2X8RA

The structure of a family gh25 lysozyme from aspergillus fumigatus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
TTVQGFDISNHQKSVNFEAAKKDGAQFVMIKATEGTTYKDTVFNSHYTGATKAGLLRGGYHFARPDKSTGSTQAKFFLKNGGGWSDDNRTLPGMLDIEYNPYGATCYGLSHSQMVAWIHDFVNEYHHATSRWPMIYTTADWWNRCTGNAKGFGDKCPLVLAAYSSSPPKTIPGDWKTWTIWQNSDKYKHGGDSDKFNGPMTQLRKLASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Family Gh25 Lysozyme from Aspergillus Fumigatus
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE
total genus 69
structure length 209
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x8rA00
3VDHA 4XUYA 4PEEA 2A3AA 2BY0A 2NW0A 5IHRA 1OWQA 1E4LA 3CHEA 3BAYA 3RM9A 3POCA 1FH9A 1QBAA 1V3LA 4B9YA 2WSKA 4F9DA 3AHVA 1E6SM 3BC9A 7CGTA 3MUAA 4HA4A 2YDQA 3T09A 5IHSA 1GQJA 4CCDA 3UERA 1XSJA 2X1IA 4AD2A 1E56A 4HU0A 1VB9A 1MW2A 2CITA 3IK2A 4C7DA 3QHMA 1L8NA 4GQRA 4QLLA 3CLWA 2VCBA 3WBAA 2VQUA 3D3AA 1JYXA 4FK9A 1E6PA 3SCUA 4JHZA 4FLQA 1UD4A 3AS3A 3UESA 4HOWA 2WYSA 1ISWA 4PSRA 1JDDA 3WH6A 1DWAM 1HT6A 3T0AA 4H7VA 1DWIM 1UWIA 4MB3A 1R8LA 3K46A 4GZJA 1UD3A 3WFLA 5IFTA 1BSIA 1VRXA 3QR3A 3ARRA 3ARVA 2XUCA 1TCMA 3TONA 4AW7A 3GBDA 4D6EA 4D6IA 1VFUA 1LLOA 2V3DA 2WVVA 1JD7A 2VRKA 1V3IA 1BHGA 1HN1A 1UD8A 5A8OA 5BXTA 5ABFB 4AZGA 4ZENA 3B9DA 2ZXAA 7A3HA 1W32A 2JEQA 1UKTA 4NI3A 3WDJA 4V2XA 4UFLA 1LWHA 2QHAA 4QLJA 3K8MA 3KL0A 1UWTA 1TE1A 1J0HA 1NWSA 3VIIA 2XHYA 2D0HA 1B3XA 3LMYA 3WF4A 4EK7A 1TA3A 3FAXA 1GORA 4TTGA 3AHZA 1ZJBA 3VDAA 2YA0A 1NQ6A 1E43A 1WZKA 4CU8A 2D2OA 3WF3A 1I75A 5A6BD 4BF7A 5A95A 1CGUA 3W27A 4GZEA 2C7FA 3SUTA 4BCEA 2EBNA 4YPJA 1JNDA 1ITXA 3WQVA 5A8MA 3WD1A 1G1YA 2ZIDA 1UZ1A 4HZ6A 3ARWA 1LWJA 3AZTA 1J0IA 1LL4A 5ABFA 3AZSA 1V08A 1W2PA 3DHPA 1E0WA 2Y8VA 5D9OA 5EB8A 1LL6A 2JIWA 4H2CA 5CSYA 3CH9A 4HZ8A 3A4WA 3QOKA 1V6XA 1C8QA 1K9EA 3BCFA 3VMPA 2YL9A 3DYPA 1IV8A 2WVVB 1QI4A 2GK1B 1Q4NX 3PZQA 4KRUA 2VCCA 4B3LA 2CBIA 3EMCA 1PAMA 4UCFA 1AMYA 1QBBA 4QDMA 1UR9A 3CTTA 4W89A 1MXDA 3II1A 2PWFA 1TVNA 4DUVA 2DSWA 4UZUA 3T0DA 3KL5A 4ZE4A 1KBKA 1XHGA 4PRWA 1KWKA 3EDKA 3ZR5A 1XC6A 1G0CA 3WDRA 4AD4A 2OWCA 3SEPA 3L4ZA 4AZBA 3BMWA 4KGJA 4UQAA 1GCYA 2AOSA 3M7SA 3WELA 4PN2A 1EGZA 2WMFA 1G94A 2FHCA 4CN4A 1KR0A 3ZJ8A 3WFZA 5E0CA 1E6XM 1GOKA 3GDBA 4U31A 4X9YA 1QW9A 2O9TA 2WVTA 4WSKA 1JI1A 2WZIA 4U2YA 2J7CA 4D71A 3GNRA 1HJQA 1QPKA 1UD6A 5E9AA 1Q6GA 1WDPA 2VQTA 3AHTA 1BTCA 2VZUA 3NJ3A 4QCEA 2YA2A 1HXJA 5I6SA 2XG9A 5A2AA 5GNYA 3BLPX 1EXPA 1FH8A 3ARTA 1E0VA 1MVYA 2J79A 3VX1A 5I0DA 5EBAA 3K4DA 2QPSA 2TAAA 8CGTA 2V38A 2CYGA 1JD9A 4CCEA 2DSZA 5DMYA 3AJ7A 3ZQ9A 1NARA 1LJYA 1CIUA 2WMJA 3VUPA 3ARPA 2D23A 1WZMA 5A69A 1GOOA 4AZIA 1B31A 3EMQA 2PI6A 1H41A 2YBTA 5F7UA 4Q22A 1QI5A 2W5FA 3AMKA 4H8UA 1XH0A 4D6JA 1KCLA 2GFTA 1U33A 1VEMA 5AC5A 1B9ZA 1QNPA 1E4IA 3A4AA 1H49A 4B3KA 2DH2A 2WHKA 3W53A 2OSYA 2VZSA 1KXQA 1RP9A 3POHA 5GPRA 4JKMA 3U5YA 3RILA 1UWSA 1FOBA 4UQEA 2GJPA 3VINA 2XFYA 1OINA 1XRVA 3EMZA 2OSWA 3NUKA 4OJYA 4JFSA 5FKYA 1UWUA 1PJ9A 2VVSA 4M24A 3WMCA 1GOIA 1JZ3A 1JF5A 1VJZA 1BAGA 4GKLA 2XVNA 6TAAA 1Q6DA 3VPLA 4WKHA 2D0FA 2WANA 2W63A 4R5EA 1ZB5A 1GUVA 3VD5A 4AZCA 4PUEA 2WZHA 3SUWA 1JG9A 4HMEA 1JDAA 1VFMA 1UH2A 1W3HA 3ARSA 1I1WA 2VR5A 3OGSA 5FCZA 2E9BA 2BHZA 4J28A 4TX6A 3SCVA 2GUYA 1NOFA 3VU2A 1HP4A 2OSXA 3AXXA 4D1IA 1Z32X 2GSJA 3WUBA 1QI2A 2YL6A 2VX4A 3WDQA 1WZLA 1IZKA 4AD3A 1KQZA 4DM2A 4GXPA 1SFSA 5HBFA 1WCGA 4WK9A 3AOFA 4ZXLA 1PIFA 5BRPA 1CGTA 4ZFMA 4WF7A 2WCGA 4TVDA 1BGAA 4UR9A 4Z2KA 3T2PA 4ACYA 4W7VA 4W8LA 1EO7A 2OWWA 2JE8A 2D3NA 3W81A 1UA7A 3NDZA 2GK1A 4TVUA 1O7AA 1ECEA 1R87A 1BYDA 1G9HA 3UG4A 4CU6A 3FHQA 5HPCA 4TTUA 4BQ3A 1CLVA 1GVYA 1UKSA 4Z2JA 4UOZA 1ZBWA 4AZHA 4W5UA 4IISA 1A3HA 4N42A 1X6LA 4BS0A 4MB4A 3VIFA 1B30A 3PHAA 2DQXA 3WD2A 4J3WA 1HL9A 3TTQA 1WE5A 4XV0A 1VFFA 3SURA 5BROA 2CCRA 3SUVA 4QFUA 3VD9A 2GJRA 2XIIA 1J0KA 2YKKA 1E4MM 2J7FA 4JFVA 4DUXA 4P7LA 3F5JA 1UH3A 1JIBA 3VDBA 1MQPA 3FN9A 4UQCA 3MU7A 1OGGA 3UCQA 1CXEA 1KCKA 1LF1A 4W7UA 4L4OA 5M5DA 3SCOA 1KXVA 3KL3A 2VOTA 4V27A 5E0FA 1Q6EA 2YJQA 2YDRA 3ARXA 3WBEA 4H04A 3CUHA 4AD5A 2O9PA 1UR0A 1GOWA 1HL8A 5FL1A 2PC8A 1V3JA 1V02A 3VIOA 2YL8A 1A47A 1K9DA 3OZPA 2O9RA 4UQ9A 4JCLA 1JF6A 5E70A 1PZ3A 1CTNA 3WENA 5A8NA 3BAWA 4CGTA 3OG2A 1AQHA 1CDGA 5GNXA 1BQCA 3LPFA 4WLCA 2ZUUA 4XX6A 1E3XA 4L4PA 3AS1A 4J7RA 1PIGA 5ECUA 2YIHA 3AIRA 2J7BA 3GXDA 3MMWA 2CXGA 2QMJA 1EQCA 2G3MA 1JZ7A 3ZJ6A 1C8YA 2WHLA 2A3EA 2W62A 3AIUA 2J7EA 3BAIA 3N18A 1HKKA 3WL0A 1E6QM 2JALA 4PBGA 4J3XA 5CLWA 3ALFA 1JDCA 1QHZA 2G8ZA 1HIZA 5C70A 1NWTA 2BFGA 1D2KA 3WDPP 2OWXA 2ZX9A 1YHTA 5FIPA 1YQ2A 2QPUA 1HKMA 5AC4A 5BCAA 3LPPA 3EYPA 4DWSA 1H2JA 3W0KA 5BXRA 3CUJA 2W92A 3QHNA 5DT5A 1JZ5A 1NWUA 3SIMA 1U30A 1K9TA 2OYLA 1KB3A 1ITCA 4W93A 5HPOA 1KWGA 2VNCA 1UH4A 4JL2A 2V3GA 2O9OA 5CGTA 3VO0A 3WQ4A 1GOMA 3VD7A 4A3HA 3WD4A 2Y4SA 3IANA 3AIEA 4B15A 3ZO9A 3IAPA 2JEPA 4AEEA 4OOZA 1GONA 4NSBA 4EKJA 3CBWA 1VF8A 2G3IA 5D9MA 2DSVA 1PX8A 4D6CA 3N12A 1Y7VA 4UTFA 1QI0A 4RE3A 4M82A 1PBGA 1JL8A 3VIMA 2ZX7A 4D1JA 2WZEA 3BSGA 5E6YA 1R85A 3VVGA 2A3CA 5I78A 2DH3A 3QGVA 4GI6A 4UZSA 1PZ2A 2VMFA 4MJ4A 4HOZA 3GNOA 2DSUA 1JI2A 4PTVA 5HDRA 1GHRA 4MNJA 3BAXA 3AS2A 1HX0A 1XCWA 1CPUA 3W6MA 1AVAA 1CENA 4U5IA 3ARUA 2ZXQA 2EPLX 2G3NA 2DT2A 2E4TA 3FY1A 5ABEA 1QHPA 3BH4A 2EPNA 2XWDA 4P8XA 3OIHA 3WNOA 2VT0A 4W8AA 2VTFA 1ZBKA 1G01A 1S46A 2G3JA 3AIWA 4P7RA 4MNLA 1PX3A 2BS9A 4C7GA 2XGIA 1W3LA 4CN6A 4PMQA 1DP0A 3CO4A 5D4YA 4AD1A 2VRJA 3WEOA 4GINA 4JHOA 4AD0A 5CQ1A 5M17A 2ZUMA 2WVSA 5KEZA 4TVCA 4KMQA 1DHKA 2XJ7A 4H8HA 3WUEA 4BQ2A 2X0HA 1M53A 1ZS2A 2JIEA 4PTMA 1EO5A 1J18A 2IXVA 3MANA 2ZX6A 3VD3A 3OA5A 1VEOA 1H5VA 3WDHA 1TUXA 1WDSA 4BA0A 3IJ8A 1QHOA 5BRQA 2W66A 3QOMA 1I1XA 1JYWA 2ZUVA 3AMLA 3ZJ7A 2BY3A 3WQWA 3F4VA 4MAZA 5JBFA 1LG1A 4CN1A 1RPKA 4MJ2A 3EDEA 4HPGA 1BLIA 1HP5A 4Z2IA 4BQ4A 3CHFA 3PBGA 1H0GA 1L0PA 3EBVA 3WSUA 1HJUA 5A1AA 1OT1A 2XVGA 2Y24A 1XYFA 1W9VA 1BGGA 2O92A 2ZUTA 4PTXA 2CBUA 3W82A 4JFWA 1FHDA 5CLTA 2B31A 3NCOA 1CEOA 3IJ7A 3CHDA 2NT0A 4DM1A 4D6HA 5A6SA 4HTYA 3QHOA 5A6BA 2GVYA 4GO9A 4OOUA 1NOWA 1CXFA 5DF0A 3U7BA 1JGIA 1V6VA 2YLAA 2DT3A 3O9NA 2V3EA 1MW0A 1V6WA 2BHUA 2XYLA 4PMRA 1LG2A 4JKKA 5A3HA 2WC7A 2WSPA 4LPCA 3THDA 5ABGA 3WNLA 1E6NA 4JZ5A 3FXYA 3ZT7A 1UOKA 3VD4A 4CCCA 2W61A 3SCQA 1GNXA 3NSMA 2IXUA 3WEMA 2VC9A 4JFUA 2YL5A 1UQZA 2BV9A 2DPEA 4WJXA 3FHAA 3HN3A 3CZGA 3BAJA 3M46A 4OBSA 3CZJA 2WCSA 2EEXA 1OT2A 2QV4A 3WY1A 1UD5A 3BMVA 2CIPA 3VTRA 3AMCA 4HZ7A 1EH9A 1WAWA 4JCMA 1E73M 2IUZA 2VX5A 1NM9A 2F2HA 3A4XA 1CXHA 1WDQA 4NRRA 3RMEA 4OUEA 4HA3A 1CXIA 2E8ZA 3TTOA 6A3HA 4FMVA 2FHFA 1FP9A 4AY1A 2PBGA 1RD6A 2UY3A 1W9XA 1UR2A 1KGUA 4YHEA 5CSUA 4UOQA 3GH4A 2ZUNA 3MV11 3W38A 1V3KA 3F5LA 2D22A 3WUFA 4JIEA 2J47A 5M03A 3CUFA 1RP8A 1V0LA 1JZ4A 1HJWA 1N82A 4E2OA 1V6UA 1R86A 2OYKA 4NRSA 3W6LA 2E3ZA 1CECA 1C8XA 2BVDA 1DWJM 3KZSA 1J0JA 3BXWA 2J62A 1O6IA 3WIJA 4AC1X 4XZBA 1NOUA 3MKKA 3W25A 4GPNA 4ATLA 2E9MA 1KGXA 4ZEPA 1OD0A 1W9DM 2ZXBA 3MSDA 4GQQA 1PX4A 8A3HA 1JYVA 3K8LA 5IXEA 1FFQA 1SMAA 1BG9A 1UUQA 3ZSSA 5BYWA 1SR0A 2EQDA 3EDDA 1ISVA 1HJXA 1G5AA 4PMYA 1ZBVA 1BYCA 2F61A 3I3BA 4ML4A 2W67A 4HOXA 4TOQA 1US2A 2X8RA 4MPKA 5A6MA 4AIEA 4P7QA 3LPOA 2BVTA 1CGYA 1WDRA 1ODZA 1WP6A 1XYZA 3CMJA 2VX7A 2CHOA 1QVBA 1NWRA 2VRQA 2A3HA 3ZIZA 5EFDA 2ZUSA 3CGTA 4V28A 2BXYA 1W9PA 3OLGA 2J75A 3AZRA 3SCTA 4Z2GA 3GZAA 1HF6A 5A8PA 2J78A 3U5UA 3W28A 1ZBCA 1W1TA 2WM0A 1B1YA 9CGTA 1B90A 1B0IA 1K9FA 3J7HA 3EDJA 3IAQA 3CMGA 1VJSA 3ZSTA 3L4UA 5AYBA 1V0NA 5CXPA 2JF7A 3ZT6A 1H4PA 3N1AA 3WMSA 3T08A 3AICA 4Q7NA 1UG6A 4PMOA 2A3BA 3PZMA 2WB5A 1EHNA 1E1EA 2WWDA 3AXHA 3L2MA 2PF0A 1GJWA 1TMQA 1J10A 4PMVA 1V3MA 4CD7A 4AWEA 3WNPA 4HMDA 5LA2A 2VZTA 4AZ7A 4W7WA 1WPCA 1CGXA 3VGEA 4CVWA 4PMDA 5DT7A 1CZ1A 5JBDA 4ZXOA 4AISA 4F9JA 1H0IA 1W3JA 4MADA 1J0ZA 4EE9A 4KRTA 2CHNA 3OBAA 1MW3A 1VEPA 4PMXA 1JFHA 5GNZA 2WPGA 2WMIA 5E09A 2G4FA 4QP0A 4YHGA 3RDKA 3L4YA 3W24A 1E3ZA 2DDXA 5JBEA 3UG3A 1BVZA 1MW1A 4QLKA 3RJYA 2ESCA 4D72A 1JZ2A 3HJEA 5A8QA 2FGZA 4ATDA 5D8WA 5E6ZA 1W9UA 1R7OA 2WHMA 1UR4A 5C71A 2V5CA 3PZVA 2UY2A 4AIUA 3TA9A 4A4AA 2AMGA 4M8UA 4W87A 1H11A 1MQRA 1HJVA 3O6AA 5A6AA 2YBUA 4W8BA 2Y2WA 2OYMA 3VIGA 3RM4A 1ESWA 2YOCA 5LA0A 1UYQA 3SUSA 1CXKA 4X0NA 4U3AA 2PBOA 5CZKA 4K68A 4CKQA 5CPTA 1ISZA 5FOOA 5D9PA 1BF2A 3ZJKA 3EDFA 4U3CA 1M01A 1XV8A 4MB5A 4NZCA 2DSKA 4MDPA 1UWRA 1TR1A 3GXFA 4TX8A 5IDIA 4CD5A 2NSXA 1W1YA 3WH9A 1ZU8A 4J3VA 2C0HA 4M80A 3W29A 4S3KA 3WF1A 1UKPA 3VIPA 4S3JA 5BWFA 2WBGA 3VGDA 3WH8A 2E0PA 3UR7A 2EXOA 1JXKA 1EDQA 4AZCB 2XIBA 4QAWA 4PUDA 2CNCA 2DGAA 2GJXB 1VIWA 1J0YA 1JNEA 2QLYA 1HVXA 1V0MA 2BHYA 3TTYA 1MFUA 1GQIA 1NP2A 3GBEA 2Z1KA 4LGXA 1E1FA 3SCNA 3MO4A 1TA3B 3A6OA 1J11A 1CXLA 1VENA 3FW6A 4CD6A 3WD0A 4HU8A 4AZ6A 2MANA 3DHUA 2D1ZA 3PTKA 3VDCA 3CZEA 1JZ6A 1FA2A 1EOMA 1MQQA 4GI9A 3AROA 4R27A 1BFNA 2E9LA 1TZ7A 5CPQA 5HXMA 1KQYA 1QOXA 2CBVA 4FLRA 2V5DA 1FH7A 2CESA 1QNSA 1E5JA 3WQ8A 2DT1A 2C8NA 1M03A 1ISYA 3L4WA 2WXDM 4B16A 1HKIA 1KXTA 3K4AA 3A47A 4CVUA 5HOSA 5TD4A 4CUCA 5FD0A 1W2VA 2PWHA 3BAKA 3VILA 2EPKX 2ZUWA 3WL1A 2ZOXA 3CIVA 3KEHA 3U7VA 2J8GA 3CZLA 4PCTA 3W26A 2WW5A 3VNZA 4U5KA 3VM7A 2VVNA 1CNVA 4AMCA 2J77A 4UQBA 3KE0A 3MMDA 1XH1A 1W1PA 2JFEX 3SCWA 1OGSA 1F4AA 4D6FA 4GO8A 3ARQA 3W37A 5ABHA 3WF2A 1WKYA 2GJXA 3N9KA 4BQ5A 1VFOA 3NDYA 4DWSB 1E0XA 4PMUA 1J9YA 2PWDA 1UR1A 1JYNA 2Y8KA 2J7GA 1J12A 3RO8A 5CG0A 2PWEA 1V02E 2BY1A 3N17A 3B9AA 3GM8A 4IPLA 4ACZB 4EANA 3PZGA 3DECA 3GH7A 1E5NA 1QNRA 2E40A 4XZWA 5D9NA 2CERA 3OGVA 1FHLA 1XH2A 3IJ9A 1GOQA 1GVIA 5A2BA 3WEZA 2BXZA 1UR8A 3DYOA 1JZ8A 2VO5A 1JFXA 2XVKA 2D20A 3AMGA 1B2YA 4RL3A 4TUFA 4W86A 3ECQA 2Q8XA 4W5ZA 2W4XA 1HJSA 4FLSA 4AZ5A 1TG7A 1V6YA 3U57A 4IM4A 3PN8A 4UFMA 3UR8A 3TP4A 3ARZA 1GQLA 3GTNA 2XFRA 3WQ6A 4Y7EA 5C8BB 4P7NA 1WNOA 1CLXA 2J74A 2D0GA 3PZNA 2X2YA 4XB3A 3ZR6A 3AIVA 1V0KA 1MWOA 4LXFA 4MTVA 4CD4A 2VL4A 3LPGA 3AIBA 3VMOA 2NT1A 4UFJA 3T0BA 2FH6A 1AQ0A 3RCNA 2VUYA 1XD1A 2UWFA 3VMNA 3PZ9A 4GZIA 2PB1A 3WUGA 3AMDA 7TAAA 4J27A 4HA1A 4GI8A 4MAVA 3I3DA 1V03A 2WBKA 4W88A 1EDTA 1P6WA 5I79A 3WD3A 2WCAA 1CWYA 2WAGA 4KWUA 2WHJA 2XGBA 4KGLA 4MDOA 4LYRA 1GZJA 1E40A 2XSBA 2E8YA 3HMCA 2ZX8A 2D3LA 2DEPA 3RPMA 5KZ6A 4DUWA 4PYSA 2FHBA 2WLYA 2F8QA 5JUVA 1NH6A 3N13A 4WIWA 3VM5A 1H1NA 1U2YA 3E1F1 5A2CA 3PTMA 1US3A 4Z2LA 2DIEA 3CZKA 5D8ZA 1XCXA 2X0YA 3BSHA 4OZOA 4HPHA 3VOCA 4AYSA 2VJXA 2ZWZA 5BXSA 2J25A 3AYRA 5CPSA 3WH7A 5DFAA 4E8CA 5I77A 3WKZA 1E4NA 1JAKA 2V3FA 1UZ4A 1EDGA 4M81A 1QI3A 4N0RA 3PZOA 1WB0A 1GQKA 4OKDA 2WKLA 3T2QA 3APGA 1MYRA 4WKFA 3B8SA 4D6DA 5JIWA 1OIMA 3RJXA 1D7FA 1AQMA 4PCSA 2EJ1A 5A6JA 4UFKA 4ZE5A 4IUGA 4E8DA 3L4TA 2FGLA 4KH2A 1WO2A 1GHSA 3TTSA 1C7TA 5AY7A 1C92A 1DWHM 3MMUA 4LYQA 4AXNA 5M3WA 3PZUA 1IT0A 1DWGM 5DO8A 5GQBA 1E71M 2QF8A 4A3YA 1Q6FA 1VBUA 3B9EA 1NP0A 4ACZA 3ZT5A 1CYGA 3F5KA 2HISA 4CU7A 1E6ZA 3NSNA 5EMYA 6CGTA 1TVPA 1SMDA 4UOJA 2XTKA 3VGFA 1KR1A 4W85A 1PEZA 3GNPA 2CBJA 5LA1A 2WLZA 2WMKA 3L4VA 2GDUA 2GDVA 1E70M 3MV01 1C3FA 3RM8A 4PTWA 1UWQA 2DIJA 3THCA 1J01A 3AFBA 1E6RA 2WK2A 3K8KA 3VNYA 3FNDA 2HVMA 1JAEA 2ZXDA 3JUGA 1EHAA 1WZAA 4YN5A 2XVLA 3KWXA 5I23A 1GPFA 4MB1A 1E72M 3D5HA 2FDMA 5JIPA 4RE4A 1KGWA 1QNOA 1F4HA 2XVPA 2ZWYA 2CEQA 4UFHA 1MXGA 3PZIA 1DTUA 5HNNA 4H8VA 4OBRA 1H09A 3CUIA 4F8XA 5LYRA 1E15A 1X6NA 2OLHA 4PMNA 4DWSD 3VGBA 1OB0A 4UQDA 1PPIA 1OGBA 3A3HA 3WDIA 3WF0A 5AYIA 1UA3A 2YDSA 1GW1A 2YLLA 1OIFA 4U33A 4AEFA 5CGMA 1VBRA 3AS0A 3BCDA 3BLKA 3AI0A 1VAHA 5A6LA 4JFTA 2X09A 2JF6A 2J7HA 3WH5A 1KXHA 1BG4A 5FL0A 4URIA 3AISA 1M7XA 3S6TA 3N04A 2BVYA 2X05A 3UG5A 1HKJA 4J3UA 4W84A 2UY4A 3G6MA 1EA9C 1EQPA 3PTQA 2WKGA 1B3VA 4FF5A 2WC4A 3RIKA 4AIOA 1K6AA 2RGLA 1HNYA 2J4GA 3ZM8A 4B9ZA 1ISXA 3SCRA 1FP8A 1XD0A 2WNWA 4F79A 4JKLA 3MUIA 2WC3A 2WWCA 2VZOA 2VR4A 2WMGA 1FFRA 3CZ8A 3L4XA 5I3DA 3WNKA 2VZVA 3SCSA 1LL7A 2RGMA 4P7OA 2J7DA 4GIAA 4J3SA 1UD2A 3ZMRA 1E55A 1X1NA 4WKAA 2G41A 1OM0A 1GJUA 1EIBA 4QCFA 3VKKA 4P8UA 4RE2A 5I24A 2XWEA 3O2LA 2J8FA 2EPMX 4JL1A 2CKRA 1BYBA 3OLIA 1H3GA 2AAAA 2UY5A 4IPNB 4MNMA 4ATWA 3SCPA 2VURA 2VCAA 1ZJAA 4JAWA 4Z2HA 5IFPA 2WMHA 1B3ZA 2EO7A 1BYAA 3BGAA 3L2LA 5EFFA 3TOPA 1XGZA 4LYPA 3GXMA 3PZTA 1OSEA 3G6LA 3N15A 1OBAA 1B3YA 3CPUA 4EAMA 3N11A 1KFWA 1ZL1A 1UHVA 4LQ1A 1Q6CA 2XPKA 1UQYA 2Y5EA 2Z1SA 5I5RA 3WNNA 1W9BM 2ZICA 4M56A 4PSPA 2ZE0A 3WMBA 5A94A 5A6KA 3WN6A 3ZOAA 2VI0A 1SYTA 2FH8A 3K1DA 4F66A 3WQ5A 3GYCA 1UKOA 3OGRA 1C93A 1KBBA 3NIYA 2D24A 1BPLB 3VGGA 1C91A 3AYSA 1CGVA 3M07A 3MUY1 2BNJA 5DEZA 1OD8A 1C90A 3ALGA 4HMCA 4MNKA 3FAWA 4P8WA 3OLDA 1B3WA 2XFFA 1UKQA 3VIHA 4C7FA 1CGWA 4NF7A 3UEQA 1QNQA 1R7AA 3AIQA 3AHXA 1MFVA 1XSKA 3HU7A 1LQ0A 4OIFA 3MUZ1 4UFIA 4CD8A 5I2UA 5BXPA 1W3KA 3GXIA 3AQUA 4FLOA 4E4PA 3DC0A 3CUGA 5CJ5A 4HP5A 4PMZA 1E9LA 3OLEA 3WNMA 3SUUA 3NSXA 3DYMA 1V3HA 2CKSA 3NYDA 2XM2A 4H41A 1D3CA 3VX0A 3T2OA 1DEDA 1IZJA 3OB8A 3MS8A 1DWFM 2WMIB 1XSIA 1HVQA 2YA1A 1CBGA 4DWSC 1TFVA 3VIJA 3AHYA 2EPOA 2W91A 4D6GA 3MSGA 4BZYA 1OCQA 3VIKA 3I3EA 2XSAA 2WVUA 2VX6A 3VGHA 4U2ZA 4LX4A 1ODUA 2ZX5A 4M1RA 2CPUA 4TXEA 3UETA 3ARYA 4P8VA 2QMKA 1EOKA 1M04A 1C7SA 4X0VA 3W4RA 1RH9A 3CHCA 1W91A 2CETA 1W1VA 4J3TA 4UNIA 2PWGA 4M29A 1BVNP 1JXJA 3OZOA 4WSJA 2DT0A 2XM1A 3AXIA 3M6DA 1QW8A 2BY2A 3GH5A 3S2CA
chains in the Genus database with same CATH superfamily
4Q4OA 3EOSA 4PEEA 2NW0A 1A5KC 5K4XA 1E4LA 3VKCA 3M6YA 4FX6M 3POCA 4DF1A 4JX4A 3GIYA 3DI1A 3I6RA 3G1HA 3BC9A 1JCTA 3GVQA 3HG3A 4GC4A 4QSFA 5H6HA 5AYXA 4ZL1A 2YDQA 3OHMB 3A9IA 2QS8A 3EPMA 5IHSA 1GQJA 1RAKA 4IFRA 1XSJA 3E96A 1E56A 1V51A 1KCXA 3TQKA 1K1DA 1VB9A 3IK2A 2ALDA 4ML9A 4C7DA 3E5PA 2VCBA 4Q8VA 2WM1A 3D3AA 4GRSA 1E6PA 5TBOA 3HPAA 3RLVA 4FLQA 1EZ2A 3OZYA 4HOWA 4PSRA 1P0BA 4WXZA 4IIEA 1DWAM 2PEVA 1HT6A 4JEJA 3CAWA 1DWIM 4MB3A 1R8LA 2O4MA 4H4IA 2ONEA 2H8XA 4I9TA 5LXEA 1IGSA 3LU2A 3DFPA 2DV0A 1VRXA 2YCIX 1PDYA 2PDGA 3NM1A 3QR3A 3ARRA 3ARVA 4LH8A 5I3FA 2XUCA 2INEA 3RRXA 3L0NA 4D6EA 1P6BA 1VFUA 1LLOA 4FEZA 2VRKA 1GZGA 3APYA 5A8OA 4N9DA 4GI4A 5FACA 2JEQA 1UKTA 3IEBA 3WDJA 4WY0B 3QV6A 3I68A 1LWHA 2QHAA 1UIPA 4HKPA 3BLEA 1A5LC 1UWTA 1TE1A 1F8IA 2ZRUA 4KCWA 1NDYA 1NWSA 3SN4A 3UT0A 2XHYA 1TTQA 2P3EA 3WF4A 3ITCA 3KHDA 1RCXB 2OFJA 1LP6A 1ZJBA 3AC0A 1NQ6A 4QG8A 1WZKA 1UR3M 2I57A 2ZVRA 4EPBC 5A6BD 4K1GA 5A95A 2XISA 4GZEA 3W7GA 5EMLA 5CC7A 3T44A 1JNDA 1ITXA 1G1YA 2ZIDA 3NQ2A 3CEUA 1W2PA 2E7FA 4Q32A 5REQB 5D9OA 4H2CA 3BZJA 1H7RA 1PYMA 3CH9A 1WBJA 4HZ8A 3A4WA 3QOKA 1HGWA 1KO0A 3GUWA 4I8YA 3DYPA 2GK1B 4ZQRA 5HUOA 1FCUA 3QV7A 4MY8A 5J5RA 3TMQA 1QTWA 2VGGA 3MVTA 3BJFA 3KOZA 1MDRA 2WNZA 3N9RA 4DUVA 3UYCA 4ZE4A 2R82A 4RXFA 2BSLA 2OMAA 3IGSA 1XRSA 3VFLA 1QFEA 2PDFA 4UQAA 3OODA 2W6RA 2AOSA 3W76A 3WELA 4PN2A 2PDPA 4CN4A 3FYOA 4LY4A 2OT0A 1GOKA 1DPMA 3CWNA 4N9EA 1E1CB 2XZ9A 3A13A 1YNPA 4WSKA 2ZC1A 5J8LA 1JI1A 1DVJA 2OU4A 1V77A 2PZNA 1RK6A 1UD6A 4IMAA 5BOEA 4A2SA 1WDPA 2GGEA 2YA2A 2H3BA 4UUIA 3V7PA 1BVWA 3CU2A 1EL3A 4S39A 1E0VA 3MKCA 2J79A 1PB0A 5J04A 1AD1A 3K4DA 2OJPA 3FK4A 3OPSA 2V38A 3P2VA 1G4TA 1RJRA 2EHHA 6TIMA 3AJ7A 3AU6A 1NARA 2EKCA 1CIUA 2AKZA 3KBSA 1FDJA 1WZMA 4AZIA 3EMQA 2HQAA 2PI6A 1JEZA 2YBTA 4Q22A 1XFBA 4DBSA 5HQEA 1QI5A 2R1PA 2W5FA 2NSOA 3DGBA 3QF0A 3R0DA 1XH0A 2GFTA 5AC5A 1QNPA 1E4IA 3WFAA 2XH2A 2DH2A 4QM1A 3V36A 2OSYA 3RX4A 1QK0A 1RP9A 3POHA 5GPRA 1UWSA 3VINA 1KFJA 5DQPA 2OSWA 1SO4A 3WQGA 2H8ZA 5FKYA 2VVSA 1JCLA 4DO5A 4M24A 1Q2RA 1XBZA 1JZ3A 5GJMA 4IPPA 4GKLA 2OTDA 3KBMA 3EAUA 4WKHA 1X96A 1GUVA 3DERA 3MKVA 4AY7A 3TYCA 2FZNA 2VFDA 2YCLA 1JG9A 4DN1A 1I1WA 4FHAA 2H3DA 5CC5A 1FWWA 2E9BA 3GR7A 4PB4A 2GUYA 3NO1A 5BRBA 2PU0A 3AXXA 5LGXA 1Z32X 2GSJA 2HTMA 3ABSA 4R34A 3GG1A 4H9XA 3WDQA 1WZLA 4B2DA 5IOBA 5BNKA 1VFTA 1SFSA 5HBFA 4ZXLA 3AOFA 3O0KA 5BRPA 5FJOA 1RBLA 4WF7A 3N9SA 3N73A 4TVDA 4GIEA 4FXSA 3W81A 3FIGA 3T1GA 3KDOA 4CU6A 3LX9A 1CLVA 1GVYA 1UKSA 1ZBWA 4HSHA 4AZHA 2YZ5A 4MB4A 2VELA 3PHAA 1M1BA 3HG2A 3M43A 3UGRA 2J6XA 1WE5A 4Q8QA 2P53A 1VFFA 4YTTA 3BOLA 4QIUA 2VDGA 2FMNA 3W1RA 2ZZ4A 5HJYA 1E4MM 4C6NA 1UH3A 2QYGA 1LWIA 2Z29A 3NGJA 1N8IA 3QQ1A 1CXEA 3GC4A 4IUOA 1EC9A 3TR9A 1KXVA 5D04C 2Z2AA 5E5CA 1RLDA 2E5CA 5E0FA 2OG9A 4V1YA 2CZ5A 2YJQA 1FWRA 4AHPA 4IGNA 3DKJA 3QKEA 4H04A 4AD5A 3Q67A 3UWWA 1GOWA 4NAFB 5FL1A 4UBPC 3TROA 1DE5A 1XGEA 4XZ9A 1OCNA 1EZWA 1EEPA 1R6WA 3NTYA 1MEHA 1P0DA 1Z89A 3TN5A 1K9DA 2IQTA 4MWAC 4CLMA 2O9RA 2ZZ2A 4G7EB 5B7YA 1RUSA 2VDIA 4YYCA 1CLKA 2R9RA 3OG2A 3A24A 4F0SA 3D3FA 4XX6A 4J7RA 1PIGA 1PHWA 2CXGA 1QWKA 2G3MA 5FI8A 4A21A 1IEQA 1HKKA 2VC6A 4U4MA 3AYVA 4J3XA 3ALFA 1D7KA 1HIZA 4H7ZA 4RE0A 3CASA 1NWTA 1IEVA 3WDPP 4HN4A 3F4CA 1YQ2A 2Z24A 5C9RA 3LPPA 3O16A 5I02A 4DWSA 4LB3A 4JY8A 2W92A 1R38A 1SJAA 2VC7A 3WQPA 1NWUA 4LWWA 3SIMA 3EB2A 1OFPA 4H9MA 1UH4A 1ONRA 1FWHC 3H2MA 3WQ4A 1GOMA 3VD7A 1HUVA 3EOLA 4JTLA 1IIHA 4LANA 3ZO9A 3IAPA 4DY1A 4JQ3A 5CPLA 4EKJA 2HS8A 3CBWA 1VF8A 2G3IA 3LN3A 4D6CA 3CT2A 1XW8A 3WCZA 4KW2A 4L4LA 3VIMA 3QW4B 4QEEA 3VVGA 2QPXA 2OXNA 1EC7A 3VOIA 1JI2A 1MZRA 5D09A 5LIXX 2XSXA 4GNJA 2PUZA 4QDPA 3KP1A 2GGJA 4ERGA 4HYWA 3RYSA 4ZO8A 4HT3A 1JRBA 1TX2A 3W7CA 2ZXQA 1I2QA 1YNQA 3R12A 2UZ9A 2G3NA 2DT2A 4IIGA 2X40A 2X1UA 2VR2A 3FY1A 5ABEA 1QHPA 2XWDA 5FJUA 3DZ1A 4PUJA 1T6MA 4K39A 3KTCA 2VTFA 3U2ZA 1IR2A 5LNVA 3K2GA 1ZBKA 3M0YA 4ROPA 2G3JA 4MNLA 3L68A 3CO4A 1TPH1 2ABAA 4MLJA 3WEOA 4LVBA 4IPIA 1F76A 1J96A 4GBDA 1HKVA 2W9MA 2OQYA 2MNRA 3CQHA 1M53A 3NGFA 4PTMA 1EO5A 4GK8A 4X60A 2IXVA 1RCQA 3MBDA 2D2HA 3G1VA 2GGIA 4FPSA 1TIWA 1H5VA 4H19A 2XZ7A 1WDSA 4XAPA 2A4AA 3LRKA 1QHOA 5BRQA 3VYLA 2ZUVA 3ATZA 3HJZA 3ZJ7A 2BY3A 5JBFA 4IICA 4MJ2A 4LBUA 1UP2A 4IH3A 1BLIA 3EBVA 1OT1A 3R5EA 5IBXA 2VEIA 1W9VA 1MXSA 2ZRZA 3G22A 3UJ2A 2OEJA 4UTTA 3N19B 2ZUTA 4GE8A 2HNHA 3KVMA 4JFWA 1XS2A 2B31A 4RZ5A 2NT0A 4DM1A 3LRMA 3SZ8A 4B5XA 4EPDC 2Q02A 5DBTA 4GFSA 3FLUA 1V6VA 1DJHA 2V3EA 1SR9A 3GG7A 4JKKA 3KS6A 2WC7A 2WSPA 3O05A 4JZ5A 2IKHA 3LLXA 3W7EA 2EGZA 4QXIA 3VD4A 3NPWA 4MOZA 1M7PA 5D03A 3F4NA 3UWVA 4NX5A 1JUBA 1DOSA 3CZGA 5AHFA 4OBSA 4IFKA 2VWTA 4HGXA 1UD5A 4XTIA 3N4EA 2CIPA 3P60A 4HZ7A 1WAWA 3IVSA 2VX5A 3H8AA 3QXBA 4DIAA 4XKYB 1CXHA 4NILA 2BG5A 5HULA 4X22A 1NY1A 3UG8A 2PURA 3FDGA 3NL2A 3TXZA 3EKLA 4XBSA 1OC5A 1W9XA 1FUYA 3MJYA 3SAZA 1O1HA 4PL1A 4UOQA 4H9VA 3MV11 4BF5A 3W38A 4HQVA 2VEFA 3WUFA 2J47A 6XIMA 2CLFA 2BMBA 3ISIX 2ACSA 3IJ6A 5JH2A 3A23A 1ZUAX 3W6LA 2E3ZA 4LOCA 2INFA 4JTIA 1TV5A 4A8IA 1WKEA 3W71A 5DRIA 2ISFA 5EYWA 2CZFA 4Q4KA 3T4WA 3LHYA 4NX0A 4NQ1A 4ZEPA 1KGXA 1UW9A 3C2FA 4GQQA 1W9DM 2ZXBA 1ALDA 1PX4A 3MSYA 4MZYA 1J93A 1NFGA 1SR0A 2EQDA 1FWDC 4PMYA 3TWBA 3VI2A 4ML4A 1OG0A 2PCQA 1LOLA 2W67A 5E93A 2YR1A 2ASHA 1U1UA 2NV1A 3LPOA 1EIXA 1XYZA 3CMJA 3OP2A 2VX7A 5LKYA 3OEXA 2VRQA 5HINA 3W01A 3ZIZA 2ZZ5A 3L12A 2YCJA 1P6CA 1W9PA 1HFBA 3LI0A 3C0JA 4AHOA 3A3XA 3ES8A 1XKYA 3GZAA 4JTEA 4X2RA 2PDMA 3SCTA 1HF6A 4N2YA 4LCRA 2NLIA 2PDLA 3WLNA 2HPMA 3U5UA 2VEKA 5LIYX 4OV9A 1B1YA 1B0IA 4DYKA 3CMGA 1OJXA 1OY0A 4XWUA 1QXLA 2FJKA 1DJZA 3ZSTA 5CJMA 3R8HA 3QJAA 3V75A 1DL3A 1GKPA 3WMSA 3AXKA 4PMOA 4B5VA 4DBEA 1A5UA 3L2MA 4C65A 2OX1A 1J10A 1F6YA 1GWJA 3IVTA 4AXKA 3N14A 2VHLA 4AZ7A 3CAKA 1NFPA 4CVWA 5DT7A 1FWCC 1A5MC 1TWSA 1CZ1A 3S8HA 4ZXOA 4F9JA 1OC6A 3I7RA 3UXIA 1J0ZA 4EE9A 2CHNA 1MW3A 3CB8A 5FEWA 4MPQA 2WPGA 3TZNA 4XZLX 4RNIA 3N3TA 3W24A 1E3ZA 3GKAA 1EGMA 4QAIA 2V2HA 4PB3A 3DCPA 3BQ6A 3R6IA 3LDVA 3HJEA 1IWBA 3PBYA 5A8QA 4JR5A 1WQ5A 5F2GA 2D69A 1S3TC 5C71A 3L7RA 2H9AA 2UY2A 4A8RA 1GG1A 3PSVA 4E6MA 1BRLA 1H11A 4DJEA 3SADA 1XLAA 2E5DA 3V1HA 2Y2WA 1YPIA 3VIGA 3GE7A 2OLSA 2C13A 2PDXA 2C14A 4L65A 3LHVA 2QVHA 2X42A 3PS7A 1VCGA 4CKQA 5CPTA 1F3EA 2LLEA 5C0QA 4KKXA 1OVDA 2ZE3A 1Z9AA 1K4HA 4LV9A 4LNCA 1M01A 1Q7MA 3UZXA 2DSKA 4L6OA 1MEWA 1XLCA 3INPA 4KERA 4CD5A 1YDNA 4KETA 1W1YA 1ZU8A 2C0HA 3OBEA 2E1WA 3W29A 3WF1A 1OYCA 1WXYA 1YEYA 4O0QA 1UUOA 5BWFA 4XAYA 2E0PA 2VFEA 3A12A 3M0HA 3WK1A 4IQLA 1FXPA 2GJXB 1VIWA 1UMYA 3BK0A 3TTYA 1NP2A 3RR4A 3LV5A 2Q01A 3P0WA 3MO4A 1O5QA 3A6OA 3W2JA 1TZZA 1J11A 1TV2A 4I6VA 4O28A 2YXOA 4CD6A 5CGQA 3DHUA 1IYXA 1VPQA 2BASA 3CZEA 1JZ6A 2PDNA 4NZJA 2E9LA 5D32A 1IQ8A 4IL0A 1KQYA 2X1RA 4AH7A 2V5DA 1QNSA 3BG5A 3RNDA 4EX4A 2G95A 3WQ8A 5IM51 1V6TA 1SM9A 4C6FA 1FY6A 3G0UA 3BW3A 4F0MA 3A47A 2DZSA 4XZNX 5FD0A 3P0XA 2NQ5A 3BAKA 2I9EA 4AX6A 4HN8A 3KEHA 1SJCA 2PSNA 5T91A 3LBCA 1X39A 2WW5A 2VOMA 1P5BA 2Z1XA 3E74A 3KBWA 4AMCA 3FXGA 3NZQA 2J77A 2ACUA 3KE0A 1W1PA 2YFOA 1OGSA 1O5XA 3DDMA 3QC3A 1IEWA 3O7UA 3N9KA 4JIRA 3UCCA 5DCBA 4L64A 3O6CA 2PWDA 2QCNA 5DELA 2J7GA 4JGDA 4IFOA 4F2UA 5CG0A 2AAMA 1XICA 4NXSA 4H3DA 3WMLA 3WJSA 4IPLA 1XL9A 5H8UA 3NVTA 3ITTA 2E40A 2CERA 3M0JA 1FHLA 1XH2A 3MUCA 1GOQA 1GVIA 3ZLHA 5AYYA 3VNLA 2QR6A 2RKXA 4MVAA 3SGGA 4G2DA 1U5JA 2D20A 2NQHA 3AMGA 1S1PA 1UBSA 4RL3A 4TUFA 3ECQA 2VM8A 4MY1A 4V15A 1HJSA 4Q4SA 3BG9A 4XKYA 2QCCA 2P76A 3U57A 3TP4A 3C8FA 3DI0A 4Y7EA 3MI3A 3QFEA 5C8BB 2J74A 4JN6A 1AODA 3S2MA 3LD5A 2A6NA 4KPLA 3ZR6A 3ME3A 2VL4A 3AIBA 4O11A 4UFJA 3GQYA 3W7HA 1AQ0A 4WVXA 3RCNA 2UWFA 3PZ9A 2PB1A 1A5CA 3MCNA 1TV4A 2YYUA 1EP1A 1TV3A 1I2PA 4GI8A 2XGZA 3FS2A 2GQAA 3I3DA 1KLZA 1N8FA 3WD3A 4WZHA 2WCAA 1CWYA 4MYAA 2WHJA 2XGBA 1GZJA 1E40A 2E8YA 2XIQA 2D3LA 2R24A 2YCEA 3QQ0A 3S46A 4BHYA 5C2XA 4PYSA 3PNZA 3P3BA 2FHBA 2EG6A 3IARA 1NH6A 4K38A 5H8MA 3KWSA 2Z28A 3SJ3A 4HNTA 3URAA 5AVNA 3CWHA 4Z2LA 5G1TA 4R9XA 4E3TA 2F6XA 4OZOA 4Y6GA 4AAJA 4GCAA 4GIYA 2WZTA 5BXSA 4R3UA 2VGIA 3REQA 3V4BA 5DFAA 1PL9A 4E8CA 5I77A 1OADA 1E4NA 4QJ1A 5AZ0A 4N0RA 3T2QA 4B90A 3APGA 5FJIA 3V1PA 1MYRA 1LTDA 4XAZA 3W2LA 2W0UA 2EJ1A 2FFIA 5C54A 3K5XA 5KSWA 3BDKA 3N6QA 4ZE5A 3OIXA 4IUGA 2FGLA 2Q8ZA 3TTSA 1C92A 3DU0A 4AXNA 1DWGM 3FSTA 1W8SA 5DO8A 3A64A 3BICA 1NP0A 3GSMA 4Q7IA 3RU6A 2YCKX 3ZT5A 6PTDA 3TNBA 3PJTA 2B7QA 4CU7A 4G8TA 1Q3NA 1I6NA 3VGFA 3R58A 4FA3A 2F2KA 3UFYA 3K13A 5LA1A 4GJIA 4DBDA 2GDUA 3GDMA 3KCOA 3DFQA 1XUZA 5LNSA 4XZHA 2QCMA 2ADAA 5AHMA 3MV01 1C3FA 1KM4A 4UTLA 4HSNA 4PTWA 3VABA 2J9ZA 1L9WA 4AWTA 2DIJA 3U2CA 3TA6A 5BU6A 2Y7GA 3GAKA 2Z4GA 3K8KA 2EKGA 1XP3A 1EHAA 1F05A 4MSSA 1V8EA 3UNTA 2XVLA 1GPFA 4MB1A 1R3SA 3HOJA 2NVDA 5JIPA 4RE4A 1QNOA 2XVPA 1DJXA 2ZWYA 3M1ZA 2CEQA 4UFHA 4AF0B 4FX8A 1S1RA 3N34A 2YW4A 1H09A 3RG6A 5C7VA 4E2DA 1OX4A 1E15A 4DWSD 1PPIA 2V63A 5HANA 2NX3A 3SECA 1OIFA 2X1SA 3ZS4A 1V4YA 4FNPA 3ANUA 3KRSA 2GVLA 3VZZA 4GNVA 3RAOA 1UJPA 1W1ZA 1EJVC 5JU6A 3WH5A 4O18A 2WZMA 4L9ZA 5FL0A 1JUEA 1M7XA 4RW3A 1R9ZA 3SQMA 4V33A 4K37A 3G0SA 2X05A 4JQAA 2J66A 3UG5A 1HKJA 5KITA 4O16A 2UY4A 2CFFA 3G6MA 3GFYA 4HU4A 2WKGA 4EPKA 1W3TA 5D2XA 2RGLA 3V18A 4H6EA 3KRBA 4MKNA 3M0ZA 1YKWA 3MUIA 2VR4A 2OX4A 3QZEA 3L4XA 5I3DA 4JTSA 4D9PA 2VZVA 4IXHA 4D8AA 3IJDA 2ANUA 1IXPA 1AW5A 1E55A 1AJZA 1X1NA 1GJUA 3EA2A 6REQA 3HPSA 1XIIA 5D02A 1THFD 3DAQA 3MWCA 3NZRA 2PD9A 1TPWA 3SCPA 4C60A 1YADA 2QJNA 4JAWA 2E5BA 3G1DA 4HA0A 1W17A 4F0LA 1DJIA 1OK6A 1B3YA 4JTHA 4M6UA 4HJFA 4GY7A 3W7NA 1EP2A 1XISA 3P7YA 4GZ7A 4M51A 4TMCA 4MFEA 3HTWA 1W9BM 4PSPA 3S9IA 4DLFA 3ZOAA 4UMAA 3MA8A 1SZEA 3HG5A 2VI0A 1SYTA 3VNDA 3LGGA 2DP3A 1C93A 1BXCA 2GPTA 1KW1A 2D24A 1CGVA 5FAGA 1JCMP 1OD8A 1TJ0A 1DORA 4P8WA 5AHEA 1K8YA 1UKQA 3VIHA 2Q8LA 4C7FA 2OKOA 2IQDA 2O56A 4US5D 3UEQA 1QNQA 3E5BA 1ZP4A 1MFVA 2GVJA 1XSKA 2BVWA 1MUCA 4UFIA 1W3KA 1OFQA 3GXIA 4YVVA 4J3ZA 4U10A 3LG3A 4Q8OA 3GXNA 3S5ZA 1L6YA 4IHCA 3WNMA 2W27A 3H2AA 4FX7A 4CQBA 1V3HA 3G5EA 2B7NA 2V69A 1PHQA 3WLQA 1BSLA 1B3OA 1N7KA 3WLKX 2C0AA 1DWFM 1LT8A 2C91A 4D2JA 2XINA 1HVQA 2YA1A 1MNSA 1H51A 4YIWA 3VIJA 3GDTA 2B4GA 4AWUA 3QN3A 1EF2A 3M47A 3C52A 4NL1A 5HMSA 3WLSA 3UA3A 4KRZA 4M1RA 3W7LA 5C2GA 3ARYA 4P8VA 3NWRA 1PCWA 2A7PA 4LT9A 3FVDA 3ABZA 3EB4A 1KFBA 5HJLA 1W1VA 4J3TA 5CSRA 5G4HC 2CWNA 3SM0A 4M29A 2Y8UA 3LA4A 5AECA 4WSJA 3W3OA 3R2GA 1QW8A 1UJQA 2OZ0A 5TIMA 3MDWA 3EKGA 3GH5A 2CC0A 1KV5A 5C6MA 2IW0A 3HFTA 2HXUA 3BAYA 3RM9A 1QBAA 2C1GA 2E09A 1E6SM 2QT3A 7CGTA 5G1YA 3C61A 2FYMA 1X8CA 1JCYA 5EMMA 3UERA 1XQKA 2X1IA 1NU5A 4GACA 5BU9A 2ATMA 1MW2A 2CITA 1FKXA 4ZZ9A 4LVAA 1K7EA 3CLWA 1J5SA 1EJUC 3AALA 3WBAA 5FJPA 1JYXA 1CCWB 3FJ6A 2FGBA 4KFNA 1S39A 1UD4A 3AS3A 3UESA 4MJMA 4H1ZA 1ISWA 2PAJA 4C6LA 1JDDA 3NXLA 1S2TA 1QWGA 3T0AA 4H7VA 3VNKA 1H7OA 1UWIA 1S38A 3RLGA 3K46A 5IFTA 3TMLA 2Y63A 1LDCA 1LBFA 1TCMA 2QV5A 3PUGA 5K9XA 4HMNA 4BEQA 4AW7A 4M5PA 3CO8A 4N6EA 2V3DA 2WVVA 1JD7A 1EUNA 1BHGA 3HF3A 4HNUA 2XU2A 3EX1A 5ABFB 4AZGA 3PM6A 4LUYA 3VCCA 2ZXAA 7A3HA 1WAUA 1XG3A 1M7OA 4UFLA 3LI1A 1V93A 5FJTA 4XVDA 6ENLA 1J0HA 3UVAA 3HM7A 2P10A 1KRCC 3LNMA 4DWDA 2RAGA 4TR9A 2A7NA 4ICNA 3BE7A 1B3XA 3LMYA 1TA3A 1GORA 4TTGA 3DFYA 3AHZA 3SQSA 2YA0A 3G1XA 4NJJA 3O15A 2HPIA 1CGUA 2C7FA 3R79A 2EBNA 4YPJA 3U2EA 3WQVA 5A8MA 3WD1A 1GK8A 4HZ6A 1LWJA 5H8PA 3GIPA 5ABFA 2NZLA 1G7VA 1V08A 4RK8A 4HCDA 3RCMA 4CNOA 1W3IA 3DHPA 1E0WA 5F1VA 1F3WA 4WOZA 1H50A 1LL6A 4WQ6A 2VEGA 5CZSA 5CSYA 1Q8JA 4RPPA 1C8QA 1TB3A 3VMPA 1RBAA 3GU9A 2VFHA 3CV1A 1QI4A 2QUTA 1DJYA 4KRUA 3CQKA 2CBIA 4UCFA 4B3ZA 2Y85A 4W89A 5ABTA 2Y7EA 2HROA 4XSMA 4NKCA 2PWFA 4MYXA 2DSWA 4UZUA 3T0DA 3KL5A 2YCLB 2XIMA 1KWKA 3EDKA 3ZR5A 5CAHA 5BWAA 1G0CA 1R0MA 3L4ZA 4GJJA 2CLIA 4KGJA 3QMSA 1EGZA 2WMFA 3VZXA 1HW6A 3M16A 3ZJ8A 5C7HA 1E6XM 3GDBA 4WX2A 3LHUA 4OECA 4QNWA 3QYQA 3UBPC 4O8RA 1Q6OA 3LCGA 2J7CA 4IJRA 5I09A 4D71A 3GNRA 1QPKA 4A29A 4S3CA 1BTCA 4DXVA 2VZUA 4QCEA 1HXJA 5I6SA 2XG9A 5A2AA 4KWOA 4NZ5A 2A85A 3BLPX 1EXPA 5G5IA 4GUIA 3V0TA 3VX1A 1ML1A 4PCFA 1HL2A 3DFSA 4LUTB 9XIAA 2DSZA 2WNNA 1XIMA 4BR1A 3MY9A 2WMJA 5A69A 3SO7A 4I5RA 3GTXA 2QJHA 2Y1HA 4GMEA 4H8UA 4D6JA 1VEMA 5F4XA 1I8JA 3DH7A 1ZPTA 5KZEA 4O1AA 1H49A 1ONWA 3UWYA 1KXQA 4IGMA 4F2BA 1OX5A 4IL2A 4RDYA 3RILA 3W7JA 4UQEA 1OINA 1XRVA 3EMZA 4DVOA 4OJYA 1UWUA 1PJ9A 3WMCA 4R85A 2ZCGA 3MYOA 4FOJA 1TJ1A 1VJZA 1F7BA 2QEZA 3OVPA 2XVNA 1Q6DA 5KZDA 3GW0A 2D0FA 2PP1A 2WANA 2W63A 4G9PA 4QROA 1QO5A 4FAMA 4AZCA 2WZHA 2ISDA 1W3HA 4HMEA 3ARSA 4Z0SA 1P48A 3ABXA 2QGHA 1Q4WA 2BHZA 4J28A 3SCVA 1NOFA 4XO7A 1VLWA 4H83A 4IJBA 4FO4A 3WUBA 1QI2A 1L6WA 1TE6A 3B3DA 1KCZA 2YL6A 3A5VA 3LCWA 1TCDA 4H2HA 1IZKA 1KQZA 4DM2A 4GY0A 4GXPA 3P14A 2FZMA 3BTNA 3HGJA 1PIFA 1BKHA 3LTSA 2HWGA 1CGTA 4CEXC 2WCGA 4FZIA 4Z2KA 3EEGA 5C9ZA 4ACYA 3GR4A 4W7VA 2OWWA 2QUMA 5AB3A 4UB9A 2D3NA 1UA7A 4MM1A 3SFKA 3WJXA 4QR6A 1R87A 3W1XA 4BQ3A 4JX5A 4LCQA 4UOZA 5HMFA 2NLYA 4N42A 3MW7A 1YXCA 1X6LA 4GA8A 3LB0A 1XG4A 1EGVA 5C9XA 4ZA0A 3WJWA 3H55A 3SURA 3G1SA 1VQTA 4PCPA 5AVHA 3VD9A 2XIIA 1FCQA 1PKNA 4DF2A 1GEQA 2V30A 4DUXA 4P7LA 3HMJG 5ENLA 1FHUA 3TKFA 4D8ZA 3PF3A 4UQCA 3MU7A 1OGGA 3TWAA 1G67A 1EX1A 4L4OA 5M5DA 1ZTVA 3SCOA 1FVPA 2RH9A 5FEPA 3AWOA 4K8GA 4V27A 5C55A 3L67A 1Q6EA 3SN0A 3ARXA 4QG6A 4AVNA 2OOFA 4PRTA 4WOQA 4GVGA 2HJPA 2O9PA 4BWLA 4QSHA 3OQEA 3C6CA 3RU8X 1Y65A 1OZQA 4L5ZA 4LRTA 3E02A 1V3JA 3TSMA 1V02A 3VIOA 1AG1O 2ZZ3A 1RY0A 1T8QA 3QBUA 4UQ9A 3OO2A 1G7UA 4JCLA 5E70A 3W1AA 3EKZA 1JDEA 1PZ3A 1WUEA 4M1BA 3WENA 4C5YA 5A8NA 4XD4A 3BAWA 4HBKA 4PRRA 4NAEB 1XQLA 3DC8A 1DJWA 3LPFA 2RDTA 2ZUUA 4L4PA 1B4EA 3AS1A 4JIIX 3GXDA 3MMWA 4C6MA 4GVIA 1EQCA 1IE7C 3S6DA 1C8YA 2J7EA 4UTIA 2PTWA 4LEQA 2A2IA 2GWNA 1TJPA 4ORIA 1QHZA 1AA1B 5L6UA 1TSIA 1ZAHA 3UPBA 4BI5A 4B91A 1OG6A 4ZSTA 2QPUA 1K6WA 1FWTA 1V7AA 3ITYA 1H2JA 3W0KA 2V8ZA 4ZBCA 3C0QA 3ORWA 2WSQA 1VIZA 1JZ5A 2G96A 3W7PA 3TYEA 4W93A 4MMWA 3QV9A 1KWGA 2VNCA 2HK0A 3ELFA 2V9DA 2V3GA 3O0FA 1GPWA 3CV7A 1XRTA 3LGDA 3V0SA 4H00A 3LHWA 3AIEA 2V68A 4UIOA 4AEEA 3S0CA 4OOZA 1RCOB 3CB3A 5FSEC 1PX8A 4FXFA 4UTFA 4RE3A 4AFYA 4FIRA 3BUVA 1Y5VA 4KFPA 1K4GA 2ZX7A 4A8NA 3BSGA 5E6YA 1R85A 3SQLA 1QCWA 3CC1A 3UXAA 2WJZA 1QK2A 4GI6A 2VMFA 2QCFA 4EF9A 4TO8A 3QEZA 2VKZG 3S5NA 5HMEA 4MNJA 4GD0A 3AS2A 3NFUA 1P7TA 2PDUA 3F2BA 1HX0A 1XCWA 1DHPA 3PFMA 3N2OA 1CPUA 2G0WA 3W83A 2GVGA 3W6MA 1LOQA 3FYPA 5LSMA 2EPLX 3PC0A 1J8VA 2E4TA 3BH4A 3N2XA 5F2MA 3BZGA 4XVEA 2NV2A 4P8XA 3HV9A 3OIHA 3WNOA 2PDBA 1FQ0A 2JK2A 1C9WA 4Y96A 4MWAD 3JVAA 3UPMA 1H61A 4P7RA 1RSCA 2BS9A 2QCGA 4MKVA 1TREA 2A79A 4PMQA 5D4YA 4ASTA 4UTWC 2VRJA 4JHOA 1UPPA 2V5KA 3CM4A 2G97A 5M17A 4PGLA 3FDKA 4IOTA 5KEZA 2YYTA 3IPWA 3UR5A 3UF9A 3MCOA 1PCKA 4I5UA 3RPDA 2FZBA 2JIEA 1N55A 3UCDA 4LCSA 3GB6A 3WDHA 4ADUA 1TUXA 4BA0A 1KKRA 1Y5XA 3QYSA 4J35A 1AJ0A 4ZTXA 3TLLA 3HV8A 1I1XA 3AU2A 1JYWA 3B9NA 4MAZA 4KEMA 4CN1A 1RPKA 2GSHA 4O13A 5KETA 2X16A 3EDEA 4BQ4A 3RN6A 1OC7A 2PODA 4FP1A 4M7TA 3S2JA 3NAVA 2OB3A 2XVGA 4P61A 2Y24A 1XYFA 3B0UX 5EY5A 1BGGA 4CQ8A 3LM3A 3B8DA 2CBUA 3P67A 3RLHA 1LQ2A 1VBGA 3ITVA 3MVIA 3NVDA 3QVQA 3XIMA 3T81A 3NCOA 3CMFA 3S42A 3E3HA 2OODA 5G2HA 4NZ4A 4ORMA 4AMAA 4D6HA 3VC5A 5A6SA 3MHUA 3QHOA 2DY3A 4OOUA 4XISA 3KVLA 2R1KA 1CXFA 1JGIA 1W5OA 4O19A 3NQMA 2QJMA 2DT3A 3IIVA 3O9NA 2OT1A 1TPEA 1QAPA 4ZOEA 1WXZA 2NVAA 4PMRA 1V7YA 5A3HA 3THDA 4FB7A 1E6NA 1MUWA 2GQ8A 3B0XA 5FF4A 5DXXA 2CZVA 1J6OA 2W61A 1AFSA 3NPUA 4O15A 1GNXA 4UCGA 4DQWA 4FF7A 3K30A 4C91A 4YTQA 2YL5A 4S3EA 2BV9A 3H2FA 2DPEA 4RX0A 4WJXA 4OHQA 2EG8A 1WOAA 3HN3A 3CZJA 2EEXA 1YDYA 1Z3NA 3T9PA 4C6EA 2F38A 3BMVA 4PFHA 3MMTA 2OZ3A 3VTRA 4DJEC 2QCHA 1EH9A 3OU8A 1E73M 4JCMA 3ZLFA 3L5AA 1XLJA 4NRRA 1LM1A 3M0IA 1QT1A 1XINA 2DU2A 3GYEA 2FHFA 2PBGA 3P8IA 5LIUX 3L0KA 2GDQA 4Q8UA 1MO0A 4Y9NA 5M1TA 2HBVA 3BANA 3DHDA 1K7XA 3KTXA 2PTDA 4LBRA 4JYEA 4XIAA 4I8DA 1G4PA 1QU4A 1V3KA 3SRDA 4DAIA 4CQCA 3F5LA 2PDCA 2R1NA 3TQPA 1LCOA 2I17A 2BB0A 3JZUA 3CIWA 1RP8A 3AYTA 3W22A 1JZ4A 1HJWA 4E2OA 3E0LA 1V6UA 3GR8A 1XBYA 1FKWA 4EIVA 3KZSA 3KAOA 1A0DA 4GOAA 3WIJA 4XZBA 1IGWA 5EA9A 2B81A 3W72A 3QTGA 5AHNA 5MKGB 3PNUA 2E9MA 2DZXA 4Q8NA 3MP3A 1OD0A 1H7NA 4IMFA 1W3NA 3NOYA 5JXQA 3ZSSA 2CLHA 5BYWA 1ADDA 3EDDA 4G7FA 3STEA 1AH3A 2PLMA 4ERIA 3G3DA 4HOXA 4IT1A 2FZ8A 2X8RA 2GJNA 1G4EA 2BVTA 3UD6A 4JOMA 1QW7A 1WP6A 1QRQA 3LY0A 3THAA 2BGSA 3G8RA 3RK8A 5B7ZA 3OLGA 2J75A 3AZRA 1F3XA 3HZ3A 3G1AA 2J78A 4Z1CA 4DBWA 3S1GA 4GFIA 4QE4A 1W1TA 3YPIA 2V5BA 3XINA 5HWNA 1MZHA 3EDJA 3IAQA 1RHCA 1JUKA 5DY2A 1XX1A 4NYUA 2IPJA 3UWEA 1XUUA 1J2BA 3C8NA 5AYBA 1K8XA 1KKOA 1H4PA 2UBPC 3AICA 1DQXA 1FX6A 3T40A 3PZMA 2WB5A 2WWDA 4C6BA 4S3FA 5AC7A 4AWEA 1PIIA 4HMDA 2VZTA 1DQUA 1R30A 1UC5A 4PMDA 4KEUA 1TIMA 3F4DA 4AISA 3EXTA 1H0IA 5TQLA 1W3JA 4JTKA 3W7MA 2PWUA 4KRTA 1Q7QA 5CKSA 2AGTA 5HQLA 3NDOA 2G4FA 1LROA 3RDKA 1JRCA 1Q8AA 3L4YA 3T07A 1MW1A 4QLKA 3FKRA 3RJYA 1EJSC 3NURA 3NZPA 1JZ2A 1TQJA 2PDIA 2FGZA 1W9UA 3TNOA 1NELA 2WHMA 3DESA 3HGOA 1PZ1A 1KTNA 3T78A 4M8UA 2WJEA 4OGZA 4ZOCA 4DJFD 3O6AA 5FEZA 4J40A 4JTTA 2YBUA 1GEHA 3RM4A 2PDJA 1ESWA 2YOCA 1UYQA 3SUSA 4AVFA 1BTMA 1GGOA 3F2CA 1ITQA 1R9XA 2FZDA 1ISZA 3TIMA 5D9PA 1F73A 4U28A 2ZRXA 5LIWX 4MDPA 4S2BA 3TJXA 4TX8A 5IDIA 2QUNA 3KS5A 3K4WA 4J3VA 3BLFA 1CB7B 5FF0A 4W9TA 1A50A 3IWPA 3VIPA 4S3JA 2WBGA 4H8NA 2DVUA 1S5TA 4PTDA 3UR7A 2NXHA 1EDQA 1R3QA 5DANA 4ILSA 1QOQA 1R3WA 2CNCA 1J0YA 4L6HA 4MKSA 2QLYA 1A5OC 4PE8A 4RZ6A 3HPXA 3N4AA 1C29A 1UPMB 2G4JA 4LGXA 5LNWA 3KM8A 3SCNA 2CHRA 2YBVA 1PTDA 3EX3A 4KCVA 3REQB 4WRHA 2FKPA 3EB3A 4LTSA 1FXQA 2MANA 4Y9OA 2D1ZA 2WJFA 2EPHA 3I7SA 4RV3A 1EOMA 1MQQA 4GI9A 1GTHA 4JTGA 4R27A 5MHBA 2CBVA 1FH7A 4NASA 1JQXA 1E5JA 1FWNA 2ODOA 3T55A 1ISYA 4FSAA 1WOBA 3GIQA 3VKJA 5TD4A 4CUCA 1W2VA 3LBOA 2EPKX 2ZUWA 5JQ9A 3S9ZA 3CIVA 2J8GA 4XQ6A 3USBA 2GOUA 4N6FA 4U5KA 4WDUA 3VFCA 1RA0A 3B04A 4H6RA 4M6QA 4GGHA 3W02A 4ZO7A 4XBKA 3OJGA 4WGXA 3W7RA 3BOFA 1Z44A 3W37A 5ABHA 3WF2A 1WKYA 3BL3A 1VBHA 3NDYA 4NY2A 4DWSB 1YRRA 2IMRA 1X97A 4PMUA 4JNMA 1GG0A 3GZ3A 3HGSA 4DNMA 3P80A 2Y8KA 4DAFA 1KFCA 3TJ4A 1J12A 3RO8A 3LXAA 1DIDA 4DPQA 1FWSA 3HQ1A 1V02E 2BY1A 3B9AA 4YL2A 3GM8A 1XIJA 4ACZB 4GY1A 5DMNA 4EANA 3DECA 3GH7A 1E5NA 1QNRA 5D9NA 5T9CE 3CL7A 5J5DA 3OGVA 4IF2A 1DV7A 1AZ1A 3IJ9A 4WR3A 4A3UA 4IMGA 5A2BA 3WEZA 1SSDA 3LM7A 4NUWA 3DYOA 2VO5A 4OBTA 4FOKA 1KM0A 4M0XA 1RD5A 4NNBA 3NM3A 4W5ZA 2PS2A 1O12A 4AZ5A 2ZFAA 4UFMA 1GQLA 1IEIA 3EXSA 1SJDA 5D37A 3T8LA 2D0GA 3S4TA 3PZNA 4XB3A 1V0KA 1T40A 3Q37A 3M44A 4LXFA 4MTVA 4CD4A 2RJGA 3LPGA 4RCXA 4WY0F 4ADTA 1W37A 1GT8A 3XISA 2XFWA 2Y61A 4GZIA 5TAOA 7TAAA 2IPGA 7PTDA 4J27A 3UQNA 4C6DA 3CV6A 4BEUA 4KEZA 2WBKA 4GQ0A 4W88A 3MQTA 1P6WA 2ZDRA 1IXNA 2WAGA 4KWUA 4RNJA 2DUXA 3B0YA 5IBXC 4KGLA 4L1XA 4LYRA 5I7GA 3HMCA 2ZX8A 3CL8A 3DG3A 4GYFA 1VH7A 2BX7A 4QNEA 3EWBX 3W9ZA 2DQWA 1XYMA 3EPNA 2F8QA 2I9UA 3VM5A 5T9BG 2X7WA 3G18A 3E1F1 1I60A 3WK0A 4GVHA 3CZKA 5D8ZA 3PR2A 3SIZA 3E49A 1WDDA 3BSHA 3G0XA 4HPHA 3LTPA 1XXXA 2Z0IA 2VJXA 2XH4A 1K77A 3MB9A 7ODCA 1X98A 2FVKA 5EL1A 2A5HA 3PUOA 5EBUA 3VAVA 1W5NA 3KLLA 4M81A 1QI3A 1KD0A 3RGTA 1WB0A 3KCLA 4OKDA 2ZTJA 2J6VA 1MRAA 4WKFA 3B8SA 3FKKA 1OIMA 3RJXA 1D7FA 3PJWA 4HB7A 2E68A 4PCSA 3IRDA 5C9UA 9RUBA 3LV6A 3U3HA 1AUSL 2WO5A 4QHRA 5AY7A 1YBQA 5G2WA 3NQEA 4QTGA 1UOZA 1P7TB 3IVUA 3FA5A 4A3YA 1X7FA 4Y8EA 2DVTA 2Y6ZA 3EWYA 3B9EA 4LF2A 3ZVHB 1IT8A 4TQTA 3KXQA 3RFAA 1CYGA 4MLRA 1E6ZA 6CGTA 4RDWA 3LCHA 5EMKA 4UOJA 2E25A 3GLCA 3H2OA 2QDDA 4US5A 4OE7A 1UZHA 3B4YA 2C6QA 3F03K 4EXQA 2ZZ6A 4W85A 5CZ0A 1CI1A 2FB3A 1DIEA 4IIDA 1LLZA 3OZMA 1UWQA 3TFCA 3F4WA 1X8FA 4GIRA 3JUGA 2H6RA 3PWAA 5FAJA 2V5JA 4DX3A 3LOTA 5I23A 3W1LA 3QW3A 4GX8A 3WLHA 1R2SA 4XZMX 2E6FA 1KGWA 2A0NA 1AL7A 4DRSA 3V5FA 3WLLA 3P5ZA 5HNNA 4H8VA 1EPVA 2PDYA 3UA4A 1UP3A 4D8LA 3LCFA 5LYRA 1X6NA 2OLHA 4PMNA 1OB0A 3SY1A 3WDIA 4KIEA 1UA3A 2YDSA 4INFA 3IV3A 3WQEA 1WV2A 4AEFA 3RR1A 3AS0A 3BCDA 4XSLA 1LRNA 3AI0A 5H2ZA 1TRDA 5A5WA 1VAHA 1OYAA 1JQVA 2X09A 2FVMA 1H7PA 3E12A 2BBFA 1KXHA 1FTXA 4JYDA 3A21A 2CLLA 3H7RA 3MO7A 3N04A 4EPEC 4MWAE 3QFWA 2RJHA 3ATYA 5D2WA 1RR2A 1I9CB 5AC8A 2PRMA 1ELSA 4AIOA 3NQ8A 1EJ7L 1Q6QA 1HNYA 2J4GA 3SW6A 5G4EA 1S2WA 3HIJA 5AFDA 3GHSA 1FP8A 1XD0A 4F79A 4JKLA 1X1ZA 3S5SA 1YYAA 3CZ8A 4DBUA 4IFKB 3W85A 3SCSA 1AJ2A 2NWRA 2J7DA 1HKWA 4HK6A 4J3SA 4Z1YA 4JD4A 3NQDA 4WKAA 1OM0A 3TEVA 4P8UA 4MIMA 5I24A 1W1IE 3O2LA 2J8FA 3OVQA 2X41A 4OU1A 5T26A 3R13A 1BWKA 2AAAA 3BW4A 1RQHA 1YDVA 4IPNB 4L7ZA 4ATWA 3UPWA 2DJXA 2VCAA 9XIMA 1E9IA 4R33A 3P8JA 1B3ZA 2EO7A 1R5YA 3KTSA 3BGAA 4L9YA 4IQEA 3I7QA 1XGZA 3OYXA 4LYPA 4MJZA 4C5ZA 3G6LA 3QV8A 2NQ9A 2F9RA 2OZTA 1UHVA 2XPKA 3UR2A 3GVGA 1IT7A 4NZFA 4A35A 2R14A 4A22A 1YPFA 1TPFA 4FALA 5D33A 3UVIA 4LAKA 3U6WA 4Q4PA 2NXIA 2POTA 1LLWA 5HUPA 4O1BA 1N8WA 3U0HA 5C5YA 3I6TA 1VHCA 3GU1A 3VGGA 1C91A 3AYSA 5DMMA 3URQA 4Y9AA 2BNJA 4MNKA 1A5AA 4ERAA 3OLDA 1KRAC 1SW3A 4HNLA 3KZPA 4JQ2A 3AIQA 2X30A 1KNWA 1DIKA 1LQ0A 1TR9A 2GZXA 4F4RA 1PKMA 4PEKA 3QQWA 3CNYA 3ZWSA 4FLOA 1TYGA 3B8IA 3N29A 3DC0A 1ONEA 3U8GA 3I65A 3TN4A 5CJ5A 3M41A 4HP5A 2WQDA 4PMZA 3M0VA 1E9LA 3NSXA 3DYMA 3GDLA 5BZAA 3AWNA 3VKDA 4H41A 4E2VA 3VX0A 1DEDA 1IZJA 2ACRA 3IGUA 3BG3A 2G50A 3MS8A 2G37A 4GX9A 3GDKA 1SUXA 4ZODA 3TZFA 4IIHA 4JDBA 3FX4A 3R4IA 1JVNA 2VENA 2W91A 1OCQA 1OK4A 2VX6A 1HO1A 3GHUA 3QTPA 2RDUA 4YNGA 2ATSA 1YNYA 1M04A 3GW3A 1BXNA 1BEUA 3GXTA 4TX9A 3KW3A 1S5NA 1RH9A 1V5XA 3WBYA 3CIXA 1T96A 2PWGA 1U22A 1IXQA 2GL5A 3M6DA 2J8TA 2BY2A 1AD4A 1EBHA 1IXOA 1PWMA 4H9TA 3S2CA 3MYPA 4L1WA 1X1OA 3GUGA 4PBFA 2BY0A 1P0KA 3E9AA 4H01A 1FH9A 4DB7A 2BDQA 2WSKA 3AHVA 3DX5A 4O0ZA 4JN7A 4HA4A 2YB1A 2OOGA 3ZVIA 4ICMA 3T09A 1WA3A 1R3RA 3PG8A 2JBMA 1SZNA 4ZO6A 5AC6A 4HU0A 2I7GA 3W86A 1DBTA 1VBJA 3B9OA 4FR1A 2IPFA 4GQRA 3PANA 4QLLA 3BLDA 3ZR4A 4REQA 3IUHA 3RMJA 3M0KA 2PP3A 1S5VA 3VC6A 2VQUA 1YTEA 3LCIA 3SCUA 1R2RA 3KLKA 3T8QA 4JTQA 1F6KA 3DEQA 3CV2A 2OPJA 2V81A 2R1MA 3IIZA 1PV8A 2GGHA 5KZMA 4QQUA 2WJDA 4GZJA 3CS2A 2QCDB 1BSIA 2P88A 3MHGA 4MUPA 4O10A 2QZRA 3N6JA 1K70A 5I03A 3N2MA 3TONA 4TMBA 1VZWA 3GBDA 5JMUA 1B5TA 2XDFA 4HPNA 1V3IA 4A3QA 1UD8A 5BXTA 3NQBA 4ZENA 1WYIA 1D3GA 3B9DA 4ZGYA 4W4QA 2V2DA 1W32A 4NI3A 2IQ0A 1A80A 3O07A 1P43A 4EAYA 4QLJA 1VR6A 4GUHA 2TRSA 4JNZA 1XIHA 3MWAA 4Y9PA 3CYJA 3VIIA 3TCSA 2D0HA 4KIRA 4POCA 1XBVA 4EK7A 3QGAC 3AXMA 3FAXA 1E43A 5FA5A 3VK5A 3WF3A 4LYKA 1I75A 4BF7A 3VNJA 1ZHAA 1XGDA 1EPXA 1UZ1A 1LL4A 2QJGA 3AZSA 2Q3OA 3H4GA 3QSRA 4G1NA 1EF3A 5EB8A 4JDYA 2JIWA 1PE1A 4NU7A 3BPWA 2HCVA 1V6XA 3NXFA 3EPOA 1K9EA 3BCFA 2FZ9A 1BD0A 2FMOA 4E8GA 1GVOA 1IV8A 4K2SA 3JS3A 4C1NA 4EXAA 1LUCB 2J27A 1Q4NX 5FEXA 4LC6A 1PAMA 1LRQA 5H91A 4RZBA 4QDMA 4ES4A 1GKQA 1UR9A 3CTTA 4HVXA 1XDMA 1J4EA 1MXDA 3II1A 4O1DA 3R0UA 1TVNA 1DTNA 3T42A 1VYPX 4PRWA 4GYPC 5FESA 1OQFA 1XC6A 2QF7A 4XO6A 1R3YA 4MGGA 3WDRA 3UXKA 4AD4A 2OWCA 3SEPA 4AZBA 3BMWA 4KWWA 5PTDA 1BRLB 1G94A 4G6CA 3VE7A 4ZQPA 1EWDA 2FHCA 1NF0A 3NR0A 4NNAA 4Y90A 1KR0A 3WFZA 5E0CA 1KBIA 1GVFA 4U31A 4X9YA 4K7YA 2O9TA 2ZKMX 4NVTA 4A8LA 3QLLA 5EKYA 1EUAA 4JNYA 1C9DA 3C2EA 2IKJA 4I9MA 2WZIA 4LALA 1TJRA 2ZADA 2PDHA 1PSCA 1HJQA 3M4HA 1PS9A 1Q6GA 1SZRA 2I5GA 4MZ8A 1IWPA 2VQTA 2YXGA 1QDSA 2Z1VA 1JGMA 3EXRA 1EJTC 3QPEA 4EWJA 3ARTA 3C0LA 1MVYA 4BWLC 1SFJA 5HQMA 2ZC8A 5EBAA 5SWUA 2QPSA 2TAAA 3D47A 1R47A 1AMKA 4TIMA 4CCEA 2CLMA 4F3HA 5DMYA 3ARPA 3DBNA 4WCJA 1GOOA 1H41A 2ZQ0A 5F7UA 5CZTA 1Q85A 5CSSA 4MZ1A 1KCLA 1U33A 1B9ZA 2R6OA 3W6YA 1ZSXA 1U83A 2WHKA 3W53A 2CLEA 1O5RA 2PRHA 4JKMA 1KTCA 3WJYA 2GJPA 1L6SA 1OFBA 3DFNA 2A6LA 5HA7A 4JTUA 3NUKA 4JFSA 1OEPA 3R0KA 1XRFA 3TYZA 1XYCA 3DFTA 5FJJA 4MWAA 2O4QA 5BMWA 1A0CA 6TAAA 3VPLA 2OGJA 4R5EA 1ZB5A 2C18A 2XH7A 3H7VA 1T5AA 5ECVA 3VD5A 4RXGA 4PC8A 4LB4A 3SUWA 1VFMA 1UH2A 2YPIA 3URNA 2VR5A 3OGSA 3SR7A 1XFCA 1TQXA 2CZDA 2VX4A 4I90A 4WHBA 4AD3A 3B8VA 4JTCA 4QS5A 5D2YA 3RUBL 2ACQA 4MUZA 4ZFMA 4C6OA 3M64A 1QR7A 4UR9A 4XKMA 2Z2BA 4RDVA 4W8LA 3KBVA 1HQTA 4KBXA 1A0EA 1UB3A 4FXJA 4TVUA 1O7AA 5HPCA 3FHQA 4Z2JA 3L9CA 2NX1A 1A3HA 3LLFA 4PL2A 3GHTA 4K1WA 4CNSA 1B30A 3HBLA 4RNHA 2DQXA 2V6AA 4J3WA 4US6A 4I3GA 3BV7A 3CUXA 4LEFA 1AL8A 1XIGA 2CCRA 5AN7A 4QFUA 3SUVA 3W7QA 1G6CA 1M7JA 4LSBA 3E2RA 1J0KA 2Z6IA 2J7FA 4KCTA 3OBKA 4O53A 4GWEA 1HO4A 3GO2A 1OHLA 1JIBA 3VDBA 3BO9A 1T99A 3FN9A 5HATA 4JTJA 4PUNA 2VUNA 4DI9A 1LF1A 4W7UA 2I16A 3TV8A 1I2OA 2HVOA 3KL3A 2VOTA 3W2KA 3W1PA 2YDRA 4RV8A 3WBEA 3CUHA 4M7SA 4DNHA 4L6DA 2KAUC 3EWUA 1D9EA 1UR0A 2O0TA 4AF0A 1C8VA 2TYSA 5EMUA 1ADOA 3LEPA 3S1VA 1RA5A 4ZMGA 2YL8A 1UC4A 1A47A 2QDEA 4AY8A 2BP1A 3T4CA 4JTFA 3GS6A 1JF6A 1BXBA 4WDTA 4GNKB 5AZ1A 4GUGA 2F7FA 2PGWA 3V0UA 4S23A 2ZTKA 4JIPA 5HR6A 1AQHA 3T0TA 4S3AA 1CDGA 3TTEA 1BQCA 1E9ZB 3OVGA 3HA1A 1E3XA 2DZVA 2YIHA 2J7BA 2NQJA 3VE9A 2QMJA 1RPXA 4KWSA 1JZ7A 3ZJ6A 1XKJA 2C16A 4WUIA 2W62A 1F61A 4PULA 4I5XA 1E6QM 2DZBA 1ZRQA 2XN0A 1JDCA 1UMLA 2G8ZA 3WJZA 4WXYA 5C70A 3WK2A 1GYLA 1YHTA 5DRCA 2D73A 5FIPA 4O0KA 1HKMA 5AC4A 4UMBA 3KDNA 4PTNA 3EYPA 3GVWA 3QHNA 5DT5A 2E1DA 1U30A 5D05A 4JL2A 1KC7A 5CGTA 1FCVA 4AX7A 1SZFA 3VO0A 2DIKA 4UTTC 4A3HA 3WD4A 3IANA 4B15A 1EB3A 3W2MA 5GVJA 3ID7A 3RPTA 2DSVA 3SGZA 5LNUA 1AZ2A 3IJIA 1M6JA 1Q2SA 3M9YA 1PBGA 3CQJA 3HQNA 4D1JA 1ICPA 2AKMA 2OELA 2BTMA 2DH3A 3JRKA 4PTVA 5HNTA 4WY0A 1GHRA 2PTYA 3C3UA 4MFDA 3NO3A 4XAGA 3QY7A 4HPXA 1JPDX 4WJEA 1U1JA 2R1LA 1AVAA 4U5IA 3ARUA 1JPHA 1A49A 4XK2A 1G4SA 2QVNA 2EPNA 2F84A 3LHZA 3PAOA 4IP5A 4JY9A 2VT0A 4B5SA 2JKAA 1DJNA 4W8AA 1PTGA 3S47A 2GVEA 1G01A 1JR1A 3RCYA 1PX3A 1DP0A 1MMFA 4AD1A 3D0CA 1TV7A 3LYEA 3L5MA 4GINA 4RLIA 1S2UA 2ON3A 1DYSA 4L9XA 2PZ0A 1VFSA 2VC5A 4TVCA 4GKTA 4KMQA 3QR1A 1DHKA 4XBJA 2AL2A 1S2CA 2XJ7A 4LUJA 1KFLA 1UUMA 4CNPA 4DEFA 4BQ2A 2PTZA 2YB4A 4Q3MA 4MHBA 3W1NA 2Z25A 1J6PA 3MANA 3G77A 3VA8A 1E51A 2ZX6A 2XIJA 3VD3A 3OA5A 1VEOA 2L5HA 2J9YA 3GVVA 1LQAA 3R25A 2FB2A 3NQVA 4NJKA 3IJ8A 3WX7A 2PPGA 3QOMA 4HD5A 4B4HA 3CLMA 2BLEA 3WQWA 2Q3RA 3F4VA 1LG1A 3CXOA 1F6PA 4L1GA 4LW7A 1Z8AA 3ERPA 4HPGA 4UTHA 1IEXA 3PBGA 4O12A 1H0GA 1L0PA 3WSUA 1HJUA 3KOXA 4IIFA 3E38A 3TW7A 4PTXA 4E3VA 3HO8A 1W5MA 4CEUC 3M5XA 1TTPA 1E0UA 3P6LA 1VGAA 2CLKA 3DHFA 3IJ7A 1NQKA 3LNPA 4DLMA 2IKGA 1GVQA 3PPFA 3S1UA 1NOWA 2W79A 1W54A 3U7BA 5D2VA 2BHUA 2XYLA 1LG2A 4AQLA 5DBUA 2HNEA 4AUBA 4GQBA 4LPCA 1OFRA 5ABGA 3WNLA 4PB5A 3EOOA 5XIMA 4YVPA 4CCCA 3H4XA 3SDOA 3FEMA 2NUYA 2VC9A 3UJRA 1UIOA 3NPXA 4EXBA 1J5TA 1PZ0A 3GNNA 3FHAA 3M46A 3T0CA 4RPQA 3IIOA 1RVKA 1OT2A 3NL3A 3WY1A 1GOXA 5CPNA 1ZY9A 3MP5A 4UWMA 2IUZA 4GYJA 5DX7A 1EJWC 1L6FA 2F2HA 3A4JA 4HA3A 2PU1A 2E8ZA 3VNMA 4Q8TA 3TH6A 4KESA 4J5NA 1F3TA 7REQA 1LT7A 1RD6A 4IMEA 4LUSB 1KGUA 4YHEA 1YDOA 4UNLA 4PUKA 4H9UA 5CSUA 3I4KA 1F07A 2ZUNA 2D2GA 4Q4QA 3MBFA 3H6OA 6XIAA 4IMDA 2X1TA 2Y5JA 3M5ZA 5M03A 1B4KA 3OG3A 3ONBA 2JGYA 3P84A 1V0LA 1N82A 1QJWA 3GG0A 2ZZ7A 4FIQA 3A9BA 1CECA 1C8XA 2BVDA 1J79A 1J0JA 3GX9A 1NOUA 3MP4A 4HZMA 2Q6ZA 3MZNA 4GPNA 1I45A 3MTWA 4HU3A 3SRFA 1E0TA 4ATLA 3HURA 3W1QA 3MSDA 1JYVA 8A3HA 2V2CA 3B8WA 3K8LA 2ZA1A 3IGHX 3PY2A 5DY3A 4JXCA 5KINA 3GC2A 4ZCWA 1ISVA 1HJXA 4NZ3A 4DUOA 2HVNA 1BYCA 2F61A 2Z27A 3ZFHA 4TOQA 2I5IA 4MPKA 5A6MA 3MHFA 1ICQA 5D2TA 4E4FA 5A8GA 4Q6XA 1ZGDA 1SFLA 3I10A 1OABA 6ALDA 1NWRA 1VD6A 2A3HA 1Z6KA 2ZUSA 1EC8A 3CGTA 3ONCA 3IS4A 3QRHA 3BWWA 4NXKA 4Z2GA 4NIRA 3CQ0A 2P3ZA 3KCJA 5A8PA 1ZBCA 4JPGA 1B90A 1K9FA 3J7HA 2E6YA 4LVFA 2OO0A 2QIWA 3B8UA 3ANVA 3HPFA 4Y9MA 3ANYA 1ZCCA 3L4UA 2GSEA 3P82A 3ZZ1A 7XIMA 3W74A 1V0NA 3QMRA 4LFYA 3L65A 5CXPA 2JF7A 2OGYA 1XLHA 3T08A 2IS7A 1UG6A 1QPOA 3EWZA 3Q45A 1TX0A 1EHNA 5LHFA 1Q13A 3AXHA 3PBVA 4DYEA 1GJWA 1EJRC 2A1YA 4PMVA 2DZPA 4L80A 1V3MA 4CD7A 3WNPA 5LA2A 4DZHA 4W7WA 4KCUA 1WPCA 3U4FA 1CGXA 3HFYA 1KTBA 4LAOA 1ZNNA 5JBDA 4JQ1A 2FQIA 3IIXA 2JKEA