2X89A

Structure of the beta2_microglobulin involved in amyloidogenesis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
b'QVQLQESGGGSVQAGGSLRLSCAASGYTDSRYCMAWFRQAPGKEREWVARINSGRDITYYADSVKGRFTFSQDNAKNTVYLQMDSLEPEDTATYYCATDIPLRCRDIVAKGGDGFRYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY
molecule tags Immune system
source organism Camelus dromedarius
publication title Atomic Structure of a Nanobody-Trapped Domain-Swapped Dimer of an Amyloidogenic {Beta}2-Microglobulin Variant.
pubmed doi rcsb
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x89A00
2CH8A 5IEHA 4CU8A 2B8OT 1XFPA 3EGSB 1ED3B 1JI2A 5KN5A 4Z7WB 1OGAE 4JLRB 4NWUH 4K94H 5DRXB 1XEDA 5HHPA 4LLWA 4LOUD 4P4KC 4DVBB 4ZOEA 1T5WA 2PCPB 1ND0A 1UVQA 1CLCA 3PDDA 3QBTB 4I18A 1S9XB 4MA7H 1BFVH 1BZ7A 3JUYA 2W9EL 4L29B 5F3HA 3ET9F 3MROB 1ZSDB 1UXSA 2ATPB 5T1MA 4XMKL 2HMIC 4XH2A 5IHUH 1TTFA 5DR5L 3K8MA 1KT2A 3MRMA 1NGYA 2ZOLA 3SE4A 5D7IA 2GAZB 3X12B 5L7XH 1A7RH 3CD4A 4RGNB 4D9QE 25C8H 4ELKB 1G9NH 1EAPA 2DD8L 5SV3A 4B5EA 4FQLL 1S5HA 4EI6A 3VFMA 3SE9H 1C5DA 1SMOA 2NXZC 3EO9L 3MLPA 4ODXB 4CUCA 4ETYA 3NFPB 1HXMB 4NQEB 3S3SA 5CSGA 4PJGF 3MYJB 4CVZA 4PS4L 4HLJA 2DMKA 4N1EA 4KMLB 3KPSB 1CD1B 5ILTH 2H6PB 1CCZA 4D0BA 1AP2B 4FABH 4NO0B 4JPWL 4U1JB 1MCIA 2ZCHH 3ZDZF 1D6VH 4JVUA 1ZHNB 5J1AA 1S7SA 4GBXB 3QUZC 3V7MA 1NCCH 5GHWL 1N0LA 1VEMA 2VXUH 3EOAB 4G6KH 4XP6L 3K2MC 1Y6NR 2JJSC 2HG5B 3S3PA 3U36B 4HH9A 4WTWA 1NCCL 2K7QA 5GRVL 4NPYB 1DQMH 4P2CG 1T0PB 3I9GH 2NW3B 4UT9L 1A14H 2BK8A 2NY3D 4Q58C 4C56D 2GIYA 2VXTH 2WUCL 3ZL4H 2YUWA 3VFOA 5IVNA 3OAYH 4TUJB 1CR9L 3QIUA 2PXYB 4OZGB 4RGOH 4HK3J 5F7YC 4ERSH 4Y5XA 3ZDYF 1FBIL 4F33A 3RBGA 4NBXB 1QLEL 4MJ6B 4M7KL 4QRQA 1L9MA 3IETA 1T66C 3VXTB 1KTDA 3X3GH 3IDXH 3U6RA 4OZHE 3DUSA 1JGLH 4G9DA 2VLLB 4C56E 3SEPA 4LEXH 2BOCB 4PJHA 1KLGA 3I50H 3PGDB 3WHXB 3W82A 2X4PA 3GIZH 1ZANL 1NFIA 5KG9A 2X4OB 2H2SD 4U3HA 1QFWM 3ROOA 3FOMB 3QHZL 5JTWA 4HPOL 1NFDE 3QP3A 1YQVL 3VXRB 3ZKNC 5MEOA 3QUZA 3RL1B 2JCCF 3BP4B 5KSVB 2OM5A 2HJKB 1RUPH 3GMPA 1YPZA 1I1AA 1G0XA 2D7QA 5JMOC 3AROA 1FPTH 1XIWB 4XC3H 5JDSB 2EYTB 1RUQL 5DTFB 3OHXA 2EE2A 4P5MA 1X5ZA 5ICZB 1VACB 5C6PB 3DV4A 1IGCH 4PD4K 3NFNA 4Z78B 2G5BB 3U7WL 5FHAL 4XI5D 4PFEA 1U3YA 2CLVA 4QHLA 1U8HB 3JWOH 4HKZA 4PGZA 3PHOB 4JGMA 4NHCL 5C92A 1VFAA 1J05B 2G75A 2J5LB 2CJUL 3O9WB 2YD6A 3O2WL 5LGHL 4WU7A 4ELMB 5D6DA 3UBXB 2VZUA 3QA3A 5GIRB 1YA5A 4ZUSA 4HG4J 3CVHB 4CL7A 1T80A 4QOKE 2NTFA 1A1NB 1FL3A 3WDHA 1YMMA 3GSNB 5LVEA 3PV6A 4LP5A 4QRPA 4WHTA 2JK5A 2QR0A 1JPFA 3QFJD 4WFHE 2KDGA 2XXCB 3BT2H 4MDIB 3ARSA 3FN3A 4XP4L 2YMXH 1R0AL 5HHVH 3X3FL 2A74A 3KPLA 1T7YA 4PBWD 2R8SL 4EUPB 5KS9B 1DL7H 1NDGA 4U6XB 3BUTA 3QQ4A 5JORA 4F7TA 1GGCH 3MJ9L 1G0DA 4YGAB 3U7YH 3UJTL 1F6AB 1UKSA 1X5AA 4KROB 4XNXH 4KDTC 1VFBB 4M8VA 3BZEA 1HHIB 1QBBA 3IXTB 4Y5VC 2Q7YB 1H15B 3RY6A 3WXVH 2QSQA 4GMSH 5ABDE 1JGVL 3SKOA 1CVSC 4KTDH 5MHSE 1ZGLA 5GRUL 4OCSH 1INQA 2BY3A 4F58H 5JZ7D 5D96B 2ITCA 5LQBH 2A83A 2FDBP 4ZDHB 4HFWA 4OUOA 4YX2L 3I75B 5D8JH 2EKSA 1QLRA 4QHNB 5JZ7C 2ZSVA 2R56L 4LHQB 4BJLA 2H2PD 2EKJA 2KPNA 4X7EC 1MWAL 1HEZA 3DRTA 3BDXA 3IU3B 2VDQL 3CLFH 4MHHG 4P0DA 4OIAA 3MOQA 3HMXH 3SDAB 1J1PL 4R8WH 5CSZB 4G8FB 2XG5A 3OKLB 3QWOA 4KRMB 1AGFB 4OCWL 3T2PA 4IDLA 5F7DA 4HKJA 4FN0A 3WV0A 3O2VL 1XGRA 3VCLA 2G60L 4PJFB 4DKFL 3V5KB 4P2RA 4RA3A 5I1AA 4YDVA 2IF7A 4OZFA 4HC1L 3N0PB 5GQBA 4LASL 4FFWC 3D0LB 5E03A 4GW5B 3K7UA 1J8HD 2FSEB 2CJUH 3FRUB 4HWZB 4NJAL 2DLTA 3E6FA 4K71B 3K4ZA 4IRSB 3GMLA 4TVPL 5IB5B 2BNRA 5B38A 1T21A 1KFAL 3KPPB 3S5LG 4JJ5B 5EZIL 4OLUH 5HYSB 1XGUA 3WFBH 3ME0A 4M5YL 3BZ4A 3EDEA 4HWUA 2VQUA 4O58L 1AXTH 5DLML 5F44A 5DJYA 4NFCA 3VFPA 4PJ8A 3VGFA 2ESVA 4Z76A 1P9MC 1CVRA 1A21A 1BPVA 4M1DH 4S1SH 1D7FA 1LO4L 1IILE 2XFXB 2W60A 4KDTA 3WIHA 4OSUH 1L6XA 5DJ6A 1F3DJ 1VKXA 2BCKB 1M7DB 2R56H 4P57B 5L6YL 3QH3B 1EFXD 1AGEB 1BZ9A 2BDNL 3EYFA 4E41A 3SDAC 4GG6F 3GIVA 3ZDXF 4F8QA 3P9LB 5A16A 4Y2OA 2R0ZL 1YDPA 3J8F7 4LFHD 4XZUA 1RZGB 1ORQA 5HYJE 2GK2A 1A1MA 2EYSB 4WHDA 4X7SH 1L9NA 3SGJA 5T3ZD 4FZ8H 3WUWG 4H25B 4DGIH 2J6EL 2I60L 3N50A 1Y6KR 1HILA 1RK1A 1CL7I 5DT1L 3WIIH 3ETBF 2X89A 5DFTA 1MRDL 5IR1A 5TFSL 2G60H 2OL3H 1QFWL 2OTUA 2VR5A 5I1GL 4GRLB 2PF6A 3O3EA 5D7JB 3MLZL 1GC1C 4WRLA 4X6DE 3BKYL 1N6VA 5EBLA 4NCC2 3T4YB 3CK0H 4RMVA 4N0UB 2FIKA 1J8HE 4JHWL 4NO3B 4J1UB 3RX5A 2Q87A 3QHZH 1S7VA 1UENA 1G7JA 1RUAH 3ARVA 2YPKA 3FAWA 3N1QC 2NXZB 3V7AE 1JZ2A 2J8HA 4PRIB 3V6FB 5MEQA 1S78C 1MHEB 5LWYL 3K8LA 4PRNA 1UCTA 4GSDL 1BX2B 3WKML 4Z7OE 4MQXD 3GJEA 4EN3D 2OYPA 5CIPB 3RX7A 4D0CB 1XF5B 2QQNL 1FL6A 1HQ4B 1IGJB 3FQWB 4RFNC 2HN7A 3CXHJ 4KI5F 3LDBC 1Q9KB 3IDIA 3ECBB 3HA0A 1YECH 1RHHB 1VGKB 3FT4A 3QCVL 1MVUA 1NCDL 4J4PC 4XNXL 2R0KL 3FZUD 5ALCH 4Z7VA 2Y7QA 1KF9B 3PHSA 3JWOL 4GKNB 1A5FH 3ARDA 3ORJA 2VXTL 2WUCH 3MUZ1 3P9MB 3ZL4L 2XWBA 2CO7B 1E6JH 5D71H 1C8PA 1CFSB 1RIVL 4OZIF 2VDPH 3EJJX 3S4SA 3CJJA 4XCFH 4GG6B 5C7XL 1KTRL 2W91A 3GHBL 4N0YL 1JK8A 4CKVX 1EGJL 2QEJA 2XN9A 3NCYS 4GJTB 1RUPL 3LEVL 5F1NA 4XWGL 4PLNC 5D7LB 3MREA 4POZC 2DQIL 3FO0H 4NRXB 4YK4B 4KVCL 1KCSH 5EU6D 1AO7E 1JCKA 3UJIL 4IOFC 1DN2A 5J56B 3VXNA 3EUUA 2NY2C 4L4VD 4W6XB 2YRPA 1HHGB 3K46A 5IMOA 3VRLF 5LGJA 5F9OH 1T7ZA 1S7XA 1E4WL 4FNLL 3O6FD 3P40A 4UT6L 5KVGH 3RVVD 5JOFA 1W0VB 3PWVB 2QLVB 5J11B 1S9YB 4PJDF 4F9LA 3TNMA 4N5UA 1CIUA 4OKVA 4I4WA 3QXVA 1N5AA 2XWJB 2AJSL 4Z8FH 5IGXH 5F3BA 4O02L 3PV7A 2Z8WC 1OGAD 3WIFB 3WNMA 2HKHL 4GUPB 4P4RA 3DJ9A 4FP8L 2ZCLL 4K3JL 4A2LA 4YAQA 3AS2A 4MSWA 3RTQA 1SEQL 4CGTA 1DBBL 3LDBB 4EVNA 3BIKA 4FXKB 3C8KB 4QGYA 4X6FB 3ZYZA 4XVSH 1T66D 5JA8B 4FFYH 3PABA 1YEJL 3O3AB 1UXWA 5T33H 1Y0LA 2WBKA 3L7FA 2OP4L 5HYIA 5I8EB 1C12B 4EQ2A 5BZDA 1SYVA 2JJTC 4S2SB 4Y16D 3K1DA 4ZG1A 1FNSL 1XGQB 4OGAC 3SN6N 2FRGP 5GISL 4BH8A 4JO4H 5D71L 4PRPB 3RVTC 4OFKA 1FQ9C 1OGAB 1UQSB 5EC2A 3V8CA 2FZ3B 4Y5VA 4PJAB 2AXFA 6CGTA 1CD8A 1ODAA 1I8IB 1B0WA 3LS5H 4NQUA 8FABB 4JFOA 1F58H 1NDMB 2F74B 4YFLI 1BECA 4M7KH 1KEMH 4OCRL 1CLOH 4LVNB 1FZKA 1EEUA 2WBJC 2AKRB 4G8GB 3RKPA 4HIXH 4JKMA 4OLVH 2F8OA 4YWGL 1SBBA 1W72B 3SDDA 4BZ1L 3QXAA 3WS6C 3RWJB 3GSXA 4Z0BL 1A6VL 1S3KL 1EPFA 1XGPB 5I1DA 1R3LB 4O5LL 2A6DB 2DQCH 1A14L 4RGNC 4S1DD 1KXTB 4X8JB 1DEEB 1RJYB 1MWAA 5C0CB 3IU4H 3VFTA 1EGJH 3MMEA 1MAKA 2VXSL 1RK0B 3HPJB 1P4BH 3GHBH 3TVMD 5A1AA 2R0LH 1IAOB 4PG9A 1Q72L 1TITA 2NLJB 5ESQB 3MCKA 1Z2KA 1G6VK 4X5LA 4MLIA 3SGJC 1KB5H 2C1OA 5GZNC 4YHIA 4H5SA 2R1XB 3VD3A 1QYGH 3CU1A 3WDJA 1SEQH 2CDFB 5FA3A 5B39G 1MFAL 2Y25A 2VNCA 4Z7UE 5IF0B 1F4XL 1IC7L 4JKPL 5J6GA 1VENA 2VERN 1P4IH 2P7TB 3VXQA 5EO1A 1CICA 1ZS8A 5DD0L 5F1KC 1GC1L 1RZFL 2HT4C 3GGWB 3GJFK 3VWJD 2DL9A 4FQIL 3LV3B 4OGAD 3TH4T 3TLRA 3V6ZA 1IC5H 3U30B 3BDBA 4ZQKB 1WITA 1EK3A 5INCB 3TYGH 3BPLB 4BUHA 1I3GL 5ESVB 5C8JA 1B4JH 3KDMA 3TZVC 5I15H 3NIFE 5DR5H 4L8DA 4W6YB 2WM0A 5KVMC 3REVB 1MY7A 2I9LA 2IALA 3D6GA 4NGHL 1W8OA 5HPOA 3A6CL 4OLZH 4R4FH 2LVEA 1DBJH 1EO7A 3IDMA 4MAYB 5SWSB 3V4PH 1LVEA 1JI1A 1IT9H 1UZ8A 1X5LA 3JV0A 4QO1A 4AM0B 2HRPL 2GYSA 4FQJL 2NY1C 4OLZL 4R4FL 4PV8A 2DLGA 1JPST 3MA9L 5DD6A 5E8PA 3MXVH 3UC0H 3WFBL 2UUDK 2VZVA 2X4SA 3VXPA 2YRLA 2FH6A 2X9XA 2ZUSA 5K93A 5EORH 5JHLL 2P49B 5IB4B 3O2WH 2YD3A 5ACZB 3LSOA 3VI3F 1QSEB 5TF0A 4NC1C 1IKFH 4XVTL 3BAEH 1E28B 5FOBB 2V17H 2X7LB 4W4OC 1KC5H 1KLFA 1N26A 4FFWD 2DBJA 3Q6FA 1WWBX 1JZ8A 4XPTH 1JTPA 4XBGA 3QUYD 2J6EA 2MQ0A 2FB4L 3RGVC 3ZE0E 2BY1A 2WWKT 2IGFH 4NQCB 4MCZB 2QQNH 1IGCL 3WNLA 5DJZA 2DQFA 1SQ2N 4AMKL 4JY5H 4NKDA 3UBXI 4MXVE 4U7MA 2L4OA 4AG4H 4HXAL 1B6UA 2CRMA 4LCWB 5C0FB 3QDJE 3WFCL 4FFVD 4M6ML 4U6VL 4APQD 2IG2L 2XPGB 4HMCA 3VJ6A 2J8UA 4MCYA 1BOYA 3VH8G 4Z95H 2UV3A 5EFIA 5D1XC 3KYKL 2VDQH 4FQ2H 4YHNA 5LAXB 3T0EB 1QEWB 5HYFA 3MA7B 2XNAA 5IG7A 3LQZB 5GGVH 5DRNB 5CEZE 1OTTC 5E2VL 1F8TL 3CVHH 1RZKC 4YLQT 5C9JB 1H5BC 4A6YL 4WW2B 3GBLA 2OL3L 1CXEA 2FEDC 4F58L 4JZJC 4OZHA 5EIIA 5I1JH 3KPRB 3OG6B 1HINH 3OB0K 2BHZA 4LCCB 1VGEL 2D0HA 3MLVL 4TSCH 5L9DL 4PBVC 2ADFL 3SBWC 2DIAA 5DVKA 4HUWA 5IJKA 2QHRH 2HTKD 2EIEA 1FLTX 3ZT6A 4P46A 3WS6A 4LDEB 2X42A 3N1MC 5SWSD 1DBKL 4RMUA 1I1RA 1FYTD 5I2IA 1PDKA 3MSPA 2XZAH 4JFXB 4MHHI 1XF4A 1EBAA 1X5IA 4MAYC 3E0GA 3O8XB 5D5MF 5ANME 3O11A 3IFOB 4U1GC 4N8PA 1MIMH 3B9KD 5HHVL 3U7AA 3QIWD 5JO5B 3T1FA 3DBXB 4KKBC 5T3ZL 1ZT7B 1KPVB 2UZIH 2L7UA 3MRRA 5J57B 1GJIA 5ETUA 5J9PB 4E0RB 1PG7W 4KDVA 4JPWH 1BQHB 2Y07L 5TDNB 3N85L 3BVNB 5FUCE 5ANMA 3IAPA 2BJML 1S7TA 2A6JB 4WO4D 1S78D 4N0RA 3PQYA 5ENWA 3TNNA 3BESR 1ZA3A 4U0RB 1CTNA 5L2KB 4WFGD 5M94B 3OZ9H 3HLAA 4WJ5B 1G84A 4P5TA 2ADFH 3P4OA 4G80A 4F2MB 2IH1A 5AZ2H 1XH3A 5EG6C 5T3XD 3UYPA 1RJZB 2RR3A 5F6HI 1UKQA 5BV7C 1JF1A 2QJDA 3W81A 4OD1L 5DO2C 1S7RA 5C0AD 3ROLA 1G7PB 2BSSB 1UWEH 4UQ3B 3VFUA 2YD7A 1LEGA 1F11B 1DL7L 1NSNL 4MA3B 5T1KA 4WCYH 5BS0A 4TPRL 3DVFA 3GI9L 5GZOC 2H8PB 2ZPKH 4RNRA 2MWCA 2VABB 2VQTA 4XNYL 1T83C 5IT2H 2VXQH 3PL6A 3H9SD 4RAVA 4UILL 3VXOB 2AW2A 5ALBH 1V7NL 4B7IA 2Y5TA 3NZ8B 3L3HB 3LQAL 3FL7A 1S7QA 4OZGE 4ZXBB 3P0YL 2AJUL 2NYYC 1C08B 3FO9B 4NRZA 1JGLL 5E00A 4TOYH 2Z4QB 1EMTL 5ISZA 5D6CA 1T6VN 4JZNA 4OFYD 4NJAH 4LKXA 4NBYB 4V1DA 5D7KD 4QF1B 1DQTA 3G6AB 1A4JA 1TCRA 2D31B 2W9LA 3M8OH 3QEGL 3DX8B 4DGVH 1YN7B 1RIHL 3BKJH 1X4XA 5IVXE 5F7EH 3S8WA 2CIIA 4OF6A 4M9OA 5F1IB 1JUFA 5KJRH 1MCBA 2OS7A 3L1OL 4RAUA 2RIKA 4ZFZB 5F97E 3GRWH 4F57L 4HS6B 3QUMA 2R1YB 2GTZA 2IQ9H 2F5BH 5FYKU 3O6LH 4DKAA 1U8PB 1J8HA 1WBZA 4ZO6A 2FYYB 3CLFL 1CU4H 4YEEA 1FDLL 3ARGC 3MRJB 3ZE1E 2F58H 1Q0XH 2DI8A 3GIZL 5BW7A 2GHWB 1K9TA 1IM9B 1KULA 1ZVSA 5K59E 1X6NA 3RVWC 4APQC 2Y36L 1JJUA 3OKOA 3DX7A 1CDIA 1CGSL 3MBEC 4ZUWB 1A6PA 4P2OB 4WEBL 3SQOH 43CAA 3GMNB 4M9PA 1KB5B 4Y5XC 1G9MC 4HV8B 3MRDA 3QR2A 3BXNA 4PGDB 4KRNA 2PYEA 1X9QA 1XGYH 1JN6A 4XBEH 5I1KL 1QYGL 1JP5A 1OAKL 4YHML 3RWFA 4JG1H 1Q94B 1CZ8L 3L3IB 2XZCL 3OMZA 2LABA 4FQXB 1DDHA 4J3XA 5DD5H 2EDFA 2JELH 4P59L 1JHKL 1L0XA 3O4OB 3ULVF 5DF0A 4ETQB 3MO1A 1T1WB 1QQDB 3U9UB 2QSCL 1CFTA 4RIRA 1AQKL 5FYJU 2YD1A 1YY8A 3S34H 3VWJB 5CGTA 4JFFD 1S7UB 2GT9B 4LQFL 5D9SA 1OP9A 5HGDA 5DURD 2FEEL 4OLYH 3HRZA 3RL2B 5FYKD 3SDCD 3P0VL 5I1HH 1R3JA 2IJ0C 1WEJL 1Z9LA 2HLAB 3TCLB 2XKUA 4M1CD 3U4AA 2RBLA 4J3TA 4R26L 5SWQB 3IJSB 3OJDA 3N06B 5H94A 3SO5A 3ZLQC 1NEZA 2HH0L 3PWLA 4LKCA 3RWIB 4TNWF 3TYFB 2AEIT 1RD6A 1KG0B 5DK2B 1UM6L 4KK6D 5JQHC 3UPRA 1MCKA 4N0FB 1K2DB 3LS5L 1I9RH 4RMQA 2DN7A 3CCHB 2ID5A 4R0LA 1KLUB 4YHKH 5AZ2L 1CF8H 3QDAA 1II4E 3BP7A 3DUUA 4CAGA 4XXCC 1GYAA 1TETH 5C08A 3QXDA 3ZE2F 5EBGA 3MNVA 1E6OH 3F8UB 3V6BR 4LSVH 5IVOA 1JTTA 3QO0B 2HVJA 3TBYB 3O45B 3CSBA 1MJ7H 4X5XB 4YR6A 2YUVA 5DEFB 1I4FA 2NCMA 1OP3K 1KV3A 1QNZH 2FL5B 4ZNEE 1I7ZA 3SO3C 2Z91B 4X4ME 2EC9T 4X4YB 2PR4L 3OF6D 5DD5L 5FDYA 4JQVA 5E9DD 1CZ8H 5C0BA 1BOGB 1A6AB 1MQKH 4NWUL 4RQQA 4YPGB 5HVWA 3QG6A 5K9OA 2EYRA 2P4AB 2VLME 5SX4H 3H3PL 4P5KA 1OP5H 1NGZB 1QPPA 1U93A 5AYUH 3MUGB 5DRWA 5HYJD 1M4KA 4HF5L 1X3DA 5LCVH 1R3KB 3LEYH 35C8H 4X0KA 1MRCL 3ULVC 1UYWL 4JR9H 3B5GA 4M7LL 1QHPA 3L3GB 3ALXA 4U6HA 2DM4A 1U8IB 4HJJH 4M61A 1INDH 4FQXD 3DYPA 4HGWB 3C08H 1WK0A 2IH3A 1OPGL 1OT2A 4NKMB 3W9EA 1EGJA 2DQTH 5DGQA 4ZPTB 3FQTB 3S7GA 3VH8A 1ORSB 2H32A 4XNUL 1YEDB 5F7NC 3OKMA 3WJJA 2NY2D 3RVUD 5F96L 4RFEB 4JN2A 4PB0H 4MJIA 1E6OL 4UB0L 1CDGA 4C83A 3RI5K 1FN4A 2AK4A 3BW9B 3H0TA 4QOKA 4FP8H 2JF1A 1WF5A 5TE4H 3MRNB 4YO0A 3P0GB 3CZFB 3CVIL 12E8L 3VGEA 1A47A 2IADA 1I9RL 3SKUD 3QHFH 3EBAA 3TGXA 4YDLC 4MZ2A 4Q6IA 1RIUL 3KNBB 5ADOL 1GZQB 3DURB 4Z5RB 4IHOB 1NLBL 3SKMB 3HZYA 4PJ9A 1KIQA 1MCOH 4EDWH 5L6YH 1HHJA 1P84J 1YEIH 3MRBA 1H8NA 2VSCA 2FHBA 2EIBA 3FN9A 1I7RA 1Q9WB 4OLWH 1I7TA 4LU5L 3FJTA 3SDAD 3GMMA 4XC3L 4LLDB 3QIBB 2ERJC 1KCRH 1BIHA 2F54B 1ZWIA 4U1HA 3IJYA 3LMJL 3HI6L 1QKZL 5FECB 3HI5L 2YOCA 4KFZC 5BVJB 5I1GH 4JFQB 2H26A 3ARFA 4WU5B 2IAMA 3KG5A 4LLAA 3D18A 1JPTL 3HE6B 3D2UD 3QEQD 4ISVB 5DJXA 2Y06H 2X4QB 4KKCC 1EV2E 1WC7A 5BO1L 5GS2H 3T2OA 3MRGB 5DI8A 1A7NH 1U3HC 2DM3A 4DGYL 1YEKL 2FIRT 5EBWA 4K8RL 3L3KB 4ZPVA 2VMFA 5I16A 1U92B 1ZK9A 3MRPB 2DIJA 4L1DA 2AGJL 4GW1B 4P3CH 1CLYH 1HH6A 4OCMC 2X4TB 1EO5A 3WSQL 4FNLH 5IHZB 4POYA 1LDPL 4YGVA 3G6DL 3S96A 1WIPA 2FEEI 1BQSA 3W0WE 4HKBB 4EUPG 1T20B 1CGYA 4UNVA 5I8KL 1W0YT 2CR6A 2HFFA 2VSDA 1U6AL 1LMKA 3F12B 4AT6A 3VFRB 5E8NB 5DO2D 3M1BB 1A3RH 3TA3A 2VN7A 1MCFA 4TVSa 3UZQA 3RPIA 3HC0B 4NQXA 2LAGB 1MJUL 3SHSA 4LSDA 3P4NB 1DCLA 1IGYA 3P3YA 4YUEL 2OR7A 3S6CA 1ZA6A 1M1SA 3HFMH 3PWNA 5AG8A 2BVYA 4EN3A 5I17B 1DUZA 1A3LH 4F3FB 1FG9C 5EC1B 5D5MB 3OAZH 4LK4A 3VGGA 1IQDB 1ZT4A 3F6IA 2H1PL 5CEYB 5C0RH 2HT2D 1LQSR 5FO9B 4HPYH 2OI9C 1SYSA 3C09B 2EEBA 2DJUA 3HN3A 4M43L 2QADD 3HCVB 5AYUL 3DX9B 5LXGL 1IFHH 3IFLH 4HIJA 3ARED 4CW1A 4PUBL 1YMHA 4D9RD 2VQ1B 3EYVB 1OSZA 3C60D 2ERJB 5D7IE 3NPSC 3TC9A 2E9IA 1IL1A 4LPVA 1KIRB 2GJ6B 1N2RB 1TDQA 4H88L 5H2BA 1OAXL 4YIQB 1T1XA 2J2ZA 4HKXA 3VFMB 1K3IA 3O6LL 4LVHB 4N9OB 4U1KB 3RP1A 4ODXA 2N7AA 2Q1EA 5INDB 4OQTL 4S0TD 1YEFL 5FA4A 4PJGB 3IVKA 2I07A 1ZLVK 5JW4N 3QO1B 3MRIB 4D9LL 4OCXH 5A2JH 3MLSH 1AY1L 2DMBA 1CE6A 4N9GB 2OCFD 3SDCA 1UWEL 2I25N 4OFIA 4UV7L 3LKSA 1H0DA 3ISWA 4MNGE 1DQJB 2EZ0D 3DVNB 3M17A 1JGEA 1FLRL 5KTEH 3BZDA 4QTIH 1A6ZB 4Q9QL 3GSQB 3F7QA 5DGRA 1NCBH 5TE7H 4ZTPL 4HLZH 5E08H 5H35A 1QA9A 1YJDC 4FFVC 2R2HA 2A6KA 3AUVA 3O0RL 2FX8H 5GGSB 4OZGA 1BVKB 2B2XL 4P9HH 1RI8A 4F33B 4DN3H 3NMEA 2Y07H 1F3RB 1ZLSH 1I85A 4DJMA 3LY6A 3P2TA 4QHMA 1FSKC 2Q3AA 1PYWA 5I9QC 4JRYA 3HZVB 2W0PA 5HDBE 1QLFB 3QFDB 1W8NA 2AXGB 5C0IB 4YC2B 3RNKA 4G8GD 4WIQA 3JWDH 4HAGA 2OI9B 3H7LA 3QJHA 3NH7L 1NCNA 4OBSA 4WI6A 1X5HA 1G7IB 4DTGH 1NCAL 1RIHH 1G6RL 2VUOA 3KVQA 4S1QH 2X41A 4RMWA 2GSGB 4TUOB 1LO2L 3WXVL 32C2B 3BP6B 3NIDF 3MLRH 1VB9A 3U7WH 1YN6A 1FZOB 1VESA 2ZUYA 1I8MA 3JV4A 5JDSA 4OF5A 1FJ1B 5ICZA 3TO4A 5IMMB 1EMTH 5C3LD 4DZBB 3A0OA 3U0WH 3OKKA 1DBML 5C70A 3STLA 1LE5A 4X98B 3U2SA 3MFGB 1F8TH 4I0CC 1LP9E 4D0DA 2CLVB 1U36A 3S97C 1Q0XL 3LKOA 1OB1A 2KQMA 4R90L 1J05A 5HHMB 2DTSA 1XCQA 2VDKL 4PTUA 4QRPE 3G04B 4HJ0C 1D5XA 4ZFGL 4DK3A 5MHSD 2YA0A 3OTTA 3GB7A 3HAEH 1P7QA 1NBQA 5ILTL 1A1NA 1FL3B 4RWHA 1CDUA 1YMMD 3IJHA 5EU3A 4FOMA 2FATH 3GSNA 2DKMA 1WBYA 2EH8H 3NTCL 2NX5E 1U91B 3C8HA 3MLTA 4WO4C 1F58L 3HB3C 2B4CC 2PTUA 2NY4B 2VXVH 4X6CB 2N56A 4XVJH 4Q9QH 1EVTC 4GMTH 1OHQA 1U0QA 5F70A 4HMDA 3ZYJA 5HHNB 4LHUB 4G6FB 2NY2B 3H42L 4QKXB 1A7NL 3D3VA 5JHLH 1T2JA 4BSVA 2OZ4L 3RQ3A 3MJ8B 3B43A 5IVZA 2E9BA 1QSEE 3TIEA 5A43C 3ULUH 4MDJA 4OCXL 1YEEL 2AK1H 2F19L 4D2NA 5KZCD 5F88B 3RWGB 3KWWA 4JZJB 3ZKND 1VFBA 5I1LB 2X4NB 1IT9L 4R97C 4NRYB 3GMQB 2DYPD 4YE4L 4EDXA 3ARUA 2FGWL 4Y5YA 3RIAF 5SWSE 4M7ZC 5I66B 3CX5J 4OT1H 1CDJA 1FV1A 3QDMD 2A83B 1ZLUH 4ZDHA 3SGDI 4MQ7A 3MGTB 1SJHB 1RUKL 3FQRB 4TULH 3VXUE 5IMLB 1ZMYA 1ZTXH 5LGHH 3LN5B 4HK0A 4XPTL 3E3QE 3KJ6H 4BK5A 2DLFH 2YD8A 3K74B 4K3EL 3RTQC 2P44B 4LSPH 1KB9K 1R5WA 3JWDC 5J0BA 1F2QA 4CN6A 4D9RE 2VC2L 1NAMB 4KI5E 4HKJB 1XF3A 1HINL 2V5RA 3MXVL 1CFQA 2MJWA 5DYOA 4R7NA 4JHAH 1M71B 5C6TL 2BNUA 2MOVA 3J7HA 1M7XA 4UBDC 1BJ1J 2BSRB 1X5XA 2P47B 2YD5A 1P9MA 5TQ2L 5IB1B 4X9IA 4CRPA 3REWA 4KZEH 4ONHB 1ZVYA 1DBJL 3QAZC 4KC3B 4OZIE 4KQ4L 1OPGH 2O5XL 2BNRB 2Z8SA 1TZHA 3T0XA 3GSUB 2EC9U 2H9GB 1N59B 4HZLA 2D7TH 3UTSB 3MXWL 1TQCC 4GG8A 3D25B 1NC4B 4XBEL 1CLZL 4Z7QE 4H8WC 1DBMH 2I9TA 4XPBH 1A9BB 2OTPA 3PXHA 4FMFA 4KJPD 5EOCL 4YDKH 2X6MA 2DQGL 2IMMA 1QSZA 3FOLB 4JM4H 5JPNB 12E8H 4X4XA 5D2LE 4P3CL 3HC4L 5C0GB 4LSSH 1QBAA 1YYLL 1I1FB 4LL9A 4ZMAT 3QWQB 4P2QB 3B9VA 4JQIL 3OAUH 2P8PB 2IAMD 1AGEA 2VDLL 3VXME 4A6YH 4XPAH 2YBRB 4K7PY 3SGEI 3U4EB 1DQML 5GS1C 3JTSB 1EIBA 4L8SB 2IAMC 1EFXB 1A7BA 5HHXL 3EFFA 4XMLL 4P4KA 4HJGA 5D7KE 5FK9A 4L9LA 1P1ZB 5JW3H 3G5VB 4HUVA 4KMTH 1SM3H 1BD2B 2ZNXA 1XZ0B 2W65A 5JLZA 5CJBA 3VE0A 3O2DL 3VFWA 4WFFD 3DWTA 4NDMB 1GIGL 1SJEA 1KTLA 4R7DA 2ZCLH 3OGCA 4KHTL 1JGDA 4E5XB 4EKXA 4EZMA 4ZOAA 1MCPH 2PW1B 2R9HD 5MENB 2NTSP 1X7QB 5HDLA 1WICA 4MJ5A 1JYNA 3SQBA 3V0VB 2NY5C 5DFVC 1AXSB 5LCVL 1WUNT 3KYOA 3WS3A 1MHCB 2JB6B 1URLA 5I75C 2ZUQC 3AREB 2HKFL 2WBJA 4NNPL 3JUZA 1MI5B 4ZNCD 1INEH 1HOCB 2EIZB 1EXUB 2KZWA 2Z31D 5GISH 3C9NA 5EUKA 4UU9A 1QG3A 3LOWA 2OTWA 3G6JA 4YDJB 2DKUA 1CGUA 2DL2A 4OM1H 4G9FB 4NKQB 1XF5A 1UZ6F 4TSBL 2ZPKL 1BLNB 1KPRA 3STZA 1J1OL 4Y8DC 1FO0H 3IFNH 5I30H 4JRXD 1JYXA 3U0PA 4LRIC 3S88L 2QSCH 4Y19B 3FQNA 3WBDA 1I8KA 2EEAA 4YDIH 3HZKA 4LFHG 3CSPA 1JPSL 4KV5F 4F7CA 3MLXL 1FIGL 3X13B 4OCNC 2W9DL 2FJFB 3T1WA 3VGBA 3MR9A 1AGBA 4Z7UB 4F7EB 3KPMB 1KCVL 3TPUB 2VUYA 3QQ9C 2DWEB 4CN4A 2NY7H 4X99A 3VXSD 4PTTB 3QDMA 3OPZL 1MRFH 1KNOB 1PZUB 3FQXA 2HKFH 1FFPB 4N90D 4LGPB 3WFHA 5MEPB 1KIPA 1OAUL 4PGEB 4TN9A 3VWKC 4P3DB 3EGSA 4EI5A 4N1CA 1ZV5A 3BJLA 5I6XB 4JLRA 3RGVD 1IAMA 3WJLC 5IMKB 2FHCA 1A2YB 4HCRL 3BH8A 4OM0H 4L3CB 5E9DA 4AQ1B 4BSWA 4Q6IC 4OZ4B 4LLWB 1DQQB 5E8EB 3P0VH 4PR5B 3QFJB 3SDXB 4FQQB 4LLYA 2IQAA 4OZIA 3TO4D 3ARYA 4CMMA 5JW3L 3V4UL 3RHWF 1CD0A 2NY3C 5TJWK 3RWCA 3FTGA 2BFVH 4MNQE 4LLVA 4FS0A 3ULUL 2VLKD 4YXKL 1RIVH 2CRYA 4K2UH 4MAUH 2QADC 5E5MA 1JPGB 1RY7B 2ZOLB 4KUZH 4NYLA 3D85B 4L3ED 1YMME 2WWMC 2A2QT 5EUOF 1UC6A 4JR9L 2QHRL 3ARBD 3BKMH 1BFTA 1NGWA 1ZLWH 1EAPB 3UEZA 1HH9A 2JIXB 1MFBH 1DLHA 4LLMA 5F89B 3ARBC 1XF2B 4U1SB 2E7HA 2CIKA 3MRFA 1T1ZB 2DQGH 2DQDL 5GSRA 2R0ZH 3TJHC 3CH8A 1A9EA 1EHLH 4WTXA 1MUJA 2GKIA 5D1QB 3EOBB 1QFUL 4PJEB 3CSGA 3UTSE 1F4WL 1VFUA 3ULUC 1AP2A 5D4QA 4U1JA 2PO6A 3OKDA 1NGPH 2VH5L 3EDFA 1HHKB 1MAJA 4WHYH 4Y4FB 4JFFA 1NDMA 1PLGH 2P24A 3GDBA 3UDWA 1WQVT 1AGCB 3EOAA 1IAKA 1QHOA 1KBGL 1CK0L 1MFDL 2NYYD 3BKYH 1VERA 3HI6H 4UIMA 5TQ2H 1IAIM 1A7QL 4IJ3B 2C1PA 1K4DA 3QRGL 2PYFB 4BQCA 4LSVL 4TTDC 4TUJA 4XCFL 1MCWM 4E42B 4R2GD 1KJ3H 5D2LB 1HXYB 4M93B 4OCLC 4E9LA 8CGTA 2DLFL 4MD4A 3ZHKA 2ZUXA 4KPHH 4XVJL 4YEFA 4X6BA 3MCKB 3V52H 1RZKH 4P23D 5FHAH 2A9NH 1WZ1L 4MNHB 5E94A 2Z9TA 4GW4B 3TWCH 2R1XA 1U8MA 1KLGB 5A2LH 1UKTA 2ZSWA 3VXRE 4WENB 1EEZA 2NY3B 5M7QA 3EZJB 3RZWA 2Z93A 5CGMA 3NCYP 3B8YA 3UDWC 4NKOB 1LNUA 5AAMA 1DTUA 3MOBL 3NN8A 2BC4B 3QUKB 5B21A 5E7FA 1T5WB 3N9GH 3O0RH 3D0VA 1FRGH 4G6JL 4NO0D 3ARPA 1V3LA 4PG2C 5B38G 5LQBL 3D39E 4Z78A 3CFKA 3RJQB 1T5XB 5J7CC 3QDGD 4CMHB 1WGOA 5IHLB 3SGEH 4QTIL 2CLZB 1MFNA 1NMBH 1RSFA 2O5ZH 3B4NA 4G6ML 4XH2B 1CBVL 4PY7A 2G75B 1MI5E 1FGNL 1T4KB 3O9WA 4NFDA 4P9HC 1NLDL 1QTYT 3MNWA 4NKIH 5CMAB 2BVPA 1FFNA 3DLQR 4PLJD 5E7BA 4ELKA 1TVDA 3O81A 4LSQH 5IBUB 4E41E 1KEGH 2GTWB 3G5ZA 3TBVB 4GRWB 1F42A 2P42B 3NH7H 4XPGH 4HBQA 1C5DB 5J12B 4KY1L 2BDNH 4AEIH 4S11A 4UUJB 2CDEB 3DSFH 3L9RA 2O61A 3CDYA 4OCYH 1IM3B 1SY6L 5GGVL 4LCCC 1P4BL 1G7LA 3CGTA 1V3KA 3SKNA 1CD1A 5GHWH 3RDTC 5T3ZH 1MCNA 4R96A 5IB2A 4ODUA 4KTYA 2F53D 2A74B 4UDTA 2WQRA 2DMCA 4Y0GA 4E41D 4ZD3L 5DJZB 3WDIA 4HUKB 2F54D 4QTHA 1S7SB 5FUZL 2FBJH 2R4RH 4Q0XH 5EZJA 5FYKH 3V9FA 5DJCA 4Q2ZB 5E6IA 2JJVA 3CSYB 3RAJL 1NFDB 3P30L 2K1MA 3PHQA 2X9YA 1A0QH 3BKCL 1LDPH 4NPYA 5HI4D 4UZGA 1LK3H 3VI4E 3SBWA 1F00I 3MUY1 4XNZC 1BVLB 3BZEB 4P46D 3ES6B 3AC0A 3LKPB 4U6TA 4KPHL 4Y4KD 1HYSD 1QFPA 5ITFB 5DS8A 5JPMA 1K5NA 3BHBB 3C5ZC 2PXYA 4X6DF 4UIKL 5DRNA 4M8QB 1FVCA 1VPOH 1TJHL 3SCMB 3BEWB 3W0WB 5JIKA 2IFFL 4TNVF 1SEBA 1JZ4A 5C9JA 1A6TB 2V2XA 3TBWB 2OR9L 4HFWB 2C3GA 3IETB 3MGOB 2A0LD 2FJGA 3QRGH 2H3NB 4NNXA 1UA6H 3EJYD 4QXUH 3MNZB 2APTA 3JZ7A 5HJ3A 1QKZH 4PJHB 3H9HA 2AAVA 4Z7OF 4ZD3H 1IGIH 4OV5A 2QQKH 3ZT5A 3RZCB 4LGSB 4AY0A 1PVHA 2BSED 1SBSL 3FT3A 5IJVA 4JKKA 4XVUD 1WIUA 5IW3A 5DLMH 4WHYG 4AG4L 4AL8H 3LD8B 3WIHL 5F21B 4WUUB 1I3GH 4ZUUB 1XGRB 2AK1L 1INEL 1M05B 2F19H 4OCYL 3UMTA 1IQWH 1YY9C 4P2RB 4NP4L 4X9BA 3TZVA 4N8VG 3PUCA 4KGJA 4QYOA 4MZ3A 5GXBB 1S9WA 3OHXB 1FZJB 4OLXL 3DBXA 4CADA 1VACA 3E6FB 3QZWG 4WW1A 1M7IB 2X10A 2AJXL 1MELA 1NUGA 2F8VA 5BRZB 3SKJH 1YNKL 1QFWI 2EH7L 3ULUF 4WO4A 4XRCB 1UCBL 1V05A 5HI5D 3PQYB 5ENWB 3VXUB 1A3LL 1MJJB 3VDCA 1A0QL 3BKCH 4KXZI 2Y36H 1A7QH 5FYJE 5DJYB 3ZKQD 1IARB 4CNIB 5D96C 4GRMB 2A77H 2D2OA 4X80L 5K9JH 2V5MA 3VA2C 5D70H 2KBGA 3TPKA 5HVFB 4LNVA 4Y1AB 4XP4H 1AFVL 4JFDB 1NJ9A 3NAAL 2XFXA 4ODHL 2WW8A 1XGTA 3RU8H 2HJLB 3VWKB 4UQ3A 3DGGA 4PJDE 2AJ3B 2NQCA 3V5HA 3MRQA 4M7JH 4MA3A 3MV01 5FM5O 1MREH 3MJ9A 4QOKD 3WFCH 5ADOH 3RIAK 3S98A 2VZ3A 3DX6A 4OLVL 3QQ9D 4EUPA 4K07A 1NDGB 1FORH 4JVWA 4U6XA 3GNMH 1GGBL 4C56A 1N6UA 4HWBA 3R8BB 4U2YA 3VFVA 3SE9L 3TA3D 3FN0H 5HXMA 2AJZB 3ARGB 1I8LA 4G42B 5I1EH 5E56A 4Y4KB 2X44D 4NHCH 2D4DA 3DIFB 4DTGL 5IR1B 1MIEH 3B83A 5L2KD 5E5RB 4M6AA 3DUHA 4GRLA 3BQUB 1CN4A 1HZHH 4U4BA 2YPVH 3MA9H 5DD1L 1HHHB 5IW1B 5GRJH 1AKJB 5IFHL 2VITA 5ALBL 1MEXH 4GRWH 3Q5TA 5DUPL 4I77L 5BW7C 3FONB 3R4DA 3NCFB 3IFNL 4QHNA 5KVEL 4JJHA 4LSRH 4K9EC 1TCRB 2N4IA 5ID0B 5JXEC 2YPKB 5I8CB 1FO0A 2E27L 1PSKH 5DDHA 1MHEA 2R69H 1V7MH 1K85A 4Z0BH 3GSRB 3O8XD 4ONOA 4WCYL 4IIQB 2EDJA 3GJEB 2VC2H 1LP9B 4HIIB 1FAKT 2B4CH 3B9KB 3S5LB 5DA0B 4F37K 4IRJB 5HYQB 43C9B 2X5PA 3QUYA 2A6IB 4HS3A 4WWID 2QQQA 4KJQC 4JFPA 2DLHA 5T3XL 5L8LB 1Q9KA 1E27B 1FYTB 2V5TA 1MVUB 3BN9C 4R4NC 4BSJA 2WWKO 2FEDD 4OZFB 3LKQB 3SDYL 4YBLC 3D0LA 1ZVSB 3FB6B 3IDJA 4DFIA 2DLIA 1MCPL 4CBPA 4PJCE 4MNGB 5BMFH 3O4LA 2BP3A 1MFCH 3VFSA 2W0KA 2WIIA 1T22B 3ZT7A 5B38B 3DSNA 3C2AL 1QBLH 4XCYB 4KMTL 5GGRA 4ZAKD 4Y4FD 5GZND 4QXUL 4TRPL 3H6JA 2AK4D 5HHOB 3AU1A 1PJ9A 4KK5D 5J8OA 3BX7C 4MJID 3BEVA 3OXSA 3HZMB 2JCCE 3CXDL 3CFBB 5GS2D 1H3PL 2XRAH 5EIVA 1B4JL 1KFAH 4DCQB 2ATKA 4KJPC 1BIIB 5DMKB 4QRTA 1BJ1H 1IC1A 3DO3A 1JWMA 5EU5B 4BZ1H 4GMTL 3GSOA 5IK3A 4LCWD 2FO1A 2ICCA 1OAZH 2GT9A 3F58L 4P23B 2I27N 5GGTA 4CVXB 3PL6C 6FABL 5CD5C 4YXLL 4I3GA 2HLAA 3TCLA 3BYTA 3HI1A 3QWRD 2AQ3A 3K2UL 3O6FA 3LKNB 3U0TA 3PGCA 3EW3B 4N8CH 3SDXE 4G8IB 4NQSB 5FHBH 5FYLD 2B1AL 2QKIB 4ORGA 4PRAB 1NBYB 3H2WA 3FFCA 4PJIB 4GAYA 5CUSL 2JLLA 4LNRB 5HVHB 2PR4H 3CVHL 2ZJSL 1T1YB 4DEPB 2R2EA 1U58A 3P73A 4OTXL 5AWNL 1EAJA 5EBMA 2HLFD 1GGIL 1ED3A 3OQ3B 1KLUA 4V1DD 2F5AH 2ITDB 3ABZA 5LGKA 3HNTL 3NPSB 3PP3K 1P4LA 2VLJB 1BGXH 5C08E 3KPQA 5HHPB 4PJEF 2IWGA 5TH2A 4Y5VB 4FZEL 1UYWH 3MBED 1XCTA 1DE4B 5BOZG 4KKNA 5AEAA 2R1WA 5EWIH 4PYHA 3DETC 1BZ7B 4YHKL 4YR6B 4S1QL 4L29A 3MROA 4GO6B 3E8UL 4ENEC 5K9QG 3R06B 4KMQA 3QT2A 4Y16C 4Q9RH 4AENA 4YXHH 5C07A 3BRDA 1FL6B 1KPUB 1KT2B 3MRMB 1NMAL 3H3PH 2WLZA 4RQQB 4KJYA 3ALWA 3VW3L 5IV2A 5EZOH 2JE8A 1KJMA 4C55A 1TENA 4TQEL 4HQQH 3U9PL 4BFGA 1V7ML 1YNTB 3P9MA 5FCUH 3TA3C 2ICWJ 4PG9B 1SJXA 4ODTL 5AD0B 2ARJB 4OAWA 4P9HL 2J3SA 3IF1A 1AXTL 1C16A 4PRPE 4CVZB 3I6LE 3FO1B 1N4XH 3C5ZB 3VGAC 3JV5A 3D3VD 2H2PC 3CU7A 4EBQL 5CCKH 4HIEB 2DJSA 1CQYA 3QEUB 5BZWA 4TNWK 2VISA 3BMWA 4JG1L 1E6JL 5DQJB 3AMLA 3QDJD 1LD9A 1NEZG 2KZ1B 2BRRL 3MODH 5GS1B 5DHYA 4IMLA 1QSFA 1H3WM 4KKAC 3U36A 4QCIA 5D5ME 4HWEL 4ZYKB 4UT7L 4I5BA 2EDRA 5C0CD 2Z92A 5FO8B 4JPVL 3X11B 3DRQA 4Z18A 3OSKA 4MAYD 4XWOC 3MUJA 2YKLH 4J6RH 1RHFA 4JKPH 2HH0H 5C8JB 5HI5C 2PO6D 1IC4H 2VLMD 4P46C 1T89C 5DK3A 2HT2C 3BI9X 1Z6JT 4JANB 1P6FA 5CJQH 1PLGL 4UQ2A 1RFDH 5SWSA 4UV4L 1HWHB 1AFVH 1AQKH 1TJIL 4Y88A 3DURA 1ZANH 3AREC 3I6KA 5DZLA 1PGRB 4PJ5B 5FV1L 4LF3A 3PGDA 5BS0E 1TTUA 3N1PC 5DJ2B 5BRZD 1S5HB 4HJJL 4PJ9C 5DEGB 5DMJB 3UTOA 4RRPG 3SE8H 1RU9L 1OTTD 4M4RA 5E6YA 1GL4B 1JNHB 3H42H 3UPAA 4QXTA 1BWMA 3BKJL 3U1SH 2ICEB 3ESVF 2F54A 1NPUA 4D9QD 5CJXA 1CGWA 1FBIH 4AK1A 3FN0L 4OZFG 4MYWB 2GQHA 4FFZL 4GG6E 4LBEB 3ZHDA 2QBWA 5T1DL 3OR6B 5FYLL 3EFDL 1AH1A 3WUZA 1WWCA 3ZTNL 4W70A 4JFOB 2V2WA 5TF1H 1WAAF 3A6BH 2ED9A 1EHAA 2VB5A 4NQCE 1WC7B 4YQXL 2FX9H 4NN7C 4X9FA 3QNYB 4M7JL 4CMHC 2NPLX 2XPGA 3VXRD 2VN4A 3OXRA 4PG2A 3PHOA 4QWWD 5DJAB 2ZUTA 2FBOJ 3PP3H 5GGQL 5LAXA 2VXQL 5EU4A 3F5WA 2V5SA 3KPTA 1CXLA 4WNQB 1L6ZA 4POUB 1FZMB 1LO3H 3WUWA 3O3DA 1G0YR 5IOPA 5GIRA 1OAYL 5J1TC 4G5ZH 4U6VH 4NT6A 1DVFC 4QRQB 2LU4A 4R2GC 4RFNB 4ZSOB 1IAOA 3AB0C 4NM8H 2ZKHL 1MRDH 4HH8A 4OCSL 4PV9A 1H5BA 5HDBF 3DUSB 4G6AD 2I5YL 3KYMA 2BOCA 4NQDD 3MV8E 2L0DA 5I76A 3MJGX 1QD0A 2O5YL 3BE1H 4NQXB 5D2NC 3VGDA 1B0GA 5J4MA 1T2QL 4P46B 1AD0B 3TBTA 1JF5A 1K8DB 3QNXA 3SE8L 1IGYB 5FF6A 5EO1B 5MENE 2ZCKH 4X9GA 1E4WH 1DUZB 1HIML 2EDDA 3BH9B 4WWKA 2W07A 3CH1B 3BN3B 2BVUA 1BFVL 2BOBA 3O6KL 3AXLB 3EO0B 1J0IA 5EOTA 1JZ6A 5KSBB 2IANA 1HI6B 1GGYA 1LO3L 3BT2L 3Q5YA 3BDYH 3NFNB 3HPLB 4LCUB 4Z0XA 1ZE3C 3AGVA 3SCMC 1IGFL 2J8UE 3KXFA 5CEZD 4HIJB 2XTJD 1OQXA 4XX1G 2DF3A 5D7JD 5T1LB 2W0FA 4MWFB 1P2CA 4BELD 4UI2A 3TNNB 2KUTA 1KIRA 2EXWC 3JXAA 4AM0A 3HG1B 4PJDB 2NX5B 5T1LD 4GBXC 4G80B 1OM3H 4QRSA 3W9DB 4OQ1A 5DVNA 2EXWD 1OLLA 3V5DA 4JFDE 5JNYA 4UIKH 4BQ6A 1FVDA 2X1QA 3D69B 1CGVA 1F13A 3VXPB 2CKBA 4RBPK 3UROR 2OJZH 3QWOB 1WSST 4LEOA 5TE4L 2YC1A 4YC2C 5LKNA 5F9JB 2OL3B 1AY1H 2DICA 5D1XB 4BZ2H 5I1JL 3Q6FB 4HBCL 1G9NC 4NM8L 1RURH 1ULVA 1PKQE 2PXYC 3DGCR 3RY5A 4NO2A 1I75A 3MQIA 1JYWA 3JWDL 3M17B 1KACB 4XNMB 4ZTOH 4DOHE 4WGWB 4F7TB 2V9QA 3K4DA 2VABA 2ED7A 4U6YB 1DQDH 4F7PB 1NBZA 1ZGLM 4RAVB 4NN6B 4XGZA 5CJQL 5GJTL 1B4RA 2YA1A 5AG9A 1QA9B 4PJXA 2P5WB 4NUJA 1LO5A 3E3QC 5KZCB 1MAMH 4H8WH 5BVPL 2A9ML 2XOTA 1GPOL 3U0WL 4LSSL 3KYNB 3UBXG 1I9IH 1INQB 2P45B 3GMRA 1KEML 4OCRH 1EUUA 4K3GA 5JW4M 2PW2A 2A9NL 5DHVA 1YNKH 2EH7H 2AI0H 4WW2A 1N0XH 4I0PC 4JAMA 4LLQB 3MLVH 2AGJH 1MFAH 4LPYA 2XKNB 5GS3A 2VDNL 1PX4A 2XWTB 4GKZA 1H9VA 1W0WB 3NGBB 2Z35B 1AJ7H 4HXBH 4TOYL 1XR9A 3MRCA 1BGXL 5DD3H 1PEWA 4RAUB 4ZFZA 3C5ZD 2HYMA 2OR8A 4N8VA 4G8FA 5F7UA 4GOSA 4L5FH 3W5NA 4KK8C 3CZJA 1AGFA 1FPTL 2YEZA 3OF6A 1G7HA 2GFBA 1XF4B 2VTFA 1Q1JH 3EJZD 1LO4H 1U3HA 2E8ZA 1FG2A 5I1AB 1U8JA 4FFYL 1I8MB 5CINH 3KPOB 5C2BL 3ZDYE 5EPMB 1N64L 5D7SH 1HKLH 1YYML 4M6OL 3OX8A 3QEQA 2Z31A 4HWZA 5F9WB 4J8RB 5BV7B 4HCRH 2NY6B 1KCLA 5JR1L 3GMLB 1CF8L 3BP5B 2FD6H 1CGTA 1I3RB 3GUTB 5B3NA 4DKDC 1ITBB 1D5XB 2J88L 4XP1H 5C0RL 3DXAB 4O51A 3NA9H 1J12A 3B2UD 2NNAB 1TZGL 3VA6A 5DK0A 3QIUC 1AD9B 1GZPB 4FTVD 1NH6A 1U95A 2B5IC 4D0CA 4DKFH 1KN4H 2BSTA 2FGWH 4RSVA 4NZTH 4TRPH 1J7VR 3NACL 2DQIH 4MVBC 3U9UA 4LSRL 2HRPH 4O2CA 4AEEA 4LOUC 1YJDH 2NY0B 4P4KD 3WO4C 2OX5A 3V4PL 1ZEAH 4MQSB 1MEXL 4Z77B 1OTSD 4LRNH 3NIFF 3BPCB 2VWEE 1NCTA 4XVSL 1YEEH 2A38A 2GK0B 2R2BA 2JELL 4P59H 3TIDB 3D3VB 2UWEF 1MFCL 3EOTH 1MCLA 3MJ8A 1N5YL 3CAFA 1NEZB 3S4SB 3FHAA 1N7ML 3IS1X 4EIGB 2GSIA 4HHAA 5DC9B 5C2UB 3KWWB 4JZJA 4PUBH 4HUMB 4IOIA 5GJSL 1NCWL 3QDJB 4QT5A 2FR4B 3QHFL 5D7LA 3EJZC 5GRUH 2W92A 5IEHB 3WD5H 2LE9A 4V1DE 4JPIB 3JVGA 3MGAA 5DJ0B 2Z4QA 3BP7B 3UTTA 1TQBC 4L4TA 3JVGC 5ESAA 5SWZE 1ACZA 4XNUH 4JY4B 3QO0A 1RMFH 3OV6A 1AO7A 5DRZB 5FKAB 5JOFB 5DXWA 3B5TA 4F9LC 4MS8D 2BNQB 1MLCB 5HY9B 4APQB 1XR8B 2ADIB 3ZKMD 4I3SH 3A6OA 3RWHB 4UDUB 1Y6MR 3HI5H 3NCJL 3BMVA 4PRIE 2R1YA 5EOCJ 3FQUA 4IOFD 5C08D 2ADJA 4PJCA 1KN4L 4MSWB 4Y1AE 2HFTA 3DO7A 4M6MH 3MRHA 4U1NA 1EZVY 4WI2A 5FDWB 5I71C 5I73B 1DLFL 4N68A 2HFEB 3UZEA 4P9MH 2BSRA 1VDGA 4K3HA 3REWB 3MUGA 3SJVA 3K8KA 5I8EA 4JFZH 4WFHD 3SE3C 3F58H 4X6DB 1FORL 4U1MB 4DQOL 1UJ3A 2FNBA 2VLJD 2P46B 3ARRA 3T0AA 2F9BT 4GS7B 4JCMA 4PBXA 4DUVA 1AHWB 4FQ1L 3B8SA 4JY6B 1IQWL 5CZXD 1N7MH 3WO4B 3WNOA 4PRBA 2DI9A 3RU8L 4ODSH 2P5EB 3HNSL 1GIGH 1PX3A 4WFGE 5HSFA 1ETZB 2G2RA 4WY7L 2IH3B 5DJDA 3WFZA 2Y4SA 4X4XB 3INUH 5LGJB 1RULH 3W39B 5HPMB 3TZVD 3RNQA 3T0EE 1QQDA 4WI3A 4XI5C 1HIMH 3TEUA 1XGPA 5I1DB 2VAAB 3OAZK 2AS5M 2BVQB 4C83B 4K3JH 2NY5L 4OKVB 1OAQH 3WFDL 2AABH 3NA9L 1WBXA 1ZGLP 4ZS7H 2OZ4H 4JM2A 4PJHE 4OV6F 3C5SB 2XZQL 5EU6A 1R3JB 4P2QD 4Q74A 4LAQH 4WUKL 1NLBH 1RK0A 4ZFOA 1J88A 5SWQA 5ESQA 2YUZA 1U42A 1RVFL 2XIDA 35C8L 4OLEA 1J5OH 2VE6A 5MERB 1FNEA 5IBLC 5CBAA 5T3XH 2VLLA 5CJOL 4R0LC 2DTMH 4PJBB 3WD5L 2DS4A 1OD7A 4ZSOE 3UPRB 1I9IL 5BRZE 2UY6A 3L7FB 4JDTL 2AJVH 5GRZA 3JTTA 4DWHA 4PD4J 4IRZL 4LP4A 2V7HA 3JV6B 2ENYA 3D2UB 4IRJC 5DEZA 4HUUA 3BP4A 4UNUA 2EO9A 2JB6A 3KJ4C 1F4HA 2EZ0C 3QXDB 1MFEL 2D0FA 4ZUTA 5GGQH 1I1AB 5H37H 1T0MA 4QNPF 3BJ91 5EC2B 2R0LL 4RGND 4S1DC 2N1KA 4KKAD 4OTXH 4YHPA 3EO1A 3L5HA 1L0YA 4OGYL 1JV5B 2IQ9L 3QIWA 4L5FL 5JXAL 8FABA 5FFLA 1NAMH 2EDOA 3C6SA 5DJ8B 3MLZH 3QUMH 3RVTD 5E6ID 3U30C 7FABH 3A67H 1RURL 1LK2B 5T1MB 1EUTA 5C07E 1UWXH 4HKZB 3MUHL 4RRPA 3IDMB 1BOGA 4HDIB 4OZGF 1UZ8B 3ULUD 3U46B 3U83A 4W6WB 1ZHBB 1A7OH 1LK3L 3UBXA 4YK4C 2DQJH 4MX7A 3EYUL 1OAZL 1F2XK 1NCWH 1UH3A 3GKWH 2WNGA 4JRXB 3MMEB 4NNYB 4NSKA 3HE7A 5C0EB 1F3JB 4W68A 3H9SA 4U1LB 1FCCA 4AEHH 1QBMH 1FFOB 3RWEA 3MYJA 3QDMB 4AL8L 2WINB 1NC2D 5F9AC 2H6PA 5HGHA 4KI5C 3TBSB 1P7HL 5EUOA 15C8H 2C4FU 1SHMA 5CINL 3CK0L 3BDYL 2DIBA 4OQTA 5E2UL 2JCCB 3P9WB 1HSBA 4YX2H 4MA1B 5D1QC 1LHZA 5JOPE 1CFVL 1A2YA 1QO3B 3HHRB 1GVIA 4WTZA 4M62H 3VG0H 3QQ3B 5C0FA 1T0NB 4O4YH 4OGXL 3BGMB 3UTPE 1IM9D 3EDJA 4PJIE 4GAJL 5EC1A 1I1AC 3P4MA 2NW3A 4X6CF 4A6YB 5F6IC 2NR6C 3PNWA 3PDGA 2X2YA 1H15A 1IMHC 1K8IA 4JPKH 1KC5L 3QXUA 1CQKA 3KDMB 4X5WB 3LZFH 3QUXD 1ZGLB 4L8DB 1Y18A 5E8OB 3REVA 1RPQA 3VFNB 1SMAA 5C71A 1I1YB 1UM6H 4UTBH 5EU6E 4MJ6A 1OSPL 3WN5C 2OZ4A 1R5IA 4FG6C 4ELME 1T7XA 3I75A 1JPTH 1D9KB 4KKLC 4U1IA 4G6JH 3SCMD 3W0WD 2BMKA 4JFHD 3KS0H 2XT1B 4H26A 3VWJC 5EO9B 5JR1H 2ICWB 4PP2B 5SV4A 4NM4H 4M93C 4LIQH 3LHPL 4GQ9H 4L8CA 5CSZA 3X14A 3VRLE 5ICYA 5CKGA 1IGTA 4ODWA 4XB7A 3ULVE 1ZHKA 5JHDD 3B6SB 1J0HA 2X4RA 2XQBL 3IGAA 1TMCB 5HHXH 2IANE 3QIBA 1QBML 3T2QA 1PKQA 3V5KA 3IJYB 2VDMH 1WIOA 3BZFA 2MKWA 1KJ2H 3TJHD 3OKDB 4Z7WE 2XZCH 4WUUD 2EYTA 5DTFA 5HDQH 1CT8A 4P5MB 5D72H 4WEUD 3FRUA 2FSEA 2K9UA 3ILPA 2VLRA 1RZ7L 5DQ9B 3IRPX 4ISVA 4OIIL 5CWSB 5DJXB 2O5YH 1Z0MA 4NOFA 4LCWA 5T3XE 4Q97A 2AI0L 2VLJE 3L3KA 3KPSE 3NIGE 4JHZA 4KVNH 3D39A 4PJFF 4ESKA 3VGAB 1FAIH 1IAIL 4JO3L 5HBBA 1FFQA 3RAJH 4WW2F 1GGCL 3LQZA 5LWYH 3G9VA 4NO5B 3CVHA 1KBGH 1XH3B 1DZBA 4AZ8A 4LGRB 1V7NH 5FM8A 1BMGA 4JM2F 1H3XA 3QDGB 4M5ZH 2BVOA 4HSQA 3FFCD 4GKOA 2WBWB 1NEUA 5TDOA 1I85C 1R3IL 2RCSH 4HIHA 3P11L 3VFUB 4O5LH 1I9JL 5L2JB 5DA4A 4KJQD 4KKBD 4TPRH 3F7YA 5ACMA 5EN2B 2WWMD 1MHHB 3WCYA 4I1NB 3QJFB 1BWWA 3GKWL 4I13B 3S37H 3MLWL 3KR3H 1PG7H 1A6UL 4DGVL 1NCBL 1OW0A 1LNUB 1A1OB 3K3QA 1K3ZA 4EN3B 3CPLA 2J6EH 1EZVX 4OD1H 2PNDA 1FZOA 3BWUC 4YHZH 5DHXB 4K3EH 5JQ6L 3OPZH 3QZWA 4WUKH 1IQDA 5F1OB 3SPVB 2F54E 1CFNA 2Q7YA 5HGAB 3BGFC 5CEXA 3BPOC 2YZ8A 3NA4A 1OGTB 2FO4B 3SGDH 5CIPH 2EDBA 2IMNA 5JDJA 2ZZUT 4OGYH 5IW6B 4X4MA 2BVEA 1N3NA 4QHUA 3ULVL 5CHNB 3QRFM 4V1DB 3INUL 3RVXC 2GCYA 1TZIB 5F8QC 1LEIB 1AIFB 4YNYA 3VXSA 3PIQA 2CIIB 1JGUL 4F2MA 3C60C 1P7QB 4HPOH 5JXED 4GRLD 1BX2A 2YK1H 3H7BB 4UUJA 2VWEC 1WBYB 3KHQA 4LCYB 4NWTH 1DP0A 1HQ4A 2OR9H 2BSSA 3WNPA 2AEPL 1U91A 4RWYH 3C6LD 2C7UA 4C58B 1A6WH 2DQUL 1QACA 3IAGC 2VIRB 4DKEL 1JIBA 3CC5A 3DMMC 4LSTL 1A7RL 5GGTL 4JKWA 3Q48A 1CIDA 5BS0B 1D5IL 5EZJB 1HQRA 5BO1H 2VYRE 3QDME 1Q9OB 4JRWA 1OAQL 4XXDA 3WFDH 4RNRB 3DHJA 3DX7B 4QLRA 4EBQH 1MCWW 3IFPB 5IBUG 2VLKB 4PB0L 4D9LH 2HT3D 3VXOA 3CFEB 3HFML 4X7TB 4I3RL 1CICC 3ULSA 5A2FA 2DBLL 2X4NA 2YN3A 5TQ0L 1OAYH 1S7QB 1PQZB 3GMQA 1QP1A 2QQLH 5HHOE 3QIUD 4M8QA 3VI3E 2PTVA 4NJ9H 3C08L 1OF2A 2ZJSH 4K94L 4PJ8B 2J4WL 1DEDA 1D6VL 4G8EA 1MWAH 1KGCD 2V2TB 3GM0A 2Q8BH 1YEIL 2DWDB 2IG2H 1K6QH 3D39D 3G6JE 1MCOL 2H3NA 1FNGB 1PYWB 1WCBB 5IESL 4ETQA 3LB6C 1UJ3C 2IPUK 5JW5A 2HRLA 3L3DB 3PWVA 3MYZA 2XZZA 3VWJA 1ZLUK 1TFHA 2LFGA 4ACPA 4R3SA 1UM4H 3LB6D 5C09A 1A7OL 4G6FD 4OV5B 4KRLB 3OAYK 4JPVH 1P4IL 4LARH 5EWIL 1ORQB 2GTZB 5I19L 2N7BA 5DUMH 3DV6A 5JUEH 4YAQB 4IRSD 1M05A 1F4YL 3GK8L 3RWIA 1ZHLB 1KB5L 2C9AA 3U4BH 2AEQL 4CVUA 3L7EB 3PJSB 2VL5B 1FJ1A 4DZ8B 3KAAA 4R4BB 2OTUB 3RUGF 1GSMA 3P77A 1OARL 4NN5B 4JB9H 2HT3C 5GSVB 3EHBC 1MCRA 3OKOB 4Y2DA 5HHME 4LMQI 5I30L 4XPFH 2NY6D 3TVMC 2GUOB 4BH7A 4GG8B 1OB1B 2NY4C 4W81A 5DRXA 3MNVB 3MV11 4NO3A 1S7WB 3QI9B 1OGAA 1DVFA 4M4PA 4PJAA 1UVQB 1VADA 3IDYC 3PWPB 3T2NH 5BMFL 3G04A 2HVJB 5JIPA 3G5XA 1REIA 4UAOC 3V6FA 5MEQB 1WISA 2AVGA 2V9RA 4L9LC 4GKSB 4MB3A 4PRNB 1NMAH 2CKBH 1OVZA 3FT2A 2K7PA 5D6DC 3THML 3TO4C 2RFXB 4KAQH 3CDGA 1JHTA 3EZ8A 4JFDA 3UZVB 1RVFH 3MV8B 3CX2A 2HJLA 4YZFF 5TGBB 3T65B 3I02B 5B3JE 1NGYB 4JM2C 1T1WA 4NN6C 3CVIH 3WKNA 3NABH 5D7IB 4RIRB 4NP4H 4R97B 4QRRB 2BRRH 3RWDA 3SO3B 4UOJA 3QG6B 4HEME 2GJ6E 4JDVA 5C0DA 2EYRB 2OK0H 2ARJQ 1CG9B 3E2HB 4Z7VB 4JFHE 4M48L 1YQ2A 2VDOL 4FZEH 1CXIA 1HKLL 1YYMH 2BHUA 1WCQA 3AM8A 2NY0D 4JO2L 4H20H 4EI6B 5HDOA 4XNYH 2CD0A 4BSVB 1IGIL 4NQTA 3NFPA 1R3KA 4HJGB 2CUIA 4HFUH 4OQTH 5GGVY 1XZ0A 5E2UH 5JLZB 2Y23A 4ONGL 1NSNH 1UB5A 5CP7A 1ES0A 5DQDL 1X5FA 3JBG7 5DUBA 3HC3L 4AIZA 2ZCKL 2CDFA 5HI3D 2XQYK 4R7DB 5CFHA 4E5XA 1Z5LA 3RDTD 1VFOA 3HE7D 3Q6GH 3PWUA 5HYJB 3OKEB 1A5FL 2J8OA 2DI7A 2Y6SC 1FNHA 4K7PX 2R23A 2HG5A 4LDOB 3O9WD 4HH9B 1XF1A 1YYLH 1ONQB 3GHEL 1YC8A 3QI9C 1CLOL 3SQOL 1JF6A 1UM4L 1RAMA 1SJHA 4ZUVA 1NKOA 1Q9LA 2C3HA 2XTJC 2XA8L 1F6LL 3F7VB 4NQCD 1TVHB 3Q0HA 2KKQA 1K6QL 3CZFA 4HUXA 4X7FC 1CYGA 3WIFA 1JWSA 2F58L 2Q8BL 5D1ZC 4K7PL 3KLAA 3NAAH 2ICES 1AQDB 3BIKB 1RZJH 4G9DB 3KNBA 4CJ0A 4QRUB 2OQJA 4OUUA 3IDGB 4PGBB 4POZD 2OP4H 1NC2A 5I18H 5IHBA 2VXUL 1NGZA 2D7PA 5J13B 1ZEAL 1UXWB 3ESUF 2OLDA 3MV7B 4ZOCA 2BERA 3LN4B 3VD9A 5KG9B 3BWAB 3GMOA 1G9MH 5MEND 3FOMA 5KAQF 1AGDA 3T08A 1QSEA 5I1CH 2DWEA 1F4YH 1A6VH 3VXRA 5FYLE 1UCBH 1BQLL 4G3YL 4PJ7B 3ELAT 2VZ1A 2H9GA 4YHZL 2A0LC 5IVXF 4XAKE 3MV8D 3GMPB 3HNVL 1BD2D 1LO2H 2F53A 4OIIH 3QNZB 1I8IA 1J1XL 2C4XA 5DMGD 4JM4L 3E2HC 4J4PA 4JGUA 4PLOB 5KS9E 5IMKA 5BXFA 4QY8A 2G5BA 1SVCP 1TCMA 5M95B 5DI8B 1MY5A 5LBSH 4G8GA 1TNNA 3Q6GL 4HT1H 1I1FA 2H32B 3EOTL 1RJCA 3JSSA 1R24B 3FRPG 4YHNB 1JPSH 3T0EA 3LEXB 1HH6B 1T3FB 2W59A 3BUYB 3CFDB 3G08A 2AK4B 5HHOD 3HUJF 4X8JA 3FTGB 2A77L 3QA3B 3RA7H 1NMCB 1HSAA 5HTSA 3TFKC 5JOPD 4KK5C 2DBLH 4L8SA 2CLRB 4PGCB 1YEJH 5FKPA 4HKBA 4IM8A 4QRPB 3D85A 4OZHB 4GH7B 4J2XA 3D3VE 2JB5H 4UOW0 1FCGA 1DVFD 3VXMD 3I85A 4DK6A 3CLEL 1FYHB 4G7YL 1GXEA 2IFFH 2X1PA 4YHIB 5TDPA 3TA3B 2D9CA 3RPIB 5FUOL 1NFIB 2X05A 4NQVA 5KS9A 2WV3A 2PW1A 4X6EA 1D5MA 3ARBA 3GMMB 2HAZA 4IMKC 4Y2DC 4LLDA 4L4VB 1LEKB 3L95B 3HS0A 4PLKD 3TN0B 5EDXA 5FGBA 2EDTA 3LV3A 3MBEA 3AREA 2YK1L 2V7NB 2DKSA 5SX4I 2IPKB 1R5VB 2H26B 1HHIA 4RAHA 1KPVA 2WK2A 2Z8RA 3DV4B 1WAAE 1LE9A 1R3HB 2CGRH 4H1LG 5B8CA 4YDJA 3BD5A 5A2KH 3HMXA 3TH3T 2I9LB 2FJHA 2NXYD 3VI4F 5FB8B 3PGFL 1CE1H 4QHLB 1S7TB 1TLKA 3LRSA 3C5JB 2GITB 3DMMB 3L5XH 4KJYB 4GS7C 2PYFA 4P5TD 1G7QA 3UAJC 4PIRF 2GJ6A 1IBGL 1N2RA 3SY0B 4LPCA 1IC5L 2Q86B 4X8XA 1I8KB 2VDRH 1IEAA 4FQIH 1QVOA 4ZUSB 4PJBF 1ZT1A 5EU7C 3VXUD 5F7EL 1NFKA 4B53A 2ADGB 1IEBA 4M43H 1RZIA 5L0QB 4GMSL 5T5FH 4HULB 4QRRE 2P8MA 3KPMA 4HLZG 4OAWB 4LSUH 4OFPA 1DN0A 3IDNA 2QR0B 4PJGA 5GGUB 3UCRA 3UTQB 2G5RA 3IVKB 5FOBA 5D7LE 2Y5EA 4P2RD 4Y4HC 5E8NA 2GJZB 1AO7D 3I3BA 5AUMA 1CI5A 1UADC 4YDVB 5T1KB 2HTLC 3VDAA 3O3BB 5HDQL 4XPBL 2HP4A 2JJTA 1BFOA 2AV1A 4MCZA 1LD9B 1OP5K 2FBJL 5EZLB 3Q1SL 5ID1A 5BQ7B 4NKDB 5AWNH 2RCSL 4IRSA 5GJTH 2NX5D 3S3JA 3BH8B 4MXQD 4XP6H 4Q6YA 4EI5D 4K94C 2E9JA 2YD9A 4BSWB 4ZYKA 3VRJB 4BFIA 3NN8B 1SBSH 4ZO8A 4ZOBA 1LWRA 2QQLL 1F6AA 4NOBA 2EDWA 3V6OA 2F5BL 1ZT4B 3RX8A 4JHBA 4OZIB 4XP9L 1X44A 2X1WL 3TO2A 5J6HA 4WFFE 3SKOB 1PZ5A 2AXHA 5E00B 5K9QI 3OG4B 3ZTNH 4Y8AA 5JXEA 3VXMB 1WZ1H 2ILLA 3EYVA 3M8OL 4PRDA 4TTGA 2X4UB 4CN1A 1X5GA 1QLRB 2NZ9C 5EIIB 2W60B 2ZSVB 2W0LA 1VKXB 1E4KC 2J7LA 3FO2B 3C6LA 4JFEA 1P84K 4MD5A 3ZZ1A 1HH9B 3QH3A 1T1XB 1WFTA 4I0PA 3VGHA 1TNMA 4U1KA 5D2LF 4FTVA 5E95B 1D5ZB 3JWOC 5FA4B 3UPCA 4PY8I 1IM3A 3HR6A 4M62L 3VG0L 5F7DB 3IDYB 3N9GL 4JFXA 2FHFA 3T0BA 3QO1A 3MOBH 3VCLB 1JGUH 1HN1A 3LRGA 3MZTA 3D87B 4ODTH 2ZUVA 4LBEA 1RK1B 3WNKA 3O11B 4KROD 4GRWE 1A4KB 2XICA 1DQJA 3DVNA 3NZHL 1FE8H 4GW5A 1EBPA 4Q2ZA 5E6IB 1M6OA 2AJVL 3STLB 2R29L 1LE5B 2ZWLT 5IBTL 4U1GB 3F6LA 3DROA 2NR6D 1IZKA 1G9EA 5IEKA 3KPPA 4ODVL 43CAB 2XZAL 1CLYL 2LTQC 1J5OL 4OF3A 4MLSA 5FYLH 5EU4B 1EEQA 3O3DB 4UOW1 1U8LB 3MV7D 4JPKL 5D2LA 1MFBL 5DHVH 3I6GA 2RB8A 1DUYA 2NZ9D 5IQ7L 1SEBB 1OW0C 1QPXA 4G43B 2AJYH 1OTUC 4JN1H 5IVXB 5B39A 1WFUA 1D6EA 1BAFL 4QHKI 5IIEA 3FB8A 1TVBA 4K2UL 2VOTA 4MAUL 1T04B 4J3VA 4QHKJ 3T4AA 3U79A 3WL9A 5BVPH 3QFDA 5KAQG 1WWWX 3LEVH 3ARDD 4P57A 4X6CA 1SY6A 3H9HB 3Q2CA 4LQ1A 1RHHA 1VGKA 4I0PD 5I76B 3FT4B 1MJUH 2YA2A 3LH2H 2GJJA 5HGDB 4Y19D 4E41B 4F7MB 5KVFL 3VMOA 4OFVA 1EJ6A 2YRZA 4J12A 1UZ6E 2XWBB 1FC1A 1G7IA 4Z7NF 1RMFL 3IJSA 2EYSA 2HWZL 1FP5A 3PWLB 1IE5A 5DSCA 1E4XI 2BC4A 3QUKA 5DK2A 3JV4B 4LDLB 4KV5E 4LARL 4WWKC 2YPLA 3RHWK 5L88H 4NZUL 3MRLB 1LDSA 4WHCA 4U0QB 4HWBH 2HVKB 2ZOKA 5L88L 5JW4R 1FV1B 4P9ML 2FLBT 3VXUA 4GXUM 4XXCA 2E9WA 1RU9H 3MNWB 1G7JB 3NCMA 4OJFH 2NY5H 2Z0BA 3O45A 3AS3A 4ODHH 4I18B 3T8XB 1CWVA 3OGOE 4HK0B 4JGJA 1NGXA 1Q72H 5KVFH 1D5BB 2BFVL 4HD9A 5DEFA 4GAGL 3KXFE 4XCCH 4QRRD 4MNQA 4LEOB 3S35X 3IKCB 4RZCB 3SOBL 3LQMA 3GBNH 4UINH 5KSAB 3NGBC 3FQWA 4F9PA 1A6AA 3VRIA 3RTQB 3E1F1 4FABL 3V5HB 1AE6H 3C8KA 4X6FA 1S9VB 4JN1L 4LIQL 4P5KB 2XKSA 4FXGB 3MRJA 3RZCC 4UDTB 5SWZA 4JDTH 3FB5A 4WV1A 4HT1L 5C0JB 5F7FA 2BHYA 3PWPD 5TE7L 4X4ZA 3TT3L 5D7IF 4F7PA 1EHLL 1XGQA 3CFJB 5JHDA 3ZKSD 2E7LC 1J1XH 2APXA 4Y4KA 2XYCA 3TT3H 1B2WL 4KRPC 3ZSSA 3BAEL 4PJXB 4XCNA 3MRDB 4HV8A 1UQSA 4QXGL 3BXNB 5E6ZA 1KJ3L 2IAND 3FB7A 5KSAD 4DUXA 3V0WH 2AV7B 2XRAL 3CLEH 1NQBA 1S8DB 1ZHNA 5HI4C 1YZZA 3W5MA 3NZHH 1KCSL 2FECI 3RUGA 3PWPE 4XBPA 4EXKA 4WI4A 2F74A 4ONGH 4EEEA 4DVRL 3SOBH 2BNRD 3HE7C 1L0QA 2BY2A 4XCEA 1NGQH 5TE6H 4ZNEA 1S7XB 1UJTA 5EH1A 3ULVH 2D7NA 4I48B 4N0YH 4NCDA 3FQRA 1HZHL 1R3LA 4U3XA 3LN5A 4M48H 3VWKD 1U8OA 4XPAL 4N8VB 1NCUA 3RL2A 2DQCL 3S5LA 5HYEA 1EJOL 4Y5XB 5FHBL 43C9A 1K4CA 5I1KH 3GK8H 3HE6D 3AM8C 3WLBB 1OP3H 4P4RB 2IADB 3A6BL 3G5VA 2XA8H 1KXQE 2RAMA 3THMH 1G6RA 1BD2A 3GO1L 1GZQA 5D1ZD 5C0CE 4YFLF 4QYOB 4FQXC 4RA0C 3EYSH 1MH5A 4EIZC 3O41A 4PRHD 1KENH 5CILH 3VD5A 4KUCD 3MJ7B 3ZHLA 5FA3B 2VLRE 3ROOB 1JGDB 1Q9WA 5FUZH 3DMMD 5CD3A 4Z7WA 1ACYH 2WZPD 4ZFGH 1G9ML 1AKJD 4WO4B 3GGWA 1RUAL 1BREA 5F1SA 4FMKA 4C4KO 4XCCL 3WXWL 4XMLH 5BVJA 4I3SL 4JRYE 1VHPA 5F8RC 5HGBA 3HE6A 3BEVB 4W4NA 4AEIL 5A40E 1EO8L 1N6QH 3H3BC 4HMEA 1YC7A 5IFAL 2J5LC 4NZTL 4U33A 1AD9A 3GSNL 3WMSA 5TFSH 2Z91A 2B0SH 4G9FA 1U8HA 1ADQH 2HJFA 4GXVH 3SDDB 3QEHA 4MAYA 1NLDH 3WLWD 3BISA 4M3JA 3DGGB 4KI1A 1CFBA 4NHUB 4CJ1A 1S5IH 5I1IH 1DQLH 5CZXC 4GW1A 1JWUA 1EHXA 1HKFA 2ZNWA 3PE9A 1IZJA 1PEZA 4NNPH 1NCAH 1CDBA 3RVUC 1GGBH 1DEEA 1RJYA 3HZKB 1GHFL 1LP9F 2CUHA 4F7CB 3OKYA 4NCC1 4KWUA 3T3ME 1N8ZB 3MLYH 1OTSC 3TH2T 2IFGA 3LSOB 1BBDH 4O2FA 1IKFL 3LQAH 3QPQC 4NQEA 5F7KC 1FRGL 2AEWA 4XAWL 4TYUA 4YHOL 4PRAA 1UB6A 4AT6B 2AABL 4PJIA 4JM2D 5MI0B 2C1OB 4M1GH 1UEMA 4K55A 4PRHA 4D0BB 3L3GA 3T3PF 4KVCH 1JZ3A 4U6HB 3P73B 3BO8B 5EU7E 1WZKA 4P3DA 5EBMB 1SJVA 3MV9A 5E99H 3GJFB 3PL6D 1QR1A 3V79C 4JPIA 4KZEL 5HHMD 4HGWA 3MV9E 1E4KA 3V0VA 1LO0L 5IW1A 2MPAH 1Q0YL 5MP6L 4PRHE 3C60A 3MRKB 2HLFC 4L4TB 1KUMA 3P4LA 4JDZB 1KYOK 4ZTPH 4PR5A 3V6ZB 5C07D 2JKXA 4BKLB 2X70B 5DDHB 2I60H 3PP4L 4RFEA 1Z9SA 5CEYA 1OCWH 4JQIH 2BXYA 5IG7B 1F4AA 4ODBD 4FQHB 4QWWC 4LHJB 4XP5L 1OQOA 3B9KA 3KHOA 5FXCH 5I0ZA 2ZG2A 1DBAH 1TQCB 3KPSD 1BLNA 1WT5A 3TVMB 4LPUA 1RJLA 3PWJB 1MOEA 3ARGD 1TTGA 3DO7B 1VSCA 3SJVD 4LAJH 2B39A 3UTSD 2QV2A 4G9FE 4LCCA 5ICXB 1ADQL 3LKQA 3AY4A 1CK0H 1MFDH 3L6FA 2DM7A 2YSSB 3OJVC 2IPUG 2OJEB 3FFDB 4ZO7A 4JZOB 5ACZA 3KPRE 1P6AB 2I07B 4K7FB 3MLUH 4PY8J 5F6HJ 1QRNE 4AIOA 2Q6WA 4KK9C 3FQXB 1F4WH 1Z3GH 4JKLA 3B2VL 4P23C 4IRSC 4N9GA 5MEPA 2P8LB 3QEUA 4HIEA 3UTPD 5E24E 3U4BL 4BQ8A 1G1YA 1MIEL 2IAMB 1C5CH 3QWRA 5ETUB 3UTTD 1T03H 2X1XR 1QSFB 3QEGH 4LHUG 2D7OA 3SKJL 1CGXA 4DCQA 5B4MD 3MRGA 4JVPA 4M1CC 1T21B 4EOWH 4I5BB 1BIIA 5ANMB 1U8NB 4LSTH 5GGTH 5HYSA 1T03L 3OWEA 2A6JA 3QDHA 3VJ6B 1NMBL 3MC0A 1CBVH 2CDGB 3AAZB 5E2TH 3KR3L 1F5WA 5IK3B 2VAAA 2FECL 4MJIE 4MB5A 3SGKA 1QEWA 5DURB 4YBQC 2X4TA 2UYLA 4H1LA 4RMSA 5IHZA 5FV2A 3WE6A 5E2VH 1MCQA 4G7VH 5GZOD 3RGVA 5C6WH 2NTFB 2D4FA 4G6KL 5DC0A 3HMWH 2FH8A 4KKCD 4NYLB 4X6BB 1S7RB 4Z7QF 4WHTB 3WJLA 1MIML 3QB7C 4K7PH 4ORGB 5D7JC 3WEXB 3HE6C 4PRID 1QNZL 1OTUD 3BPOB 1BEYL 1KJVB 4GXUN 2V7HB 1H3GA 4Y4HA 5CD5D 4LSQL 4M5YH 4QXTB 3QQ4B 5FO7B 3GJFH 4P2OD 2ICEA 3OB8A 5I17A 4FQLH 4H25A 3R1GL 1T0MB 4PJAF 4Z7WF 1HILB 4XT1C 5GRYA 1B2WH 5FUOH 3BQUC 4ZS6D 4K8RC 3D0VB 4MA1C 4XVTH 4DGYH 4DZBA 1F90H 4D8PA 2NY4D 1XIWC 2V2WB 4M7ZB 2P24B 2AEPH 5L2KE 3EYOB 4M02A 3MLSL 2PTTA 2VKWA 4KHXH 3T0VA 3BVNA 4WFEE 2R9HC 2MPAL 5JMRA 2BJMH 4FQJH 1R0AH 4V2CB 1FE8L 3ARQA 5IV2B 1S7VB 4TNVK 2D31A 4H0IA 4P5TB 3IU3A 4RISH 5IKCA 1FNFA 2W38A 1IC4L 4NSKB 3L5WB 5IM7B 2OK0L 1PFCA 3QUMB 5AD0A 1HDMB 5IFJB 2MMXA 4FQ1H 3LKRB 3ROLB 4UTAL 3CUPB 3C5ZA 3IDIB 4OD2A 2MTPA 1UACH 3NVQA 1V3JA 4BFBD 3EYUH 1BHGA 3S36L 3WN5A 3MV7E 4JO1L 3MLRL 1EFQA 1AD0A 3TBTB 3LRHA 1N0XL 1AC0A 1JGEB 2DB8A 4GXVL 4AH2A 1BQLH 4G3YH 5EOQL 2LU3A 1L7TH 4EUPH 4QCIB 1XAUA 3SDDD 5FO8A 4P2OA 3P4MB 4JJ5A 4H8WL 1QRNA 2X1OA 3EKCA 2Y5TB 2XN9B 4OCWH 1IBGH 1KSRA 3UP1A 1BQUA 5C0BE 4ZXBA 4OZHF 4DAGH 2CKNA 3HPLA 2CSPA 4LCUA 3CFKB 3BEWA 1T5XA 3KXFB 2YUXA 2UWEA 2IBBA 5D1QD 4DAGL 4IDJL 5T1LA 4X80H 3QPXH 5J11C 5C0AE 5K9JL 1D9KA 4U1IB 4OI9A 4LLUB 4RX4D 4HW6A 2FJGB 4H1LH 1KELL 3QULA 5FYJL 4MQ7B 3QUYC 4KY1H 1CL7H 5KSUA 3E6HA 2AXGA 3HTLX 5GRXG 2PYEE 4S10A 4Y4FC 1T7VA 3QSKB 2CO6B 3W9DA 4NN7B 3GIVB 4UTBL 3ARDC 3R0MA 3P9LA 1R5WB 4JCLA 4HS6A 3B6SA 1U8QB 1VA9A 4NQDB 4URTB 2HFGL 3RI5F 3QCUH 3MACL 5KW9L 5DVLA 1CR9H 5E0QA 2SEBB 5D2NB 4FXKA 1OCWL 3VDBA 1UM5H 2IBGA 4C57C 4PREB 2Y06L 3CXDH 2Q7NA 3O3AA