2X8LA

Plasmodium falciparum lactate dehydrogenase apo structure
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
320
structure length
311
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Apo Crystal Structure of Plasmodium Falciparum Lactate Dehydrogenase
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
total genus 117
structure length 311
sequence length 320
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x8lA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2x8lA02
1E3LA 1X13A 4E2YA 1SC6A 1NQOA 3K31A 1UZLA 2VYVD 1GR0A 3LC1O 3B1JA 3OHSX 1U28A 1GUYA 2GERA 3GY0A 4CQLB 3K2BA 2NVUA 1P9LA 4EJMA 2JHGA 3F4BA 4K28A 1GQYA 1I10A 3P7MA 1TT7A 4GMGA 4O59O 5GMOA 3ULKA 4E0BA 5CFZA 3PPIA 4KMSA 2YJZA 4CMBA 1H9AA 1B3BA 2FZWA 4AJOA 3DHEA 3JV7A 2EXXA 3PZBA 5B4VA 1BRMA 4YT5A 4PGFA 2VZ0A 1HLPA 3KEOA 2EP5A 2P9CA 1RKXA 4U7WA 3DZFA 4R16A 3L9WA 2V7PA 3GMDA 3M6IA 1FDTA 4CUKA 1BDBA 2OO5A 2Y67A 1YQXA 1R15A 1LBEA 3K5PA 3PLNA 3TDKA 1NQ5A 5ADHA 2YDXA 4J1SA 4PZEA 1M76A 3KM0A 4DMLA 4YAIA 3DAGA 5DULA 2BF7A 3JQEA 3JQ7B 3LF2A 4L4XA 3S8MA 3VKUA 3ZI0A 3BMOB 1ZZEA 4ALMA 4OIMA 3OFSA 4Z9XA 3RASA 2EW2A 2OUIA 4YWJA 2RHCA 2GR9A 2UYYA 5A03A 2DU8A 4D43A 2UUOA 2ZB4A 1R0LA 3G3EA 4NR0A 2X7HA 4NDNE 5JLAA 4KTVE 3QVSA 3ZHXA 3WBFA 4RF5A 3PWZA 4IPTA 1B8UA 2ET6A 3EVTA 4XGNA 3L6OO 3WSVA 4RV9A 3QWAA 1VL8A 3LF1A 3UAGA 4FOOA 1XU7A 5TLSA 4A5OA 1ZO8A 3D3WA 3PHJA 2E6UX 2C07A 2P4QA 4CM4B 4GLOA 3D3WB 3ZV6A 3KOUA 5I8WA 4FC6A 2HJRA 3IKTA 3BAZA 3H3FA 1B3RA 1W8DA 4W99A 3FR8A 4R4JA 2Q2QA 1U5CA 1MXHA 1WZEA 1X1TA 3M2PA 2HO5A 2AG5A 5K6AC 3VH2A 3P2YA 2NTNA 1YDWA 3UHAA 1PJLA 1YQDA 1P1JA 3H5AA 1KC3A 1QYCA 1ORRA 1I2CA 3H5RA 3VDQA 5L53A 1R66A 3FTPA 1JA9A 4GL4A 4R54A 3I52A 4I9UA 1KEVA 1VE9A 4RVSA 4KUEA 3NEPX 1ZKMA 4WCFB 1WW8A 3G49A 1K5HA 5J23A 2C20A 4MO2A 5JMWA 4OKNA 1F17A 3JQDA 3OECA 4FPXA 3TQHA 3RKUA 1H2BA 5L95A 1PGOA 1C1DB 2JJYA 2C5EA 3OJ0A 4RZHA 3WJAA 5EIOA 5CHEA 3CUKA 3ZNPA 3WWYA 3VPXA 3L4BA 4CMIB 3NGXA 5FEUA 1E5LA 2CF5A 3DBRB 3DHNA 2NU7A 3D7LA 1QMGA 4MKZA 4P22A 2VZ9A 1RM0A 1VL6A 3ROKA 5JYDA 4OOFA 3GH3A 1OC4A 4PLVA 4XEHA 1WAMA 5CDGA 4KOAA 4R69A 1UR5A 4DLAA 1X7HA 4HADA 3D3EA 4I5EA 3L4BC 5CPBA 3CEAA 3PVZA 1FDWA 1FMCA 2AEFA 1IE3A 3KLPX 2B0JA 2HMTA 2Y1EA 3EMKA 1OZAA 3HHPA 3DR3A 2QIOA 3KHUA 3VC7A 1E3WA 4LVCA 5U1PA 4XB1A 4UUMA 4PLWA 2HQ1A 1IZ0A 5EESA 3FN4A 1XIVA 4CL3A 4BNZA 4CMHA 2CVQA 3L6EA 1PJSA 1EZ4A 2W2LD 3FWNA 4Q3BA 4BUCA 4RO0A 2DPHA 1EQUA 2Q46A 3F4LA 4P4NA 4DREA 3I23A 4N18A 4PG7A 1ZEJA 2Q45A 4JBIA 1WP4A 1QLHA 2AMFA 3D0OA 4WLFA 3KLMX 3D4OA 2FR8A 1SNYA 2ZB3A 5U4QA 2CD9A 3ZWCA 5ITVA 4GX1A 1ZFNA 3R1IA 1PZEA 4IXTA 3PJEA 4RPGA 1Y8RB 4Q3EA 1LQTA 3E03A 3G1UA 5HS6A 5BNIA 4TRJA 2O3TA 1RWBA 3V2HA 1D8AA 4O1MA 1K6IA 1KC1A 1HZJA 4BVAA 1KVQA 3HDJA 2I3AA 3Q2KA 3F3SA 1X14A 1GUFA 6ADHA 2NUAA 5EMHA 5FWNA 3QSGA 4YACA 1YBVA 4C7JA 2O2SA 1ONPA 1QLJA 4HFMA 4YYZA 1PGPA 2YV1A 2NTJA 3OICA 3P19A 2NU8A 1R37A 4PZDA 4NQZA 4E2XA 1UXKA 4OXKA 4CLDA 2WTBA 1GV0A 1PQUA 4MVJA 5DZSA 1LSUA 3I6IA 3PHIA 4KWIA 3F5SA 4R01A 3ZWNA 3VVBA 3GF4A 2I3GA 1PU2A 2CUKA 4YJHA 1JN0A 3INRA 4WLVA 2Y93A 4W7IA 4BO8A 1GAEO 1A71A 2R6JA 4OSOA 1H6CA 4K26A 3SJ7A 4RDIA 5JSFA 1ZSNA 1HRDA 1H93A 3MTGA 5B1YA 4XWYA 1HE5A 1CWUA 1BVRA 3AJRA 3EHEA 3EGOA 5JW6A 4HXYA 2GPTA 4D0RA 3DDNA 3U0BA 2GZ3A 3WGHA 2IEDA 1JLLA 4WCFA 5KJCA 3E6AA 1LI4A 4RZIA 3AUUA 3SVTA 3U4HA 4IQ8A 1YB4A 3ICCA 3RAJA 5C3MA 2G1UA 3FBGA 3LT1A 5U9CA 2YW9A 1Y8QB 3MEQA 2HK7A 3ONFA 1P33A 1ZEMA 4ILKA 1LSOA 2X23A 3P5SA 2ZIZA 2DT5A 4B79A 5DF1A 1VJ1A 2Y1OA 4JIGA 4P4LA 4YAJA 2HCTA 3CZRA 1NNUA 2AE1A 2RCYA 4F6CA 5H82A 4CL8A 4E33A 2Y66A 4JLWA 1XSEA 2Y0EA 4IZHA 1R0KA 1M6WA 1EUZA 3AM5A 1AE1A 4J2HA 3ROQA 1UXHA 2GNAA 2DAPA 1TT5B 4YB8A 1DLJA 2Q1WA 5JFOA 2ZYDA 3RJ5A 3IDSA 3NX4A 2GF2A 1PJQA 3B70A 3CMCO 4MKRA 4YJGA 2Z5LA 4O0LA 3OMLA 4TRMA 1YQGA 2OORA 2HMVA 4KP7A 1PZHA 3I9NA 1PJ2A 4EEXA 3RJ9A 2IXBA 4BKUA 1XDWA 4CUJA 2V6BA 4LSWA 4YQZA 3GZNA 4OYRA 5KIAA 5GZ3A 1GTMA 1U3WA 3ENKA 4GI2A 1G0OA 3GPIA 4KUGA 3V5NA 3RFTA 1PTJA 3DAPA 1X0XA 1F8FA 1I3LA 1I3NA 2B4TO 4TKLA 2W2KB 5C7LO 2JFFA 1I30A 1P1FA 4D3SA 2JFGA 5DBFA 3MJTA 4FFPA 1YOVA 3HSKA 1TI7A 2B4QA 4F3YA 3GGGA 2WEKA 5EJ2A 4GSKA 3DBLB 5JCJA 2VWHA 1Y8RA 1IY8A 4CR8A 4CMJA 5CDTA 3F1KA 1RPNA 4GX0A 3ZU3A 4BHTA 4TMFA 1GL3A 4EI2A 4W9NC 5TT1A 2Q49A 4E2WA 4UEJA 4NFYA 2O23A 4QXMA 1UJMA 4CM8B 5EPOA 1GQQA 4AG3A 5KVVA 3OEYA 4R1SA 4IDAA 3BTSA 5H83A 1NP3A 3AUTA 3EY4A 3QRWA 3RFVA 4BO1A 5L51A 4ONEA 3INTA 3O38A 3UGKA 4B4WA 2X58A 1DB3A 2B4RO 2X0NA 1A27A 4BO9A 5CAEA 4NIMA 3RC9A 1B2LA 5DNAA 1TLTA 2E82A 3DBVO 1XHLA 3KXDA 1KEWA 2Y1CA 3H9EO 2Q2WA 2G76A 5IZCC 1QYWA 1XKQA 1E7RA 3NT4A 4U0KA 1J5PA 4WE3A 4IGEA 2QQ5A 4RPLA 1BMDA 4WCFC 4MVJP 1SMKA 4BMVA 1FF9A 2FMUA 2H9IA 1R4MA 4IDCA 4L73A 4WNIA 3UOGA 1E3WB 1AUPA 3C24A 4NFHA 3BYZA 1YL7A 3Q2IA 1ZK1A 1E7QA 4WECA 5IZCA 5ILOA 4EBFA 1C0IA 3LU1A 1O8CA 3LLSA 3WGZA 1DIRA 2Q99A 3FNEA 5KKAA 3CH6A 4TVBA 2X0RA 1ZMOA 3ZCXA 3B6ZA 1HDYA 3KYCA 5ILGA 4CM3A 5CDUA 1O9BA 3COSA 1VJ0A 3MJ4A 3HB5X 5HBRA 3SBOA 3JQFA 4P8RA 4GX5A 1XLTA 3QE3A 1V3TA 4II2A 4OQYA 3WGQA 3I4CA 1YRLA 1Z75A 2WSBA 4D41A 4J16A 5JDIC 5JC1A 1Y5MA 5A06A 2G5CA 2VHVA 3E9QA 3OA2A 4JXKA 4CM6A 1E1LA 3RUHA 2PH3A 4G65A 3F1LA 3C7AA 4IDFA 4JN6B 1WVGA 3PEFA 1LDNA 1CJCA 2V6GA 4I8XA 3DAFA 4CUZA 4Q3DA 2PK3A 3WG9A 4EEZA 1HSZA 3D4PA 1Q7CA 1HDGO 2VOEA 3MZ0A 2D0IA 3OF2A 3C8MA 3O4RA 5C7OO 2QHXA 5I9LA 3L6DA 3O03A 2NVBA 1H5QA 2SCUA 3RFXA 1ZXLA 2HLPA 2PY6A 3FPCA 1T4BA 3JD4A 4TRRA 2UDPA 3JD0A 2HJSA 1I24A 3UCXA 1CDOA 3W8DA 1SB9A 4OM8A 3GAZA 4E21A 3W4IA 3NKLA 2NNLD 4QSMA 3GEGA 1NAHA 1LA2A 1ULSA 2D5CA 3GNSA 3HDHA 1KIFA 1C1XB 3GRKA 4A2CA 1NFQA 3I1JA 4XDYA 1YXMA 4A26A 5TT0A 1O6ZA 1FK8A 1Q7BA 4UREA 1DXYA 4TQGA 5AOVA 4BNMA 4TROA 2AE2A 3ETDA 5DP1A 1OAAA 3MCVA 1BG6A 2W98A 4GAEA 4XYGA 5ITWA 3NT5A 1NHWA 4QQRA 1DPGA 4ZJUA 4D42A 1MP0A 2J5RA 5JCXA 3PYMA 3WB9A 5EINA 4L4SA 4BO2A 4YAKA 1C0PA 1GPJA 5HS4A 2DC1A 3DOJA 4M55A 1PGJA 2ZQZA 3NTRA 2QG4A 4DQVA 4FJ1A 2OFPA 2PH5A 4OH1A 3ZWAA 3WXBA 4L0QA 1BXGB 3KVOA 1SAYA 4U8GA 1NQTA 5JCJD 2XPCA 2UUPA 1KY4A 1DC4A 1UXIA 1ZCJA 2PTGA 4AJIA 2WDZA 3IMFA 3WGGA 2Y99A 3HDQA 3K73O 5C7IO 1WLYA 3I9MA 1LLQA 1H2HA 2PNFA 3AFMA 4BV9A 3BHIA 5DBIA 5G4LA 2A4KA 3NRCA 4Z6KA 2QRKA 3RU9A 2R00A 2WYVA 5TC4A 5JE8A 2E4AA 4B7CA 4B4UA 1LLUA 3GG9A 4DIBA 1U4OA 1E6EA 3A14A 1N7HA 2CZCA 4NBRA 1IPFA 1JWAB 5CDYA 5AVOA 1GPDG 1OBFO 1CQIA 4HFRA 2AA3A 4RCVA 3KYBA 2XAAA 3WJ7A 4B7UA 5HTOA 3MOIA 3I6QA 4IIVA 3CMMA 4J43A 3FBTA 3U62A 1LRLA 3EC7A 1HKUA 1PEDA 1DRWA 1XELA 4JJIA 3W6UA 1CYDA 1GCUA 4FJ2A 4RGBA 5T57A 1N92A 2B83A 3DOCA 2VWPA 3WGOA 4PLYA 4L8VA 2JKVA 3OA0A 3QA9A 5KWEA 1H0KA 5I7SA 3ZWOA 2YQ5A 1H9BA 3GMSA 4MP3A 1PSDA 1T1RA 3GFBA 1CIVA 4IDEA 3RWBA 4RORA 2C59A 1EBFA 1BVUA 1NQAO 2X0JA 4CMEC 5JAZA 1JWBB 4E3ZA 3JQ9A 4IMRA 2PGJA 4DIFA 2EERA 3PHHA 1V3VA 3UUWA 4DGSA 1SCUA 4RPKA 2PV7A 1KYQA 3DTYA 1AN9A 3I83A 2B69A 3N74A 3QP9A 4Y67A 3WIEA 3WSWA 1WMAA 3VKVA 4YT4A 3HADA 3O9ZA 1GU7A 4HFNA 4KDEA 3F9IA 3LQFA 1EK5A 4OOEA 4Y8VA 3ZWXA 5FI3A 1PQPA 3H2SA 4UEKA 4CLRB 3GA0A 1E92A 5BNTA 2IZ0A 1XR3A 4PIVA 3ZWBA 2VNAA 1UXGA 1PL8A 4NG5A 3L9XA 1QRRA 2X6TA 1XA0A 1RYDA 4R1UA 3OP4A 7MDHA 1J6UA 2CDCA 2X0IA 4FDAA 2IXAA 3EDMA 3VPHA 3DFZA 2BFPA 4FFLA 2FHSA 4UUNA 1I8TA 5JO0A 1NBOA 1D1TA 1EEHA 4YXFA 4HX5A 4AJHA 5CG2A 4BGEA 2BFOA 2X5JO 2FSSA 2Q4BA 2D5AA 3DMTC 3JQ8B 4FR5A 4OHUA 1SB8A 3OH8A 4N5MA 4NH4A 1E3IA 3SLKA 5KJEA 4BNNA 1P1RA 4E5NA 4CMEA 4R5MA 3EZLA 3OIFA 3TSCA 4IQ0A 4WLOA 3JQ6A 3JQFC 2LDBA 3A06A 3ST7A 3IAHA 4GVXA 1DAOA 3NV9A 1Z74A 2IODA 1HDCA 4J4HA 3ETEA 5A04A 4Z9YA 1Z6ZA 3UH1A 1GDHA 1BSVA 3UW3A 1FXSA 2X9VA 3FR7A 1NHGA 2VYNA 3E1KA 1ZMTA 2DKNA 2FPIA 4IS3A 4UVDA 5IXYA 1KVTA 4CM5A 1P44A 3VHRA 3O26A 1LJ8A 4PCVA 3ZU2A 5ICMA 3CZMA 1QYDA 5MGBA 2BFMA 4G2NA 4NPCA 1NVTA 5G2OA 1B7GO 1HYGA 4U6QA 3DZIA 2A35A 4U6SA 9LDTA 1KY5A 3EZYA 3GOHA 2HK9A 1EE2A 4HNGA 4D3DA 3D1LA 1KVSA 5F21A 2EJVA 5GZ1A 2OHXA 1DIHA 1OMOA 3MJCA 4I9HA 2E48A 4B8WA 3H8VA 2OBYA 2P5YA 4BNVA 5F5NA 5TIIA 2DM6A 5CP8A 1NXQA 2RBEA 4EUFA 2GGSA 4E13A 1L7DA 1VLLA 1J4AA 1O94A 4OGWA 1VKOA 3PRJA 2BH9A 1R0SA 2O3RA 3QW2A 3PHGA 3PJGA 3IJPA 1X7GA 1PGNA 2CMDA 3B20A 3C1AA 1ZSVA 4IGFA 2PD4A 3PLRA 1EVIA 4DMMA 4OO3A 4B4OA 4IXWA 1N5DA 3H2ZA 3SX2A 4HWKA 3GRPA 1F14A 3ZW9A 3ITDA 3GEDA 2C54A 3IC5A 3IUSA 4XQGA 3S55A 2D59A 3UN1A 5A05A 5JY1A 2J6IA 1AXGA 1Q0HA 3DFUA 3JQGA 1U8XX 3TRIA 5A3JA 3ZHZA 1YBAA 1YDEA 3H6KA 4EDFA 1B15A 1QSGA 1T1SA 2J3JA 5L4NA 3GQVA 3WS7A 5G0SA 3IS3A 4ALNA 1N2SA 3DMYA 4ALKA 2JD0A 9LDBA 1I01A 2NACA 4JGBA 4URFA 4XB2A 1E6WA 1TXGA 4YAGA 1MFPA 1PQWA 1T2DA 1DO8A 3RBVA 1EUDA 2XXBA 2DBVO 4PLCA 3ASUA 2HMWA 3ONDA 4CM4A 3U9LA 3ANLA 4BGVA 1TEHA 4NI5A 5FFFA 3GGOA 4LISA 2C7VA 1E3SA 2F1KA 3ADOA 1HDOA 3AY3A 3G0OA 5CEEA 1BXKA 4LMPA 2R00C 3BMQB 2QRJA 4BNWA 4M8SA 3IUPA 2J3IA 3GVPA 4UVHA 3SC4A 1MXFA 2FPPA 4WLEA 4YBZA 1RM3A 3BMCB 4XYMA 4I9NA 4JQCA 4FBGA 2DLDA 4ZHSA 2HMUA 1WPQA 1UDBA 4NZ9A 4KUHA 1UDAA 1LU9A 3H4VA 5ER6A 1HE3A 1SOWA 3AY6A 5TGDA 4A27A 3JQ7A 4DLLA 1LC0A 2FPGA 4CLEA 2GUGA 3DB2A 2P9GA 1N9GB 1VC2A 3WYCA 1B8VA 3L4SO 4ZQGA 5A9RA 4RPHA 1DRUA 3UF0A 1IOLA 4FGWA 1HXHA 2Y1DA 5L4SA 2VUTA 3K30A 3VOSA 2NM0A 1QV6A 4S1VA 2D1YA 4IUYA 3C85A 5L4LA 3OJOA 4FCCA 3TPCA 4Z0HO 4IJKA 1XCBA 1BTOA 1LEHA 1I33A 3I4FA 3PQFA 3GZ4A 3WQQA 3CINA 4GH5A 2Y68A 1U7TA 3AI3A 2X8LA 1FDUA 4D46A 3JQAD 3D64A 1M75A 4YT2A 2P9EA 1JKIA 4W4TA 1YKFA 1HSOA 1ZSYA 2YHIA 2EGHA 3AWDA 4XKJA 1G6KA 2DUUA 1GY8A 4GX2A 4J7UA 5JPIA 1U2GA 1EVZA 4Q3CA 4CM9D 4OL9A 3B1FA 1K2WA 4R9SA 5B12A 3W8EA 4YCAA 1SOVA 4AJEA 2C82A 3BTVA 4Y98A 2JCVA 2GO1A 5IDYA 5IXSA 1EDOA 2O3SA 2GSDA 2EKLA 2PZJA 1GUZA 2A92A 1HE2A 1P45A 1DIBA 2F00A 4NNJA 1PS0A 1PZFA 4RJTA 1U1IA 1VI2A 2JFHA 3TL3A 4FOSA 4OMUA 4BNLA 4F46A 1QYVA 1GQ2A 3WMWA 5BSEA 1PJTA 4MVJM 4CMIA 3L77A 5IDWA 3UCFA 3WLEA 1NFRA 4B3JA 5THQA 1Z7EA 2PZKA 3F47A 3GAFA 5LDHA 3RU7A 2TMGA 2FP4A 3V1TC 2C0CA 1UP7A 1SEVA 2X5KO 4PLGA 4CM8A 3FCOA 2OXIA 1E7SA 2I67A 4BMSA 2W8ZA 2WYUA 2Y0DA 5TF4A 4ESOA 3LSYA 2WD7A 1Q1NA 2O7QA 4XQ9A 4FJ0A 3SLGA 4ZQFA 2PKQP 3QLJA 4QFDA 1WZIA 4QO7A 1MUUA 4XIYA 1DEHA 3HQ4O 5JXWA 2X9GA 1R4NB 3BTOA 5KJFA 1ZIDA 5DBGA 1T4DA 4LCJA 1O95A 2C5AA 4MKXA 2G82A 4DQUA 4E31A 3AU9A 4BV8A 3OQ6A 1NFFA 1NR1A 3PXXA 3E82A 2EV9A 1EMDA 2RIRA 3BTUA 3WQSB 1V8BA 1ZBQA 5G0WA 2VOJA 2AHRA 4IS2A 3WICA 2ZCUA 1LSSA 3MWEB 1L7EA 4D0SA 4IJVA 5B37A 1R6DA 3ZW8A 5CEFA 1QKIA 4RVHA 5K0ZA 1R16A 2A94A 3GVIA 4YRDA 1W73A 1VSUA 3KTDA 4NK4A 2AEJA 5A3VA 4CV3A 3JTMA 1E7MA 1D3AA 4S3MA 1DFHA 3U3XA 2BGLA 2CDBA 5A4DA 1JTVA 1G0NA 4R41A 4J6FA 4E5YA 1LNQA 3JD3A 3Q9UA 3ANMA 1DJNA 3JD1A 4XYEA 3PK0A 3WTBA 4PLFA 4WK6A 4FW8A 4CMAA 1HLDA 1EFLA 1N7GA 2DPGA 4OXNA 5DP2A 4JCOA 2LDXA 4PG5A 1W4ZA 4I5FA 4J0EA 8LDHA 2ZYGA 1E1NA 2BI8A 4E5KA 3QVXA 2FWMX 3I9KA 4AJPA 4W7HA 4YJFB 1U3TA 3BHMA 3GK3A 4BGUA 3LLVA 1S6YA 1JW9B 2B5WA 2DQ4A 2Q4EA 4NK5A 1TT5A 1KVRA 2OZPA 2O3UA 1I3KA 4BNUA 1ENZA 2GDZA 8ADHA 1JKJA 2POQX 3L07A 3WGYA 5C37A 4O5OA 1H6DA 4MVJD 4B3HA 1R12A 1PJCA 2I99A 3PFFA 1M2WA 1C0KA 1QG6A 3QWHA 4PG4A 2ZTMA 4CLOB 1P31A 2EKQA 1WNTA 2EKPA 1J49A 4WNCA 4QTZA 1KBZA 3HN7A 1VRWA 1A72A 5TSDA 1YH3A 2WE8A 3E5MA 2X9NA 1AHHA 4IBOA 3AW9A 4YJDA 2X22A 3WMXA 4P38A 4BO4A 2X1HA 4K6FA 4HP8A 3KYCB 4GGPA 1ZK0A 4D7AA 3E9MA 1L1FA 3QWFA 3SJUA 2CVOA 3UKOA 1M6HA 1MB4A 1HDRA 2DUWA 1VPDA 4LK3A 5I7EA 3M1LA 3X2EA 1GCOA 4WCDA 1WMBA 1QV7A 4XGIA 4MIYA 2AQHA 4GPD1 5G0VA 4AJ2A 5KJ1A 2RH4A 3SC6A 2YFQA 1EK6A 3V1YA 5H81A 2X5OA 1Y6JA 2HK8A 4XJTA 1JDJA 1GFSA 1T2EA 2EHDA 1NASA 2VWGA 5A5EA 1B0AA 2WD8A 5JC8A 4YRAA 4RPJA 2NADA 3PGJA 5JO9A 4GSLA 4DPKA 3WR5A 1IB6A 4R51A 1E3JA 2BELA 4J2OA 3NAQA 3TNLA 1ISGA 4QX6A 3VPSA 2FR1A 2HRBA 3ORFA 4DYVA 3JSAA 4BB5A 1DLIA 3WNVA 1WDKA 1HL3A 1ZJZA 2WD7B 3DC2A 3ZWVA 2YQ4A 3F46A 1RYEA 4FD3A 1WDMA 2GRAA 3RBZA 4CV2A 5CDSA 2CVZA 4MINA 4NFSA 2O4CA 3V2GA 1B8PA 5HRUA 2PKRA 4INAA 1VL0A 3OEWA 3AI2A 4NU5A 4CLHA 4RVFA 4NJMB 2O2YA 2YV3A 1FDSA 2BRUA 5JDCC 3UVEA 4BIIA 2JAHA 3ZV3A 1JVSA 3DZGA 3FSRA 3QY9A 4Z0TA 5G4KA 4A7PA 5IN5A 4KWHA 4CLRA 2ZB7A 3LT0A 1I32A 5IDXA 4BNKA 1V0JA 2HDHA 2O7SA 3QVTA 2VHZA 1GYQA 1MLDA 1T2FA 2YZ7A 1GV1A 3Q11A 4BKOA 4Z3KA 3KRTA 5A1TA 4FB5A 4NJOA 4TZTA 1FDVA 3C1OA 3DZJA 4Z3DA 5TX7A 4BNJA 4NHEA 1I5RA 4FIZA 1YVEI 1MX3A 4BNTA 1U4SA 5ENDA 3A9WA 1GYPA 3QHAA 3K96A 4E32A 1M66A 4XD2A 3ZNQA 3AM4A 1M67A 4J4TA 5F5LA 3GDOA 2VRCA 3DTTA 4KZPA 4FFMA 4ND5A 5F3RA 2I65A 1GYRA 3OETA 4WOKA 3NUGA 1JAYA 3RBXA 1LDYA 1U3VA 4CODB 5COBA 3E9NA 2B5VA 1F12A 4XZ3A 1DHTA 2E37A 2JL1A 3DBHA 4AL4A 2HKIA 1JU9A 1VSVA 2J5QA 2PFGA 2EWMA 3PWKA 2VT2A 4XR4A 4WLNA 1MG5A 1LDBA 3H9QA 3NDIA 3ETGA 3GVXA 1SZJG 3HN2A 3W4KA 4AJKA 3K8ZA 1MGOA 1SPXA 2FOIA 1RM5A 4IJUA 3WLFA 1IZ9A 2DFVA 5KOIA 5JYEA 2DBRA 4IY1A 2CDAA 1IL0A 3O8QA 3UFXA 1DC6A 2H5LA 1D1SA 5JBIA 3UCEA 3RCBA 3JYLA 2GN4A 2O50A 4BO5A 3KYDB 4DC0A 1Z82A 4J1QA 4I1IA 1HT0A 3V2UA 5IN4A 2VTDA 1XGKA 1PJ3A 4BS9A 3K92A 3FPLA 4X54A 5T8KC 5F1KA 2BHLA 1LDMA 1C1XA 1YS4A 1MC5A 3N58A 5EQDA 4LW8A 3RUDA 4ALJA 5HM8A 3ONEA 4WEOA 1Y5RA 4CPDA 1D4FA 4N7RA 2OP1A 1NAIA 3HNPA 5COAA 4C7KA 2DTXA 5TNXA 3FHLA 1YL5A 5HA5A 4L76A 1YL6A 1LLDA 4DL9A 4CQMB 5TJ9A 1DFIA 4Y6RA 2GN6A 3OBBA 2IYOA 2ZQYA 5DOVA 4CMCA 4I5DA 4B7XA 4PRKA 3STHA 2W90A 4BQRA 1YGYA 5AXDA 4JP2A 4DTIA 1CF2O 3WNQA 3G79A 3ZZNA 1PL7A 1N8KA 3B1KA 2GN8A 1BGVA 4TSKA 4CM9A 5LCXA 1UZMA 4TWRA 1GD1O 2Z95A 1GZ6A 4HUJA 4WPGA 5DOZA 3GUYA 1U9JA 3TOZA 2X4GA 4DYDA 2GLXA 4OSPA 4J9UE 4UEOA 1P3DA 4FGSA 1NVMB 3NJ8A 3QWIA 1BW9B 4IJWA 5KVCA 4B8ZA 1Z7BA 3E8XA 3H7AA 1TB4A 4PVDA 1A9ZA 3QJ5A 3S2GA 4BKPA 1VM6A 3ZWYA 2VHXA 3NT2A 4WEQA 1R4NA 1ADGA 1R4MB 2V65A 1A5ZA 3DZHA 3OQ1A 4E5PA 4PLTA 4MVJF 5HWSA 1ID1A 3IL2A 1HYHA 3BMQA 2DTDA 2DTEA 3TZQA 4BNXA 5DCYA 5L40A 1IPEA 1OFGA 4CMKA 3MJEA 1ZK3A 1YB5A 4CQLA 3W1VA 1ISFA 1YB1A 2J3HA 3OJEA 2I76A 2QRLA 3D5QA 3M1AA 2UVDA 4ID9A 3ZWPA 2X86A 1EFKA 1H6BA 1ADCA 3WYEA 2PKQO 1E7WA 4BO3A 1P0CA 5A9SA 5FYDA 3KO8A 1DBVO 1JKFA 2B36A 3TZKA 1T2AA 2NSDA 3GPDG 1ZNQO 1QR6A 4YDRA 3G1TA 1KOLA 4D79A 4HBGA 5L7TA 1VJTA 1IYZA 2PD6A 4RF3A 1C1DA 1KS9A 2AEMA 4PG8A 2Y1GA 4C4OA 3TF5A 1DDOA 1GEEA 3GN2A 3KSZO 1EDZA 4PLZA 4YAEA 4OAQA 3CTMA 1D7OA 3EUWA 4BGIA 3WTCA 3ZH2A 4YRBA 1K0UA 1K89A 4ZGWA 1V3UA 2VZ8A 1DC3A 3R3JA 3R6DA 1UP6A 3KSDO 2H6EA 3GGPA 3HE3A 1WWKA 4FFRA 1Y1PA 1NWHA 4IINA 2GZ2A 4HNHA 4ROSA 1DJQA 1DFGA 3TZ6A 4R1TA 5BSHA 3GT0A 4UAGA 4CM1A 2DFDA 3I5MA 2W4QA 4J0FA 5G0TA 1PL6A 1P74A 4GGOA 4H3VA 4CLOA 4DLBA 3OM9A 4FFNA 2NV6A 1GADO 2E49A 4ITUA 3ZNOA 1O89A 1XEAA 1U2DA 4MIEA 5L45A 2P68A 3VPGA 4WJZA 1WDLA 5F1PA 4MVJE 1Q7GA 4CQMA 3JYPA 1AGNA 5BNFA 1LLCA 1F8GA 5KTKA 3MWDB 5TS3A 1XYGA 4CR6A 2C29D 4RF4A 2VNSA 3LDHA 4MPDA 4EYEA 2D8AA 3JQ8A 4M87A 1HEUA 2P91A 5JMPA 3LT2A 4E2ZA 4I08A 4Z0PA 4DC1A 5A9TA 3WDSA 3MJVA 1LRKA 2C2YA 4CQMD 6LDHA 4BNHA 1PZGA 3BZUA 5AXAA 2J5KA 3PI7A 1ISJA 1N9GA 3ZNNA 4L9RA 3I9LA 4FQ8A 3BMOA 3GHHA 4XRRA 3CKYA 3KUXA 4XQEA 1N1GA 3TZHA 3X2FA 1ARZA 4JNKA 4RL6A 3VVCA 5T5QA 4ZICA 3UXYA 4QEDA 4RVGA 1DSSG 4ZA2A 2GCGA 3RKRA 3E48A 1NYTA 3HUDA 1QORA 2B35A 1CRWG 4L75A 3TZCA 1OI7A 4D44A 1EQ2A 3OQBA 2ZTVA 4ZD6A 5JY6A 3HFGA 4BKRA 1HWYA 2PA3A 4DBVO 3DXFA 5JDCA 4UVIA 5I7FA 4Q3NA 1A7KA 1P0FA 2G17A 4Y6PA 5DCWA 4IZIA 4DQXA 4J90A 4XCVA 5ES3A 1U8FO 5G4KB 3LT4A 4PG6A 4D3FA 1MA0A 4XYBA 3H9JA 2J8ZA 1ZXBA 4H7PA 4WLUA 1E0DA 3L0DA 1CQJA 3RVDA 4KTTE 1DOHA 4H16A 1E3EA 1PS8A 3NTOA 3PYXA 3QIVA 2VQ3A 3IKVA 3RI3A 1ZUD1 3K6JA 3PTZA 2V6FA 1ENOA 1X7DA 4IQGA 3PQDA 2ZKLA 2I5PO 2DBZA 5BSGA 1XQ1A 1T2CA 4XYLA 1PWZA 2JCXA 3VZSA 1DIGA 1FJHA 1HETA 1OC2A 3AUSA 1UZNA 3AU8A 1SBYA 1BHSA 3EK2A 3ICPA 5THKA 4Q9NA 4XDZA 4XQCA 4OJNA 1Y9EA 1HYEA 5T67A 4P4GA 1CETA 4JJGA 3DBHB 4BNIA 3VZPA 4OXYA 2UAGA 3TWOA 3DBRA 1H94A 5KVSA 3V8BA 2O3JA 2P5UA 4EJ6A 2EP7A 5A5FA 4WUVA 3ZV4A 1ML3A 5L3ZA 4JK3A 2I66A 2Z1MA 4ND4A 4KQXA 1EVYA 1QP8A 1YE3A 2RH8A 3BIOA 3FD8A 3ADPA 3O8QB 4MJLA 3WOHA 2QYTA 3AK4A 4F45A 2EW8A 3RC2A 2Q1TA 4GWGA 5GZ6A 1PS9A 2PD3A 2P4HX 3VPFA 3WWZA 2YV2A 2NQTA 5JNLA 1UDCA 1ISIA 1CERA 2ZK7A 4OKIA 4EZBA 5IAAA 5BR7A 1YJQA 2HAEA 4A73A 4YJGB 3BHJA 4AJJA 4UUPA 3ANNA 2EEZA 2J3KA 1ISMA 4XA8A 5F1OA 4TVOA 3A4VA 3Q9NA 4H15A 3RUFA 4WKGA 3VH1A 3GG2A 5EN4A 1S7CA 4YJHB 3QV1A 1Y7TA 1LSJA 2JD1A 4N54A 3DL2A 1I3MA 2D4AA 4ZN6A 2GD1O 3GVCA 3WFJA 3ZU5A 2FY8A 2W2KA 4AICA 3TFOA 1P1IA 2VYVA 4PN3A 4CV0A 5KJ6A 2O48X 3ENNA 1E5QA 2FR0A 4XGKA 4RF2A 3PHLA 1EVJA 4K9DA 2ZTUA 2OP0A 5I9NA 2Q1UA 1XU9A 3Q3CA 4GQAA 3F5QA 3IQDB 2VRCD 3NDRA 4YQYA 1BDMA 3CE6A 4ZRMA 2QW8A 4ZVVA 2BLLA 1E6UA 1ADFA 2BKAA 3WBBA 5IZ4A 3W4JA 4M49A 5KVQA 3BXXA 3VH4A 2Y05A 4IDGA 2XF8A 4J91A 3WQRA 2EGGA 4YT8A 4Y6SA 2PZLA 3EVNA 2YFHA 4WASA 3AUAA 1E77A 2WJPA 4BO6A 4J7XA 2WMDA 2ZCVA 1LQUA 5B4UA 4DRYA 3OIGA 2Y1FA 3GC6A 4YJFA 2IYPA 2GN9A 1GEGA 2NQ8A 2A9FA 2Y0CA 2FRDA 2VTEA 4Q39A 1ZK2A 4R1NA 4JROA 4CR7A 2NTVA 2YHIB 1SEPA 4MP8A 1Q0QA 1J0XO 3HG7A 4GLLA 3TJRA 4W9NA 1NX6A 5GY7A 4O6VA 1O5IA 2Q3EA 4LCEA 4LSMA 1UH5A 3ZN2A 3JCZA 3U4CA 4A03A 4BQPA 2VHWA 1XG5A 3KETA 1AHIA 4Q3AA 2VT3A 1LDEA 4U5QA 2PGDA 5IFLA 4ZQEA 4M86A 3AFNA 1UAYA 3GDFA 4TZKA 3RROA 4ZU3A 1TA4A 4J49A 2GASA 5JAIA 3OSUA 4HV4A 2G0TA 1ZH8A 4ND3A 1DAPA 4YPOA 3T7EA 4YVFA 3K2EA 1F06A 1F0YA 3JQAA 5TRTA 3VAZA 5JAMA 3T7CA 1MC4A 3WIDA 5CPFA 1LXCA 3UICA 3DBLA 3I9OA 3FNFA 4JBHA 2GYYA 3WX0A 5KKCA 1PWXA 1ZVMA 2VUUA 1PJ4A 1E1MA 2YYYA 4BB6A 3HZZA 3SXPA 2AQKA 3VDRA 4AJ1A 3EW7A 1ZK4A 3ASVA 3C3XA 4U0JA 5G0UA 5CG1A 5FI5A 1ISHA 3I9JA 2O4UX 4HKTA 4MVJG 2YUTA 3PDJA 4GMFA 2UV8A 3Q6IA 3AOEC 1Y81A 1JVBA 5T6BA 3FRJA 3ROPA 4NJMA 3C7DB 3RD5A 4NBTA 4J1TA 1YBMA 2IEBA 3RUAA 4ZQHA 4ND2A 4EW6A 1MG0A 2NLOA 5B4TA 3OJFA 1W0CA 3GR6A 4DUPA 3S2EA 1IULA 4M89A 4BNFA 4CMGA 4E5MA 2B37A 2HUNA 5EQFA 1O0SA 1P1HA 1BWSA 1LX6A 2D2IA 3RC1A 1B16A 4L74A 4D45A 2C7GA 2EIHA 2Q2VA 1YWGO 4CJXA 2HU2A 2AQIA 2W2LA 1C3VA 1EUCA 3I3OA 1QYXA 2AXQA 1YOVB 4ZRNA 2NVWA 3V1UA 2NU9A 4K1LA 1CEQA 2HMSA 1ONNA 5AXCA 2WM3A 3M2TA 5BSFA 4JP3A 4YEDA 3E18A 4G81A 3BMNA 1MV8A 1SO8A 4GKVA 1A7AA 4DXHA 2C2XA 1LC3A 4G5HA 5JDIA 1NWCA 2WE7A 1NPYA 3JYNA 1V35A 2IZ1A 3VTZA 4BO0A 2CSUA 4XIJA 3RSHA 3HB4X 4DPLA 4BKQA 5EERA 1BXGA 4FSHA 3GLQA 3HJAA 3LZ6A 3WYBA 4BL5A 3DHYA 4AJLA 4IDDA 1DIAA 4R9RA 4UULA 1UUFA 2BMAA 4DPMA 1I36A 3GFGA 3PQEA 1DC5A 2RAFA 5IF3A 1HE4A 1Z45A 3OJLA 1HZZA 4RVUA 3U4DA 5TQVA 2WWRA 3NDJA 4MOWA 4NMHA 3AY7A 3U4IA 3EYWA 1PGQA 3DO5A 3IIEA 3QQPA 4J9VA 2HRZA 2VHYA 2VUSA 3KYDA 1Q2XA 5AQ1A 1ZJYA 4WOJA 2I6TA 3DOOA 4GVLA 4PLPA 1A9YA 4J1NA 4JX8A 2ILTA 4EUHA 1MFZA 3NYWA 5L7YA 1I2BA 1JQBA 2JAPA 2AW5A 5T64A 3VH3A 4Y9DA 1P77A 2CY0A 3ZU4A 1LUAA 1HF3A 4QFCA 4PRLA 5A02A 3G17A 2Q50A 3CSDA 4LVUA 4TRNA 2PWZA 2AQ8A 3K9QO 4LN1A 1KEPA 3AOEA 2IDZA 4LRSB 4XR9A 2FSVA 3TFQA 3TN7A 1YO6A 3GHYA 1T24A 1YONA 3RIHA 1LDGA 5BT9A 3R0IA 1Z73A 3T4XA 4MVJH 3CXRA 3DEYX 4UVGA 5EL0A 3RUCA 4AJNA 2NU6A 2QX7A 3JQGB 2YHUA 5I7VA 4JBGA 4QECA 4CM7A 4IDBA 1OOEA 2I9PA 1X0VA 2ZB8A 2ZTLA 3INGA 3ROMA 3H9UA 3LK7A 3PYLA 4TKMA 3PZRA 3H65A 1DRVA 1B14A 3IP1A 3KZVA 3W6ZA 3KB6A 2FZEA 4MP6A 1KEUA 2EJWA 2ZJ1A 3PDUA 4DVJA 4E4YA 7ADHA 3LC7O 3A28A 1V6AA 1RJWA 3H5NA 1I2ZA 1HTBA 1PR3A 5IDQA 2EF1A 1PIWA 5DDIP 1IHYA 3C7CB 3HFSA 3HWRA 4GKBA 3LC2O 4CLXA 1HDXA 1W6UA 2ZJ0A 1EE9A 1UAGA 1K6XA 5BQFA 2QZZA 1GZ3A 5DCUA 4FN4A 4DWVA 2BGKA 3GNQA 3JQCA 4R3NA 3RUIA 1K3TA 5IG2A 1Q0LA 3S1LA 3VTFA 1ZW1A 4A10A 2ZATA 3MJSA 4R68A 3JQBA 3ITKA 1NTOA 3BMCA 4DBZA 1NVGA 5JS6A 4HFJA 1ADBA 2R2GA 5ICSA 5FF9A 4MIOA 3OIDA 2DBQA 3WGTA 4GBJA 4KDFA 4L4RA 2PLAA 5A9SB 1KERA 3IP3A 2CF6A 5MDHA 1U3UA 2OGUA 3Q0EA 1UP4A 2DVMA 4Z9FA 2XXJA 4FFOA 2V6MA 3KBOA 1G1AA 3RUEA 2WYWA 5IJZA 1GZ4A 2BD0A 2O3QA 1E7YA 1Y9AA 3NTQA 3D5TA 3D4NA 4EITA 1PJBA 4M1QA 1KETA 3MOGA 2JHFA 2PZMA 3EAGA 3DONA 3ZWWA 5I9MA 4A0SA 5JAQA 4E6PA 3ON5A 4W82A 4BO7A 1A4UA 2GZ1A 4R3WA 5CEJA 3PJFA 5AYVA 1B26A 1WXDA 3PIIA 4EJ0A 2OOSA 2QYSA 3DWFA 3QVWA 4YTEA 1C14A 3JQ9C 5TJHA 2VCYA 4PVCA 2H63A 4FS3A 5KNLA 3S2IA 3MTJA 4E12A 3DZBA 1C0LA 2QZ9A 4R5HA 2NVUB 3N7UA 4QT0A 3GZNB 4XJSA 3LYLA 3GDGA 3U09A 4IMPA 1RM4A 2BGMA 3S2FA 4XRGA 2VRBA 3DMTA 4YA6A 4II3A 5ER9A 1NM5A 2JD2A 3E5RA 1V9LA 3NJ4A 2OMEA 3GUCA 3JQAB 3JYOA 3HDYA 1PR9A 3U5TA 1Y8QA 4J3FA 3BA1A 4NBWA 3ZGYA 3KV3O 1U5AA 4I5GA 4N5LA 3ZDFA 1X15A 4ZQBA 4RLSA 1IHXA 3FF4A 1H6AA 1T25A 3BMNB 1K6JA 3A1NA 4NBUA 3KEQA 4PFJA 5DN9A 5KCZA 1BXZA 1QXSA 2JCYA 3FNGA 3IJRA 3TOXA 3FI9A 3SEFA 3FTNA 4WGGA 3DZKA 3ZHBA 1XQ6A 3GEMA 3H9GA 4ALIA 1ENYA 3PJDA 2BI7A 5AXBA 1BW9A 3ABIA 4LMRA 3DQPA 3R3SA 4IIUA 4ND1A 5L7WA 4AJ4A 2ZYAA 4UVEA 2PR2A 3GN1A 3QVOA 1VKNA 4HY3A 1T26A 4BNYA 3NGLA 3PIDA 3IOYA 1IUKA 4E30A 3T4EA 3LVFO 4BNGA 1JAXA 1ULUA 1YJ8A 2VYND 1LRJA 1U7HA 4B4VA 3RQSA 1E1KA 5T8KA 2RHRA 3AM3A 3AOGA 3GNTA 3Q1LA 4K6CA 4F6LA 1XWFA 5L9AA 4RQUA 3ZV5A 1I0ZA 2AG8A 3QWBA 3ZWMA 4BMNA 4EGFA 5DT9A 2YDYA 4XX0A 4UUOA 1PX0A 3JD2A 4J7CA 4NBVA 4LRTB 5LDGA 3VZRA 2OBNA 2Q1SA 5COQA 2CNBA 4CV1A 1A4IA 4RQTA 5K6AA 1NPDA 2VN8A 4YR9A 4LGVA 4QO8A 2TMDA 3CPSA 4GWKA 3W8FA 3KSUA 4AFNA 1ENPA 2IRWA 4RVDA 4MDHA 5K9ZA 4EUEA 3CIFA 3F6YA 2Z1NA 3FWZA 1X1EA 4DIOA 3PGXA 4PZCA 1UXJA 2HSDA 5LC1A 4BOYA 4KQWA 3U49A 2EG9A 1EBUA 4IM7A 3PFWO 3RC7A 3AI1A 1HDZA 4JJFA 1NR7A 4NU6A 4ALLA 1P1KA 4FC7A 2VWQA 4AVYA 4DA9A 3VZQA 1DHRA 3ZHYA 4W6ZA 2H1SA 5I8ZA 3FNHA 4O63O 3WGIA 4MVJI 5ENVA 3C1TA 3PWSA 1N1EA 2XOXA 3H3JA 1KVUA 3P2OA 2P2SA 2NWQA 1AXEA 2CFCA 5C5IA 1NPTO 4N5NA 4B3IA 3PP8A 4OQZA 3JQBC 3JYQA 4RDHA 3TL2A 2FN7A 4M54A 3GVHA 3WFIA 2BFAA 2YY7A 1LTHR 2OL4A 2PGLA 1TVEA 4J4BA 4QUKA 2IZZA 1ONOA 4RLHA 2D3TA 4PLHA 2IE0A
chains in the Genus database with same CATH superfamily
1E3LA 2A0UA 1L8LA 3E22A 4E2YA 1AKTA 2OKCA 3PNLA 5HCUA 3SDZA 4ZYTA 2VYVD 4MTLA 1P9NA 2WJIA 4JB2A 3K9NA 2JFPA 3GY0A 2GERA 3PNBA 3FY4A 3K2BA 4UXJA 4HDSA 4IO1A 1UFOA 3ZDEA 4BFZA 5E6UB 4K28A 4UHFA 3P7MA 4F5YA 1TT7A 1BVYF 1YI1A 2BI4A 2ZS8A 2W11A 2J7KA 4X7RA 3PPIA 3ULKA 3WDKA 3ZE0B 1JEJA 5BRNA 4CMBA 5BN5B 1B3BA 4BVGA 2VZEA 5JNTA 1CJKC 2AOTB 4RS3A 1JG2A 2VH2A 3PZBA 3EX7C 4YT5A 1MHPA 2VZ0A 1TZ2A 3X1MA 2GWRA 3MWDA 1TKRA 3VR5A 1DWOA 1UBCA 3VMFA 1V2GA 1TJ3A 4H17A 4EVRA 1QQTA 3FWHA 1PT8A 1ZOOA 3QPDA 2IP4A 1BDBA 1Y48E 1XZGA 1ODCA 1R15A 1FRZA 2VTBA 1N6KA 3PLNA 3MFQA 2G88A 1P4GA 1V9CA 3G9QA 1KKUA 1YULA 3T0GA 1SUFA 3MA0A 4C4RA 2N75A 3W5SA 3DYIA 1ODLA 1CSEE 2E4UA 3DAGA 1YI8A 3LDUA 3CLKA 3JQ7B 5DULA 4V38A 3ZI0A 3DO8A 3S8MA 3ZQ6A 4R1LA 2BFBA 1ZOPA 3PE6A 4Z9XA 4O2AF 3F8SA 5TPWB 1ZGAA 3KP1A 2OUIA 4ZJYA 4UNPA 4D9BA 2GR9A 4FVTA 2SBTA 3L4KA 3FZNA 3UEOA 1R0LA 3ZE7A 1QNLA 2C2ZA 4B84A 2X7HA 2Y9PB 3CCFA 4PSAA 2XNCA 3TRDA 3QVSA 4ZKDA 3CLRD 3KPUA 5IKEA 1NLZA 3WBFA 2X19A 4I6JA 4IIFA 2RHMA 3PWZA 3Q7TA 5JHHB 1R4AA 4IPTA 2JGIA 2YHBA 1TRHA 2CBZA 4EY3A 4EY5A 2A1TR 1VL8A 3LF1A 3LQ1A 3UAGA 1H4TA 3PC6A 1V47A 4A5OA 4CM4B 2P4QA 3X3HA 2I62A 4R83A 2VQEB 3KR0A 2AC2A 5I8WA 3IKTA 5CVDA 2DWUA 2XCUA 3KVRA 3RYIA 1RXWA 2CB0A 1XZBA 3WMGA 4K8OA 5DMXA 3FR8A 2Q2QA 1MXHA 3GEEA 1SXIA 1X1TA 2HCRA 3LNTA 3M2PA 2PT5A 4QOHA 2HO5A 1AK9A 2V7GA 3VU9B 4C01A 2R9VA 2HOQA 1K9SA 2GX6A 1YDWA 4MWZA 5T4EA 2IKSA 1YR3A 1J8FA 5BOSA 1QYCA 1UFRA 1TQ6A 3TLJA 3U7GA 2E87A 1KSHA 3KUCA 2VTVA 2PZBA 3LUPA 3GT3A 4MKFA 4NAUA 4WINA 2QUKA 3R74A 1EGVB 1PFQA 4M0FA 1OU4A 4R84A 3TBHA 1WMSA 1N5IA 5F4BA 1C41A 1NVKA 5HHTA 4K9MA 2BONA 3HWX1 3I52A 5ANRB 4Q3LA 4BKMA 4EB0A 4GBGA 4QOFA 4MWCA 3NEPX 4WCFB 3DEZA 4W5OA 3HBJA 2E55A 1QM5A 3G49A 4EGAA 1RYYA 2RG7A 2C20A 5DFAA 4FPXA 2JLRA 4RESA 2QWXA 1PGOA 3MVEA 3ILHA 4AX8A 2C5EA 3EMDA 1OT5A 1JJVA 5EJ5A 5GTDA 4F8EA 3CUKA 3FUVA 3PQ4A 4Q3OA 1XZDA 2V5UA 2WICA 4O5AA 2HEGA 5AVTA 1WLSA 5ITZA 3NYIA 4CMIB 5FEUA 2CF5A 2J9RA 2NZXA 2P40A 2WAYA 4OXQA 1HC7A 5KX5A 1QMGA 4MKZA 2FWJA 1TEVA 2XNHA 3G8BA 1A04A 2VZ9A 5AM0A 3V33A 2HIHA 1VL6A 1HA3A 3Q8KA 2HW8A 5LM3A 4LA4A 5K0NA 1AKMA 1FYFA 3USCS 4HADA 1P4AA 3D3EA 4I5EA 3NHYA 4POAA 3CEAA 3TGWA 4E4RA 3NO4A 2AL7A 1TF2A 2AEFA 2F4NA 4DJJA 3O82A 1QRUA 3E70C 3KLPX 1JVNA 1Z5GA 2J0UB 3K9HA 5FBHA 5KTMA 2WQ6A 5FO0A 2JFXA 4ZV7A 1YFLA 1E3WA 2B98A 5U1PA 2Y76A 4UUMA 4O4HF 3R6TA 3QX7A 4ZI7F 5DTMA 4PZUA 1XIVA 1E69A 2IS2A 1DXOA 1R5JA 4BNZA 2JJ1A 4BNDB 4OQLA 2PQ2A 4M9QA 1IEXA 2DPHA 1EQUA 2Q46A 4NG4A 2R5WA 3RS3A 1VHLA 2UYQA 3D7RA 3LLMA 3NLLA 4TOIA 1CDEA 2Z57A 4BZZA 4DW8A 3AINA 3WHLA 4BTLA 4IHJA 2PKWA 3IBGA 3OM1A 1YVPA 4JBIA 3L8YA 2DFTA 1A9OA 1QLHA 3D0OA 4MRSA 5B1HA 3KLMX 3AF0A 4FX2A 2NP6A 5U4QA 1SNYA 3FGNA 4ISBA 5FIUA 1QKKA 2FSPA 4GX1A 3TRKA 4EA9A 1CV2A 2CYAA 2J3EA 3DXXA 2D5LA 3E2IA 3Q1KA 4H18A 4TTPA 1DWQA 3L01A 3PJEA 4C0QC 3GX1A 3OZGA 1A76A 4B3SB 1Z56C 1Y8RB 3B60A 3M5CA 4JXJA 5HJ5A 3E03A 2Q5EA 5BNIA 3VGJA 4JLPA 3PIRA 1XUOA 1RMTA 2ZKIA 4J6EA 3TCNA 1HDIA 3V2HA 5IVKA 3F97A 4LYJA 5JI2E 3SHFA 3CYFA 3KNZA 3O7MA 4ZYXA 4BVAA 4ZMRA 4JLJA 5BXYA 2R5FA 1SHKA 4JC4A 5EZYF 2FP4B 1FEZA 2KWIA 3G2HA 1NVAA 3NAZA 3O3NB 3IAM6 2PS9A 1FJXA 2NN3C 1JT2A 5FUXA 3DF9A 1Q2UA 3L1UA 2C3YA 5FWNA 1LBSA 4YACA 4TZ0A 1Y1TA 4C7JA 1ZMRA 1QLJA 1I14A 2JK1A 3A1SA 1SG9A 4FFSA 3DDZX 4FWTA 3P19A 4PTZA 1C9MA 2OOKA 3HZOA 1CUWA 3IIJA 4G89A 2PJDA 4NQZA 4PZDA 1IZZA 2MTBA 2XQGA 3JZIA 3IJ5A 1PV1A 3OF3A 1T4GA 3QE2A 3IQIX 4TL7A 3SZOA 3N05A 4R2IA 1RQGA 3WSTA 2J3LA 2BR5A 3PFHA 5KQGA 5ALHA 3OWHA 3F5SA 4R01A 2XRMA 1RXIA 2PRIA 4H1VA 2D7CA 1NUQA 3VVBA 3WOVA 4DCJA 1NBIA 5INTA 4BXOA 3ZGZA 1SK8A 1S8FA 4RCZA 2Y93A 2Z1DA 3GJ5A 3FYTA 1XVLA 4GS5A 2B34A 4OSOA 3ZKWA 1H6CA 1JQJC 3C3KA 4RM3A 3RTCA 5C7YA 1KAQA 3N2KA 4N40A 1UT5A 2MINB 1HRDA 1FRFS 4CGYA 5A3QA 5C8YF 3ZDDA 1DG1G 1P3Y1 1YE5A 3HCRA 4RD3A 3KJGA 3MTGA 4KR9A 4EWLA 1L8QA 2WUFA 1BVRA 3D0KA 3MS4A 2VYFA 3EGOA 1ZONA 1LW7A 3OPXA 3FRIA 4HXYA 4LX8A 2VP9A 3DDNA 1R0XA 1TLLA 1QE3A 5J5AA 2IEDA 3ZI4A 2QD3A 4GSYA 2XRYA 4KO4S 4D9CA 5ABPA 2JFWA 4MRNA 2AJCA 4XOUA 2WIAA 1JSRA 3AUUA 1FSZA 3U4HA 4IQ8A 2AMYA 3LT1A 5U9CA 2EJBA 3MEQA 2WJ3A 4N8EA 1P33A 2WNSA 1ZEMA 5D6OA 4CKZA 4NSNA 4XJXA 1PQYA 3L7CA 5ITZB 5IWAB 3ZS8A 1DX9A 3U80A 3QG1A 3GLKA 4D8YA 1AQJA 1U7OA 2QTRA 3ABSB 1Y4UA 2ATEA 2YYZA 4HTFA 4TKUB 4ZEXA 1UIMA 5D7NA 3ZPXA 5J4LA 2JFYA 1VJ1A 4YV2A 3CR8A 1OKKD 2V7QD 3I2KA 1COWD 4NS4A 1D7AA 5HOEA 2YWJA 3EXHA 1P81A 4GRIA 1YZYA 2PX3A 3WYNA 3Q3HA 1R74A 4CL8A 2R87A 2BYTA 5H9VA 3G9XA 3ZXXA 2GA9A 1SOMA 3AM5A 5ESRA 2OZKA 3FA2A 4DR7B 3NIGB 3MBKA 1UXHA 5JWOA 3RYCB 3HM2A 3BEOA 1U65A 2A30A 2ECOA 2GNAA 1TT5B 2Z5VA 2Q1WA 1W5TA 4OYHA 4YB8A 5IM5A 3KQHA 2ZYDA 2WNIA 1ILEA 1RCUA 3NX4A 2W8BB 1PJQA 3VR4A 1Y8AA 2VPZA 4YJGA 4BX9A 4KAXA 2XUIA 5LQNA 4TRMA 3VYVA 1U2QA 5IUNC 1YQGA 3EGXA 1ZUNA 2HMVA 4CTOA 4ZZIA 4CDRA 2HY7A 1Q92A 4YMSA 4TQAA 3KSRA 3R9KA 1JSCA 3NC4A 4BKUA 1KWGA 1IN6A 4DM3A 1IN1A 4Q1FA 1ZGCA 1PEAA 3NHLA 2OAP1 5KIAA 3UB2A 4WWHA 5AVWA 2VDQB 5H3LA 1NUHA 3AEUB 3GPIA 3N2GB 1PTJA 1H42A 3TLGA 2RGYA 1T3HA 1WKVA 1SKYB 1H2XA 2W2KB 3JAWA 1RZRA 3M6WA 2HWYA 3JXEA 4X8LA 1RRMA 2VXBA 3NBQA 4FFPA 2ACEA 4Y2SA 1IQ0A 1MGPA 1ZM7A 1G8GA 5BYJA 1KIMA 2OECA 5CNIA 1FFEA 4R8KA 1APBA 2IY7A 2QXYA 5AW7A 2P4EA 3VR1A 3NEYA 4K2AA 4ER0A 3HI6A 2FEPA 3KTAA 1J0EA 3DBLB 1L5FA 1IY8A 4N01A 3LUAA 4CR8A 2GD2A 5KQSA 4QE3A 1RPNA 4GX0A 4BHTA 1AMOA 3VMMA 4XD7D 2AN9A 3U44B 4UE6A 2O5RA 1GDDA 2RAPA 4P83A 2R8OA 3FFWA 4CM9D 4E2WA 2WWHA 4L2IA 1M8FA 5I7UA 2IU3A 2XIJA 1OLUA 4NULA 3VTKA 5KREA 3EPHA 1O7JA 4ZAFA 1I0LA 1JHOA 4LOJA 4WQMA 2R6CA 3HYRA 4X95A 3SQDA 2FG7C 1BMTA 2WFAA 4IDAA 3JATA 4JASB 3QRWA 2CLMB 2NO9A 3EY4A 4K9KA 4IICA 1Z6TA 4NVRA 5H83A 1XJCA 5B58C 1SKBA 3MD9A 2FN4A 4B4WA 1S4QA 3FSEA 2CVPA 1A27A 2FQYA 3K9WA 3SHQA 3OKPA 2DKFA 2RIPA 3FTQA 1FFCA 2PIDA 5LP6C 1XYVA 5JCPA 1XHLA 2Y1CA 2YXEA 3H9EO 2G76A 5HCIA 2R68A 1XKQA 2GM4A 1KKLA 4U0KA 4NE9A 1BMDA 1A9SA 3M6VA 1U6JA 3FYUB 1R4MA 3AVPA 4L73A 5AMXA 1WU7A 1K4KA 1E1QA 3BWMA 4GC5A 4PYQA 3FSGA 1ZD8A 3O3MB 4L15A 521PA 4AP6A 3ESXA 1E7QA 3I37X 1CQJB 3M9LA 2BCGY 5L7WA 4EBFA 1C4WA 4BWFB 1SVMA 3LU1A 3DGEC 1O8CA 2ORVA 2R8XA 3LLSA 5J4YA 1XD2B 1Z29A 3PCRB 2IQ5A 2Q99A 4YP9A 2NUPB 2I8LA 2F2TA 3FNEA 3PXAA 4IP0A 5KKAA 1U9ZA 4QLBA 4UTRA 2VP5A 1C1YA 2I1QA 3IA7A 1YJBA 4KH1A 5E7QA 1RAHA 5EUCA 1JECA 1XRPA 2G5GX 1HDYA 3FVVA 3OF5A 5ILGA 4C7BA 5CDUA 1ULHA 2WPDA 5HBRA 2Z4SA 2X6RA 1E1QD 3EEYA 4US1R 2PMBA 2RC5A 1KGDA 3WGQA 4KX5A 2FMXA 1RDFA 2PZEA 5DISB 8ABPA 1HBJA 2VJOA 3AFIA 2OVFA 2OAQ1 5LU8A 3VC3A 2NPOA 1Y5MA 4L0MA 5EAIA 3PXDA 4K8RB 4A1OA 1ZOIA 4YYEA 4N47A 4G0ZA 5EA2A 1TKAA 3E9QA 4FKZA 1XFDA 3GJYA 4IOJA 3C7AA 4YDSA 1O94C 1K7CA 4JN6B 4Q00A 4CUZA 2V6GA 4C3UA 1VKRA 1PI3A 2VSNA 4Q3DA 3VSCA 2YJ3A 5EJEA 1C8VB 1U5BA 1VE3A 3A58B 1J97A 3A7EA 3FAZA 3VR6D 3ASZA 3GRFA 3QLUC 4HDOB 3ZYCA 1Q7CA 1HDGO 1NIPA 1E2BA 4YFVA 2CL6X 4HAWA 5HTKA 2HQBA 3W6PA 1Y3DE 2FEKA 3DMRA 2DSTA 1HORA 3UOAB 4AU1A 4PC1A 5BPHA 4DCGA 2FKNA 2IIQA 1G42A 3L6DA 5JVDF 4GMXA 4Q4HB 2SCUA 3ZLBA 5KOJA 1ZXLA 4NHOA 6ABPA 2GCEA 3A70A 2HBZA 4TRRA 5DIFA 4JLNA 4KYTA 3UCXA 4Y9RA 3RGWS 1CDOA 3X1XA 4JOCA 4RTKA 4HQ0A 1TJNA 4N82A 4DVGA 4E21A 1RI2A 2OV3A 2XDQB 3S3TA 1USWA 2B8NA 3FDXA 2P5SA 3AHCA 4CT5A 2RE8A 1ULSA 3HEBA 1U8AA 2JZNA 2VDPB 4I1SA 5HUQA 3G9UA 1UMDA 2A1UB 2QM7A 1S2MA 6NULA 2GFQA 2NAPA 2IQIA 1O6BA 4NZPA 4X1KA 2JGFA 4A26A 1PN3A 4G9EA 4IVPA 1Q7BA 5FAKA 4TQGA 2Y0BA 5AOVA 4TS3A 5C4GB 4RSHA 2GT1A 3KB1A 2Z2IA 1QTIA 3EIUA 4AY2A 3TTVA 3OJXA 4ZWNA 2NU9B 4B74A 4LOLA 1IXZA 1OX5A 1L7BA 4W5RA 1EUCB 4U3JB 4RHEA 2CXUA 2H1LA 3V7NA 3B7WA 2I6SA 2O5VA 3EQ6A 5GPBA 3NKVA 1DPGA 5LL6P 4JI2B 2R65A 4MQLA 4D42A 3HB0A 2PVPA 3MGAA 4YJ3B 1ABEA 4MUYA 3WB9A 4E09A 1U4NA 3HY6A 3QH4A 2ZIUB 1VP3A 5JADA 1W1WA 4YAKA 1G41A 2C2OA 4C4YA 2WVAA 3DOJA 5JXIA 5C18A 4RD4A 1MQ8B 2ADMA 2ZJOA 3H8SA 5D85A 4ARSA 2XWBF 5HW0A 1HNNA 1PQ4A 4FM9A 4JX9A 4L0QA 1FFSA 3KVOA 2XQIA 1CUDA 3GQBB 3QVLA 5FYQA 3SXUB 3EZNA 4PYRA 4A6EA 5DHSA 4GC9A 2PCLA 2UUPA 1EWRA 4QOSA 4QQKA 4ESHA 2DUMA 1W1UA 1FW8A 3OFVA 2G25A 3THXB 2A5JA 1L7QA 3MWLA 4AJIA 4D9KA 2V3CC 2H08A 2H4ZA 4C0KA 4O4JF 2R11A 5FOWA 2IYWA 4KIWA 1CUCA 6YASA 3L04A 4WFKA 5C3UA 2C94A 4FK8A 4ESVA 4DADA 4BLWA 5DBIA 1MO3A 1SKMA 2BR3A 3K53A 4IIBA 3PB3A 2IDKA 1JG7A 1L4NA 2C9YA 1CHNA 1N0VC 1ZR4A 2R00A 2WYVA 3EJ6A 4X5OA 4IDQA 5JE8A 4MPPA 1LGYA 3DYVA 3D8BA 5IDVA 2XWJI 2QM3A 4W5TA 3MLEA 1SHLA 2BEVA 1U4OA 3N8GA 4S1PA 4Y2VA 3UGQA 3UHOA 1JWAB 5FWYA 5A5GA 4DMGA 2AG6A 1M2GA 3HO8A 2AA3A 2A3RA 5CH5A 1GA4A 5LWHA 3HXLA 5CURA 2F8TA 2C42A 3OU2A 2ZIXB 1L4FA 2N42A 4HX2A 5AOAA 1M34A 3IHKA 2VJDA 3TZBA 4F4IA 2CNDA 1CS0A 4MHSA 1CG6A 1XELA 1F48A 4RGYA 2ZYTX 4MQ4A 1BFUA 4KPUB 1VI5A 3RYFB 5JPDA 2H8KA 2OT3B 1N92A 1GPMA 2P9YA 3EEBA 3RVQA 3DOCA 3VR3A 3SHOA 2IH4A 4PLYA 4AZ3B 2JKVA 1THGA 1VMDA 3QYFA 4UDNA 5DV9A 3I5YA 4OG2A 3IBYA 5KWEA 4OX9B 1NI3A 2YVUA 1H9BA 4DNQA 4JI4B 1KI3A 3CT4A 1THTA 4DEYA 3T94A 4BCBA 3BULA 1PKXA 5EJIA 4C0LA 1T1RA 1ZH4A 3F90A 1JR3A 3GFBA 3HCEA 5IUKC 4RC9A 4AKEA 1M1YB 1TC2A 2Z04A 4PSCA 2QMEA 3QOXA 1Z07A 4U8HA 3T99A 1QS0A 1BVUA 2PBRA 4PHGA 3LX4A 5LP6B 5HUJA 4F2WA 2Y2VA 4COKA 5J2TF 3SYNA 2VDMB 4MA5A 5JAZA 3HU3A 1E2EA 4NRDA 1F8XA 2V54A 1INLA 4R98A 3ZVNA 4CKEB 4NV3A 1BJTA 1WMEA 2HSWA 3AF2A 4PY2A 1RIIA 2EERA 5JAUA 4DJDC 4DANA 4DGSA 2GPSA 3WIEA 1AN9A 1WJGA 2IXFA 3DOUA 1CY1A 4JUAA 4Y67A 5E8RA 3V4VB 4NCAA 1F1BA 3D3JA 1E9AA 1GZDA 4ZV9A 1KFJB 4XIGS 1O2DA 2XNDA 4HFNA 3PR2B 3D81A 5B3AA 5JARA 1KL7A 2WQ7A 2BZGA 2YNMD 5FI3A 3QOYA 1G2OA 4A4DA 3P26A 2XYHA 1BMFD 2IZ0A 3HLYA 3ZGVA 3G0HA 1EU1A 3SJCA 2MHCA 3QVGA 2H00A 5F77A 1R10A 1G5HA 2JVJA 2GVDC 3G5UA 4B85A 3OP4A 1CZRA 4GMHA 1H23A 2X0IA 4L50A 5K0LA 1S7GA 1EVQA 3KQKA 4FDAA 3PQ3A 1N5LA 3ZGXA 1IZ8A 3OMXA 4FFLA 4PCUA 3N6RA 1I8TA 3E15A 2GBLC 3EARA 2ZXEA 3OAAD 1VBKA 4NH0A 3ONVA 2QVYX 1D1TA 3B2NA 4YJ2F 3VYTB 2C1XA 1FP7A 2WU3A 2BBOA 2ZWMA 5BSTA 4HX5A 4F2HA 1OCEA 5I3CA 4BGEA 2X5JO 5HZMA 3QKSA 1L1QA 5KTPA 4QSHA 5FUBA 1W47A 5A0FA 2Q4BA 3DMTC 4P3XA 5HF5A 2IUTA 1KEKA 1RRVA 1SB8A 1OXUA 1TGYA 1NMSA 2AFIE 3OH8A 4OHYA 5IH3A 2IXTA 4HLUC 3NHKA 5AVJA 2I6XA 4ZDJA 4LV5B 4O4IA 4O08A 3EWAA 4BNNA 4C76A 5IUJC 3LZCA 4PX3A 4CMEA 4G0XA 5FTLA 1XNQB 1QHXA 4WW0A 5SICE 5M3BA 2AIRA 3AIOA 2PX4A 4IQ0A 3JQ6A 5A2QA 2I9KA 4TYWA 4JBNA 4JUIA 4CG0A 2YKGA 3AEQB 1GP2A 2C5FA 1Z74A 3IQXA 3YASA 1PD1A 2YIDA 3CNLA 1XMJA 1RADA 3L8EA 1MD9A 3UG7A 2PGNA 1W581 2IYXA 1BSVA 4IDNA 1Q0UA 1TJ5A 1FXSA 1F2VA 1BE0A 5JZBA 2VYNA 1U8YA 3E1KA 2FPIA 3K0BA 1JYEA 1DKPA 3IEXA 4XDGA 2JG3A 2WZBA 4CM5A 1SA0B 3ISTA 3KOWA 1LJ8A 2ZE7A 3LS2A 1VJDA 3QXXA 3G9TA 5ALNA 2OHJA 1YFKA 1NVTA 1SOAA 4AO7A 5BWBA 4EBBA 2DLCX 2GNPA 3LYUA 1EX6A 4HDQB 4U6QA 1IOWA 3OPMA 1UPAA 3R09A 1JSZA 3LY9A 2HK9A 4CHGA 1XTTA 3CWCA 4R0MA 1KVSA 2RJNA 3LUGA 5B7GA 2XYRA 4MUHA 5A5VA 1UJBA 3AVVA 1DIHA 3QNMA 3ZLUA 3VFDA 4X3PA 4B8WA 4TTQA 2II6A 3U4AA 4AMBA 1ABBA 1Q3HA 3QHQA 4G5YA 1X8XA 2BKEA 4HAXA 2P5YA 5F5NA 1BYIA 1GNTA 1SUSA 4NESA 4RPIA 2OLJA 3CNQS 3V4OA 4IUCS 5HRAA 2H4YA 5BUZA 1OXSC 2YXLA 1GVNB 4KBGA 1LQ2A 3Q7PA 4KQHA 4KODA 3HSSA 4UU8A 1VMKA 1YCFA 2O3RA 3LFTA 4AN4A 4P35A 3IJPA 3J81k 3ESAA 1X7GA 3B20A 5CFLA 1G3IA 2BFEA 2VP3A 1F6WA 3F2VA 4PAMA 2XB9A 3T9FA 1HEYA 3IUYA 5JVDA 4LGCA 1F14A 3F74A 1YJXA 1EXWA 4JP5A 4RMIA 3EN0A 3BMXA 3IUSA 1GPBA 3S55A 1E6KA 5CLLA 2OLKA 3AVWA 1FX1A 3L7LA 3NETA 2V6JA 2L0XA 3IGFA 3TRIA 5BV2P 3JQGA 1U8XX 5HXAA 1DEAA 4EW3A 4JT8A 3H6KA 3F9RA 1DJMA 3N0WA 1B15A 1T1SA 2J3JA 2QNIA 2BZ1A 4LOKA 4I3GA 3RVBA 3Q15C 4OVKA 2CUZA 3PRYA 5G0SA 4ALNA 1U0RA 1EZ1A 1N2SA 4D98A 4ABTA 4M9UA 3VHXA 1UC5B 9LDBA 3IA2A 4URFA 4XB2A 4UHDA 1W4AA 4J7AA 5EOVA 2OKGA 3CLTC 3RIEA 3E7WA 4Y1RA 1XDGA 2ZM5A 1DL5A 3FOAA 1DO8A 3OOWA 4ZO8A 1KE2A 4C3OB 2BFCA 3NWBA 2WYIA 2OCAA 1AS0A 4OHZA 3T6KA 2HMWA 1F2TA 2I80A 3R3WA 3IAEA 1BQEA 2AN4A 2OQIA 1IM8A 2J41A 3PTLA 2YXNA 1ZIPA 3FXAA 4KXLA 5IBPA 2J0EA 4J07A 4EVIA 2R85A 2R6AA 4WOPA 3AY3A 4PGAA 3DVAA 5A4KA 4QODA 1RE1A 2R00C 1SVNA 1QK5A 3OO0A 3I64A 5IT4A 5LU9A 2W48A 1KR2A 3IFSA 5ALWA 2QRJA 4IQFA 4BNWA 4D9MA 1YDGA 3QVGB 4ER3A 5A3SA 2J3IA 1XRMA 3ZK7A 1MX5A 4LJRA 3ETCA 1XZQA 2H7YA 1IHDA 1SWWA 3FGPA 1NN0A 3OQIA 4UOZA 1WXHA 3BH6A 3BD8A 3ZD6A 4Y1GA 1UBGA 3VBCA 1X80B 2AUNA 2XJ9A 1PLJA 5GONF 4UMFA 3VNAA 5JATA 3C15C 5SY9A 2XMBA 3K8OE 4B35A 1WPQA 5FPHA 2ES4A 2IW1A 4QFBA 1JDBB 2BP7B 2VK8A 2AF4C 3NAMA 1HE3A 1HMYA 2AK3A 3AY6A 1LC0A 4WBNA 4CLEA 5GV7A 2P9GA 3PENA 2QRZA 3L4SO 4MI9A 2L69A 4ZQGA 3EPLA 4RPHA 1DRUA 4EUSA 4BN5A 4NPAA 4FGWA 5FUVA 2Y1DA 4MPRA 5ESXA 5AI8A 4DFDA 3T38A 1CEXA 2W7TA 2BEWA 2FQ1A 3R3ZA 1XHFA 1QV6A 3AIMA 2D1YA 3C85A 2H2IA 5EHQA 2QLNA 3BUSA 4G1FA 4JBWA 2Q6OA 3OJOA 1EFPA 1ZGBA 3RJTA 5J43A 4Z0HO 5J5VA 1CP2A 2GS9A 3IEMA 4XGRA 1E9EA 5A7GA 5CD9A 1LEHA 3FPKA 3R7WA 1DMRA 1HLFA 2VQ6A 1CB0A 4GH5A 3WP0A 2R6HA 4HBZA 5B5SA 1Z2EA 4D46A 3I09A 4M1YA 1D6SA 1M75A 4JELA 1JKIA 1K9VF 5J1TB 3UWDA 1YKFA 2LBPA 1SXJD 3HA2A 3LQYA 1W36C 4YS6A 5GIOE 4BLQA 1MJHA 4WNAB 2HQOA 3AWDA 4K03A 4XKJA 1HO3A 1YA4A 5JPIA 4J7UA 2OCKA 4D4LA 1EVZA 1KZ6A 1Q1QA 2C2HA 2C9CA 4Q3CA 5L3RA 5JMOA 1XVTA 1DAEA 1V45E 3NVDA 4CQNA 1WXQA 1G5TA 3HXMA 3W2GA 1DZIA 1P61B 3PXEA 3EZ6A 1N3IA 4G0MA 4TTAA 2IXGA 1SOVA 3LVQE 2BEVB 2WU4A 3ZZTA 5BMVB 3HFRA 5K5EA 3KXPA 2C82A 2QN8A 2BMWA 4LY0A 3HABA 3KOXA 4E70A 2LR0A 2I2XB 4HLDA 3W9BA 1SRRA 1WU8A 2CFRA 4X90A 3WLKX 5BN5A 4WZAB 4AG6A 2X41A 2PZJA 1N2OA 2XV1A 2EC5A 4AQDA 3LPLA 1DIBA 1V39A 4YRQA 4XDHA 4B48A 4B3GA 3QITA 3I8SA 5AUNB 1NN5A 3IR7A 1VI2A 3D8TA 4G0NA 1GCIA 4KRYA 3H19A 3TL3A 1FUUA 3IVXA 4F46A 4YASA 4Y1FA 5KOHA 4WJKB 4OBBA 5FNVA 1QYVA 1GQ2A 4BMPB 5AJXA 1RW4A 5GM2A 4QWWA 3WYFA 4HH0A 2EFHB 3UCFA 1Z7EA 4O8ZA 5C46F 2I29A 3IEKA 2TMGA 2FP4A 3V1TC 3MRTA 4FMCF 4DEVA 1GZ5A 1X86B 5LXTB 1GR1A 3KQQA 5LQAA 5K2OA 1BQ4A 5AI0A 5DSZA 1K5GA 5BURA 3Q7RA 1A8QA 1HOTA 4HDMB 2I2FA 4BMSA 2W8ZA 4F93B 4BRUA 2WLTA 4QASA 2Y0DA 3H0CA 5TF4A 4ESOA 3AB7A 4EY7A 1ZL2A 5I3ZA 2FMFA 2PUFA 4KI7A 2VJKA 5CX1A 4IIJB 2V3WA 4FJ0A 2PKQP 3BFKA 1NBMA 3IALA 1Z28A 2W2XA 4GPZA 3HQ4O 4XIYA 4JKOA 2CE2X 3B6KA 4F4UA 1N2EA 3BTOA 3M4YA 3SNKA 5JRJA 3AF6A 4QTUB 2B1QA 5CLHA 1R8XA 3PX3A 5DBGA 1WL8A 3BJIC 4LCJA 2WIDA 4RK4A 3VX3A 4C08A 1XA4A 5AHOA 2GTIA 1DQSA 4E31A 4OP2A 1Q7RA 3OE4A 1NR1A 3PXXA 2EV9A 1EMDA 1QGDA 1T3GA 2JGDA 3IIKA 3Q40A 4R3UC 1VLHA 3UMBA 3ET4A 1JEYB 2VOJA 1E60A 2ZUEA 2AHRA 3EUAA 1US8B 2Z8ZA 4IS2A 4N7JA 1GTZA 4Y2GA 2WD9A 4RNCA 1Y42X 1LSSA 3RC8A 4MMZB 4IJVA 4CCSA 1R6DA 4RD2A 5IKMA 1EIWA 2G77B 2WJZB 2ZRPA 3IMGA 1LWOA 3S2ZA 4DSOA 5JBNA 5CCXA 2ID9A 2WTUA 1R16A 3PXBA 2A94A 3HB7A 3MRSA 4RH1A 3A6EA 4Q4JB 4YRDA 1KEEA 1V1JA 3U7QA 1TYBE 4UHEA 3LBYA 3NRBA 4AMVA 1EZZA 1DFHA 2C95A 1ZLYA 3C5HA 3QY0A 5IKPA 1X7WB 1ZVQA 3E3NA 5EQTA 3AG6A 1W5EA 1A1SA 2NO0A 1G0NA 4AW9A 2ZRDA 4J6FA 2R751 4CNQA 1LNQA 3M3DA 4LF5B 1SBCA 1MVLA 2Z08A 3JD1A 2QP3A 3DE3X 1Z6PA 3PK0A 1OTXA 3PQ8A 3WTBA 2CXQA 1GG9A 5E4YA 3R2JA 3QFSA 1DRKA 3QUQA 4FW8A 4CMAA 1H8HA 3L92A 1KJZA 4JCOA 4LQDA 4TV8F 1L4LA 2I2CA 2CMFA 3G68A 5FI1B 3ZCPA 4ZI7B 1M6VA 1N2CE 1ZCFA 2F9FA 4QRHA 3TIVA 3L8DA 4OI2A 3EGDB 1G8AA 4W7HA 1QVRA 1T2NA 2J4CA 4RJIA 1FS6A 1MX9A 1EFVB 4YLEA 2GCOB 3USES 2H1VA 2PMKA 2HHAA 2JDIA 4ZP1A 2RHOA 2WJVA 8ADHA 5KYGA 1JDNA 1YDHA 3EOBI 2POQX 3ZHQA 2JS7A 4PHTA 4O5OA 4MVJD 1RXYA 5C37A 4MYSA 1T6ZA 3CN9A 1D2HA 4H3HB 4DWJA 1M2WA 1I4OA 1QG6A 2KLBA 2OZEA 3QWHA 4XUGB 4EF4A 3QSYA 1ZI9A 2EKQA 4DG5A 4QXQA 3BXZA 4M1OA 2G9NA 2ZWVA 1NF8A 4RFSB 1N2ZA 3HN7A 1RQ2A 3ZE1B 4LNAA 1XD2A 3AKDA 5JD3A 4UU7A 2FN8A 2ZLBA 1GZHB 4YJDA 1FBTA 2R6FA 2X22A 3ACBA 1C0EA 4IV8A 2UVQA 4TM7A 3WMXA 2QNBA 2X1HA 3WLOA 4HP8A 4BO4A 3LNCA 3KYCB 4GGPA 3P1JA 1JI0A 2ALJA 3AVOA 2PXHA 3AY0A 5ERYA 2CVOA 4FEAA 1MB4A 3CJQA 1VPDA 2WK1A 3LOPA 1T3LA 4QYIB 5I7EA 3M83A 1UZUA 1F9EA 1F3OA 1VYTA 3I0ZA 4TWAA 2ZRFA 3EUFA 5FUQA 2R6ZA 3RS9A 1NU6A 1QV7A 4XGIA 4XVQA 5FBLB 3ADBA 3NTLA 2B94A 1BWRA 2RH4A 5LPNA 3U6BA 1FYDA 1JIJA 2ZIAA 1A7UA 4QOGA 4KREA 3ME5A 2EFDB 1JDJA 4JWTA 1GPH1 1T2EA 4FD2A 3MT9A 3CEMA 4PBTA 4EAAA 2Y2UA 2QMZA 2F64A 3AP1A 2FLVA 1EFRA 1U8TA 4RPJA 5FOXA 3RQIA 3VZCA 3HU2A 4CIWA 1DTEA 4FR2A 4Y9UA 3OE5A 1IRIA 4ZT6A 4J2OA 3T5PA 1ISGA 1K8ZB 3OT5A 2HRBA 3TXYA 2QIPA 2OXTA 3A25A 1KNQA 2ODQA 3JSAA 1M3SA 1WDKA 1YU6A 5FBRB 1EX7A 1HL3A 2WD7B 3ZWVA 3LG2A 3ZVLA 3DA8A 2GRAA 1JEDA 4V2IA 4CV2A 2OFOA 4A8TA 1KH2A 3A27A 3DFMA 2DPYA 4XE5A 3V2GA 2CNNA 5HRUA 4K9NA 4YAUA 4NWIA 2I4RA 3A6KA 4TV9F 2YR0A 4F06A 1VL0A 3OEWA 2C88A 1P2TA 3NYQA 2QF7A 1AKUA 2I2DA 4M1WA 4NU5A 4RVFA 2O2YA 3G7NA 2YV3A 1FDSA 4V0MA 3EWIA 5DNWA 3OZDA 4ARBA 4EZIA 2CLLB 1GGEA 5G4KA 4A7PA 5IN5A 4PSUA 3B48A 5EUQB 4LPKA 3NB0A 1TM2A 1RS0A 3LT0A 3TNYA 3GAAA 4LYYA 2PPVA 4DPKA 5H16A 5MHTA 1UBSB 1LPPA 2HDHA 2R2AA 3QVTA 4LVNA 5BQPA 1GYQA 4BKOA 4EG8A 4Z3KA 1M0EA 1CJTC 1D4OA 3G8AA 1NXTA 1U1FA 3QUTA 4NJOA 5L3SB 1FDVA 2OO7A 3C1OA 3DZJA 1KRWA 2RGWA 4NHEA 5F12A 4YI5A 3OVMA 1W59A 3ZVRA 4EELA 4H7JA 2ZROA 1U4SA 4W7SA 3RB8A 1BE6A 2XUAA 1XCGB 3HR8A 4MQBA 3OT1A 3ROFA 2LVBA 4K3VA 3RC3A 2V7UA 3TKAA 3ZXUB 4B5KA 1EDBA 4RZUA 4E15A 1QG4A 2FZGA 2FFAA 3ZNQA 2QGZA 3E3LA 3HMKA 3AEZA 1C9KA 3I2IA 2GYUA 4J4TA 5F5LA 2I91A 2O8DB 1M34B 3CA8A 4MB0A 1RRGA 1XC7A 2VRCA 4B3TB 4FFMA 4C3VA 3F2IA 4X00A 2BEUB 3IUEA 3WLJA 2X5NA 1U3VA 4CODB 4C6HA 1L8OA 2B5VA 2O2XA 1ORDA 4H1TA 3HRHA 1QK3A 3LTEA 2Z09A 2JL1A 4NKRA 1IEWA 2FZVA 3MCTA 1DARA 4O1IA 4S1NA 4HTFB 1UAAA 5MFZA 3EXHB 1JI3A 5BN3B 2V7XA 2OYSA 1L7XA 2GCPA 3GVXA 1Y0BA 3ODGA 3WHKA 1QRAA 5EIEA 4AJKA 5KC9A 5JZMA 1U2SA 3C3JA 1RM5A 2J0SA 5EJFA 3WLFA 3X1YA 2DFVA 4AS3A 2DBRA 2OK8A 3TVDA 3EXAA 2ISSD 4XD7A 1YF3A 5F4ZA 1IBLB 2FOLA 1V11B 4ZCLA 3TE6A 1Y9JA 4O0MA 1JMVA 2W9XA 2O50A 2XB6A 3KYDB 4I2VA 4DC0A 1E58A 1GKYA 1Z82A 2W6CX 5LKAA 4J1QA 4I1IA 1EP3B 4MR8A 3V2UA 4DSTA 2VTDA 1XGKA 4BS9A 2F55A 2QYHA 4X1OA 3EBLA 5EMKA 4BVLA 3FPLA 1SHUX 2P3OA 2BCEA 5T8KC 4NOKA 1KP9A 1FTGA 1MC5A 3F6BX 3W5BA 3ND5A 5K3OA 4LW8A 5AVUA 1HE1C 4ZOEA 4DT1B 1TNDA 3R4VA 2X9LA 1D04A 2HREA 3OTGA 4C89A 4HYYA 1AS3A 1GNLA 5KU1A 3FHLA 4P7FA 1PG2A 2GZMA 2HSZA 2QVGA 1MR3F 1VE1A 4L76A 4RTNA 1YL6A 5GVSA 3KZNA 2R8BA 1N3YA 4I50F 4JA0A 3NNDA 2I55A 3I92A 4PTLA 3WWOA 4GQBA 4Q7JB 4O4LF 5AW1A 2W42A 4CMCA 5CRIA 1PWEA 1AQNA 4FI3C 4PRKA 3RIMA 3B1VA 4BQRA 4DLSA 5AXDA 4DTIA 2WP0A 1DCKA 1CF2O 3OO1A 2ZYUX 1ZOSA 1MO2A 3ZZNA 1MAWA 2FEAA 2EFCB 1B1AA 1NOJA 2A33A 1RQRA 1BGVA 1CHDA 5LBUA 3JRXA 1WZNA 4YMWA 2CYBA 4CM9A 3BB1A 3EQ9A 4HUJA 4HH3C 5DOZA 3GUYA 4GXTA 1PZXA 4F56A 2PV0A 4D74A 4HXGA 5BPFA 4MWEA 4OSPA 4MO9A 1RLTA 1V8PA 3NJ8A 4IJWA 5LQCA 2HGZA 4PX9A 4U2FA 1WHTB 2WRZA 4RJLA 5DNUA 3SVLA 2O8BA 2RGXA 3E8XA 4PZZA 1KJQA 4PYIA 1ZI6A 2FR8C 1TB4A 2VPXA 3LHSA 3KALA 4P31A 2OPHA 4PVDA 1G3QA 2JLXA 4IOKA 3S2GA 3HVUA 1DOAA 4DAEA 3ZVMA 5JWHA 3R7AA 1JH8A 2Y1KA 3QA3E 1SZCA 3ZWYA 5KS2A 1QUEA 4INJA 1N0HA 4C2UA 1DAFA 2OHGA 1GQRA 1ADGA 5JSUA 3A4TA 2DCMA 2Z2YA 3BWDD 4MSUA 2ABWA 2C03A 3PGLA 3QU5A 5IMSA 1L0BA 1SU7A 2JIMA 2J3QA 1T9AA 4I1VA 3QTBA 3GV0A 1FP6A 1KH3A 3EIHA 4YMIA 3U31A 3IL2A 5JASA 4F4HA 2JVIA 3II6X 1IPEA 1L3BA 1U1DA 2VYQA 3UJAA 4JOQA 1UJ6A 4X3OA 3T3MB 3W1VA 1IWBB 3ETNA 2G8NA 5JS8A 4AS1A 2W58A 1MPTA 5DPMA 5M04A 3CUVA 4JLVA 4L16A 5IW8A 4PAOA 1JEAA 4N5HX 3TH5A 2ZYWX 4LJAA 1H6BA 4KMRA 1RPTA 1BZYA 1W9MA 3STUA 1KYWA 3F7OA 1KEEB 2J9ZB 3B9QA 3KO8A 4N03A 4O4JB 5DW3A 3PNKA 3CBQA 5FYDA 3TZKA 1F6DA 3A31A 4GI1A 5LB4A 3X1DA 3H04A 1S89A 4P81A 3USZA 3G1TA 4V1CI 2MYNA