2X8LA

Plasmodium falciparum lactate dehydrogenase apo structure
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
320
structure length
311
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE
publication title The Apo Crystal Structure of Plasmodium Falciparum Lactate Dehydrogenase
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 117
structure length 311
sequence length 320
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x8lA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2x8lA02
4MVJM 1QYWA 2YDXA 1R16A 1N8KA 1L7DA 1QLJA 1F06A 1XCBA 4PG4A 5GY7A 2NU8A 4BV8A 1ZK4A 2B5WA 2HO5A 1YJ8A 1YDEA 1WZIA 1YBVA 2F00A 3QWAA 1A71A 1V35A 1GUYA 1U5CA 2BD0A 4I5EA 1QR6A 2GR9A 3BHIA 4I9NA 4O59O 4D3DA 2W98A 4EUFA 2H5LA 1PL8A 2HMWA 4PZEA 3ZWCA 2IXAA 1JKIA 4X54A 2JD0A 3ICCA 1Q2XA 1GCUA 1LXCA 3PYXA 3PTZA 1MFZA 3NKLA 1GPDG 3F5QA 1NQTA 4FDAA 4IDDA 2JD2A 4JP2A 5DF1A 3GHHA 2Q99A 3M6IA 4HBGA 3RAJA 3RUDA 5IZ4A 5BQFA 4GX0A 2O50A 3DBRA 4EEXA 2PH3A 3GFBA 4WLUA 3HFSA 3L77A 3PXXA 4F6LA 3E9NA 4OAQA 2OUIA 3A14A 3F4BA 3JD3A 4RVFA 5DN9A 3TFQA 3U4DA 1FDUA 2IZ1A 4DBVO 4YT5A 3P5SA 4RQUA 4B7CA 3JQ7B 2I67A 2BKAA 1UDBA 4NMHA 1U9JA 4IPTA 1KY5A 4ZICA 4Z9YA 1PZEA 3VC7A 1X15A 2CD9A 1T1SA 1GYRA 4YAJA 3AI1A 1GY8A 3WGZA 1R0SA 4TZKA 1UXJA 1ZH8A 1PU2A 4AJEA 2O3QA 4I9HA 3V8BA 4CLRA 1I5RA 3GRPA 4JK3A 1D3AA 4MIEA 3TDKA 4BNTA 4GVXA 3RBVA 1X14A 2Y0DA 4UVIA 4CMKA 5CEFA 2BFAA 4GL4A 3AFMA 4CLXA 3N58A 4FD3A 1V3TA 5TJ9A 5C37A 2O7QA 3I4FA 5T57A 3PYLA 5IG2A 3IIEA 2VZ0A 2AXQA 3AY3A 4JN6B 1OC2A 2B35A 1NAIA 4LVUA 5J23A 2VUTA 5A9SB 2GN9A 2GO1A 3KOUA 3RI3A 2CSUA 4JBGA 3DL2A 5L7YA 4XYLA 4Q39A 3X2FA 1NVTA 2B5VA 4FSHA 5ILGA 4JLWA 4IBOA 1CEQA 3AI3A 1BRMA 2CFCA 5TSDA 5BSFA 4WNCA 2VNAA 3ASUA 3JD1A 2QZZA 1PTJA 3B1FA 3GGOA 2EW8A 1HDCA 3NEPX 4RVHA 5TJHA 3IJPA 2GPTA 3PLNA 4J0EA 5F5LA 1NP3A 1GAEO 4Z3KA 8LDHA 5JAIA 3KSUA 1IPFA 3DZBA 2GD1O 3FTNA 3WQSB 4CLOA 3IUSA 2HLPA 4WASA 1JLLA 4IMPA 1GEEA 3D7LA 1C14A 5JBIA 2FR1A 1UAGA 3MJSA 4GWGA 3TF5A 2QYSA 4Z9FA 1YQGA 1OAAA 4XDZA 1ZK1A 3IP1A 1ISMA 1XU7A 3DBHB 4CM9A 3D64A 3OQ1A 2RBEA 3C1TA 4KUHA 2Q50A 1LRKA 5BSEA 3GPDG 4PLZA 3DONA 1U1IA 3FI9A 5DNAA 5TF4A 3W8FA 5L7WA 1D4FA 3E18A 3MWEB 4YR9A 5FI5A 1E7SA 3RC7A 4RPJA 4NNJA 1NVGA 4RV9A 5C7IO 4YVFA 4UEOA 2ZB8A 1T2FA 4JJFA 3DBLB 4UUNA 1QXSA 3ZHBA 2GN4A 2QQ5A 1N1EA 2YHIA 4QQRA 1UXGA 4DXHA 1BVRA 1I24A 4GKVA 1LX6A 5KJ1A 1JAXA 3C7AA 2GERA 4UVGA 2NSDA 1LDEA 1GZ4A 3DWFA 3WQRA 3WNVA 3AOGA 3I9LA 3UAGA 3O26A 2IDZA 1O89A 2Q3EA 2YQ4A 2VYNA 1M75A 2YQ5A 3I52A 2EJWA 4BO2A 4AJHA 5JC1A 3WGQA 1IY8A 3AUUA 4NJOA 3U49A 1ZEMA 1XIVA 5FFFA 4BGIA 4HNHA 4DPMA 3VZRA 1KS9A 1EVIA 4AJPA 5I7SA 1T4DA 1Y81A 3RCBA 3RIHA 4XIYA 1RM3A 2DAPA 5G0WA 2XF8A 3DZGA 1T2DA 4ZQFA 1K3TA 5HM8A 3L0DA 3JQ6A 4PLCA 2O23A 4HV4A 1MGOA 4DIFA 4OIMA 1M76A 2Y05A 3ENNA 4BNYA 2W4QA 4BNMA 3U4IA 5B1YA 4EI2A 2A4KA 4HP8A 4IQ8A 2YFHA 4P4GA 2BGKA 2D5AA 4LW8A 1PJ3A 4WOKA 4HFRA 5C7LO 1EQ2A 2FPGA 3INRA 1M6HA 1PJQA 3TQHA 4W82A 3VPHA 4PLTA 3KTDA 3DTTA 5G4KA 3HDQA 3P19A 3LT0A 1P1FA 1RYDA 2DVMA 4BO0A 4XZ3A 2GZ1A 1C1DB 4OQYA 2ZTLA 5JC8A 3KYCA 1EK6A 1H6AA 1UJMA 1VI2A 2X0RA 3FSRA 4B79A 2BHLA 3JQFC 3EW7A 2IYPA 1J49A 1PGJA 3ZNPA 4IGFA 5JDIC 4YYZA 3PWKA 2NTVA 1R15A 4U5QA 4NQZA 3TJRA 4YRBA 5ITVA 3W4KA 4MVJI 3VKVA 4S3MA 3QJ5A 3VVCA 2RH8A 5IF3A 3VTFA 1ZSYA 4Y6PA 1HYGA 1GQ2A 4BNUA 2D4AA 2WMDA 3FBGA 4CV1A 1B0AA 1SB8A 3ZWYA 4BMNA 3CMMA 3BHJA 2C0CA 4EBFA 2XXJA 4BNXA 3VVBA 5U9CA 1ZJYA 1Z73A 5BNFA 5G4LA 1NASA 2VHYA 4OH1A 4XCVA 1MG0A 2DTDA 5C7OO 4QEDA 1CYDA 1K6XA 2I6TA 3JQAA 5CG1A 5IJZA 3HJAA 2Y66A 2B37A 3AU9A 3F46A 2DPGA 1MB4A 5HS6A 3WGOA 3KEOA 1KVUA 2FOIA 2G17A 4CM9D 5I9MA 4H3VA 3INTA 2NU9A 4FQ8A 1P74A 1A5ZA 4A10A 3VZPA 4DC1A 1YE3A 2DUUA 1FF9A 3DZFA 2VUSA 5TQVA 2FSSA 5ICMA 4J7UA 3K6JA 4AJJA 4CPDA 1WNTA 2UUOA 2OP0A 3ZV3A 1MUUA 1NXQA 3D4NA 2FMUA 3H9JA 1BW9B 4WCFB 1HE3A 1V9LA 3F5SA 1VSUA 3H5RA 4TRJA 4CM8A 4MP6A 4J4HA 2VOEA 4WEOA 5F3RA 1E7RA 3FD8A 2OXIA 3SC4A 1GZ6A 1KBZA 4NFYA 1GR0A 2PR2A 5U1PA 4PRKA 1NYTA 4RDHA 4E33A 1E5LA 3DHNA 4UUOA 4A2CA 4J6FA 1I3LA 4R54A 4GI2A 5A06A 1I10A 5JFOA 1Q1NA 4XJSA 3GUCA 3WXBA 4W9NC 3K31A 4AJIA 1EDOA 2ZYAA 2E48A 1IZ0A 5A9SA 2D1YA 1NQAO 4UAGA 2VT2A 3BAZA 3DOJA 2YFQA 3V2UA 4CM6A 3OJFA 1QORA 4XJTA 4FFOA 1L7EA 2P9EA 4BNIA 3L4SO 5I8ZA 4E5MA 2Q2WA 1X7HA 3TSCA 1ZZEA 4ZU3A 3S8MA 2VN8A 2IE0A 2DPHA 4ZRNA 4YT2A 4R4JA 4ALMA 4MVJG 2NVWA 4ZD6A 3VZSA 2Q1UA 4A27A 4BB6A 4IY1A 4WECA 2IODA 4Y8VA 1B2LA 1YB5A 3I9NA 4IJWA 2JFHA 3BTOA 1ONNA 3NDJA 4AJLA 3ZHXA 3VH4A 5B4VA 1XGKA 4BVAA 3PQFA 4HNGA 3ON5A 4G2NA 5L51A 4YPOA 1PEDA 2CUKA 4RF4A 5COQA 1FDVA 3AOEA 5GZ1A 4CMJA 1JKJA 1P1RA 3DBHA 4RVSA 1SBYA 4YJHB 4BB5A 5DDIP 3K9QO 1VJ1A 1PQWA 2EHDA 3Q0EA 4WK6A 4Z3DA 3U5TA 1E6WA 1HYEA 3LZ6A 4G65A 2BMAA 3GLQA 3SJUA 1PGPA 5IN4A 1C3VA 3FNEA 4Y67A 2OGUA 4RL6A 1I2ZA 3QQPA 4CODB 2ET6A 3OIFA 3DBLA 3STHA 2EKPA 2OFPA 1ZEJA 1KVSA 1PWZA 4K1LA 3V1UA 3AJRA 2EJVA 4CMIB 4AJ1A 2I3AA 3PIIA 1ADFA 2J3HA 1JQBA 4JJGA 4TROA 1GQYA 5CPFA 3WS7A 3GR6A 3COSA 5MDHA 1DHRA 4BQPA 3WIDA 4B3HA 3CIFA 1U7TA 1YL5A 2AE2A 2ZQYA 3OQBA 4HY3A 4R1NA 2VWHA 4CMCA 1HDGO 1WWKA 3GVIA 4F46A 1KEVA 1B8VA 2J5RA 3I9MA 3FNGA 1RWBA 1ISIA 3TOXA 1SPXA 3G49A 1E7QA 1XHLA 4LN1A 4DREA 4MVJE 3I23A 2ZIZA 3OEWA 4O5OA 1WDKA 2RHCA 5KNLA 3JQAD 1BDMA 3HDYA 3PGJA 4J16A 5ER9A 4DL9A 1DBVO 5AXCA 3ZWBA 5IZCA 1BXGB 2PKQP 4NFHA 2UAGA 3P2OA 2AQKA 2VQ3A 4E2WA 2X0JA 1EVJA 4N54A 1TA4A 3U0BA 1Y8QB 4J91A 4MVJP 3S1LA 1DIAA 1JKFA 1NPTO 5JS6A 5HS4A 1T4BA 3DR3A 3H5AA 2EP7A 3TZ6A 4U0JA 1YBMA 1BDBA 4L76A 3ZU5A 1MG5A 1S6YA 3BMOB 4A7PA 1F17A 1FDWA 3WYEA 2HK7A 3TL3A 3WOHA 3ZV6A 4YT8A 3KLMX 2BGMA 2WYUA 1Y8RB 1LEHA 3IUPA 5JO9A 1B26A 3TPCA 3SVTA 1TI7A 3KBOA 1YJQA 4FFMA 2E49A 4BGEA 1XQ6A 5THQA 1C1DA 3H9UA 3BMNB 5DBFA 3CZMA 1PJCA 1PS0A 1OBFO 1YQXA 4WGGA 2VYVA 2I76A 2YUTA 1MA0A 1NR1A 3BMQB 5JCXA 1N7HA 4FJ0A 4RVUA 3TWOA 1PJBA 1ULUA 2C07A 3EMKA 4YB8A 4XQEA 4AFNA 1N9GB 4JBHA 1NFRA 3IJRA 4Y9DA 1CRWG 1ZK3A 4GQAA 2YY7A 3OFSA 3HB5X 5COBA 2B83A 1YDWA 2CMDA 3CXRA 2QHXA 1WDLA 3GAZA 1LUAA 3ASVA 4C4OA 2PA3A 3K2BA 4CQMB 2NU6A 1IZ9A 3HE3A 5EIOA 1E7MA 3WBFA 1P44A 3WR5A 2D59A 2HDHA 2X9GA 2QW8A 4DC0A 3ICPA 3WTBA 4UEJA 1GV0A 1MX3A 2NQTA 3WLFA 1ADCA 1CQIA 2Y1EA 3VTZA 2FHSA 1A4IA 2P5YA 4WLFA 3KYBA 4E4YA 4LCJA 4D0RA 5H83A 3K96A 3UF0A 3U09A 1Y7TA 3A1NA 3PHJA 2OZPA 3UUWA 4MPDA 1KOLA 4I8XA 4IIVA 4D41A 4CV3A 3BTUA 4YEDA 1E1KA 2DBRA 5JY1A 3GVXA 3DHYA 3U3XA 3RUHA 3EAGA 4W99A 1R0LA 4TQGA 4ITUA 4CMGA 2EG9A 1Y6JA 4BOYA 4J2OA 1ZSVA 4OOEA 1I2CA 3H7AA 3HHPA 4IZHA 3FWZA 1P45A 1Q7GA 4UVEA 5L3ZA 4NJMB 3PHLA 2OP1A 4JIGA 4O1MA 5IXYA 4XX0A 3NAQA 1DRVA 3H6KA 3S2IA 4XGIA 1O0SA 2VRCA 1BW9A 1KVTA 1J4AA 1K5HA 1QV7A 4FOOA 3DDNA 4L74A 1JVSA 2VWGA 3VOSA 3H65A 4LK3A 2ZYDA 1AGNA 4J9UE 4PLGA 1ENPA 3FHLA 3E8XA 2LDBA 4DLLA 4KDEA 1NWHA 2ZTMA 1ZJZA 1PS9A 2D5CA 4GGPA 4M89A 2OHXA 2PFGA 3BIOA 3FRJA 4TKMA 3MJTA 4Y6RA 1WXDA 4WKGA 4INAA 1YS4A 1EK5A 4GX2A 4XQ9A 2JL1A 3E5MA 1ZSNA 2AG5A 3JD0A 2BLLA 4KTVE 1DJNA 2JJYA 3PDJA 2FZWA 3BZUA 4PG6A 5A1TA 4Q3NA 1MC5A 4IDBA 1LLCA 3R3SA 3UCXA 4GMFA 3WQQA 3GHYA 5I8WA 4YBZA 3O4RA 1O5IA 1VL0A 2VNSA 1A72A 5LCXA 3A4VA 1U8FO 3RUIA 3M1AA 4WEQA 4CUZA 1VJ0A 3QE3A 3PJDA 5JXWA 4GH5A 3Q2KA 3TNLA 1D8AA 4CMAA 1G6KA 2CY0A 4NPCA 5I9LA 2I9PA 1HL3A 2D2IA 1Z6ZA 2X7HA 5G2OA 1U4OA 3E6AA 3KZVA 2HMVA 2V6FA 2AMFA 3IMFA 3EVTA 2Y0CA 2PGJA 5KKCA 5TT0A 3KEQA 4N5NA 4WOJA 2BI8A 2C7GA 2VUUA 3VDRA 3PP8A 1T26A 2VRBA 1GPJA 4DUPA 4YCAA 4K9DA 1OMOA 3WYCA 4YJHA 3GPIA 1GDHA 1C0PA 2PH5A 4AJ4A 4I5FA 3UGKA 1TLTA 1ARZA 4RGBA 4YRAA 4E30A 1DFIA 2HKIA 4GAEA 2ZCVA 4UVDA 2C5AA 1E3WB 1X7GA 4II3A 2H9IA 4BO6A 4BO3A 5TRTA 2X86A 3GZNB 2DTXA 4MKXA 2X5KO 2HMSA 1B8PA 1U3WA 3CMCO 4H7PA 4KWHA 2PV7A 3PFFA 3RC9A 4E6PA 5ADHA 4XWYA 2JCVA 4ND3A 4CMIA 1JU9A 4L4RA 4Z0TA 1LU9A 4EUHA 3GOHA 4I9UA 1IHYA 3GK3A 2VZ8A 4BUCA 3V2HA 1SC6A 3INGA 3JQCA 3S2FA 3UH1A 3WICA 4DRYA 2DU8A 1DB3A 3DXFA 1RM5A 2X0IA 2NTJA 2DKNA 4KP7A 4OM8A 5I7VA 1BWSA 3CZRA 1EZ4A 5CDGA 1PQUA 1A27A 3DMTC 1U3VA 4B8ZA 1R4NB 1NHGA 2ZJ1A 4WE3A 1HSZA 4GX5A 1ZMOA 1DAOA 3JQEA 1P0CA 5ITWA 5CDTA 1WPQA 1T2EA 3E5RA 4GX1A 3HWRA 4BNVA 1BXGA 1GUFA 4BKOA 5JMPA 4DTIA 1QYDA 2EWMA 1A7KA 3AY7A 1MLDA 3O8QB 1TEHA 1UZMA 1Y8QA 4E5YA 7MDHA 1F8FA 2O2YA 4JROA 3ROQA 1TVEA 3EYWA 1P77A 3ZZNA 3OF2A 4MVJD 1NAHA 4D44A 4U6SA 4D42A 3H2ZA 2XOXA 1HDRA 1XWFA 3BMOA 5CG2A 2PK3A 5GZ6A 1BTOA 2X1HA 1SMKA 2I3GA 1Y8RA 3A28A 5KVSA 4D3FA 1ONOA 4XYMA 1VKOA 2QZ9A 3HFGA 3JQFA 4XR9A 3BMNA 3L9WA 5A5FA 1QYXA 1ISJA 4H15A 5ENVA 5JDIA 1NVMB 4E2YA 3C24A 2E37A 4F45A 1BXZA 3DOOA 4F6CA 4DQUA 3GMSA 3OA0A 3KVOA 4XDYA 4WCFC 2VZ9A 1P1JA 1MV8A 1N9GA 4E3ZA 4R16A 1H5QA 3E48A 1SOVA 2P9CA 3PPIA 4J0FA 3C7CB 3FPCA 4MIYA 4EUEA 5HRUA 3ZI0A 3C8MA 2OMEA 4CQMA 1CDOA 3QP9A 4BO9A 1DC3A 3ADOA 2HMTA 5IN5A 8ADHA 2NTNA 3KB6A 4IIUA 5LC1A 3AM3A 3BXXA 5T8KC 3WG9A 2X5JO 3WFJA 5JMWA 4IDGA 3KM0A 4W4TA 4RVDA 1NFFA 1KETA 4IXTA 2RCYA 5EL0A 3FTPA 3RC2A 2Y1FA 1H6BA 3DZIA 1EDZA 5JDCA 4RZIA 5FWNA 1HE2A 2DM6A 1DAPA 2NACA 1ZVMA 2WDZA 1ZCJA 3EHEA 1E3JA 1YL7A 1HE4A 3PJGA 2YZ7A 3LK7A 2GN6A 2FR0A 4FB5A 2CNBA 5JAMA 5A9TA 5L4NA 1DDOA 4BNWA 3I1JA 3GN2A 4J7CA 3GGGA 3PK0A 2D3TA 2W8ZA 4YT4A 4NJMA 1VC2A 2YV2A 3QV1A 3W4JA 2ZB3A 4BO1A 3GDGA 1DSSG 3D4PA 4WPGA 2J6IA 4EYEA 3I9KA 4FGSA 5T5QA 4NU6A 4A26A 4BMSA 1EFLA 4OSOA 4J43A 1GQQA 4HUJA 2P91A 2DBVO 1X0VA 3GC6A 4PVDA 4BO5A 4CMHA 5MGBA 1D1TA 4MDHA 5CHEA 3WTCA 2HUNA 1LDYA 4W9NA 3GY0A 3D1LA 1H2BA 3KUXA 1SEVA 3ULKA 2VOJA 3I9OA 4KMSA 4IJKA 3TN7A 1EUZA 1RM0A 3ITDA 4IMRA 1ENYA 5IDWA 1HLPA 5L4SA 2VWPA 4CLEA 1Y1PA 4LCEA 3QW2A 4I5GA 3MEQA 5CFZA 4GPD1 1XKQA 3PEFA 2B4QA 4GBJA 3MWDB 4FR5A 4HFNA 1XR3A 3NRCA 3GMDA 4Z0HO 1QYCA 3NTRA 4IUYA 4M86A 3WMWA 1B3BA 2CZCA 5B37A 3E9QA 2DC1A 1TB4A 3PVZA 2EIHA 4S1VA 1HZZA 4OKNA 4TRRA 1E3LA 3IC5A 3EUWA 3DOCA 4FIZA 4DLAA 3B70A 3QY9A 3DZJA 3OJLA 3FBTA 3X2EA 5KKAA 1WAMA 1HKUA 2E6UX 4PN3A 1SCUA 1IL0A 2J8ZA 3GUYA 3UCEA 4NK4A 3LC2O 1RKXA 4BHTA 2QRJA 5TX7A 3KETA 5CDUA 5JCJA 2Y99A 4RO0A 4IQGA 2P4QA 2C59A 3GDOA 5TLSA 3QVOA 4DBZA 5EINA 1EBFA 3T4EA 4R1UA 2JAPA 2UVDA 3C85A 5BNIA 3UCFA 2AEMA 1GYQA 1E3WA 4QO7A 4UULA 3BYZA 2EF1A 1X0XA 4L73A 4QTZA 1P33A 2CVQA 3RFVA 1DIHA 4MINA 4YACA 1NQ5A 3V1YA 1NNUA 2DT5A 4UEKA 4ND5A 1MP0A 4NH4A 4YJDA 4DIOA 1P1KA 2BRUA 4YAGA 2X58A 1SO8A 2A92A 2Q1SA 1H6CA 4L8VA 4YWJA 3AU8A 3UXYA 4EGFA 3D3WB 1NFQA 3LU1A 1JWAB 3G3EA 4TMFA 3RVDA 1ENZA 1T2CA 2D0IA 3CUKA 3B1JA 3VPFA 4BNJA 2E4AA 1R4NA 4QT0A 3OH8A 3OEYA 2LDXA 4K26A 1G1AA 1L1FA 3RFTA 3TL2A 3G1UA 3D4OA 2AEFA 4NBVA 4R5MA 4CM4B 4PLHA 2VTEA 3O8QA 4W6ZA 3HADA 5JDCC 6ADHA 3TZHA 1QP8A 3DFUA 1MFPA 3FNFA 3WSVA 4OQZA 2RAFA 4BKQA 2AW5A 3CH6A 2Q46A 4DQVA 4J1NA 2OBNA 3SLKA 1I3MA 3GAFA 2NADA 2TMDA 3FF4A 4J1TA 3H2SA 2HJRA 5TNXA 4CMEC 3QVXA 4FFPA 1XLTA 1EMDA 2BF7A 3JQ7A 3WMXA 4BNGA 1YRLA 4Y98A 2YHUA 1E3IA 4BNNA 2P9GA 1VKNA 3PQDA 1F8GA 4OYRA 1EFKA 1HXHA 2FY8A 4DVJA 4IDAA 3RROA 1GCOA 3VKUA 2I99A 4WLOA 2C82A 4EJ0A 1HSOA 1N1GA 4UUPA 4Q9NA 3BTSA 3QSGA 3UOGA 2GUGA 3VPXA 4BO8A 3NJ8A 1SB9A 5HA5A 2VYND 3GG2A 2HRZA 3SLGA 3NGXA 5G0VA 4AL4A 3A9WA 1E7WA 1LDBA 1W73A 1N7GA 2QRLA 3DC2A 3JYPA 2X8LA 3JD2A 3LLVA 4JXKA 4MJLA 4L4XA 3EK2A 4FPXA 4K28A 4R68A 4HFMA 1YL6A 1BMDA 2X9VA 3NYWA 4PIVA 4YJGB 1KEUA 1WW8A 1BVUA 3GZ4A 2CF5A 3RJ9A 4WJZA 4RF5A 3I9JA 5FF9A 4RORA 4TRNA 4FN4A 4ALLA 1LDNA 3HB4X 1LRJA 2ILTA 2JFFA 1CJCA 3BMCB 1PIWA 2WYVA 1YOVB 5G0TA 3GRKA 3GGPA 4NU5A 4XYEA 4EJMA 4FFLA 1HYHA 1YONA 2EXXA 3PDUA 1CETA 1J5PA 4W7HA 5CPBA 3RWBA 4ZQEA 2HQ1A 1QKIA 3GVPA 5TIIA 3NJ4A 4M49A 2YJZA 2UV8A 4QX6A 1FXSA 3A06A 2QYTA 3U4CA 4CR8A 4BQRA 5I7EA 3IOYA 4LRSB 2Y67A 5EERA 4JBIA 4KTTE 5T64A 3GH3A 1AE1A 2X22A 5ER6A 1ZO8A 4MVJF 2JHFA 4R69A 4D43A 4D7AA 3OECA 4ZGWA 5TC4A 1E1NA 4ID9A 4EDFA 2PGDA 2VT3A 2NV6A 3O03A 2ZATA 4JP3A 3RC1A 1V3VA 1YKFA 1AHIA 2Q4BA 3HDJA 1RM4A 2PKRA 3QHAA 3ZWOA 3GDFA 5DBGA 2R00C 4B3IA 2Y1DA 1DFGA 4AG3A 2WE8A 4BNFA 4PLVA 1NPDA 2GYYA 1H2HA 2Q4EA 1E1MA 3G17A 2FWMX 3UICA 1C0KA 3Q9UA 1DIGA 2IZ0A 3GT0A 3PJEA 2GCGA 5CAEA 2D8AA 1UDCA 4IS3A 4JX8A 5TT1A 3GVHA 4YQZA 3W8EA 5C3MA 1B7GO 1R0KA 3DAFA 2I66A 3WGIA 2EGGA 1I36A 1WDMA 5B4TA 1H0KA 1OZAA 3RU9A 1DEHA 2ZTVA 2V65A 1X1TA 1P0FA 5JNLA 3KV3O 2Y1CA 1Z82A 3ETEA 3GN1A 3MJ4A 4MVJH 3OJEA 3ANNA 2YW9A 1DC4A 1KERA 3UKOA 3PHIA 5FEUA 2NVBA 2B69A 1Q7CA 1U4SA 1HWYA 3Q9NA 4R1SA 2RHRA 2V6BA 3QWBA 1NHWA 1E5QA 1NR7A 9LDBA 4CM7A 5L9AA 2PZLA 3FN4A 1NWCA 3UN1A 1A9YA 1BSVA 4U6QA 3JQ8B 2JHGA 4ZQGA 1ISGA 1FJHA 3DZHA 4PFJA 1WVGA 5KCZA 3TFOA 2GDZA 3I6QA 4R1TA 1I3NA 5DCYA 1YWGO 5K9ZA 1DO8A 3IAHA 5A04A 3AY6A 3HN2A 3Q2IA 4GLOA 1KEWA 2A94A 4BKPA 1XU9A 3F6YA 1SAYA 2G5CA 3B1KA 3L6DA 4DPLA 4KQXA 5IXSA 4CQLB 3QWHA 3U9LA 4QSMA 5A05A 4RLSA 3WGHA 3DMTA 1W6UA 2WTBA 2AHRA 3PQEA 3GF4A 3RUFA 3ZHYA 4NIMA 1HF3A 3DFZA 3RUCA 4B7XA 1NBOA 4IGEA 1LLDA 2WSBA 1GYPA 1LQUA 2OOSA 1LA2A 4DGSA 1QLHA 3RD5A 1DC6A 1T25A 3B20A 5F21A 4NK5A 5L7TA 4WLVA 3W1VA 3VZQA 3K8ZA 2ZKLA 4XB2A 1VRWA 1Y9EA 1FK8A 5KVVA 3DTYA 2WYWA 3WGGA 2GGSA 3JV7A 1B14A 4JQCA 3RQSA 2O2SA 1DLIA 3PFWO 3MZ0A 4MP8A 1XYGA 2G76A 1ZKMA 1LI4A 4WLEA 4BO4A 4RJTA 4CM5A 5KJEA 5GMOA 4URFA 3TOZA 2J3IA 1LLUA 3MCVA 3WFIA 1YB4A 2C2XA 3LDHA 5KIAA 5DP2A 4A73A 1OOEA 1T1RA 4E13A 4FFRA 4U7WA 3ZU3A 3K73O 1SOWA 4J2HA 1C0IA 3LF2A 2AQIA 3C7DB 2YDYA 1PL6A 1K6JA 3SBOA 1LSJA 1M67A 2Q49A 3ORFA 4OOFA 1IOLA 1Z75A 1K89A 2NNLD 2NUAA 4WCFA 1ZUD1 2EKQA 3UHAA 3Q11A 1R66A 2Q1WA 5JE8A 1HE5A 2JD1A 2UUPA 4IDCA 1DRUA 5HWSA 4PCVA 3HN7A 5LDGA 4NBRA 2X4GA 5KJCA 1E92A 1DRWA 4RPKA 2HCTA 2HK9A 3I3OA 4L75A 1K6IA 2NVUB 4JCOA 4ND1A 1W0CA 4M1QA 2HU2A 1Y9AA 3S2EA 4ZJUA 5T8KA 3M2TA 1PWXA 3H4VA 3GEDA 3M2PA 3D0OA 4DYVA 5A3JA 2EEZA 4YJGA 1LBEA 3DBVO 3SJ7A 2JFGA 3PGXA 3Q6IA 2B4RO 3QVSA 3ZWVA 3ST7A 1DOHA 1Q0HA 2PZJA 1I30A 2CVZA 4DIBA 2R6JA 5ICSA 2P2SA 1ZIDA 4LGVA 3ANMA 1LTHR 1JN0A 5T67A 3BMCA 1VL8A 2J3KA 2NLOA 2G82A 4JGBA 2NQ8A 1EVZA 3C1AA 5KWEA 4ALJA 1RJWA 1SEPA 3OIDA 1DIBA 1ID1A 1UUFA 2BELA 5B4UA 2AQHA 4B3JA 1EE9A 2F1KA 1CF2O 5C5IA 4J1SA 3OETA 1KC3A 1O8CA 1OFGA 1O9BA 1UZLA 4CMBA 2YV3A 2G1UA 3AI2A 3JCZA 3JQGB 1UP4A 3RFXA 5HBRA 2VYVD 3HZZA 3N7UA 4J90A 1GUZA 4NBUA 5CEEA 4Q3CA 1CIVA 5IDXA 2BGLA 5AQ1A 4XGKA 4EZBA 1WMAA 2W2KB 4DA9A 3W6UA 5L45A 4ZA2A 1ZXBA 2A9FA 3D3EA 4WLNA 1YXMA 5KJ6A 4PLWA 3H3FA 1UDAA 4CJXA 2FPIA 3GNTA 1UXHA 4W7IA 1LRLA 1E6EA 3OP4A 5EN4A 4BGVA 4E21A 1I32A 3LVFO 4G81A 2WD8A 4GMGA 4D0SA 2CF6A 5JLAA 1PJ4A 4LISA 3JTMA 4Q3EA 2O48X 1GEGA 2C20A 1QSGA 4BNZA 3ENKA 2GF2A 1F14A 4IDEA 3EZLA 2CVOA 4J3FA 1V0JA 4RPHA 1H93A 2PLAA 5K0ZA 1W8DA 3G79A 5L53A 3WBBA 1U3UA 4OMUA 1ZBQA 2NU7A 4AJ2A 4E5PA 3IQDB 4AJOA 1ADBA 3FR7A 3RBXA 4CV0A 1IYZA 4G5HA 1E6UA 4A5OA 3KSDO 4PG5A 5DCWA 1ENOA 1G0NA 1YQDA 1FDTA 1XQ1A 3QLJA 4KWIA 2O3JA 3DEYX 3JQBC 3NUGA 4XQCA 1GADO 1Y5RA 2R2GA 3JD4A 4R3NA 1WLYA 3MJEA 4R51A 1JA9A 3ZWMA 3AFNA 2Z95A 2DLDA 4QUKA 2ZYGA 2WM3A 2FRDA 5G0SA 3W4IA 3ZN2A 3GA0A 4DMLA 4PZDA 5I9NA 2RH4A 3RJ5A 2VRCD 4E32A 1Z74A 3LQFA 5DOVA 4TWRA 3SEFA 3WIEA 1XG5A 3OA2A 3ONEA 4QECA 3E03A 4KUEA 5BNTA 1LQTA 4QXMA 3JQ8A 4LSWA 3JQAB 1K0UA 4NBTA 1NM5A 3E1KA 5COAA 2DBQA 4CL8A 5THKA 3NGLA 1FMCA 3BMQA 5EPOA 1BHSA 4Q3AA 4Q3DA 3LT1A 1QRRA 1CERA 1KVRA 3NT5A 5IFLA 3LYLA 4ND2A 2IEDA 3QVWA 2PZKA 4YJFB 1M2WA 2O3SA 4Q3BA 2PWZA 3ZH2A 1M6WA 5A02A 3V2GA 3PWZA 5ILOA 1ULSA 2PZMA 3M1LA 4IJUA 1ISFA 3ZWAA 4BGUA 2V6GA 1X7DA 3P2YA 4CQLA 1U28A 4J4TA 2WJPA 3IKTA 4YQYA 4O0LA 3S2GA 1PZFA 5KVCA 5L95A 3HQ4O 3MJVA 1HDOA 2X23A 4CM8B 4KUGA 1QYVA 4UVHA 5BSHA 3DB2A 4IQ0A 4U8GA 4PLFA 4L4SA 1F12A 4CLDA 1U7HA 2WD7B 4MKRA 4RVGA 4KOAA 2Y1OA 1N5DA 1PGQA 4D45A 1I01A 4EW6A 4XIJA 1PZGA 2ZB4A 4BL5A 3LC7O 1VLLA 3AWDA 1PS8A 1H94A 4RPGA 4PLPA 2FPPA 5DT9A 2Q2VA 2Y68A 4GVLA 4TRMA 1V6AA 3WB9A 1I33A 6LDHA 3OM9A 3ZV4A 5IDYA 3FR8A 3WNQA 4CMEA 4K6FA 1N2SA 4ZHSA 3AM5A 4YAKA 3RKUA 2P68A 3MJCA 1HEUA 4GWKA 3RBZA 2V7PA 3JYLA 4DQXA 2EW2A 4RQTA 3MOGA 3MOIA 4P8RA 2GNAA 4PG8A 1H9AA 1GU7A 4ESOA 3IS3A 2X6TA 3AUAA 1J6UA 1ZK0A 3ANLA 4C7JA 5L4LA 4CUJA 1HDYA 2DFVA 3RASA 1UH5A 5JPIA 2DFDA 5JSFA 1HLDA 4DLBA 3T4XA 1P31A 2PD6A 5FI3A 2AG8A 2BFOA 2O4UX 3QA9A 1PX0A 4R9SA 3DZKA 3G0OA 4TVOA 1PZHA 4OXYA 1I8TA 4XA8A 2VHXA 5EQDA 3NDRA 4CV2A 2PNFA 4Z6KA 1DXYA 1LNQA 2A35A 3PLRA 1PSDA 4P4NA 4CR6A 1R4MB 4B4WA 2QRKA 5DOZA 5L40A 4RPLA 5EESA 4YAEA 2NVUA 4WUVA 2GASA 4C7KA 1GFSA 2CDAA 1O6ZA 4B7UA 1ZNQO 1J0XO 3PRJA 2O3TA 3H8VA 2FN7A 4N7RA 4ALKA 3C3XA 5F5NA 1RPNA 4ZQBA 4CUKA 1O94A 4E0BA 5JO0A 1LJ8A 3EC7A 1DJQA 3JQ9C 1DHTA 1P3DA 3NT2A 3H9QA 3F4LA 4DPKA 1ZFNA 4FCCA 2I65A 3TZKA 5DULA 3ONFA 1AUPA 2YYYA 3RU7A 2X5OA 1BXKA 2WWRA 4PRLA 3UVEA 4YAIA 2IRWA 4EJ6A 4DMMA 4R41A 4J49A 3ITKA 4QFDA 3AK4A 4J7XA 4ONEA 4D79A 5F1KA 1DFHA 2O4CA 4IS2A 3ZV5A 3CPSA 2Q2QA 4XGNA 4BKRA 3RSHA 1JTVA 4XRRA 3KLPX 2Z1MA 1K2WA 3RKRA 4BMVA 5K6AA 4XEHA 5I7FA 3JQGA 1P1IA 4AJNA 4N5LA 4WCDA 2EV9A 3WJAA 3O38A 1HTBA 3KYDB 2IEBA 5DBIA 1H6DA 2OORA 1DC5A 5KOIA 3GNQA 3OQ6A 4OGWA 2W2KA 4XYGA 4IXWA 3F1KA 3C1OA 3GZNA 1NPYA 4OSPA 3K30A 4MOWA 4NFSA 5HTOA 1QG6A 3F1LA 4MO2A 5EQFA 1MXFA 2C29D 5H81A 3OJOA 1YO6A 1CQJA 1KY4A 1HDXA 4EITA 5BSGA 2R00A 1BGVA 3OHSX 5KJFA 2VTDA 5KTKA 1I2BA 4CQMD 2Y0EA 2X0NA 2PTGA 4I1IA 3QWIA 2WE7A 3R1IA 5TGDA 3PHHA 1EE2A 2PGLA 3IKVA 3WGYA 3L07A 2AQ8A 4A0SA 1U5AA 3AUSA 4NI5A 4B4VA 4PZCA 2C54A 5AXDA 1XEAA 2FR8A 2CDCA 3NTQA 3QVTA 3KRTA 3T7EA 4ZN6A 1LDGA 1JAYA 2DTEA 1JW9B 3I4CA 5AXBA 3ZWNA 1PQPA 2H6EA 2JKVA 3JSAA 2IYOA 1KYQA 2EERA 4YDRA 1UP6A 1EUDA 5CDSA 1D7OA 3H3JA 1VJTA 4EEZA 1UR5A 1Q7BA 2EP5A 1LLQA 1ISHA 3OIGA 1U2GA 3W6ZA 3FPLA 1PR9A 4OJNA 1ZMTA 3KXDA 4CLHA 1TXGA 3HSKA 4FOSA 4GKBA 4OL9A 4XYBA 4FW8A 1P1HA 3FCOA 1IULA 2QIOA 3ETGA 3VH2A 4NG5A 3V1TC 5A5EA 2Y93A 4FC6A 2EGHA 3TZCA 5KVQA 2ZTUA 2XXBA 4P22A 2OBYA 2IZZA 1G0OA 1JDJA 3K2EA 4NR0A 4XKJA 4CM1A 1PJTA 4TZTA 4E31A 4LMPA 4OXNA 4ROSA 3DMYA 5F1OA 4HXYA 4II2A 5A3VA 1FDSA 3H5NA 3GNSA 1ZXLA 1X1EA 2HSDA 2O3UA 4B4UA 1E7YA 1X13A 3CTMA 1AHHA 1H9BA 3WYBA 5LDHA 3GVCA 3ZWXA 1F0YA 3F47A 1IE3A 4U0KA 4RDIA 4BNHA 2XAAA 4YJFA 4M55A 1QV6A 3PI7A 1R12A 2NM0A 2ZB7A 3E82A 1XA0A 1KEPA 3VDQA 1PGNA 1LC3A 4E5KA 4OO3A 5CDYA 4LMRA 1EQUA 3W8DA 4CM3A 3L6EA 3OSUA 3H9EO 3JYOA 5AOVA 1SZJG 3L4BA 3RUAA 3CE6A 2OO5A 5FYDA 3ZNOA 3GG9A 2JCYA 2FP4A 4ALNA 4E2ZA 1YVEI 5A4DA 1YH3A 3HG7A 5JY6A 2WD7A 4N18A 4MKZA 4DYDA 1HZJA 4B4OA 1WZEA 2FZEA 2GZ2A 2IXBA 3VH1A 4GLLA 3P7MA 3IDSA 3GEGA 2X9NA 3OJ0A 5ENDA 5JCJD 2RIRA 4YTEA 3S55A 1U3TA 3UFXA 4ND4A 4FJ1A 2V6MA 2Q45A 5GZ3A 3PHGA 3KO8A 1MXHA 3WGTA 4R9RA 2J5KA 1PGOA 4RZHA 3UW3A 3I83A 5AVOA 3ZNQA 4J1QA 5IDQA 1TT5B 1WP4A 4UUMA 1NQOA 2JCXA 3OICA 2JAHA 2GRAA 4NDNE 3NX4A 2VCYA 5K6AC 4BIIA 4NBWA 3PYMA 4XR4A 3U4HA 4HFJA 9LDTA 5U4QA 4IDFA 1ZW1A 1C1XB 3ROKA 4ZQHA 1Q0LA 3GQVA 1KVQA 3PZBA 4IZIA 2E82A 2WEKA 4JJIA 4XQGA 4PVCA 1A7AA 1XSEA 1AXGA 1ORRA 3JYQA 1R4MA 4Z9XA 2EKLA 3EGOA 4KZPA 4O6VA 1PL7A 3ZNNA 3OMLA 3ABIA 3B6ZA 1I0ZA 4Y6SA 5DP1A 3TZQA 2W2LA 4ZRMA 3JYNA 2DBZA 2CDBA 1VE9A 4I5DA 2OL4A 3K92A 1PR3A 3AW9A 4R3WA 5CP8A 3SC6A 1E3SA 3ROMA 4GSKA 2C5EA 1UXIA 1E3EA 3QIVA 2HJSA 3D5QA 5DZSA 4M87A 1B8UA 1B15A 1DIRA 1A9ZA 3JQDA 1OI7A 1UP7A 4KQWA 4MP3A 1SNYA 3LF1A 5G0UA 4BNLA 4O63O 3WWZA 1W4ZA 4AVYA 1NTOA 3DAGA 1Y5MA 3ZWWA 3SX2A 3ZW9A 5AYVA 3AUTA 1KIFA 1LSOA 3FNHA 3BTVA 4JNKA 1IHXA 2POQX 4KDFA 4RF2A 3CINA 2Z5LA 4K6CA 4M8SA 4RCVA 1PJ2A 3HNPA 1DLJA 4L9RA 2H1SA 3KYDA 3HUDA 1A4UA 1YGYA 2UDPA 4PGFA 3DBRB 5T6BA 3ONDA 1GTMA 1HT0A 3LC1O 4PLYA 3WSWA 1VL6A 2PD4A 3TRIA 4LVCA 4BKUA 2YV1A 4BO7A 2H63A 3F9IA 1O95A 2J5QA 4TSKA 1XELA 2NWQA 3DO5A 4E2XA 2ZCUA 1T24A 2Z1NA 5DCUA 2HK8A 2DQ4A 4AICA 4BNKA 5JW6A 1U8XX 3ZDFA 3VHRA 4HWKA 3VAZA 1LDMA 2BH9A 2ZJ0A 3ZWPA 4UREA 3WJ7A 2P5UA 1GZ3A 4TKLA 4Z0PA 5B12A 2XPCA 3E9MA 4P4LA 2PKQO 3NDIA 3QWFA 4HX5A 4NZ9A 4R5HA 4CL3A 3KHUA 4RF3A 3D3WA 1LSUA 4IJVA 2PY6A 2O3RA 3BA1A 3QRWA 4FGWA 1PJSA 3MTGA 4E12A 3I6IA 2VHZA 3N74A 3L4BC 4CLRB 4M54A 3WWYA 1HETA 5ES3A 1AN9A 3DQPA 2P4HX 4HKTA 4YXFA 2DUWA 2VHVA 3JQBA 4CM4A 1Z7EA 3PIDA 3R0IA 4FBGA 4OHUA 5H82A 1EBUA 3NTOA 2VHWA 3NV9A 5BT9A 3Q1LA 3L9XA 2B36A 4QFCA 3LT2A 1XDWA 1BG6A 3WLEA 3G1TA 4DWVA 3AM4A 1JWBB 1QMGA 3EDMA 1AXEA 1CWUA 4L0QA 4N5MA 4I08A 4PG7A 5BR7A 2QG4A 4LRTB 2QX7A 3OBBA 2W90A 2VWQA 3EVNA 1NX6A 1TT7A 3PJFA 5F1PA 3U62A 4OKIA 3VPSA 1M66A 5AXAA 4NHEA 3L6OO 3FWNA 4CR7A 1P9LA 1B3RA 2ZQZA 1DPGA 1MC4A 2AEJA 3WX0A 1S7CA 3O9ZA 4FS3A 3ZHZA 3IP3A 4RLHA 2J3JA 4MIOA 1E1LA 1YBAA 1I3KA 4J9VA 4CLOB 1UXKA 1VPDA 3V5NA 3PWSA 1ONPA 1LSSA 4HADA 4ILKA 2GSDA 4LSMA 4FFNA 2W2LD 3LT4A 4TVBA 7ADHA 1LC0A 3ZGYA 3T7CA 2SCUA 3R3JA 3ROPA 1ZK2A 4MVJA 2B0JA 3GFGA 1C0LA 2GLXA 3H9GA 1B16A 2BI7A 3EZYA 4YRDA 2AE1A 3AOEC 3ETDA 3NT4A 4YA6A 4B8WA 1IPEA 4D3SA 3K5PA 1R37A 4R01A 2B4TO 5A9RA 2AA3A 1EUCA 2C2YA 4BV9A 3ZU2A 4D46A 3PZRA 1YB1A 3DHEA 3I5MA 3VH3A 1EVYA 5EJ2A 2YHIB 1ADGA 3ADPA 3IL2A 5A03A 4P38A 3R6DA 5JAQA 1GL3A 1UZNA 1IUKA 3DAPA 3KSZO 1EEHA 1GD1O 1ML3A 1YOVA 2BFMA 2ZK7A 1UAYA 1VM6A 5CEJA 1HRDA 2HRBA 4XD2A 2O7SA 2BFPA 1OC4A 1T2AA 4WNIA 4AJKA 5JYEA 3LLSA 3VPGA 3BHMA 4H16A 1D1SA 3CKYA 1WMBA 5JAZA 3ZCXA 2GN8A 2I5PO 1TT5A 1IB6A 1JVBA 4XRGA 1R6DA 1E77A 1KC1A 3CSDA 4GSLA 4ZVVA 3HDHA 1VSVA 3EY4A 2HAEA 3ZW8A 2Q1TA 1E0DA 2Y1GA 1V8BA 4QO8A 2GZ3A 2PD3A 1C1XA 5IZCC 4OXKA 4GGOA 1Z45A 2C7VA 3SXPA 1Z7BA 4J4BA 3LSYA 5IAAA 4XB1A 4E5NA 2TMGA 1U2DA 5TS3A 5EMHA 1PJLA 1HDZA 3Q3CA 3WDSA 3CEAA 4FJ2A 4F3YA 3MTJA 1RYEA 5G4KB 2HMUA 1N92A 1Q0QA 2UYYA 3D5TA 3ZU4A 4BS9A 5JYDA 2G0TA 3RUEA 3KYCB 4FC7A 4A03A 4IM7A 1V3UA 3GEMA 3JQ9A 3F3SA 2FSVA 4IINA 1GV1A 4ALIA
chains in the Genus database with same CATH superfamily
4MVJM 2IHUA 3OZAA 1T3HA 1S8NA 1WUKS 1Z37A 3KXLA 3LUHA 4Q7JB 2JFNA 1L7DA 4UNQA 1NUQA 3NTXA 3RFCA 1JHPA 3HY6A 2BFDB 3X1KA 1YDEA 1WZIA 1YBVA 5FTKA 1Y37A 1II0A 1QG4A 3K71B 3RVSA 1U5CA 3CVUA 5F33A 2ZE6A 2GR9A 5EFOA 5LBTA 2G5TA 4O59O 2PR7A 2VXOA 3LUBA 1CQWA 4ESEA 3MVEA 3S5UA 1PL8A 5ALLA 1RCFA 4PZEA 3ZWCA 2IXAA 3QXGA 1ZWKA 1E9CA 4OH7A 4RV5A 4RYLA 3UJ3X 1VJDA 2JD0A 1Q2XA 1FPMA 1GCUA 1GSHA 1K06A 1SVSA 2ZR0A 3DUWA 3ICCA 3PXGA 1AMOA 2QSJA 2VDJA 1MFZA 2GEUA 2XH8A 3AR9A 3HKEB 3AVXA 2O9JA 1GPDG 2VDMB 4I6EA 5HKLA 4A0HA 2F59A 4QUAA 4IDDA 2K2QB 5E3JA 4L5AA 1B1AA 3UA3A 1FFSA 1GNLA 1QK3A 3TLMA 2Q99A 1DS6A 3WV5A 1TJNA 1HQCA 3NBKA 1NT2A 2FWRA 5JZ9A 1TIKA 4GC5A 4I36A 2PH3A 4LMAA 3T7TA 4EEXA 4Q4AA 2Z8YA 3L77A 4H3KB 1JJVA 4URZR 3GLHE 2OUIA 5E38A 4ZC8A 2WV9A 4DDKA 3HWX1 1UKZA 1SXJC 1OZ0A 1L0BA 2I4OA 1FXUA 3KJZA 4BQQA 3JD3A 4RVFA 1IXZA 4L7QA 1NVUQ 1TZJA 2NV0A 1WY7A 4MKIA 3V9AA 3WLHA 1PQ4A 2RHDA 4FWIB 3PE4A 3MD0A 4JD5A 3LAWA 1MB0A 5EWJA 3UJCA 3A04A 2MSKA 2ZI9A 3I3SR 1FJGB 1KY5A 2A5YB 3R3VA 2NTYC 5EJEA 1BHO1 5LP1A 3EA0A 2V9CA 3O7WA 3NP7A 3OC6A 4EHHA 1XVVA 1ZYUA 2ECKA 3BREA 3BEDA 3DXZA 3ZY3A 2QN8A 4DMHA 3V8BA 4QPPA 2QUBA 2GK6A 1T6YA 3QU2A 4BNTA 4JK3A 1D3AA 3S68A 5DHQA 4ID3A 4QJ3A 4UD6A 3S44A 1QQTA 2X7XA 1OUMA 1RYFA 1T9ZA 2NPOA 2BFAA 4IL5A 3ZBQA 4RTRA 1HT2E 4GL4A 4HX9A 3F6SA 5K0LA 4PPQA 3TIVA 4FD3A 5C37A 1OT3A 3I4FA 2O0HA 5IG2A 3AY3A 1QIEA 2MR5A 4JN6B 1OC2A 1X9GA 3LX4A 1TQ8A 2HA6A 1L7RA 2H92A 4RMJA 4AS3A 2I87A 3KOUA 1Y3FE 1IWOA 1TJ4A 1Z0AA 1CULC 4JB8A 2Q3LA 2R6GA 5CJPA 5JPDA 4ISBA 4RAQA 4URXR 4OUDA 1HBJA 4M0DA 5BR1A 1XQXA 1BRMA 1YZUA 2DH6A 3SIWA 1KAMA 3F6RA 5TSDA 3GZJA 3JD1A 3LCCA 4U2BA 5AKJA 2YXPX 5C31A 1EI9A 1ODJA 4CEHA 2XGMA 2QM7A 4RVHA 1M0TA 3I72A 2WG1A 4JFAA 4NICA 1BU5A 1JHUA 3PLNA 5F5LA 5AH0A 1NP3A 3IBCA 4A8JB 3A9CA 1ZH0A 2YZGA 3NHMA 3TMYA 5A0FA 1JHMA 4R8SA 2V4ZA 1IPFA 1W5BA 2XTMA 1TECE 2AXNA 5JNVA 4CLOA 2HLPA 2X8JA 2YWXA 1UKCA 4XH9B 1UIMA 1MDBA 2WU1A 3D7LA 5JBIA 5CX1A 4GWGA 2IV3A 1SC1A 2QYSA 4N8SA 3T0GA 5M7EA 1GJRA 3OAAD 4PAOA 4XDZA 4RCYA 5AHXA 3DULA 3GJ0A 2JAWA 4WGFA 1FFEA 1ISMA 1FP7A 3DBHB 3OQVA 4CM9A 2G7MC 2J3QA 5E9JA 2PZFA 3NHYA 2IS4A 2Q50A 3LXRA 3DHVA 3YASA 3CRW1 3U61B 5BSEA 3O73A 1CJBA 1TCCA 1U1IA 3DONA 3GLRA 3H2KA 5TF4A 1WB9A 1D4FA 2RGGA 3O84A 4X6XA 5J3JA 2AYXA 1AA9A 1ZC3A 4RV9A 3KJHA 4NNJA 3ODGA 4EA7A 3WSTA 2B5OA 4KAXA 1UMKA 5AIAA 3R0VA 3MTQA 3BFKA 1QXSA 4CEJB 3TTVA 2DECA 3GLVA 1I24A 1WMSA 3DE6X 3OFVA 2XUOA 4JXJA 1CJVC 4UDYX 4BNDA 5KJ1A 3C7AA 2ZSAA 1YR7A 1GG2A 3O1JC 2ZBUA 4CNBA 4I50F 1DV2A 2G1KA 4AO6A 3I9LA 1ECLA 4FYIA 2AZTA 1J8VA 2WQZA 2YQ4A 2O14A 4FHDA 4AZVA 4HMPA 2EJWA 5JNSA 4FYKA 3ZUPA 2P78A 2A86A 1OX6A 1UEJA 3GOQA 3RU2A 1IY8A 2ZUEA 4NJOA 4DMCA 4H4DA 3QE9Y 1NVKA 4BGIA 3QBEA 3N2LA 4L5BA 1F8YA 4HO1X 1OWOA 4KE9A 1QMPA 3VZRA 2BEUA 3FHOA 3RIHA 1TCAA 1RM3A 4EG4A 4V38A 2XF8A 1QE5A 1P4HA 2WPDA 3SQNA 1XL1A 4ZQFA 2RGWA 3UWDA 4YMIA 3G5LA 2QORA 3H97A 3T0FA 4PLCA 2CKDA 1RHRA 3I04A 2QAGC 2GZRA 4OIMA 2ZBFA 2WC1A 2GM9A 2W4QA 4Z53A 1CUGA 2IYNA 1JX6A 3H04A 3HSYA 1BMTA 3IUNA 3MMZA 4AY5A 5B1YA 2DR2A 2VNIA 1SG9A 1UBEA 2W8BA 3U7RA 4CT4B 1ISPA 3CA8A 4OK6A 3U40A 4MW6A 5C7LO 1EQ2A 3TCXB 4O4JF 2Z5GA 2I7DA 5IYZA 1G98A 3C48A 2VRWA 3LVQE 3OI7A 1N0IA 2G71A 2GPSA 3BM5A 4JYCA 3TQHA 3UC9A 1OZFA 5IWCA 1Z0DA 4LAFA 4W82A 3BD9A 2P9HA 1JG3A 3INYA 4R1LA 1VP3A 3P19A 3C5CA 1RYDA 1T9KA 2GZ1A 1AIPA 1AQ6A 1RLIA 2H1LA 2QL7A 3AMVA 2R2AA 4JDUA 3KALA 5CFRA 1VI2A 3NASA 5FQNA 3HCAA 5ALPA 4ACBA 3JQFC 4MMYB 3EW7A 3A1EA 4B79A 1PGJA 4P33A 1ECJA 1WPXA 2WAAA 3ND7A 4IGFA 3SR3A 4JBLA 1ABFA 3MWGA 5J1TB 3ZDCA 2NTVA 3GJ7A 1EP9A 4YRMA 4Z4CA 4NQZA 4AAYA 2BFDA 2HLNA 4EGSA 4N9WA 5DX1A 5AW9A 2QTWB 5B7QA 4O08A 1TU3A 4MTCA 3CNHA 4N47A 3W4KA 3UG7A 1VIDA 5E3IA 4S3MA 3LK6A 2QN3A 3QJ5A 7GPBA 1OWMA 1XJCA 3LBYA 3VTFA 2QU7A 4F1KA 2XCOA 1UADA 3ELBA 4P7GA 2J31A 2GNOA 1SVOA 3UJ6A 1BA3A 4RKYA 2Y71A 1THMA 5BQOA 1LKZA 3M49A 1HEIA 1QHNA 3FBGA 5JWOA 4Z4QA 1B1CA 3W05A 2KB0A 2ZJFA 3QITA 1EA7A 3CMMA 3P0IA 4FWBA 2H29A 2C0CA 1J0BA 3HKEA 4TLCA 1EVLA 3VVBA 3OFNA 5U9CA 1RD4A 1QO7A 3IYLW 4GOKA 5G4LA 4BJ5A 1RTKA 1ZCAA 1QM5A 3OJXA 5EZ6B 4ZO6A 1QE3A 3PFNA 1LPSA 3THSA 4BMZA 1II9A 4FILA 3MT8A 1K3FA 4M1KA 4QEDA 4W1PA 4ZVUA 4E88A 1Z4MA 5CG1A 4KFCA 1S2GA 4DDHA 3H42B 1W0JD 2ZSBA 4H7FA 1A4RA 4GZLA 2QR5A 5C5EA 1U63A 1Z5NA 1L5LA 1AXRA 2G17A 2JLYA 4CM9D 1RRKA 3J7AC 2P7HA 4EY8A 3KZXA 5DKFA 1KMMA 4GL2A 3SZGA 2ZIWB 1NULA 3FROA 3C3AA 1R3UA 1N8TA 4KR0A 1YE3A 3CLRC 3ENVA 4EVSA 2VDOB 1FF9A 2JIPA 3I04M 3DZFA 3M6MD 5TQVA 2FSSA 1U2QA 1IJEA 3HLYA 3R5TA 1PSWA 3W2IA 4TL6A 3PNLA 2ZIVB 1GPLA 3I1IA 2UUOA 5C1PA 3FCSB 3OTOB 4B6SA 1RR6A 4ZCTA 1SBHA 1C9DB 3AFHA 3TE6A 4E08A 3H9JA 1Q0RA 3O3NB 5AICA 2W2OA 1D8TA 1LW7A 1MT3A 2CMKA 2QM8A 4J4HA 1FNMA 4MP6A 3ZCQA 1CNFA 4BMCA 3BRCA 4BVKA 3LECA 2C5FA 2VQ6A 1KBZA 1XEFA 2QTGA 5LA6B 1LI5A 1V11B 1ZITA 2PR2A 3DD5A 1HG1A 4FHZA 1WMFA 4JLJA 4PRKA 4UBIA 4Z2AA 5IKMA 1H9CA 4LRWA 3BKWA 4AZ3B 3ID6C 5HQ3B 4DV5B 5AJWA 4MZDA 4A2CA 1B4DA 1D1QA 4QOSA 1K4YA 2FSHA 1IVNA 5A06A 4OHPA 4XJSA 3RHSA 3IHWA 2JGMA 3EZXA 4UZFA 3WXBA 4W9NC 1VCNA 5DNDA 1GRNA 3K31A 1EDOA 1YJCA 1RKQA 3JY6A 1PUXA 1JG4A 3AL0C 3LQRA 2PN1A 2X41A 1TADA 1XMQB 1A97A 3MB5A 1Y6FA 1MW8X 2XYVA 3GROA 4CM6A 3OJFA 3WLPA 4XJTA 1L7EA 1F3OA 3HYNA 3L4SO 2A1IA 1X7HA 3VYWA 4U2CA 4HEQA 1QF7A 1G66A 4YMTA 3AG6A 2IE0A 1PR2A 1UT6A 4R4JA 4ALMA 2NVWA 4M9RA 1S2OA 1FXWA 2A0KA 2B21A 5A5GA 4A8JA 1MDFA 2GA9A 4RVNA 1B2LA 1YB5A 2H1VA 3I9NA 4MICA 3STWA 1YS2X 5TDHA 2I80A 2WTUA 2JFHA 2P3OA 3OIUA 4PO3X 1SG6A 3QBJA 2XCIA 3TQSA 4WXEA 1IVYA 1N5JA 5A4MS 3DG9A 5B4VA 5JALA 1F4VA 3EA4A 4ARUA 2DXIA 4XPZA 1NVDA 4YPOA 4FGUA 1K98A 5COQA 5DSZA 1P1RA 3DBHA 3KT3A 4KV9A 1SBYA 1VQ1A 5DBHX 4YJHB 6GPBA 3K5IA 2DHCA 4Y0AA 1Z6AA 2AG1A 4D9BA 3V4RA 1H2YA 3Q0EA 4WK6A 4Z3DA 3X0DA 3U5TA 3KJIA 4C2UA 3E61A 3LZ6A 3P45A 4G65A 4GICA 2BMAA 3GLQA 1F2DA 2WICA 4HLUC 2JA1A 2YINC 4HAVA 1DWQA 1RC0A 4OLBA 4LWZA 5JZOA 4Y67A 3UOAB 1RS0A 2F1HA 5IT9A 1RW4A 1AKVA 2GJ9A 3QFRA 3UBMA 4G9BA 2GRUA 4C5BA 3G82C 3C8ZA 1ZEJA 4K2AA 1KVSA 5JI3E 2HCFA 3DLPX 1A9QA 5NLLA 3V1UA 3JRNA 5CB4B 1NMQA 2WZCA 4CMIB 4NL4H 1OIWA 4ENVA 3F71A 1ADFA 2QYOA 2FMFA 3PIIA 4HHEA 1E59A 3WS7A 3ZJTA 5BXQC 1DHRA 4LJLA 4AZ0B 5FNZA 1FP2A 4JC4A 5KVAA 4C3OB 2AE2A 3OQBA 2VWHA 4GP9A 4CMCA 1S3GA 2FRVA 1B8VA 3DF7A 1H4SA 1RWBA 4K81B 2RHGB 5AM4A 3UKDA 1E7QA 1XHLA 4NG4A 1NUHA 5JHGB 3I23A 2AKEA 4LZNA 1QTIA 2VS1A 5BPHA 2NN3C 3WIBA 1P17A 2RHCA 5KNLA 3COPA 1BDMA 3PGJA 4J16A 3D4IA 3P0JA 4PQFA 1Z4LA 2VP0A 4DL9A 5JZVA 1DBVO 3L7JA 1XZ8A 4IG9A 3SICE 2G3YA 2GPJA 4TS3A 3RVNA 3JATB 4BBAA 4TQAA 1F7VA 2CL5A 4MPRA 3IEMA 3DTVD 4I9GA 4E94A 5CA0F 1JJIA 2VPIA 3WAKA 4E2WA 2C5BA 4JKIA 2X0JA 1I3OA 1QBKC 2FUKA 4N54A 2BTOA 1PEKE 1BVYF 3S1LA 3EIUA 4QDXA 3CUTA 1SUAA 1JKFA 221PA 4EDHA 2O2HA 1J2TA 4GT1A 4KAJA 5JS6A 1KNXA 1SHLA 5BW8A 3P2IA 2G5PA 3GRCA 1H23A 4GDMA 2EP7A 1QU3A 2I22A 3F5MA 4U0JA 1SIOA 2WG2A 3RIGA 3TZ6A 4BVEA 1G1MA 3WP0A 1MG5A 1S6YA 2EYQA 2P90A 3F98A 1F51E 4A7PA 2HK7A 2R751 4F3RA 1QOQB 3G2PA 4MPTA 1B0ZA 3TL3A 3ZV6A 2AT1A 3TPZA 3BF7A 2IS1A 3IUPA 1IHDA 4KR3A 4Z1MD 3QMPA 4FFMA 5AW0A 5LP6F 3SVTA 1R9NA 3ZC3A 1E3MA 2G83A 2Z2JA 2B8NA 4B33A 3BMNB 2F8SA 2J5BA 4D8WA 1KO8A 2PXHA 4JVNA 1OBFO 1YQXA 2OD2A 3H5WA 3FB1A 2I76A 1BOOA 4WGGA 3UPDA 1NR1A 4M22A 4AMBA 4K9QA 5AJHA 4BRSA 1AQUA 3EZ7A 1D9ZA 3NC4A 4RVUA 2OV2A 5KYKA 2C07A 1RC1A 1V95A 4QYSA 5HGJA 4YB8A 3U81A 4XQEA 3IERA 1USVA 2Q4TA 4JBHA 2PJRA 3IJRA 4ZAVA 1R0RE 3S70A 4DJ5X 5I51A 1X8JA 4QJ4A 1BFKA 3OZ7A 4RULA 4RK7A 2EEPA 1U2RA 4GQAA 2HCBA 3IDQA 3PEWA 1V25A 2YY7A 4NARA 5GWXA 2D1SA 3CXRA 3DLBA 1LUAA 1R50A 1UINA 2ZRDA 3ASVA 2P6PA 4CQMB 3ZOZA 2E4WA 2H2AA 4OA8A 4Y9SA 1IH8A 3TIIA 4EL5A 2ZZNA 3FNBA 1OW3B 1G3RA 3K15A 1NI4B 1STOA 3OIVA 4P7FA 3EXIB 3KHTA 3KOXA 4OI4A 3ZHBA 2HDHA 5FUVA 3BQ9A 4HZIA 2BEVB 5AK6A 4MW0A 2X9LA 2NQTA 2O2GA 4N3NA 1ADCA 4ZV9A 3VTZA 2FHSA 5JUWA 3LUDA 1WLSA 1WP9A 4PO8A 4FMDB 3G9TA 4ISCA 2HPZA 3BWEA 3UMMA 1BGXT 3PUYA 4EQZA 4DSUA 3MINB 5IMSA 3TSWA 4LXQA 1Z8HA 2JLCA 5IKOA 3UUWA 1PG0A 4AF8A 4FEEA 5E95A 2QXTA 3BVPA 3T9CA 4W5RA 2ZJ3A 1K27A 3IR7A 4LRUA 2G04A 3MTEA 1FLDA 1Q3HA 1Z0UA 4GE0A 4G5XA 4UC0A 3D0QA 1R0LA 1ZM3A 2QV0A 4G4SO 2EG9A 1F48A 4BKMA 5MN5A 1GPMA 3I4LA 2HXGA 3OG9A 4OK5A 5KNCA 1Q7GA 1ZN9A 5L3ZA 1YQTA 2DWQA 5IKXA 1ZA2A 2OP1A 1ZUNB 2DWCA 3KKLA 4JIGA 2WM9B 4JEMA 1JYSA 3LRXA 4FYVA 2XCRB 3P94A 3NWOA 2IV7A 5H70A 4ZI7A 1NNSA 2H85A 2Q5FA 3OESA 1QDLB 1JG2A 1XAJA 4FOOA 2CXSA 4CFYA 3PDHA 4Z86A 4WVLA 5HUHA 1EFTA 3LKDA 1AKMA 1T8UA 4PLGA 4POOA 5E4TA 3IP6A 1UBSB 4DLLA 4N6NA 4H7EA 1U8TA 5LA6A 1TRKA 1V11A 3MSCA 5HF8A 1XRNA 3M5WA 4LYEA 1SCKA 1PS9A 4AZ3A 5HQ3A 4M89A 2OHXA 3FRJA 3BIOA 5G1PA 2OK7A 4RZ2A 5K6TA 1HNZB 2FFBA 5FPTA 1ZJJA 4INAA 1YS4A 1E0KA 3TYXA 3KYIB 1W44A 3FCYA 2JL1A 1AQLA 4L5JA 4FKZA 3S6JA 5AHRA 1WBDA 2AG5A 3RIYA 2FWJA 2YBDA 3L0IB 1DJNA 3HEBA 1C4KA 3WHLA 5CVEA 4BU0A 2BDEA 3QYJA 3R9IA 4Z3OA 3BZUA 5AVQA 1NDHA 3CPEA 1ZM9A 1X42A 4F92B 3EC1A 3HVIA 4PC3A 1T5HX 4GGMX 3VC2A 4GKJB 5JJKA 4C7VA 2OB1A 5DNCA 5K45A 4LXUA 4RTJA 3IKMB 4S1NA 2DGDA 1O5IA 2C4KA 2HWYA 3BL5A 4B3CA 3GLFB 1GU1A 1EQAA 2A33A 1VJ0A 5DYGA 3QE3A 5JXWA 3B6JA 5GVRA 3Q2KA 4PYRA 4J07A 1G6KA 1O9HA 3GMTA 2P2GA 5BQXA 4E5DA 4CETA 1NSTA 1TOAA 4F04A 2GHRA 1UKVY 2GAJA 1U4OA 1QTNA 1NI5A 1YR1A 3GIDA 2O59A 2V6FA 3CKLA 3IMFA 3EVTA 3AR3A 3AHFA 4WZBA 5KKCA 3HP1A 3KEQA 4N5NA 4WOJA 3H83A 2YW2A 2J85A 2C7GA 3R3UA 4V0MA 1KYIA 5KNDA 3LDUA 1G8AA 4FX2A 4IEEA 2A0UA 1S3FA 2VRBA 3BJIC 3C3MA 2WSMA 3VI4B 2BBTA 3EPRA 4ZVLA 3T3EA 4JR1A 2DCUA 3ZX5A 2HF2A 4YJHA 3ENQA 4P3PA 1Z5VA 2CNWD 2GCOB 4A6DA 1D5WA 2PRSA 1FRFS 3BFJA 1CS4C 3CLUC 3UGKA 1ARZA 4AJ4A 4C0HA 4YRAA 1FTYA 1N2HA 4GAEA 4AYXA 2H0AA 2HXSA 1JHYA 3ZBUA 1W34A 3IVMA 1PNOA 3DHWC 1E3WB 2HOQA 4II3A 3LPCA 3GZNB 5JBNA 2DTXA 4MKXA 4YQEA 3W1WA 1B8PA 1UWVA 4KWHA 2PV7A 1I9CA 3WISA 3LXUX 1V39A 3W5AA 1XUOA 4Q3OA 5HBGA 3I5AA 4E6PA 3I2JA 3HP7A 2CK3D 4AKHA 1GG5A 1N36B 3LHSA 5FAKA 4CMIA 1SVMA 3PPXA 3UAZA 1GA6A 1LU9A 3T1TA 1P0QA 2X42A 4XI9A 2EAUA 3TQTA 4H60A 4I9UA 2RE8A 3IH5A 3GK3A 4NDZA 1BKSB 3NCHA 4MRRA 4AZ0A 1SC6A 1XTPA 1X2BA 4LKOA 1DB3A 3GJQA 1RM5A 2BP7A 4Q6BA 2YXNA 1YFJA 2DKNA 3SD7A 4QWWA 3NHSA 4UHCA 3AVQA 4BYMA 4MV7A 1EZ4A 1FNNA 2GJ4A 1C9KA 3M4NA 4HOYA 1Y8AA 5AHOA 1S4MA 3R3HA 2JPDA 3UJAA 5FBQB 1NNEA 2EW1A 2CXXA 2HW8A 4WW0A 1HSZA 1ZU4A 1MIOA 2NSYA 4L8LA 4JL6A 4ZI2A 3DNPA 4L85A 2R84A 3BPSA 4M0EA 4BFTA 1WPQA 3JATA 4O8CA 1QIKA 2XD4A 3FPFA 4JKYA 5TMDA 3RHFA 4BKOA 5AUPB 4DTIA 2EWMA 4YH1A 1MLDA 5BPFA 5E6UB 3T3MB 4MDEA 1UZMA 7MDHA 3UHPA 1MBZA 1F8FA 4RLFA 2PUGA 4QM6A 4UU8A 1BDHA 3LCJA 3ZY4A 4GYJA 5BV1A 3M33A 2VAWA 3TNDA 3B6KA 4ZJPA 4I2NA 4D44A 4HF7A 3GQBA 5IT5A 4N0MA 5A7HA 1ORVA 4G9GA 1XQWA 5JSKA 4PHTA 4WY8A 1YTLA 2XYHA 4AJ9A 2PK3A 5GZ6A 4DJEC 5HGXA 2XAUA 3NTLA 1NMYA 2I3GA 5LQDA 2J09A 4Q4JB 5JARA 3GFPA 4D3FA 3U4AA 2ZVDA 4OTZA 2QZ9A 5AHKA 3V33A 1HQYE 4PAWA 3BMNA 1QHXA 2CLEB 2IOFA 3UJNA 1DP4A 2FKAA 1U6JA 3DQQA 4H15A 4OB6A 5ENVA 3T1VA 5F5XA 2E37A 1XRSB 4JR2A 4F6CA 1VPTA 4DQUA 3LWZA 2ZULA 4XDYA 1QV9A 1QGED 1VP9A 4AS1A 4WCFC 4H6XA 1IMOA 3R5JA 2AEEA 5EKDA 5L3VA 4RZQA 2CHUA 3ZG6A 1J1IA 1H5QA 2PO7A 2P9CA 3E48A 2HM7A 1L4HA 4KREA 3C7CB 2IZ6A 1HDEA 2ZXFA 3G9ZA 3K1JA 1BC5A 2F48A 3LW7A 2ACEA 4YUWA 4WK4B 2OMEA 4D9JA 4CQMA 3IOEA 3QP9A 4QBFA 2VH2A 5SICE 4BO9A 3ADOA 1LVUA 3EEIA 5IN5A 4EB8A 3WWOA 1L3CA 4KKVA 8ADHA 4IIUA 5LC1A 4NESA 1UDWA 1NI4A 1HA3A 3IP8A 3LP8A 1C8BA 2X5JO 3U4QB 3EXIA 3KM0A 4DR2B 4D99A 1F4PA 2RCYA 3AEZA 3FTPA 4I7EA 3UGQA 3RC2A 4G4GA 4OJQA 1H6BA 4I1VA 1Z0FA 4OFBA 4TV8B 5JDCA 4PYMA 3BGWA 3GZTB 1JU4A 4QYMA 4N0EA 4Z7QB 1QZXA 3VAYA 2BV3A 1OH6A 1HE2A 3ZS9A 2WSSA 3D8TA 3EGDB 1ZCJA 3MINA 4JJ4A 4QA9A 1OFHA 1YL7A 4LDQA 3H1BA 3WL4A 4B3DA 5FWDA 4JZYA 4CVNA 2GN6A 5FUYA 2FX2A 3VPAA 2B99A 1KI4A 4H08A 4O4LF 3CUEF 3HKCB 3KSMA 5EYPB 5JATA 4FB5A 3RS4A 4W8GA 3N2YA 1TDJA 4DVGA 4B40A 2WM2A 2VDQB 1DG1G 5A9TA 2I6QA 2OESA 1HFWA 4NU8X 3TLEA 4ZEVA 3I1JA 1JG1A 1N2EA 3H86A 1VCIA 3GFTA 4XDGA 2NYAA 1WQ3A 1O2DA 4GBED 3BXPA 1SH7A 1KKMA 3VO8A 1QZZA 1NBAA 1I7LA 1U04A 4KR9A 3HSSA 4OIFA 3RODA 3ZYZA 1RLTA 2H06A 2ZB3A 1KOFA 3GDGA 4Y2PA 4Z7NB 1ND5A 3DB1A 1QS0B 1T1GA 3FZGA 4FGSA 5T5QA 3I2YX 2PIAA 4J0QA 3SX0A 4MCJA 4QYTA 1IOVA 2X3YA 1GKKA 3QF7A 1GQQA 4GPBA 4Y2JA 3HFRA 1VG1A 1FDIA 2DBVO 4TMZA 2XNJA 3L6UA 4PVDA 4QPZA 5DTQA 1AUQA 5MGBA 3TQCA 2QVCA 1D1TA 2XNCA 2VA9A 4NEQA 2C2MA 1JFFB 2HUNA 1LDYA 3RW9A 4DHWA 2RJOA 3PF8A 2FAXA 4KLRA 1HM5A 1VLMA 2WOJA 3D1LA 4TLLB 5D84A 5C8YB 4HWGA 1K2VN 3GFSA 3ULKA 4F4UA 5FWXB 3I9OA 1J90A 2QDXA 4IJKA 1HLPA 1V8DA 1SZCA 2QY6A 3I1YA 2VPTA 4FCTA 4LJSA 4NABA 5DRYA 4LCEA 1M34B 1XCOA 4E22A 4EIWA 3ME5A 3D0KA 1NSFA 2A5LA 4GPD1 3VKWA 3PEFA 2B4QA 1EK2A 1MJGA 1P5FA 4B6EA 5JAPA 3NIFB 1DKMA 4HQFA 5FPQA 4ZVOA 4W5JA 1I1NA 4BP8A 1CY4A 1GGNA 3AR2A 2CZCA 5B37A 3HVUA 3PVZA 1W46A 4E5SA 3WHIA 4TSFA 4MRPA 2ESRA 2Q5IA 5YASA 2BKEA 2UXBB 4WT7A 4E6EA 1RE1A 4C4SA 2IHYA 2P4EA 2A6PA 3DOCA 4UUQA 5FOWA 3U39A 1G42A 3DZJA 4ENTA 2C4HA 4JI8B 3I8XA 4HLCA 4V24A 1G6HA 4CTOA 3WJ2A 5J4LA 4RAOA 1JDBB 2IYXA 3W9SA 4U7DA 1U0FA 3LWDA 3CF6R 2R5WA 2MTBA 1ZJWA 3OX1A 3AR7A 4M6WB 4JUCA 2YRFA 5JCJA 2JFBA 2INGX 5JI2E 3TM4A 3T5PA 1MB3A 5TLSA 5BUSA 4X24A 3VO9A 4B4DA 3NXSA 2QX6A 4Q05A 2A7XA 3I9V6 3H8SA 3JU3A 1E3WA 4QO7A 1FYEA 3RVJA 1CZOA 5ALFA 3IT1A 3UB3A 1C3OB 1MH1A 4RH0A 4G0XA 3I6MA 4LOKA 3DOFA 4L73A 1SKUA 1FLVA 2YY6A 3AF4A 1BD4A 4QTZA 4R83A 5EIAA 1NUTA 1F8XA 1EWVA 2R7AA 4GEKA 4JVLA 2PS0A 4YX9A 2A3RA 4JJKA 1YQEA 2QYHA 2IUSA 3T7AA 1NQ5A 1QRSA 3W7AA 7ABPA 3AEQA 2OFOA 4RJKA 4D9CA 2ZKIA 2OBMA 4JP8A 2H54A 1MP0A 1ZIXA 2NTEA 1LWNA 3IJ5A 4GRIA 3ZHVA 2X58A 3ETLA 1CR0A 3BH0A 4A5SA 5P21A 1EXNA 3CLSD 3FE2A 3EIEA 3C8UA 1H6CA 3LD9A 4YWJA 1XI2A 2ZRJA 3ED1A 3OX2A 1E0JA 2I1WA 3NVAA 1JWAB 4TMFA 2YUIA 3WLNA 1T2CA 3CUKA 3REOA 1M8GA 3C4VA 4G0MA 3G0DA 3CB2A 1R4ZA 2QN2A 5CT5A 2BM8A 3USES 3WRXA 4RHFA 4K26A 4MROA 2WW8A 3TL2A 3LPLA 3TM5A 1L5SA 1G2PA 2AVNA 3FSEA 4RZ3A 2IX3A 3UXEA 1E4YA 3SHQA 2AEFA 2VK8A 2H2GA 2PRYA 3G0CA 1CJKC 4RM2A 2OCYC 3IQEA 4KLAA 3PKIA 4AF6A 4C7MA 2VTEA 1O6BA 3HADA 3S7TA 5LMCA 1HURA 5E6UA 1MJGM 2PTHA 1DINA 1AM4D 1MFPA 3HA7A 3M3HA 3T5CA 3UMFA 1EIZA 2D2XA 2GF0A 3E3OA 4OQZA 1XDBA 2AW5A 2ZYRA 2Q46A 3GEEA 3L0CA 4P3YA 1S7GA 4E1AA 1EZZA 5IUJC 1R5OA 1I3MA 1HLGA 3OD1A 2CT8A 3OQNA 1JIVA 1WNFA 2GK4A 1CUAA 2FZKA 2NXWA 3FF4A 3H9CA 3DDHA 3GGSA 1H2AS 5DHRA 4FFPA 4HJXA 3WMXA 4RABA 1ZD8A 3CZPA 2Z58A 4L78A 1US8B 4Q4JA 1DQRA 2P9GA 3TLCA 4BNNA 5LMNB 3RNLA 1FNDA 1AZSC 4QDJA 3A70A 1Q0ZA 3AYXB 4OYRA 3Q88A 4MYDA 1PD0A 2Q62A 4INJA 2ZLBA 4LDJA 4FHEA 1GCOA 5DHFA 3RROA 4EYQA 1Y4SA 1NV9A 2C82A 2ZRIA 3BIWA 3E8MA 1E9SA 4F8JA 5DLEA 1DBQA 1DEAA 2LUOA 2W2TA 3BTSA 3IODA 4YPVA 5HSGA 4JH0A 3EFOB 1L5NA 1SXHA 4HAWA 2OZEA 4FKMA 3KPVA 1JHRA 2L69A 5D3MA 5TMBA 5ENZA 3MUNA 1TE2A 2IXFA 1RI5A 2QVXX 3K7EA 1ZVJA 3NJ8A 3RUPA 1QHHB 2VYND 2YKGA 3Q8MA 4ENPA 4RC9A 4AL4A 1H3EA 4Q0MA 2ZBRA 5AOAA 5JS1A 1N7GA 2QRLA 1THGA 4MJLA 3LLVA 4F5YA 3FXAA 1Y1LA 1RYZA 1ZH2A 4YDQA 1T5LA 2B2XA 5CH5A 2R8ZA 3VHXB 4MW2A 2JAUA 1WW8A 1ST2A 1BVUA 3F6BX 3ZKAA 3U4QA 4WJZA 4RF5A 1CR1A 5EP3A 3I9JA 1MU0A 2O2EA 4ME6A 2FYTA 2PT5A 5HG0A 2WF5A 4TRNA 1JEEA 1LDNA 2RSLA 3HA2A 3C14C 1LRJA 3OIYA 4EKNB 2C57A 1H5UA 2ILTA 1IJBA 1RQ7A 2JFFA 1R88A 2QRHA 3H8WA 3QXXA 2GBCA 4IH1A 4U7PB 1CJCA 1A2OA 2GBLC 5FPPA 2IFTA 3HP4A 4BX0A 1HYHA 4G41A 3PNBA 1UPBA 3PDUA 3EGDA 2VJCA 3PD1A 4Y2QA 5BSUA 2OYRA 3TTSA 4W7HA 3VGPA 5EWLB 2Y9PB 2HJWA 1DJMA 2HQ1A 1CR2A 4LNAA 3TPFA 5LM3A 2ZE8A 1V4NA 2P6MA 3HKCA 2P9QA 1QKIA 4N5HX 5EYPA 4D1YA 3TLXA 1G2OA 1NUSA 2A9JA 3G7UA 2ZPAA 3GJ8A 4YQFA 3T6KA 3N75A 4J2TA 1JL3A 2UV8A 4ZOCA 4QX6A 4BCDA 5EUMA 2PSDA 2CYBA 5JD6A 1OWNA 3U4CA 4ZVKA 1KORA 5EXPA 1FIUA 2D2EA 4BQRA 4GLBA 5JG7A 5CCXA 4HEA6 3S3TA 1RJGA 2Q3FA 2YVQA 5F23A 1EVEA 1MO6A 3Q3VA 4JBIA 1W76A 3IUYA 4KTTE 5EERA 4EHIA 2WVJA 4PHFA 4LY0A 4D9GA 2TECE 1QS0A 2A9VA 1JDPA 1ZO8A 1EFPB 1ZOPA 2Y6VA 3I09A 2OORC 4MVJF 4D43A 3OECA 5IH7A 2CFTA 5JAOA 2UYCA 1I6KA 3N87A 1VE3A 3DFMA 3IAAA 3KD3A 5TC4A 1E1NA 1JIQA 2PGDA 4JP3A 2ZATA 4TYMA 1WQ4A 1V3VA 1YKFA 3IURA 1EFUA 3RS2A 3UC5A 1BS1A 1AHIA 1PFGA 2WHYA 1JFFA 2DE0X 3HDJA 3IFSA 4PY2A 1PEYA 1V7QA 1YBFA 2P62A 5K0FA 2GEDA 1Y1SA 1DKPA 2ADOA 3GDFA 2YCBA 2RK4A 1OVGA 1QF6A 3HVJA 5DBOA 5AT1A 3JYHA 1YGPA 2B9EA 3ACCA 1JIIA 3K0CC 3L43A 4PLVA 5FWXA 4BZPA 4YMUA 1RMQA 4RVOA 4AQYB 3THYB 1YB7A 1E1MA 1Q3TA 3H99A 2AI3A 2HTEA 2JGIA 3K0EA 1R9GA 2I3DA 2F3PA 3GT0A 1RZ3A 3IE2A 2XITA 4WINA 2P3SA 2VTKA 3I58A 3NO4A 1NJGA 1WPGA 3HYSA 1U31A 5TT1A 4IKOA 3I76A 2GEFA 4QG7A 4IIYA 4XUCA 1D0IA 2O5VA 3IIJA 5FOUA 1B7GO 3DAFA 3VUEA 1O8BA 1LVHA 2FZLA 4QGAA 4XVCA 5EJ9A 3WGIA 1DCFA 1BEZA 5B4TA 1OZAA 2CV0A 1JPVA 3VSAA 3M4JA 2EJTA 3N2KB 3M5DA 1G5RA 3FTCA 1UCFA 4DUZB 3VKGA 4YUYA 5JNLA 1VSTA 1PYGA 3KV3O 3ETEA 4X60A 6YASA 3UWKA 1ODTC 1GRCA 3JQQA 1T0IA 4GP7A 2OAP1 1JEOA 4BRZA 2G0NA 2QJRA 4XFJA 1KERA 2OQIA 4B6FA 3PHIA 1DVRA 5FEUA 1WV1A 2NVBA 1F2VA 1S4QA 5M29A 4GXQA 1Q7CA 1SQFA 4M6WA 1HWYA 3LXXA 2VBFA 2V6BA 3NVMB 3QWBA 4YBRA 5EXEA 5ABPA 1SOUA 4CM7A 3RD5A 3V8MA 4TLDA 2PZLA 4FP9A 4LX8A 4F3NA 1AK9A 2JHGA 1OXMA 4EG7A 3BCSA 1ISGA 5AI0A 3RO7A 3DZHA 4DNPA 2W9XA 1C3OA 2C2HA 1AUOA 2WJ6A 3X43A 3AGQA 4E07A 1WVGA 4JC5A 1RFLA 3KR1A 4ZOQI 3QLVA 3PC2A 4B2YA 3I6QA 4EG8A 4DC9A 3EWAA 1O4WA 5JT1A 1DO8A 1QTQA 1ISRA 2L82A 2WFZA 3AY6A 3IAHA 4G0QA 3Q2IA 4QICA 2GARA 3QMMA 4ZT6A 1V37A 4ZCRA 5KU7A 1XU9A 2YWGA 3NTVA 4I1RA 5J5VA 3UT6A 3VUFA 5BOSB 1JR2A 4E09A 5HUQA 1SC3A 1L8XA 1L1QA 2MYTA 4X6YA 4IIGA 5UKDA 2H3HA 1R8JA 7MHTA 4CQLB 5DIFA 1YDHA 3Q10A 2XOKA 3WGHA 3DMTA 2WTBA 3PQEA 3C8DA 2JBWA 3GF4A 3RUFA 1UJ4A 2GZHA 4NIMA 5K99A 3ZZMA 1AKRA 4IGEA 5IK2A 1V8OA 5JMOA 1GNVA 5LKAA 2CLFB 2FW1A 3KKZA 4LG1A 3IO3A 2OO5C 4PAQA 5L7TA 4Z1OA 4WLVA 1J9ZA 5J2UB 3MBIA 2VTBA 4XB2A 5HKAA 1Y9EA 1DQSA 1E9AA 3WZLA 1D4OA 2WYWA 3E1GA 4GG1A 4Z51A 4JQCA 1NVBA 5JD4A 1JV2B 1DLIA 2OPHA 5FTLA 4BFYA 2AWNA 4ZHQA 5AQEA 2Q6KA 3IR6A 5KTRA 3FWPA 3TEMA 1GNTA 2OHOA 3VR6A 3EDYA 4MW9A 2QP4A 1E1RD 1LI4A 1DARA 2VPZA 3KZNA 4BO4A 2R6ZA 2Z4SA 1AY0A 3TLJA 3JXEA 4RJTA 1JLKA 7AT1A 3NUQA 2L0XA 4MKHA 1BE6A 2VAVA 3NBUA 5GMOA 1TTHA 4OL0A 2MCFA 3WFIA 1LLUA 3MCVA 4PNEA 5CBPB 5KIAA 3U56A 1OKKA 3FSJX 5DP2A 5BMVB 4FEAA 3FVQA 1P5HA 1Z2NX 1AKNA 1R0CA 1US8A 2C7RA 1GRVA 4HDSA 1SOWA 4I1SA 3RTEA 4J2HA 3DYVA 3EGWA 4M1YA 2AQIA 4PX3A 2BEWB 2W6QA 4I6JA 3C7DB 2XBUA 3KOMA 5AKKA 1SUDA 2GHTA 2DHEA 4OOFA 3CF0A 2NNLD 2VT6A 3L7IA 2EKQA 4I4LA 421PA 1X7ZB 2Q1WA 4YRJA 2Q7DA 1PKEA 4ITRC 4GBMA 2J9ZB 4LWQA 3EX7C 2ORWA 2UUPA 4PCVA 2OCIA 3N5KA 1G4HA 4NJEB 3HN7A 4PHGA 1ZS9A 2GB4A 5D1NA 5EC8A 5LDGA 1QHHA 1TF2A 5SY4A 1J9GA 1VXOA 2HCTA 4GR5A 1COWD 2TYSB 1J00A 4BLVA 3F8SA 3CEJA 1W0CA 2BUAA 2HU2A 2GCIA 1GRQA 3ESBA 4J29A 5T8KA 1S02A 3I9V1 1TGYA 3M2TA 2NO0A 4LGMA 2QTNA 4MPJA 3IQFA 1N4AA 3VTKA 1K97A 1SCBA 3M2PA 3VHXA 3TKLA 4F9TA 2EEZA 2EFDB 3GPLA 3DBVO 3FMIA 4HC4A 4RZXA 2P8SA 1G6OA 3QVSA 1SCQA 4RMGA 3ST7A 1JRLA 2YC4C 3PGKA 2PZJA 3PDCA 2YN2A 3IQZA 4FYHA 3R7WB 3GP8A 2R8YA 1JB9A 2BE7A 1XDSA 4LGVA 4X84A 1QNFA 3ANMA 3ANSA 2JJ2D 2QL6A 4PPNA 2H65A 3A6PC 1UZUA 4RWZA 1VKHA 4EWLA 3TUZC 1C9NA 3L1HA 3I61A 2NLOA 3MC1A 4Q1DA 1ST3A 3D6TB 4NATA 3D2BA 1KR2A 5BNWA 1EVZA 1L5WA 1KH1A 1XXLA 4BZWA 4F38A 1KWGA 1GFWA 3MIZA 5F77A 4MEBA 4UU1A 1NN0A 4DV6B 2F1KA 5D6OA 1CF2O 1XHEA 2I2WA 3B2NA 3LX6A 1KC3A 1O8CA 3OETA 4US0R 4ZVPA