2X8LA

Plasmodium falciparum lactate dehydrogenase apo structure
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
320
structure length
311
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE
publication title The Apo Crystal Structure of Plasmodium Falciparum Lactate Dehydrogenase
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 117
structure length 311
sequence length 320
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x8lA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2x8lA02
1AXEA 4NR0A 3ENKA 3RU7A 1RYEA 3Q9NA 4ND1A 2B69A 5LDGA 3RUIA 4I8XA 2VWHA 1V3TA 4KUEA 4E2ZA 4IPTA 1GEEA 3ZDFA 4BKUA 4XCVA 3NTQA 1QYWA 4ZRMA 3ENNA 4GX0A 4NFSA 3W4JA 4CODB 5L4NA 4XQCA 4Z9XA 3WJAA 4U7WA 1PR3A 1PJQA 4YCAA 4Y6PA 3ZNPA 3S8MA 2ZATA 5ENDA 1U9JA 1NBOA 4MVJD 2CF6A 4FPXA 5I8ZA 5HM8A 1H9AA 3A1NA 3C8MA 4DUPA 4CLXA 4YAIA 3DMTC 3SBOA 1ZMTA 1BDMA 3HQ4O 1F06A 1G0OA 2EP7A 4NK5A 1Z82A 1SZJG 1Q0LA 1I3LA 1U5AA 2D0IA 2Q4BA 3C1AA 4OXNA 1KEPA 4PG6A 4YAGA 2PZLA 4MP8A 2EWMA 3DWFA 1Y8QB 1UP7A 2NVBA 2J5QA 4FFMA 2UV8A 4NQZA 1GQ2A 2OORA 4TKLA 1WP4A 4OSPA 4E5KA 4CLOB 3LQFA 2XPCA 3M2TA 3KOUA 4B7UA 5JBIA 1GY8A 1SBYA 4IGFA 3OJ0A 4TVOA 3K5PA 2WE8A 1GDHA 4JJFA 3WIEA 5F1OA 4N18A 3ROPA 4NBRA 1HDXA 4XYBA 3WICA 2ZQYA 3QE3A 5TJHA 4TSKA 3IL2A 1KY5A 4KWIA 3FBGA 1BW9A 4O1MA 4LMRA 3UUWA 1UAGA 3LT2A 1CDOA 2W98A 2HJRA 2AEJA 3DB2A 3RUEA 5TGDA 5B37A 2CVOA 3F5QA 1KVRA 2O4CA 3NV9A 1JA9A 5EMHA 3I6QA 5C37A 3EC7A 1TT5B 4IDGA 1QLJA 3GQVA 2DPGA 3PYXA 4PIVA 4MKRA 4QT0A 4YJFA 1YKFA 4A2CA 4E5MA 1DIHA 2ILTA 3E82A 4YA6A 4RPHA 2NUAA 2P5UA 2FZEA 3INGA 3V5NA 1MXFA 3WQRA 4DVJA 2C2XA 5T64A 4YAEA 1LDBA 3I6IA 3RAJA 1A4UA 1ADCA 1GQYA 2EG9A 3ITKA 4CV1A 3B20A 3RU9A 3ZWCA 5L4SA 1Z75A 4J1SA 4CM9A 1FF9A 4DLBA 3PEFA 3Q1LA 2BRUA 2X8LA 4J0EA 4IS2A 5LCXA 1G0NA 1C1XB 3UF0A 5ICSA 1LRJA 4OKNA 1XKQA 1U4OA 4YJHA 3P19A 3GVHA 1U7TA 3VH3A 1O9BA 2PWZA 2HMWA 5TLSA 1CIVA 3Q0EA 2GNAA 1LDMA 1MFZA 1E1LA 3UCFA 1T4BA 2PR2A 4XZ3A 1H9BA 3ZN2A 3RIHA 1T1SA 4L9RA 4MKZA 1MC4A 2AE2A 4E5YA 3VKUA 4AJ4A 2HMTA 3BIOA 1R15A 4IDBA 3TF5A 3FTNA 4A73A 4BGEA 4CUJA 1ENYA 2UAGA 2YDXA 4YAJA 4KP7A 3ADPA 1C0IA 4PG7A 4BNFA 5I7FA 2WEKA 1QYDA 1YDWA 1ZKMA 1XR3A 3PDUA 3PWSA 3QWFA 3WMWA 3AFNA 3JQEA 4LMPA 4RF5A 3ZU5A 2IE0A 1GUFA 1VI2A 5HA5A 2NU8A 4CR7A 1DPGA 3C7AA 2ZTVA 4Q3NA 4FFRA 2ZCUA 3W4IA 3ZWNA 1ZFNA 4UREA 4J43A 3QSGA 4BB5A 4LN1A 1DIRA 3K6JA 4NG5A 4YPOA 4GSLA 5JAMA 4DIFA 4RV9A 3HN2A 2CUKA 1P77A 4XQEA 3MOGA 4YVFA 3QIVA 1UDCA 3DZFA 4CL8A 4L76A 4Q3BA 4ITUA 4CUKA 1NFRA 4PLYA 4QSMA 3KYDA 1GPJA 2C54A 2Y1GA 3GLQA 4YYZA 1I33A 4GX5A 4RZHA 2AE1A 4Z6KA 2NVUA 4TVBA 4DC0A 3E48A 1NYTA 1UZMA 2EV9A 1CYDA 1IULA 4HUJA 3H5NA 2QHXA 5U9CA 4I5DA 4GH5A 2J5KA 3D3EA 3GEDA 1NVTA 4L73A 2BFPA 4B7XA 1E1NA 2G76A 3LF1A 3AFMA 3ANLA 3L6DA 4HXYA 5KTKA 2O3JA 3RFVA 2NTJA 4Z3KA 2DTXA 3EY4A 1N5DA 2W8ZA 3OJLA 1QRRA 2X1HA 2YHUA 3CZRA 5JCJA 1LQTA 1UDBA 4RPKA 1WWKA 1FMCA 1M2WA 1EVYA 5KVCA 1BG6A 4I08A 4I9NA 1A4IA 4Y8VA 3OEWA 2FR1A 4FGSA 4YJDA 4OH1A 3GC6A 3VH2A 3GGGA 2E37A 1PZGA 3MJEA 4NPCA 5L4LA 3WFIA 4U6QA 2W2LA 2J6IA 2GN9A 3UW3A 4YRAA 1FDSA 2VCYA 3A06A 1YB5A 2OGUA 3PFFA 4NU5A 3AOEA 2HMSA 4IXTA 3OSUA 1G6KA 4HNGA 2I66A 1HDGO 3CUKA 3ZGYA 2X86A 4BQPA 1U3TA 2GERA 4HY3A 1WAMA 4TMFA 1RJWA 2IRWA 4QEDA 5BQFA 1MG5A 3AY6A 4CQMD 3EK2A 1GZ6A 3X2FA 5TSDA 1ZEMA 1IY8A 4RF4A 2C7GA 3VDRA 4N5MA 3FBTA 3QVOA 3SXPA 5B4UA 1MUUA 1UXJA 2PKQO 3FNEA 2EP5A 3ANMA 3CZMA 3JYOA 3LT1A 1K6JA 1XQ6A 3LT4A 4E2YA 1JWBB 5C7IO 3OJOA 1SOWA 3MTJA 1LLQA 1W73A 4G81A 4P4LA 3Q2KA 2O3TA 2Z1MA 4UVHA 3OA2A 4OXYA 4NMHA 3L6EA 1JN0A 1I24A 3JYNA 3ZU4A 4BNYA 1CEQA 4PLFA 5DCWA 5DBIA 2Z1NA 4D3SA 4RQUA 1NPDA 1SO8A 1C0KA 1YBVA 4ROSA 5AXDA 1HDCA 5FI5A 5ICMA 4BGVA 3L9XA 4XEHA 3I9NA 3O26A 1X1TA 3BAZA 1ZVMA 2BELA 3M6IA 1PGJA 4YRDA 1H6CA 1MP0A 3IP3A 1V3UA 3PHGA 3DHEA 4BKQA 3WR5A 1EBFA 3L77A 3QVTA 4RVSA 4BKRA 1XEAA 3KEOA 4XYMA 4RVGA 4B8WA 4HFRA 1H93A 1ARZA 2AG5A 2NNLD 3W6UA 3PLNA 3ZCXA 1E0DA 3GAZA 4D41A 4J1TA 2NU7A 3KVOA 4I9HA 2OBYA 2IEDA 4C4OA 4DWVA 4JP3A 4L0QA 1QV6A 4CMKA 4CR6A 4DLAA 1Z7BA 1QYCA 3WSWA 1DIAA 4D79A 1C3VA 1ZZEA 1EE9A 3D0OA 5KJEA 1K6IA 2PD6A 4OOFA 1DAOA 2DVMA 3HDYA 5ITVA 1GADO 2AXQA 5JC1A 4P22A 4XDZA 3BYZA 2AA3A 2E82A 3ZH2A 1LLUA 2I9PA 1P44A 3NKLA 1GUZA 5GY7A 2WYWA 1YDEA 3AY7A 1NHWA 4FFOA 1V3VA 1VL6A 4GWGA 1PGNA 3G1UA 3GN2A 2FR8A 3DXFA 4JIGA 1ISMA 3WLEA 3HUDA 1M6HA 2P4QA 3NAQA 4F3YA 1PQWA 3Q6IA 3BMQA 3U09A 1B8VA 3D3WA 2EGGA 1GU7A 2Q3EA 1NQTA 2DUUA 3K8ZA 4AL4A 4K26A 3VVCA 4XWYA 4OL9A 4FB5A 3RUFA 3EHEA 2OP0A 1E7QA 5HBRA 4CQMA 2AQHA 2IXAA 5KKAA 3O8QA 5B1YA 3SLKA 3KETA 2RH4A 5KJ1A 5KOIA 3LDHA 3U4HA 2TMGA 1B16A 3E03A 3RQSA 1C1DA 2PK3A 4XJSA 1E1KA 3SC4A 4ND4A 1JKIA 3Q2IA 3PHLA 2NSDA 3I9JA 1R6DA 4DRYA 3BHIA 2H63A 5DCUA 1HE5A 1PJSA 3DAGA 4CM5A 5CDUA 1E6WA 3BZUA 4RPGA 3VPHA 3NT4A 3RKRA 1K0UA 1JQBA 1TA4A 5IN4A 1DRVA 2BFAA 4LRTB 3V2GA 5KVSA 3CKYA 4GMFA 3FPCA 1H94A 2C7VA 1NQAO 4OO3A 2AEFA 4DBVO 3ZHYA 2CF5A 2GZ2A 3DBRA 3DTTA 4J2HA 1ORRA 3FNHA 1R4MA 1QKIA 1X15A 2AG8A 3PQDA 4PRKA 3N7UA 3GF4A 3QJ5A 3WWZA 4OAQA 4JX8A 1X0XA 4BO4A 4MVJP 1HTBA 3KSUA 3T4XA 2WM3A 5CEJA 1DLIA 1LRKA 4R5MA 3BMNB 3D4NA 3HB5X 2V6MA 2VRBA 1H5QA 1ULUA 4MIYA 2YYYA 3A14A 3DHNA 4XGNA 3HHPA 4BO0A 1ONNA 4CLHA 3F46A 5KCZA 4UVGA 1BXKA 2GN4A 5ILGA 3UICA 2I65A 3PWZA 2PGDA 1LU9A 1NPTO 1U1IA 2Z95A 3WSVA 1KS9A 1E3WB 1UZLA 1LC0A 4BNGA 1I01A 4R4JA 4GPD1 3FCOA 3AY3A 1IHXA 2Y93A 3LT0A 2WDZA 4IJKA 4ALJA 5A4DA 5C5IA 2AQIA 3EGOA 5IN5A 3RC7A 1T2EA 1VRWA 1PS0A 1YB1A 2C82A 2C5AA 4AJIA 5IXSA 1DBVO 4M8SA 4GX2A 2X58A 1OMOA 5JC8A 1Y81A 3S1LA 3U9LA 2NU6A 3OIDA 2ZYDA 1D3AA 1DFHA 2PD3A 2NVWA 1E3IA 4TRRA 2PZJA 3FD8A 1KBZA 1W4ZA 2BF7A 3DAFA 3T7EA 4E2WA 3PRJA 4U0KA 5IZ4A 1QYVA 1KC1A 4R51A 1KVSA 1I8TA 1CETA 4IQ0A 2NTNA 2YHIB 1MB4A 2QZZA 4UULA 4DYDA 4RPJA 4EJMA 2O3QA 2PZKA 1NFFA 2VOEA 5AXBA 3WWYA 5DOVA 2UVDA 2EW2A 4IDEA 4JN6B 4PZDA 1YJQA 1WMAA 1HF3A 3FR8A 3BXXA 3WNVA 4BUCA 2YZ7A 5GZ1A 1JVSA 5A9SB 1S7CA 3EZYA 3FN4A 3IC5A 2YFHA 4BNWA 2ZYGA 1SB9A 4DMMA 2VZ8A 1YGYA 2JJYA 3BMCA 4ILKA 4YEDA 4BNKA 2EERA 2QRLA 1GZ4A 2OL4A 3NDJA 4BNUA 2IZZA 4HX5A 5JO0A 2JFGA 1M75A 5AXAA 4R1SA 3WS7A 3FHLA 2HJSA 2X0IA 4FFNA 4LGVA 4OSOA 3NTOA 5JDIA 3MJSA 3UXYA 1T26A 2HO5A 4BNJA 4BGIA 1TLTA 1RYDA 2GLXA 3EVTA 4H16A 1VL0A 1M6WA 4AJ1A 2Q4EA 1XQ1A 1ISGA 2FSVA 4M87A 3MTGA 4NFYA 3U5TA 1DAPA 1DC4A 2BLLA 1GYPA 1O5IA 4ZHSA 4PLCA 4Q39A 3IMFA 3WX0A 2PKRA 1B0AA 1I3MA 2C20A 4IGEA 4Y9DA 1V6AA 4DBZA 3IQDB 4DL9A 5I7EA 5JDIC 5F5LA 2JD1A 3GZ4A 2NM0A 2X0NA 4FOSA 3DOOA 3JD2A 4DMLA 1QMGA 4FD3A 2OP1A 3PYLA 4BO5A 2VWGA 3TQHA 1N9GB 3G0OA 3GVPA 3K2BA 4ND3A 1BXGA 4C7KA 3PQFA 1F0YA 1P1KA 1UP6A 3N58A 1XELA 4RLHA 3CSDA 4S1VA 3O9ZA 1CWUA 1LDNA 3HFSA 4L4SA 2Y68A 3H3FA 3R1IA 1MV8A 1S6YA 3DR3A 2CZCA 1DO8A 3E8XA 3JD1A 4B3IA 5BNFA 4R54A 5IDXA 2D5CA 2C5EA 5CDYA 2CVQA 4J9VA 4QTZA 2ZK7A 2VWPA 2NQ8A 3SVTA 4FN4A 4DQUA 1HE4A 2EJWA 1LLCA 1DC5A 2OO5A 3A28A 1GPDG 3RFTA 2FZWA 1GZ3A 3R6DA 3UFXA 4BV8A 3WYCA 3LVFO 1YOVA 5BT9A 2WE7A 2AHRA 5B4VA 1HDZA 5JAIA 2JKVA 4J2OA 1PX0A 4PG5A 5CDSA 2FWMX 5DDIP 1HWYA 1HKUA 1GV1A 2WYUA 4TROA 2J3IA 3JQ6A 4WEQA 3D1LA 3GHHA 4NI5A 1PJLA 3VOSA 4H15A 3HNPA 3G79A 3VZQA 2DFDA 3P5SA 4E33A 1PQPA 3PYMA 5KWEA 3JD0A 1LA2A 4TRNA 4K1LA 3NT5A 2DLDA 4XYGA 3AWDA 5COAA 5JY6A 2R00A 3LC1O 4OXKA 3ZWAA 4XIYA 4P8RA 1ZEJA 3L07A 1ENZA 1ZO8A 4JK3A 1HSZA 2ET6A 3ZW9A 1MG0A 4FGWA 4BO3A 3NDIA 3BMOA 4IZHA 1SAYA 1E7MA 2A35A 1YVEI 4IQ8A 2W2KB 4MIOA 4CLEA 3GZNA 4ESOA 3E6AA 1NWHA 5CHEA 8LDHA 5AQ1A 1P1JA 1I3KA 1LBEA 2I5PO 2R00C 4QUKA 4CM9D 1QR6A 4WCFC 3E5RA 5CG1A 5JLAA 1V35A 1Q1NA 4I5FA 1IPFA 4W9NA 3W8DA 1O89A 1J6UA 1YL7A 2HDHA 2V6FA 4MVJG 2E49A 2I99A 4PLHA 5I8WA 3OA0A 3DL2A 1U4SA 1YO6A 2H5LA 2OMEA 4GGPA 2J5RA 4R1NA 1KERA 1H6BA 3DZIA 5JDCA 5K6AA 2ZKLA 3D4OA 5FI3A 1GYQA 1N1GA 3ONDA 5IFLA 2WD7A 3GFGA 3PFWO 1UDAA 1PS9A 3KUXA 4W9NC 4NIMA 1ZMOA 4YBZA 4B79A 4Z9FA 4AJJA 5T6BA 2P9CA 1X0VA 2VTEA 4J91A 1R0SA 2A9FA 5A03A 4XYLA 5J23A 2V6BA 3IP1A 4AJNA 5I9LA 3GNQA 4IDDA 5EN4A 3HN7A 4YJGA 1GEGA 1H2HA 1E7RA 4R9SA 3BA1A 3IUSA 5JDCC 1J49A 3JQFA 1KYQA 3JTMA 3OF2A 4G5HA 1ENOA 2WSBA 1MFPA 3UGKA 3OP4A 3OQBA 4RDIA 3SLGA 1DFIA 3ADOA 2PY6A 2VZ0A 4ALMA 4CR8A 1DIGA 2VYVD 1X13A 4M86A 2P2SA 2PV7A 1R4NA 1XCBA 3ZV6A 4CM6A 3C24A 4CMAA 2ZIZA 2PGJA 3JQFC 2QG4A 4BGUA 1RM0A 1B14A 3H5AA 3QW2A 2CMDA 2ZTUA 4NJMA 2AEMA 4HFJA 4QX6A 3JCZA 1UR5A 1PIWA 4BNHA 3JQ7A 4GL4A 4RPLA 3WXBA 3RSHA 1AGNA 3PGXA 4CM7A 2Q2QA 3KXDA 3RJ9A 4O5OA 3MZ0A 1SNYA 2EF1A 3ORFA 1LDEA 5KKCA 2Q2VA 5B12A 2JCVA 5JMWA 1FDWA 1M66A 1QORA 5L3ZA 3OHSX 3U4IA 2EJVA 4LRSB 4GI2A 4PVCA 3WGOA 4CLRB 1KVQA 1EUCA 4IJUA 2B37A 4DYVA 1V8BA 2X6TA 2ZB4A 2PNFA 4RLSA 4CMEA 3H8VA 2TMDA 3TZHA 4GKVA 3DC2A 5EESA 3VTFA 1YL5A 1K2WA 1XWFA 5T8KA 3F9IA 3IOYA 2XAAA 3CE6A 1JU9A 4D46A 4AJKA 3JQAA 3V8BA 5JCJD 1GFSA 3WGIA 2RHCA 1JWAB 4GBJA 5JO9A 1JLLA 3C7CB 4CMEC 1B3BA 4AICA 4CQLB 5L9AA 5LC1A 3AI2A 1ZNQO 4RVDA 1YH3A 2IDZA 5T8KC 4DC1A 1PWZA 3W8EA 3GOHA 2D1YA 4QFDA 1ZK4A 2Q1SA 3RBZA 3VDQA 4GMGA 1EUDA 1GL3A 2W2LD 3F3SA 2VZ9A 4RZIA 3I83A 2J3KA 2QW8A 3GFBA 4WLUA 4HFNA 4EZBA 1E3SA 3IDSA 1ZK1A 1EBUA 2BGMA 1D7OA 2B35A 2GPTA 2Q1UA 1BDBA 3KYCA 5FF9A 4EEXA 4N54A 3PQEA 2XXBA 3CPSA 1JAYA 3M1LA 2I3AA 4BNVA 5THKA 6ADHA 3QVSA 2VHXA 1WLYA 1TXGA 4D0RA 4I9UA 1BVUA 4ZICA 1T1RA 1DDOA 2JHFA 2YQ4A 4GX1A 1Z7EA 2GZ3A 1SC6A 3WGQA 1Q7BA 4OGWA 1H2BA 1H0KA 5BR7A 4DREA 1XHLA 3QY9A 2GYYA 2YV2A 2VYVA 4MKXA 3ZZNA 3GK3A 3W4KA 1HT0A 4JJIA 3MJTA 1MA0A 3U62A 4XB1A 5G4KA 1YBMA 4NK4A 3KO8A 2HQ1A 5MGBA 2JD2A 3E9QA 4JQCA 1DFGA 1U2GA 1K3TA 1ZCJA 4NH4A 4BNTA 5A5EA 4PLGA 1JKJA 3GUYA 3D64A 2V6GA 1PWXA 5KJ6A 1NNUA 4GVLA 3JQGA 1EVIA 3DZKA 1E5QA 4E6PA 1I10A 4E31A 3VKVA 4ND2A 3K92A 1HEUA 4BL5A 3ROKA 5A06A 3TDKA 4URFA 1U3UA 3AI3A 5ER6A 1TI7A 4HADA 1E1MA 4B4UA 3NJ4A 4WCFB 2IODA 2H6EA 3WGGA 5JS6A 3KSZO 3VPSA 1A7KA 2OOSA 5JYDA 2QRKA 4OM8A 3Q11A 3L4SO 1R66A 3TZQA 4KDEA 2C59A 2P5YA 1MC5A 3BHJA 3KHUA 2R2GA 3RUDA 2Z5LA 1B8PA 5I7SA 1NVGA 2VNSA 4BNNA 2CFCA 5T57A 5FEUA 1DHTA 4JBHA 3WLFA 1VPDA 1E7WA 3HDQA 2I6TA 4PN3A 1AHHA 1I2BA 4MVJI 1ZK2A 2X7HA 2WD8A 4WLVA 1P0FA 1X14A 3G1TA 1XU7A 4Y67A 4Q3AA 2E6UX 3ZWBA 1O8CA 1UP4A 3LYLA 3NGXA 1HLPA 1ID1A 1VKOA 2O3UA 2PTGA 1Y8RA 5TX7A 4QFCA 4PCVA 4ZJUA 5TS3A 2C2YA 1FDUA 4HFMA 3LC7O 1GAEO 1H6DA 1GYRA 2O4UX 1P9LA 3WB9A 3MEQA 2AW5A 3JQBA 3MOIA 3GRKA 3ZWOA 4XR9A 4JNKA 2EKQA 3KSDO 3NUGA 2JAPA 1ENPA 3VPFA 4Q9NA 2JHGA 4CM8A 3FR7A 3H9JA 5JW6A 1I0ZA 5CPFA 1JDJA 2NU9A 4J90A 4U6SA 3JQCA 3WGHA 4OQYA 5KNLA 4GGOA 4CM4A 1PZEA 4RCVA 4RORA 1LUAA 4R9RA 3ZNNA 4ALLA 3RFXA 1A7AA 1HL3A 4JBIA 3JQBC 1BRMA 1VSVA 2DFVA 4DPLA 4ZGWA 2VN8A 4AG3A 1YXMA 1CJCA 3AOEC 3TPCA 2O48X 5A3VA 3RVDA 3S2IA 4IMRA 2BMAA 2BGKA 4OIMA 1ZH8A 2EIHA 2RIRA 3KYBA 1A5ZA 1HYGA 1NPYA 2X9NA 2BGLA 4MO2A 4LVUA 1I5RA 3K73O 2P68A 3P7MA 3VAZA 1NR1A 1XIVA 5EQFA 4XD2A 2FPIA 2EKPA 1ADBA 4K6FA 2QZ9A 3MWDB 3EMKA 5F5NA 5CP8A 4J7UA 1BW9B 4EDFA 3DO5A 2J3HA 3GMSA 3BTVA 3DQPA 4CMHA 4U5QA 3K96A 1E92A 2PZMA 2DTDA 4KUHA 1IPEA 5DBFA 1TEHA 1E7YA 4BNMA 1EFLA 2QQ5A 5A9RA 2JL1A 2DC1A 2C0CA 4NJOA 4R1TA 3RC2A 2NADA 4YJFB 5G0TA 3PZRA 4R68A 2J3JA 5A1TA 2DBRA 3NX4A 5BNIA 5CAEA 3WMXA 2DKNA 2HKIA 2EHDA 4J4HA 1Z6ZA 4PZCA 2B5VA 1BXZA 3VTZA 2X23A 2HCTA 2R6JA 4R16A 3PDJA 3ITDA 3TL3A 2CVZA 4UEJA 1HDYA 2QIOA 2Y67A 2ZB3A 3A9WA 1UAYA 3D5QA 3RI3A 2Y1FA 4IMPA 4R01A 4DPMA 1Y9AA 4J9UE 4JP2A 1YE3A 4YJHB 4BNZA 4IZIA 1CF2O 3WGYA 4LSMA 4WLFA 4YAKA 1UXHA 1NQOA 1YL6A 4BNLA 2DAPA 1ZK3A 4E21A 4AJPA 3TNLA 5CG2A 4F6LA 1OZAA 3I9MA 3NGLA 3O4RA 5TF4A 3B70A 1PR9A 5IJZA 4HKTA 4Z3DA 3ZU2A 4LCJA 4FC6A 3QA9A 4IDFA 1WMBA 3UCEA 3DBHA 3GPDG 4Z0PA 1E7SA 2D59A 1EEHA 4B3HA 5JMPA 3DZBA 2FSSA 1T2FA 5CDTA 1IYZA 3WGZA 4J49A 5A05A 3LC2O 4EJ0A 4YT2A 1KEWA 4UUMA 2YV1A 1EZ4A 3AUAA 3T4EA 5TQVA 4AJLA 5DCYA 4BO2A 3TJRA 1RM4A 3RBVA 3WOHA 1B3RA 3PIIA 4RVHA 4WGGA 3B1KA 4RDHA 5IG2A 1B15A 3ABIA 3B1JA 5ER9A 1UZNA 4O63O 2NLOA 4B4VA 4CMIA 3PJGA 1A72A 3Q9UA 1LNQA 1ISFA 1OI7A 4WEOA 4A5OA 4WOJA 4Z9YA 1DOHA 2E48A 2X0RA 3EAGA 1SCUA 3KYDB 3TN7A 5BSFA 1T24A 3JD3A 3K30A 1NVMB 2NVUB 3LU1A 4XQGA 4WKGA 4E2XA 4TRJA 4JLWA 2VRCD 2HMUA 2Q46A 3NYWA 4FJ0A 3IKTA 2GD1O 1ADFA 2O7QA 3CINA 3H7AA 5AYVA 4A26A 4GWKA 1W6UA 2VYNA 1PGOA 3C1OA 4IIUA 3AJRA 4E5NA 2IYOA 1A27A 4ZD6A 4UAGA 4Y6RA 4OJNA 1Z74A 3ZW8A 4FJ1A 5DZSA 3F6YA 4JXKA 2O2YA 3QLJA 3EUWA 3RD5A 3I4FA 2PA3A 4RGBA 4N7RA 2XXJA 3JYPA 3DBLA 3D5TA 2BH9A 4O6VA 3DBVO 4L8VA 3UAGA 3QQPA 4BMNA 2VUSA 2B0JA 3QHAA 1KEUA 1LRLA 1LJ8A 1N2SA 5FFFA 5JPIA 4TQGA 3WNQA 1PJCA 3ZV3A 2CDAA 1GUYA 3GUCA 1ZJYA 1J0XO 1CERA 1Y1PA 1HE2A 1OBFO 3S2FA 3O03A 1ZBQA 2P9EA 1ZSVA 1BHSA 2Y1EA 2G1UA 1MX3A 4M89A 4WECA 1O6ZA 4FSHA 1EK5A 3COSA 5IAAA 1IUKA 3K31A 3V1UA 4KQXA 5COBA 5JY1A 2B4RO 2PD4A 3AOGA 4YTEA 5K0ZA 5IF3A 1ISIA 3CMMA 4WLOA 1T25A 1BWSA 1E6EA 1VLLA 2ZB8A 3KBOA 4MP6A 3IKVA 1DB3A 4U8GA 2HK7A 2IZ0A 3C85A 4H3VA 4D44A 1PJBA 1IOLA 4YR9A 2VHWA 4CM3A 4JBGA 2DM6A 2G17A 2UUOA 1I36A 1WZEA 2D2IA 1VJ1A 1ISJA 4NZ9A 1P1HA 2D5AA 3QP9A 1LDYA 3JV7A 4D42A 1C0LA 4CPDA 1Q7CA 3CTMA 5CFZA 1ZSNA 2VUUA 3HWRA 3KV3O 4CMJA 4AJOA 3EZLA 1Y8QA 1E5LA 2B83A 5DOZA 1SOVA 4RVUA 1Y9EA 2FPGA 4BO6A 1Q0QA 4HNHA 4AFNA 4CLOA 3HE3A 1EK6A 3UCXA 4M49A 4WUVA 5L7TA 1ZXLA 4B4WA 1PJ4A 2QYTA 3PP8A 3IAHA 3QWIA 8ADHA 4BV9A 3DTYA 4FDAA 1DJQA 1RKXA 2VRCA 3TOXA 3ZV4A 1BVRA 1ZIDA 3RKUA 4BVAA 3H2SA 3RJ5A 1YWGO 3LF2A 4BKPA 4FR5A 4G65A 4KZPA 3VH1A 3VVBA 2Q1TA 2QRJA 4IIVA 1L1FA 1PGQA 1WDLA 1TT5A 3JQ8A 3GT0A 4BOYA 1PL7A 1PU2A 1W8DA 1SPXA 2A94A 3DZJA 3PPIA 1X7HA 4ZQGA 1YRLA 4WE3A 3AI1A 1PSDA 3WJ7A 1XSEA 1VM6A 5A04A 5KVVA 3AM3A 3HFGA 1DC6A 2RAFA 5I7VA 3BTSA 3ON5A 1B26A 2VHZA 2JFHA 2Q45A 3IJRA 3O38A 3WYEA 3PZBA 2RHRA 3I9KA 3N74A 5H83A 9LDBA 4CLDA 5CPBA 4FQ8A 3I52A 2CY0A 3NEPX 5DP1A 3I9OA 4LVCA 3RCBA 3GDOA 4O0LA 1QLHA 7ADHA 1E3EA 2Y0CA 1P45A 2P9GA 2WTBA 3ST7A 1C1XA 4EGFA 5BSHA 1SMKA 4PG8A 1N7GA 3ICPA 3WQQA 5L51A 4AJEA 3BMQB 4PVDA 5IDQA 3D3WB 5GZ3A 4MPDA 4KDFA 3NJ8A 4II2A 5TT1A 1A9YA 2YY7A 2FHSA 4CQMB 1YQDA 1OFGA 3SJ7A 5TC4A 3SEFA 3VPXA 4ZQEA 3O8QB 2AQKA 4J16A 3ICCA 4WNIA 3TZCA 3RC9A 4A10A 2NV6A 5BNTA 2B36A 2XOXA 3I9LA 3ZHZA 2X5JO 5L40A 1NAHA 1C1DB 1NXQA 2VT2A 1LI4A 3LSYA 1MGOA 3OIFA 3FSRA 5JYEA 1V9LA 4GLLA 4J1QA 3TL2A 2ZTMA 2V7PA 1T2AA 4KOAA 1Q0HA 1EDZA 3NRCA 3R3JA 4EW6A 3SJUA 3ONFA 3DFUA 1PEDA 1R16A 3RUHA 2W90A 3W6ZA 4DIOA 4TWRA 4EBFA 1TB4A 4DIBA 2Q49A 4R1UA 1E77A 1N8KA 3GGPA 1Y5MA 3FI9A 4BS9A 4XR4A 4E12A 3UN1A 2PFGA 1P0CA 4BO1A 4MP3A 4W7HA 1Q2XA 1XDWA 3JQAD 5T67A 1XA0A 1WNTA 1KOLA 3U4DA 3DBRB 5TNXA 1R4MB 3GVIA 5FYDA 5H81A 3WFJA 3DOJA 3AUUA 4CMCA 4J3FA 5B4TA 2BFOA 1LXCA 3AW9A 3WGTA 4J0FA 3M1AA 1GQQA 5A3JA 3ROMA 3WQSB 5EJ2A 1XGKA 2H1SA 4UUOA 1IB6A 1GTMA 1NFQA 3HB4X 4E0BA 2H9IA 1A71A 4YACA 4CM1A 1YQXA 3R3SA 2QX7A 1D4FA 4D7AA 4QO8A 4ZN6A 5AOVA 4XRGA 3HZZA 3E1KA 3SC6A 1L7EA 3C3XA 3HDJA 5I9MA 1SB8A 4Q3EA 3MJ4A 1HYEA 2X9VA 1E3JA 3VPGA 3WIDA 3UH1A 1NX6A 3UOGA 4M55A 2YUTA 4CJXA 5L7WA 1LX6A 3GVXA 2X9GA 4EYEA 2JCYA 1QG6A 5JCXA 2YFQA 5K6AC 3ZWMA 1LTHR 3DMTA 4N5NA 3GNTA 3KLPX 1ONOA 4Q3DA 1HYHA 2I67A 2B5WA 4OOEA 4Z0HO 5TT0A 3HG7A 2GF2A 1R0KA 1OC2A 1LSOA 2GO1A 5L95A 3GEGA 3OICA 3E9NA 3I1JA 4J1NA 3F4BA 2HLPA 3H2ZA 4Z0TA 5JAZA 3DDNA 5JXWA 4MINA 1DIBA 3RASA 5KJCA 1AHIA 4E4YA 3KM0A 2EEZA 1B8UA 4D0SA 5ILOA 4E32A 1B7GO 1I2ZA 3PI7A 4BKOA 1DC3A 2JCXA 1D8AA 3GEMA 3GMDA 1M67A 1FK8A 3ZU3A 2CD9A 4PG4A 2ZQZA 1CQIA 4RO0A 4OHUA 5DF1A 5IZCA 2DBZA 2OFPA 1HZZA 4ND5A 2Y0EA 1PQUA 5F1PA 2Q99A 4DQVA 1CQJA 3IUPA 3H9QA 1L7DA 5HTOA 2GUGA 4A03A 1A9ZA 4NBUA 5CEEA 4R41A 3VC7A 2EGHA 2BFMA 3BMCB 1ML3A 2DTEA 5IZCC 3S2EA 1ZUD1 1IZ0A 3WBBA 4K28A 1O95A 4PZEA 1NWCA 2VHVA 2O50A 3H65A 2Y99A 4TRMA 3VZRA 3EVNA 5LDHA 3GH3A 2IEBA 2YW9A 1TT7A 3V1TC 2EXXA 4C7JA 1Z73A 1E3LA 4WLNA 3AM4A 3H3JA 3JQ8B 1J4AA 4S3MA 1V0JA 1Y7TA 4UEOA 2OBNA 4ID9A 3KB6A 2HK8A 1EE2A 2J8ZA 2F00A 1HLDA 1LQUA 1W0CA 4BMSA 1ZK0A 1PJ3A 3TZKA 2FP4A 2ZYAA 4XKJA 5IXYA 1U5CA 3DZHA 3V2UA 1EFKA 4FC7A 1FDTA 1VJTA 3KEQA 5BSEA 4DTIA 7MDHA 4D3FA 4TZKA 1QSGA 4K9DA 4KUGA 5KJFA 5A02A 1HETA 2DU8A 2B4QA 3I3OA 4ZQHA 1BXGB 3V1YA 4CV3A 5GMOA 4WLEA 4DQXA 3ZNQA 4FFPA 5ENVA 2XF8A 4UUNA 4WOKA 4YB8A 1CRWG 1GD1O 1IZ9A 1PJ2A 2LDXA 1DJNA 2I3GA 2B4TO 1KC3A 1HE3A 4WK6A 2OXIA 1DEHA 1XG5A 4INAA 3TFOA 2NTVA 3WTBA 2Y66A 3LLSA 3EDMA 2HRZA 1HRDA 1QV7A 5FWNA 4R3WA 1YOVB 4IBOA 1U8FO 4MVJA 4W6ZA 3E5MA 3L9WA 3PXXA 4GLOA 4L75A 1TVEA 2PKQP 3GG9A 4QQRA 1DHRA 1P1IA 1EDOA 2X5KO 3QWBA 1DRUA 4NDNE 3RC1A 1F8GA 4GAEA 3KZVA 2BI8A 1O0SA 3A4VA 5H82A 4RF2A 4AJHA 3GA0A 1E6UA 1GCUA 1UH5A 1NP3A 2VTDA 4NNJA 4B8ZA 2O2SA 3M2PA 3ASUA 4O59O 1H6AA 1P1RA 2POQX 3G3EA 3WYBA 3P2OA 4P4NA 4P4GA 4XYEA 1R0LA 1T2CA 4FCCA 4KTVE 3U4CA 2X4GA 3BMOB 2O3RA 3GRPA 3PGJA 3GNSA 2CNBA 3PLRA 2GSDA 4WCDA 5EL0A 5JSFA 4PLPA 1PZFA 3OFSA 3GZNB 4YT8A 1PL8A 1P1FA 3JD4A 5L45A 5ADHA 2DPHA 2JD0A 1F14A 1JAXA 4YXFA 1EQ2A 4WASA 4A7PA 1U2DA 1ZW1A 4IDCA 3OM9A 3BTUA 3RUCA 3TZ6A 4K6CA 5HS4A 3LK7A 1WDKA 2BKAA 1QYXA 2VUTA 4IXWA 1LEHA 2ZTLA 4ZQBA 3GDGA 1GR0A 2WWRA 1HDRA 2PGLA 1AUPA 1DLJA 3EYWA 4CV0A 2WD7B 1P31A 4IDAA 5G0SA 1KVTA 4HBGA 1NHGA 1U3VA 3BMNA 4ALKA 1WVGA 1PS8A 2C07A 3G49A 3GY0A 4XRRA 1FDVA 5DULA 2FOIA 3INRA 4LK3A 4DLLA 1P3DA 4P38A 2GR9A 1AN9A 2HRBA 2Q2WA 2VT3A 4YJGB 1KY4A 2X5OA 1K89A 4YQYA 2YDYA 3KRTA 1LSUA 2JFFA 1OOEA 5EINA 1VL8A 3QV1A 4NU6A 3K2EA 3PJFA 3ZV5A 3IS3A 1YB4A 1ADGA 1I30A 2P91A 2OUIA 4IY1A 3OJEA 4WJZA 1MXHA 5F1KA 3WG9A 2PLAA 3H9EO 1ZJZA 2GN6A 4JCOA 1E3WA 3SX2A 3X2EA 5HWSA 2Q50A 1R4NB 1YS4A 4AJ2A 3AM5A 4TKMA 3QWAA 1FXSA 4EEZA 1ONPA 4Q3CA 3PHHA 4GVXA 4MIEA 4NJMB 4CV2A 4NBTA 2HK9A 4NBWA 2EW8A 4B3JA 4UUPA 4ALIA 1VC2A 4A27A 3GAFA 1OC4A 3JQ7B 3U0BA 1JTVA 2F1KA 1X7GA 4QXMA 1U8XX 4RQTA 4FIZA 3GR6A 4XGKA 3R0IA 3FNFA 2FMUA 4HWKA 3ROQA 2FRDA 4E13A 4L74A 5EERA 4EI2A 4NFHA 3AUTA 1M76A 3RWBA 2VYND 4D3DA 1F17A 2YHIA 9LDTA 2OHXA 1UXKA 3ZWWA 4CUZA 2Y1CA 1FJHA 2RH8A 1SEPA 3ANNA 2WMDA 4XX0A 1P33A 1G1AA 5JE8A 4W99A 1NAIA 2VQ3A 4J6FA 4LISA 1NR7A 4YQZA 1ZSYA 3JQAB 4YWJA 4I5EA 4W4TA 3PWKA 4PRLA 5A9SA 2Y05A 1DXYA 5TJ9A 5CDGA 3UVEA 4YT4A 4YDRA 3PJEA 4IQGA 2LDBA 4L4XA 3T7CA 3ZHXA 3ASVA 3MWEB 4J4TA 1VJ0A 4ZA2A 3GDFA 2RBEA 4L4RA 4NHEA 5U4QA 4MOWA 1U28A 1F8FA 3I5MA 5AXCA 4RL6A 3OIGA 5F3RA 3ETEA 1X1EA 3W1VA 1R12A 2UDPA 2X0JA 2O23A 3GHYA 2X22A 1PTJA 2CSUA 3CIFA 3KYCB 3ONEA 3ZWYA 2I76A 5CEFA 3JYLA 4QECA 2ZJ0A 5BSGA 4PLVA 4TZTA 1UXGA 1F12A 4XDYA 1XU9A 1KIFA 3PTZA 3Q3CA 4JGBA 3ULKA 4IS3A 1ISHA 1Q7GA 1YBAA 4BO9A 4GQAA 5F21A 4DPKA 5EIOA 1B2LA 4XQ9A 5A5FA 2WYVA 1N9GA 3NT2A 4WPGA 2VOJA 4RVFA 5DN9A 3OJFA 4UVEA 1GV0A 3TRIA 4LW8A 3MJVA 5AVOA 1T2DA 3PJDA 4FJ2A 3ZWXA 2D4AA 4BO7A 2HMVA 1XYGA 3DMYA 3H9UA 3FRJA 5G4KB 2P4HX 3B1FA 3DEYX 3ZNOA 2IZ1A 4MDHA 4R5HA 3S55A 4OYRA 1PL6A 2DBVO 2HU2A 4J7XA 3PIDA 1U7HA 2GDZA 3JQGB 2JAHA 3CXRA 2RCYA 4ALNA 3TSCA 5TIIA 5DBGA 4KTTE 2YV3A 3ZI0A 3MJCA 1JKFA 3B6ZA 2ZB7A 1HSOA 5EPOA 2FPPA 4M1QA 3C1TA 3L6OO 4BNIA 4U0JA 1N92A 2CDCA 2G0TA 4EJ6A 2BD0A 3DFZA 1DRWA 1LLDA 3I4CA 1I3NA 1WZIA 2UYYA 2O7SA 4W7IA 3QVXA 4E3ZA 4MVJH 3MCVA 3F4LA 3E9MA 3GG2A 3UHAA 2D3TA 3OQ1A 5G2OA 4F6CA 4II3A 4DGSA 2W2KA 3IIEA 2OZPA 4RF3A 2NQTA 4EUFA 1PZHA 1NM5A 4F46A 2GASA 5G0WA 4XJTA 1Y8RB 3GPIA 3L0DA 4PFJA 4PGFA 2GGSA 5K9ZA 6LDHA 5IDWA 1MLDA 1LDGA 2NACA 4ZRNA 1Y6JA 4FW8A 1HDOA 4B7CA 5COQA 2CDBA 3BTOA 1QP8A 3KTDA 2SCUA 1IE3A 1BGVA 1JVBA 5L53A 3JQDA 4HV4A 3PHJA 5DP2A 4XGIA 4BNXA 4HP8A 1I32A 3NTRA 2AMFA 4UVDA 5HS6A 4CM8B 4FS3A 4F45A 4W82A 3ZHBA 3RUAA 2HUNA 4WNCA 1T4DA 4EUHA 3QRWA 3RBXA 4CM4B 1RM5A 2GRAA 1UUFA 3AU9A 4QO7A 3CEAA 4B4OA 4BIIA 3HDHA 2ZCVA 2D8AA 3F5SA 1LC3A 1VKNA 4IUYA 4H7PA 5JAQA 1EVJA 3FWZA 2A4KA 3HJAA 5JFOA 1OAAA 3CH6A 1X7DA 1R37A 4N5LA 4I1IA 4EITA 3U3XA 4E5PA 2HAEA 3ETDA 2VHYA 2GN8A 4XB2A 3V2HA 3UKOA 1YJ8A 3DOCA 3OQ6A 1LSJA 3FNGA 1GCOA 4E30A 4R69A 3STHA 1C14A 4CMGA 4ZVVA 1WW8A 1KEVA 5T5QA 3I23A 4DXHA 4I5GA 4A0SA 1P74A 3DAPA 1LSSA 1UXIA 3KLMX 4PLWA 1DSSG 3P2YA 2IYPA 2FR0A 2GZ1A 3PVZA 4M54A 5EQDA 4OKIA 4XIJA 3D4PA 3L4BA 5ES3A 1Y5RA 2A92A 4MVJE 3H6KA 2Y1DA 3S2GA 3BHMA 5A9TA 1YQGA 2DBQA 4J7CA 5U1PA 1BMDA 5MDHA 2FY8A 3F1LA 4YRBA 1N1EA 2O3SA 1XLTA 5KVQA 4CLRA 2DT5A 4XA8A 3HADA 2VWQA 3F47A 3L4BC 2BI7A 4FFLA 5G0UA 2ZJ1A 1ULSA 1ZXBA 1O94A 4BHTA 4PLTA 5HRUA 1RM3A 3ETGA 1EMDA 1SEVA 2PH3A 3QVWA 4D45A 4AVYA 1NTOA 3CMCO 4BMVA 2V65A 3WBFA 4GKBA 3RROA 4FBGA 4GSKA 1BSVA 4CL3A 3H4VA 4CQLA 3U49A 4MVJM 3FPLA 3VZSA 2QYSA 4ONEA 4FOOA 4KWHA 3WTCA 3OH8A 4YT5A 5C3MA 3VZPA 3DHYA 3VHRA 3INTA 4JJGA 3OETA 3NDRA 4RJTA 5I9NA 1PGPA 3PK0A 4CMBA 1QXSA 4EUEA 3F1KA 3JQ9A 3GGOA 3EW7A 1AXGA 3FF4A 3PHIA 4IINA 1IHYA 1YONA 3DBHB 5GZ6A 1EUZA 1D1SA 2G5CA 2PH5A 4X54A 2BHLA 4IJVA 4DA9A 3DZGA 5TRTA 3TWOA 1VSUA 1HXHA 3H5RA 1AE1A 4ZU3A 3IJPA 3HSKA 5JNLA 1IL0A 1Z45A 3JQ9C 2IXBA 3H9GA 3LLVA 4NBVA 3WDSA 2NWQA 4MJLA 5L7YA 4KQWA 2E4AA 1RWBA 4MVJF 1BTOA 1N7HA 2G82A 5THQA 2AQ8A 1D1TA 1KETA 1U3WA 2YQ5A 1K6XA 3OEYA 5G0VA 3D7LA 5IDYA 4IJWA 1EVZA 2YJZA 4OQZA 5C7OO 5G4LA 4CMIB 2EKLA 1KVUA 2Q1WA 4R3NA 3W8FA 3ZWPA 1PJTA 2FN7A 5C7LO 4IM7A 1NQ5A 3FTPA 3G17A 1RPNA 1NASA 1I2CA 2GCGA 4ZQFA 3AU8A 1WPQA 2HSDA 3GN1A 2C29D 2VNAA 3QWHA 2Y0DA 3AUSA 4J4BA 3OBBA 5ITWA 1EQUA 1K5HA 3JYQA 4BO8A 2Y1OA 2W4QA 4G2NA 4UVIA 4Y6SA 5DT9A 3JSAA 2WJPA 3DONA 4OMUA 4BB6A 2DQ4A 4UEKA 1VE9A 3AK4A 3OMLA 3LZ6A 3TFQA 1WDMA 4WCFA 4LCEA 3C7DB 3DBLB 3K9QO 2DUWA 1WXDA 3FWNA 5KIAA 4KMSA 4BQRA 3GVCA 2UUPA 4PLZA 4D43A 1JW9B 3TOZA 3ZWVA 3VH4A 1C0PA 4JROA 4LSWA 1J5PA 5DNAA 3OECA 1UJMA 1HZJA 4Y98A 3E18A
chains in the Genus database with same CATH superfamily
3L1IA 4NR0A 1IXKA 1J0EA 3ENKA 1HOTA 1PG2A 3Q9NA 1NX9A 2DT8A 4ENTA 4G85A 2A0YA 2VT6A 3TCNA 2H1VA 3WKBA 2YS7A 2YYAA 3C6QA 4NDZA 2ZI4A 4IGKA 2Q0HA 3N53A 1TKAA 3T7IA 3ENNA 3ZGOA 4IKPA 3EF3A 1NOIA 4LRYA 1CQXA 4X1KB 2JATA 4A0RA 3ZLUA 3MJDA 3A1DA 2FFHA 2KB0A 4GM1A 3ZNPA 5BSVA 4M37A 2CXQA 5ENDA 1U9JA 3MB8A 3EPKA 1FYVA 4MKFA 2YW2A 2P6RA 3HACA 2CF6A 3PNLA 5MFPA 1Q7TA 2GXAA 1IAQA 1YZNA 1ECCA 1NBAA 3EVGA 3UATA 3MG9A 4JYCA 4AS3A 1E60A 2QNBA 4BRWA 3NC1C 2OV1A 1TZJA 2FPKA 2QM8A 3U61B 1RWQA 1WW2A 3CVJA 3L7CA 3PBKA 5KPDA 3OAAD 3F6EX 1Z82A 1OIWA 1SZJG 3KBBA 3VM6A 1Q0LA 1I3LA 1U5AA 3DEKA 4P58A 3TQRA 3D7NA 1U8EA 1AZSC 4LJ9A 3UK1A 2PZLA 2H0AA 2HLDD 4NYIQ 2E87A 4ADSG 4FFMA 4MRAA 2C3MA 1EFVB 3HCBA 2YIVX 4C1BA 2CV0A 1ULBA 1U94A 2O8VA 1Q11A 1CZUA 1S9DA 4QWWA 3N0XA 3OC6A 4JB8A 4MEAA 3BWDD 1UCFA 3VUFA 4E22A 1QU2A 3LQFA 4QM6A 4IWNA 4O02B 2C9ZA 5JDCC 1JDBB 1UKZA 3M2TA 4PCUA 5A6VA 5JBIA 4IWYA 1SBYA 4HJRA 3IHKA 2CKDA 121PA 3I34X 4UAVA 3NRJA 1VCNA 3KZ1E 3TRDA 2VPZA 3ROPA 1WSAA 3WICA 2GESA 3AJAA 2QEQA 3HA5A 3ZQ6A 4D0LB 3IODA 1YA8A 2G9ZA 4F96A 4JJKA 4MWTA 5TJHA 4X60A 4TSKA 5GM2A 4YMVA 4R2XA 3HEMA 1BW9A 3ZQ4A 4IXNA 1UAGA 5AHOA 3LT2A 1CDOA 4B4DA 5CNKA 1GTZA 4CL0A 2AEJA 1QOZA 2ZUUA 3RUEA 1YRWA 1V37A 2O4CA 4IVRA 1JA9A 1EYZA 3U1TA 3C3EA 4G1UC 4EAQA 5EUQB 4X63A 4CGYA 1E1CA 2HM7A 3QNWA 2HF7A 2GBPA 1ULZA 2Q6TA 2QX4A 4Q6BA 2BM9A 2ILTA 3SHQA 2NUAA 2FZEA 1Y4DE 2GXUA 1H2EA 3INGA 1H8EA 4JLNA 3V5NA 2C2XA 1ZZGA 3PTLA 1LDBA 1ORVA 5EMJA 2OFOA 2X1LA 3IIKA 1A4UA 1JE1A 4R8SA 4BJ3A 4RGVA 2EG9A 1RKUA 3B20A 3BJRA 4NCJA 1QKKA 1CY6A 3V1KA 5JJ5A 3CR3C 2RHOA 4CL2A 4X0EA 2AX4A 3ZE1B 4J0EA 1VHLA 4CCSA 3TZEA 5LCXA 5KMGB 4YRIA 2GN1A 1G0NA 1NBME 1C1XB 3JWIA 2RC6A 1TGYA 3UF0A 4JP8A 1LRJA 1XKQA 3MTAA 5H3CA 1XTZA 1QCDA 2NYRA 2H06A 4ZT3A 1TC1A 4OHYA 1O9BA 4TYPA 5TLSA 1HNNA 3DJFA 2ZYSA 4EFKA 1YQWA 3TVDA 3UCFA 1KGDA 1MNQA 3IV7A 2PMFA 3K4HA 4DYHA 1H9BA 2DYKA 4EJ2A 1T1SA 1LI5A 2XEDA 1MC4A 4UQOA 4MGZR 4LI3X 4LYHA 4O4JF 1YJBA 2FEKA 3N05A 4UDXX 4FLMA 4ZKEA 4F3TA 1V47A 1R15A 2J85A 1KWKA 1OH8A 3QG1A 3FTNA 4BGEA 4IG4A 3IEVA 4CUJA 2JH8A 2VJMB 1ENYA 1H3EA 2CLHB 4GL2A 1M1NA 2FSFA 1OXMA 1M2VA 1Q5PA 2I4MA 4C0BA 1YTLA 2XODA 1FFXA 3MUNA 3QYAA 5LB4A 3SBDA 2DQYA 4NHOA 1VJGA 2HPAA 1DKQA 1TU3A 1QYDA 3I32A 1ZKMA 1XR3A 3PGKA 3WMWA 3PEWA 3KZXA 4L6IA 1JJBA 3JQEA 4FR2A 1GAXA 2Y71A 4LMPA 3ZU5A 1ACLA 2FAXA 3MWJA 4KNYA 3NVMB 1LV8A 5CJ2A 3C7AA 3V8RA 1KRHA 1A77A 5TEWA 2ZCUA 3O4GA 4OK5A 3EDOA 3LHDA 3MXOA 3W4IA 4DDKA 2IDMA 4R8LA 4AK9A 5FQNA 4NG5A 1JHUA 2ZJBA 4GSLA 5JAMA 1WKCA 3P9XA 1CVIA 4RV9A 2CUKA 2JHCA 5TGTA 3PUKA 1O6GA 3OFNA 5DTIA 1V4VA 4YVFA 3QIVA 2JC3A 1UDCA 1Y63A 2GBLA 2CCGA 2VDPB 5HCUA 1U98A 4L76A 4Q3BA 4G37A 4AX4A 4OQNA 4H7DA 5ALJA 1I33A 1E6MA 2AE1A 4Z6KA 3EDYA 1Y9JA 3OTIA 4DC0A 3KVVA 5BRAA 3HJHA 3THYA 4NAVA 4X8MA 3TTYA 4C4SA 1UZMA 1IULA 2FDRA 2VNJA 3CC8A 4N4AA 2JKZA 1QU3A 3NXKA 1SCBA 4BWVA 2A86A 2AG1A 2AFRA 2IHJA 2BFPA 4M99A 2Q3BA 5E4TA 5E8RA 1L9KA 2QY9A 2WUVA 1DBQA 4GYWA 4IV5A 3AFMA 1Z5WA 5GONA 2RI6A 2XA2A 4E2YA 3TH5A 3ZZ1A 1SG6A 2DTXA 1XYVA 1EFUA 3E9CA 1F51E 3EG9A 3CZ4A 1SUFA 1YASA 3NC4A 4EOGA 5JIBA 2IP2A 1VJ5A 1LQTA 4ZV9A 2QR3A 1JSLA 4TTIA 4C1NA 5C31A 1OV4A 1LPOA 1YOBA 4W5JA 2JB9A 2Q8QA 2WRZA 2X8BA 4QNRA 1FMCA 4AF6A 1EVYA 3ND5A 2ZUSA 1K3FA 3EGXA 1FLNA 3I9V6 2RHHA 3ZIAD 1A4IA 2J9ZB 5FL3A 3F6SA 4FGSA 1MOSA 4PS1A 3KT8A 3QOFA 4YJDA 1I7NA 721PA 3GC6A 3OCWA 3VH2A 2GKGA 4UTOA 1J2EA 2E37A 4H4EA 4TYMA 3WXMA 2DF8A 5K5EA 3C4QA 2W2LA 1T0PA 1QMPA 5BVHA 2GJKA 1ZGCA 4K7JA 1P4HA 4OA8A 1YB5A 3SZOA 1ZCFA 3KQMA 1FVHA 1XI2A 4PAWA 1UODA 4NU5A 5KWVA 4D9IA 3OSUA 3RSCA 5L4SA 1OAOA 2I66A 5DXAA 4ETMA 3PNSA 2HHAA 2UZ1A 2PFKA 3IX7A 1RFGE 5BMVF 4TOIA 1P4AA 1U3TA 2GERA 3DW3X 3VR5A 1RJWA 1FE8A 2IRWA 4C89A 3QLUA 1MG5A 3WL5A 3M6AA 1YJAA 3L84A 2HCJB 3D8RA 3OZTA 2Q07A 2XI4A 3O95A 4G26A 4P84A 4PW0A 5TSDA 4DANA 1SBZA 5FUQA 1R8XA 2IW1A 3NO4A 2CKMA 5D85A 5JXJA 2C7GA 1NONA 4TVKA 4N5MA 3FBTA 2H17A 2QN3A 4EG4A 4UTRA 3KZCA 2FZ4A 5B4UA 1PJZA 1UXJA 2GQ0A 1U7PA 2R8XA 2FN3A 3E4CA 3FNEA 4COOA 3HYSA 4L5IA 1T1IA 3KAJA 4MZDA 5C7IO 2C5SA 4JWKA 4JLOA 3WO1A 3Q5EA 3WL7A 4D4LA 1EXVA 3MTJA 3ZVKA 5JD3A 2P9BA 3P2EA 5ES4B 3H5WA 1TOAA 1R9JA 1J9GA 1U7WA 1XX6A 2XUJA 3FZQA 1FP4A 1XJQA 3QX8A 4W5HA 1VE3A 1CC1S 3C5CA 2P2GA 1I24A 3BGVA 5FAKA 3GJSA 1LF5A 3ZU4A 3MMXA 2KBEA 3SY8A 1NBMD 3DO6A 3VNSA 1FYEA 4DM3A 4B6QA 4YP9A 4RQUA 2BKVA 5JI3E 1SO8A 1L5QA 1TJ4A 4OP1A 4P54A 2QSUA 4JAVC 4Q3LA 5AXDA 5A7GA 3JU3A 5ICMA 4MS4B 4XEHA 1PLKA 4GR5A 4X61A 1V5IA 1NJGA 1W44A 2WUWE 2ZT6A 4JJEA 1X1TA 4JLBA 1NGSA 5JHHB 2BELA 2M2IA 4AP9A 4OATA 2O8BB 4EB8A 1G20E 3PA8A 4AW9A 3IP3A 3AEKB 2IIPA 3WR5A 3L77A 3NHBA 1N2CB 1Z6TA 2AR7A 2G4CA 4LZNA 1CZRA 3KEOA 2CNWD 4RVGA 1BCSB 4B8WA 4AF8A 1RRMA 4JXXA 1QIFA 1ARZA 2AG5A 4P5PA 3W6UA 2FP4B 1F0PA 5JR3A 1TZMA 3GAZA 3CO5A 4J1TA 1GSHA 1C8LA 2QKYA 3K8YA 2OBYA 4LJ5A 5HK9A 1JEYB 1DX6A 1F7UA 3HYCA 4F93B 2LW7A 2A9KA 1KJNA 2X13A 1QV6A 3EFHA 5K0CA 1GRRA 4DLAA 5EXTA 1Z7BA 3ER8A 1QYCA 4D79A 1DIAA 3HVRA 3D3KA 1NOJA 3D0OA 4TMZA 4LF8B 4OOFA 4XJXA 1SQ0A 5KBYA 3MTEA 1SK8A 3E3OA 3OEHA 3VR1A 4EYKA 1JHVA 5JC1A 1ZL0A 3SDSA 1CY2A 1C2TA 3ZH2A 1LLUA 1DQSA 3CKMA 1W85B 1OLXB 1FX0A 3G9UA 3L6CA 3M9WA 3Q98A 2XADA 2X1VA 4P3XA 4TSFD 3S1AB 3P9CA 1IN8A 1YDEA 5IK2A 3V1LA 1NHWA 1PR6A 2PX0A 4BQOA 3EZ7A 1NKSA 3TZBA 3AG6A 3OUUA 4RJ2A 3CX3A 3WLEA 2R87A 3O84A 1YRAA 4TM8A 3HSYA 2PIDA 1S9HA 3NAQA 4F3YA 2RDMA 3BMQA 3DM9B 5EIAA 1B8VA 3CLSD 5KNCD 1Z56C 1NQTA 2JGNA 5AJYA 3K8ZA 1VCOA 1DU4A 3HR4A 4COKA 4XWYA 4OL9A 4CKBB 4GPAA 1FFXB 4M9ZA 4FB5A 1ZUHA 4M9SA 4B3CA 3EHEA 3OLCX 2AQHA 1QJ4A 4RHFA 3B7GA 3LWDA 4TN1A 5TS2A 4BLOA 3AV0B 2Y1WA 3UGQA 5K6TA 5LP6B 2RH4A 4KR9A 4AP5A 4YDHB 3I45A 2Q7XA 2EIXA 1QRAA 1WDWB 5CT8A 5LDGA 3RQSA 1C1DA 4GVPA 1T8UA 1DKRA 1ZD3A 2R6ZA 2OQVA 5KB3A 3KQSA 1F9AA 4LRUA 1CVRA 1GHTA 2R5FA 1JBQA 3QKUA 1UC4B 1EGHA 1XNJA 2NSDA 2YRWA 4TYWA 1PVOA 5FNVF 1AUQA 2PFSA 3LWBA 3UPTA 4HX9A 5DCUA 4DRYA 3NYRA 4DV4B 1W4CA 2BCJQ 4HDSB 3T61A 3WGUA 1B1CA 4YR7A 3KWMA 3UJ6A 2F8LA 2CNKA 3KIPA 1E6WA 4BPBA 1DDGA 3VYVA 3QKRB 4MVYA 3QEOA 3QOYA 1C8VB 5EE9A 4JI6B 3ZLTA 1G8FA 5KX5A 2IOHA 2Q7OE 1FZQA 2BISA 1TA4A 2ZIGA 4GDMA 1DRVA 1VBKA 5KVSA 1T3TA 1NXSA 3OCJA 5IN5A 1H0HA 3O6VA 2C7VA 2EVWX 4MLCA 4Y6LA 3ZX4A 4OQMA 5EJ7A 3FVRA 1PWEA 2HXYA 4YCLA 2W6IA 2M6RA 3FNHA 4QOIA 4ZZ3A 5KTRA 1J90A 4MR7B 3TDNA 3W34A 3N7UA 5BN4A 1NBEA 1R5JA 2WVAA 2P65A 4H59A 3DCNA 4YASA 1V8PA 1BCRB 1QS0A 3VJRA 2WQ7A 1M34B 2COEA 3N6RA 4Y2XA 3WFZA 2JAWA 3QKSB 4KE9A 3T4XA 4ENRA 4AZ3A 1DLIA 4PM4A 4DPKA 2VNIA 4C14A 1TJYA 2QMYA 5F35A 3BWEA 3DXXA 4WKBA 1ZN8A 2BEWB 3W0LB 1GTJ1 4ZIRA 1ZOLA 3L8EA 1AKMA 1TMKA 2V6MA 3EGXB 4F3CA 1ULUA 3VRHA 2YYYA 2WZBA 2ZIAA 4HPJB 1EGQA 4HLUA 2R5NA 4BO0A 1ONNA 4CLHA 1C7FA 3H18A 1NN0A 4V03A 3F46A 1EFCA 5HSGA 4REMA 1BXKA 3W5JA 3N70A 5KCZA 3OPXA 1BS2A 1BXRA 4IJMA 3SIRA 3UICA 1UT5A 3AHGA 3FPKA 1S4MA 3PWZA 2JLYA 3U44B 4EUNA 2B61A 1HT3A 3KAKA 1RLJA 1P2FA 4XDHA 5AVQA 3WSVA 1KS9A 1ZD9A 1E3WB 1UZLA 3W6PA 1SXHA 5ECGC 1J5EB 3EA0A 1NYLA 2Q62A 3LT0A 1IHXA 2OXCA 2Y93A 1DCMA 2ZS8A 4H18A 3UHPA 4UASA 4ECEA 4KR6A 3LAWA 3T94A 4LNHA 4ALJA 1FMJA 2AQIA 5K0FA 4J3JA 1UFVA 2XT6A 3Q3GE 1JGTA 5B3JA 1T2EA 4ZARA 1J97A 1G41A 2Q0XA 3MPUA 4K46A 4WOBA 4FHFA 5E6SA 5KSYA 1GKUB 1TYEB 1W1UA 1LF0A 4XB6B 1WZCA 4BJ1A 4E51A 4OLAA 4QGBA 2FZVA 3AF4A 1Z2CA 3NHFA 4LA4A 4M6WB 2ETVA 4NCHA 3S1LA 1E5TA 2DQZA 3I1FA 3TIGA 2BMDA 2QL7A 2ZYDA 4P3KA 3LECA 2NVWA 4Q7LA 2W2OA 1DKMA 2X40A 5P8WA 3NIBA 3ZY5A 3QHPA 4MUIA 5I4CA 1PSWA 3AVQA 1KBZA 4PQRA 1W4ZA 4URWR 3T7EA 4HEJA 5CA1F 3IUEA 3IAS1 4KFUA 5KSOA 5AUQA 3QZUA 4DWOA 1I8TA 4L5CA 1L7BA 1RR6A 3CLSC 4K9PA 5ALQA 2IU4A 4LIPD 3QXHA 1GILA 2NSJA 3W1EA 3WGLA 4EJMA 2PZKA 2VPIA 2PANA 3KKOA 3PC3A 3VAYA 4XX0B 1U9YA 2VOEA 3K70D 5AXBA 1EA7A 3MLAA 4P3YA 4WTOA 4JN6B 4I50A 2ZQ5A 6NULA 3MD0A 1HF3A 3FR8A 4KYUA 4V0KA 2O0HA 2CK3A 3WWPA 4AG5A 4LV8B 1AKTA 1VKHA 1XRNA 2HSEA 2ZU6A 4QTTB 3DEAA 2WLTA 3E9ZA 4BNWA 1TO6A 2VZ8A 1GWNA 2P6NA 1RRPA 1XDGA 4I8DA 5DYNA 5ITSA 2DKOA 4YEDA 1XBTA 1YHNA 6PFKA 2HWKA 2EERA 3BIFA 4BNKA 4C3VA 1OTYA 3M81A 2OL4A 3NDJA 4REQB 4BNUA 4DRXB 1VHQA 4HDNB 4WNYA 2YMMA 1M75A 3A1SA 3FHLA 2VK8A 3OT4A 4G0NA 4FFNA 3QFCA 3RYCB 4OSOA 3RO7A 3NTOA 4C6TA 5JDIA 3T6KA 3UXYA 2BZ0A 1IOZA 1SBCA 1LS6A 1NKTA 2ADMA 2RG7A 3R6LA 5E1BA 5FL7D 1P61B 3RRMA 2PLRA 4BGIA 1RYDA 2GLXA 2GEDA 3R7WA 2BMJA 1SHJA 4H16A 1ZIXA 4AJ1A 3OTOB 4M87A 2G5PA 3MTGA 4GG1A 4NFYA 1U2RA 2DPMA 1L4GA 1ZU5A 2GZAA 1Z4OA 1QRUA 4P3PA 4ZHSA 1Q1EA 4PLCA 3Q7RA 3ROFA 3IQGX 3T9BA 3RADC 5EIXA 2PV0A 1OH5A 4IGEA 4MV3A 2C20A 4KGZA 3VNUA 3D6NB 4LJRA 1FTNA 5C51B 2Z3WA 5B6PA 2CL6X 4Y0VA 1H3NA 2OP1A 1GGMA 1LJUA 3PYLA 5ALDA 5JYBA 2OKGA 2VWGA 2W6CX 2O2EA 3U3RA 3GVPA 3G0OA 3PXDA 2C2BA 3DLAA 4PINA 4M0LA 1P1KA 3WE7A 1XELA 4RLHA 4WV3A 2AYYA 2GWHA 1Z37A 5DBOA 5ISMA 1LDNA 4L4SA 2J6HA 2Y68A 3ZBUA 4ZTUB 3NG1A 4QDXA 1V2HE 3LBYA 4FUQA 2YV4A 1DO8A 2Z6VA 3JD1A 4X6YA 4DV5B 4QZVA 2FP3A 3DMDA 2RHJA 4AWBA 2C5EA 4EECA 1C9YA 2CVQA 3MT9A 4UHJA 2HXSA 4P6VF 1QH9A 2W6JD 3DV2A 4FN4A 4DQUA 4L3VA 2BEUA 1A2QA 1N6KA 2EJWA 1EFDN 2FMKA 2WHPA 3COPA 3P26A 5DTJA 3R6DA 3A1UA 3WYCA 1MPTA 3JVUA 3PQ5A 3OO1A 1MN6A 1YOVA 2AWNA 3CX4A 3AHJA 3BWYA 2HTFA 4JBYA 1V1RB 3AR9A 4R8MA 2XMPA 3FPBA 4QQNA 2QTAA 5JAIA 5LP6A 1NUAA 1WCWA 1PR2A 2FWMX 2FLKA 4TS1A 2OBMA 1HKUA 1GV1A 4HGPA 2WYUA 2QQ0A 3HUTA 2VPPA 3X1KA 3P9ZA 3WJ1A 3JQ6A 3D1LA 2OO5C 1G8SA 1PJLA 3FVWA 3VOSA 3SCZA 2OE2A 4C4AA 3VZQA 2DFDA 2HPVA 2IXTA 5EE5B 1FL9A 4TRNA 3BXGA 4DDMA 5COAA 4XYGA 5IH3A 3ZHVA 3KD3A 3LC1O 4OXKA 2ZJ5A 4P5EA 1GGKA 2IEZA 3CU5A 3L07A 3PC6A 1ODKA 4BLQA 1ZO8A 1IIBA 4JK3A 2ZITA 4KV9A 1HSZA 3B3GA 1KAOA 2MR5A 4KX3A 4YI3A 4EY8A 4AECA 3IMEA 1G3QA 2IPXA 2IYXA 1MG0A 3JPWA 4NCXA 3BMOA 2X3UA 2F59A 1YVEI 4KSYA 2AFVA 2CNNA 2E4WA 4L6AA 4MCJA 4RAQA 2FA9A 4OQPA 4XOIA 4ARBA 5JVDF 8LDHA 3K70C 2QORA 2V5VA 1IG0A 1Z6PA 1P1JA 1I3KA 1EM6A 1O6CA 2I5PO 3F6CA 4N03A 4EFDA 3RAFC 2VJYA 4QUJA 4F3KA 3ETHA 4IVPA 3QNUA 5KTTA 1BROA 1NRIA 1V35A 2H4XA 1N34B 1QIIA 4YGYA 5B1HA 1O89A 3TLZA 2ZRJA 4EY7A 5HX7A 1TGVA 3V4FA 4ZZ1A 4FEEA 2E49A 4KOEC 4ER0A 4BQIA 4RZSA 4QD3A 1G5TA 1YO6A 1UDWA 3KZKA 4PN7A 2OMEA 1D09A 1ZGJA 1E2BA 4R1NA 1CX9B 4O2AA 2IY9A 1HV8A 1KJYA 2VCHA 2JCBA 3GRYA 3JARA 2ZKLA 3D4OA 2ANCA 1SOMA 3DD5A 2QRHA 4GOXA 4C6RA 4MNTA 4H35A 5IFLA 3GFGA 3VDXA 2CYBA 3K9BA 1Z33A 1PS9A 5DN6A 3D81A 4W9NC 4YRTA 1ZMOA 2Y0PA 4FW9A 2AFHE 5T6BA 4FCTA 1DARA 1PZMA 2VTEA 1R0SA 2ZXFA 1M1UA 2XWPA 4J91A 1MVNA 3IP1A 4RTKA 4EG0A 2ZDQA 5BR8B 5EN4A 2OAP1 5BYBA 5A04A 3LKZA 1C4OA 4Q1FA 4EB6B 2BMVA 4JBNA 3IUSA 1IZZA 1J49A 3A10A 4IIJF 4KMRA 2WSBA 4MW2A 1WIWA 3OUTA 3X3HA 2FJUA 2V7EA 3OP4A 1IHOA 3OQBA 3JRNA 5I48A 1UKVY 1NVXQ 4OMFG 2PY6A 2C4TA 2WHQA 3GFRA 1U2TA 2ECKA 3C43A 3R5JA 4ENPA 5DHSA 1YVPA 3ILXA 3C97A 4EFMA 1GZVA 2G25A 4M86A 3KB8A 1TQ8A 4QTUB 1QDLB 3LUFA 1Z6GA 4YUVA 1HNXB 3VJLA 4ZI3A 1NW9B 1R4NA 2WJAA 2OECA 1QH1B 1Y1RA 2WJ4A 1FPQA 3TPZA 4CMAA 2ZUEA 4AUKA 1MABA 1UOQA 3JQFC 4IR7A 1B14A 3H5AA 1TK3A 1XVUA 1ISSA 1TZBA 2CMDA 2DPXA 2ZDGA 5CDHA 3R8XA 3V9AA 9MHTA 4V0LA 3F3MA 2G1PA 1ABBA 3C3MA 1VMEA 4GEKA 3JCZA 3M1IA 4IUCS 1T6NA 4TXMA 4GL4A 1CEEA 3RSHA 4K9OA 3IPAA 2AFIA 1QF9A 4LWQA 4CM7A 4CDRA 1TIBA 3N8NA 2WTNA 4MJ7A 2HV8A 2W11A 3ZVNA 4BYGA 1Q84A 1II8B 2JCVA 1DKLA 4IRXA 5B12A 4LE1A 1EVQA 2HRRA 1USIA 4X24A 1QORA 4EGJA 2IP4A 2VS1A 2EJVA 2XCLA 4FT4A 4PVCA 1A82A 1V6SA 4FT2A 1BX1A 3WGOA 5F2NA 5ESXA 3VJKA 1KVQA 2IS4A 2QSJA 2B37A 3KD2A 4QICA 4C0KA 1DXHA 1V8BA 2X6TA 2PNFA 2ZB4A 3LV8A 4FK8A 4RLSA 2OM2A 1G7RA 1USGA 3DC2A 4FCVA 1XWFA 2OFWA 3QBJA 4IO1A 3F9IA 4X1OA 3NUZA 421PA 3AI7A 1PUIA 2R48A 3OPMA 6REQA 2F67A 4OX9Y 1EI9A 1O03A 1S1MA 1SVUA 1IHUA 3HCOA 3LBFA 3M6FA 1Q21A 2LRHA 3MINB 2RHCA 4JYAB 1RXUA 3BBPA 1W4AA 4WOPA 4QFBA 4A15A 1E3QA 1JFFA 1YACA 5J5VA 3QUTA 5AOAA 2WNIA 3K9GA 2R25B 3KWJA 3R7WB 5FCDA 3WLIA 2E3JA 3STYA 1S02A 2A5JA 3W8EA 2D1YA 3U31A 3JQQA 4WN9A 1GL3A 2EHJA 2J09A 4A0HA 1QHXA 5CK5A 3WI7A 2VZ9A 2YNMA 4H3KB 3BDVA 1EHIA 1CJVC 4D96A 1TUBB 1JQLB 2JNWA 5J2UB 1E3SA 1IFXA 1ODLA 3IDSA 1EBUA 5BV2P 1CUIA 5LBIA 4EEXA 2HSWA 1PVDA 1J99A 4YMTA 4YX9A 4MJXA 2I3AA 4BNVA 2G40A 2Q4RA 1NV9A 2R7NA 5THKA 3BQMB 6ADHA 1T34A 5GIOE 2VHXA 1SIOA 3QITA 1J9ZA 1MJNA 4JU8A 4PC1A 2MCFA 3UWKA 4YDQA 1PNVA 3QQPA 4I9UA 5LOVB 4ZICA 5BN3B 1C8KA 4PXSA 4RYLA 2YQ4A 1WB4A 5JD5A 4KK3A 3X0DA 2LCIA 2XZTA 4MQ6A 2GZ3A 2DJIA 4R7TA 1SC6A 4DLRA 4YUWA 2JLAA 4OGWA 4GIBA 2I91A 1H0KA 1K7CA 4DREA 5BR7A 1SCJA 1XEXA 2OHFA 1M7GA 1BO6A 1P80A 2ES4A 1GPMA 2GYYA 2O6HA 2YV2A 2VYVA 3GGJA 3SIPA 3ZZNA 2P41A 5EUMA 2ORED 4F4HA 3MC1A 1P91A 2BEJA 1XXHB 2D7DA 4EKNB 1W0KA 4O4IF 1I1NA 3U62A 2H00A 3GJ0A 1DX9A 2HDWA 4JBLA 2GPJA 4XB1A 1C9JA 2HHLA 1B43A 1U7UA 2HQ1A 2QB5A 2JD2A 3E9QA 3KO8A 4IDNA 5MGBA 2H2FA 2HJ9A 3A1VA 4BNTA 1THGA 1X39A 3DKKA 3GUYA 4PLGA 3D64A 4IIHA 2V6GA 3VC2A 3IR5A 1BYUA 3DKIA 3QHQA 4GVLA 1MJFA 2IE8A 2VJKA 3FCXA 4JB0A 3K1JA 3SG0A 1QH0A 3RVMA 4E6PA 4CQNA 4E31A 4ND2A 5B1SA 3K92A 3OZRA 2QAGA 2RKOA 3HL0A 5C32A 5HZGA 1RDFA 1GLNA 4REOA 2BBTA 1U3UA 1T2UA 4HADA 4B2LA 2A5LA 2OCLA 4LAFA 4O1HA 4O4HB 5A4KA 3R0QA 3COYA 3P0IA 3D9QX 2N9UA 4LSGA 2FWJA 2R0QC 3FTCA 1YR2A 3COVA 4LZLA 2H6EA 4MPPA 2IFTA 5JS6A 1GRQA 1IY9A 5BR1A 3KSZO 3KX2A 1A7KA 1XJWA 3K5WA 3I2JA 4CFZA 1CKEA 2QRKA 5AJVB 3Q11A 3VUEA 4PSKA 3M49A 8AT1A 4KDEA 3KHUA 2V7QA 2OQ2A 1A0OA 1NE7A 4RTOA 5AI6A 1HURA 1SVKA 2R2GA 3AF1A 3RUDA 5C8DA 1B6SA 2Z5LA 1B8PA 3DULA 1NVGA 4HWTA 3IAEA 5FEUA 3D3JA 3H2BA 2EBWA 2D7JA 1VPDA 5CX1A 5MHTA 3SFVA 1TJ5A 1SOUA 4PN3A 4P36A 1YZVA 4LDJA 1JHAA 1ZL2A 3PQCA 1ZK2A 4MVJI 4DA8A 4HNUA 2BBSA 3G1TA 2RGEA 3OCCA 2E6UX 3ZWBA 1O8CA 1M2FA 1X1AA 4ZAVA 2VDUE 2SKDA 3KQQA 1T8TA 4AS1A 1HLPA 1TYAE 2O3UA 2C9BA 3F6BX 1W46A 4DV7B 3OZUA 1WHSA 2W93A 3FCAA 1EAYA 2C2YA 3G13A 4HFMA 1KDPA 1UBMS 1UOOA 2OZLB 3LC7O 5EWMA 4M0EA 1SC9A 1H6DA 4K9RA 1PKEA 1S5PA 2O4UX 3N75A 3REQB 4A6EA 5CFPA 3DP7A 2KM1A 4QJ3A 1L8QA 4NABA 4PXYA 4AY6A 4TUYB 3EZ9A 5JAUA 3NUGA 2DY1A 1ENPA 4LQ4A 5KTNA 1G5HA 3BPSA 1TMYA 3ISTA 4YUAA 5CFLA 3LL4A 5LZ4A 2HZ7A 3KG2A 3WGHA 3IESA 1JQJC 1PZEA 4LV5B 4GPZA 4NV3A 5AW3A 5DISB 1GQSA 3LQ4A 1Z2AA 2Q28A 1C3JA 1R8SA 2QZ4A 1XRPA 2XUHA 1YB7A 3HDGA 4DPLA 4DHWA 2ZIXB 2VN8A 1K1EA 1F8XA 3AOEC 3CGGA 2B6HA 2O48X 2A57A 2V54A 5FB3A 1KSJA 2UU9B 3MJRA 3V4VB 2YICA 1L4LA 2BGKA 4OFBA 3C39A 1ZP6A 1ZH8A 3ODPA 2JFZA 1Q1QA 4HH1A 5KX5B 1JFTA 2CWDA 3C3WA 1NPYA 2J4CA 2WFZA 3OESA 2DRIA 3SF8A 5JEDA 4MO2A 2CHVA 8ADHA 4LVUA 1ADYA 2FN4A 3FZNA 2IYVA 3O7MA 4JB2A 4B2IA 3EYAA 3H83A 5D2CA 3LGSA 2QAIA 3QXJA 4M1TA 1NR1A 4MGHA 4XSGA 1UPAA 5EQFA 4B5LA 4TKZA 3UJ9A 1ADBA 4FFDA 1WXGA 1SUBA 5AQEA 4K6FA 5HIKA 1W7AA 1S7GA 3EMKA 4KCGA 4WXPA 4CETA 4BLVA 1A04A 1Y6ZA 3KT3A 2Q5QA 3KS9A 5FXMA 4RLQA 2EARA 1JDSA 1W4RA 2J3HA 4FUTA 3BTVA 4CMHA 4F9FA 3TLEA 2JVJA 2PUFA 3K96A 4NYMQ 5TMDA 5ALFA 1FMTA 3DD1A 5INTA 4YBRA 1IPEA 2FSIA 2VNHA 2IYLD 2H0QA 2BW0A 3UAWA 4WD3A 8OHMA 3Q7EA 1RYYA 2JL1A 1ZM3A 4R1TA 2JGFA 2EJUA 3RC2A 1UINA 4YJFB 5A3QA 4DB2A 2J3JA 3K53A 3ZKAA 3I2IA 2PRSA 2NXWA 3H8JA 1GNPA 1YAHA 3SSAA 1Z8NA 3WMXA 3PFHA 5LZ7A 3EXEA 1RJGA 2UYCA 1YC2A 1NVBA 1YS2X 5ALIA 4IZ6A 3EEFA 2B5VA 3C7TA 3VTZA 1YUNA 1AV7A 5DIFA 3ZI4A 2R6JA 1YE8A 2ANBA 3A2MA 3E70C 1NN3A 2JGDB 4JUBA 5TVGA 4FLFA 1UXOA 4XDGA 3K72B 4WNAA 3AW8A 3RC8A 1HDYA 4L28A 2HGZA 2H1CA 4IOMA 4B6EA 1MD9A 3A9WA 2WF8A 4B2YA 1WBDA 1V1MA 3JVIA 3LY8A 4IMPA 4ASUA 1INLA 1R9NA 1BFDA 1MW9X 1S2LA 2H07A 4TLDA 3NUQA 4MITA 4L9AA 3B51X 4BNZA 1PF7E 1E66A 1Z47A 3WGYA 5EP1A 1SELA 1Q22A 2CVFA 4E21A 1NQOA 4BNLA 3K9NA 1OFHA 1ZK3A 2DAPA 1N57A 3DT6A 3EB9A 4HNQA 2D62A 3TNLA 1ZA1A 4LHXA 2XKBA 4R40A 5TF4A 3ITEA 2G6TA 1KJZA 2E4XA 3B70A 1E63A 4YCJA 3V1MA 1QH8A 2MYNA 3HJCA 3LWNA 4HKTA 4EGQA 3BRQA 1OROA 2Q4OA 3UK0A 4B31A 2R5WA 2RSLA 3UCEA 1WMBA 3K0SA 1U0FA 2W2XA 2D59A 5AM4A 4BB0A 2BGWA 1ZS9A 4QVIA 1MVLA 5F5XA 1Z34A 2A9QA 1UWCA 3UJCA 3BRWA 4LFCB 1N0VC 2PL9A 1FEZA 2G70A 2QRVA 4WZAA 3IOBA 5CDTA 4CKWA 4J49A 2BMWA 3PUHA 4WGFA 4ETIA 2IHNA 1KEWA 1A96A 1WTAA 1EFPB 1M8KA 2AN9A 1HQYE 3AUAA 3EIFA 4X6XA 3VR3D 5DCYA 3DVSX 3GJYA 2O59A 1P6UA 4KIWA 5C53B 1B00A 4G84A 5ERGB 3RLIA 3PCTA 1S3IA 1GGJA 3GLIA 2OQRA 2F3UA 1EM8B 2EL7A 1W5BA 2XIJA 2HNBA 3KYIB 4NEQA 4RDHA 1B15A 1NMZA 2QUJA 5AVZA 5IG2A 3RM3A 4ENSA 1W94A 4O4LB 1R88A 2GEKA 2O1SA 1K8XB 1VLHA 2NLOA 4BVLA 4C07A 1E20A 1ZM2A 5JTUA 1KMIY 1FU7A 3PJGA 4I1RA 2YN0A 5TF0A 4WZ6A 5PGMA 2MSEB 4S24A 4D98A 1EWYA 2E48A 4OBEA 2K4MA 1SCUA 2PLNA 2Q3MA 3EAGA 3HY6A 3KYDB 3MN1A 5BSFA 3HVJA 3JD3A 3K30A 4M0PA 4M3NA 1NYRA 2WNHA 4YFYA 5EE1A 4AURA 3CVVA 3M5PA 1TCBA 5AR1A 4WKGA 4TRJA 3RABA 3U3OA 2ZBEA 2OYSA 3B5JA 2HMUA 3G9ZA 4FJ0A 4G4SP 4L9WA 3FWKA 4DLZA 3H7AA 5AYVA 3F8TA 3G2LA 2ECOA 3TTXA 2IHTA 3UW1A 4A26A 1PGOA 2NO0A 4S1OA 1FTSA 3ZPXA 3VR2D 4OVKA 5F3WB 3QYFA 3AFOA 4TMWA 2YKGA 4OJNA 4US2R 1A9QA 4G5OA 4LJ8A 1BX0A 3ZW8A 3MIIA 2X15A 2RGUA 4PTYA 4Q1VA 3FAZA 4JXKA 4QOEA 4EA9A 3RD5A 4EPTA 5HJ5A 3PU6A 4FZJA 5JD4A 3Q8LA 1L7VC 3P4YA 4N7RA 2XXJA 4V24A 2SNIE 5TXGA 3DBLA 4OEHA 3CF4A 1RZUA 2RB4A 2VQDA 1O6FA 5KEIA 4N7BA 3DBVO 1E4OA 1GTL1 1LTKA 1E2JA 2AUTA 2J4DA 2DFPA 3QLVC 2AI3A 2BTQB 3KR1A 2VA9A 2QV0A 1FFGA 2B0JA 2VUSA 2VZLA 4G25A 3OPQA 1KEUA 5LXTF 3NPMA 3R24A 5JPIA 2CDAA 3UA4A 1UMBA 2HF8A 3GXOA 5DTMA 2R9VA 3SFTA 1S2IA 1T0BA 4FTWA 2C8JA 4CYMA 5JBQA 1A8IA 4IH9A 2R84A 4G1CA 2IPMA 4QPNA 4ZCQA 5HFAA 3UUFA 1YRBA 2IYFA 3TW8A 2E5LB 1T10A 1RTTA 1CJTC 3D6FA 2M6SA 4NWIA 3M9XA 5EZYA 4I5IA 1JIJA 2O0JA 3TNFA 1BOFA 1VBFA 2G1UA 1MX3A 3NHZA 2IF2A 4UE6A 4M89A 3RSGA 2RK3A 3V7FA 1FLDA 2V9ZA 4C5AA 4BNDA 2R65A 2IOFA 3HWX1 3V7WA 3FFWA 2A14A 4G5GA 4KGVA 3RGWS 3KPWA 2PXXA 2ONYA 3M8KA 1O6ZA 3Q7PA 4JODA 4A8JA 1E6LA 2WUFA 1GN9A 3D59A 2BFDB 3K31A 4UZEA 4N7MA 2E21A 4KQXA 5JY1A 2PD4A 5LZ2A 5IF3A 3I76A 3CMMA 4WLOA 1FYDA 1VLLA 2Z2YA 1NW8A 3A26A 3KBOA 1B73A 4I8IA 2F1JA 3A9CA 5EHZA 4U8GA 2IZ0A 4D44A 2XCUA 1NW5A 1PJBA 1ZH0A 2HADA 2Q6OA 3PGVA 1JQAA 4JC8A 4RE6A 4XWKA 5HZHA 1WMEA 2DM6A 2G17A 1GU1A 3PXUA 1T36B 3KAQA 4OI4A 5C5CA 3BF7A 1VJ1A 5C46F 3UYKA 1OIXA 2K87A 3LYHA 4NZ9A 4GD3Q 4YYEA 2LCFA 1G98A 4R71A 3SF8B 2JJMA 5F9MA 4D42A 1C0LA 3N2GA 4Y9RA 5IKMA 4MS3A 4X90A 1Q7CA 4Q24A 2C96A 3KV3O 5AVKA 5F98A 2BVNA 4CMJA 4H7JA 3VMMA 3LRPA 1T1JA 3EZLA 4B3SB 4FOLA 1Y8QA 1N3IA 2RKBA 5AO9A 3TG2A 3ZDBA 7MHTA 1FRFS 3WNDA 2EX1A 3FYUB 4Q1BA 4PSAA 1LBIA 5CM8B 3CE9A 5DOZA 2VDRB 5THXA 3KJXA 1N5IA 1OH7A 3D0KA 1HMYA 4CLOA 1OILA 3HE3A 3LBNA 1JB1A 1E59A 3KKPA 1KZHA 3RYIB 3NW9A 3PFCA 3ZHTA 5D5HA 4QJ5A 4MI1A 3UT5A 4WBSA 5IEBA 1O9HA 1UDXA 3AL2A 4B4WA 3HKEA 1PRYA 2O8NA 4G1EB 3DTYA 4ICIA 4FDAA 4MLZA 5DMHA 5BY2A 2EWWA 4OGGA 3AVWA 2OEPA 1KK2A 3BG5A 5J4HA 3GV0A 3TOXA 221PA 3GFVA 1U8AA 4BVAA 1NVUQ 5IAKA 5JNUA 1JDBC 3H2SA 3E3NA 3NDPA 3IGFA 3RJ5A 3RU2A 1SURA 1OW3B 4DV6B 4BYMA 4HXFB 1U80A 1PAUA 4PYLA 3VH1A 3ZUPA 1ULAA 3EEYA 2Q1TA 4JENA 4TV9B 1PT7A 1PGQA 1WDLA 2JIRA 1TT5A 1BDJA 5GAJA 1ETHA 2FQWA 1PL7A 1PU2A 1W8DA 1SPXA 2OCBA 1XCJA 2A94A 2F48A 7REQA 2O8DB 1RZRD 4CZ2A 3VZDA 4UM9D 1QVAA 2GJAA 3PRKE 3BH0A 1G6OA 3AM3A 1ZC4A 4PCAA 1P5JA 2R2AA 2YVQA 1WVIA 3BD9A 3EIWA 3OU7A 2RAFA 5I7VA 1OLSA 3W5HA 1ZXXA 1CUDA 4GS5A 1AC5A 4GE0A 2C8KA 4GNRA 1PN3A 5KYNA 1Z29A 4P0PB 3IJRA 3O38A 4EO7A 1HQDA 2R8OA 1KDVA 2X8AA 1P3JA 3PZBA 4FGUA 3N74A 4H6WA 1L9XA 4KIFA 3TCKA 5F64A 4CLDA 1WXHA 4UBJA 4Q02A 4FQ8A 4UE2A 3NEPX 2YASA 3I9OA 4LVCA 1FJ2A 3IPCA 1F1JA 1KK0A 1P0PA 3ICVA 3FPFA