2X8FA

Native structure of endo-1,5-alpha-l-arabinanases from bacillus subtilis
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
443
structure length
443
Chain Sequence
b'KPIFKEVSVHDPSIIETNGTFYVFGSHLASAKSNDLMQWQQLTTSVSNDNPLIPNVYEELKETFEWAQSDTLWAADVTQLADGKYYMYYNACRGDSPRSAMGVAVADNIEGPYKNKGIFLKSGMEGTSSDGTPYDATKHPNVVDPHTFFDKDGKLWMVYGSYSGGIFILEMNPKTGFPLPGQGYGKKLLGGNHSRIEGPYVLYNPDTQYYYLYLSYGGLDATGGYNIRVARSKKPDGPYYDAEGNPMLDVRGKGGTFFDDRSIEPYGVKLMGSYTFETENEKGTGYVSPGHNSAYYDEKTGRSYLIFHTRFPGRGEEHEVRVHQLFMNKDGWPVAAPYRYAGETLKEVKQKDITGTYKLIQHGKDISADIKQTINIQLNKNHTISGEMTGTWRKTGKNTADITLAGKKYNGVFLRQWDSVREKNVMTFSVLNTSGEAVWGSKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-ALPHA-1,5-L-ARABINANASE
publication title New Evidence for the Role of Calcium in the Glycosidase Reaction of Gh43 Arabinanases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 132
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.99: Arabinan endo-1,5-alpha-L-arabinosidase.
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF16369 GH43_C C-terminal lipocalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.10 Mainly Beta Beta Barrel Lipocalin Lipocalin 2x8fA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2x8fA01
3C2UA 2ADDA 1SMPI 3UGGA 3WPZA 3QZ4A 4U6DA 3WPVA 2X8TA 3C7GA 3AKIA 3U75A 1OYGA 3WAUA 4UDKA 3OM2A 3D60A 3LIGA 4UDJA 3UGFA 5AYDA 3VSSA 3D5YA 3NQHA 3PIJA 3QEFA 2XQRA 2EXIA 4O8NA 3LFIA 5FKBA 3LV4A 3VSZA 4AK5A 1YIFA 3WPYA 4N1IA 2EXJA 3TAWA 3VT0A 3VT2A 2VDTA 2OXBA 3WN2A 1GYEB 5GLKA 3AKHA 4COTA 1UV4A 4FFGA 3RWKX 3BYNA 5AY9A 3CU9A 3P2NA 5GLPA 5FMCA 2QQVA 5JOXA 3VT1A 3WPUA 5B6TA 3PIGA 3KF3A 3OM5A 2AEYA 3LDRA 3OM7A 1Y9MA 2RN4A 2B4WA 3C7EA 4N2RA 4AK6A 3OM6A 5GLNA 1Y9GA 1UYPA 3WN1A 3UGHA 2X8FA 5FK8A 5ANNA 3D61A 2EXHA 4KMIA 4D47A 4O8OA 5A8DA 2YFSA 5FK7A 5JOZA 3SC7X 5GLMA 1YRZA 3AKGA 5JOYA 3C7FA 5FKCA 3OM4A 3QEEA 1YI7A 3LF7A 2AEZA 5A7VA 1Y7BA 5A8CA 5AYEA 4N4BA 4PVIA 3BYJA 4O8PA 4UDIA 3ZXKA 4UDGA 1JIWI 3K1UA 4KCBA 5GLRA 3AKFA 4KCAA 3VSRA 2ADEA 3KF5A 5FLWA 5A7VB 5FMBA 4FFFA 1GYDB 1GYHA 2QQWA 1ST8A 3R4YA 2YFRA 3BYLA 2X8SA 3LIHA 3R67A 3KSTA 3ZXJA 4KC8A 4N2ZA 3C7OA 3LDKA 5GLQA 5GLOA 4UDKE 1Y4WA 1W18A 3BYKA 4U6BA 4FFIA 4MLGA 3ZXLA 3LEMA 4KC7A 4PVAA 3U14A 2YFTA 4QQSA 5GLLA 5JOWA 3WASA 1VKDA 4ONZA 4EQVA 5AYCA 3VSFA 3WN0A 3C7HA 3R4ZA 3WATA 5FIXA 2EXKA 2AC1A 4AK7A 4NOVA 4FFHA 5B6SA 3WMZA 1W2TA 3QEDA 5FMDA 2QQUA 3WMYA 1PT2A 1WL7A 3QC2A 3D5ZA 5C0PA
chains in the Genus database with same CATH superfamily
1SWJA 3HWFA 3U75A 3UEXA 1LIEA 4BX6B 4QNIA 3N91A 3RE5A 3NQHA 4GDZA 3QEFA 1VWKB 4GJVA 3CMPA 2M4LA 4IMOA 1VWBB 3VT0A 3NX2A 2A8GA 5D8JA 5IRAA 5GLKA 3CR6A 3FIQA 5GLPA 4ID2A 1KZWA 3Q34A 1EXSA 2QO4A 1PEEA 1FENA 4CPIA 1EW3A 5GLMA 1I04A 1IFCA 1GM6A 5AYEA 4N4BA 1CJ5A 4O8PA 2HMBA 2Y3FA 2ADEA 4GH7A 1IW2A 4XMEA 2ASNX 3BYLA 1KT4A 2OY7A 1GGLA 5GLQA 1Y4WA 1W18A 3LEMA 1B8EA 2FTBA 3U0DA 4ONZA 5H9KA 3R4ZA 1MOYA 4ALOA 4O49A 3LHNA 2IZLB 1BLRA 1E2TA 3NQKA 2FHLA 1FEMA 3P6EA 1VYOA 2LKKA 4IMNA 5IRWA 3WYPA 2P8GA 1ZRYA 4KT5A 5IO7A 4QZUA 4FQBB 4I60A 1DF8A 3LV4A 1YIFA 5LJCA 2FT9A 1E02A 3VHMA 2WUTA 1HQQA 4Y5DA 1GT1A 3RDUA 3P02A 2C4IA 4COTA 2X55A 3IFBA 4WHIA 5K68A 2AEYA 4YGZA 1SXUA 2W2AA 5FQ6E 5L3YA 2F01A 1KQWA 1SWOA 3D61A 4BX5B 1DZKA 2K62A 3STKA 2MHDA 5BVQA 4PVIA 1KL5A 4RUUA 2NNQA 4AYHA 4GDAA 4CSBA 1GYDB 3AKMA 2RTNB 2Q2MA 1NGLA 3T6LA 1ZNHA 5C0NA 3LDKA 4YGGA 5K67A 5GLLA 4ORSA 3VSFA 4GGTA 3MVFA 4ORYA 1LIDA 3WATA 3MBTA 1Y0GA 2QO5A 3HOEA 1I4UA 4Y59A 1HN2A 2QQUA 1X8OA 4OS0A 4AZQA 5C0PA 3UGGA 2L5PA 4A1HA 5FFHA 4OS8A 1LPJA 3NPOA 1S44A 3B2JA 4N7CA 1UYOX 3P6GA 1VWGB 2VFCA 1SY2A 3KFGA 4YKMA 4WBKA 4GKCA 1RXJA 3KVNA 5KICA 5B5GA 1VWRB 3Q6LA 3SZIA 1JJXA 5FMCA 1BSOA 4YVBA 1MVGA 1OBPA 4IAXA 3I17A 4KIIA 2LA7A 1RAVA 4IBAA 4FBOA 1JQPA 4MISA 3H3IA 4ML7B 5JOYA 4GRJA 1IFBA 5FKCA 3OM4A 2Y3EA 1SWTA 3WZOA 2IFBA 3NQ9A 1KXOA 3KFHA 3HWGA 5AQ6A 1ERXA 5FLWA 2IZGB 4ZHHA 4FFFA 2X8SA 5HZ5A 1VWEB 2ZAIA 3APXA 1T8VA 5GLOA 3ZXLA 3F9DA 5CYBA 4DQ3A 2VFBA 5H9AA 1E06A 1BJ7A 4ES7A 1VWDB 5CHKA 2JU8A 3L4RA 4M7MA 4D6AA 1SLEB 1A3YA 1SRFA 1X89A 4O3WA 3RBYA 1Y7BA 1JJUA 1GXAA 2ADDA 2F73A 2IZKA 2JOZA 2X8TA 3FR2A 3WAUA 1SLGB 2OF8A 2BS6A 1RLBE 1JBHA 4YMYA 3SLOA 1G85A 3F6ZB 2FRSA 5F1EA 1D3SA 1GYEB 2RTDB 2FHNX 4GU8A 1SRGA 4UU3A 3OM5A 5B29A 1VYFA 4BVMA 3C7EA 1NQNA 1E5PA 2HZQA 4TJZA 2EXHA 4U8UM 2Y32A 4IB9A 1RSUB 1YRZA 3AKGA 3C7FA 3WYQA 2AL0X 1AELA 4FBRA 2IZFB 3AKFA 2GTFX 5LJBA 2IZBA 3S60A 3FDCA 3SLTA 4HPBA 1O1VA 3ZXJA 2OVEA 4YDAA 2X56A 4TKJA 1CRBA 5AYCA 3C7HA 1VWQB 2AT8X 1VWJB 4ZHFA 2O62A 4XMHA 4I9RA 4PJ2A 3UEWA 1I05A 3S26A 2IZCB 1IJ8A 1NP4A 5HCDC 3LIGA 1Y55X 4YCHA 3WJCA 1VWMB 3RDQA 3FLLA 4ZR2A 5HCCC 1KFFA 2XQRA 3AKNA 5FKBA 4IABA 1T0VA 3WPYA 2RTEB 3EMMA 1G7NA 2VDTA 5HZ8A 1N7YA 1GKAA 2CBRA 5EPQA 4FFGA 3BYNA 3OJYC 4BX7A 2CBSA 4ON1A 4WFVA 3VT1A 3BS2A 3KF3A 2G7BA 3LDRA 3TF6A 4CDEA 1Y9LA 1UYPA 1HXLA 2OL6O 2XKLA 2YMSA 2OY1O 4IB7A 4MVLA 2UYWA 1VWFB 5FK7A 3SC7X 1BSQA 2E4JA 2L9CA 1CBSA 1YIVA 1IIUA 4KCBA 3B2IA 3KF5A 5A7VB 2LBAA 5F58A 1ST8A 2YFRA 2Q9SA 2BT9A 1OBQA 1B56A 4Y0SA 4U3QA 1GT4A 4NYRA 3RY2A 4XMGA 1HMRA 4MLGA 3ZW1B 2HLVA 1U17A 2HZRA 3FMZA 3AEHA 4ZCBA 4NNTA 3MX7A 5C2MA 3QEDA 3B2HA 4JHQA 5HZQA 3C7GA 1EI5A 4Z2OA 2K23A 1A57A 1OSPO 4UDJA 3O2YA 4ZH9A 1CBRA 2WEXA 4QGWA 2HYSA 4B55A 2EXJA 3X00A 5IRUA 1IKEA 4AZNA 1KZXA 5L8OA 2WQAE 1MUPA 1FE3A 1HXZA 5B27A 1YUPA 1HQPA 4ZHCA 1XKIA 1SRIA 5B11O 5ANNA 3T2WA 1W5RA 4TNNA 1TXLA 3LF7A 2BHVA 5H9LA 4OMWA 5D4AA 3ZWEA 4UDGA 2G5LA 1SXXA 4A8ZA 1Z24A 1UYNX 1QY0A 2WWPA 2RCQA 1TL2A 4KC8A 4YFQA 3EBKA 3NX1A 3WJBA 5AEOA 3BYKA 1GX9A 4FFIA 1QFTA 4BCSA 3KZAA 4YGHA 2RTLA 1ZNEA 4EQVA 5BVSA 1LIBA 3WN0A 3CKGA 4JNJA 3RDOA 2RTBB 1G74A 3FA7A 3NADA 4CPHA 4LKPA 3HTYA 3AUMO 3WJFA 1WL7A 2NP1A 3QZ4A 1LUQA 4UU2A 1YWAA 5AYDA 4YH0A 1FTPA 1ZNLA 4YFRA 4OKAA 2YG2A 2QO6A 4N7DA 4DNEA 5HZ9A 3FEPA 4AZPA 2IZJA 1X8UA 3BU9A 1CBIA 4I3DA 5B5FA 3O22A 2AT3X 4QYNA 4NV7A 5EEDA 2YFSA 2ALLX 2R74A 3ZUIA 1TOUA 1BRQA 1STSB 2G78A 1KOIA 2G8CO 2HKDA 1EIIA 1SY1A 1GYHA 2OL8O 3R4YA 4Z2PA 3ZUOA 4BQUA 1MDCA 1JMXA 3GE2A 4PVAA 1ZNDA 3NQ3A 2YFTA 3VPJE 2X46A 3CKFA 5HBSA 4AK7A 4NOVA 3WZPA 1SWAA 2OFMX 5EDBA 2OVSA 3C2UA 4ZHGA 1G5WA 1SY3A 1OEEA 1SWRA 2EU7X 1PM1X 4O9SA 3RE6A 4ZGUA 2RD7C 2MWHA 1I78A 2FR2A 3APUA 3U03A 3C77X 4I3CA 1SWGA 2A3FX 4I3BA 2FWVA 2GH7A 2RQ0A 1MX8A 3NP1A 1SLDB 3HOLA 4KH8A 3AKHA 5AY9A 1PMPA 4EQAC 4ARHA 4OELA 2Z4HA 1NQMA 1ZNGA 1SXYA 3KFFA 4CV7A 2Q39A 1YWDA 1YP6A 1AB0A 4HPCA 1WBIA 5F6ZA 3VG2A 3OM6A 4U9CA 2OY8A 4LQZA 1EALA 1HMTA 1STPA 4CK4A 3CBCA 3PH5A 2Z4IA 5F2BA 1PBYA 1SRHA 4QQ1A 1SWLA 3HPEA 3ZXKA 4XMCA 1RSTB 4U8UN 5FMBA 1SWNA 1H91A 1WUBA 5D47A 2JW1A 1DZJA 1E00A 2L68A 3UEVA 2AKQA 1VWOB 2GTLO 5DPQA 1T68X 4MIRA 1SY0A 4QQSA 2KD2A 2UZ2A 3APVA 3FA9A 3P6DA 1SWUA 3ZW0B 4GE1A 1MX7A 3OD9A 4Z27A 4BX6A 4AW8A 4DCBA 4GGZA 2W2BA 3AKIA 4OMXA 1VYGA 2OVAA 4L1NA 1DF3A 1QG5A 2JU3A 1LFOA 1HBPA 2OVDA 3PECA 3WJDA 3WN2A 4MVEA 1VWPB 3G7XA 3DSZA 2QCBA 2QOMA 1VWIB 3MG5A 4O4SA 3VG7A 2IZHB 3OE3A 2A2UA 1NC9A 5FK8A 2N93A 1LCZA 1YP7A 2JMBA 1OEKA 3SZHA 3QKGA 3VG4A 5GLRA 1DFVA 2RTAA 1RXKA 3WXQA 2A13A 1AVGI 3RZYA 4TLJA 4I9SA 2G79A 4OS3A 1JJJA 2NNDA 4CDCA 1SWSA 5EZ2A 3PK2A 4O3ZA 3T1DA 2DM5A 4YBUA 4EXZA 3SLJA 3S5VA 2A5BA 5HTEA 1UREA 5LJGA 2JU7A 4LKTA 2EXKA 4YFPA 2QMIA 4RUNA 4NNSA 4ORWA 3WMYA 1PT2A 2L67A 3QC2A 3ELXA 3D5ZA 2NNEA 3JS1A 3V8UA 4UDKA 2OFRX 3D60A 3C76X 1VWLB 2MO5A 2IZIA 2IZAA 3T6FA 3D5YA 3VG3A 4Z6JA 3PIJA 1ERBA 2I5ZO 1OPAA 1EPBA 1DC9A 4ZFXA 1SWQA 3OBLA 4Z2VA 5K06A 3VT2A 3BX7A 3O19A 1HY2A 1UV4A 5AJBA 3EM0A 3RWKX 4A60A 5KHPA 4Y0PA 4Y0RA 2CAMA 2FGSA 4BX5A 5HTDA 3TGCA 2ACPX 2QM9A 1EIOA 1N9YA 5L8IA 1U18A 5HCEC 2LFOA 5B2AO 5A8CA 3FR5A 2IZDB 4I6SA 4KCAA 1VWAB 5BVTA 3VU1A 4EKVA 2X34A 2ZSCA 2OZQA 1SWBA 3R67A 1QFVA 1GT5A 4GNWA 3WZQA 1RBPA 5LJHA 4IB6A 2A5CA 3WASA 3UAQA 2AT0X 3JQOA 4GGRA 1SREA 4PSQA 2Q4NA 5B6SA 2X4MA 3B2KA 1Y52X 3D4RA 2OFBA 1SWCA 2BS5A 1NBXA 2KT4B 2RCTA 3OM2A 3SAOA 2PY1A 3VSSA 2R56A 1W4TA 5L8NA 1YWBA 4ORXA 5FQ8E 4MEEA 3NBXX 1MM9A 4AZRA 2ANSA 1NP1A 1BBPA 3TAWA 4GNYA 1X71A 2GC9A 5HWZA 3P2NA 1CBQA 3PP6A 2C1SA 4N2RA 3BX8A 5HZ6A 3RDXA 4R0BA 4GD9A 2OYBO 3ZW0A 1DV9A 1SLFB 2MF6A 3ZQ3A 5HAEA 4ZGFA 3VHIA 1HBQA 3K3LA 1QY2A 2QQWA 3D95A 5H9NA 2X32A 3PDFA 2KW1A 1JYDA 4UDKE 3PPTA 3EW1A 4O3XB 1TW4A 5JOWA 1BM5A 1I06A 1I9HA 3EYCA 3UEUA 4ZJ0A 4NLIA 1S2PA 1QQSA 5FMDA 3EW2A 4MVKA 1Y9TA 1JV4A 3D9WA 1SWFA 3PQSA 2WPUA 4QYPA 3UGFA 2BLGA 1QABE 3FA6A 4ZHDA 3GAQA 3RY1A 1VPRA 3LFIA 2CM9A 1SWDA 4AK5A 4N1IA 2OY5O 4CPFA 3FENA 2FS7A 3F8AA 1X8NA 3QQ2A 1ML7A 1JYJA 3FEKA 5LKEA 4HWMA 2X45A 3PIGA 4EEJA 2WQ9A 3RDSA 1STRB 2RTKA 4KMIA 4CPEA 3BRNA 1Y53X 1FJ1E 5H8TA 1LKEA 3CWKA 1KT5A 3VGWA 3K1UA 1SWPA 1TOWA 4GUZA 1SWEA 1K24A 3WVMA 1OPBA 2GTLM 3LIHA 3D97A 2DJGA 2FS6A 1N9MA 2RTIB 3U14A 2R73A 3RDMA 1A18A 4QZTA 1JZUA 1PBOA 5CE4A 1PTSA 1O1UA 4C5PA 2DJFA 1DZPA 4FFHA 3LTWA 4L3RA 4U6DA 1OYGA 4JGLA 3HWEA 2FLJA 4TQ2A 4Z28A 1N4JA 2RTGB 3P6CA 5HA1A 1IKJA 2IZEB 2C1QA 3PEDA 4YDBA 3ZI8A 3P6HA 2BC3A 3CU9A 3I0AA 3EBWA 4MVIA 4GJSA 1X8PA 1GKAB 2FKGA 3VE1A 1LIFA 3OM7A 1Y9MA 4BX7B 4FGIB 1HMSA 3SOTA 1DZMA 2AVIA 5GLNA 3WN1A 3BDRA 4ALBA 4AZMA 3WJEA 5JOZA 1U0XA 2GJ5A 5KIDA 2CM4A 1YI7A 3NR3A 5A7VA 1VWHB 5FENA 3FELA 2LBVA 2OL7A 1B4MA 4TKBA 2JN3A 3B2LA 4QRLA 2RTCB 4ODDA 3TGBA 5JD2A 2AMMX 1O8VA 3ELZA 1TVQA 3ZW1A 1OBUA 1QWDA 4U6BA 2AT6X 5IO6A 4KC7A 4GETA 1BRPA 3T2XA 1LDQA 3RWXA 3WOVA 4YBPA 2AT5X 3FYFA 1EUOA 1SMPI 1KT7A 3HWDA 1LICA 3BY0A 3SZJA 3KQ0A 1VWCB 2CZTA 3PQUA 1MEPA 5IO5A 3MM0A 2PI3O 4NLJA 2RTPB 4O8NA 3VSZA 3U9PC 2KTDA 3VG6A 1EQDA 2OXBA 3WJGA 3FIDA 4O4XA 1ICMA 5LJKA 2XSTA 3FW4A 1LELA 4LZVA 5JOXA 3FA8A 2CZUA 4NP1A 2RTOB 1LDOA 2AH7X 1B0OA 4IB8A 4HPDA 4D6BA 5DG4A 2X8FA 4D47A 4WFUA 2HNXA 2RTFB 3VE2A 1KL3A 1AQBA 4INNA 1SRJA 3WBGA 5B3MO 4TKHA 1JIWI 2A2GA 4XMDA 3RKGA 1LCWA 2OFAA 1BSYA 4AZOA 4N2ZA 3WZNA 1N0SA 4GZVA 4O3YA 3RSWA 1ALBA 3EC5A 4JO6A 4QGVA 2RTMA 1BWYA 2W2FA 1BEBA 1SXWA 1X8QA 2RTJA 2RTQB 4CDDA 3WMZA 4FBVA 1GT3A 5LJDA 3BSZE 2KTSA 4ORRA 1AVEA 4CPHB 5LJEA 3STMX 1S7DA 1ADLA 3PH6A 1VWNB 1ACDA 4OEMA 3ZZVA 4BJ8A 4XMFA 5EEEA 3S5XA 2WSJA 4O4OA 4EFGA 1UZ2X 2BSZA 2QQVA 2RTRB 3WPUA 3TGAA 4HPAA 1YWCA 5B6TA 5D45A 1GX8A 1SWKA 1ICNA 4IAWA 4YKOA 1QY1A 2ZAGA 4BGFA 4ZH6A 4O8OA 1NDJA 1SWHA 5IXGA 1XCAA 2AEZA 4GK9A 3P24A 4UDIA 3P6FA 3STNA 1P6PA 1K3BA 2VDFA 1FDQA 5D48A 4YCEA 2WR6A 1LF7A 4QGXA 3CQRA 4A1YA 1R0UA 1KGLA 2FR3A 2A0AA 1KT3A 3KSTA 3VG5A 1KQXA 2LB6A 3C7OA 5FAZA 1N43A 3HK1A 5JR8A 1LCVA 3TZSA 4NV8A 5FIXA 1ZNKA 3FW5A 1Y9GA 3WPZA 1SA8A 3WPVA 4K19A 2RTHB 5HA0A 3D96A 3DTQA 3BLGA 5BYPA 4QAEA 4CDFA 3CBSA 4I95A 2FKJA 4DQ4A 5CSEA 3E3CA 2EXIA 1EPAA 3VHHA 2MM3A 2WEWA 1FELA 4O4UA 2AF5A 4U46A 2OF9A 2POAA 5LKFA 3IA8A 3CQNA 2RN4A 2B4WA 5B10O 4Y0QA 2QOSC 4NW4A 4AK6A 3UGHA 1GX3A 4U8UO 1JMZA 5A8DA 3FR4A 5FQ7E 1AVDA 2JGSA 3QEEA 4NYQA 3JSQA 4EDEA 1W6FA 4M6SA 1RXHA 1OEJA 3BYJA 1KT6A 5F6BA 3ZW2A 4ORUA 3VSRA 1LNMA 2RA6A 2I5VO 1KL4A 4LZUA 2MJIA 3BU1A 1MK5A 3APWA 3KFIA 1VKDA 3C78X 5EDCA 4HFOA 4IRWA 2GTLN 2Q2PA 1A2DA 5F7GA 1L6MA 2AC1A 2ACOA 4BBOA 1D2UA 1W2TA 2F09A 5AJCA 4BOEA
chains in the Genus database with same CATH topology
4AW8A 2W2BA 4U6DA 3S26A 3HWFA 3AKIA 3U75A 1OYGA 4JGLA 4OMXA 1NP4A 3UEXA 5HCDC 3LIGA 3HWEA 1LIEA 4QNIA 3N91A 2FLJA 4YCHA 4TQ2A 3WJCA 1VYGA 2OVAA 4L1NA 3FLLA 3P6CA 4ZR2A 3NQHA 5HA1A 1QG5A 4GDZA 5HCCC 1DF3A 3QEFA 3CMPA 2JU3A 2XQRA 1IKJA 1LFOA 2M4LA 3AKNA 5FKBA 1HBPA 2OVDA 4IABA 4IMOA 1T0VA 3PEDA 3WPYA 3PECA 3EMMA 3VT0A 4YDBA 3NX2A 1G7NA 2VDTA 5HZ8A 3ZI8A 3P6HA 1GKAA 5D8JA 2CBRA 5EPQA 3WJDA 4MVEA 3WN2A 5GLKA 3G7XA 3CR6A 4FFGA 3BYNA 3CU9A 3DSZA 3FIQA 5GLPA 3OJYC 3I0AA 2CBSA 3EBWA 4MVIA 4ON1A 4WFVA 4ID2A 3VT1A 1X8PA 1KZWA 1GKAB 3BS2A 3KF3A 3VE1A 1LIFA 2G7BA 3LDRA 3TF6A 1EXSA 1Y9MA 3OM7A 2QO4A 4FGIB 1HMSA 3SOTA 1DZMA 4O4SA 1PEEA 3VG7A 1Y9LA 1FENA 3OE3A 5GLNA 3WN1A 3BDRA 1UYPA 4ALBA 2A2UA 4AZMA 2XKLA 5FK8A 3WJEA 2YMSA 2N93A 1YP7A 4IB7A 4MVLA 1EW3A 2JMBA 5FK7A 5JOZA 3SC7X 1U0XA 1BSQA 5GLMA 2GJ5A 2E4JA 5KIDA 2CM4A 1OEKA 1YI7A 1I04A 1IFCA 3NR3A 1GM6A 5A7VA 2L9CA 1CBSA 5AYEA 5FENA 4N4BA 1CJ5A 3FELA 3QKGA 1YIVA 2LBVA 1B4MA 4O8PA 2HMBA 3VG4A 1IIUA 4TKBA 3B2IA 4KCBA 5GLRA 2JN3A 3B2LA 4QRLA 2ADEA 3KF5A 5A7VB 1DFVA 4ODDA 3TGBA 4GH7A 3WXQA 2A13A 1AVGI 2LBAA 2AMMX 1IW2A 1O8VA 4XMEA 3ELZA 2ASNX 4I9SA 4TLJA 5F58A 3RZYA 1ST8A 2G79A 2YFRA 3BYLA 2Q9SA 4OS3A 1KT4A 1TVQA 2BT9A 3ZW1A 1JJJA 1OBQA 1B56A 2NNDA 1OBUA 4Y0SA 4U3QA 1GGLA 1GT4A 1QWDA 4NYRA 5GLQA 5EZ2A 4XMGA 1HMRA 1Y4WA 1W18A 4U6BA 4MLGA 2AT6X 3ZW1B 1B8EA 5IO6A 3LEMA 4KC7A 4GETA 2FTBA 1BRPA 3T1DA 4O3ZA 2DM5A 2HLVA 1U17A 4YBUA 3U0DA 4EXZA 4ONZA 3RWXA 2HZRA 3WOVA 3FMZA 5H9KA 3S5VA 3R4ZA 5HTEA 1UREA 5LJGA 2JU7A 4LKTA 2EXKA 4ALOA 4ZCBA 4O49A 3LHNA 2QMIA 4YFPA 2AT5X 4RUNA 4YBPA 1BLRA 4NNTA 3FYFA 4NNSA 3MX7A 4ORWA 3QEDA 3B2HA 3NQKA 3WMYA 1PT2A 2L67A 1EUOA 1FEMA 3QC2A 3ELXA 3D5ZA 3P6EA 1SMPI 5HZQA 2NNEA 1KT7A 3HWDA 1LICA 3C7GA 1EI5A 3JS1A 3V8UA 2LKKA 4UDKA 2K23A 1A57A 2OFRX 3BY0A 4IMNA 3D60A 4UDJA 3C76X 3O2YA 2MO5A 3KQ0A 2CZTA 3D5YA 4ZH9A 2P8GA 3VG3A 1ZRYA 3PIJA 1ERBA 3PQUA 1CBRA 5IO5A 2WEXA 4KT5A 1OPAA 4QGWA 1EPBA 5IO7A 4NLJA 4QZUA 4O8NA 1DC9A 4FQBB 3VSZA 2HYSA 3LV4A 4ZFXA 1YIFA 5LJCA 3OBLA 2EXJA 3U9PC 5K06A 2FT9A 1E02A 3BX7A 3VT2A 2KTDA 3O19A 2WUTA 3VG6A 1EQDA 2OXBA 1GT1A 3WJGA 3P02A 4O4XA 1ICMA 4COTA 1UV4A 5AJBA 3EM0A 3RWKX 1IKEA 4AZNA 5LJKA 3IFBA 2XSTA 3FW4A 4LZVA 4WHIA 1KZXA 5JOXA 3FA8A 5L8OA 4A60A 2WQAE 4Y0PA 5KHPA 2CZUA 4NP1A 4Y0RA 1MUPA 1FE3A 2AEYA 4YGZA 2AH7X 5B27A 1B0OA 1SXUA 2W2AA 5FQ6E 1YUPA 1HQPA 4IB8A 4HPDA 4D6BA 4ZHCA 1XKIA 1KQWA 5DG4A 5HTDA 2X8FA 5ANNA 3D61A 4TNNA 4D47A 1DZKA 3TGCA 2K62A 4WFUA 2HNXA 2ACPX 2QM9A 3STKA 1EIOA 5L8IA 1U18A 5HCEC 3VE2A 1TXLA 3LF7A 2BHVA 2LFOA 2MHDA 1AQBA 5H9LA 3FR5A 4OMWA 5D4AA 5BVQA 4PVIA 4INNA 3WBGA 4I6SA 4TKHA 3ZWEA 4UDGA 1JIWI 2A2GA 4XMDA 4KCAA 5BVTA 4RUUA 3RKGA 3VU1A 2NNQA 1SXXA 5A8CA 4A8ZA 4AYHA 1Z24A 4CSBA 1GYDB 3AKMA 1QY0A 2OZQA 2WWPA 2RCQA 1BSYA 2Q2MA 4AZOA 3R67A 4KC8A 4YFQA 1QFVA 3EBKA 1NGLA 4N2ZA 1ZNHA 3NX1A 5C0NA 3LDKA 3WJBA 5AEOA 3BYKA 1GX9A 4FFIA 1N0SA 1QFTA 1GT5A 4GZVA 4GNWA 4YGGA 4O3YA 3KZAA 1RBPA 3RSWA 4YGHA 1ALBA 5LJHA 1ZNEA 4IB6A 5GLLA 3WASA 4ORSA 4EQVA 5BVSA 3UAQA 3VSFA 1LIBA 3MVFA 3WN0A 4ORYA 4QGVA 2AT0X 1LIDA 3WATA 3JQOA 1BWYA 3MBTA 1G74A 2QO5A 3HOEA 2W2FA 1BEBA 1SXWA 1I4UA 1X8QA 3FA7A 3NADA 4LKPA 2Q4NA 3HTYA 4PSQA 5B6SA 3WJFA 3WMZA 1HN2A 3B2KA 4FBVA 1GT3A 2QQUA 1X8OA 3D4RA 3BSZE 5LJDA 1WL7A 2NP1A 4OS0A 2KTSA 4ORRA 4AZQA 5C0PA 3UGGA 3QZ4A 2L5PA 4A1HA 5LJEA 5FFHA 4OS8A 1LPJA 2BS5A 3STMX 2KT4B 3NPOA 1S7DA 2RCTA 4UU2A 3OM2A 1YWAA 3SAOA 1S44A 2PY1A 5AYDA 3VSSA 2R56A 4YH0A 3B2JA 1FTPA 4N7CA 5L8NA 1ADLA 1YWBA 1ZNLA 4ORXA 3PH6A 5FQ8E 1ACDA 3NBXX 3P6GA 4YFRA 4AZRA 1SY2A 3KFGA 4YKMA 3ZZVA 2ANSA 4WBKA 1NP1A 2YG2A 4GKCA 4XMFA 5EEEA 3S5XA 2WSJA 1BBPA 3TAWA 2QO6A 4O4OA 5KICA 4N7DA 5HZ9A 3Q6LA 3FEPA 1UZ2X 4GNYA 4EFGA 4AZPA 1X71A 2GC9A 5HWZA 1JJXA 3P2NA 5FMCA 1X8UA 2QQVA 1BSOA 3BU9A 1CBIA 1MVGA 1OBPA 3WPUA 3TGAA 4HPAA 1YWCA 5B6TA 5D45A 1CBQA 1GX8A 3PP6A 4I3DA 4IAXA 1ICNA 2AT3X 3O22A 3I17A 4KIIA 4N2RA 3BX8A 4IAWA 4YKOA 5HZ6A 1QY1A 4QYNA 2LA7A 4IBAA 4FBOA 4MISA 2ZAGA 4ZH6A 4O8OA 5EEDA 3WPZA 2YFSA 2ALLX 3H3IA 4ML7B 2R74A 3ZUIA 1TOUA 4GRJA 5JOYA 4R0BA 1IFBA 1XCAA 3OM4A 5FKCA 1BRQA 2G78A 2IFBA 1KOIA 2AEZA 3NQ9A 1KXOA 3KFHA 3ZW0A 4GK9A 3P24A 1DV9A 3HWGA 4UDIA 3P6FA 5AQ6A 1P6PA 3STNA 1ERXA 3ZQ3A 5HAEA 1EIIA 5FLWA 1FDQA 5D48A 4YCEA 4ZGFA 2WR6A 4ZHHA 1HBQA 4FFFA 1SY1A 1LF7A 3K3LA 1QY2A 1GYHA 2QQWA 4QGXA 3CQRA 3D95A 5H9NA 4A1YA 1R0UA 3R4YA 1KGLA 3ZUOA 2X8SA 2FR3A 2A0AA 1KT3A 4BQUA 5HZ5A 1MDCA 3VG5A 2ZAIA 1KQXA 2KW1A 2LB6A 3KSTA 3C7OA 3APXA 1T8VA 5FAZA 5GLOA 1JYDA 3HK1A 4UDKE 3ZXLA 3F9DA 3PPTA 4O3XB 3GE2A 1TW4A 5CYBA 4PVAA 1ZNDA 4DQ3A 3NQ3A 2YFTA 5H9AA 1E06A 1BJ7A 5JOWA 1BM5A 5JR8A 1I06A 3VPJE 2X46A 4ES7A 3EYCA 3TZSA 5FIXA 5HBSA 1ZNKA 2JU8A 4AK7A 3L4RA 4M7MA 4NOVA 3UEUA 4ZJ0A 3FW5A 4NLIA 1S2PA 4D6AA 1QQSA 5FMDA 1A3YA 4MVKA 2OFMX 1X89A 4O3WA 3RBYA 5EDBA 2OVSA 1Y9TA 1Y9GA 1Y7BA 1GXAA 2F73A 1SA8A 4ZHGA 2ADDA 1G5WA 1JV4A 1SY3A 3C2UA 1OEEA 2JOZA 2X8TA 3FR2A 4K19A 3WPVA 2EU7X 1PM1X 3WAUA 3PQSA 4O9SA 5HA0A 3D96A 3DTQA 3BLGA 4QYPA 4QAEA 5BYPA 3UGFA 2BLGA 2RD7C 4ZGUA 2MWHA 1QABE 2BS6A 1RLBE 3CBSA 3FA6A 4I95A 2FR2A 3APUA 4ZHDA 4DQ4A 1JBHA 3U03A 3C77X 4I3CA 3GAQA 2A3FX 4YMYA 3E3CA 2FWVA 1G85A 4I3BA 1VPRA 3F6ZB 2RQ0A 2EXIA 2CM9A 3LFIA 4AK5A 4N1IA 1EPAA 1MX8A 2FRSA 3NP1A 3FENA 5F1EA 2FS7A 3F8AA 2MM3A 3HOLA 4KH8A 2WEWA 1D3SA 1FELA 1GYEB 1X8NA 4O4UA 3AKHA 5AY9A 1PMPA 1ML7A 4EQAC 1JYJA 4ARHA 3FEKA 2Z4HA 4GU8A 1ZNGA 2POAA 1SXYA 5LKEA 4HWMA 3KFFA 2X45A 4UU3A 5LKFA 3PIGA 3OM5A 4EEJA 3IA8A 5B29A 1VYFA 3CQNA 2RN4A 4CV7A 4BVMA 2B4WA 2Q39A 1YWDA 2WQ9A 3C7EA 4Y0QA 2QOSC 1YP6A 1AB0A 4NW4A 1E5PA 4HPCA 4AK6A 5F6ZA 3VG2A 2HZQA 3OM6A 4U9CA 4LQZA 1EALA 3UGHA 4TJZA 1HMTA 4CK4A 4U8UO 2EXHA 4KMIA 3BRNA 5A8DA 4U8UM 3CBCA 3FR4A 4IB9A 5FQ7E 3PH5A 5H8TA 1YRZA 3AKGA 2Z4IA 3C7FA 3QEEA 4NYQA 3JSQA 4EDEA 1LKEA 4M6SA 3CWKA 1OEJA 3BYJA 1KT6A 1KT5A 2AL0X 4QQ1A 5F6BA 1AELA 3ZXKA 4XMCA 3K1UA 3ZW2A 4ORUA 4FBRA 3AKFA 3VSRA 2GTFX 1LNMA 4U8UN 5FMBA 2RA6A 1H91A 5LJBA 5D47A 1TOWA 2JW1A 3S60A 1DZJA 4HPBA 1E00A 2L68A 3UEVA 2AKQA 4LZUA 2GTLO 1O1VA 3WVMA 1OPBA 2GTLM 3LIHA 2MJIA 3D97A 3ZXJA 2FS6A 3BU1A 2OVEA 4YDAA 5DPQA 4TKJA 1T68X 1CRBA 4MIRA 1SY0A 3APWA 3U14A 4QQSA 2R73A 3KFIA 1VKDA 3C78X 2KD2A 5EDCA 4HFOA 5AYCA 2GTLN 3APVA 2Q2PA 3C7HA 1A2DA 3FA9A 1A18A 2AT8X 4QZTA 5F7GA 1L6MA 3P6DA 1JZUA 1PBOA 5CE4A 3ZW0B 2AC1A 1O1UA 4ZHFA 2ACOA 1DZPA 4GE1A 2O62A 1D2UA 1MX7A 3OD9A 4XMHA 4FFHA 4I9RA 4PJ2A 1W2TA 2F09A 4L3RA 3UEWA 1I05A 5AJCA 4BOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2U A;  2ADD A;  1SMP I;  3UGG A;  3WPZ A;  3QZ4 A;  4U6D A;  3WPV A;  2X8T A;  3C7G A;  3AKI A;  3U75 A;  1OYG A;  3WAU A;  4UDK A;  3OM2 A;  3D60 A;  3LIG A;  4UDJ A;  3UGF A;  5AYD A;  3VSS A;  3D5Y A;  3NQH A;  3PIJ A;  3QEF A;  2XQR A;  2EXI A;  4O8N A;  3LFI A;  5FKB A;  3LV4 A;  3VSZ A;  4AK5 A;  1YIF A;  3WPY A;  4N1I A;  2EXJ A;  3TAW A;  3VT0 A;  3VT2 A;  2VDT A;  2OXB A;  3WN2 A;  1GYE B;  5GLK A;  3AKH A;  4COT A;  1UV4 A;  4FFG A;  3RWK X;  3BYN A;  5AY9 A;  3CU9 A;  3P2N A;  5GLP A;  5FMC A;  2QQV A;  5JOX A;  3VT1 A;  3WPU A;  5B6T A;  3PIG A;  3KF3 A;  3OM5 A;  2AEY A;  3LDR A;  3OM7 A;  1Y9M A;  2RN4 A;  2B4W A;  3C7E A;  4N2R A;  4AK6 A;  3OM6 A;  5GLN A;  1Y9G A;  1UYP A;  3WN1 A;  3UGH A;  2X8F A;  5FK8 A;  5ANN A;  3D61 A;  2EXH A;  4KMI A;  4D47 A;  4O8O A;  5A8D A;  2YFS A;  5FK7 A;  5JOZ A;  3SC7 X;  5GLM A;  1YRZ A;  3AKG A;  5JOY A;  3C7F A;  5FKC A;  3OM4 A;  3QEE A;  1YI7 A;  3LF7 A;  2AEZ A;  5A7V A;  1Y7B A;  5A8C A;  5AYE A;  4N4B A;  4PVI A;  3BYJ A;  4O8P A;  4UDI A;  3ZXK A;  4UDG A;  1JIW I;  3K1U A;  4KCB A;  5GLR A;  3AKF A;  4KCA A;  3VSR A;  2ADE A;  3KF5 A;  5FLW A;  5A7V B;  5FMB A;  4FFF A;  1GYD B;  1GYH A;  2QQW A;  1ST8 A;  3R4Y A;  2YFR A;  3BYL A;  2X8S A;  3LIH A;  3R67 A;  3KST A;  3ZXJ A;  4KC8 A;  4N2Z A;  3C7O A;  3LDK A;  5GLQ A;  5GLO A;  4UDK E;  1Y4W A;  1W18 A;  3BYK A;  4U6B A;  4FFI A;  4MLG A;  3ZXL A;  3LEM A;  4KC7 A;  4PVA A;  3U14 A;  2YFT A;  4QQS A;  5GLL A;  5JOW A;  3WAS A;  1VKD A;  4ONZ A;  4EQV A;  5AYC A;  3VSF A;  3WN0 A;  3C7H A;  3R4Z A;  3WAT A;  5FIX A;  2EXK A;  2AC1 A;  4AK7 A;  4NOV A;  4FFH A;  5B6S A;  3WMZ A;  1W2T A;  3QED A;  5FMD A;  2QQU A;  3WMY A;  1PT2 A;  1WL7 A;  3QC2 A;  3D5Z A;  5C0P A; 
#chains in the Genus database with same CATH topology
 1SWJ A;  3HWF A;  3U75 A;  3UEX A;  1LIE A;  4BX6 B;  4QNI A;  3N91 A;  3RE5 A;  3NQH A;  4GDZ A;  3QEF A;  1VWK B;  4GJV A;  3CMP A;  2M4L A;  4IMO A;  1VWB B;  3VT0 A;  3NX2 A;  2A8G A;  5D8J A;  5IRA A;  5GLK A;  3CR6 A;  3FIQ A;  5GLP A;  4ID2 A;  1KZW A;  3Q34 A;  1EXS A;  2QO4 A;  1PEE A;  1FEN A;  4CPI A;  1EW3 A;  5GLM A;  1I04 A;  1IFC A;  1GM6 A;  5AYE A;  4N4B A;  1CJ5 A;  4O8P A;  2HMB A;  2Y3F A;  2ADE A;  4GH7 A;  1IW2 A;  4XME A;  2ASN X;  3BYL A;  1KT4 A;  2OY7 A;  1GGL A;  5GLQ A;  1Y4W A;  1W18 A;  3LEM A;  1B8E A;  2FTB A;  3U0D A;  4ONZ A;  5H9K A;  3R4Z A;  1MOY A;  4ALO A;  4O49 A;  3LHN A;  2IZL B;  1BLR A;  1E2T A;  3NQK A;  2FHL A;  1FEM A;  3P6E A;  1VYO A;  2LKK A;  4IMN A;  5IRW A;  3WYP A;  2P8G A;  1ZRY A;  4KT5 A;  5IO7 A;  4QZU A;  4FQB B;  4I60 A;  1DF8 A;  3LV4 A;  1YIF A;  5LJC A;  2FT9 A;  1E02 A;  3VHM A;  2WUT A;  1HQQ A;  4Y5D A;  1GT1 A;  3RDU A;  3P02 A;  2C4I A;  4COT A;  2X55 A;  3IFB A;  4WHI A;  5K68 A;  2AEY A;  4YGZ A;  1SXU A;  2W2A A;  5FQ6 E;  5L3Y A;  2F01 A;  1KQW A;  1SWO A;  3D61 A;  4BX5 B;  1DZK A;  2K62 A;  3STK A;  2MHD A;  5BVQ A;  4PVI A;  1KL5 A;  4RUU A;  2NNQ A;  4AYH A;  4GDA A;  4CSB A;  1GYD B;  3AKM A;  2RTN B;  2Q2M A;  1NGL A;  3T6L A;  1ZNH A;  5C0N A;  3LDK A;  4YGG A;  5K67 A;  5GLL A;  4ORS A;  3VSF A;  4GGT A;  3MVF A;  4ORY A;  1LID A;  3WAT A;  3MBT A;  1Y0G A;  2QO5 A;  3HOE A;  1I4U A;  4Y59 A;  1HN2 A;  2QQU A;  1X8O A;  4OS0 A;  4AZQ A;  5C0P A;  3UGG A;  2L5P A;  4A1H A;  5FFH A;  4OS8 A;  1LPJ A;  3NPO A;  1S44 A;  3B2J A;  4N7C A;  1UYO X;  3P6G A;  1VWG B;  2VFC A;  1SY2 A;  3KFG A;  4YKM A;  4WBK A;  4GKC A;  1RXJ A;  3KVN A;  5KIC A;  5B5G A;  1VWR B;  3Q6L A;  3SZI A;  1JJX A;  5FMC A;  1BSO A;  4YVB A;  1MVG A;  1OBP A;  4IAX A;  3I17 A;  4KII A;  2LA7 A;  1RAV A;  4IBA A;  4FBO A;  1JQP A;  4MIS A;  3H3I A;  4ML7 B;  5JOY A;  4GRJ A;  1IFB A;  5FKC A;  3OM4 A;  2Y3E A;  1SWT A;  3WZO A;  2IFB A;  3NQ9 A;  1KXO A;  3KFH A;  3HWG A;  5AQ6 A;  1ERX A;  5FLW A;  2IZG B;  4ZHH A;  4FFF A;  2X8S A;  5HZ5 A;  1VWE B;  2ZAI A;  3APX A;  1T8V A;  5GLO A;  3ZXL A;  3F9D A;  5CYB A;  4DQ3 A;  2VFB A;  5H9A A;  1E06 A;  1BJ7 A;  4ES7 A;  1VWD B;  5CHK A;  2JU8 A;  3L4R A;  4M7M A;  4D6A A;  1SLE B;  1A3Y A;  1SRF A;  1X89 A;  4O3W A;  3RBY A;  1Y7B A;  1JJU A;  1GXA A;  2ADD A;  2F73 A;  2IZK A;  2JOZ A;  2X8T A;  3FR2 A;  3WAU A;  1SLG B;  2OF8 A;  2BS6 A;  1RLB E;  1JBH A;  4YMY A;  3SLO A;  1G85 A;  3F6Z B;  2FRS A;  5F1E A;  1D3S A;  1GYE B;  2RTD B;  2FHN X;  4GU8 A;  1SRG A;  4UU3 A;  3OM5 A;  5B29 A;  1VYF A;  4BVM A;  3C7E A;  1NQN A;  1E5P A;  2HZQ A;  4TJZ A;  2EXH A;  4U8U M;  2Y32 A;  4IB9 A;  1RSU B;  1YRZ A;  3AKG A;  3C7F A;  3WYQ A;  2AL0 X;  1AEL A;  4FBR A;  2IZF B;  3AKF A;  2GTF X;  5LJB A;  2IZB A;  3S60 A;  3FDC A;  3SLT A;  4HPB A;  1O1V A;  3ZXJ A;  2OVE A;  4YDA A;  2X56 A;  4TKJ A;  1CRB A;  5AYC A;  3C7H A;  1VWQ B;  2AT8 X;  1VWJ B;  4ZHF A;  2O62 A;  4XMH A;  4I9R A;  4PJ2 A;  3UEW A;  1I05 A;  3S26 A;  2IZC B;  1IJ8 A;  1NP4 A;  5HCD C;  3LIG A;  1Y55 X;  4YCH A;  3WJC A;  1VWM B;  3RDQ A;  3FLL A;  4ZR2 A;  5HCC C;  1KFF A;  2XQR A;  3AKN A;  5FKB A;  4IAB A;  1T0V A;  3WPY A;  2RTE B;  3EMM A;  1G7N A;  2VDT A;  5HZ8 A;  1N7Y A;  1GKA A;  2CBR A;  5EPQ A;  4FFG A;  3BYN A;  3OJY C;  4BX7 A;  2CBS A;  4ON1 A;  4WFV A;  3VT1 A;  3BS2 A;  3KF3 A;  2G7B A;  3LDR A;  3TF6 A;  4CDE A;  1Y9L A;  1UYP A;  1HXL A;  2OL6 O;  2XKL A;  2YMS A;  2OY1 O;  4IB7 A;  4MVL A;  2UYW A;  1VWF B;  5FK7 A;  3SC7 X;  1BSQ A;  2E4J A;  2L9C A;  1CBS A;  1YIV A;  1IIU A;  4KCB A;  3B2I A;  3KF5 A;  5A7V B;  2LBA A;  5F58 A;  1ST8 A;  2YFR A;  2Q9S A;  2BT9 A;  1OBQ A;  1B56 A;  4Y0S A;  4U3Q A;  1GT4 A;  4NYR A;  3RY2 A;  4XMG A;  1HMR A;  4MLG A;  3ZW1 B;  2HLV A;  1U17 A;  2HZR A;  3FMZ A;  3AEH A;  4ZCB A;  4NNT A;  3MX7 A;  5C2M A;  3QED A;  3B2H A;  4JHQ A;  5HZQ A;  3C7G A;  1EI5 A;  4Z2O A;  2K23 A;  1A57 A;  1OSP O;  4UDJ A;  3O2Y A;  4ZH9 A;  1CBR A;  2WEX A;  4QGW A;  2HYS A;  4B55 A;  2EXJ A;  3X00 A;  5IRU A;  1IKE A;  4AZN A;  1KZX A;  5L8O A;  2WQA E;  1MUP A;  1FE3 A;  1HXZ A;  5B27 A;  1YUP A;  1HQP A;  4ZHC A;  1XKI A;  1SRI A;  5B11 O;  5ANN A;  3T2W A;  1W5R A;  4TNN A;  1TXL A;  3LF7 A;  2BHV A;  5H9L A;  4OMW A;  5D4A A;  3ZWE A;  4UDG A;  2G5L A;  1SXX A;  4A8Z A;  1Z24 A;  1UYN X;  1QY0 A;  2WWP A;  2RCQ A;  1TL2 A;  4KC8 A;  4YFQ A;  3EBK A;  3NX1 A;  3WJB A;  5AEO A;  3BYK A;  1GX9 A;  4FFI A;  1QFT A;  4BCS A;  3KZA A;  4YGH A;  2RTL A;  1ZNE A;  4EQV A;  5BVS A;  1LIB A;  3WN0 A;  3CKG A;  4JNJ A;  3RDO A;  2RTB B;  1G74 A;  3FA7 A;  3NAD A;  4CPH A;  4LKP A;  3HTY A;  3AUM O;  3WJF A;  1WL7 A;  2NP1 A;  3QZ4 A;  1LUQ A;  4UU2 A;  1YWA A;  5AYD A;  4YH0 A;  1FTP A;  1ZNL A;  4YFR A;  4OKA A;  2YG2 A;  2QO6 A;  4N7D A;  4DNE A;  5HZ9 A;  3FEP A;  4AZP A;  2IZJ A;  1X8U A;  3BU9 A;  1CBI A;  4I3D A;  5B5F A;  3O22 A;  2AT3 X;  4QYN A;  4NV7 A;  5EED A;  2YFS A;  2ALL X;  2R74 A;  3ZUI A;  1TOU A;  1BRQ A;  1STS B;  2G78 A;  1KOI A;  2G8C O;  2HKD A;  1EII A;  1SY1 A;  1GYH A;  2OL8 O;  3R4Y A;  4Z2P A;  3ZUO A;  4BQU A;  1MDC A;  1JMX A;  3GE2 A;  4PVA A;  1ZND A;  3NQ3 A;  2YFT A;  3VPJ E;  2X46 A;  3CKF A;  5HBS A;  4AK7 A;  4NOV A;  3WZP A;  1SWA A;  2OFM X;  5EDB A;  2OVS A;  3C2U A;  4ZHG A;  1G5W A;  1SY3 A;  1OEE A;  1SWR A;  2EU7 X;  1PM1 X;  4O9S A;  3RE6 A;  4ZGU A;  2RD7 C;  2MWH A;  1I78 A;  2FR2 A;  3APU A;  3U03 A;  3C77 X;  4I3C A;  1SWG A;  2A3F X;  4I3B A;  2FWV A;  2GH7 A;  2RQ0 A;  1MX8 A;  3NP1 A;  1SLD B;  3HOL A;  4KH8 A;  3AKH A;  5AY9 A;  1PMP A;  4EQA C;  4ARH A;  4OEL A;  2Z4H A;  1NQM A;  1ZNG A;  1SXY A;  3KFF A;  4CV7 A;  2Q39 A;  1YWD A;  1YP6 A;  1AB0 A;  4HPC A;  1WBI A;  5F6Z A;  3VG2 A;  3OM6 A;  4U9C A;  2OY8 A;  4LQZ A;  1EAL A;  1HMT A;  1STP A;  4CK4 A;  3CBC A;  3PH5 A;  2Z4I A;  5F2B A;  1PBY A;  1SRH A;  4QQ1 A;  1SWL A;  3HPE A;  3ZXK A;  4XMC A;  1RST B;  4U8U N;  5FMB A;  1SWN A;  1H91 A;  1WUB A;  5D47 A;  2JW1 A;  1DZJ A;  1E00 A;  2L68 A;  3UEV A;  2AKQ A;  1VWO B;  2GTL O;  5DPQ A;  1T68 X;  4MIR A;  1SY0 A;  4QQS A;  2KD2 A;  2UZ2 A;  3APV A;  3FA9 A;  3P6D A;  1SWU A;  3ZW0 B;  4GE1 A;  1MX7 A;  3OD9 A;  4Z27 A;  4BX6 A;  4AW8 A;  4DCB A;  4GGZ A;  2W2B A;  3AKI A;  4OMX A;  1VYG A;  2OVA A;  4L1N A;  1DF3 A;  1QG5 A;  2JU3 A;  1LFO A;  1HBP A;  2OVD A;  3PEC A;  3WJD A;  3WN2 A;  4MVE A;  1VWP B;  3G7X A;  3DSZ A;  2QCB A;  2QOM A;  1VWI B;  3MG5 A;  4O4S A;  3VG7 A;  2IZH B;  3OE3 A;  2A2U A;  1NC9 A;  5FK8 A;  2N93 A;  1LCZ A;  1YP7 A;  2JMB A;  1OEK A;  3SZH A;  3QKG A;  3VG4 A;  5GLR A;  1DFV A;  2RTA A;  1RXK A;  3WXQ A;  2A13 A;  1AVG I;  3RZY A;  4TLJ A;  4I9S A;  2G79 A;  4OS3 A;  1JJJ A;  2NND A;  4CDC A;  1SWS A;  5EZ2 A;  3PK2 A;  4O3Z A;  3T1D A;  2DM5 A;  4YBU A;  4EXZ A;  3SLJ A;  3S5V A;  2A5B A;  5HTE A;  1URE A;  5LJG A;  2JU7 A;  4LKT A;  2EXK A;  4YFP A;  2QMI A;  4RUN A;  4NNS A;  4ORW A;  3WMY A;  1PT2 A;  2L67 A;  3QC2 A;  3ELX A;  3D5Z A;  2NNE A;  3JS1 A;  3V8U A;  4UDK A;  2OFR X;  3D60 A;  3C76 X;  1VWL B;  2MO5 A;  2IZI A;  2IZA A;  3T6F A;  3D5Y A;  3VG3 A;  4Z6J A;  3PIJ A;  1ERB A;  2I5Z O;  1OPA A;  1EPB A;  1DC9 A;  4ZFX A;  1SWQ A;  3OBL A;  4Z2V A;  5K06 A;  3VT2 A;  3BX7 A;  3O19 A;  1HY2 A;  1UV4 A;  5AJB A;  3EM0 A;  3RWK X;  4A60 A;  5KHP A;  4Y0P A;  4Y0R A;  2CAM A;  2FGS A;  4BX5 A;  5HTD A;  3TGC A;  2ACP X;  2QM9 A;  1EIO A;  1N9Y A;  5L8I A;  1U18 A;  5HCE C;  2LFO A;  5B2A O;  5A8C A;  3FR5 A;  2IZD B;  4I6S A;  4KCA A;  1VWA B;  5BVT A;  3VU1 A;  4EKV A;  2X34 A;  2ZSC A;  2OZQ A;  1SWB A;  3R67 A;  1QFV A;  1GT5 A;  4GNW A;  3WZQ A;  1RBP A;  5LJH A;  4IB6 A;  2A5C A;  3WAS A;  3UAQ A;  2AT0 X;  3JQO A;  4GGR A;  1SRE A;  4PSQ A;  2Q4N A;  5B6S A;  2X4M A;  3B2K A;  1Y52 X;  3D4R A;  2OFB A;  1SWC A;  2BS5 A;  1NBX A;  2KT4 B;  2RCT A;  3OM2 A;  3SAO A;  2PY1 A;  3VSS A;  2R56 A;  1W4T A;  5L8N A;  1YWB A;  4ORX A;  5FQ8 E;  4MEE A;  3NBX X;  1MM9 A;  4AZR A;  2ANS A;  1NP1 A;  1BBP A;  3TAW A;  4GNY A;  1X71 A;  2GC9 A;  5HWZ A;  3P2N A;  1CBQ A;  3PP6 A;  2C1S A;  4N2R A;  3BX8 A;  5HZ6 A;  3RDX A;  4R0B A;  4GD9 A;  2OYB O;  3ZW0 A;  1DV9 A;  1SLF B;  2MF6 A;  3ZQ3 A;  5HAE A;  4ZGF A;  3VHI A;  1HBQ A;  3K3L A;  1QY2 A;  2QQW A;  3D95 A;  5H9N A;  2X32 A;  3PDF A;  2KW1 A;  1JYD A;  4UDK E;  3PPT A;  3EW1 A;  4O3X B;  1TW4 A;  5JOW A;  1BM5 A;  1I06 A;  1I9H A;  3EYC A;  3UEU A;  4ZJ0 A;  4NLI A;  1S2P A;  1QQS A;  5FMD A;  3EW2 A;  4MVK A;  1Y9T A;  1JV4 A;  3D9W A;  1SWF A;  3PQS A;  2WPU A;  4QYP A;  3UGF A;  2BLG A;  1QAB E;  3FA6 A;  4ZHD A;  3GAQ A;  3RY1 A;  1VPR A;  3LFI A;  2CM9 A;  1SWD A;  4AK5 A;  4N1I A;  2OY5 O;  4CPF A;  3FEN A;  2FS7 A;  3F8A A;  1X8N A;  3QQ2 A;  1ML7 A;  1JYJ A;  3FEK A;  5LKE A;  4HWM A;  2X45 A;  3PIG A;  4EEJ A;  2WQ9 A;  3RDS A;  1STR B;  2RTK A;  4KMI A;  4CPE A;  3BRN A;  1Y53 X;  1FJ1 E;  5H8T A;  1LKE A;  3CWK A;  1KT5 A;  3VGW A;  3K1U A;  1SWP A;  1TOW A;  4GUZ A;  1SWE A;  1K24 A;  3WVM A;  1OPB A;  2GTL M;  3LIH A;  3D97 A;  2DJG A;  2FS6 A;  1N9M A;  2RTI B;  3U14 A;  2R73 A;  3RDM A;  1A18 A;  4QZT A;  1JZU A;  1PBO A;  5CE4 A;  1PTS A;  1O1U A;  4C5P A;  2DJF A;  1DZP A;  4FFH A;  3LTW A;  4L3R A;  4U6D A;  1OYG A;  4JGL A;  3HWE A;  2FLJ A;  4TQ2 A;  4Z28 A;  1N4J A;  2RTG B;  3P6C A;  5HA1 A;  1IKJ A;  2IZE B;  2C1Q A;  3PED A;  4YDB A;  3ZI8 A;  3P6H A;  2BC3 A;  3CU9 A;  3I0A A;  3EBW A;  4MVI A;  4GJS A;  1X8P A;  1GKA B;  2FKG A;  3VE1 A;  1LIF A;  3OM7 A;  1Y9M A;  4BX7 B;  4FGI B;  1HMS A;  3SOT A;  1DZM A;  2AVI A;  5GLN A;  3WN1 A;  3BDR A;  4ALB A;  4AZM A;  3WJE A;  5JOZ A;  1U0X A;  2GJ5 A;  5KID A;  2CM4 A;  1YI7 A;  3NR3 A;  5A7V A;  1VWH B;  5FEN A;  3FEL A;  2LBV A;  2OL7 A;  1B4M A;  4TKB A;  2JN3 A;  3B2L A;  4QRL A;  2RTC B;  4ODD A;  3TGB A;  5JD2 A;  2AMM X;  1O8V A;  3ELZ A;  1TVQ A;  3ZW1 A;  1OBU A;  1QWD A;  4U6B A;  2AT6 X;  5IO6 A;  4KC7 A;  4GET A;  1BRP A;  3T2X A;  1LDQ A;  3RWX A;  3WOV A;  4YBP A;  2AT5 X;  3FYF A;  1EUO A;  1SMP I;  1KT7 A;  3HWD A;  1LIC A;  3BY0 A;  3SZJ A;  3KQ0 A;  1VWC B;  2CZT A;  3PQU A;  1MEP A;  5IO5 A;  3MM0 A;  2PI3 O;  4NLJ A;  2RTP B;  4O8N A;  3VSZ A;  3U9P C;  2KTD A;  3VG6 A;  1EQD A;  2OXB A;  3WJG A;  3FID A;  4O4X A;  1ICM A;  5LJK A;  2XST A;  3FW4 A;  1LEL A;  4LZV A;  5JOX A;  3FA8 A;  2CZU A;  4NP1 A;  2RTO B;  1LDO A;  2AH7 X;  1B0O A;  4IB8 A;  4HPD A;  4D6B A;  5DG4 A;  2X8F A;  4D47 A;  4WFU A;  2HNX A;  2RTF B;  3VE2 A;  1KL3 A;  1AQB A;  4INN A;  1SRJ A;  3WBG A;  5B3M O;  4TKH A;  1JIW I;  2A2G A;  4XMD A;  3RKG A;  1LCW A;  2OFA A;  1BSY A;  4AZO A;  4N2Z A;  3WZN A;  1N0S A;  4GZV A;  4O3Y A;  3RSW A;  1ALB A;  3EC5 A;  4JO6 A;  4QGV A;  2RTM A;  1BWY A;  2W2F A;  1BEB A;  1SXW A;  1X8Q A;  2RTJ A;  2RTQ B;  4CDD A;  3WMZ A;  4FBV A;  1GT3 A;  5LJD A;  3BSZ E;  2KTS A;  4ORR A;  1AVE A;  4CPH B;  5LJE A;  3STM X;  1S7D A;  1ADL A;  3PH6 A;  1VWN B;  1ACD A;  4OEM A;  3ZZV A;  4BJ8 A;  4XMF A;  5EEE A;  3S5X A;  2WSJ A;  4O4O A;  4EFG A;  1UZ2 X;  2BSZ A;  2QQV A;  2RTR B;  3WPU A;  3TGA A;  4HPA A;  1YWC A;  5B6T A;  5D45 A;  1GX8 A;  1SWK A;  1ICN A;  4IAW A;  4YKO A;  1QY1 A;  2ZAG A;  4BGF A;  4ZH6 A;  4O8O A;  1NDJ A;  1SWH A;  5IXG A;  1XCA A;  2AEZ A;  4GK9 A;  3P24 A;  4UDI A;  3P6F A;  3STN A;  1P6P A;  1K3B A;  2VDF A;  1FDQ A;  5D48 A;  4YCE A;  2WR6 A;  1LF7 A;  4QGX A;  3CQR A;  4A1Y A;  1R0U A;  1KGL A;  2FR3 A;  2A0A A;  1KT3 A;  3KST A;  3VG5 A;  1KQX A;  2LB6 A;  3C7O A;  5FAZ A;  1N43 A;  3HK1 A;  5JR8 A;  1LCV A;  3TZS A;  4NV8 A;  5FIX A;  1ZNK A;  3FW5 A;  1Y9G A;  3WPZ A;  1SA8 A;  3WPV A;  4K19 A;  2RTH B;  5HA0 A;  3D96 A;  3DTQ A;  3BLG A;  5BYP A;  4QAE A;  4CDF A;  3CBS A;  4I95 A;  2FKJ A;  4DQ4 A;  5CSE A;  3E3C A;  2EXI A;  1EPA A;  3VHH A;  2MM3 A;  2WEW A;  1FEL A;  4O4U A;  2AF5 A;  4U46 A;  2OF9 A;  2POA A;  5LKF A;  3IA8 A;  3CQN A;  2RN4 A;  2B4W A;  5B10 O;  4Y0Q A;  2QOS C;  4NW4 A;  4AK6 A;  3UGH A;  1GX3 A;  4U8U O;  1JMZ A;  5A8D A;  3FR4 A;  5FQ7 E;  1AVD A;  2JGS A;  3QEE A;  4NYQ A;  3JSQ A;  4EDE A;  1W6F A;  4M6S A;  1RXH A;  1OEJ A;  3BYJ A;  1KT6 A;  5F6B A;  3ZW2 A;  4ORU A;  3VSR A;  1LNM A;  2RA6 A;  2I5V O;  1KL4 A;  4LZU A;  2MJI A;  3BU1 A;  1MK5 A;  3APW A;  3KFI A;  1VKD A;  3C78 X;  5EDC A;  4HFO A;  4IRW A;  2GTL N;  2Q2P A;  1A2D A;  5F7G A;  1L6M A;  2AC1 A;  2ACO A;  4BBO A;  1D2U A;  1W2T A;  2F09 A;  5AJC A;  4BOE A; 
#chains in the Genus database with same CATH homology
 4AW8 A;  2W2B A;  4U6D A;  3S26 A;  3HWF A;  3AKI A;  3U75 A;  1OYG A;  4JGL A;  4OMX A;  1NP4 A;  3UEX A;  5HCD C;  3LIG A;  3HWE A;  1LIE A;  4QNI A;  3N91 A;  2FLJ A;  4YCH A;  4TQ2 A;  3WJC A;  1VYG A;  2OVA A;  4L1N A;  3FLL A;  3P6C A;  4ZR2 A;  3NQH A;  5HA1 A;  1QG5 A;  4GDZ A;  5HCC C;  1DF3 A;  3QEF A;  3CMP A;  2JU3 A;  2XQR A;  1IKJ A;  1LFO A;  2M4L A;  3AKN A;  5FKB A;  1HBP A;  2OVD A;  4IAB A;  4IMO A;  1T0V A;  3PED A;  3WPY A;  3PEC A;  3EMM A;  3VT0 A;  4YDB A;  3NX2 A;  1G7N A;  2VDT A;  5HZ8 A;  3ZI8 A;  3P6H A;  1GKA A;  5D8J A;  2CBR A;  5EPQ A;  3WJD A;  4MVE A;  3WN2 A;  5GLK A;  3G7X A;  3CR6 A;  4FFG A;  3BYN A;  3CU9 A;  3DSZ A;  3FIQ A;  5GLP A;  3OJY C;  3I0A A;  2CBS A;  3EBW A;  4MVI A;  4ON1 A;  4WFV A;  4ID2 A;  3VT1 A;  1X8P A;  1KZW A;  1GKA B;  3BS2 A;  3KF3 A;  3VE1 A;  1LIF A;  2G7B A;  3LDR A;  3TF6 A;  1EXS A;  1Y9M A;  3OM7 A;  2QO4 A;  4FGI B;  1HMS A;  3SOT A;  1DZM A;  4O4S A;  1PEE A;  3VG7 A;  1Y9L A;  1FEN A;  3OE3 A;  5GLN A;  3WN1 A;  3BDR A;  1UYP A;  4ALB A;  2A2U A;  4AZM A;  2XKL A;  5FK8 A;  3WJE A;  2YMS A;  2N93 A;  1YP7 A;  4IB7 A;  4MVL A;  1EW3 A;  2JMB A;  5FK7 A;  5JOZ A;  3SC7 X;  1U0X A;  1BSQ A;  5GLM A;  2GJ5 A;  2E4J A;  5KID A;  2CM4 A;  1OEK A;  1YI7 A;  1I04 A;  1IFC A;  3NR3 A;  1GM6 A;  5A7V A;  2L9C A;  1CBS A;  5AYE A;  5FEN A;  4N4B A;  1CJ5 A;  3FEL A;  3QKG A;  1YIV A;  2LBV A;  1B4M A;  4O8P A;  2HMB A;  3VG4 A;  1IIU A;  4TKB A;  3B2I A;  4KCB A;  5GLR A;  2JN3 A;  3B2L A;  4QRL A;  2ADE A;  3KF5 A;  5A7V B;  1DFV A;  4ODD A;  3TGB A;  4GH7 A;  3WXQ A;  2A13 A;  1AVG I;  2LBA A;  2AMM X;  1IW2 A;  1O8V A;  4XME A;  3ELZ A;  2ASN X;  4I9S A;  4TLJ A;  5F58 A;  3RZY A;  1ST8 A;  2G79 A;  2YFR A;  3BYL A;  2Q9S A;  4OS3 A;  1KT4 A;  1TVQ A;  2BT9 A;  3ZW1 A;  1JJJ A;  1OBQ A;  1B56 A;  2NND A;  1OBU A;  4Y0S A;  4U3Q A;  1GGL A;  1GT4 A;  1QWD A;  4NYR A;  5GLQ A;  5EZ2 A;  4XMG A;  1HMR A;  1Y4W A;  1W18 A;  4U6B A;  4MLG A;  2AT6 X;  3ZW1 B;  1B8E A;  5IO6 A;  3LEM A;  4KC7 A;  4GET A;  2FTB A;  1BRP A;  3T1D A;  4O3Z A;  2DM5 A;  2HLV A;  1U17 A;  4YBU A;  3U0D A;  4EXZ A;  4ONZ A;  3RWX A;  2HZR A;  3WOV A;  3FMZ A;  5H9K A;  3S5V A;  3R4Z A;  5HTE A;  1URE A;  5LJG A;  2JU7 A;  4LKT A;  2EXK A;  4ALO A;  4ZCB A;  4O49 A;  3LHN A;  2QMI A;  4YFP A;  2AT5 X;  4RUN A;  4YBP A;  1BLR A;  4NNT A;  3FYF A;  4NNS A;  3MX7 A;  4ORW A;  3QED A;  3B2H A;  3NQK A;  3WMY A;  1PT2 A;  2L67 A;  1EUO A;  1FEM A;  3QC2 A;  3ELX A;  3D5Z A;  3P6E A;  1SMP I;  5HZQ A;  2NNE A;  1KT7 A;  3HWD A;  1LIC A;  3C7G A;  1EI5 A;  3JS1 A;  3V8U A;  2LKK A;  4UDK A;  2K23 A;  1A57 A;  2OFR X;  3BY0 A;  4IMN A;  3D60 A;  4UDJ A;  3C76 X;  3O2Y A;  2MO5 A;  3KQ0 A;  2CZT A;  3D5Y A;  4ZH9 A;  2P8G A;  3VG3 A;  1ZRY A;  3PIJ A;  1ERB A;  3PQU A;  1CBR A;  5IO5 A;  2WEX A;  4KT5 A;  1OPA A;  4QGW A;  1EPB A;  5IO7 A;  4NLJ A;  4QZU A;  4O8N A;  1DC9 A;  4FQB B;  3VSZ A;  2HYS A;  3LV4 A;  4ZFX A;  1YIF A;  5LJC A;  3OBL A;  2EXJ A;  3U9P C;  5K06 A;  2FT9 A;  1E02 A;  3BX7 A;  3VT2 A;  2KTD A;  3O19 A;  2WUT A;  3VG6 A;  1EQD A;  2OXB A;  1GT1 A;  3WJG A;  3P02 A;  4O4X A;  1ICM A;  4COT A;  1UV4 A;  5AJB A;  3EM0 A;  3RWK X;  1IKE A;  4AZN A;  5LJK A;  3IFB A;  2XST A;  3FW4 A;  4LZV A;  4WHI A;  1KZX A;  5JOX A;  3FA8 A;  5L8O A;  4A60 A;  2WQA E;  4Y0P A;  5KHP A;  2CZU A;  4NP1 A;  4Y0R A;  1MUP A;  1FE3 A;  2AEY A;  4YGZ A;  2AH7 X;  5B27 A;  1B0O A;  1SXU A;  2W2A A;  5FQ6 E;  1YUP A;  1HQP A;  4IB8 A;  4HPD A;  4D6B A;  4ZHC A;  1XKI A;  1KQW A;  5DG4 A;  5HTD A;  2X8F A;  5ANN A;  3D61 A;  4TNN A;  4D47 A;  1DZK A;  3TGC A;  2K62 A;  4WFU A;  2HNX A;  2ACP X;  2QM9 A;  3STK A;  1EIO A;  5L8I A;  1U18 A;  5HCE C;  3VE2 A;  1TXL A;  3LF7 A;  2BHV A;  2LFO A;  2MHD A;  1AQB A;  5H9L A;  3FR5 A;  4OMW A;  5D4A A;  5BVQ A;  4PVI A;  4INN A;  3WBG A;  4I6S A;  4TKH A;  3ZWE A;  4UDG A;  1JIW I;  2A2G A;  4XMD A;  4KCA A;  5BVT A;  4RUU A;  3RKG A;  3VU1 A;  2NNQ A;  1SXX A;  5A8C A;  4A8Z A;  4AYH A;  1Z24 A;  4CSB A;  1GYD B;  3AKM A;  1QY0 A;  2OZQ A;  2WWP A;  2RCQ A;  1BSY A;  2Q2M A;  4AZO A;  3R67 A;  4KC8 A;  4YFQ A;  1QFV A;  3EBK A;  1NGL A;  4N2Z A;  1ZNH A;  3NX1 A;  5C0N A;  3LDK A;  3WJB A;  5AEO A;  3BYK A;  1GX9 A;  4FFI A;  1N0S A;  1QFT A;  1GT5 A;  4GZV A;  4GNW A;  4YGG A;  4O3Y A;  3KZA A;  1RBP A;  3RSW A;  4YGH A;  1ALB A;  5LJH A;  1ZNE A;  4IB6 A;  5GLL A;  3WAS A;  4ORS A;  4EQV A;  5BVS A;  3UAQ A;  3VSF A;  1LIB A;  3MVF A;  3WN0 A;  4ORY A;  4QGV A;  2AT0 X;  1LID A;  3WAT A;  3JQO A;  1BWY A;  3MBT A;  1G74 A;  2QO5 A;  3HOE A;  2W2F A;  1BEB A;  1SXW A;  1I4U A;  1X8Q A;  3FA7 A;  3NAD A;  4LKP A;  2Q4N A;  3HTY A;  4PSQ A;  5B6S A;  3WJF A;  3WMZ A;  1HN2 A;  3B2K A;  4FBV A;  1GT3 A;  2QQU A;  1X8O A;  3D4R A;  3BSZ E;  5LJD A;  1WL7 A;  2NP1 A;  4OS0 A;  2KTS A;  4ORR A;  4AZQ A;  5C0P A;  3UGG A;  3QZ4 A;  2L5P A;  4A1H A;  5LJE A;  5FFH A;  4OS8 A;  1LPJ A;  2BS5 A;  3STM X;  2KT4 B;  3NPO A;  1S7D A;  2RCT A;  4UU2 A;  3OM2 A;  1YWA A;  3SAO A;  1S44 A;  2PY1 A;  5AYD A;  3VSS A;  2R56 A;  4YH0 A;  3B2J A;  1FTP A;  4N7C A;  5L8N A;  1ADL A;  1YWB A;  1ZNL A;  4ORX A;  3PH6 A;  5FQ8 E;  1ACD A;  3NBX X;  3P6G A;  4YFR A;  4AZR A;  1SY2 A;  3KFG A;  4YKM A;  3ZZV A;  2ANS A;  4WBK A;  1NP1 A;  2YG2 A;  4GKC A;  4XMF A;  5EEE A;  3S5X A;  2WSJ A;  1BBP A;  3TAW A;  2QO6 A;  4O4O A;  5KIC A;  4N7D A;  5HZ9 A;  3Q6L A;  3FEP A;  1UZ2 X;  4GNY A;  4EFG A;  4AZP A;  1X71 A;  2GC9 A;  5HWZ A;  1JJX A;  3P2N A;  5FMC A;  1X8U A;  2QQV A;  1BSO A;  3BU9 A;  1CBI A;  1MVG A;  1OBP A;  3WPU A;  3TGA A;  4HPA A;  1YWC A;  5B6T A;  5D45 A;  1CBQ A;  1GX8 A;  3PP6 A;  4I3D A;  4IAX A;  1ICN A;  2AT3 X;  3O22 A;  3I17 A;  4KII A;  4N2R A;  3BX8 A;  4IAW A;  4YKO A;  5HZ6 A;  1QY1 A;  4QYN A;  2LA7 A;  4IBA A;  4FBO A;  4MIS A;  2ZAG A;  4ZH6 A;  4O8O A;  5EED A;  3WPZ A;  2YFS A;  2ALL X;  3H3I A;  4ML7 B;  2R74 A;  3ZUI A;  1TOU A;  4GRJ A;  5JOY A;  4R0B A;  1IFB A;  1XCA A;  3OM4 A;  5FKC A;  1BRQ A;  2G78 A;  2IFB A;  1KOI A;  2AEZ A;  3NQ9 A;  1KXO A;  3KFH A;  3ZW0 A;  4GK9 A;  3P24 A;  1DV9 A;  3HWG A;  4UDI A;  3P6F A;  5AQ6 A;  1P6P A;  3STN A;  1ERX A;  3ZQ3 A;  5HAE A;  1EII A;  5FLW A;  1FDQ A;  5D48 A;  4YCE A;  4ZGF A;  2WR6 A;  4ZHH A;  1HBQ A;  4FFF A;  1SY1 A;  1LF7 A;  3K3L A;  1QY2 A;  1GYH A;  2QQW A;  4QGX A;  3CQR A;  3D95 A;  5H9N A;  4A1Y A;  1R0U A;  3R4Y A;  1KGL A;  3ZUO A;  2X8S A;  2FR3 A;  2A0A A;  1KT3 A;  4BQU A;  5HZ5 A;  1MDC A;  3VG5 A;  2ZAI A;  1KQX A;  2KW1 A;  2LB6 A;  3KST A;  3C7O A;  3APX A;  1T8V A;  5FAZ A;  5GLO A;  1JYD A;  3HK1 A;  4UDK E;  3ZXL A;  3F9D A;  3PPT A;  4O3X B;  3GE2 A;  1TW4 A;  5CYB A;  4PVA A;  1ZND A;  4DQ3 A;  3NQ3 A;  2YFT A;  5H9A A;  1E06 A;  1BJ7 A;  5JOW A;  1BM5 A;  5JR8 A;  1I06 A;  3VPJ E;  2X46 A;  4ES7 A;  3EYC A;  3TZS A;  5FIX A;  5HBS A;  1ZNK A;  2JU8 A;  4AK7 A;  3L4R A;  4M7M A;  4NOV A;  3UEU A;  4ZJ0 A;  3FW5 A;  4NLI A;  1S2P A;  4D6A A;  1QQS A;  5FMD A;  1A3Y A;  4MVK A;  2OFM X;  1X89 A;  4O3W A;  3RBY A;  5EDB A;  2OVS A;  1Y9T A;  1Y9G A;  1Y7B A;  1GXA A;  2F73 A;  1SA8 A;  4ZHG A;  2ADD A;  1G5W A;  1JV4 A;  1SY3 A;  3C2U A;  1OEE A;  2JOZ A;  2X8T A;  3FR2 A;  4K19 A;  3WPV A;  2EU7 X;  1PM1 X;  3WAU A;  3PQS A;  4O9S A;  5HA0 A;  3D96 A;  3DTQ A;  3BLG A;  4QYP A;  4QAE A;  5BYP A;  3UGF A;  2BLG A;  2RD7 C;  4ZGU A;  2MWH A;  1QAB E;  2BS6 A;  1RLB E;  3CBS A;  3FA6 A;  4I95 A;  2FR2 A;  3APU A;  4ZHD A;  4DQ4 A;  1JBH A;  3U03 A;  3C77 X;  4I3C A;  3GAQ A;  2A3F X;  4YMY A;  3E3C A;  2FWV A;  1G85 A;  4I3B A;  1VPR A;  3F6Z B;  2RQ0 A;  2EXI A;  2CM9 A;  3LFI A;  4AK5 A;  4N1I A;  1EPA A;  1MX8 A;  2FRS A;  3NP1 A;  3FEN A;  5F1E A;  2FS7 A;  3F8A A;  2MM3 A;  3HOL A;  4KH8 A;  2WEW A;  1D3S A;  1FEL A;  1GYE B;  1X8N A;  4O4U A;  3AKH A;  5AY9 A;  1PMP A;  1ML7 A;  4EQA C;  1JYJ A;  4ARH A;  3FEK A;  2Z4H A;  4GU8 A;  1ZNG A;  2POA A;  1SXY A;  5LKE A;  4HWM A;  3KFF A;  2X45 A;  4UU3 A;  5LKF A;  3PIG A;  3OM5 A;  4EEJ A;  3IA8 A;  5B29 A;  1VYF A;  3CQN A;  2RN4 A;  4CV7 A;  4BVM A;  2B4W A;  2Q39 A;  1YWD A;  2WQ9 A;  3C7E A;  4Y0Q A;  2QOS C;  1YP6 A;  1AB0 A;  4NW4 A;  1E5P A;  4HPC A;  4AK6 A;  5F6Z A;  3VG2 A;  2HZQ A;  3OM6 A;  4U9C A;  4LQZ A;  1EAL A;  3UGH A;  4TJZ A;  1HMT A;  4CK4 A;  4U8U O;  2EXH A;  4KMI A;  3BRN A;  5A8D A;  4U8U M;  3CBC A;  3FR4 A;  4IB9 A;  5FQ7 E;  3PH5 A;  5H8T A;  1YRZ A;  3AKG A;  2Z4I A;  3C7F A;  3QEE A;  4NYQ A;  3JSQ A;  4EDE A;  1LKE A;  4M6S A;  3CWK A;  1OEJ A;  3BYJ A;  1KT6 A;  1KT5 A;  2AL0 X;  4QQ1 A;  5F6B A;  1AEL A;  3ZXK A;  4XMC A;  3K1U A;  3ZW2 A;  4ORU A;  4FBR A;  3AKF A;  3VSR A;  2GTF X;  1LNM A;  4U8U N;  5FMB A;  2RA6 A;  1H91 A;  5LJB A;  5D47 A;  1TOW A;  2JW1 A;  3S60 A;  1DZJ A;  4HPB A;  1E00 A;  2L68 A;  3UEV A;  2AKQ A;  4LZU A;  2GTL O;  1O1V A;  3WVM A;  1OPB A;  2GTL M;  3LIH A;  2MJI A;  3D97 A;  3ZXJ A;  2FS6 A;  3BU1 A;  2OVE A;  4YDA A;  5DPQ A;  4TKJ A;  1T68 X;  1CRB A;  4MIR A;  1SY0 A;  3APW A;  3U14 A;  4QQS A;  2R73 A;  3KFI A;  1VKD A;  3C78 X;  2KD2 A;  5EDC A;  4HFO A;  5AYC A;  2GTL N;  3APV A;  2Q2P A;  3C7H A;  1A2D A;  3FA9 A;  1A18 A;  2AT8 X;  4QZT A;  5F7G A;  1L6M A;  3P6D A;  1JZU A;  1PBO A;  5CE4 A;  3ZW0 B;  2AC1 A;  1O1U A;  4ZHF A;  2ACO A;  1DZP A;  4GE1 A;  2O62 A;  1D2U A;  1MX7 A;  3OD9 A;  4XMH A;  4FFH A;  4I9R A;  4PJ2 A;  1W2T A;  2F09 A;  4L3R A;  3UEW A;  1I05 A;  5AJC A;  4BOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...