QKZH 3PWPE 3SPVA 4F7MB 2XZCH 4NN7C 5TE4L 4L4VE 3H8NA 3SE8H 4IJ3C 4PJXA 4D9RE 3QG6B 3PP4L 4DUXA 2OR7A 4Y4KA 2Y5TB 2JELH 4FFYH 3HFMH 4UT6L 4GAJL 4BH7A 3OZ9H 4Y2DA 1BD2E 1XR8B 4HKZB 2OQJB 1WBZA 1K3ZA 4M61B 3U9UA 4CJ0A 1RZJL 1I7ZB 1ZHKB 4YZFF 2VLRE 5E8DL 3IDJA 5ITBL 2EDEA 4U7SA 3M1BA 2PW1B 1HCFX 1Q72H 1L7IH 3H7BA 3MV7D 1I75A 1OY3B 4YBQD 4JFFA 3PGFL 4M5ZL 4OKDA 4Q6YA 4QRRD 3FTGA 4OQTL 3SGKC 3CDCA 4U3XA 5T1LB 2ZJSL 4P9HC 1RK0A 2A0LC 3MOQA 4JN2A 1KCSH 3KYAA 1MCBA 3DV6A 2F53D 5HYJE 4ELMA 3LEVL 4PRBA 3FN0L 4F57L 3I3EA 5ANME 2IBBA 4ZO7A 3QIUB 1KLUB 1NC2D 2VDLL 5E5RB 4HG4K 1ZLWK 5MEPA 1FFOB 5CINL 4P2OC 1G9EA 2EXWD 3MODH 4F8QA 4RIRA 9CGTA 2Y7QB 1PG7W 3QRFM 5DI8A 2GIYA 3IFOA 4XCNA 3TBSB 3N06B 4OIIL 1FJ1B 1ZT1A 3QUXC 4TVPE 2VXUH 2Y23A 3H2WA 5DRNB 2Y25A 3GSXA 2WBWB 4RFOL 1E6JH 5JXEC 1YQVL 1U3HC 2LU7A 5IV2B 5C0BE 3VXSE 5JDJA 3CFKB 1DLFL 5JW3L 5JORA 1UM6L 2BNQA 5BOPA 2FH6A 2MSPA 3S97C 4JRXE 2HWZH 4NO0D 2OJEA 3QEGH 5TQ2H 1FL5B 3NVQA 4K3JH 1T66C 1FNEB 4FZEL 5D7KE 2ZOKA 3QXAA 1S7WB 5ILTL 2E9WA 1XCTB 5HTSA 3RWJA 5HBBA 3O9WB 3S96A 4U1NA 4QXGL 4PJ5B 3ZT6A 1CDBA 2L0DA 5IVXA 5D71L 2YN5A 4WY7H 5ICYA 2H2PC 2MCPH 4Y1AE 1AD0A 1RIVL 3HKFA 4HXAL 4XH2A 1NEZG 1XGYL 4DGIH 2EXYD 1YJDH 4MLSA 4P2RB 4PBXA 4XP1H 1TZGL 2HT3D 2I9TB 1RVFL 4LCUB 1EEYB 3MLWH 1L0QA 4JFDD 5DURB 4FZ8L 1KLFA 1H3GA 3PP3K 2UV3A 3D6GA 5J8OA 2ZG1A 3IS1X 3TN0D 3VFOB 5DQDH 1MJUL 3I75B 3LHPL 3KLHD 3QG7H 1J87A 4YHNA 1IGTA 4JQIL 1A0QL 5DJYA 3TVMB 3TBWA 5L6YH 4XPGH 3QDAA 1WEJH 1RHFA 4R96A 5SWSA 1R3HB 4PJDB 5CEZD 3KNBA 1VFOA 2R0ZH 2W0KA 4W68A 2EYTB 4OJFL 3T04D 5CFHA 5IMMA 2XRAH 4LARL 4MAUL 1BF2A 2FX9H 3OR7A 5E95B 1A7QL 2OR9L 3HMXL 3QO1A 4K2UL 5HVHC 3AB0B 3QUKB 4JO1L 2BNUA 4K55A 2Y36L 1KELH 1BD2A 2P5WB 5CJBA 1RZ8A 1EFXA 4RX4D 2VLKE 3GMQA 3SDCC 4Q2ZA 4D8PB 3TZVD 2QQLH 1LK2A 3HRZA 1LE5A 2VLRA 3HUJE 3O4LE 4XNYL 5TDNA 3QFJA 2CGRL 2WM0A 3V6ZB 5I17B 4FQLL 2VN4A 4PRPD 4WGVB 1YNTA 1OARH 3QULB 3VRIA 1ODAA 4XBPB 1MCHA 2NY1C 1OAXL 5EBLB 3HUJB 3GNMH 2VH5L 4X9BA 2MJWA 4D9LL 4JZNA 4HJ0C 4XRCA 2B7DT 1CXEA 2R1YA 3TJHD 3TO4D 4PRHD 5I2IB 1FRGH 4X5XA 3GJFK 4OZGB 2DWEA 4XPBL 4ZTOL 2H2SC 1BF8A 1EGJH 3TH4T 3VXRE 1YDPB 4IIQB 3RX5A 3GRWH 1NCTA 1RZJC 3MNWA 3CNKA 4J4PC 4RWYL 2YRZA 3W9EB 3MUGA 1OAZL 3ZE1E 1D9KA 3H42H 4NKIL 1KJ2A 4I4WB 4JY5H 3P11H 1JPSH 1BVKB 3QO0B 5ANMA 3U6RA 5F7HA 4QRSA 4PJ7F 5C3LD 1MFBH 3MRJB 3PWNA 4JJ5A 3BN3B 4P2QE 4D0CA 3MLZH 4U1JB 4PJ9A 1U93B 3WIFB 4PJAE 2GFBB 4MB5A 3F5WB 1YYML 5TE6H 5BW7A 4OLXL 1ZKAA 4LLMA 4OI9A 1U8OB 3VG0H 1DN0A 1Z5LA 4H1LB 3BPNC 2H6PA 4K94C 4XBGA 3U4AA 5DVKA 4ZTPH 4G8EB 3B5GA 3IDUA 4P4KA 3VGEA 1JNHB 5FGCB 5I8EB 1QR1A 4NSKB 5C0BA 3VXSA 3D2UA 2XPGA 2BSRB 4ZUTA 1FYHB 4W6XB 4DUVA 2C1OB 5E9DD 3WHXA 3W81A 4JRXA 4X9FA 4M9PA 4JZOB 2NYYD 4DVBB 4EOWL 1PG7H 3IDIA 1R24B 2LAGB 3VE0A 3C60B 1ADQH 2DWDA 5IT2H 1HKLH 2D4FA 4NO3A 4U1HA 3ZT5A 2J5LC 5T5NF 1S7VA 3NN8A 1KF9B 5E8OA 5JLZA 2R9HD 1I7TA 2FLRT 3N9GH 4YXHL 1GGTA 3KPPB 4Y1AA 5C9KA 4UUJB 1IQWH 1DE4A 1UXSA 3OHXB 4GAFB 2J2ZA 3B6SB 1M7DB 4Y5XB 4DN3L 4WWKD 3RZCB 4UNTA 1AO7D 1Y0LB 2FYYA 3IF1B 1S7XA 2BXYA 4PYHA 3DETD 4D9QE 1JHLL 4HLJA 2WINA 4O58H 4LKCA 1FVEB 3S7GA 2QR0A 1BPVA 3UDWA 1JP5A 4X6BA 4M3KB 1Q1JH 5BO1H 2FJGB 5T3ZE 5CUSH 5FM5M 3BPLC 3GIVA 5D1ZC 4FP8H 4HLZG 5E5MB 4DAGL 4HJJH 1YEFH 4Y5VC 2QHRL 1YMMD 3G6JE 3L3JB 1FNHA 2OI9B 4IOSD 4KJWC 3E3QC 2DQJL 3QHZL 3QHFH 2B1HH 3QNXA 5TF1L 3DNKA 5DEZA 4GRMA 4MD4A 4GW1A 3JSSA 4NN5B 3IDYC 2IALB 3SOBL 1X6NA 3G6JB 1YEIL 2YR3A 2Y4SA 2WMPA 4JO2H 4GFTB 3KHQA 4BSVA 4GXVL 1CL7I 5IB2B 1QRND 2JB5H 2HT2D 5AUMA 1TMCB 4KDWA 1MRDH 1CICC 1NPUA 1OGAD 4K3DH 1OAKL 1AHWA 5IEKA 4XP6L 3O4LA 5BS0E 1O5DT 2R4SH 2X1XR 3OKLB 1RFDL 3HE7C 1TZHA 3KPQA 3RKDC 4Z7WE 5K9QI 1U8MA 1BVLA 5F21B 2J88L 3BW9A 3QUYC 4NGHL 4X5WA 5EZIH 1HINH 2GW5A 3V7AG 1KIRB 4U49A 1U8KA 1A6UH 1W72A 2HVJA 5DMGC 1QFWH 3MOAL 4PG2C 3VXRA 2CDGB 3TBVB 1NAKL 1D6EB 3HB3D 1G6RB 4WNQB 3TA3C 3BPOB 4PGCB 1N2RB 4CRPA 5I16A 3CMOH 5FIEA 2ARJA 4R7NA 3KS0H 5KSAC 2YRLA 1U91B 1UKTA 4LHUB 4ONHB 3PV7A 4Z76A 2AJVH 2P8PA 1FO0A 5I1GH 1FC2D 1XGQA 5FUCE 1RIUH 2NTFB 4K3GA 4PB0H 1PSKH 2AKRA 5I1LB 2A1WL 3TBYB 3TJEL 4P2QA 1GOHA 2XWJB 4UNVA 3BSZL 4I5BA 3C2AL 1CGSH 4XVJH 3PWJB 4R4FL 5HI5D 3S36H 5K9OA 4JFXB 1CBVH 4X9HA 5I66B 4P23D 4E0RA 4FA8A 5IP4A 4S0SD 3G9AB 2H45A 4LBEB 2IJ0C 3D3VE 4NQCD 1B6DA 3DX7A 1IC4L 4NNPL 3QDJD 3VI3E 2NX5B 4PGBB 1TVHB 3LS5H 3HS0B 4Y0GA 5C0AA 5I1KH 3MRDA 3BI9X 4R7DB 1D5XB 3MGTB 5EU3A 1D5IL 3B3IA 5ACMA 5DJ6A 1IQDB 5D7JC 3UJIH 1QYGL 3HUJF 3L5HA 3MBEB 4YEEA 3ZHKA 1F4YL 4AMKL 4PJ8B 4H88L 4KJPD 1NKOA 4QO1A 5CEZL 4OZGF 1JWMB 3ZYJA 4JPVH 1N4XL 1A7PH 1VFBA 2FIRT 1H3PH 3RWEA 1JZ5A 4HV8A 3ESVF 1IBGH 1JWUA 4ZAKC 4H1LG 2DYPD 2J8UA 4KC3B 3VFWA 5C6WH 1F02I 3HZMA 4G8GB 4JCLA 1F8TH 4GMSL 3TYGL 1HXYB 2PO6A 4HBQA 3L3IA 4S1QH 4MD5B 1MY7A 3ZE1F 4ZUWB 4XP4L 5TFSH 1F2QA 4MQSB 3JTTB 3L7EB 2DICA 5DD0L 4S1RL 3SDYL 1DANU 1T83C 4NFDA 1HSAA 4X0KA 3L1OL 2O26U 2FSEB 4I3GA 3RAJL 4Z7QE 1JTOA 4PJAF 4YLQT 1FSKB 1SJEB 4HUUB 4FQ2L 1T2QL 2A83B 5HHPA 1T89C 1A6TB 3O2WL 4XB8A 4QCIA 2ENYA 3DIFA 4Z8FL 1YEEH 3FT2A 5E00A 1F4WL 4HPOL 3WO4B 1FN4B 3T09A 2OXGA 3QUMA 3U4EA 1RMFL 4MJIE 5E6YA 1U8NA 1T1ZA 2UWEE 2VXSL 3OKOB 1MVUA 3V5KA 1SY6L 3EYOA 3OKNB 4JPIA 3IVKB 3G6DL 5EU6D 2AEPL 1GGUA 1RUMH 1FYTE 3WE6A 3ETBF 4PD4J 3JTSB 2UWEB 1A4JA 1KJ2H 4P57A 2B1AH 3CC5A 2Q7YA 3ZT7A 2WBJA 3SGDH 5BS0A 1QLRB 1J10A 3MCKB 4QTIH 3P0YL 1IM3B 4IS6A 3S4SA 1HHGA 3NIGE 3FONA 4ZFFB 3UMTA 5L8JB 4JFPA 3RVVD 4YHOL 5T3XE 3BWUC 1A6AB 2HJKA 2B2XH 2AERT 4G6JH 4TVPH 35C8L 5IROA 2WWMC 3S88H 3QB7C 3KYNB 1AFVH 2GAZA 2C3VB 3BYYA 43CAA 4BUHA 3HPJB 1DQDL 2ZPKL 1IL1B 3VH8B 2IPTH 4LQFH 3H0TB 1P9MA 3NABL 4MNGA 1WT5C 5FYJE 3HI5H 5HDQL 1J1OL 1J8HD 5BZDA 2Q1EA 3X14B 1LK3L 5AZ2H 5F1IA 2AXHA 1Q8MA 3KYOB 2B5IB 5JXAL 3G6JF 1I8KB 4U2YA 4EN3B 3ARGD 1I3GH 4DZBA 2NY6D 3ULUD 4DN4L 4CMHC 1B0GA 3D3VA 3LEYL 3QH3B 1RY7B 4LCWE 4XHQA 1ZOXA 3UPRB 4PRNA 5KW9L 1JE6A 1DDHA 3K81A 3MA9H 4KUCF 4OLYH 3V5HA 2NY0D 1FZMB 1LO0H 4KRPD 4U1KA 1AD9A 2OCFD 3BO8A 5CKGA 3L5WA 1RZFL 3GKZA 2WLYA 1HDMA 3HI1B 3MRPA 1CIUA 2DL9A 5HYFA 3DUSA 1GRWA 4Z7WF 4QRQB 2CMRH 2CXGA 2HT3C 3RL1A 1SQ2N 1ZS8A 3HZYA 2DQHH 3U4BL 4YAQB 2ZOLA 3O2DA 1OPGL 5D1XD 2D0HA 1I7UB 5D1QB 1C5CH 3CFBA 4NQXA 2PYEB 3TN0C 1MFAL 5ICZB 5KS9A 1A02N 3BZ4A 1A9EA 1T5WA 4K8RL 1BOGB 3UBXA 1WBXB 3OJVC 3FB5B 5DHYA 3ECBA 5IEHB 3QIBD 2CDFB 4UQ2B 6CGTA 1VGEL 3E8UH 1NLBL 1OM3H 2HFFA 3VW3H 5EFIA 2G9HA 2QQKL 3LN9A 3QBTB 4KGLA 4YHIA 3AS2A 4Y19B 5BVPH 2Q86B 3TC9A 1NUDA 2ADIB 4DW2L 5JR1H 5IVOA 1AGCA 2W9EH 4JRYB 5C0FA 4JY6B 2BDNL 3TPUA 3JV4B 4GUPB 2VZ1A 3SCMB 4QHLA 3TZVC 4KK5C 1OWRM 3VFPA 1LGVA 4X7SH 2R23A 4GAYB 5SWZE 2FB4L 2NQCA 5GIRA 2FHFA 3W0WA 3WUZA 1QSEB 4JFZL 2DQIL 5C09B 4BFIB 1N5YL 3DPBA 5EG6C 5L2KB 1RUQL 2R15A 4NRZA 4QF1A 4OV5B 4GLRI 3C6LA 3RNKB 1BQHB 3C9NB 2KUTA 1PD6A 2Y06L 4TYUA 1IVLA 1NMCC 3PNWA 5EUOB 5F9WB 3TJHC 3TO4C 4P2YA 1FO0H 1K9TA 1YC8A 4PP2A 3QFDA 1MJ8H 2FGWL 1M1SA 4GSDH 4HIXH 3QEHA 5GISL 3RHWF 4HKBA 4YDJA 2HA1A 1JRHI 3ARZA 1RZIB 5A2KH 4G6AD 2Z35B 1XCQA 1LD9B 5ADOH 5K9KA 4L8SB 4ENED 1RULH 2FD6H 4U6YA 3KPSA 5DO2D 5DZNA 5KN5A 5I18H 1MCIA 5FYKL 5KVFH 1S9VA 2EO1A 5DUPH 3S6CA 4AG4H 5J89A 1FZOB 4LASL 1NDGB 4ELKA 3G5ZB 2NNAA 4XC1L 1QRKA 3EDKA 2YHGA 2NY3B 4RZCB 4PB9L 2VXVH 3UTQA 5I75C 5FKAA 5SV4A 4S0TD 1R5WB 3ARUA 3IGAA 3O9WD 3REVB 4GMTH 4PJ5D 2AK4B 1NC4A 4QHUA 2J1KA 2KQNA 4BKLA 4HIJB 4DEPC 1SEBA 1WAAA 2NYYC 4OZFB 4LCWA 3MACL 2UWEF 3WFDL 4MQ7B 4NKDA 4P2RD 5FGRA 5HGBB 3BWAB 1BX2B 1OQXA 4QT5B 4LSVL 4O9HH 4W6YB 4AM0B 2LVCA 3MV9E 4ZDHB 2R9HC 1YY8B 4PRIB 1RZ7L 2E7MA 3L3GA 1HEZA 1DEDA 3VH8G 3JWDH 3JWOL 4PLOB 5DURD 5KOMC 3MZTA 5GS0H 1IGFL 3HC4H 4WTZG 4OIBA 2HRPH 3FO2A 1JGVH 4WWKC 4OB5H 1YEKH 4QXWA 4TRPH 3OB8A 5FUOH 4MNQA 3OPZL 5T3ZH 1BLNA 3O3UN 4HIIA 3TVMD 3DETC 3N85H 1ZT4B 1MQKH 3ISWA 5DTFB 1UZ8A 4OCYH 2VZSA 1UFUA 1E4KA 4MDJB 1M7IA 2J6EL 5DJ0A 5DQJB 5F72S 1QLEL 5HXMA 5E2WH 1GC1L 5C3TA 2EDWA 3CDFA 5I30L 5FF6A 2Q7NA 4UDUA 4U0RB 1Q38A 2ITCA 4J6RL 3QUMH 1J0HA 1IT9L 4IOIB 3QWOA 2P5WD 4OFPA 3P0VH 4HPYH 1E0OB 4RMQA 5F9JB 3O3AA 1JUFA 1Q9OB 3GMNA 1DL7H 2GEEA 3K7UA 3X17A 3HG1A 4HUVB 3JZ7A 3DX9B 5I1DA 2R4RH 1UM4H 5C07A 3STBA 4OBRA 4JFEA 2IBZX 2YA1A 4O2EA 1IGMH 1W2KT 1YMHA 2HT2C 2XKSA 4Q0XL 2VZ3A 1OL0A 4K8RC 4WTWA 1G6RH 1QVOA 4C4KT 4OLVH 5C0JB 5CMAA 4MZ3A 5SWZA 4QYOB 1NCAL 1RPQA 1J1XL 2ZUVA 4G42A 4KK8D 3MOBH 1E4WL 1G9NL 4B0MM 4CDHA 1PW3A 4DCQB 4JFQB 5D72H 4U33A 1FFPB 4ODHL 3ARTA 3AM8C 3FL7A 4LMQI 4FRWA 3TIEA 4PJXB 3QJHA 4XPFL 3H9SE 1WK0A 2HTKC 3NTCL 3RL2B 4QNPE 1QBLL 3W11D 3VXUE 1AGBA 4JFHD 4Y2DB 4G7YL 4PR5A 2E7BA 2DKMA 5DHVB 3HB3C 4YFLI 4TOYH 3ULUL 4N68A 3S35L 4CU7A 4ZNEA 3O4OB 3JV6B 4YIQA 3BH8B 3M1BB 5E4EC 4HCRL 3U9PL 3EOTH 4M62H 3BGAA 5GS1A 2R0WL 3HE6B 3OB0H 5DRWA 3PL6D 1AE6H 5C0IB 4G5ZH 4YUEL 2ZCLH 3FN9A 2F5AH 1NBVH 1WWWX 1KXQE 2V5SA 5EDXA 1VENA 5HI5C 1XF1A 2W9DH 5E4IA 1CN4A 5IGXL 1YN7A 4DTGH 1AXTH 1EO8H 4HGKC 4MJ5A 4P23C 5EOCL 3UO1H 1BQHG 4BSWB 1OSZA 3F62A 1BQSA 4LLUB 3KPNA 1N3NA 2ORBL 1RK0B 3A67L 4WFHE 5CBAA 1HNGA 5DYOA 5JW4R 5HGDA 5J3HD 1TVBA 4HT1L 4OFKA 1QLFB 1RHHA 4JCMA 4MAYB 2P5ED 3STZA 1ZA3B 5H94B 1DBKH 2YUXA 1I8IB 3BEVA 2CXKA 1V3MA 5D93B 5MEPB 5DC9B 4F58L 1C5BH 1G0XA 2EKSB 5MERB 1KC5L 4UTAL 4RIRB 1BFVL 1GHFH 3O2DH 3CH1A 2DAVA 4OLZH 5I1AA 5L0QC 1RUPL 2CUIA 1ZT1B 3T2NL 3RZCD 4KJPC 4O5LH 1IGYA 5EUOF 3RIAF 4UTBH 3DSFL 3GSXB 1WZKA 2WP3O 4DWHA 2X4RB 1P7QD 1YZZA 4DGVH 5HPMA 3MR9A 1CZ8H 3ZYOA 1LO4H 5DFTA 3DUUA 2ADJB 3MLUH 4WW2C 4QHNA 2W9LA 5ADPH 3OWEA 4NQED 1WVZA 3K4ZA 1AR1D 4P46B 2AQ1A 4MD0A 2GJ6D 4OCWH 1GIGL 3T1FA 5B3JF 1QFUL 3QXAB 1J18A 4YHZH 1G7PB 2CSPA 3RWJB 4LPUA 2D0FA 3S96B 2XTLA 1N59B 4HF5H 5IVXB 4E9LA 3QZWA 5ICYB 1MWAB 3JWOC 1Z0MA 4MA7L 4K71C 2AS5M 3UJJH 3EDFA 5DLML 1I1AB 3QI9A 3KLSA 3LKSA 5DWUH 3DMMD 3GSUB 2QSQA 3BKML 1NL0H 4ZD3L 3GHBH 4FXKA 1CGTA 1UGNA 4TUJB 2XACC 3WXVL 4YC2C 4WU7B 5GGVY 4CN4A 2E7CA 5EU7C 3HPLA 4M3JA 1L0YA 2IANB 2O5ZL 1MIEL 1NCWH 3BMWA 1GC1C 1BJ8A 8FABA 2XY2A 1XFPA 4M48H 3UTSE 4ETYA 4YHNB 5IFJB 4ISVA 4Y4FC 5T3XH 2KDGA 3KJ4B 3DURB 4MCYB 3I6LD 3OKMA 5L2JA 4PTTB 5ITFA 1JNNL 4R96B 5SWSB 4RAUB 1U92A 3O8XA 4R2GB 3MNVA 1R5IB 1LILA 4KDTC 5IMMB 3TGXA 5CD5D 1GSMA 3WFHB 3RVVC 1AP2B 3OR7B 1KN4H 1G7LA 5GSVA 3MLXL 3H9SA 3L7FA 2OTUB 2IAMA 5AYUL 3VXUA 3U7YH 1MF2H 5IQ7H 5EB9A 3SE3C 4OF6A 1KLGB 5CJQL 5FYJH 2P8LA 2QSTA 4NQDA 1IC7H 2WUBH 2N4IA 4EUPA 4P5KB 5E2TH 5D7LE 3MROB 1BFSA 3BKCH 1CS6A 1I1FB 3QFJB 2A9NL 1X5IA 1EAJA 5BXFB 1T0NA 1G9NC 2FL5B 4RNRA 3RNQA 2XXCB 5BZWA 2G5RA 1R3KA 1OTSD 5C0GA 5IMOB 1UB6B 1FORH 5D7LB 4N8VB 1W0WA 3OAUL 4JZNB 1KT2B 3S35X 2R1YB 3T65A 4OCXH 3WIIL 5EU5B 4KTEL 2BFVL 4Y88A 3FKUS 2HFEA 1I1RA 1I3UA 3ARGC 5IW1B 2VLJA 2XKUA 4LDEB 2XZAL 1GGIH 3ULUC 4G8FB 1MCKA 1N64L 2BVPA 4HKJA 4I3RL 4JO3L 4KKLC 3MUGB 3RVTD 2N7BA 5HI4D 4MHHI 4PJ8D 3EO0A 1CG9A 3OXSB 4DOHE 5KAQF 2A6JA 2PR4H 2W0FA 4JHAL 3QIWB 1B0WA 3U6RB 1FV1A 2KBGA 4KRPC 4XVSH 1FNSL 1RK1B 4NWTL 2YXFA 5ISZA 1SMAA 2OR8A 5D2LB 5EUKA 4Y16A 3MLVL 3PWVA 4L4JA 4NFCA 3HNVL 3QP3A 4YXKL 1T1XA 4G8GD 5DR5L 3P77A 1KTDB 4Z5RB 1JWSB 4A6YL 5ESAB 1Z5LB 4XBGB 5HHNA 4RGMB 3RJDA 2I9LA 4K9EH 1XIWA 5BMFL 2LABA 4XCEB 1QR1B 2D7QA 4NN6B 1ZGLB 3MYJA 4ZNCD 1JJUA 1QFPA 1BREA 2DJ4A 3D2UB 5KTEH 3DVNA 1QR4A 4ZQKA 1PYWB 1T7XA 2VUYA 3GSNB 2ZCHL 4E5XA 4L4TA 1J0IA 4NJ9H 1QO3A 1KJ3H 5JQ6L 4MNHA 4K7PY 2EH7L 2FWOA 3H3PL 1N7ML 3QXDA 5KVGH 3ARBD 3IDIB 2DJSA 3QIBC 4KHTL 5L9DL 3ZKXC 3BDXA 1G0DA 1Z0NA 3SKNA 1JZ2A 1AGDB 3C5SA 4FFVD 1BAFH 3LB6C 2XA8L 5FM8A 4OZ4A 3X12B 1A1NA 5H35A 1VA9A 4NCDA 2EKJA 1EXUB 1NAMA 3DGGB 4MVBD 2CIKA 2IMNA 3BFOA 1MREH 4UT9L 4K07A 1BZ7B 2WAHA 3PHSA 1UXSB 1ZSDB 2V7HA 3E6HA 4AENA 2XWBB 2FYYB 5TDOB 3SBWA 3RY5A 5JHDB 3RA7L 5FGBC 3D0LA 3RDTA 2WINB 1D5MA 1X5FA 3IETA 3GSOB 1OT1A 3SKUD 1D5BB 1AY1H 4KMTH 3D25B 3QQ9C 1XAUA 4JKPH 2UYLA 5TH2B 3V6FB 4E41D 3OMZA 1CGXA 2BSTB 4NO5A 2BRRL 4ODTL 1V3KA 2YZ1A 1A9BA 1KFAL 3CSPA 2ICWA 4FNLH 4NYLB 2B4CC 2YD6A 5I8OL 3CUPB 3O6FA 4XAKE 4F9LA 3QNXB 3P30H 3ZDXE 5JW4N 4G6AC 4MD4B 2EIEA 5HHMD 5DSCB 4HIHA 3MZGB 1U2HA 2GUOA 1XGTA 2V2XB 4ENEC 1YUHB 2X70A 1N8ZA 3NA9H 5I74B 2R39A 3GKWH 5D70H 2WK2A 5AUMB 4WHDA 3VD4A 1NGPH 1UA6L 4XPAL 4J3XA 1UWEH 3MREB 4OZFH 5FA4B 4ALAH 4EN3D 3MLSH 4GG6B 3NOIA 3EYFA 2G5BB 4QHMA 2WQRA 1OWWA 5FDWA 3N1GC 3ORJA 1U8MB 3FT3A 1S7TA 4JPKH 4X5WB 3BHBA 3V2AR 3B9KA 1NGYA 1U6AL 3MV8D 1KEGL 2R29H 1X5JA 4JB9H 5CP7A 5SV3A 2HVJB 3L3KB 4JR9H 2WW8A 3FJTA 3K2UL 4OGXL 4X4YB 5AEAA 3T4AB 1R3LB 1VFAB 5I16B 2BY3A 1CE1H 2ZG3A 1A3LL 4HIEA 2OL3B 2WZPD 3VGDA 3GJEB 5E0QA 3TNNA 3T0EE 5DUBA 5IBTL 3WJLA 1V05A 3VJ6A 5J12B 1RU9L 3P9LA 4GKZB 1B9ZA 4UOW1 3OKDA 3C6SB 4ZS7L 5DJAA 1GPOH 5ID0B 1S7RA 4KJYB 2JCCE 4I5BB 4CN6A 4MA8L 4DQOH 5D1QD 5F88A 3F58L 4XAWL 2PYED 5CEYA 4N8VG 4E0RB 2GQHA 1GL4B 3UPAA 3V8CA 3WFBH 1A1MA 3WKNA 3MGOB 3EW3B 4WENB 3TVMC 3DX7B 3WFEL 1XGRA 4LRNH 3H9YA 2RFXA 1IZJA 4HBCH 3X3FH 4Z7NE 1LHZA 4PLNC 2VC2L 4ERSH 4Y19D 3MRDB 4KV5E 5DEFA 5C0RL 3QNYA 4FQXC 5DRZB 1H8SA 3B3IB 4TSBL 1S7UB 3AB0C 1MCOL 4JRYD 5IMLB 3SCMD 2XG5A 1GOFA 3WEXA 1TTFA 2FECL 1T2XA 5ACZB 5LXGH 4KY1L 1SY6A 2X4QA 2X4SA 1QSED 1OCWL 5D5ME 5FCUH 5C09D 4HSQA 3L5JA 5L2KD 2PXYB 3VFWB 2QSCL 4ETQA 4MX7B 5I0ZA 1K2DA 4LAJH 4MJ2A 4IBLT 1GOGA 1IGIL 5GGQH 4AEFA 3EJZD 1FIGL 4MSWB 2A77L 3OJMB 1F11B 4J7RA 4NZUH 2ZSWA 1ZHNA 3U1SL 1TPXB 3ARXA 1FL6B 1I4FA 3BX7C 5JUEL 1HHIB 1S8DA 5D9SA 1BWWA 3ULSB 4IIQC 4KK8C 4M1GL 5D2LF 4TUOA 3FO9A 4FABH 4F9PA 1PX4A 4XB7A 4FXGA 4KUZH 1KCVL 4KQ3L 3NPSB 4EUPH 1HSAB 1HN1A 4N9OB 2R0LL 2IFFL 4Z95H 4ONGH 5T33H 4Y5YB 1B2WH 4NQTA 1YY9D 3MJ8A 3W11C 3WN5A 1YNKL 2KL6A 3OJDA 5CLTA 1QNZL 2LU4A 1QFWM 4HWZB 3TV3H 2VERN 5F7FA 1HXMA 4JVWA 1AXIB 2FCBA 2AJZA 1CLZH 1JYXA 4L9LA 5EORL 1CD8A 1CTOA 3U4EB 2VISB 1LO3L 3HNSL 3DBXA 1YEDA 5LWYL 4U31A 5EOTA 3SE9L 3CVHA 4WI8A 12E8L 3GMRA 2JJTA 4EI5A 4HHAB 3EYOB 3OBAA 1NDMB 3S3PA 1UEMA 3PL6C 4JPIB 2PN5A 3O3EA 1JV5A 1XH3B 5B8CA 4OSUH 4ZUUA 1JGDA 3SJVB 1NANI 1A4JB 4OZHA 4UBDD 1L4IA 4XXDA 3TT1H 1PEZA 2YBRA 2AK4D 3TBTB 2B0SL 3QDGB 3MJ9H 4WFEE 1MFEH 4NUGH 1BEYL 4X80L 4FTVE 5J3HC 3JV0A 5K9QG 4URTB 1PBYA 2DLIA 2HKFH 1KTKE 1Q9WB 5F9OH 4HS3B 2FO4B 4PRID 1HKFA 4LL9A 5EBGA 3QUZC 3WFCH 3KXFD 2HKHL 3BAEL 2GAZB 4QRPE 3UTPE 3QJFA 3U46B 3SDAC 5GRZA 3NCYP 1UH4A 5GRJH 4Y5XC 3T0EA 2ZZUT 4L5FH 3RZCC 5HYSB 3VFUA 1QUNA 4LQ1A 5T1KB 4TTDD 4MNGB 3WNPA 2NCMA 4IRJA 4EEEA 4JDVB 5H8DA 1CGYA 4ORGA 1IRAY 1J5OH 1X44A 1KB5A 2EZ0C 1WC7B 2F9BT 5KANG 5F1IB 3I2CL 5HHXH 3QQ4B 3VMOA 3BMVA 1HHKA 3MCLH 1AR1C 3IFNH 3FHAA 3K8MA 4BM7A 2JIXA 1J1PH 3TP4A 3CFDA 1INQA 1NAMH 4J3TA 4ZSOE 4U6VL 3RVXD 4LCCC 3H3BC 3ZDXF 3G5XB 4GRLA 5FYKU 2DD8L 2NY5H 2X4OA 3CLEL 1J0KA 1VERA 2DJUA 3FAWA 4WWID 1EBAA 3LZFH 4IJ3B 4KROB 2VKXA 3I6KB 2A73A 4GG6F 4G6MH 4NN5C 1T03L 3BO8B 3HZKA 5HHQA 3L5WB 3JVGC 2BHUA 2D03L 2VR4A 1UJ3C 1WJ3A 3DMMC 2M1KA 4J8RA 3WIHA 1CFSA 4HEPG 4K3EL 3CXDL 5CJOH 1QKZL 1ZS8B 1K6QH 1MCPH 3VFTB 5D5MA 3MLPA 1ZVYA 4U3HA 2JELL 4FFYL 3HFML 3OZ9L 3SGJC 3CFBB 4NQXB 1HILA 1G1CA 4JAMA 5KS9B 1A9EB 1WWAX 5ICXA 4IHOA 2VABA 1ZTXH 3LOWA 4FQ1H 3N1MC 3HR5B 3BVNB 4I2XA 4JY4A 3UBXB 4Y4KD 4GAGH 4PJIE 1JFQH 4Y2DD 1MFDH 3LRSB 5EOQH 4BYHA 2AV1A 2J8OA 2XN9B 2HFFB 1Q72L 4YGVB 4M9OA 1L7IL 3MLYH 2HMID 2UUDH 4X4XB 3VI4E 1EMTH 1JPGA 1GAFH 1DBJH 4QY8A 4YHIB 5KG9A 4PJIB 5CD5C 2GKIA 3MRIA 1C5DB 2JCCF 2GK2A 5IF0B 1MUJA 1DQJA 2OBGA 5EO9A 1SJHA 1NCBL 3NFPB 4NRYA 3MLTB 4P2OB 1E4XI 4KXZH 1KACB 4CDGC 2WANA 5K9JL 3BZFB 1ZLVH 1SBSH 1KCSL 3QUXB 2X42A 3BEWB 5DRXB 4WUKL 3DX8B 4NBXB 3E0GA 2R23B 4OLUH 2J7LA 5J13B 5C6PB 5GIRB 2GCYA 5IB1A 4N8CH 1PQZA 1U3HB 5FYLE 1MH5B 3WJJC 4Z7NF 1QA9A 3J8F7 4RAVB 3K3QA 4XNMA 1OTSC 4JQVA 1I7RB 1TJGH 5E2UH 4MAYD 3MODL 4LCYB 1EJOH 3C8HA 3DUHA 1L6ZA 1WISA 1IM9B 3MO1B 2VXUL 3FOMA 2CR6A 2AJYH 4EBQH 3QEHB 3CFCH 4HKBB 4YDJB 1QSVA 3RVTC 3QISA 1FNLA 5HI4C 4PJGE 3BISA 1XCQB 3C87A 3D69A 5GJTH 3EOBB 4PJ8C 1S78D 2R56H 3NCCB 5K9KB 4I18C 3O0RL 5C9JB 4WHYG 1ZE3C 3WS3A 4KTDH 3FO1B 2HWZL 3FRUA 3G5YB 3QEGL 3D39E 3KPSB 4S10A 4F3FA 3W5NA 4K3JL 5F6IC 1JZ6A 2YC1A 4P46D 1JF1A 2ATKA 1IEAB 3RIFF 4DGYH 5GXBB 2Y1VA 1T5XA 1UC6A 3D39B 1O7SA 4NIKB 3ARRA 4UV7H 4ZUSA 1V7NH 5DVOA 4WY7L 3G5VA 3EYQC 1JTTA 3BP7A 3C08H 1F3DJ 2MCPL 4KTYA 1F3DH 3X13A 3S34H 1K5NA 1FCCA 1YJDL 5IJVB 4QHUB 1EDQA 3TH3T 4ONOA 2R2HB 4I48B 3ZL4H 4XP1L 4MXWH 2GITA 3VGHA 5DJDB 3OXRB 5C2BH 4WO4A 2GSIA 3ARBC 4BQ8A 2NY4B 3MLWL 1QPPA 2ED7A 2I25N 4NNYB 1XF4A 4CADB 4XWOC 4NKDB 2DTMH 3CFJA 1PX3A 1CL7H 3LSOB 1QTYT 5HVHB 3EKCA 5DQDL 5EN2A 3CCHA 3WO4C 3QG7L 3BH9A 2R1WA 4L29B 3T1WA 2YPLA 5IVZB 3TO2B 4MVBC 4X6EA 4XXCA 5HYSG 3DO7A 5FO9A 5FV1L 3SDCB 2IAND 5L6YL 4XPGL 3NCFB 1FGVH 4E42B 1BP3B 1RQ5A 4G9FE 5IFAH 4QXTA 3OX8B 3BJLA 4UV4H 3R0MA 2XRAL 4HIIB 5D6DC 3WUWA 1HH6A 3EO9H 2FX9L 1LEGB 2Q20A 1TTUA 2D31B 5B39A 3SE4A 1T20B 5C6TH 5SWSD 2E6JA 4BK5A 2F58L 5DJ0B 1BFOA 4XCYA 1KELL 3QT2A 5L88H 5MP6H 3CU1A 5FF6B 2F5BH 2ITCB 3BE1H 4LMQE 4D9RD 3UZQA 3VFRA 3ZLQC 3PDDA 2M8XA 3IDMA 3WNOA 3VXQB 2AVGA 1XZ0A 1EFXD 1UWGH 4FXLA 3BKJL 1ZLUK 1OARL 3BXNB 2P48B 4IMKC 3RUGA 3H7LA 4H0IA 5BQ7B 5DJZA 1QSFE 3IJHB 3V4VH 5D4QA 1IC5H 1KB9K 1V7MH 3MUY1 1Y6MR 3QFJD 1FRGL 3OAYH 2HRLA 4JEGB 4O2EB 2XOTA 1EGJL 1AQKH 1QSFB 2RJMA 5JXEA 1JBJA 3GRWL 3LAFA 1S5HB 5IBUB 3QRGH 4P99A 3T0WA 1MCJA 3BPNB 5CMAB 4PJFE 2B5IC 3H42L 1DSFH 4EN3C 4JY5L 1XGUA 3P11L 2E3VA 3K1KC 4Z18A 3U0TA 1KENH 3T4YA 3UBXG 1MFBL 1FNAA 4PJFB 3MLZL 1WIOA 2VDPL 4ZFZB 1D9KD 4PY7B 3TIEB 3VFGH 4P3DA 1LP9A 5LCVH 5EC2A 1AGBB 5TE6L 2EDQA 2PTTA 2LV4A 4M93B 4EVNA 4S1DD 4ZTPL 4LKXA 4PJ9D 2ZUTA 2AJXH 3HC3H 2ZSVA 1KB5H 3FMGH 3PV6A 1PY4A 4PS4H 2Z31A 4M6MH 4PJGA 4OTXH 1WQVT 2J5LB 3MFFA 1LEKA 4YIQB 4QOKE 2WV3A 3MRGA 2FIKB 5DRWB 3FQXA 2GJZB 5GGUB 4G6FD 3RWFB 4P4KD 1UWXK 1U8JA 4F33A 1RIHH 2C3HA 4FQQA 3D87B 4HJGA 1PG7L 1MY5A 1MPAL 3D2UD 4PJIF 5D1QC 4PV8B 4X7FC 4MDIB 1YN7B 3RZWA 4MJ5B 5MHSE 3ZYZA 1OSZB 4POUB 2VLMD 5IT2L 1HKLL 1N3NB 4X99B 5DYOB 5EBWB 3VI4F 1BBJA 2Z91A 1TVBB 1RHHB 5KZCB 1A5FH 1X4ZA 3STZB 5DMKB 5CKAA 2X40A 5TJWK 3WIHH 4Q6IA 5D1ZB 2X9YA 2HFGH 5MENE 1MLBB 3TNMA 1UZ6F 4Y5VB 1JK8A 1S5IL 2YWZA 4AIXA 2G2RA 3KLAA 3S37H 3RGHA 2H32A 1W0VA 3Q5OA 4RBPH 1RZGB 4O58L 3P40A 4XPHH 4KU1A 4M1CD 1OP5H 1B0RA 3SCMC 1FNGA 1IGYB 3OKKB 5EZLB 32C2A 5IHBA 4KKCD 2DL2A 5BO1L 5JHDD 3UJTH 1RAMA 5CUSL 4JM2A 4WDIB 5E8EB 4EDXA 5HGHA 1Q9LA 4MYWB 3MJGX 5IHZA 4FP8L 4QHNB 3LH2H 1YJDC 4QRUB 4QXUH 3LN4B 4G9FA 4HS6A 1PLGH 3MRFA 1DANT 2IPUG 3EJZC 5D6CA 2HT4D 3DHJA 5E6IA 3MBXH 2DDQH 2I5YH 3HE7B 2CDEB 1UB5A 2DM4A 4WFGD 1VKXB 1CFNB 3VGAB 3GBMH 4JO2L 5IHLB 3HTLX 4NM4H 4J4PA 2VLLA 2AQ3A 1S7QB 2ESVA 2MQCA 1ORSA 2A74A 5E1AA 4K3DL 5JOEA 1YY9C 1AXSA 1AQDA 4X9IA 3TA3B 2ZUQC 3HAEB 2R4SL 5E7FA 3LKSB 3KDMB 5KSAB 5CJXC 3BOVA 1TJHH 5EZIL 1HINL 2OXHA 5DJ2A 4EIZC 1WTLA 3G04A 1A6UL 5DJCA 1QFWL 1MLCB 5E7BA 1RJYA 2BMKB 2J12B 8FABB 3KWWB 1N6VA 5JA8B 1RJLA 3O6LH 1ZGLP 3CMOL 1CFQB 3D9AH 4BZYA 4ISVB 4UBDC 1N6QH 1ES0A 4NC1C 4U6HA 1JPFA 3NA4A 3TYFA 2R69H 3GSVA 5J1AB 3LDBB 5I1GL 2AJVL 4N90E 1RIUL 2EDOA 4PB0L 1RJCA 1PSKL 2RQ8A 3O8XB 4PLKD 1NJ9B 1NGZA 1CR9H 1ED3B 1LVEA 43C9A 4G3YH 1X9QA 3WO3B 3EAKA 1KIPA 1X3DA 3T0DA 1CGSL 4XVJL 3UTTB 3W2DL 1CD9B 3S36L 2WWKO 1CBVL 4BH8B 1NSNH 1FZKB 1ZT7A 3GMLA 2EYSB 1PKQA 1H15A 4HZAA 1MEXH 1T21A 3RGVC 2ZUYA 5DGQA 2Q3AA 5C08E 3CDGA 5ECJE 2WIIA 3M07A 3LS5L 1JN6B 1I8MB 5EIIB 2APTA 4QOKA 5JNYA 5IBUG 5GPRA 1P2CB 4RNRB 4TTDC 4ZAKB 5I1KL 2P24A 5C0GB 4P0DA 4JREC 3RTQA 3WL9A 4J2XA 4PREA 3UJIL 3MYZA 1QOKA 3NBNA 3FQUA 3O2VH 5C0AD 3KPLA 3ARFA 4F7CA 2F54B 2PNDA 4GKOA 2VLJB 2X4NA 3CX5J 4JPVL 4YFLF 1A7PL 1IARB 1G7HA 1ULVA 2BVPB 4NDMA 4XI5D 1MHHA 1H3PL 4P5TB 1VACA 1OD7A 1FL3A 3SQOL 3VFNB 4NZRH 5F6HI 1IBGL 3DO3A 3QEQB 1AR2A 1PG7X 1CG9B 4X8JA 5TE7L 1MAMH 2V9TA 4P3CL 1F8TL 4JLRB 4WHTA 5J9PA 4XGZA 5MENA 1M05A 4M43H 3GO1H 5GQBA 4S1QL 5ISZB 3FQTB 3KYMB 5CZVL 4R26H 5TFSL 2PXYD 1NH6A 4LLVB 4PJFF 1JZ3A 1F4XH 1T1XB 3MV7E 2D0GA 4P9HH 1MCCA 2C3WA 2PKDA 1IFHH 4IMLA 1CICA 4GLRH 4WHCA 4QRRE 5EIQA 4GOSA 4POZD 5A43C 5EZJA 4JFOB 1DQQA 3MV7B 4MWFB 4RFEA 1Z3GH 3MYJB 1H5BC 3ARDA 4OKVB 1CLYH 2OJZH 3VWJA 3U48A 2VDMH 1NGXB 1WITA 3BGFC 4L1DA 3ES6B 4L4TB 1JRHH 2F53E 2NZIA 2VL5A 1UQSA 4QWWD 4Q58C 4Y4KC 3KPMB 2R1XB 3K4AA 4GBXA 2EEAA 3CFEB 4Y2DC 1UH2A 3GMMA 5HD8D 5AZEH 4L8CA 1LE9A 1KCUH 4C56B 4TPRH 2ZG2A 2HMIC 2R2EA 4YPGA 1A1NB 1RUML 2A9MH 1MNUH 4KZEL 1NFIB 4ZG1A 2C3GA 1CWVA 4PV9A 5C0CA 1KJ2L 2LTQC 1WBYA 2B1AL 3OKEB 5FYLH 4AH2A 4LSUH 3V5DA 4QTIL 1GZPA 1V3JA 1QSZA 1E28B 4BSJA 2V5TA 4RRPA 2IC2A 4U1GC 3MRBA 2G60H 1A3QA 3D0LB 1ACYH 3PXJA 4F8TA 2CLZA 3QDGD 4F80A 3P9MA 1DFBH 2B2XL 4G6JL 4TVPL 3RWDA 3FB8A 2D7NA 2EYRB 1PEWA 4NP4H 4XNQB 3S88L 1CFBA 1KTRL 3BUTA 4JDTH 4HUWB 1AFVL 1WFNA 2BVQA 4CMHB 2IPTL 3QZWG 4LQFL 1A64A 2P43B 2ICWB 4Z0XB 1CE6B 3HI5L 4WUUB 1CDJA 3GSWA 4GKSB 3B8YA 1P5VA 2A6IA 8CGTA 1UVQA 3VFVA 1P1ZA 5AZ2L 3LQAH 5JIPA 4NHUA 2GUOB 1P53A 5T1KD 1T80A 4X98A 1I3GL 1J05A 3EOAB 5D2NE 1KPUA 4PGDA 3VCLA 2EEBA 4JFDE 3WSQH 1XR9B 4P46C 4KZDH 4AEHH 1DZBA 3SN6N 3EYFB 3S36X 2YPVL 5FDWB 4JFDB 1LO0L 2CIIB 4N0UE 3FT3B 4ODSH 1IILE 3RWHA 2FATH 4XX1E 3EFFA 3B9KB 4LLYB 3DVGA 3NCEB 3T8XB 3F6LA 3FQNA 4V1DA 3PWUB 5CEZE 4JHZA 4KROD 1RJZB 3VXNB 4N0UB 1Q0XH 1FAKT 3C8KA 1KOAA 3MXWH 2CMRL 3PQYE 5F96H 4HIEB 4KK9C 5HVFB 4F7PA 2DQHL 5IIEB 2V5MA 5F89A 1FCGA 2AXFA 3F7YB 3VJ6B 3P9LB 1C5CL 4MHHG 4GRWE 3BQUA 4YNYA 5GRVL 3OKDB 4XC3H 1E4JA 5DJAB 2YMXH 1YEGH 1KG0B 2HP4A 5EWIH 3HCVB 3TZVB 4PRPE 5I71C 1VGKA 3E8UL 4O4YH 1OM3L 1Q9KB 5KSVA 1OP3H 3VW3L 4IM8A 2NY7H 1Q0YH 1QFHA 1Y18A 2D7OA 5DF0A 4ZYKB 5IG7A 3VXOB 1T1WA 5KBNC 3ULVD 5BVPL 4PRHE 1NUFA 4GW5B 4PRPB 2AV7A 3KJ4C 4TNVK 4QRRA 3UZEA 2DQEH 1U8HA 2FECI 4LSTL 5JR1L 1H9VA 2XN9D 2W9EL 1DBMH 5CIPA 4NQVB 4JZJA 1BZQK 4CKVX 5HHOB 3STLB 5EC1B 3QPQD 1NFDE 4OQTH 2F53A 4PUBH 4U1LB 4WI2A 1OGTA 5KVEH 4X7SL 1HCVA 1W72L 1P7HL 4P2OD 3H9ZA 2AXGB 4K94H 2P7TB 3V6OE 2W38A 1A2YB 1CXLA 4LSPL 5F1KC 3QUXD 4CVXA 3ZYIA 3LN5B 3LEVH 2IH1B 1MRFH 2X4QB 3W0WD 2JLLA 1U3HD 3QQ3B 1A6WH 4HZLA 3GJFA 2IG2H 2VE6B 2VSCA 1FO0L 4LIQE 4ETQB 4KFZC 1K2DB 4EDWL 1X5YA 4X7EC 4M7LT 1MJ8L 1U95A 3MRKB 3C6LD 4HIXL 1JHKH 1HE7A 2HJLB 4XVUD 1HH9B 2ZSWB 2ADGB 5ADOL 4F7TA 1S8DB 3ZE2E 5JIHA 5D9SB 1NFKA 2XKNA 2ITDB 4WW1A 2A6DA 4TUOB 1R6VA 3FO9B 5I75B 4NO0A 2FD6L 4FXGB 3ZTJG 3FN3A 1M6OB 1I85A 2CKBH 5F3BB 5IBLD 1J0YA 4MJ6A 1D9KC 5IWLC 5I18L 5KVFL 5E9DB 4C83B 4O2FA 5T1MB 5DUPL 3IFPA 4DEPB 4AG4L 4CVZA 3OJDB 4S1DC 5LAXA 1U8QA 1U58B 3KPSD 5JPMA 3ARQA 3RWCB 4PJ9C 1CT8A 3PDOB 3N1PC 1HXMB 5CSZB 3KAAA 4HUXA 4Z7VE 5ILTH 5HJ3B 1DQMH 1T3FB 3C5JB 4L9LB 1DEEB 5BW7C 3GZKA 3DBXB 1BBDH 3FRPA 2Z9TA 4GMTL 1AGFB 1MCSA 1AO7E 3CVHB 1D6VH 1IAOA 3GMRB 4EI5B 4Z7VB 2HJFA 3BIKA 4P4KC 4H25A 5D2NA 3O3EB 2Z93A 5B8CB 1JGDB 4NN6C 3O11A 2O5XL 3H9HB 3RQ3A 4B7LA 1ZHBA 4OZHB 5C8JB 3CX5K 1ZAGA 4XCFH 1F97A 1NC4D 1NQBA 2V5RA 1ZANH 4LLAA 3WNMA 4QRTB 5C0DA 3TN0A 2Q8BL 5CBEB 1RVFH 5I76A 3A6OA 3MPCA 4B7IA 1EK3A 4Z7UA 2NY4D 1FVDA 2VDQH 3JWDL 3FQWA 2AAVA 1YMME 3EYVB 5SX5K 1CK0H 2Y5EA 4W4OA 5IQ9A 3D0VA 3S3JA 5GS0L 3HC4L 4ZFGH 2O61A 2HRPL 4M8QA 1JGVL 5I1CH 4OB5L 3GI9H 1YEKL 4LSQH 2X41A 4NUJA 4HFUH 5FUOL 3PQYA 1G7JB 5T3ZL 1F45A 3SDCD 3DTXB 1MQKL 3DVFA 4ZPTA 4OCYL 2Z4QA 1JF6A 1E27A 1QRNE 4RX4A 5DQ9B 3PGCA 4IRJB 4MNQD 1OGAE 3HMXH 4KKCC 4BK4A 4K2UH 5F7DA 2HAZA 2JJSA 4HFWA 1I9JH 3QUML 1QRNB 3VRLF 4RGND 5DFVC 2UZYB 3UDWC 1HHKB 1OGAB 5BV7H 3P0VL 2JF1A 3HAEH 4HPYL 4B53A 5FOBA 2ZNXA 4UZGA 5DC4B 3IDNB 1HOCA 1INQB 1DL7L 1F58L 3DROA 4PRHA 2X4OB 2R4RL 4QKXB 1UM4L 2VH5H 3GK8H 1CXHA 2EEDA 2JK5A 5A16A 4D9LH 4N0FB 2A73B 4LF3A 1ZV5A 1C12A 1NFDA 2VAAB 3HG1D 3OAZK 1DVFA 2E27H 2GSGB 4ZTOH 4OLVL 3P4OA 1CVSC 3TWCH 4OF3A 1TFHA 2BNRE 5DFWH 5C07D 5HHQB 4JFED 3SKOA 1T7VA 3MOBL 3V6OA 4N1CA 1ZLWH 5CAYB 3BP6A 4YDVB 2CLRA 1S9YA 4J8RB 1SYSA 1N5AA 5DJ8A 4AT6A 4XP5L 5SWZD 1AHWC 4Q9QH 3GSQB 4OV6F 1OAUH 2HVKA 3RWGA 4JN1H 4HWBH 4KVNH 1U3JA 4XPTL 1T7ZA 4PJHA 2VXTH 4YDIH 1KCRL 3ZKND 2X09A 4TOYL 4PJEB 5ICXB 3CSYA 4P23B 5CHNA 4LK4A 3SHSA 2DI7A 1KNOA 3CH8A 4NQCB 4V2CB 2AV1B 3QDJB 4M62L 1I9RH 2UZIH 1IE5A 1BFTA 1AE6L 3FFDB 1V3LA 4G5ZL 4LP5A 2ZCLL 5BVJB 1NBVL 4F7EB 3MRIB 3V0AC 2W9DL 3RPIA 5TDPA 5EO9B 3O6MH 1T6WA 5IFHH 4DTGL 1AXTL 1EO8L 3UO1L 1G6VK 1QD0A 3F6IA 3B43A 2AJSH 1OB1A 1TJIH 2J4WL 3EDEA 4RA3A 1FGNH 1XF2A 4NQSA 1OAYL 5CZKA 2GTWA 1PQZB 3RVUC 2I07B 4DK3A 1QA9B 3SDXE 3UTZA 4LLWA 4WW2B 4FHBD 2DYPB 2VQ1A 1C5BL 1RURH 5MEQA 5FO7B 2BC4A 4CMMB 1GH7A 3L3OB 3O2DL 1RUAL 5BRZB 4M5YH 1J88A 5FO8A 5DUML 4OLZL 3PP3H 2V6HA 4J3UA 5D1ZD 5EU4B 4LEXH 4UTBL 4BQBA 3QCUH 3BDYH 1KN2L 3BP4A 4XI5C 3AAZA 3KPRB 4DGVL 2A6KB 1CZ8L 4MXVE 3D69B 3MLUL 1YMMA 4N9GB 5ADPL 1T0MB 3V95A 2I60H 1LDPH 4K71B 4LVEA 3VWKA 3WS3B 1U8IB 1KJVA 4PJBB 4DAGH 4OCWL 1IZKA 2QHRH 5EU7E 5INCA 5B38A 5F7EL 4G43A 4YHZL 3SY0A 3QHZH 1A6ZA 3ZE2F 1REIA 2C7UA 5EU6E 2ATKB 2W65B 4YC2B 3PJSB 5GRWA 2PO6C 1X5GA 4HF5L 3JWNC 3SKMB 2DQDL 3ELAT 3HE7D 4POZC 1HNFA 3JWDC 3BP7B 2VWEC 1XEDA 2VOTA 1BIIB 2AGJH 4K23H 1CF8H 1T04B 3FQRB 2QQNH 4I1NB 4Y4FB 5DMGD 3U36B 1CXIA 1NL0L 3GHBL 4OD1H 4QWWC 3FCTA 4Z7VF 1EERB 2GSIB 3GJFH 1RFDH 3ZDZF 4HAFA 3W9DB 5HD8C 3UAJC 2WIMA 4RMTA 4LSSH 1NCWL 3N1QC 1WUNT 3EFDH 3RFZC 4M48L 4ODXA 2ZUXA 3BH9B 1NBZA 4IRSA 2YPLB 5FO9B 2ID5A 2BNRA 2PETA 1VADA 3VXPB 5F8RC 3GB7B 1G7QB 5A40E 1J8HE 2FRGP 5I1JH 2FBJH 4FQJH 5EBMA 1UM5H 4UDTB 1LNUA 1ORQA 3MRMB 1KN4L 3VXTA 4LPWA 4N1HB 1U36A 4PJCB 1T4KB 1BFOB 3PHOB 3JUZA 3U7YL 4OGAC 5IQ7L 3O8XD 3ULUE 1T7WA 4POYA 3BSZH 5A2FA 2RCSH 1ZVSB 3B8SA 4LEOB 2CRMA 2WUBL 2IQ9L 1JPTH 2YK1L 3WMSA 5E2TL 5E94B 4TNWK 3BKCL 5E8PA 5ERWB 1KJMA 3RU8H 4KJQD 1CDYA 3EUUA 4NNPH 2BX5A 4NQDD 3RUGB 5CD3A 5DJZB 1IKFL 4CW1B 4DK6A 3DRTA 3MA7A 3QA3A 4KRPB 4PG9B 5GJSH 3MQIA 5L8KB 1SBBA 4OCXL 5FA3A 4UINL 1G7MA 5TGBB 2PYFB 1FG9C 4RMWA 2RB8A 1ZGLM 1GGIL 1F4YH 1ADQA 5K33A 4GKNA 4XP9H 3U0PB 5CEZH 5FKPA 1KPRA 1M71A 5FHBH 3O45B 2F54D 5J6GA 1TCRB 2VLJD 3ET9F 3U0TB 5D7IB 2XQYG 5J6HB 2PR4L 3T4YB 4XBEH 1YN6B 4KH2A 3DVIA 4XVSL 4P5TD 3IJYB 3QEQD 1HK6A 4GMSH 4DZ8B 3VU2A 1KYOK 1LP9B 4H8WC 4KROC 4GRWH 1O0VA 1JI1A 4JANA 4CNIB 2F8XC 4LLQA 3QIBB 5ISZD 3ZKXB 4AEIH 1KGCD 4K9EL 2ZSVB 3V0WH 3VFMA 4XCCL 2ICCA 4PJEF 1MJJA 5DD0H 1LEKB 3F12B 3IKKA 3MXVH 5C0EB 25C8H 5KTEL 1HHJB 2XA3A 3CLFH 1XIWD 3L5XH 4S2SA 5IMKB 2BK8A 4F33B 4NJ9L 1KJ3L 2H1PH 2AJ3A 5KVGL 5CGMA 3NAAH 2IADB 4L9DA 5JHLH 3LQZB 4Z8FH 5EU6A 5HYEA 1BAFL 5IW6A 4L4TD 4JKMA 1D7FA 1RMFH 2BVOB 4U1IA 4Y8AA 3ULVC 3DX6A 1R3JB 1BBJB 3MJ7B 4XMKL 1J9CT 2V2WA 1MREL 4RMRA 3CDYA 2FZ3B 2WUCH 4C56D 3A6BH 2HG5A 4KDTA 1P4BH 3F7VA 5A3ID 3QPQC 2WWMD 4HH9A 4OGZA 4WW2F 3KLAB 4OT1H 5FECA 2DMBA 2H32B 1W0VB 4LAQH 4JO4L 3I6GA 1NEZA 4LIQH 1B0RB 3E6FA 3SE3A 1AY1L 3PIQB 4KMTL 3SDXF 1QQDA 32C2B 4YHOH 3V0VB 2CUHA 5J13C 3RDTD 3OL2A 1NANH 1BJ1J 3WXWH 2F74A 3W39B 1BJ1H 4YHMH 2NW2A 3ZE0E 4JDZA 2X6MA 1I9IL 2YSSA 2W60B 2VTFA 4J3WA 1J8HA 4FNLL 3C6LC 4NHCL 3MRFB 1DUYA 4XVUC 3P30L 5I9QC 4PJ5E 4MXVF 1AKJA 1IGJA 4LHQB 3NCBB 2FJFB 5DD1H 5HDQH 3FFCA 4LLDA 3U0WH 4WUUD 3GKWL 1LK3H 2VLLB 5D70L 1A14H 5IBLC 4I3SH 3REWB 4X6FB 1ORSB 4M7ZB 1T22A 5E1AB 4M7JL 4P2RE 1NGPL 3NZ8A 1NCDH 4X7TB 5F7MC 1UWEL 2IH3B 3P3YA 4ALAL 3MLSL 2EIZA 3UYRH 5LJYH 4R3SA 1CDCA 1KV3A 3O41A 4JPKL 4M7LL 5KW9H 1QP1A 2CKNA 5HY9B 1PKOA 2R29L 4OZIE 1HIMH 4TTGA 4UU9A 4L8BB 2OSLA 4JR9L 3OGCA 3U2SA 3WUWG 2EDYA 4MQTB 3QCVH 1K8IB 3B9KD 5ALBL 3SGEI 3GIZH 4PJ7A 4OZIB 3EIFA 1CE1L 3V7AE 4PJDE 1EH9A 5D1XA 4F2MB 5IVNA 3TYFB 3GSVB 5GRUH 5HI3D 4F7MA 3PGDB 1TQBB 3VXMA 2XWTB 1L6XA 2NY4C 1O7VA 1EZVX 3B5HA 4RDQG 5C7XL 2P5WE 1XR8A 2OQJA 3PWPA 4L8DB 4M61A 4AZ8A 4DQOL 2NW3A 3UCRA 4FQXB 4L4VA 3NMEA 3WBDA 4LPVA 4CU8A 1H3TA 3BPCB 3BUYA 1VPOH 2OS7A 4Z77B 4JQXA 3NACL 1PKQB 4OM0H 1DBAH 1H15B 4PJCF 2HN7B 2V9QA 1T21B 4OCRH 5HHVL 4A6YB 5LG1A 2PW1A 1OF2B 4KK5D 4LRNL 1NLBH 1TETL 2VMFA 1FHGA 4HBCL 1GJIA 3X3FL 3ULUF 5DEGA 4ERSL 4R0LA 4WI9A 3RJQB 2X7LB 5F71A 4DW2H 4OZGE 4PREB 1MCWM 4I0PA 4RGNC 5T1LA 3FO0H 1N0LA 5IM7B 4A2LA 1HSBB 5HHOD 5ETUB 1HHHB 4NFBA 4OF5A 4HUNB 5DD3H 2X4NB 5F7KC 5LXGL 2VR9A 1G7HB 4UMGA 4JFZH 3LIZH 3RP1A 3QIUA 1KLUA 1C16B 1JHTA 5FCUL 5ENWB 3Q3GA 3HR6A 4ZO8A 3OR6B 1ZLSL 1HQRB 1EVTC 1E4XH 5HYJA 1FDLH 2Y7QA 2JKXA 4WHTB 3UEZA 5J9PB 2D7TH 3LKQB 5D7IF 1FJ1A 4NZUL 1OHQA 1CU4H 5D7SH 4K7FB 5DRNA 2ARJQ 2E9IA 4LFHG 5CEXB 3ROOB 3O3DA 5EZOL 2ICEB 4OLWH 4FABL 5FGCE 5IV2A 4KUZL 3NCMA 2K3TA 5ID1B 4G9DB 4YE4H 4NBZB 4Z95L 1BJMA 4ONGL 4DJMA 5T33L 3I02A 1SEQH 3PL6B 4Z78B 1B2WL 1A1OA 5I6XC 4TSCH 3VWJB 1FL5A 1FNEA 2XIDA 5L7XL 3TV3L 2VXQH 2LU3A 3ZKNC 2P5EE 2AQ2A 2UY7A 5FM5O 1MIMH 4Y4HA 3TCLA 4EZMA 1CLZL 1XCTA 1MAJA 2YD9A 4LASH 2BJMH 3O9WA 4ZPVB 1JGEA 4GBXB 1SYVB 4PJ5A 4XC1H 5I73B 1A7RH 4M93C 1PJ9A 3CXHK 3B9EA 2P5EB 4KI5D 3EJYD 2Q76B 2R2EB 4YPGB 1GZQA 4OSUL 4EQ2A 5GZOD 4MA1C 5EA0H 4FQIH 4LPXA 1H8OA 2JB6B 4PV9B 1ZA6B 5IB5B 3QUZB 5GS1C 2FDBP 4EI5D 5HPOA 5FB8B 2JTDA 4LCUA 3SDAB 1EEYA 4FOMA 4U7MA 1MFEL 3V4PH 4NUGL 1UJTA 3BD5A 2X4PA 5TPWH 3MRBB 5JA9A 4NQEE 3L3HB 4FN0A 2HKFL 5GGRB 1NMBL 2VDNH 3CZFB 2CLZB 4LVOC 3VFOA 3I75A 1P7QB 2K7QA 2GJ6E 3GSRA 5F9OL 4JHBA 5T5FL 4U6TA 4NQEB 4R97C 1IGFH 3WFCL 1NKRA 2GJ6B 3LKPA 3OSKA 4P49A 5GRJL 3DV4B 4L5FL 3GBNH 4LCCB 2VRAA 3DOSA 5JPNA 2AXJA 2Z8WC 5I8KH 4AYFA 3VFSB 1NUNB 3QUKA 5HYQB 2H9GB 3O3BB 2X4TB 1CFVH 4I0KA 1UVQB 1J5OL 2P5WA 3T0ED 5HHXL 3ZE0F 4D8PA 4NHUB 4PTUA 3MCLL 4IRJD 2GJJA 3IFNL 2DIJA 3HLAB 1J1PL 1KPUB 3IU3B 1IT9H 4OCNC 3AGVA 5IHUH 1NAML 5ESQB 1UJ3B 2VLKA 3DMMB 3UROR 4U1SB 4K8RD 2E9JA 3D18A 3QULA 5GGVH 4XBPA 3LKNA 3HUJA 1J0ZA 2JIXD 3K0WA 3BZEB 1G7IB 5I2IA 4G6ML 4XNZC 4GRLD 4OZGA 3I6LE 3FHQA 1YDPA 4V1DB 3VGAC 5HDOA 3BP5A 4HGWA 3NGBC 4ZUVB 2HTKD 1I3VA 3C8KB 3CAFA 5CJOL 4I4WA 1K6QL 4F7PB 1E4WH 1B4JH 1MCPL 2WNGA 3QO0A 4S11A 4OZIF 5F89B 3VDCA 5JDSB 2Y07H 3VGBA 3MRJA 3L6FB 5C70A 4U1JA 5I15H 1IC1A 5I8CB 3BQUB 4QTHB 1FPTH 3WIFA 1LO5B 3NTCH 2L7UA 3F5WA 1ZTXL 4WRLA 4FQ1L 5KANI 3MRHA 3R0NA 3INUL 4G7YH 4PJDF 4GAGL 4H1LA 1P69B 1JFQL 4PP1D 4X6DB 5GRXG 1MFDL 4G8EA 5EOQL 1VGKB 3FOLB 4G8IA 3EHBD 3ULUH 1CD1B 4PJAA 1WCBA 5I8EA 5DMYA 2NLJB 1TENA 2NX5E 4NSKA 3MLYL 1LO2L 1EMTL 1U8PA 1GAFL 1CGUA 3WYRA 2HH0H 2GT9B 3V8OA 3Q5YA 2R2BB 2BSRA 3LDBC 4A2MA 1K4CA 2C1OA 4YUEH 1IAII 1KTLB 3O8XC 4JZOA 4DVBA 5CIPB 1T2JA 3IKCB 3ZMRA 1SBSL 4AIZB 5CP3H 4HUMB 4Q74A 5EOCJ 1OGTB 4OLUL 3C60A 3M17B 2IAMC 2K9UA 4APQA 3SDDB 4N8CL 3DECA 5FYKD 2ORBH 4KQ4H 3Q6GH 4LNVA 4KJQC 1NBQA 3QDMB 4M1DH 3MCG1 1TJGL 2BOCB 4UQ3A 5E2UL 3IXTB 4I18B 3OHXA 2FLBT 1S9WA 4G8GE 3B6SA 5DVMA 1M7DA 1MOEA 4HZLB 1A22B 1Y0LA 1KCKA 1BIHA 3IF1A 4D2NA 1FAIH 3KYKL 4HC1A 5F6IB 1KC5H 4UI2A 5LGJA 1KULA 4RQQB 4L3CB 1BFVH 1I1CA 2AJYL 3CFCL 1M4KA 1FVEA 3AUVA 15C8H 5BRZD 3AS1A 4KWUA 2OX5A 2R56L 3DSFH 4WW1B 4EI6A 4YK4C 2A6DB 1UH3A 4WFED 4KTDL 3KPRD 3LV3B 4P5TC 5E5MA 1X6LA 4K7PH 1MCNA 5IJKA 1INDL 2P8MB 3GGWB 2CJUL 2I27N 3D85A 4O2FB 2LVEA 3IFPB 4CU6A 2YEZB 3ARBB 1GIGH 3AU1B 4UV7L 3G6JA 1V7NL 4PRAB 4HUXB 4XMLH 2D9CA 1Z6JT 5CWSB 3C08L 2E5EA 5IB2A 3IDXH 2X4UA 2ZCKH 1MJ7H 5H37G 4CAGA 3S34L 5AYQA 2X1PA 5CJ8A 2BXZA 1IAOB 4DKFH 1H0DB 2FHBA 1XIWC 4O51B 3ZL4L 1NLDL 4H25B 4J3OC 4HS8H 4MXWL 3T77B 5KSBE 4ZMAT 3BD4A 5C2BL 3OKLA 1ZHBB 4RMSA 3TIDA 1UG9A 1A3RH 2CK0H 4Y4FD 2B4CH 2DTML 1CGWA 1IAKB 4D94A 1QBAA 1CL7L 4E41E 4OAWB 5KSBB 1WFTA 1KIRA 5JW5B 4WO4D 4ZFOL 4UOJA 4Z7WA 3OGOE 3WV0A 4ODWB 3FQWB 2CDGA 3CZJA 1G6RA 4E41B 4WNQA 1FGVL 4PGCA 1N2RA 4JPWH 2XQYK 5IFAL 3WNLA 5A3IC 4UV4L 2YPLD 3EO1A 1L9MA 1U91A 4LHUA 4ONHA 3QPXH 3EO9L 1MHCA 3C2SA 2X1OA 2NTFA 5I1HH 3TESA 2Z4QB 5I1LA 3TBYA 3F7QA 4MCZB 5HHMB 4NOBA 2XWJA 1CXKA 3PGCB 4KMQA 4BQ9A 5MP6L 3SBWC 4M4PA 3PWJA 3MLXH 3RDTC 3MLRH 5AYUH 4HKXB 5I66A 3QWQB 4HLZH 2OMNA 1MHEB 3CVHL 2CLVB 1Q94A 4N5UA 1FBIH 2DM3A 2NX5A 1HOCB 3PE9A 4PGBA 1TVHA 3V4VL 2A9NH 2PCPA 4LCIH 1PZ5B 3HS0A 4I9WD 3O6KH 4KKLD 5JIIA 4NKMB 1D5XA 3MV8B 5KSUB 1AQKL 2OZ4H 3IT8D 4ZXBB 3O6FC 4F9LC 3AS3A 3MBEA 1X7QB 2C1PB 4KTEH 2BFVH 4YR6B 3QRGL 4PJ8A 3HZVB 1YA5A 4KDVA 1JWMA 5DGRA 1DSFL 3LS4H 5LQBH 2K7PA 2FGZA 4WV1A 1KENL 2CLRB 4BZ2L 1N5AB 4GQ9L 4BELD 3ZSSA 2H8PA 4UIMA 2PYEE 4J1UB 5DK2B 5FYLD 3AY4A 5JZ7D 3DXAB 5LCVL 3RWGB 3ALXA 4MZ2A 4NWTH 4J12A 4MD5A 4BQCA 4Z9KB 4PJHB 4ZUWA 1PVHA 4KRMB 3B9KC 1F3JB 2AJXL 3HC3L 1S9KC 1KB5L 5F6HJ 3FMGL 3JTTA 4BFEA 3L7EA 5CHNB 4YHPB 4PS4L 4NRXB 3EGSB 4OTXL 4X6CB 2E8ZA 3A6CH 4U6XB 4M03A 5HI3C 4Y19E 1FE8L 2O5YH 4X6DF 3BRGC 2FSEA 1IJ9A 4GS7C 4PBVC 2OK0H 2EDFA 3LB6D 4JRYE 1SJEA 2Z31D 1RIHL 4HUUA 4UB0H 2A83A 3C5ZA 1M7XA 3MV11 5EO1B 3WJLC 2QKIA 1UCTA 3RPIB 5I19L 5TDPB 1J7VR 4LFHD 2RAMA 3LQMA 2EH7H 1X5HA 3H3PH 1FN4A 4HMDA 4AQ1B 5DJXB 5FYJU 4M6OH 1QSEE 5L9DH 3PG2A 5C09E 5L2KE 1A5FL 4HK0A 3OKNA 2XNAB 1FH5H 3IVKA 3WCYA 2GTWB 4U4BA 4MJIA 3WIHL 3UBXI 5DT1H 3JTSA 3M8OH 2UWEA 2HFGL 3OG4B 5EUOE 4UT9H 2R8SH 3QQ9D 2VIRB 2Q6WA 3S37L 3MCKA 1JVKA 1FYTA 3NIFE 5FO8B 1IM3A 1TCMA 2IPKB 3LMJH 4XPHL 4R90H 4ZFFA 3B83A 3FZUD 1CDGA 3IRZA 4P59H 3BP4B 3UJTL 3V6BR 4H1LH 2ADFH 1FZJA 1FC1A 5B3JE 3LH2L 1Z9LA 1J86A 4IMKA 3DJ9A 4QXUL 1QHOA 1PLGL 1EO5A 2C3VA 4HX1B 3EJJX 1GXEA 3HPJA 1KJVB 2ZUQB 4JM2D 1IL1A 3MBXL 2DDQL 2I5YL 3WKMH 3H0TA 2D9QB 4G43B 5F93C 1ITBB 3QR2A 2CQVA 4G9FD 4LRIA 1EAPB 2C7UB 3GBML 4NM4L 3SEPA 1MFCH 3CVIH 5E6ID 1ROWA 1TNMA 5GS3A 4WU5B 4NC1E 3BKYH 2AK4E 2APWA 3ZHLA 3R06B 2PW2B 1T1YB 2HLAA 1I8KA 4PGEB 4ODVH 2ZNWA 4F9PC 1MVFA 3RKPA 2ICES 4XX1G 3QH3A 2ESVD 2Z92B 4XPAH 3CK0L 4TUKH 5IOPA 1BQLH 3MRLA 3QNZB 3WN5C 3AMKA 1FZMA 3PHQB 4HC1H 4ZO6A 4PRIE 1EEUA 4KI5C 2DM2A 3EJYC 3SKJH 4O00A 3KXFE 4D0BB 1YEHH 4L9LC 4ODXB 3O6LL 1IGCH 3HI1A 4LNRB 5GZOC 5KSBF 4HULB 3QYCA 4IRSB 3D9AL 3P73B 1P6FA 3KHOA 3RGVB 1P84J 1ND0A 2R69L 4QRQA 4EI5C 3KXFB 3IDGB 4PLJD 3QHTC 1HI6A 5F3HB 1A3LH 1H8NA 5B8CC 5HSFA 7FABH 4JKKA 1CR9L 5FXCH 5IBTH 1LEIB 1CFTB 1I7UA 1ORQB 2PYEA 5E03A 3MRCB 4JREB 1NBYB 2FX8H 2RHEA 1YYLH 1NSNL 4YXLH 1BOGA 1ZWIB 2W0PA 3FB5A 4MA8H 1CVRA 1MEXL 5IEHA 2CDFA 3GM0A 3LRHA 4UQ2A 1TZIB 4XAWH 4MS8C 3SO5A 4FQXD 4L3EB 2BSSA 4C4KO 1NGWB 4NT6A 5FAAA 1AJ7H 4Y19A 2Q86A 2XG4A 3UP1A 3MNZB 5SX4H 3RY4A 1OTTD 1MI5B 2VZTA 5CD3B 2BOBB 5ALCH 2ADIA 1HQ4B 2VITB 3VMPA 1DCLA 2IBZY 5D96C 3MA7B 5BJTB 2XZQH 3QA3B 3JV4A 4GUPA 2ZKHH 3T0EC 3BJ91 3SCMA 4QOKD 5FA3B 2ILLA 4IRJC 3O2VL 1BGXH 4ZO9A 1FP5A 1A8JH 4GAYA 1SVCP 3RTQD 4GH7B 3QEUB 3AFLA 1BECA 3GUTB 1YPZE 4BFIA 2NXZC 5L2KA 1M71B 3ARFD 2GY7B 4KY1H 5MHSD 4OV5A 1RSFA 1MAML 2F19L 3C9NA 4PJXE 1YPZB 5IB4B 1JCKA 1H5BB 5EUOA 1DLHB 2DQGL 4GRLC 2EDXA 3LPWA 1FVCA 2BY2A 2GTZB 3BGFB 4R26L 3SPVB 1NCNA 5FOJA 1F4XL 4WCYH 5DS8A 4P9HL 2P46B 5EULV 4Y4KB 5LGHH 4BH7B 4JANB 2Z35A 1G0YR 1LD9A 1WBZB 3U9UB 4O02L 4BA8A 4L8SA 4FS0A 2DI9A 2E6QA 1K8DA 1MJJB 1Z3GL 3S37X 5GGSA 4KQ3H 3IDJB 1CLYL 2OJZL 2IFFH 4X6CF 2VDML 2LTQB 2XICA 5GGTA 1JRHL 2C4FT 3H7BB 1YNKH 3T3ME 1NDGA 3EOYG 1A7OH 1CLOH 4JFFB 3G5ZA 4PP1C 3ARDD 3KR3H 3VWJD 4U1GB 3EHBC 4RZCA 4AL8H 3HC0A 3FTGB 1B4RA 2VDRL 2DLFH 4TPRL 3VGFA 1LO3H 1VDGA 4U1IB 1NGQH 2A9ML 3DX6B 1KIQA 1MNUL 3QDHA 1F4AA 3REVA 4JN2B 4GBXD 2AK4A 4JHWH 1HYSD 4LOUD 5FYLL 4W81A 3DV6B 5GHWH 4LSUL 2JE8A 4ELMB 5AG8A 5J1TC 4PRBB 1UADC 4Z6AT 2PF6A 4OZFA 3ZKMD 4LPCA 1SM3L 4Z0BH 5C0CD 4MQ7A 5HGBA 2G60L 4AM0A 3DRQA 1ACYL 1H3XA 3QUZD 3BYTA 4LGRB 3I50H 2EC9U 1VHPA 3E1F1 4I77H 1DFBL 5DI8B 4ZDHA 3SDAD 4PRIA 1YY8A 3IFOB 4XCNB 2MWCA 5EO0A 5B38G 4ODUA 1QQDB 4NP4L 2QLVB 5GS2D 2KPNA 4JDTL 3MV9A 4X7CC 3NIFF 2OP4H 4S1SH 2EZ0D 4KI1A 3WD5H 5J4MA 4JQVC 2YSSB 5JORB 2EDKA 4LDOB 2BNQB 3OJ2C 2CUMA 3BD3A 4Q9CA 4MDJA 2EDRA 2OJEB 3LQAL 5IVXE 4HWNA 2ZOKB 2C5DC 3I2CH 4U1NB 2DKSA 3WSQL 3TT3H 3RVWD 2X44D 5F9JA 2DBLL 2E7HA 4IEFB 3ARVA 4KZDL 4AEHL 3EYSH 1AD0B 1I8LA 4UIKH 4XH2B 3J7HA 3DGCR 2YPKA 4HUVA 3CLEH 4ODSL 2FATL 3O41B 2IANE 3NCJH 1W8NA 4U1MA 3VD7A 2P42B 3C8DA 1KEML 1Q0XL 2GK0A 3W82A 5I71B 2DKUA 3MXWL 5F96L 4PJ7B 4GO6B 3HMWH 4V1DD 5SWSE 2APVA 4YDLC 3Q5TA 1IGTB 2DIBA 4JFQA 4WVRA 2EE9A 3CXDH 5DJYB 4M4RA 3TBWB 1FFPA 2MQ0A 1OTUD 3OTTA 4XC3L 4WO4C 3VXMB 3RL2A 1WFOA 4LU5H 4KVCH 3KNBB 5FHAL 2YMXL 1YEGL 4BQ6A 4OFDA 5EWIL 3DYMA 2MFNA 5DHVA 3PWPB 5MI0B 2NW3B 4L4VB 3BQUD 3QO1B 4QHKI 2K1MA 4O4YL 3BUYB 2BNUB 2NY7L 3JV6A 1Q0YL 1BD2B 4XXCC 1RZ8B 1EFXB 3QFJE 5F9DC 1OVZA 3BH8A 3GMQB 4Q2ZB 3UPCA 4P2CG 2DQEL 1LK2B 3HRZB 3HE6A 1CGVA 1LE5B 2DIAA 2VLRB 4I8DA 5C0IA 3MRRA 5HGAA 3THMH 3BRDA 1DBML 5TDNB 5DEGB 1PDKA 4R0LB 4P9MH 1YNTB 4PUBL 3VRIB 1NCBH 5KVEL 3SE4C 4BSWA 3MRNA 3ZSTA 4UOW0 2VSDA 4LLUA 4I0PB 5K9JH 2FX7H 1S7SA 4K94L 4WFFD 4XRCB 1EPFA 3VDAA 4WUKH 5E08H