2X8LA

Plasmodium falciparum lactate dehydrogenase apo structure
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
320
structure length
311
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Apo Crystal Structure of Plasmodium Falciparum Lactate Dehydrogenase
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
total genus 117
structure length 311
sequence length 320
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x8lA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2x8lA02
3D3WB 4AJNA 1A7KA 1G0NA 1ZKMA 3JQ9C 2HUNA 5EMHA 4CLEA 4DVJA 5H82A 4XDYA 4BO9A 3NGLA 3FF4A 3FNHA 2AQIA 2VTDA 3MJSA 2DPHA 2NTVA 3C8MA 4FOSA 3VVBA 5L51A 4D44A 3KZVA 4LN1A 5G4KA 4RVGA 3PIIA 1DPGA 1YDEA 4J7CA 4ZU3A 2X22A 3OJLA 1UDBA 2ZIZA 1AXEA 2V6FA 4A27A 1P3DA 3D5QA 4I9HA 3BMOB 4DWVA 3GEMA 1RYEA 1X7HA 4IPTA 4CMAA 2YV1A 3SEFA 3W6UA 4CMGA 1E5QA 2V65A 4YJGB 5KVSA 4R1TA 4RPJA 1R4NB 2NQTA 1BVUA 3I3OA 4B8WA 2CVOA 3WMWA 5A03A 3DEYX 1ULSA 4CMEA 1AN9A 2EV9A 3L77A 4LK3A 4J7UA 1PSDA 5A5EA 3HQ4O 3UW3A 5BSGA 2PY6A 3HFSA 4RDIA 4XIYA 4YTEA 4XGNA 4B4WA 5IZ4A 4RCVA 4WNCA 3GLQA 4DC1A 3Q6IA 1FMCA 4MIEA 2Y1FA 3KYCA 4JXKA 5JE8A 2SCUA 1ZVMA 2C2YA 2VYVA 3KRTA 4ESOA 3Q9UA 1KEVA 1PEDA 4GI2A 4DLLA 1B2LA 1KBZA 3BA1A 4WPGA 5EL0A 1YS4A 3PZRA 1D7OA 4BNNA 4YPOA 3GFBA 4CV3A 3KEOA 1UXHA 4WLUA 5T5QA 4I1IA 4GAEA 4OAQA 4DIOA 3IDSA 4XQEA 5EIOA 1AHIA 5I8ZA 3WFIA 1N9GA 2YHUA 2DQ4A 2ZKLA 4ZRMA 2UDPA 4R1NA 3ONEA 3C7CB 4WEOA 4EJ6A 4FFLA 2BF7A 1UXIA 5HWSA 1MGOA 1EVJA 1VKNA 2B4RO 4XYBA 1GL3A 1J49A 1DRVA 1XSEA 5KJCA 3H9GA 2YHIB 2P4HX 2J6IA 4PG7A 2Y93A 5JXWA 4O1MA 1YB5A 1OZAA 5DBFA 4BKPA 2BKAA 5JFOA 4FOOA 2CMDA 4KTTE 4R16A 3MOIA 3QVOA 5LDHA 4BQRA 1YBVA 3PP8A 3AU8A 3QRWA 1U3VA 1K5HA 5DF1A 1OMOA 3ULKA 1Y9AA 4IMRA 1PGPA 1HE4A 2FHSA 2AHRA 2DBVO 1Z74A 4YBZA 1FDVA 2PZLA 2VOEA 3VTFA 2WE8A 5H83A 1NPYA 4XQCA 3FTNA 2O4UX 4TSKA 1HF3A 3OA0A 3CPSA 3I23A 5IN5A 4A03A 1KC3A 3HN2A 4IGEA 4G2NA 4PLPA 4GKVA 1HE3A 3K96A 2UUPA 2JAHA 3EUWA 3PZBA 4R51A 3T7EA 2O3RA 4L73A 1WLYA 2WYWA 5F21A 4OGWA 1KEPA 3RAJA 1PJTA 3FR8A 4D0RA 4ZICA 3WNVA 3JQBC 1WDMA 2CVZA 5K0ZA 1U5CA 2X86A 3X2FA 3OA2A 2UUOA 3RC1A 1LUAA 1Z7BA 4XKJA 4Y67A 2AEJA 3GR6A 4CQMA 2HAEA 4YB8A 1I2CA 3WQRA 4E13A 2HK9A 2P5YA 3EC7A 1O89A 4ALJA 4IZIA 4YRBA 4I5FA 4GKBA 4K1LA 2Q46A 4R3NA 4IGFA 1ZSVA 5KJFA 2YJZA 3TRIA 1UXKA 1I3LA 3DBLA 1T2AA 2PGLA 3MWEB 1SMKA 3LDHA 3P7MA 4J0FA 4OQYA 7ADHA 5FF9A 4IIVA 4CV2A 4HFNA 4E4YA 2H5LA 1U9JA 2CDCA 5IAAA 4LGVA 2WYUA 3KYBA 4Y98A 1FDTA 5TT1A 1C14A 3V1YA 4XA8A 5ER9A 3NEPX 5GZ6A 2QW8A 4GVLA 1M2WA 3SBOA 2BELA 3BHMA 4XB1A 5IN4A 1C0LA 1XELA 2B69A 5COAA 4BO4A 1XYGA 2JFGA 2R00C 1R4MB 3ZWXA 4BNXA 3OIDA 3WOHA 1W4ZA 2EF1A 3GF4A 2X6TA 1GR0A 4Y9DA 3ETEA 5EN4A 3ZWVA 4E30A 3AU9A 2PH3A 4D45A 3UCEA 1I5RA 2XPCA 5JYEA 1XWFA 4RVFA 2Q99A 2Y68A 1BTOA 1P31A 4PLTA 4BKQA 4J90A 3LK7A 1IE3A 3OIGA 3FSRA 1EK5A 4NFSA 2B36A 4CM1A 3PI7A 1BSVA 1ID1A 2J3IA 3AM4A 1HDCA 4WLVA 1AHHA 4E0BA 3JYLA 3QA9A 5TS3A 4D3DA 1FJHA 4UUMA 3V1TC 5KKCA 1H5QA 1HE5A 4L76A 1JU9A 3STHA 2EJVA 5COQA 3HADA 3O4RA 4MP6A 4ROSA 4EUEA 4MVJP 2A9FA 1YXMA 4FD3A 3U5TA 3UAGA 1EVYA 4YCAA 3I9NA 3WLEA 4AJ1A 2UAGA 4MVJM 2IYPA 5JCJD 3DOJA 4DBZA 1HLDA 2VZ8A 3QIVA 1RWBA 2P68A 2VCYA 4KOAA 4FDAA 1PJSA 4AJOA 4OOEA 4XDZA 4HV4A 2I3AA 1WMBA 3Q0EA 1EQ2A 1EUDA 4CODB 3GPDG 4HNGA 1ZBQA 5L4NA 2HK7A 4RQUA 3JD1A 2GSDA 4UVEA 3H8VA 1CWUA 4E5KA 1YVEI 2Q50A 4K26A 3O03A 4K28A 3VOSA 1DO8A 3AUSA 2FZEA 4ZN6A 4DRYA 3GAZA 4KUHA 2OZPA 3OETA 3MJEA 4IXWA 3KBOA 3IC5A 1HDYA 1GD1O 3DHYA 5DP2A 5JAZA 1GUZA 3D1LA 4CMJA 4YRDA 3PWKA 3GHYA 4CM6A 4Q3NA 1ONNA 4LMRA 1V3TA 4RVDA 4CM9A 1QSGA 3GK3A 1N9GB 3OIFA 4IIUA 4CMKA 4NBUA 2DBZA 3OJEA 1XU9A 4JIGA 1DAPA 4YYZA 1DJNA 3EK2A 1LQUA 1Q7GA 4OOFA 4JNKA 2EIHA 3ZU3A 3GPIA 2VHYA 3WJAA 2X0JA 1EUZA 1UR5A 1X13A 4P4NA 1HDOA 3WFJA 2YQ5A 1C0IA 1GAEO 3AUAA 3KHUA 1PS0A 1E3EA 3B1FA 4K6CA 4UUOA 4XJSA 1ZK3A 4ZGWA 3OM9A 1SPXA 3U0BA 1HXHA 4WOKA 1PGQA 4CM9D 2JHGA 4H3VA 4JP2A 3RUAA 1DAOA 4ND1A 3A4VA 1WVGA 1GCOA 4I5EA 4Y6PA 1LDEA 1O9BA 1R0SA 2FR0A 4BNVA 3IL2A 3ZU4A 4D43A 4BNYA 2D59A 2AG5A 4BNGA 1VM6A 1P9LA 2NVBA 4XJTA 1JWAB 3M1LA 5IG2A 4XEHA 1KVQA 3E18A 4A7PA 3FN4A 4GWKA 4WK6A 2EGHA 3JD2A 5EPOA 1PQUA 3WGIA 5JBIA 1JVBA 3JD3A 3BTOA 1RPNA 4PG4A 3U3XA 4BGUA 1B14A 4IS3A 4CPDA 3ZWNA 3QWIA 1Z82A 2RCYA 1NXQA 2V6GA 1T2FA 5BSHA 4EDFA 4GX2A 3AM3A 1R6DA 3V2HA 3JYQA 3L9XA 5CEJA 4MINA 5G0WA 3RFVA 3HDHA 1BWSA 1O94A 5B4UA 3ZN2A 3S8MA 4Z6KA 3NAQA 1T25A 2VRCA 1TI7A 3INGA 4URFA 2VZ0A 3QWFA 4NHEA 1JA9A 1ZSYA 2CUKA 3DZFA 4UUNA 5THKA 2PH5A 1E77A 4JROA 2HMVA 1E3LA 1EE2A 1BG6A 2EKLA 3GNQA 6ADHA 4Y8VA 4AJEA 1Q1NA 4HBGA 4L0QA 1NVGA 2GN9A 1JKJA 3PQEA 3L6DA 3AOEC 4YJDA 1B3BA 2HJSA 1F14A 4NH4A 3WGQA 1BDBA 2EHDA 3K30A 4IMPA 2VHWA 2HRBA 2Q1UA 2VWPA 3KV3O 4DGSA 4JJGA 3M6IA 4S3MA 1LRKA 4BO0A 1L1FA 1JKIA 1LJ8A 4JP3A 3JQGB 1MC4A 2EW8A 4CMEC 1ZZEA 5C7LO 2I6TA 1RM0A 1NYTA 2ZCVA 2BMAA 5CP8A 4BMVA 5DCYA 3ITKA 3GVXA 3TJRA 2AE2A 4IJKA 2CFCA 4S1VA 4NG5A 2JFHA 5HA5A 1YL5A 3AUUA 5I7FA 4OIMA 1U5AA 2ZQYA 1NAIA 1YOVB 3ZV6A 4OQZA 1F8GA 4PLCA 5G0SA 1RM5A 1I30A 2I76A 4TVBA 1T2EA 1UZMA 3BYZA 3H3JA 3QV1A 4UEKA 4XIJA 1ISJA 2PKQO 2VHXA 4RPLA 5LDGA 4OM8A 2C54A 2ILTA 3UF0A 3FCOA 4IM7A 3JQ6A 4L9RA 2EW2A 3D4PA 4EITA 5A04A 2VYND 2V6BA 4PZDA 5TNXA 1E7SA 3CINA 4MIOA 1ZUD1 2CDAA 3PFWO 3SC4A 2XF8A 4N5MA 3HJAA 4PFJA 2W90A 4F45A 1H6AA 4D0SA 2DVMA 1LRLA 3M1AA 3ZNPA 1DOHA 3DB2A 2AQKA 3F46A 5CAEA 3LT2A 4A2CA 3FHLA 1E1MA 3CTMA 1H2HA 3OFSA 1EEHA 4J0EA 4E2YA 1MG5A 2O3SA 5TGDA 3PYMA 5C37A 4XR4A 1YE3A 1WNTA 5DBGA 3HG7A 3ZWMA 1JW9B 3B1KA 1GV1A 4MVJE 2Z5LA 1KEUA 1GQQA 2Y1OA 2YV2A 4NDNE 3EZYA 1NQTA 1V35A 4E5YA 4M54A 4KQXA 3ZNNA 1H0KA 3H5NA 5IDWA 4YJGA 1HDRA 3WBBA 1LLDA 5I9NA 3E9QA 3SLGA 3W4IA 2PR2A 1U2DA 2BGLA 1YRLA 3LQFA 2ZK7A 3C7AA 4I5GA 1HYGA 4YR9A 3PFFA 1KOLA 4AJPA 2GZ2A 2D8AA 4XGIA 4AJIA 4MDHA 3WWYA 1QXSA 4WNIA 4BNMA 1PR9A 3ANMA 2HU2A 1E1LA 1N5DA 1P44A 4AJLA 3DTYA 1MV8A 1WDKA 1IZ9A 1HE2A 4O6VA 3SJUA 1F12A 3EW7A 3R3SA 1U7HA 4NMHA 1YB1A 1WDLA 1NPTO 4A0SA 4JBHA 4P22A 4DPLA 4RGBA 4WCFC 4NQZA 5F1PA 1QLHA 1FDUA 1U2GA 1U28A 5JDIA 5KNLA 6LDHA 4HFJA 1SNYA 1ISGA 1MXFA 1JAXA 1PL7A 4HY3A 2X5JO 1V3UA 1ZW1A 3IUPA 4O59O 4N7RA 2NTNA 1U4SA 4OSPA 3NJ8A 3HHPA 3RSHA 4CQMB 3RKUA 2Q2QA 3C85A 4IUYA 4BUCA 3DZBA 2ZB3A 1XLTA 2FRDA 2O4CA 4JX8A 4EJ0A 3H9QA 1T2DA 3B70A 1PL6A 3W6ZA 1LQTA 3H2SA 1J4AA 1ZIDA 4XYGA 1PJQA 1Q7CA 1UXJA 4FFMA 4XB2A 4CUZA 4A73A 2E37A 3V1UA 4Q3AA 1SB9A 1LI4A 2HO5A 3QWBA 3UKOA 2GN6A 4G65A 3TDKA 4DQUA 3JD4A 4ZQGA 1NBOA 5JY6A 3HUDA 4XWYA 5IDQA 5KKAA 4LISA 2C5EA 2IZ1A 3OECA 4QTZA 3SX2A 5DZSA 4WE3A 2JAPA 1GUFA 1K6IA 1YL7A 3DBHA 2NV6A 4BOYA 5ITWA 3BHIA 3TWOA 1H2BA 1SC6A 1DRUA 1EMDA 3JQDA 1X1TA 1YGYA 3K9QO 3AWDA 4TRRA 2GUGA 3NDIA 1XKQA 2I3GA 4XZ3A 1GU7A 2HSDA 2ZJ0A 4TROA 5THQA 3VDRA 1ZEJA 3OJ0A 4CM8A 1R16A 1E3JA 1GADO 4YWJA 2EEZA 1EUCA 2GO1A 3GNTA 3KVOA 2BRUA 4PGFA 2BI8A 4RF5A 1ORRA 3FTPA 1W0CA 2WD8A 3E8XA 5AYVA 5TX7A 4DC0A 5FI5A 3E03A 4D46A 3RUDA 4ALNA 5IXSA 1O0SA 2A35A 1Y9EA 5A5FA 1YONA 3DFZA 3WQQA 4CV0A 4Z3KA 2AEMA 2RHCA 5KVQA 4R4JA 3HNPA 4HUJA 4CMBA 4M8SA 3INTA 4F46A 3TF5A 3RU7A 2IZZA 1NVMB 3BMCB 4YJFB 3S2EA 2ZYAA 3BTSA 4RVSA 2JD0A 3ZV5A 2FZWA 3ONDA 4YJHB 4GX0A 5L95A 3PIDA 2OXIA 4UAGA 1DC5A 1Q0LA 4RV9A 1QR6A 2X1HA 3TQHA 1DLIA 4IBOA 4YT2A 1J6UA 1BHSA 1JN0A 1A72A 3IP3A 4BNWA 3ETDA 1GTMA 1XQ1A 4W7IA 3WJ7A 4Q39A 4BNZA 2QZZA 3VPSA 5TLSA 1M67A 2OP1A 3PLRA 2GN8A 3WSVA 2GLXA 1NTOA 1VRWA 3PDUA 2EG9A 1PS8A 3RFTA 3RWBA 2JKVA 3W4KA 1HT0A 3KSUA 5BT9A 3E5RA 1V0JA 3DWFA 3C1OA 4XQ9A 4AJKA 1DFHA 3FRJA 1Q7BA 2NSDA 1Y8QA 1LNQA 4KQWA 1MG0A 1G0OA 4R01A 2ZB7A 4RF2A 1DDOA 3ZWBA 4JJFA 1XU7A 4LVCA 1CQJA 1QYXA 4PZCA 4RPKA 3WYBA 4Q3EA 1ENOA 2PNFA 5JC1A 5F5NA 1UJMA 4LMPA 1LDYA 1ZK2A 3BAZA 1DXYA 2O7QA 1B16A 4LRSB 3TNLA 3UH1A 4DA9A 3RUIA 1UP4A 4NZ9A 4QXMA 1XIVA 3KTDA 1A4IA 3IS3A 3GEDA 2ZB8A 4M55A 2HK8A 3JQEA 1KETA 4U7WA 4EW6A 3ADPA 4R1UA 4NK5A 5CPFA 4B3IA 4FB5A 3AY6A 1R37A 1CETA 2DM6A 2X7HA 1Y7TA 2WD7A 1YBAA 3LSYA 1BGVA 1P74A 3HDYA 1K6XA 5TQVA 1RYDA 3PTZA 3A28A 1XG5A 4B4VA 2BGMA 3F4LA 1R4NA 2O23A 3AFNA 5ENDA 5GZ3A 3FPLA 3WGYA 3BTUA 4UULA 8LDHA 4ALMA 3GHHA 4BO6A 1H6BA 5JCXA 3KLPX 2C29D 3GQVA 4Z9YA 7MDHA 2P4QA 1LEHA 1C1XB 4IXTA 1BMDA 2HJRA 2E48A 5KVVA 3HZZA 4UEOA 1EK6A 2WE7A 4NU6A 4E21A 4PLVA 3I83A 3ZWPA 4K6FA 4ID9A 2C07A 1ADBA 4BV8A 1CERA 4BNIA 2JFFA 3GOHA 1PTJA 3DAFA 2GZ3A 3C24A 3HB4X 1Y6JA 1PX0A 1NVTA 5K9ZA 1NR7A 1BW9B 2PKQP 1ENZA 4R54A 1JQBA 4ZD6A 3RC7A 2ZTUA 4ILKA 1DIRA 1YOVA 5F3RA 2PFGA 2PD3A 2WDZA 1ZO8A 1OOEA 2I65A 2R00A 3E9NA 2QQ5A 2PV7A 3QWAA 4MPDA 1T2CA 1E7QA 2UYYA 2IEBA 4M87A 2VQ3A 2D0IA 4YA6A 5G4LA 1EQUA 1NHWA 1UZLA 3AUTA 3I5MA 2B83A 4WJZA 1XHLA 1J0XO 3QVTA 2BGKA 4OO3A 2OO5A 2CVQA 5EESA 4CM4B 3R1IA 3KETA 4DL9A 3GMDA 2CY0A 2FSSA 1DC3A 2NU7A 4NBTA 4PG6A 4XR9A 4B8ZA 3CZMA 3AFMA 3LU1A 1N92A 4B4OA 1E1NA 2DTXA 2DKNA 1X0VA 2X0IA 1HRDA 2GGSA 5AVOA 1LSUA 2DT5A 3GEGA 3TZ6A 2W98A 2X9GA 3O9ZA 4OXNA 1NP3A 3BXXA 4R5MA 2EGGA 4AFNA 3LC2O 3MEQA 3CE6A 4FW8A 4FS3A 1GUYA 1DC6A 2RIRA 3H2ZA 2VWQA 1ZMTA 4CL3A 1ADCA 3EYWA 4MKZA 3WMXA 1XGKA 3I6IA 1IZ0A 2CSUA 3ZU5A 4GBJA 4QQRA 3DHEA 4RORA 1GPDG 2DC1A 4MVJD 1DFGA 3ENNA 5HBRA 2HCTA 1UUFA 1X15A 3VKUA 5U1PA 2P9EA 3GFGA 3JQ7B 1GDHA 4FC7A 2QX7A 5L4LA 2O3QA 3QVWA 3BTVA 4NFHA 2DTEA 4MP8A 5A06A 1PIWA 1G1AA 1CJCA 3QSGA 4CQLA 1HDZA 2W8ZA 3IP1A 1P33A 1R66A 1Y81A 1U4OA 4J1TA 2GYYA 4KTVE 4ND4A 1ISMA 5JYDA 3DL2A 5KWEA 4E12A 5JC8A 3NT2A 1TEHA 2D2IA 4B3JA 3GA0A 3GN2A 4I9UA 4U6SA 4EEZA 4FJ2A 4JK3A 4E6PA 3OH8A 4J6FA 3CH6A 1I36A 1SAYA 1PJBA 3PHLA 3OICA 3RVDA 1KERA 3FNGA 2C5AA 2I9PA 1A27A 2BFPA 1VL0A 4WKGA 4RZHA 4GSLA 2Y66A 1FK8A 1LXCA 1F0YA 1NQAO 1YL6A 4JBIA 5K6AA 1FDSA 5DP1A 3LC7O 2J5RA 5LCXA 4DLAA 1GZ4A 4BV9A 2RH8A 4UVIA 3K8ZA 2WSBA 2C7GA 4WUVA 4OH1A 2VNAA 2ZTMA 5EINA 3DZGA 4WECA 5JPIA 3G0OA 3UGKA 1QYDA 1W8DA 4OJNA 4BO3A 5JDIC 1ZMOA 1Q0HA 4J9VA 3ZHYA 2QIOA 1D4FA 3NTQA 3COSA 3L4SO 1QG6A 3Q3CA 3HDQA 3GVCA 3S2IA 1QP8A 1JDJA 2OMEA 1T26A 3DXFA 3KSDO 1MXHA 1E3SA 4JBGA 3EAGA 5JLAA 5TT0A 4JN6B 3U4CA 4BGVA 4EEXA 4FCCA 3B20A 2HRZA 3K2EA 3HB5X 1I3MA 3D7LA 4WGGA 3ZZNA 4L4RA 2DBRA 5ENVA 4TZKA 1ZK0A 3S55A 4TVOA 4DLBA 1Z45A 4W82A 1QMGA 4IZHA 1H93A 3RJ9A 3JV7A 3W8FA 4GX5A 1SEPA 5FI3A 3EGOA 4BO5A 4RDHA 5B37A 5JAQA 4RVHA 5I8WA 2NM0A 3GZNB 3LYLA 3GGOA 4FJ0A 1H9AA 2DPGA 2Q1WA 3FR7A 3NJ4A 3E48A 4B7UA 8ADHA 1GYPA 1TB4A 1N1EA 3BMNA 1C0KA 2B5VA 3DAPA 1UDCA 1PGJA 3GUCA 5F1KA 2PGJA 4LRTB 4OHUA 4CM4A 3KB6A 1F06A 3W8EA 4Y6SA 4FFPA 3DDNA 2YY7A 2E82A 2YFHA 3S1LA 4IDAA 3C7DB 3JSAA 3LT0A 5HM8A 5U4QA 2IXBA 1HTBA 2ZYDA 2GRAA 2J3HA 2WWRA 3A06A 4HKTA 1CYDA 4RVUA 1B7GO 3UCFA 2NVUA 3DC2A 5JMPA 3TPCA 3KUXA 2VN8A 4MVJI 3UOGA 3GZNA 3JYOA 4RF3A 3KLMX 4NK4A 2Y05A 1LC0A 4HWKA 3BMQA 5BSFA 3E82A 4PLHA 3INRA 3PHHA 5AXDA 5JMWA 2Q45A 4FQ8A 2NU9A 4J2HA 1VC2A 2H9IA 3DONA 3RIHA 4OKIA 3ROQA 3U62A 3VZSA 4YT4A 1KVUA 2ZATA 1O95A 3UCXA 4LCJA 4DPMA 3DMYA 4II3A 5MGBA 3MTJA 4LCEA 2FY8A 2J3JA 4PRKA 2AA3A 2B5WA 5A3JA 2EKQA 3JYNA 2ZTLA 1RM3A 3PHGA 3W4JA 4D79A 3WTBA 3BMCA 4D41A 3PJDA 1K6JA 3DMTC 2Q49A 5L40A 5CFZA 4DIBA 3H9UA 4L75A 5KTKA 2NU6A 3ANNA 1SB8A 4QFCA 1KYQA 4L8VA 4B79A 3EHEA 4O0LA 2JL1A 1ZSNA 2X9VA 3PJEA 4GMGA 3HE3A 1MFPA 2A4KA 4RJTA 3OJOA 3WQSB 1T1SA 4MVJH 1CF2O 4W7HA 3WIDA 4E5PA 4PIVA 4MKRA 1NX6A 4DPKA 1A4UA 1E6WA 3IAHA 3L07A 3RU9A 4YAKA 3L6OO 4BNTA 2VYVD 3DAGA 5TC4A 1IPFA 2P5UA 5ILGA 4ND3A 1P0FA 3U9LA 1NASA 1T1RA 1PQPA 2GD1O 2O3UA 4KDEA 5TJHA 4E5NA 1IYZA 1WAMA 3MJ4A 1VPDA 4E5MA 3I9JA 5DCUA 4Y6RA 3RBXA 3BMNB 1TLTA 4O63O 3OBBA 4WCFB 5FFFA 1ZFNA 4IDCA 1L7EA 3VH3A 4C7KA 4DBVO 1A7AA 1R0KA 2WYVA 1ZK1A 3KEQA 5CG1A 5DT9A 5JW6A 4HXYA 1OAAA 5AQ1A 5TIIA 1HDGO 4AL4A 4DQVA 3AOEA 1NAHA 3AW9A 1M6HA 3ZV4A 2W4QA 4J7XA 5HS6A 2QRLA 1ONPA 1UXGA 3CSDA 4JQCA 4QUKA 1PU2A 2Q1TA 3S2FA 1P1RA 1U8FO 3GGGA 4C4OA 1BRMA 4QEDA 1YDWA 1PZHA 4CLHA 4R3WA 3B1JA 3ZNQA 3QWHA 4QO8A 5L3ZA 5T67A 1Y8RA 3GH3A 4WCDA 3Q2IA 4AICA 1O5IA 4RL6A 4XGKA 3PLNA 3HN7A 5A3VA 3A1NA 4FGSA 4AVYA 5L7WA 3OF2A 1SZJG 2NADA 1V9LA 1FDWA 1I01A 3NX4A 1N8KA 3DR3A 3GZ4A 2QYSA 3FWZA 4MVJA 2Z1NA 5C3MA 4IS2A 3JQAD 2XXJA 2B4QA 1X1EA 2Y1EA 2OHXA 3NTOA 5T64A 2GERA 3H3FA 4IDBA 4BHTA 5A9SB 3VPFA 1E1KA 1HYEA 5JSFA 3SJ7A 2AE1A 3BMOA 3V2UA 2O3TA 4G81A 2GR9A 3FBGA 4E2ZA 3PQFA 3HFGA 4BKOA 4ITUA 2VRBA 5LC1A 1GZ6A 3VPXA 4RLSA 2GCGA 1WXDA 3DO5A 4IQ0A 5CEFA 1NQ5A 3ZWAA 1LRJA 4CR7A 4J91A 1LLUA 3K92A 1E3IA 4U6QA 5HS4A 1PJ3A 3JQAB 4M86A 2P91A 1C0PA 1PR3A 3VDQA 4R69A 3I1JA 1I10A 5CDGA 1I32A 2OP0A 3LC1O 2YYYA 2J5KA 3OQ1A 1JTVA 2EP5A 5A02A 1TT7A 4WLEA 5C5IA 3DHNA 3PYXA 4FN4A 2CF5A 2EWMA 5ICSA 4YVFA 3M2TA 2GN4A 1IY8A 3FWNA 1ZNQO 5A9SA 3H5AA 4YDRA 1E7RA 3P2OA 4AJHA 2JD1A 4UVDA 1KVSA 5L4SA 2AXQA 3IKTA 1VSVA 4Z9FA 2PKRA 3P19A 3PJGA 3E9MA 4YQZA 3AI2A 3PWSA 2FN7A 3ZDFA 5AXBA 4WLFA 1PQWA 1M6WA 4PN3A 2NQ8A 2Y67A 1YJ8A 4E33A 4WOJA 3QP9A 4U5QA 2YZ7A 4BKUA 3KO8A 1I33A 2QG4A 2TMDA 1U8XX 1C1XA 1GEGA 4Q3BA 3DFUA 1ONOA 4BGEA 3RUFA 1SCUA 5B1YA 2ZYGA 4U8GA 3C3XA 3ENKA 1GCUA 1HDXA 4KUEA 2C82A 3BMQB 3F5QA 2GPTA 3OP4A 4GMFA 1U1IA 1B0AA 2G1UA 3F3SA 2O2SA 4OKNA 2UVDA 5KIAA 1F17A 3CUKA 5CPBA 2NWQA 1ZK4A 4W4TA 3S2GA 2IODA 1LC3A 2BH9A 1P0CA 4CR8A 1OI7A 2O48X 4FBGA 1VJTA 4ZHSA 1IULA 3GAFA 5CEEA 2D4AA 3I9KA 2CZCA 3JD0A 3RC2A 1TT5B 4RPHA 4J16A 1AGNA 1I2ZA 4D42A 5K6AC 1LDMA 2HQ1A 5FWNA 1NFRA 1E3WB 1EBUA 4QECA 3GY0A 1UZNA 5L9AA 2DTDA 1XQ6A 4DMMA 3EVNA 2OL4A 3TFQA 5JS6A 4B7CA 4ONEA 4RQTA 1I3NA 4TKMA 2X58A 4AJ2A 5IZCC 3KYDB 3FI9A 3TZKA 2QZ9A 1DC4A 4FFRA 4J49A 3A14A 1MX3A 4NU5A 4M1QA 5G0VA 1IL0A 1MB4A 4HNHA 4CMCA 9LDTA 4CQMD 4PVDA 5MDHA 3KM0A 4I5DA 1DJQA 4ZVVA 3TSCA 4GGOA 3F47A 1D1TA 3JQGA 1IOLA 5DOVA 4NPCA 2HMSA 5AXAA 4MKXA 3TZHA 1NR1A 3Q11A 3G1UA 1RJWA 3VZRA 1JVSA 4U0KA 4Q3CA 1ZXBA 2X9NA 3LT4A 3MZ0A 1CEQA 4IDEA 4XD2A 2AQ8A 2W2LA 4LSWA 1IPEA 3PHIA 4Z0PA 1R12A 1I0ZA 1QLJA 4QFDA 3IJPA 2OGUA 1PWXA 1EE9A 1YQXA 5CDYA 3ICCA 2LDBA 5KJEA 5KCZA 1GFSA 2X5OA 3AY3A 3OQ6A 2OUIA 5IDYA 3DZHA 4XX0A 2H1SA 3RROA 4WLNA 2Z95A 4BNJA 5I7EA 4INAA 3O8QB 3WICA 4EBFA 3SVTA 3RBVA 3VPHA 2GDZA 4NFYA 2POQX 4BIIA 4CQLB 2XAAA 3PQDA 4BO7A 5A9RA 2IRWA 3E6AA 3WYCA 2WD7B 4QO7A 1M66A 4II2A 1XDWA 3ADOA 1VSUA 1A71A 1MFZA 1QYWA 3ZHXA 2XOXA 3NUGA 4CM7A 3JQ8A 3ZWCA 3K2BA 3N7UA 4JLWA 1R4MA 3Q9NA 3PVZA 3AM5A 3DBRA 3Q1LA 4BNFA 3DBVO 2JD2A 2NVWA 1Y5MA 1HWYA 2BFAA 2GASA 3ZCXA 1X7GA 2HMUA 2PZKA 1Q0QA 4KZPA 5F5LA 4F6CA 4H7PA 3WB9A 1DIBA 2WEKA 1MLDA 1ISHA 2R2GA 3IQDB 4OYRA 1KVRA 2VNSA 3JQ9A 2DLDA 3G3EA 4IY1A 1DIGA 1WZIA 4YJFA 1HLPA 1HZZA 2WM3A 1M75A 4YAEA 5JNLA 1WWKA 3VVCA 2X0RA 3GG9A 3R0IA 4CLRA 1EVIA 2PD4A 3MTGA 2FSVA 4CMHA 4O5OA 3G49A 5JAIA 4CUKA 2DBQA 4GVXA 2RHRA 4GGPA 5BNIA 2VWHA 1TXGA 2J5QA 3L4BC 3OJFA 1P45A 1DIAA 1TA4A 1NWHA 2JCYA 4OXKA 3WXBA 3U4DA 3NT5A 2PWZA 3BIOA 3JQ7A 4TZTA 5JY1A 3ON5A 4PG8A 2FWMX 3AY7A 2Y1DA 4MP3A 5A05A 4YAIA 4PRLA 2Y0EA 3VH4A 4FR5A 2WMDA 4YJHA 3FD8A 2B4TO 1K3TA 3H9JA 2VOJA 3RI3A 1PJ2A 3H5RA 4A5OA 2VUUA 2C0CA 2F1KA 4P4GA 1SBYA 2VT3A 1H94A 2Y0CA 2YUTA 1OC2A 3NV9A 3D64A 4CR6A 1A9YA 4BB6A 4NR0A 3DZJA 4N54A 3TL2A 1HZJA 1LBEA 1DBVO 1E5LA 3VH2A 1IB6A 1K2WA 2E4AA 3V2GA 2RAFA 5EQFA 4NJMA 3ZWOA 1JKFA 1VKOA 4JJIA 4J1QA 4WEQA 2NVUB 2VT2A 3D5TA 3RFXA 4XYMA 3F9IA 4H16A 3PK0A 1EVZA 2Q2VA 3EVTA 1VL8A 3QE3A 5F1OA 4EUHA 1KVTA 2C2XA 2Z1MA 1M76A 4GSKA 4I9NA 4LVUA 5G0UA 2FMUA 3ZHZA 3ZNOA 2QRJA 4RLHA 2PD6A 1ULUA 5H81A 4FC6A 1S6YA 2ZCUA 2JHFA 2AG8A 5IFLA 2FP4A 2J8ZA 3PWZA 2HMWA 3GT0A 3NTRA 1C1DA 2Q3EA 1QV6A 3D4OA 2VWGA 4XQGA 3IUSA 2WTBA 1BXZA 1Z75A 3DBHB 2G0TA 1H9BA 1N2SA 5KJ1A 3DQPA 3QQPA 2W2LD 3W8DA 1P1FA 1YQDA 3RJ5A 1EDZA 4EZBA 5CDUA 3BHJA 1EZ4A 5ICMA 3ST7A 4CLRB 2GF2A 1HSZA 1E7YA 3D0OA 4R1SA 2G76A 2B35A 4BGIA 4AG3A 4R5HA 3MWDB 4J9UE 3I4FA 3IMFA 5C7OO 5T8KA 2IXAA 1E3WA 3ZI0A 2BI7A 3LF2A 3QJ5A 3K6JA 4B7XA 4CLOB 5A1TA 3I9OA 3RUEA 4YACA 3OEWA 3OHSX 1PWZA 4D7AA 4CM5A 4ZQFA 1TT5A 2HMTA 1F8FA 1DRWA 1VLLA 3VH1A 1LLCA 1NFQA 4W6ZA 4XYLA 1MA0A 5IJZA 3CEAA 5ER6A 2IE0A 3MOGA 5TJ9A 3N74A 2VUSA 1LDNA 3JQCA 2DU8A 4YT8A 3LLSA 1T24A 3VTZA 1ZEMA 1E92A 1V6AA 3MJCA 2QRKA 3GVHA 4ZRNA 3ETGA 4E2XA 1XCBA 3EY4A 4XCVA 4XYEA 3ZU2A 4ND2A 5JAMA 4IDGA 1P77A 4BS9A 4EI2A 4GPD1 3IOYA 3PGJA 2FPGA 3V5NA 3GDFA 4GWGA 4WLOA 3ZV3A 1U3WA 4EYEA 2O3JA 5BNFA 3L6EA 1I3KA 2C7VA 2H63A 1B3RA 2OBNA 2OFPA 1SO8A 2J3KA 4IJUA 1Y1PA 1PGOA 3U4IA 1ISIA 2DFDA 3GG2A 4MIYA 5JDCC 3RQSA 3F1KA 1WP4A 3DZIA 1VI2A 4IINA 4OMUA 2ET6A 1HYHA 4H15A 3QHAA 4GH5A 4M49A 4ALIA 5KJ6A 2ZQZA 2DUUA 2AMFA 5JO9A 4BL5A 1ZJYA 4HFRA 1IUKA 4KWHA 1D1SA 2YDYA 3RD5A 5HRUA 3GUYA 3W1VA 3O38A 4EUFA 3WR5A 3AK4A 3E1KA 3OMLA 3V8BA 1DSSG 3DZKA 4UEJA 3ZGYA 2OORA 3RKRA 2X0NA 3ZH2A 2OOSA 1WZEA 1B15A 2XXBA 1P1KA 1Q2XA 4RPGA 2DFVA 3F4BA 4PVCA 4BO8A 4YRAA 1I24A 2NNLD 5JO0A 4G5HA 1UP6A 3IKVA 5ITVA 4CJXA 2I5PO 1C3VA 3WNQA 4CLOA 3OSUA 4NBVA 2YQ4A 5AOVA 1ARZA 2BLLA 1BXGB 5BSEA 3JQFA 4P4LA 4Q9NA 1PZFA 1D3AA 1MP0A 4J4BA 3WGHA 1JAYA 2X8LA 4B4UA 1LTHR 1Y8QB 5EQDA 5I7SA 3H4VA 3RBZA 4DREA 3GRKA 2X23A 4N5LA 4PLYA 5JDCA 1HL3A 3WWZA 4JCOA 4NJMB 3DTTA 2CDBA 1VJ0A 2JCVA 2LDXA 3I52A 5TSDA 3CZRA 1RKXA 1CQIA 1J5PA 1YQGA 3DOCA 1YBMA 4A10A 4WCFA 3EDMA 4BNLA 1BXKA 4J2OA 5BNTA 3UXYA 3U09A 1O8CA 2PZJA 3M2PA 2VHZA 1BXGA 4RZIA 5T57A 2B37A 3NGXA 2NACA 3T4EA 3NRCA 4RF4A 1HEUA 4FFOA 3JQAA 3JYPA 5A4DA 1KS9A 1Y8RB 3HSKA 4BQPA 4GQAA 4P38A 4AJ4A 2V6MA 2E6UX 3WGGA 2BD0A 3MCVA 4EJMA 3VC7A 2YHIA 5IZCA 5A9TA 1LU9A 4Z3DA 3JTMA 2VZ9A 3PPIA 5B12A 1E7WA 2NU8A 5CHEA 4DMLA 1GQ2A 3NDJA 4CUJA 1LLQA 1KC1A 4FGWA 3RC9A 3ROPA 2DAPA 1UAGA 4UUPA 4WASA 4KP7A 3PXXA 5DN9A 2FR1A 1GPJA 2Y99A 4TQGA 3VZQA 4E31A 4CMIA 4XRGA 2ZB4A 4D3SA 4DUPA 1QORA 2Q4EA 1W6UA 4EGFA 3WIEA 2VHVA 4NI5A 4TRMA 3WG9A 1IHYA 3GC6A 4PLWA 4BVAA 2FR8A 3OEYA 1NM5A 1WW8A 5B4VA 1LDBA 2QYTA 2D1YA 4ND5A 1KY5A 2EJWA 1FF9A 1GV0A 2DUWA 5DULA 4BO1A 4TMFA 2OBYA 3VKVA 3HWRA 4B3HA 5GZ1A 1B8UA 1PL8A 3I9LA 2FPPA 1UP7A 3HDJA 4CMIB 4XRRA 3GVPA 2PA3A 3WYEA 3H65A 5L45A 3JQBA 3NKLA 3EZLA 3G79A 3ROMA 3PJFA 5TRTA 4QT0A 3CXRA 2AEFA 3O8QA 5I9LA 3ZWYA 5IDXA 4YAGA 2YFQA 3KYDA 5DNAA 1BW9A 5DBIA 5CDTA 1MUUA 3RASA 2PZMA 1JLLA 4R68A 4OXYA 3R3JA 4TRNA 2VTEA 2X5KO 5EJ2A 4U0JA 3U49A 3FPCA 4FJ1A 1Z73A 1SOWA 2A94A 3GGPA 1DHRA 3QY9A 4MVJG 4ZQEA 9LDBA 2YDXA 3UUWA 3KOUA 5JCJA 2D3TA 3ZW9A 5HTOA 3AI1A 3AOGA 3DBRB 1XEAA 3DMTA 4ZQHA 3EMKA 3FBTA 1OBFO 1XR3A 1PZEA 2HKIA 1KEWA 2C20A 2V7PA 1U3UA 1VL6A 1MC5A 1AUPA 4IDFA 1HETA 4L4SA 4OSOA 2EERA 5IXYA 3OQBA 3T7CA 4J4TA 4HP8A 4PLZA 1GY8A 1ENPA 2FPIA 2Y1GA 3X2EA 1E6UA 3DOOA 1U7TA 4FPXA 4DQXA 3UVEA 1YO6A 4F3YA 4IQGA 3ABIA 3G17A 1AXGA 2AQHA 1PZGA 2JJYA 5G2OA 5L7TA 1LX6A 4IJVA 1ISFA 2IDZA 1GEEA 3ASVA 4DXHA 4YXFA 1PJ4A 3FNEA 1VJ1A 3GDOA 4FIZA 5GMOA 4MO2A 4J3FA 5G4KB 1YH3A 1X7DA 3I6QA 1R15A 3H9EO 2IEDA 2P9GA 1EFKA 2TMGA 2I66A 1K0UA 5CDSA 2BFOA 3TOZA 2D5AA 4KDFA 4MVJF 3ANLA 4R41A 4UREA 2W2KB 1NFFA 2PK3A 2PTGA 5BR7A 4DTIA 4UVGA 1DLJA 5T8KC 2Y0DA 1E0DA 1H6DA 3CMCO 4J1SA 3WTCA 1ZCJA 3AJRA 2BHLA 3ICPA 2G82A 3TL3A 1YJQA 5AXCA 4DIFA 1JWBB 4ALKA 1R0LA 3LLVA 1ENYA 1CRWG 4J4HA 3LF1A 1DFIA 2O2YA 4FSHA 1A5ZA 4ZQBA 3LZ6A 2Q2WA 1HSOA 4PLGA 2YW9A 3I4CA 2RH4A 4BMSA 5BQFA 4IJWA 3WGOA 4A26A 2G5CA 2YV3A 2WJPA 3VHRA 1WPQA 4D3FA 4BNKA 1X14A 2P9CA 3TN7A 5COBA 4BO2A 4F6LA 4R9RA 1Z7EA 3UFXA 3ZW8A 3K31A 3WDSA 1B8PA 1LDGA 2IYOA 4BMNA 2G17A 3MJTA 4GLLA 3D3WA 1N7GA 1I8TA 4M89A 1SEVA 2X4GA 1SOVA 3GRPA 4TWRA 4I8XA 4JGBA 1RM4A 1U3TA 3C1TA 1PJCA 3P2YA 4CLDA 5ILOA 4E3ZA 2CNBA 4NJOA 5TF4A 4PCVA 4UVHA 1P1IA 3P5SA 1YKFA 1QRRA 4L4XA 5C7IO 2CF6A 3GNSA 3T4XA 3CMMA 4ZJUA 3RUCA 1NHGA 4NBRA 1QKIA 4IQ8A 2PLAA 5GY7A 3NDRA 1GZ3A 3FNFA 1UAYA 4GX1A 5ADHA 5EERA 1V8BA 3TOXA 5J23A 2IZ0A 1YWGO 3Q2KA 2NTJA 2GNAA 1T4DA 1DIHA 1K89A 4QX6A 1B26A 3JQ8B 2PGDA 3SC6A 1IHXA 4CM3A 1ZXLA 3GN1A 2F00A 2RBEA 3D3EA 3RUHA 4P8RA 3H7AA 2R6JA 3L4BA 4TKLA 4K9DA 4LSMA 4N18A 2CD9A 3E5MA 3DBLB 2Q1SA 3ZWWA 2ZJ1A 2I99A 3WBFA 1VE9A 4CV1A 3F6YA 4YQYA 3K73O 1A9ZA 1X0XA 5DOZA 3CIFA 3WGTA 1V3VA 4I08A 4NNJA 1E7MA 3U4HA 1LSOA 3L0DA 4C7JA 1UH5A 4DYVA 1I2BA 4YEDA 1LSJA 5DDIP 3TZQA 4CLXA 3PYLA 2I67A 5I9MA 3QW2A 1Y5RA 2VUTA 3ONFA 2EP7A 3GDGA 3WS7A 1PS9A 2VYNA 1GYQA 2FOIA 2B0JA 3JCZA 5B4TA 1AE1A 1EDOA 5L53A 1D8AA 1EBFA 3O26A 2C59A 1YB4A 1Z6ZA 1QYCA 4PLFA 3RCBA 3PDJA 4DYDA 1DB3A 4PZEA 2UV8A 4W9NC 4CL8A 3G1TA 3ZHBA 4KWIA 1NNUA 4GL4A 4E2WA 1EFLA 3F5SA 5G0TA 3VAZA 4BKRA 4Q3DA 3NYWA 1HKUA 2O7SA 3WSWA 1N7HA 3SLKA 3PRJA 1QYVA 2A92A 2W2KA 3F1LA 3QVSA 4CM8B 1PJLA 4QSMA 3BZUA 3VZPA 1CIVA 1P1JA 2AW5A 2ZTVA 1CDOA 3UICA 3R6DA 4W9NA 1FXSA 4GLOA 2EXXA 1OFGA 2Q4BA 5T6BA 1N1GA 1T4BA 4NBWA 5U9CA 3LVFO 1BVRA 2H6EA 4HADA 3K5PA 3KYCB 4YAJA 2D5CA 3ITDA 3JQFC 3IJRA 2JCXA 3TFOA 1ADGA 1TVEA 1BDMA 3C1AA 2O50A 1PGNA 3TZCA 4ALLA 1L7DA 3WX0A 3QLJA 4KMSA 5I7VA 4KUGA 3ROKA 4BB5A 2QHXA 1G6KA 1KIFA 1DHTA 1ML3A 1OC4A 1W73A 1ADFA 4TRJA 1GQYA 1GYRA 4BNHA 5FYDA 4W99A 1DEHA 4FFNA 2HLPA 3I9MA 4RO0A 4MJLA 3LT1A 3WLFA 2VRCD 2NUAA 4X54A 3N58A 1QV7A 3CKYA 4AJJA 3GMSA 4PG5A 4MOWA 1NPDA 5IF3A 1C1DB 3MJVA 2EKPA 3NT4A 2P2SA 3VPGA 1E6EA 1B8VA 1O6ZA 3ASUA 3KXDA 2Y1CA 3GVIA 4LW8A 4Z0TA 3WGZA 4BNUA 3PHJA 1ZJZA 3UN1A 1H6CA 1WMAA 3AI3A 3KSZO 2E49A 4HFMA 4N5NA 5DCWA 1LSSA 4OL9A 3H6KA 2HDHA 4L74A 4Z0HO 4ZA2A 5ES3A 3D4NA 1LA2A 1ZH8A 3ORFA 3L9WA 5CG2A 2BFMA 1UDAA 1KY4A 4NIMA 3SXPA 5KVCA 2GZ1A 5FEUA 1NWCA 4Z9XA 4YT5A 4J43A 4J1NA 4E32A 4R9SA 3B6ZA 3IIEA 3A9WA 1NQOA 3QVXA 4HX5A 5L7YA 3UHAA 2NLOA 3PEFA 1XA0A 5KOIA 1S7CA 3PGXA 4IDDA 1P1HA
chains in the Genus database with same CATH superfamily
4PYLA 3M4YA 1G0NA 2QMUA 3F9CA 1T9ZA 2FRDC 2HUNA 3JQ9C 4AJNA 1UPBA 3I05A 5H82A 2CFRA 3TI9A 2E87A 3IAAA 3VVBA 2B3TA 2NTVA 1B23P 1D04A 3V7YA 3I1FA 5CJPA 2BVNA 3GFTA 4D44A 2CMKA 1NE2A 4PHTA 5IAEA 3E0XA 3QY0A 1RJFA 4RVGA 1U8YA 4OGGA 5BXYA 4ZU3A 3OJLA 2I7CA 4EY4A 4NYIR 2ZIZA 5KKNB 4G1BA 5DYTA 3P5BA 1ND6A 3DEAA 4X92A 4DWVA 1V1RB 4POAA 1YDHA 1JYSA 1Z83A 3OZGA 4JMLA 5D5PA 4C0QC 2A9OA 4QA9A 4D3ZA 1E5QA 2XQJA 3UIEA 1RYBA 1R4NB 3ECCA 2F1HA 4WN3A 2IWHA 1G3UA 5JS2A 1M54A 4OCZA 4QELA 3RTBA 3WK9A 2XUKA 2J3LA 4HDRA 2AB0A 1ACMA 1BHQ1 1QZXA 3SBXA 3WMWA 1F4LA 1RZUA 1ULSA 2WA1A 3DEYX 3LQ4A 1AN9A 3OM0A 4FMCF 1PUXA 1GAJA 3QEOA 4LK3A 1PSDA 4S0ZA 1YASA 2B6NA 4MYUA 3DMHA 5A4AA 1OR8A 1QCYA 3L7IA 5DNVA 4DDVA 3W5BA 3OO0A 4NYIQ 1E9VA 4C30A 2WUEA 1KYWA 3UWPA 1FRQA 3HFSA 4RDIA 1DX6A 4XGNA 4HPWA 5IZ4A 1F9AA 2AV6A 1KQPA 3CNHA 3GLQA 1WEHA 1FMCA 3N7TA 4TQUS 4X1YA 4AS3A 2R8ZA 2Q4TA 5JE8A 1XQWA 2I7TA 2SCUA 2IV2X 2DHCA 2ODAA 3DAOA 4UHJA 2AI2A 2C2YA 3STYA 2V5UA 1GCAA 3CV3A 2H2AA 2BHNA 2GD6A 1JR3A 1KQNA 2ZI5A 1AGXA 4GPTA 5EY5B 3BA1A 4WPGA 5I7RA 4GPEA 5AJXA 2PFKA 2X2OA 1ZXXA 3GGSA 4YPOA 1NDHA 4LQDA 1B76A 1U8ZA 2GPNA 3KEOA 4I4LA 2H4WA 4PONA 4I1IA 4EF5A 1YJCA 4GAEA 3LRTA 3QVKA 4LNHA 4DIOA 3FW1A 4P4SB 4IRUB 4PSVA 4U63A 3H6GA 3K4QA 4KVGA 3V34A 4R0VA 2DQ4A 2P2CA 3TTWA 1IBRA 3HKEA 5EZYA 2B8EA 4R1NA 2GDJA 4EJSB 2G80A 1SC9A 4FFLA 1HK7A 3L49A 4LEIA 1KE1A 3SZGA 4QASA 1MGOA 2Q5FA 3P4UA 5DI3B 4D3YA 1KI6A 4TWIA 1J49A 3IPCA 1KIAA 3N0RA 3QEMB 4R1OA 4DCTA 5KJCA 2V9ZA 1U1GA 4IVRA 2BP7B 2FFBA 1P7ZA 1XZJA 1UBKS 4LDNA 2RGUA 3PCTA 3EWIA 4HAZA 4O1MA 1I6KA 4EG8A 3DH0A 2QAGA 1IQ0A 3HWX1 4RAQA 1OZAA 4P5PA 4MA4A 4N3GA 5DBFA 3GFPA 4H6WA 1EIZA 4BKPA 2IXFA 1GRVA 3IT1A 1ZP6A 3C4VA 5JFOA 3F8TA 1WZCA 3FVTA 3IUMA 3RIGA 3VOAA 2O6HA 4WSOA 4YYEA 4JI0B 3MOIA 3PUHA 3MOSA 3SBDA 3F6PA 4MZXA 1MOZA 3D43A 5HK9A 2ONZA 1O95C 5JBNA 1X9HA 3QXHA 3MIIA 5GWXA 1VGRA 1XDGA 4NCHA 1SXIA 3Q15C 2GFIA 4D1YA 3OI7A 1ZAYA 1G5QA 2ZDQA 4MV8A 4PHHA 3V33A 3GCGA 1KQFA 1C7EA 4Z1MA 3R7WA 2JFOA 1FDVA 2PZLA 3GQBB 1LK0A 7ABPA 5KPJA 1COWA 3SDZA 2OGWA 3R77A 5FO1A 1NPYA 1ITZA 5H83A 4EBBA 3G0IA 4C4PA 1U6JA 4BFTA 4FFSA 1ODKA 3URMA 4QPCA 5IN5A 3O4IA 1WD5A 3CEHA 3MIZA 2O8BA 4ZK6A 4G2NA 3K96A 3IQGX 3EUWA 2JAHA 3MRTA 1K5PA 1CUSA 2GF0A 2HUPA 2O3RA 2RK6A 4NJEB 4R51A 5FBLB 3RR2A 2HX1A 4AMVA 4MZDA 3UT6A 3R9XB 2WK1A 2FEKA 3AKCA 4G8DA 4H6VA 1KEPA 2VDNB 3CTPA 4HJRA 1KQOA 1LX7A 4MITA 4YMUA 5J2TB 1KI7A 3KFLA 2YWEA 3VPAA 5K0ZA 2G1PA 3X2FA 4WZBE 4TLCA 3OA2A 1Q0PA 3OZTA 5IUJC 2AEJA 2IDMA 2WJGA 2HAEA 4CN9A 1N2CA 4EB6A 4DDUA 1QK5A 5I4IA 2QAGB 4E88A 5E2AA 2P5YA 3NUQA 1NXPA 4IZIA 5GIOE 4YRBA 3RVNA 4UZEA 3QEJA 2BE9A 3E27A 4U00A 2JRCA 4I1OA 3C3CA 4QUGA 3FFBA 3TQQA 1KOGA 1K68A 2ESRA 2ZIXB 4LOHA 5JYCA 1NRJB 2CHGA 3HLYA 2ZYIA 3MWEB 4OQYA 5EHNA 1R0YA 3LDHA 3UWSA 1JQKA 2HJVA 5CLIA 1SIWA 5FF9A 2VT7A 1P91A 4XGQA 3PQ8A 5I3CA 4AY2A 3G5LA 2Q0QA 3UQYS 1WXXA 1U9JA 3S2YA 5LOVB 2CDCA 3HA7A 1D2HA 1FMLA 2A14A 3NALA 2BFFB 3B3AA 1TYZA 2HV8A 1GKUB 2QENA 2WYUA 4I2VA 4IG4A 4ME6A 1Y1RA 3TLEA 1FLAA 2QGZA 1IJKA 3KYBA 4CDNA 4NOJA 1C14A 3ZVNA 3V1YA 4XA8A 4INOA 3NEPX 3CPJB 1W47A 3ONWA 4RKQA 1Z5VA 4JJAA 1FA9A 1L4LA 5LSAA 2HQRA 5JI3E 4RD1A 3A6HA 1TD9A 1TM3E 3V1KA 5CT6A 2SCUB 4DLSA 1Y1QA 3JX9A 4PBRA 5IXJA 3KZNA 4ZPJA 4BNXA 1OBOA 3OIDA 4KVZA 3MLBA 4I36A 3KR0A 3WOHA 3ZCVA 3E9DA 1RQGA 2WTMA 2X6TA 3VR4H 2J4FA 5KTNA 1W5SA 1GGKA 3UCEA 4R2MA 1GL7A 2WSSD 3IAEA 3QE4A 2IGBA 2AN4A 1SG6A 2X8JA 2Y68A 4RVFA 5JQGB 1GGJA 4AS1A 2XITA 4IOJA 4J90A 3KVNA 3HZOA 5EJ5A 2MSCB 1FIUA 2ZB2A 1YC2A 2Q2NA 1BSVA 1ID1A 2NUPB 2I7VA 3ENWA 3NM5A 5BY2A 2J3IA 3EOZA 4WLVA 3ZDBA 2WWYA 1KO8A 5EJ7A 1V9SA 3O1JC 3ABZA 4G41A 4R8SA 3ACCA 4GYYA 1FP6A 1M0TA 3LVQE 4L76A 2Z3WA 5HDQA 3STHA 2EJVA 4B0PA 3ZD9A 1VMKA 2V5AA 5DEOA 3ZY4A 4MP6A 3HNRA 3WRXA 5C9ZA 2A9FA 3A10A 3W2IA 1S8OA 3TG2A 2XQIA 3K09C 4FD3A 3FYCA 5IP5A 2OXCA 5E1BA 4UNQA 3KHSA 2AK3A 2IYPA 2NOAA 2QT9A 1QO0A 1IZ8A 1P2FA 1V4NA 2V03A 3DOJA 4BY9E 3QIVA 1Y8CA 5BOSB 1V47A 2P68A 3UJ9A 1RLUA 4FUQA 1J1IA 2G07A 4V0LA 4XDZA 2WSLA 1DXHA 1ZGGA 2VTBA 1Z08A 1GKKA 1IM5A 4CKBA 2JNWA 3LX4A 4R7TA 1EUDA 1KZ1A 1KXJA 1UANA 2O7RA 3FPGA 3UMFA 3EGDA 4CODB 1ZBQA 5HYVA 1QQBA 1N2XA 2HK7A 1WM1A 3BCRA 3JD1A 2GSDA 2XYPA 1RJGA 2H7YA 3A1WA 3ITEA 2JAQA 4K40A 1XMOB 3TCNA 4ENVA 3H8VA 3FZQA 2WKSA 5IM4A 3GLFE 5L3SA 1YVEI 2FZCA 2Q50A 1Z6AA 3IHLA 5TQ2A 4BQEA 3CISA 2ZZNA 2Z3ZA 4K28A 3T9AA 1SVNA 3AUSA 2FZEA 5I3ZA 3GUVA 4LYFA 4B31A 3TLAA 1T8SA 1G6Q1 3SIPA 4DRYA 1NU8A 2QUIA 3MJEA 1OV6A 2HSJA 2R86A 2YIMA 3KBOA 2Y92A 2XIQA 3IC5A 3QJGA 4QWMA 1HDYA 1GD1O 4YECA 5EXDA 3VU9A 4R9NA 4TV9B 3SLRA 2J67A 3QE2A 1A76A 4CM6A 2L18A 4Q3NA 4QUEA 4MV3A 3IJ5A 4ZVPA 1JE1A 1V3TA 4RVDA 4QHYA 1QSGA 2GVZC 4W5OA 4WV3A 1DAEA 1N9GB 4Q1AA 2V8OA 3DM5A 4YXWA 4CMKA 4RMGA 4NBUA 2ZUVA 4C43A 3BQ9A 1SBZA 2ZYWX 3A6KA 4I4NA 2WVJA 3CLSD 3X1ZA 1N6KA 4L4ZA 1HC7A 4RA9A 1Q7GA 4JNKA 4M1EA 1HLGA 2QTFA 4ZYWA 1KMNA 1NMQA 4XJXA 3BWYA 3GD7A 1PL0A 1XJQA 5K6RA 1N36B 4M8LA 2H5EA 4PFKA 5JAPA 1JUDA 1UR5A 1E98A 1JEQA 1X13A 3AI7A 3M5DA 3DJYA 3UJCA 2YQ5A 1C0IA 2EFEB 3F6RA 4QVKA 2FQXA 3CY6A 1A9TA 3OCYA 3L8MA 1NX9A 2G0NA 3B1FA 1X7WB 3QKSB 2W7TA 4TUYF 4WZ6A 4XJSA 4DFDA 1E2PA 5LMNB 3V4OA 1YZTA 1CUIA 2YWCA 4KE7A 5K4GA 4DKJA 3PTLA 1PGQA 4QGAA 1PQ4A 2JHGA 4H3VA 4JP2A 1Y4AE 3HVIA 1SOAA 2OAGA 4LYJA 4M1KA 3EZ2A 2BWJA 3SY8A 3WKCA 1GGEA 1O9BA 2FK8A 1R0SA 2C9YA 3KJEA 2H4FA 3OCUA 4QIHA 5CBPB 2AVDA 4R1MA 5BUQA 3RUPA 4F84A 4B6FA 1RI1A 2FP3A 3HCAA 1ZI8A 2BDEA 2OA0A 3KUKA 3DLPX 1VM6A 3V55A 3ZLTA 4ZI7B 1MDFA 1KK2A 4G23A 4XJTA 2UU9B 1JWAB 4HCJA 3P8ZA 3M1LA 2VEDA 1O96A 1PBNA 2PZAA 3HVUA 4YI3A 4F9GA 4XEHA 1W4LA 4HLDA 3W9UA 1PTKA 1ZM2A 5BN3B 5HIIA 3E18A 4A7PA 3FN4A 3IIKA 1AF4A 5DW0A 3TUZC 4WK6A 1BYIA 2ZPUA 3R2JA 5EPOA 5FUXA 1TTHA 3I6BA 4EB0A 2MSNA 4RCYA 1NUHA 1BE8A 1B14A 4HC4A 2EF0A 4CPDA 4BZPA 1W4BA 3LVRE 3SMVA 1I94B 1FSFA 2VSFA 2RAPA 1A9QA 2RCYA 4F60A 3HXQA 1NXQA 5HJ7A 2V6GA 2IIQA 3CZAA 4EDFA 1AJEA 4C1BA 2G04A 4FN5A 5A4IS 2XEXA 1X3LA 4MINA 5AOCA 3HDHA 5EP1A 3RFVA 3CKMA 2QWXA 5AUPB 1JEOA 3OEHA 4C7MA 2Q3DA 3PKJA 3ZN2A 1QIFA 1T25A 2VRCA 4A2WA 4IZOA 4LHZA 1FFBA 2VJKA 3PC8A 4QEZA 5LZ7A 3QPWA 3WV5A 1Y7HA 4LKRA 4JROA 3B5EA 2W6ZA 4I1VA 1E3LA 4B9EA 1SXJD 2PEYA 4YMTA 1BG6A 6ADHA 3MMNA 3N0TA 3M7IA 1M7GA 1Q1NA 2D0DA 2IBMA 4OTZA 3W5JA 4M0PA 2F9FA 1Q6YA 3PQ2A 5KZMB 5CCBA 4KPYA 2B2XA 2IHVA 5E6SB 3AG5A 4GE0A 1UT8A 1ZN7A 4TTRA 4ZJYA 6ABPA 4FEGA 5A7GA 1MO3A 1MVNA 3C4QA 1WX1A 2QMQA 1F14A 4PHGA 5DNEA 4HLNA 1W0KA 5CM9C 3T1OA 3EVEA 3V4LA 2EHDA 4RFSA 4LRXA 2ZRKA 3CU5A 3VNQA 2FSFA 3AVWA 2G5TA 2QPAA 3DLCA 4LI3X 2ZR0A 2TS1A 3VR0A 4DGSA 5DYYA 1DELA 4BO0A 1L1FA 4GBMA 16PKA 1FE8A 4H0FA 4CF7A 1D2GA 4JP3A 1VMDA 4JLSA 3JQGB 4N49A 1J99A 1NDUA 1W2WB 2I6TA 5C7LO 3KPWA 4L2IA 1KRHA 1KOFA 2B3DA 4O2AA 5CP8A 5FNZA 4BVLA 4HNVA 3D7SA 1G7CA 4LI0A 3STXA 5CA1B 1S3IA 4FWIB 5DCYA 3GVXA 4B7AA 3TJRA 2AE2A 2EU8A 4IJKA 1X7YA 4UBJA 4YMLA 3S2ZA 4HDSA 1X39A 3AUUA 3DW1X 2XQFA 5DRYA 1I6WA 1U5AA 4LJLA 3ADBA 1K3FA 3HYLA 1F8GA 1G5PA 1KA9H 2R6AA 1K7FB 4W63A 4BDTA 2C1EA 1T2EA 3LBYA 4UEKA 4DMMA 1C9EA 2FZVA 2W58A 1ISJA 1SBNE 3CFYA 3FDIA 4U5XA 4ZVLA 3OZEA 2G9NA 2IYLD 3TPFA 4RJIA 3UF0A 4GC5A 4IM7A 4QU5A 2HLNA 5H70A 1TW3A 4FGLA 4B2LA 4CTOA 1T6NA 5BXQC 4L9RA 1KXZA 3D4PA 4EITA 2BHTA 5A04A 5SZKB 1MJHA 2HO4A 4E15A 3C5VA 2JJMA 1OLSA 5LZ4A 1CZOA 2COEA 3CINA 1ZUD1 4G5SA 1M34E 2O5CA 2VC2B 2XF8A 4K6OA 3QLVA 2FSGA 3EIHA 3FFXA 2W90A 2LUOA 2G77B 4W7SA 1WB9A 2DVMA 2J9XB 3RTDA 4X7BA 3ZNPA 4JUIA 2PLFA 2A8YA 1NMYA 5FHRA 1CR2A 1RQ7A 1RPAA 2HPHA 3KT8A 3SEQA 2ZRPA 1JG2A 3E2IA 1MG5A 2AHOA 2DMRA 2O3SA 3PYMA 1FX0B 4FNMA 3VO9A 3FCXA 4B71A 1YQWA 2IC5A 4JVOA 5CNJA 3ET5A 1WNTA 2PN1A 3WDLA 3H5TA 4ML3A 1R3UA 1CKEA 4OK6A 3N2ZB 1FZQA 4QTUB 2WJHA 2Z5LA 3W04A 2PSJA 3GZTB 5EJ9A 1S4QA 2IYQA 3EA0A 1O0CA 3EZYA 1DUSA 3TD9A 3AR8A 2WUWE 4W1RA 2R8EA 2ZP1A 3H5NA 3LPAA 4YK7A 3WBBA 4F71A 1ZUIA 3SLGA 1KSJA 3HU5A 1DUIA 4JWTA 3AC0A 1E1CB 2Q29A 1UFOA 1ZHHA 2WU8A 2CB9A 2FSHA 2XT6A 2Q3CA 4HQOA 3CWCA 3ZHOA 2QX4A 1U2DA 4Y9RA 4QM7A 1HNZB 4A6PA 4BXOB 1YRLA 1PNTA 4YQEA 2ZK7A 5BN4B 4GM4A 3PT9A 3C7AA 4PGMA 4C4RA 4I5GA 3CLRC 3THWB 1W581 4EA9A 3PFFA 4YR9A 5JARA 1JEYB 2GZ2A 4DW8A 2IYSA 1YA8A 3FH0A 3O2QB 4JR2A 1ISSA 3OQHA 4WNIA 1IBSA 1W1IA 1DBWA 3LJKA 1KO1A 1PR9A 1M9NA 3ANMA 2HU2A 3QHQA 1IXZA 4M0FA 1JHAA 1P44A 2FZ4A 2ID7A 3DTYA 5CHYA 2O59A 2ZGVA 4O6VA 3SJUA 4RDCA 2X7JA 2VK8A 2JI9A 3QPAA 5AVKA 1NPTO 4ND6A 3CF6R 4Q7KA 1T3SA 3T52A 1T10A 4DPLA 3AP3A 2WJWA 2IXDA 3M34A 2RH9B 5JATA 3NDPA 1P80A 4UMVA 4ENSA 2C1ZA 2ILVA 4Q9LA 5JDIA 3DXXA 2YMMA 3FYUC 4HLCA 4M22A 5F51A 1E63A 3SHFA 3G6WA 5FQNA 6LDHA 5IW8A 1ISGA 1Q6ZA 2HHJA 2OZEA 2QM8A 4J0KA 4JODA 2WMOB 4ZALA 1SXJE 5BQ3A 1MJGA 1VP3A 3FPFA 1V3UA 2A4MA 3GCZA 3IUPA 3KKEA 1JJFA 4IV5A 4OMCA 1XALA 5GGXA 5JHGB 3AHIA 1U4SA 1JXQA 1NVBA 3PNMA 4RS4A 3ICQB 3PIRA 5CAEB 1Y3HA 2AS0A 4BUCA 1NW6A 2A2ZA 4I5IA 4GT1A 2O5EA 4BU1A 1NN3A 2IUFA 3OIVA 2HA6A 1FEZA 3KB2A 1A69A 3RVRA 4JJ4A 5BR4A 1PL6A 4HOYA 3W6ZA 3PR3A 3MRVA 3L5OA 3TEJA 2XMRA 5D6NA 2CUTA 5EAIA 2Q9CA 3EXAA 4FFMA 4YI5A 4LC0A 3AR3A 3R5TA 4JLBA 3H5OA 3G2HA 4ZV7A 5BN3A 1IVYA 4EFLA 5FUVA 1P4RA 1O7JA 2AF4C 5E1OA 3HRHA 3QKWA 1SUSA 4Q3AA 1LI4A 3A1CA 5DTIA 5TQ0A 2RHMA 4L5CA 1XCLA 2GN6A 3UKOA 1GLNA 1ZUWA 4ZQGA 3MBIA 1NBOA 3CO0S 5HKLA 2PEZA 2RGGA 2XV1A 3X43A 2WFLA 2WUFA 5LA6B 4L7QA 3OECA 4FZRA 2XXAB 3SX2A 4LS3A 2G5GX 4V1CI 4G3XA 1GUFA 1BGXT 3GJQA 1T43A 3D5EA 1K6IA 3ZXYA 5KNLA 3DBHA 2Q4RA 2NV6A 5GONB 3AEXA 3GT4A 3MTBA 3WOVA 4ZZIA 2QN3A 3BHIA 3TXYA 1CS0B 1BYUA 1P0MA 4OQXA 1C81A 1EINA 3AWDA 4P08A 5IEBA 2OAP1 3FNIA 4O4LB 2ONJA 2I3GA 4XZ3A 2X13A 3WAKA 5TQJA 2Z9BA 4F91B 3C14C 4DY6A 1GU7A 2DECA 3W5CA 3EA4A 3K15A 3NBQA 4KFUA 5THQA 1SZDA 4YJ3F 5EE3A 1ZEJA 3OJ0A 4CM8A 1SXJB 1GADO 4HNQA 4E7PA 2JS7A 1QGYA 1YNSA 3KVOA 4Q02A 2BRUA 4HN4B 4MLZA 4RF5A 1WSBA 3FTPA 3KKOA 2WD8A 3E8XA 4HB2A 2I8LA 2ONKA 3UMJA 4LTNA 3VR6A 3RYFA 5CDHA 1K9SA 2IEGA 1F8UA 1G8YA 1OYYA 1U1EA 3R6WA 5D84A 2A6PA 3HKCB 3FVRA 3TW0A 1KZ9A 4I3FA 1YONA 4WK4B 1BOOA 3R7SA 1TC2A 2RHCA 5KVQA 4R4JA 3FSJX 3HNPA 1MT0A 1BKSB 1MJFA 3RU7A 3DLAA 1NVMB 1TTQB 1XZIA 4FYMA 3DDCA 1XPUA 1VG8A 2HA5A 4DDMA 4RVSA 1V6CA 5DM2A 4PRYA 2XUDA 5EUCA 5ALTA 3PC6A 1IN5A 4GX0A 4R6WA 4CI9A 3PIDA 4O4HA 4UAGA 4V24A 1KYVA 4ZT4A 2Y9PB 4KKXB 2X1HA 3QXSA 1E99A 2WDPA 4GG1A 4YT2A 4QLOA 4TUYA 1J6UA 1BHSA 1JN0A 1P7VA 3WHPA 1A72A 5HW0A 4BNWA 3ETDA 4E46A 4EELA 3ZHSA 2J6HA 2JZNA 3WJ7A 5KOJA 2X0DA 1J0EA 3SR0A 2OP1A 1J00A 3AEKA 1FBTA 1DADA 3Q7QA 4H31A 4F5WA 1RWQA 3Q8LA 1N7IA 1DQRA 2GBLC 4PTLA 4BFUA 3K70D 1VRWA 1EM8B 2EG9A 4WBNA 3AV0B 1IVSA 3NUZA 2HSWA 2R5NA 3MUOA 1H1TA 3N5KA 1FU4A 1SM4A 2WTNA 3W4KA 4KPEC 1WMEA 2BM1A 2J6CA 2YN0A 4PYOA 5BT9A 3ZHRA 1UOEA 5C8YF 2LV8A 2R11A 4XQ9A 4QDZA 2C9OA 1NN1A 2CNDA 1DFHA 3LBFA 2NSDA 1A8UA 5M34A 4JUAA 4EHNA 4FFDA 2BFDA 4RF2A 4RL4A 2E1RA 4JJFA 3I8OA 3LUGA 1CQJA 1QYXA 3C6YA 3WYBA 4ZANA 4Q3EA 4A9AA 4OHMA 3MJHA 5JC1A 1WOYA 2D4HA 4LMPA 1ZK2A 5DYGA 5IJ0A 3UH1A 1UAAA 1JILA 1SQ0A 2G7ZA 3UXHA 5AVWA 2QRZA 5K20A 3DDWA 5CB0A 2F3TA 3AVYA 3NYIA 1V8FA 2CDRA 4IXNA 4LF7B 3JQEA 4N12A 1CR4A 1O8BA 3H1GA 5HJEA 1AS3A 2A86A 3EEYA 2A5JA 2AFHE 2I3ZA 3PNPA 4URWR 1ORWA 3VPDA 2FE4A 1CETA 1KFBB 1KO7A 2X7HA 3RJTA 1PV4A 1E62A 2QZ4A 1BGVA 1NMXA 3NWJA 2DG2A 3BT7A 3MT7A 1VMIA 3YASA 1U4NA 3AILA 2HZ7A 1NW8A 2V98A 4JVNA 2ANBA 3KC2A 3AFNA 3SOPA 3CLUD 3UGJA 4ZXPA 2C97A 4DZZA 3N53A 3ODGA 3RT9A 5LUAA 3JATB 2EX0A 3HSYA 1VSQA 2N47A 3C7KA 3WJ2A 4F12A 5JMOA 4L3VA 1RE1A 1H6BA 4FFVA 3CW2A 1V11B 1XL1A 4JFRA 4LWQA 1LEHA 3MINA 3N8DA 3OKCA 4DDHA 4JQYA 3HZZA 4UEOA 1OX4A 3WL5A 1RHUA 3Q72A 1EWVA 3QUCA 5JH7B 3I83A 2FPOA 3C74A 3MS4A 3HGQA 5JZBA 2P3SA 5DGXA 5JS8A 4O2BB 1SHJA 4N39A 1KARA 2XUZA 4GI3A 2CKDA 2JFFA 3GOHA 2FW6A 1PTJA 3HB4X 2F17A 2OSBA 1NVTA 2B6HA 3ZHCA 2OO7A 3A8TA 3JATA 1NVXQ 3NHAA 1BEUB 4KOEC 4F93B 1ENZA 1JT9A 1SWVA 2ZTUA 3M6MD 5ADUS 1JI0A 3PXEA 4LF4B 2VSQA 2PD3A 2EP8A 3FVWA 3BJZA 5E9AA 2WDZA 1DMSA 3TLBA 1ACLA 1UZAA 3N3BC 5EIEA 3C8DA 2CMFA 3CX4A 3TSYA 4MPDA 1YUMA 3KE9A 2N0SA 2ZSKA 4HAIA 1L7AA 4KVFA 4M87A 4XPIA 3WISA 4QQFA 2VQ3A 4QUAA 4IJ6A 1WETA 1T0HB 1BQ3A 3B9PA 2FG7C 4HLUC 3KQSA 1LPAB 2PMDA 4WJZA 2B83A 1U63A 1TYBE 1XHLA 4F3TA 1T1JA 1Z2AA 3U6KA 5J2TA 1AOXA 3L40A 1E79A 4PAQA 4ZGGA 1T5HX 3L02A 4EY8A 5KOHB 1FMTA 2YUIA 3HACA 4OO3A 3VX4A 4WKCA 3EIWA 1J2YA 4YP9A 3R1IA 4D98A 1W5AA 2XOKA 3GMDA 2FSSA 4OLJA 1DC3A 1I7PA 5ELMA 3WXMA 1RQNA 2WZQA 4MPJA 1WZUA 1G3IA 3B8EA 1EIWA 1ZH2A 5WRFA 3LCRA 1T4CB 3ESAA 1X0VA 5AW9A 4ZDKA 4YMIA 3GRZA 3L0CA 1AUXA 5AVOA 3NORA 2DT5A 3GEGA 3T7KA 1U2RA 2M6SA 2PRSA 1SHLA 3TQTA 1O87A 4I9GA 2FJUA 1EFUA 1G4HA 4NXMB 4OXNA 1DCFA 1SXQA 1XTQA 3O90A 4FW8A 4F8JA 3BEDA 4BP1A 4M6WA 5CFQA 2XODA 4OM7A 2HRQA 1Y1KE 2YVKA 4JOSA 1RWPA 1ADCA 2A88A 3EYWA 3M5PA 2VXYA 4NSNA 4Q4AB 3WO1A 1RLIA 1XGKA 3I6IA 3KEMA 1O94C 4TLMB 1WDWB 4POOA 4QQRA 2H4ZA 5CVEA 4GC9A 2X41A 2IQ5A 2DC1A 5FOUA 1TM1E 1H65A 4F3CA 3LDUA 4CIDA 2HCTA 1UUFA 3HZHA 4FCVA 1RRVA 3AESB 2REXB 1R3DA 3JQ7B 2WU0A 1GDHA 4FC7A 2QX7A 4WD3A 3H8SA 4Q6BA 3OCXA 1L5OA 1Z4OA 5L4LA 1M2KA 4IH1A 1MIOB 4RVNA 2JLVA 1L0BA 1IQUA 1LPPA 1P0PA 2WIJA 2FV8A 3K0BA 4CQLA 4DXDA 1HDZA 1Y81A 4MWTA 1T1GA 2GYYA 3H0CA 4Z2YA 3RS5A 4WKPA 1G8AA 2OTCA 3K2IA 2SKEA 5KWEA 2VXOA 3ETHA 1W88A 2I1VB 1YD7A 1J42A 4C05A 4HEHA 3DOHA 4QPZA 2IPNA 1NUAA 4I9UA 2ZYVX 3EUEA 1KMHA 3EH1A 4U6SA 4YJ2F 3Q5DA 4FJ2A 4EEZA 4YRGA 2BH2A 1JHUA 3OH8A 4J2TA 4LSZA 4AMZA 3GU3A 3PHLA 2VPIA 4XTCS 2Y2VA 4HQNA 1KERA 1C7FA 1Y9JA 2XWBF 4TUYB 5LP6B 3WKDA 1ZCBA 4X1IB 4D4JA 2RE8A 1YB7A 3DEZA 1M2NA 2I9PA 4BLTA 2BFPA 1VL0A 3GP3A 1T8UA 3O2NA 4WKGA 5AJYA 1RI5A 4GSLA 4P83A 2R1TB 4N7MA 2WFZA 1J2RA 1YL6A 4Y7DA 2RBGA 5KQLA 1FSPA 3KNZA 2QQGA 4YO8A 3HY6A 2K87A 4OJYA 4QYSA 5TE9A 4V39A 4LSGA 5LCXA 3EXG1 4NNPA 2P90A 3GBVA 4BV9A 2RH8A 3V2IA 3N28A 4G24A 1ZGJA 3ASYA 1IJFA 3S6JA 4UCXA 1K98A 3LO8A 3DZGA 4L0MA 4V02A 4GMHA 3CUEF 1KDPA 4IFEA 3UGKA 3VQTA 2XTAA 5JDIC 4NBNA 4J6EA 1T2NA 2I4NA 4LVNA 1Z2PX 4TV9A 3COSA 2PBFA 4D9IA 1LFAA 2PRJA 2YY5A 3HXKA 3Q3CA 5E9QA 2W6JD 4JA2A 4ISCA 5FLKA 5JVDB 1QP8A 1X3SA 2A1UA 1IOWA 1JBEA 3PXDA 4ACBA 1TQDA 1N2OA 1QMPA 2WJZB 3DXFA 2R7LA 4TV9F 1J33A 4Y2XA 5JCOA 4HDQB 1EXWA 1E3SA 4F0JA 4L6CA 4JBGA 1OAKA 3EAGA 5EFZA 3QVMA 5JLAA 4JN6B 1T4MA 3MFYA 3HO6A 5TARA 4B87A 4EEXA 4ES6A 4RIFA 4ESHA 2FWJA 4UU1A 2D62A 1XTTA 4DR7B 3HB5X 3I1YA 5EEGA 2X15A 1X9IA 4CHTA 1PUJA 2FFJA 2DBRA 1HO3A 3WL7A 3S55A 1U2GC 1U28C 3FDZA 4IIHA 4M0KA 4TVOA 3I5UA 1WSAA 4W82A 1IRIA 3ZYCA 4DJJA 3RJ9A 3ZCRA 4JU9A 3RSLA 3JV7A 3TOSA 3W8FA 4GX5A 4C2AA 5FI3A 1U3FA 4BO5A 1R5BA 5JAQA 1KQGA 3GZNB 1SKQA 4E5DA 1KY3A 2AF3C 2HYDA 2IP4A 2QJRA 3VDXA 1F5NA 3SYKA 2QLLA 5HR5A 2HWKA 4PC6A 3GGOA 3FKSA 3O4JA 1H9AA 1V45E 1EGMB 1N4DA 4GOOD 1E5DA 2ISCA 4Q1DA 1T5LA 4ZT7A 1CY7A 2ZBPA 4F1KA 3D6UA 4B7UA 3E48A 3OPQA 4UHBA 1YHYA 1N1EA 3L1KA 5EWLA 1VLJA 2ECQA 1UDCA 1PGJA 2GM3A 4M83A 2JKZA 4HO1X 5EKXA 4C3OB 1J90A 3EE6A 3JR3A 4LRTB 2JZCA 2FWPA 3KXIA 3B6IA 3LPCA 1ZKDA 3W8EA 3UK0A 3Q40A 1Z5NA 1SCDA 1Z2NX 1XZKA 2YFHA 3PD0A 4HPJB 4LGCA 3FWPA 1O1YA 4IDAA 4YDSA 5BN4A 4G4JA 5U4QA 1HTBA 3SKYA 2ZYDA 1G38A 2CVPA 2GRAA 2WWRA 3A1TA 3JTEA 5HK8A 1ZHFA 3HCDA 2QU8A 2ACEA 2Z6QA 3UCFA 2FAXA 5F35A 1S2IA 5JMPA 1GZVA 2WAOA 3O4VA 3TPCA 4CE6A 1XD2A 3UJDA 2QJTA 3DO6A 4LZAA 5LYYA 2NP7A 4EYKA 3KLMX 1D4OA 5C4GB 3ZQ4A 4P93A 4UFPA 4NK4A 1AA9A 3HJFA 3OUZA 3NXKA 3ZZ1A 1LC0A 4HWKA 1UPCA 3BMQA 4PLHA 3GROA 1Y6FA 3KCNA 1T4CA 4NEHB 1MABB 2QN8A 3BPSA 5TXGA 3WFZA 1R6XA 3NHMA 2P62A 1JEDA 4ASUA 2YRXA 2YZNA 4OSEA 3VZSA 5B53A 2FSIA 3LA8A 4MICA 3IHWA 4W5NA 3ETNA 1ZUHA 3MCWA 1KVUA 3KPUA 1XXHB 1G8HA 1R5OA 2YXEA 1P0IA 1MD9A 1VIVA 3BSYA 1AMUA 3MTJA 4LCEA 1FFXB 3ND8A 1KJ9A 4PO9A 3O1LA 2BCGY 2J3MA 4HZGA 1NIJA 2F7SA 2HF2A 4Z7OB 5A3JA 3WTBA 3BMCA 2X1LA 1U81A 1QH1B 4HUQB 4OFXA 3AO0B 3DMTC 2RJNA 3PTAA 4IX1A 2VDOB 3MRSA 2Q49A 5CFZA 3H9UA 2J48A 1Y34E 1NA5A 5KTKA 1L7QA 1SB8A 2VYCA 4I4IA 3D2LA 4L8VA 5LWQA 3IAUA 3A70A 2QD3A 4J7AA 3PJEA 4AO8A 2PKYX 2Z2XA 2I03A 1JLHA 4B5KA 4EX6A 5IM4F 2QY9A 3MWKA 1WE2A 2A4KA 4FDVA 4RV4A 4ZOEA 3OJOA 1EFCA 5SY6A 4A6XA 1T1SA 4N9QA 3WLTA 2ORYA 1CF2O 5BYAA 3GI1A 2MIIA 3C3AA 3OOWA 5D51S 5KUTA 2IYAA 1Z34A 4LBVA 2DXIA 1URPA 2ZWMA 1NX6A 2W6JA 2RG7A 3BWXA 3F9RA 1NC1A 3KFVA 3PS9A 1P2SA 2DPMA 3L0BA 4H0NA 2ZIWB 4NU0A 4YAKA 2P67A 2BZGA 2VYVD 2FP4B 3DAGA 3GLUA 5F76A 1QNFA 2OCDA 3NTXA 1P0FA 2JKYA 3COYA 5AI8A 5DTEA 3DTVA 5FA5A 1PQPA 4E5NA 3NNNA 5K3CA 3BIJA 1VPDA 4E5MA 2XDQA 5JISA 3IBCA 3T3MB 3CX7A 4JB3A 4C0XA 4C5CA 1TLTA 3L7DA 4R1QA 4WFIA 3DZDA 2IQIA 3OBBA 3UAWA 4OJKA 1F3OA 1L7EA 5F2EA 1K1EA 2VDMB 3TCXB 4C7KA 4ZC1A 3BX1A 5M7EA 2H1HA 3MTQA 1HOXA 2R4QA 3LUDA 4EGJA 3ASZA 1EXDA 4OATA 3GB9A 4MTLA 1J24A 4F5YA 4HXYA 2OESA 5GOZA 5AQ1A 3LD9A 1UJBA 2F48A 1MOSA 4C4SA 1LLFA 1N5RA 3AW9A 1UBOS 2FCAA 3MD0A 3NR2A 5EJAA 2JIPA 5HS6A 4C4TA 1PNVA 2VNJA 2X8WA 4B46A 1UXGA 1DKPA 1FPQA 4C4OA 2FPPB 3R4CA 4ENTA 1P1RA 1U8FO 3GGGA 5CITA 5IF9A 2R60A 2R66A 2NG1A 5JXGA 3TLJA 1RXEA 3N2YA 4R3WA 3MWFA 1W1UA 2BT4A 5EWMA 3DOIA 3BH0A 4LHVA 2V0GA 3MPUA 4K8RB 1OXTA 1FU7A 2EBFX 1VL1A 3A1NA 1U9IC 3WLLA 4AVYA 1B73A 2NADA 3NX4A 3NAMA 2FUG1 2J85A 3ZDDA 4C89A 4MVJA 2IKQA 2Z1NA 4ZCRA 3CRNA 3G8BA 3WLRA 4ERNA 2VBIA 4BBZA 4DLUA 2Y1EA 4Q6WA 5KYKA 2W9XA 3D8BA 3QZUA 3RVJA 1G3RA 3TOCA 2GERA 4HH4A 3SX4A 1VHJA 4BHTA 3VPFA 2BY4A 3ZJ4A 1HYEA 2RB5A 1I2MA 3O2JA 1VI6A 1FC0A 3ICVA 1F0KA 3UWMA 5ISMA 2AE1A 3TQFA 3V2UA 1OBHA 3IEIA 3P1JA 5GINE 4K3VA 4MYDA 4LNAA 4RD6A 3SJAA 4FU0A 4BKOA 5BUZA 2JA1A 1JJ7A 3THXB 3R09A 4NCKA 1COWD 1GZ6A 4KO1S 2HQSA 4G63A 4MPTA 3U9SA 5B6JA 5CEFA 3RGWS 1NQ5A 3ZWAA 4D96A 9ATCA 3WHLA 1IXRC 2QTCA 3CT6A 3D6JA 1MH1A 2JFUA 3Q3JB 2SBTA 1EVEA 4U6QA 1RLMA 3OLWA 1U65A 2D2VA 3ORSA 1C0PA 1GKLA 3M6UA 1I10A 2OP0A 1A2KC 1E3DA 2J5KA 2Y3IA 3DMNA 3N6XA 1TT7A 4I55F 3ZZ0A 3F73A 2A1IA 3VKWA 4FN4A 2EWMA 4TOIA 3ZI4A 1U2PA 2YVUA 1SVLA 1JHDA 2MDTA 3DNMA 5IYZB 1C7RA 3U7EB 3CLTC 2V4ZA 4N0EA 1GKIA 2PSEA 5B6IA 3EEBA 1JRLA 3OLQA 3ELUA 1AZLA 2VDWA 3ZXXA 4EKGA 2JD1A 4UVDA 5L4SA 3HYTA 2AXQA 3BGSA 1JAZA 3Q98A 4B3MB 5AW3A 2V7GA 1S3SA 2A33A 3UG6A 5DMHA 4LOAA 5ABPA 3GV0A 5DHUA 1C9NA 4W9RA 3T0FA 2PGOA 5FUBA 3A1UA 3ZZMA 4FCWA 3RLIA 1WW3A 2V0CA 4LZNA 1ZIYA 3SE0A 1M6WA 3VAYA 1GTRA 3EFOA 1UK8A 1QQ7A 4PN3A 5EHIA 4PF1A 1MC1A 5C1IA 3GFRA 4GICA 1FS5A 3CH4B 3G8YA 3PICA 2DR2A 4AB1A 3QP9A 1GUAA 4BKUA 3WL3A 3KO8A 4RLQA 1O6CA 1CJBA 1O58A 2QN7A 3RYHA 4FSXA 4P0PB 2MTBA 4CKEA 2VKTA 1FOEB 4PQYA 5L3QA 2VJYA 1Y7LA 1CDDA 3FSGD 1VE5A 1RKQA 1GCUA 5HXAA 2FWNA 4HDCA 4D74A 3FSGA 3TR5A 3T06B 2X2PA 2O8VA 1ZOLA 2L69A 3OP4A 1ZRMA 4US2R 2PANA 1KFEB 1SQFA 2VDQB 1XAGA 3EVBA 2W70A 3A6GA 1VB3A 4YUVA 1F17A 1Q19A 3GUZA 5KSWB 2WVHA 3CUKA 3H16A 4MCIA 1TZCA 3HUUA 4HAXA 2OQRA 2KSQA 4DMKA 3Q8KA 2Q62A 4TV8B 4F9TA 1P0CA 2YZ2A 4CR8A 1OI7A 4OQDA 3ZW7A 1NBMA 1Z26A 4HQLA 4RHEA 4CU2A 4RTJA 1RRMA 2BFBA 4GPAA 4CHGA 4G97A 1IN6A 3UT5A 2ZIFA 2FUG6 2X9QA 2BI4A 1AGNA 4MS4B 4D42A 3OC0A 1X1AA 5G41A 1Z37A 3ZKWB 4QXOA 4UTRA 5JNTA 4C2UA 4IDQA 3UWDA 3CNNA 4NZYA 4DRXA 4QECA 4G0WA 3GY0A 5L9AA 1M2EA 4ZVQA 3UATA 3UXMA 2CEAA 3P0EA 3WNCA 2GM9A 1E96A 4O02B 1Z8HA 3ILVA 2OL4A 3TFQA 2QM0A 5J1TB 1JAHA 5J59A 1D6NA 4UTPA 3EASA 3OAAD 4KO8A 3T1NA 1KFJB 3T94A 4AJ2A 5IZCC 3JALA 4KACA 1XX6A 2RC6A 3TZKA 1DC4A 4CIVA 1E64A 4PGGA 3C6MA 4TTIA 5F7OA 4M1QA 4CMCA 4F11A 3QU7A 2RHOA 4CQMD 1JNYA 3FOEC 4EPVA