2X8RA

The structure of a family gh25 lysozyme from aspergillus fumigatus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
TTVQGFDISNHQKSVNFEAAKKDGAQFVMIKATEGTTYKDTVFNSHYTGATKAGLLRGGYHFARPDKSTGSTQAKFFLKNGGGWSDDNRTLPGMLDIEYNPYGATCYGLSHSQMVAWIHDFVNEYHHATSRWPMIYTTADWWNRCTGNAKGFGDKCPLVLAAYSSSPPKTIPGDWKTWTIWQNSDKYKHGGDSDKFNGPMTQLRKLASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE
publication title The Structure of a Family Gh25 Lysozyme from Aspergillus Fumigatus
pubmed doi rcsb
molecule tags Hydrolase
total genus 69
structure length 209
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x8rA00
2VI0A 1LWJA 1E55A 3PBGA 1W1VA 1VIWA 1DHKA 3SUVA 2W63A 2OWWA 1XYZA 2CPUA 1NOFA 3VX1A 3GXFA 3VD9A 1B0IA 1JF5A 5E09A 5IHRA 1W3HA 3BXWA 1LL7A 5A6MA 2WC7A 3K8LA 1C91A 1EDGA 3CUJA 4WK9A 1MQQA 1NOUA 4JKKA 1E72M 3GXMA 2FDMA 1JL8A 4PCSA 2ZIDA 4JCLA 4UCFA 4PMXA 1VEPA 3BH4A 3UERA 2YL8A 1KB3A 3IAPA 3EDFA 1E73M 3AIBA 4OJYA 1CPUA 4W8AA 3DHUA 4H2CA 3I3DA 1NM9A 4ZENA 3ARVA 4IPNB 3GNPA 4MAZA 3THDA 2E40A 1GOWA 3ZJKA 2D1ZA 2WMIB 4E4PA 2WC3A 1NQ6A 3WDHA 2WVSA 5FD0A 4N0RA 1QOXA 4GZEA 2RGLA 4GZIA 1E4LA 2XWDA 4GXPA 4Z2HA 2J7EA 4TXEA 4JL2A 1KGXA 3BSGA 1GJUA 3WH5A 3T0AA 1MXGA 3HMCA 1W3JA 2YL5A 1KQYA 2J7HA 5DMYA 1OD0A 1E6RA 1OIMA 2VX7A 2DIEA 1FP8A 3PZIA 3VUPA 1HJXA 1V0NA 4UFHA 2YDRA 3PZTA 3NDZA 4RE3A 2DH3A 3EMZA 4AZBA 4RE2A 4UFKA 3PTQA 4JFUA 1G5AA 2WHJA 5LA1A 4AD3A 3AHXA 4AZ5A 3VINA 5A8NA 3DYOA 4KH2A 3L4UA 3W4RA 4F9JA 1KGUA 2VNCA 4J28A 2XUCA 2GSJA 3AXHA 4V27A 2YBTA 1E40A 2PWDA 3EDKA 1U30A 4B15A 2GUYA 4OOUA 2XPKA 1UKTA 4ZXOA 3RJYA 5BRPA 1TR1A 2BVYA 1GPFA 3ARQA 4PMZA 2E8YA 3RO8A 2EPOA 3TTSA 3VDCA 1JF6A 1WZLA 2X0HA 3CMJA 1US2A 1JYXA 3B9AA 4JHOA 3QHMA 1VRXA 1B3WA 2DSVA 3CTTA 3WUBA 2VCAA 4AZ6A 3AQUA 1WAWA 4W87A 1PX3A 2BVTA 4RL3A 1H2JA 1EHNA 1J10A 4MNMA 3ZM8A 2WWDA 2D3NA 2XGBA 1JYNA 3WH7A 4QLJA 3QOKA 2EEXA 1W32A 2Y24A 4HOXA 5C70A 2WK2A 1UWQA 3A4AA 2YA2A 3TTQA 2Y8KA 4AZGA 3ZT5A 4HA4A 1CGTA 1QI3A 2WVVB 4GO8A 3GZAA 4PSRA 3GDBA 2XFFA 3AIWA 3SCOA 4AC1X 2WZIA 3WSUA 1RD6A 1J9YA 2F2HA 2VVNA 4AD5A 1UA3A 2CBVA 3WIJA 4UQBA 4A4AA 1JGIA 2IUZA 2J75A 4JFWA 1XC6A 2CESA 2J79A 5CLTA 3WQ8A 4CVWA 5ABEA 1CGXA 1E4MM 1V02A 2WKGA 3SUUA 3NYDA 3QGVA 4HZ6A 5GPRA 2EPMX 2J4GA 3VD3A 1C7SA 3F5LA 1DWGM 1DWAM 3LMYA 2G3NA 1DP0A 3CO4A 1I1WA 1JDDA 1J0JA 4IISA 4W86A 1NARA 1VF8A 1UD8A 3BAIA 3PZVA 1PX8A 4W7UA 3WUGA 2D2OA 1V3JA 2FHBA 3IJ8A 2GFTA 1Q6EA 1JNEA 4P8WA 1XGZA 3T09A 4UQAA 3EBVA 4GKLA 3EMCA 1CXEA 3EDDA 1GVIA 1UZ4A 1V6WA 4CUCA 2A3AA 2GDVA 3VM5A 3WL1A 2YA1A 4TVCA 4W88A 3SCPA 4B9YA 3WNOA 5BXRA 3QOMA 5ABFB 5LA0A 1KWKA 1OWQA 3K46A 2YDQA 3BMVA 4D72A 3VIMA 4M29A 1OGBA 3D3AA 1JZ6A 2WHLA 4TUFA 1MXDA 1E1EA 3SCTA 1EHAA 1WZAA 5ABHA 2PBGA 1UD6A 5DT7A 1V6UA 3DC0A 4J7RA 3WF0A 1E71M 4PRWA 5GNZA 1OSEA 2XVNA 1Y7VA 1BF2A 4P8UA 1ZJBA 1W2VA 5I5RA 2CHNA 5M5DA 4B16A 1EGZA 1X6LA 1FFQA 3TOPA 3WNKA 1UD5A 2G3JA 5EFDA 5EBAA 1JXJA 3VTRA 3T2QA 2G3IA 5EFFA 3GNRA 5DFAA 1PAMA 2WKLA 3ZJ7A 4UNIA 3KL3A 4HMEA 4PMYA 5LA2A 6TAAA 3VD4A 1E0VA 2D22A 3W81A 1PPIA 1GOKA 5CLWA 3WQ4A 3BLKA 2EPKX 1E4NA 3BSHA 3FAWA 1ZL1A 1CLVA 3OBAA 3IK2A 1V03A 2MANA 1PEZA 3ZR6A 5A6LA 3VGGA 3VIJA 4PMQA 1E4IA 5GQBA 2Y2WA 1W3LA 5CSYA 2VX4A 1UR2A 2VCCA 3WELA 4D6JA 3VGDA 1C90A 4WLCA 4ATLA 3MO4A 1KXQA 5A2AA 2V3FA 1KXHA 1QI4A 1FFRA 4BQ3A 2QPUA 2W67A 2DGAA 1ZS2A 1G1YA 3CZ8A 4CGTA 4W7VA 4PTWA 1OBAA 3VX0A 5BYWA 3CBWA 3QR3A 4PTXA 1UZ1A 3WNMA 3ZSTA 3CH9A 3NSNA 3RMEA 7A3HA 4H8HA 2XVGA 5CPTA 2VUYA 4D6CA 3VM7A 1DWFM 1JI1A 1WNOA 5BROA 1Q6DA 4ACZA 2J7GA 5BRQA 2BY1A 1HL9A 3N15A 2J7DA 2VCBA 3G6LA 1W2PA 2JEPA 4IPLA 4ML4A 4TX8A 4E2OA 3PZMA 1LL4A 1C93A 4BS0A 4X0NA 1PZ2A 2IXVA 2VRQA 3AMCA 3WMCA 4AEEA 3OLDA 1PBGA 2VL4A 4DWSC 1A3HA 4Y7EA 1OINA 5IHSA 1UR8A 3F4VA 4NZCA 1XH2A 3WDJA 4BZYA 1ODUA 3AZSA 1BYBA 3WEZA 3BGAA 3VGHA 4AWEA 1GZJA 1PJ9A 1WPCA 5TD4A 3MU7A 5D9PA 5FIPA 4E8DA 4YHGA 3J7HA 5KZ6A 3SCRA 3KE0A 2ZX7A 5GNXA 4ATDA 3GYCA 3MMDA 4D6HA 1CEOA 3L4TA 2EJ1A 4KGLA 4XB3A 3SCSA 2YDSA 2WMFA 2G4FA 3AMLA 3T08A 4AIEA 2AOSA 1ZBKA 4DUVA 4TVUA 1DEDA 1BLIA 3UR7A 1JZ2A 4W5ZA 4CU7A 2ZX6A 5A69A 3NSMA 1GOOA 4W89A 3VPLA 1HN1A 3ALFA 5JIPA 2ZX9A 1HJSA 4PMDA 2WM0A 2J7BA 1CTNA 1LG2A 4J3XA 2DIJA 2XIIA 1TA3A 3K8KA 3AXIA 3IJ9A 2WYSA 3SCNA 1UWIA 3AIVA 1GOQA 4B3KA 4KRTA 1HX0A 5A6AA 3PZOA 4P7RA 4GPNA 3KWXA 1EQCA 4N42A 1KR0A 2CBIA 1H3GA 4Z2LA 2DSZA 1SMDA 1PIFA 4H04A 3PZUA 4UFMA 2XIBA 1HKMA 2J7FA 4PMNA 4U2YA 3THCA 4D6DA 4PSPA 2ZUWA 3ARWA 1WKYA 4P7LA 4JAWA 2GK1A 1J11A 1H11A 1UHVA 1OGSA 4YHEA 2JF7A 2WW5A 4JFVA 2YA0A 4LYRA 4CN4A 4MB1A 3FHQA 3KL5A 1WO2A 4B3LA 4HOWA 4UZSA 4ZFMA 3AHZA 3ARSA 3HN3A 2BNJA 4BCEA 1JYVA 1S46A 2WZHA 3VIKA 5FOOA 7CGTA 1MQPA 2G41A 1US3A 3N17A 1PIGA 2D0GA 4QCEA 1CGYA 3I3BA 1I75A 5C8BB 1R86A 3CHEA 3FAXA 4KMQA 1SMAA 5JIWA 4OBRA 2V5DA 5HNNA 3ZO9A 4FLOA 4NF7A 1E6XM 4U3CA 1H09A 3VNZA 2BV9A 3AYSA 2QF8A 2OYKA 1WDSA 1V02E 4AD0A 1B2YA 4HZ8A 4R27A 3MSDA 4H8VA 2JF6A 4P7OA 1BHGA 4HTYA 3WUFA 3WDIA 4XZWA 1QNPA 4DWSD 5CZKA 5HPOA 1ZB5A 3PTKA 3WF3A 4PCTA 1ITXA 2DT2A 4HPHA 4JFTA 3VMPA 5CG0A 1XD0A 4LYQA 4UFLA 2O9OA 4OUEA 4PBGA 3W6LA 4WIWA 5D8ZA 2EBNA 4UOJA 3FXYA 3WF1A 2WSPA 1VFUA 2JE8A 4DUXA 2YLAA 4M1RA 2D3LA 2GJXA 1GORA 2WB5A 4XUYA 4MNLA 1LG1A 3VO0A 1GOMA 3RM8A 3WD1A 4H7VA 1XCXA 3ARZA 1GQIA 3TTOA 8A3HA 2E9BA 4UOQA 2A3BA 3N04A 2PWHA 2CKSA 2OSWA 2VR4A 3AS2A 1V6XA 3VILA 3SUSA 1M53A 2CHOA 3WBEA 5AYBA 4XV0A 4Z2JA 2W91A 1QNOA 5A8PA 2CERA 1QHPA 3LPPA 4DUWA 1TE1A 3B9EA 1HKKA 1BG9A 2DDXA 2J78A 3OLEA 4JL1A 3ZJ6A 1GVYA 1W9VA 4F8XA 3UESA 1NP2A 2OSYA 2XWEA 4YPJA 2DSWA 1AQ0A 2O9TA 2B31A 3SIMA 3BAXA 4HZ7A 2VZTA 1B31A 1AQHA 1CYGA 2CYGA 2WBGA 5EMYA 1B3YA 1E0WA 1H0IA 3AI0A 1KWGA 1UA7A 2VC9A 2XHYA 1E6PA 1BVNP 5CXPA 1LJYA 4URIA 2BHUA 3JUGA 2BXYA 2YBUA 4PUEA 4MADA 1JXKA 3FN9A 3A47A 2EPLX 1QHOA 2C7FA 2VZSA 1KR1A 2C8NA 4KGJA 3FNDA 1ZJAA 4PMRA 1OM0A 4RE4A 4PUDA 4AD4A 3AZRA 3GXIA 4LGXA 1IZKA 2IXUA 1C8YA 1FP9A 3OZPA 1QNRA 2D0FA 5LYRA 2E3ZA 2ZUSA 1ITCA 2VMFA 1WZKA 1EH9A 2VZUA 3WF4A 2WVUA 1CGWA 3VGFA 2PI6A 5E0CA 2X2YA 2ZX8A 3WD3A 1JD7A 3KEHA 5E9AA 3RM4A 4PTMA 1R7AA 2AMGA 2JEQA 2XGIA 5A95A 4AIUA 3II1A 3AFBA 1E3ZA 1E0XA 2BXZA 2HISA 3VIPA 4E8CA 2Y4SA 1Q4NX 4LQ1A 1CDGA 3CZGA 4NRSA 4FLRA 4QFUA 3EYPA 4PMOA 5I79A 5KEZA 1ISVA 3A4XA 2VOTA 4LPCA 4LXFA 1W9BM 4M81A 1E15A 1XH1A 4CD4A 2ZXDA 4AD1A 3IJ7A 2WCGA 2XSBA 3KZSA 1CGUA 3PN8A 3K4DA 3VVGA 1XCWA 4OOZA 3U5YA 2O9RA 3OGVA 4V2XA 1R8LA 4AZCA 2J25A 4IUGA 5CQ1A 3DYMA 1UG6A 1QBAA 2PB1A 5JBFA 1E6SM 1WE5A 2UY4A 3WDPP 1TZ7A 4ACZB 2UY5A 3PZNA 2V3EA 1BGGA 1FHDA 2VT0A 3WBAA 4HU8A 3VU2A 2QHAA 3WDRA 5IDIA 5A6JA 3W26A 4FK9A 2W92A 1JZ5A 1K9DA 1JZ4A 5JUVA 2A3CA 1V3KA 1M03A 4CD8A 5ECUA 1KGWA 4MB3A 2DT1A 2WMIA 3G6MA 3MUIA 3CZKA 2J8FA 1OT2A 4CD7A 4GI6A 4UR9A 4TVDA 3BAJA 1QVBA 4J3TA 1JDCA 2DSKA 3A4WA 1MW0A 2W62A 4QAWA 4MB4A 3T0DA 3EDEA 4CCEA 1QI2A 2PWEA 3RCNA 1K9EA 2J8GA 1UH2A 1NWUA 3WD2A 1G94A 2W61A 2DEPA 3OGSA 5A8MA 1OD8A 5A6SA 4P8XA 1UKPA 3FW6A 3NJ3A 4GIAA 1E70M 1X1NA 1C3FA 5E0FA 1HJQA 3M07A 1C7TA 1N82A 4C7FA 3AHYA 4CD6A 2JFEX 3OIHA 1EOKA 1O6IA 2BY3A 1J0YA 2WAGA 2OYMA 1JZ3A 2BFGA 2QMKA 2FH6A 3AMKA 3L4YA 5A8OA 4CN1A 1XV8A 4J3SA 1VAHA 4C7GA 1UWRA 3CZLA 5IFTA 1TA3B 3AMDA 1QHZA 1CIUA 1LLOA 1Z32X 4L4PA 3T0BA 2VZVA 1JI2A 4D6FA 3DYPA 5FCZA 2YLLA 3PZGA 1W9XA 2V3GA 1GHSA 3WD4A 3AXXA 1QNQA 1UD3A 1V3IA 1D2KA 2G3MA 2XM2A 1UR0A 4HMCA 2XTKA 4UFJA 2VX5A 5A8QA 2WMKA 4JZ5A 2JIWA 3WMSA 4D1JA 1MWOA 1MQRA 1UKOA 3GH7A 4UFIA 4BQ2A 3GBEA 2BY2A 2XVLA 2X05A 1B90A 2ZWYA 5HBFA 4QLKA 1MFUA 2GK1B 3MMWA 2NW0A 4D6EA 4JCMA 3N11A 4U31A 1W9DM 3W37A 4AZ7A 1EO7A 1VFOA 4W93A 1UYQA 1XD1A 1PZ3A 4FLSA 3UETA 1UD2A 1HP4A 4J3WA 1ZU8A 1E6ZA 1ODZA 2W4XA 5ABGA 2C0HA 3BMWA 3ZT7A 4Z2KA 3UG3A 1HXJA 3VGEA 1B1YA 5FL0A 2RGMA 1JIBA 3WMBA 1H5VA 4W7WA 1WZMA 5BXSA 4J3UA 4CKQA 3VIGA 2VRJA 3ZR5A 3W28A 4NRRA 4ZXLA 1W91A 3WF2A 1SFSA 3W25A 3BCDA 3VMOA 3WNPA 3AICA 3BCFA 4U33A 1WDRA 3W0KA 3WL0A 2O9PA 1E5NA 1UH4A 2UY2A 2ZOXA 3SUTA 1UKSA 1QPKA 1QI5A 1BFNA 2E0PA 1FOBA 3ZOAA 5EB8A 4DM1A 4Z2IA 1CXIA 1V0KA 1XHGA 1V0MA 1JAKA 1V3LA 2PBOA 1NOWA 4GINA 2XVKA 4PMVA 2WANA 1FHLA 1NWSA 3AS1A 2BVDA 1BPLB 4PMUA 1EDQA 1HKJA 4QDMA 3PZQA 3O9NA 2GJXB 3AROA 1H1NA 1VBRA 5ABFA 2CKRA 2XG9A 4Q7NA 1EA9C 1TUXA 4J3VA 4MAVA 1JFXA 1UR1A 3RM9A 4BF7A 1XSKA 3IAQA 3AS3A 2ZUMA 1C92A 2WMJA 2J74A 2CEQA 2NSXA 1VJSA 1RPKA 4MPKA 2E8ZA 3K8MA 1CXKA 2WZEA 4WSJA 5DEZA 1KBKA 2OYLA 3RIKA 2ZUVA 2WVTA 4U5KA 4WF7A 2TAAA 4JIEA 1M7XA 1BYAA 1RP8A 2PWFA 3N18A 4EE9A 3NDYA 2OWCA 2W5FA 3L4VA 4WSKA 1XRVA 4P7NA 3L4XA 2XVPA 3A3HA 4AIOA 1PX4A 2ZX5A 4QCFA 3OG2A 4DWSA 3VDAA 2F8QA 3VIHA 3WNLA 2WMGA 4EAMA 5HDRA 1J0ZA 3M6DA 2CNCA 4EK7A 4WJXA 1VFFA 2X8RA 3NCOA 3U57A 1W1YA 1IZJA 3UG4A 3AIUA 1HP5A 1H4PA 1V3MA 4AISA 3MANA 1LF1A 3W27A 3UR8A 2PC8A 1E6QM 5I77A 3QHOA 1CBGA 3WFLA 1VJZA 3ARPA 4PYSA 3RILA 1JZ7A 1W1TA 3D5HA 2V38A 4F66A 4FF5A 3AHTA 4MJ4A 1W9UA 2YOCA 1F4HA 2OLHA 2VX6A 3AZTA 1JNDA 3WQ6A 3U5UA 4AYSA 2V3DA 4M56A 3HU7A 3GXDA 4HPGA 3VIOA 4CN6A 2XSAA 5HXMA 5A6KA 1E56A 1Q6GA 3T2PA 1GCYA 1QW9A 3FHAA 3OA5A 1NP0A 2X0YA 4FMVA 1JG9A 4GI8A 1SR0A 3TA9A 2FGZA 5BWFA 1GOIA 2VTFA 3T2OA 4CD5A 4U2ZA 4LX4A 4ACYA 1AMYA 2VR5A 3ZT6A 2BHZA 1E6NA 3MUY1 2BHYA 3O6AA 2EO7A 2VRKA 3OB8A 4KWUA 3GM8A 4OIFA 2X09A 4W8BA 3ARXA 4F79A 1GQJA 5BXPA 2AAAA 3GBDA 3TTYA 1HNYA 1G9HA 3ZIZA 3WEOA 1DTUA 1V0LA 2YJQA 1BSIA 1HKIA 4AZCB 1B3XA 1EQPA 1NWRA 3TP4A 1CECA 4UQ9A 4D71A 2ZICA 1E9LA 4HMDA 4C7DA 1JFHA 4UTFA 4JKLA 2DSUA 4MTVA 4XZBA 3OLIA 4J27A 1XSIA 4GQQA 1V6VA 2ZXQA 2BS9A 2CXGA 1TVPA 1HVXA 1HJWA 4U5IA 3SURA 3L2LA 3E1F1 5A6BD 1KBBA 1D3CA 5I2UA 3POCA 4H8UA 2D0HA 2ZWZA 4TTUA 2NT1A 5I23A 2D20A 1CZ1A 2ZUTA 3B9DA 1ISYA 1MW2A 4K68A 3UCQA 1E43A 3KL0A 3EMQA 1ZBVA 5C71A 1JAEA 1W9PA 4GQRA 1ISXA 1LWHA 3WKZA 2WWCA 3WFZA 9CGTA 5I24A 1C8XA 1ESWA 1DWHM 1VBUA 1TMQA 3S6TA 1WP6A 2GJPA 1HF6A 4WKAA 1OIFA 2CCRA 4TOQA 1CXFA 2EQDA 3VDHA 3WQ5A 3ARRA 4ZEPA 2GDUA 4PN2A 2YKKA 1UUQA 1FH8A 1L8NA 1HJUA 1UR9A 1VEOA 2GJRA 1FA2A 1NH6A 1GUVA 3PZ9A 4BQ5A 5M3WA 2CBUA 1GNXA 2HVMA 3QHNA 2XM1A 4R5EA 5IXEA 4ATWA 1QW8A 3SUWA 1UOKA 1BQCA 4X0VA 1YQ2A 2E4TA 1U2YA 1P6WA 5JBEA 1ECEA 3ALGA 4UQEA 5D9NA 1CXLA 2WCAA 1E3XA 4CU8A 1FH9A 4MDOA 6A3HA 1J18A 4U3AA 1FH7A 5A1AA 1VEMA 2J7CA 1JDAA 2XFYA 1OB0A 3RJXA 4GI9A 1Q6CA 1UKQA 1V6YA 3VNYA 4S3JA 3RDKA 3CHDA 5E6YA 5A3HA 3WY1A 2F61A 1V3HA 2J62A 5JBDA 2JALA 5FKYA 3W6MA 2O92A 1O7AA 1J01A 2WCSA 2WNWA 4ZE4A 1R85A 3CPUA 1J0KA 3CMGA 4CCDA 3WENA 3SCUA 5I3DA 3U7VA 1UQYA 1BTCA 4PTVA 2JIEA 1B30A 4A3HA 1U33A 1MVYA 4MJ2A 1DWIM 4M82A 2Y5EA 4ZE5A 4HP5A 2XFRA 2QPSA 1UQZA 4JKMA 4LYPA 6CGTA 1TG7A 4MNJA 1E5JA 3O2LA 1BYCA 3RPMA 3N13A 1EO5A 4CVUA 3SCVA 4MB5A 4NI3A 1TVNA 4H41A 1L0PA 3DECA 1GONA 3I3EA 3CLWA 5A94A 1UWSA 5AYIA 3LPOA 4DM2A 5D9OA 1GW1A 4P8VA 3GH5A 1EOMA 4EANA 3WH6A 1KCKA 3K4AA 4Z2GA 2D24A 2QV4A 5IFPA 1IT0A 1W3KA 4KRUA 1ISWA 4GO9A 4GZJA 4AEFA 1WDQA 1GQLA 1G0CA 1UR4A 1DWJM 2J77A 3ECQA 2YIHA 4UQCA 2ZUUA 1B9ZA 4W5UA 5FL1A 5BCAA 2Z1KA 3NIYA 2WLZA 3MMUA 3F5KA 1JYWA 1H0GA 1WB0A 2VVSA 1E1FA 3WQVA 3MV11 3CGTA 3CUHA 1CNVA 1WCGA 3MUAA 2YL6A 3N1AA 1VFMA 3BAWA 1ZBCA 5D8WA 5A2CA 2A3HA 1I1XA 1UWUA 1Q6FA 2WBKA 3CUGA 3EDJA 2ZXBA 4D6IA 2FH8A 2WHMA 5E6ZA 1GJWA 1TCMA 1QI0A 1J12A 3WUEA 2NT0A 3VIIA 2QMJA 1KCLA 1JZ8A 5M03A 3PHAA 5D4YA 1OCQA 4M8UA 1J0IA 3A6OA 1MFVA 3WN6A 2EXOA 4V28A 1CWYA 3K1DA 3AOFA 1UWTA 5I78A 1H41A 4D1IA 5F7UA 4CCCA 2XYLA 1M04A 3ZSSA 1AVAA 3CHCA 2QLYA 3WNNA 3TONA 2WLYA 8CGTA 3F5JA 1HT6A 7TAAA 4DWSB 1HVQA 4EKJA 3MS8A 2PWGA 2DQXA 3B8SA 1C8QA 4AY1A 2E9MA 1CENA 4MDPA 2VQUA 3NUKA 4PEEA 4AD2A 5CJ5A 1X6NA 4W85A 1EIBA 3M46A 1UH3A 3CHFA 3HJEA 4UZUA 1BAGA 3CUFA 1UD4A 4WKFA 4QP0A 3ARYA 4TTGA 2WVVA 4JFSA 1R7OA 1B3ZA 2OSXA 2UWFA 2E9LA 5CPQA 1VENA 2WC4A 5DO8A 1K6AA 3GTNA 4B9ZA 4CU6A 3CUIA 1RP9A 4HU0A 2DT3A 3W24A 3W53A 4HA3A 3L2MA 1IV8A 2Z1SA 4UQDA 3VKKA 1SYTA 4OBSA 4BQ4A 5BXTA 2DPEA 2OWXA 1KFWA 4AZHA 5HPCA 3AISA 3MSGA 3AYRA 5AY7A 3VDBA 5CSUA 1GQKA 4L4OA 3L4WA 3N9KA 4M24A 4W84A 2WMHA 5D9MA 1J0HA 3AIRA 3W38A 1RH9A 3ZMRA 4HOZA 1JD9A 5A2BA 4M80A 1HL8A 3WDQA 2CETA 2G8ZA 1VB9A 4MNKA 1XSJA 1KXTA 4BA0A 3OGRA 2X1IA 4XX6A 2VJXA 2ZXAA 1BGAA 5AC5A 3AHVA 1K9FA 3WH9A 2PF0A 4JHZA 1EXPA 5I0DA 3ARUA 1LQ0A 3OZOA 5DF0A 5AC4A 2FHCA 1V08A 3BAKA 4A3YA 3POHA 2UY3A 1EDTA 3DHPA 5E70A 5GNYA 3CZJA 4TX6A 3PTMA 3ZQ9A 3BC9A 3SCWA 1M01A 1GHRA 4NSBA 1MW1A 4Q22A 1F4AA 3SEPA 2ZUNA 3NSXA 5I6SA 4AMCA 3BAYA 3VGBA 2DH2A 2VURA 3WEMA 2DT0A 1R87A 3W29A 3LPGA 1OT1A 4HA1A 1XH0A 2J47A 1W1PA 3AMGA 3VIFA 3BLPX 3MV01 4QLLA 1QBBA 3APGA 2WHKA 4AXNA 3GH4A 1A47A 2WXDM 4OKDA 1MYRA 4YN5A 1CLXA 4X9YA 3S2CA 2WPGA 3GNOA 1NWTA 4FLQA 2VO5A 1K9TA 2WSKA 3LPFA 4OZOA 5CGMA 1XYFA 3AIQA 1AQMA 3CZEA 5HOSA 4IM4A 2FHFA 1B3VA 3VMNA 4D6GA 1BG4A 5DT5A 4AZIA 1KQZA 2CITA 3VD7A 4AW7A 2Q8XA 1BYDA 3FY1A 1OGGA 1ZBWA 4P7QA 5M17A 2GVYA 3M7SA 5CPSA 3W82A 4F9DA 3WD0A 2A3EA 3ZJ8A 2FGLA 1TFVA 3U7BA 3UEQA 3MUZ1 1BVZA 1G01A 2D23A 1QNSA 1CXHA 2BY0A 1LL6A 2VQTA 1WDPA 3VOCA 1YHTA 3AJ7A 1CGVA 3AS0A 2ZE0A 3ARTA 2YL9A 3CIVA 4WKHA 2V5CA 3WQWA 4S3KA 3UG5A 1HJVA 5A6BA 2XJ7A 3OLGA 3N12A 3MKKA 3VD5A 1KXVA 1D7FA 3SCQA 3WH8A 1MW3A 3L4ZA 3IANA 1ISZA 2CIPA 2Y8VA 3AIEA 5CGTA 4UOZA 2ESCA 2VZOA 4W8LA 1H49A 2EPNA 1HIZA 2W66A 2CBJA
chains in the Genus database with same CATH superfamily
4LCRA 1YPFA 3C8FA 3E49A 3GD6A 5LKYA 5E9XA 2VDIA 3IIXA 3PBGA 1VIWA 2OWWA 4DAFA 2NVDA 3FJ4A 1OG6A 4I5UA 4S3FA 1JF5A 3B06A 4C6KA 5IHRA 1L6WA 5A6MA 2WC7A 1C91A 1KKRA 3GC5A 3PNUA 2ZIDA 4JCLA 1VEPA 2R1LA 4A8RA 4WEVX 3BH4A 4ZQMA 4YIWA 4R33A 1E73M 5D37A 3RITA 4L7ZA 4G56A 5G1MA 3GRIA 4RV8A 3THDA 5AHIA 2E40A 3UZ5A 3W7HA 1GOWA 2O4MA 1AW5A 3HIJA 2FTWA 2WC3A 4O4VA 2XIQA 1XKYA 2WVSA 2Z6JA 2HXUA 4GZEA 3SADA 3BSMA 4GOAA 1P0BA 3IACA 4LF1A 3ITLA 3WLNA 4WUIA 4G5DA 4DYEA 1X7IA 2QCLA 3MYOA 4BKNA 4FEZA 1GJUA 3HMCA 1W3JA 2LLEA 2YL5A 1KQYA 3GUGA 4DO6A 4REQB 5KMYA 1OD0A 1IEIA 1FP8A 3MBDA 4UFHA 4D8ZA 2YDRA 1QPRA 1TQJA 3EMZA 3ITVA 3PTQA 3KVKA 1G5AA 4RZ5A 2WHJA 1P5BA 3KVJA 3O07A 4AD3A 1XCFA 4PBFA 3SI9A 4AZ5A 3VFLA 4JXCA 3DYOA 4R7WA 2WJZA 3L4UA 1KGUA 4J28A 4XVEA 4IIHA 2I9UA 3NQ2A 2CLMA 2GSJA 2PF8A 5J04A 2YBTA 1E40A 2PWDA 2PMQA 5KITA 4HPJA 2XPKA 1OFDA 2OX1A 3RJYA 5BRPA 3KVMA 1F3EA 2BVYA 3ARQA 3KWSA 4O0KA 4C6FA 3VDCA 4FNPA 1JF6A 1YTDA 3S5ZA 2X0HA 3CMJA 2F38A 1Q5MA 2BOEX 5F1UA 2HQAA 1ZUAX 1XP3A 4KFPA 1VRXA 3DFSA 2UZ9A 3MI2A 1WAWA 1PV8A 4R7JA 1SJAA 4GY7A 4EPEC 4FALA 1R0MA 2BVTA 4QNEA 1R3VA 2GVLA 2WKJA 4IIGA 3LXCA 2OU4A 1XWYA 1FRBA 5C70A 1MEWA 2WK2A 3N3TA 4ILSA 3TSBA 2MNRA 4AZGA 4HA4A 2WVVB 1EPVA 4Q32A 2RJGA 2FZ9A 2XFFA 4WDTA 3SCOA 2F2HA 2FLIA 1GKQA 2CBVA 3IK4A 3FJLA 5EMKA 3GIPA 5G2IA 5CLTA 5ABEA 3ZLHA 4PCPA 2WKGA 2PODA 2EPMX 2J4GA 3VD3A 3F5LA 1DWGM 2FTPA 4UTKA 4FX6M 4JIPA 3CV1A 1DP0A 3XIMA 4W86A 1NARA 1UBSA 3ONCA 1O68A 3QYSA 4JX4A 1UD8A 1KRCC 3D0CA 3PZVA 4W7UA 2VENA 4GA8A 3M0JA 2FHBA 2GFTA 1Q6EA 1JNEA 1XGZA 3H7RA 4RXGA 1YNYA 3F4NA 3EBVA 4GKLA 1A5CA 3UZXA 3E2QA 1OY0A 4GQGA 1GVIA 3HGRA 3NXLA 1V6WA 4CUCA 2OXNA 1K6WA 1UP0A 3QOMA 5LA0A 3TU9A 4UMCA 2YDQA 3T78A 1OCJA 2FQIA 3N14A 1T41A 1WXJA 5BRBA 2E1DA 4LAUA 3HQPA 1TMHA 1SVDA 1XI3A 2PBGA 1UD6A 5DT7A 4J5NA 1HUVA 4J7RA 5LNUA 1VLWA 4GJJA 4HBKA 5HR7A 4NJIA 4P8UA 3PG8A 1T6MA 3GHSA 4DZAA 2CHNA 1SQ7A 5M5DA 3TOPA 3SGZA 4RJEA 4JQ2A 3EWDA 4PUWA 1GW9A 5EBAA 4WY0A 3P67A 3NL5A 2P10A 2OELA 2WKLA 4ICNA 2RUSA 4NNCA 6TAAA 4IWWA 2Z1VA 1DL3A 3UZZA 4IL0A 3WLIA 4JN7A 3W81A 4BEQA 1PPIA 3G24A 3PVFA 1V79A 1RQEA 3QTGA 4ML9A 1WKDA 3BLKA 2QCEA 3BSHA 5LNSA 1TR9A 3P8IA 3W07A 3MZNA 3ZR6A 4LH8A 3VGGA 3VIJA 3VYLA 4F0KA 1VGAA 1E9ZB 2HE8A 4RE0A 1KC7A 2VP8A 2ZC8A 3UWVA 1C90A 1MXSA 1S2UA 4WLCA 3GNNA 1NDZA 4GMEA 1WDWA 1KXQA 5F2LA 4IMFA 4DBEA 1Z48A 5EKYA 6REQB 1A53A 1LRTA 1KV5A 3PSVA 3BL3A 3EWBX 3KXQA 4KW2A 3QY6A 1S1RA 4W7VA 3G3DA 5M1TA 3BJTA 5BYWA 4Z0SA 4PTXA 3WNMA 7A3HA 3NPVA 4H8HA 3N4AA 3LCXA 2GSHA 3W7CA 1TJ0A 1YDVA 2EHHA 2J7GA 3N15A 1QXLA 1QMLA 3G1DA 3M0ZA 3NQ6A 4TX8A 1XG3A 1TUFA 3BLIA 1RK6A 1C93A 4BS0A 3N4FA 3C3UA 2V82A 2JBMA 3V75A 3FDGA 2QGYA 4AEEA 1ONEA 2VL4A 4LS0A 3LV5A 1HQTA 1XQLA 2FPVA 3JR2A 3WDJA 3BDKA 2VD9A 3AZSA 1BYBA 2B7PA 4GCXA 2X1SA 1PVNA 3TH6A 1PHWA 3N3MA 1U1JA 4FS9A 4HK6A 1SFTA 3NPXA 4RZBA 4OHQA 5KZ6A 2ZX7A 4AY7A 2QJJA 4ATDA 3GYCA 3C0LA 3NAVA 3R2GA 2J24A 2EJ1A 1TWWA 2G4FA 3AMLA 4GIRA 2YX0A 1VD6A 1ZBKA 4XIMA 1TV7A 1KCXA 2PTZA 2VEIA 4MLJA 4NX5A 3UR7A 1P4CA 4HPNA 4R85A 5A69A 1KTBA 4KFOA 3DHFA 3B8VA 3ZXWA 2ZX9A 1HJSA 4PMDA 1TJPA 3A23A 3PF3A 4PZVA 2A0NA 2E09A 1YIXA 4DJDC 1UWIA 2BSLA 1GOQA 2W9MA 3F1QA 3R43A 2HS8A 5REQA 1W8SA 3PZOA 4P7RA 2Z7KA 1NSJA 4GPNA 4JX6A 5EU9A 3AJXA 1GG0A 2IKHA 1EQCA 4N42A 1KR0A 1J93A 1DIEA 4UFMA 4J2MA 3IGUA 4OBTA 2ABAA 2YDAA 3KRZA 2X41A 4D6DA 3K5XA 3ZS4A 1HGYA 3LD5A 4P7LA 4JAWA 1J11A 2I5IA 1OGSA 2E6AA 4J3ZA 5IBXC 4DO7A 2WW5A 3RLUA 2V81A 2YA0A 4LYRA 8TIMA 1WBHA 1KM4A 4MB1A 3FHQA 4B3LA 4UZSA 4ZFMA 1SPQA 3KTCA 4HNTA 4BCEA 1ICPA 4EOUA 3T8QA 3W1XA 3GG7A 1PIGA 3NQ8A 1CGYA 2PDUA 4JTSA 4AIBA 1GEHA 1UJQA 3NG3A 1ENUA 3CHEA 1S5VA 1SMAA 2NZLA 3SAZA 4OBRA 4ADUA 2NV9A 3ZO9A 1GWJA 4FLOA 4XO6A 1E6XM 3GC2A 3RPDA 2BV9A 1V02E 3FFSA 1P1MA 3MSDA 4H8VA 3FV9A 1BHGA 3PBWA 4XZWA 3P93A 2X30A 4NZ5A 1CCWB 5HPOA 2OCZA 1ZB5A 1WXZA 3LZ5A 3PTKA 4HSOA 3W74A 3F2DA 4AHPA 4HPHA 1H7RA 3CWHA 4WD0A 3NO1A 3ZVHA 3GQYA 1XYBA 1KFJA 4UFLA 2O9OA 3W6LA 5D8ZA 4YTSA 2EJAA 4FIRA 1VFUA 1YRRA 2OGYA 1IXOA 1Z8AA 2GJXA 3CWOX 2C15A 1K8CA 4UTUA 1GOMA 3HPZA 3MA8A 3WD1A 4F40A 3ARZA 8A3HA 1RHCA 1XBVA 1IIHA 4O52A 3M5YA 4M0XA 2ZZ7A 3AS2A 2YZ5A 3SUSA 5KZMA 3O63A 3G1HA 4XV0A 4L4LA 4GC4A 2CERA 1S2WA 3A24A 4V15A 3QZ6A 4DUWA 1HKKA 4H7CA 3LQGA 2J78A 4GE8A 1B9BA 1W9VA 3UESA 3Q67A 4WJEA 2O9TA 1T40A 1NDYA 1TIWA 4O54A 1B31A 3WLQA 2DFAA 4C1NB 1EEPA 4JPGA 1A5KC 1X8FA 3TC6A 1WKFA 1B3YA 3QR1A 4PULA 1KWGA 3ITTA 2XHYA 3WLPA 1QR7A 4FXSA 3PANA 1JRCA 3QN3A 5FJUA 1XBZA 4A3RA 2YBUA 3BUVA 4NZ3A 5BZAA 3QEZA 3B0VC 1M7OA 5PTDA 1KR1A 2C8NA 4KGJA 3A5FA 1ZJAA 3R10A 4PMRA 1DJQA 2OZTA 1LUCB 1CW2A 4GUGA 1C8YA 3HG3A 4L9XA 7REQA 3KCOA 3CV6A 3RGTA 2JKEA 5LYRA 2VFHA 3CUXA 4EWND 4AB4A 4BWLA 1WZKA 4WQ6A 1QPOA 1V5XA 2OKOA 4LV9A 3VGFA 5LXXA 1XGDA 1JQXA 3WD3A 3KEHA 3VI2A 4MWAC 1R7AA 2INZA 3VZZA 2XGIA 5A95A 1B54A 3II1A 5G1YA 2Y4SA 3GU9A 5HUPA 3CZGA 1DIDA 3W6YA 1OFPA 1JVNA 5HMDA 4O1BA 4XBSA 3EYPA 1ISVA 2VOTA 2X1TA 1W9BM 3L9CA 2VEFA 5EMLA 4CD4A 2ZXDA 4AD1A 3IJ7A 3NZQA 1ZJHA 3IJQA 1AG1O 3U5YA 4AMAA 1H1ZA 3LCWA 4AZCA 1VZWA 4C1LA 2YZRA 4H6EA 2NXIA 1WE5A 4ASTA 3WDPP 1TZ7A 4KEUA 1EPXA 3E3HA 1FHDA 4GX8A 3UPWA 4O13A 3EPNA 5IDIA 3W26A 5T8GA 1TJ2A 4CCZA 5JUVA 5FAJA 1M03A 2G37A 3CB3A 1ME8A 1XLLA 3MUIA 3A22A 3CZKA 1MI3A 3COTA 2VELA 1XDJA 2OGJA 2QYGA 2DQWA 4AUBA 4TVDA 1UOZA 1QVBA 2WJFA 1LBMA 4J3TA 2KZHA 2DSKA 2W62A 3B9NA 4QAWA 2BGSA 1OC7A 3RLVA 4N9BA 3UVAA 3RCNA 3P2VA 4B4HA 2J8GA 1NWUA 3WD2A 1GVEA 2DEPA 4LBUA 1UKPA 2PDCA 4HHLA 3NJ3A 1X1NA 1P7TB 5E0FA 2PGRA 5C6MA 1C8VA 3A9IA 1HJQA 3TYCA 3O15A 3VE7A 1X39A 1RVKA 3LLFA 1N82A 4C7FA 4CD6A 3MHUA 1KM5A 3PPHA 4C90A 1JZ3A 4RX0A 2P0IA 3AMKA 5A8OA 4CN1A 4CNOA 2R1NA 3AMDA 1QHZA 3PWIA 3FKRA 1CIUA 1RY0A 4ZSUA 1LLOA 1Z32X 4DBDA 5HJYA 4QJ4B 3GVVA 4YWSA 4L4PA 2VZVA 4A22A 5FCZA 1KBJA 1W9XA 3WX7A 4OV9A 2V3GA 1GHSA 1TRIA 2R14A 4DELA 1UD3A 1TX2A 2G3MA 3TYAA 4HMCA 1XLIA 2QIIA 2TODA 2HSAA 2XTKA 1H51A 2WMKA 3ABOA 2PGFA 5E0KA 3WMSA 4BR1A 2XVLA 2X05A 2YXXA 5AHMA 5HBFA 1MFUA 2GK1B 4DJED 4WVXA 2BODX 2QUVA 4U31A 3W37A 5FF3A 3UPMA 4W93A 4Z1YA 2OTDA 3PUEA 1XD1A 3FJNA 3DHDA 1UD2A 2YCIX 1ZU8A 1E6ZA 2W4XA 4L1GA 3BMWA 3UFYA 3FYOA 3B0PA 3LRKA 4ZODA 3U4FA 1LP6A 3WK1A 1B1YA 4PRRA 3STPA 3BV4A 3W70A 5BXSA 1EJUC 4QJ5B 4XQ6A 1Q4WA 3LS9A 2C3ZA 2V5BA 4RDWA 3BCDA 1ZPTA 4O4WA 4N9DA 4H4IA 4U33A 3TQPA 3H8AA 3SUTA 1ZAIA 5DRIA 3V4BA 4UR7A 1FWCC 1QPKA 3R89A 1W5MA 3G0UA 2J9YA 1QWGA 2W0UA 4GFIA 5EB8A 2OO6A 2EG8A 5DN1A 3E74A 3W87A 1CXIA 1V0MA 1JAKA 3LZ3A 2ZQ0A 4JEJA 2P8BA 1NWSA 3WLSA 3T55A 3FOKA 2X1UA 4GD0A 1HKJA 1LYXA 1SW3A 2J8TA 1N2VA 2CKRA 1EA9C 4DY1A 1TUXA 4MSSA 4MAVA 1UR1A 4BEUA 2PC4A 1XSKA 3IAQA 1NAL1 1FWGC 4MKNA 2WMJA 2O7QA 3PWGA 4I6KA 2CEQA 1IYXA 4IH3A 1XLBA 1KRAC 3TDFA 4NAFA 2WZEA 5DEZA 2YYUA 1EKOA 3TROA 2KAUC 1ZY9A 1RBOB 2TAAA 3USBA 4NI8A 3N18A 4NJKA 2R6OA 3NDYA 3MCOA 4LUJA 3IJLA 3A64A 3A3HA 1OFAA 2YB1A 2ON3A 1PX4A 1G6CA 4MZYA 6XIMA 1OFQA 3OW1A 2PWVA 1O4UA 4FO4A 1DXEA 4YTUA 1XLHA 2WMGA 4B5NA 5T26A 4FXJA 3R8GA 5HWMA 2X8RA 3HQNA 3RR4A 3OA3A 4EACA 3Q58A 2VD8A 1W1YA 4V1XA 1IZJA 4GNKB 3BVJA 1WXYA 1H4PA 1V3MA 1LF1A 1IIGA 3O1NA 4LVGA 3M16A 2PC8A 3W86A 1Z69A 1CBGA 1UBPC 4IPJA 4FAMA 3RRAA 4K38A 3RILA 2WPBA 3HURA 4FF5A 4MJ4A 2ABBA 2OLHA 2VX6A 1JNDA 4LS2A 2XIOA 4QAIA 3HU7A 3RG6A 2XSAA 2CWNA 2P8CA 1FKWA 3TSMA 3FEQA 1QW9A 2GWGA 1NP0A 1TSIA 4FMVA 3EZ4A 3LCIA 4E3VA 2VTFA 4XZNX 4EPBC 2J9ZA 4IZGA 3T2OA 4CD5A 1QPQA 1XL9A 4U2ZA 4XTDA 1S2CA 3ZT6A 2BHZA 4GVHA 3PBMA 3OB8A 5DX7A 4F79A 1T5AA 3V5FA 3WEOA 2FMNA 2GGGA 1EUAA 1EQPA 1NWRA 2HROA 4ZA0A 5FF7A 2FGBA 2ZRYA 4D71A 4XZLX 4JQ4A 4HMDA 1JFHA 3DGRA 3IUHA 4MJZA 3AU6A 4DF0A 3OLIA 4HT3A 4J27A 1IEVA 4GQQA 1VFTA 1QK2A 1TMLA 2C18A 1HVXA 3SN0A 3E1F1 5A6BD 1TPB1 1KBBA 1J79A 4H8UA 2XN1A 4YYCA 4IXHA 3U48A 1QOQA 2I9EA 1LOSA 4RDYA 3UJSA 1WA3A 4H9TA 1W9PA 3H54A 1ZENA 3GYEA 3OPSA 4JTTA 1R9XA 3TLQA 3ERPA 4XISA 3KAOA 4YYFA 5FEZA 2R1PA 1GKRA 1RLDA 1ESWA 3REQB 4Q4OA 2TSYA 1TMQA 3S6TA 1WP6A 1HF6A 1I2QA 2CCRA 3WQ5A 3DC8A 4AWSA 2GDUA 2YKKA 3IJDA 1D9EA 1Y8BA 3EA3A 1GUVA 1K70A 1EC8A 1CT5A 1I6NA 3V0TA 2XISA 3VNKA 2HVMA 3QHNA 5IXEA 1MDRA 2X7WA 4ATWA 3SUWA 1YQ2A 4IFRA 4IQJA 2CLEA 2DZSA 5TQLA 4D2JA 1CXLA 4CU8A 4QG8A 1I2PA 3C2FA 4ZO6A 2AGTA 3BG9A 4DJFD 1J18A 1FH7A 2V69A 3RJXA 2HPMA 1Q6CA 1V6YA 1OF6A 4KQNA 1PWMA 2NWRA 3N6QA 5E6YA 2NWSA 4WRHA 1AUSL 1R5YA 2R9RA 5FKYA 2O92A 4MUPA 2Y7EA 2AQWA 2V2HA 2JGQA 2WNWA 4ZE4A 2J6XA 1VLIA 1R85A 2YCLA 1TJRA 4XD6A 1J0KA 3CMGA 2EPHA 4CCDA 2PP1A 3SCUA 3LHTA 5I3DA 1UQYA 3MVIA 2VWSA 4A3HA 3G5EA 3O3RA 4ADTA 4ALDA 4HA0A 1U33A 1OCNA 2P53A 1MVYA 1DWIM 1H63A 2ZZ1A 4G9PA 3W1UA 3AYVA 4ZOAA 3O6YX 1TG7A 3UF9A 1E5JA 3F7JA 5HNRA 4S3DA 2TPSA 3BLLA 3W1LA 5FF0A 1EO5A 3B04A 1TJ1A 1GONA 5CGQA 3HGJA 4E0CA 1RAKA 3F2BA 5AYIA 3UGVA 3LPOA 2O56A 4DM2A 4AC7C 4C6CA 1THFD 5I3KA 4MG4A 4LB3A 4XZ9A 3SRDA 1UP3A 4KCUA 5BW6A 4GZ7A 3W7GA 4LUTB 4B92A 4A05A 4GO9A 3GG1A 1VCVA 2GGHA 2PP0A 1GQLA 4RXFA 1G0CA 4MF4A 1SGJA 3LENA 1B9ZA 1SO4A 5BCAA 2Z1KA 2GL5A 3SECA 1WB0A 4G2DA 1E1FA 2YCEA 3I4KA 3MV11 4GYJA 1SW7A 3S5OA 1DJIA 1WCGA 2PSNA 4FPSA 3W01A 3BAWA 1EC9A 4LNCA 2Y6ZA 3LX9A 1QI0A 2VEMA 4CNTA 1H7PA 3QKEA 3PHAA 1OCQA 1EWDA 3A6OA 1MFVA 1I4NA 3WN6A 4QTGA 4JBRA 4XZHA 1H41A 4D1IA 3UJRA 3NVTA 1SJDA 2R91A 5DANA 1QT1A 4IIBA 2D2GA 3CHCA 4DF1A 2BGQA 3WNNA 3LB0A 1HT6A 1B4EA 3GKFA 4EKJA 2V2CA 5D33A 4QS6A 3OQEA 1XLFA 4AY1A 4O53A 3HG4A 4L5ZA 1EUNA 4MDPA 1I2OA 4AD2A 5CJ5A 2QKFA 3EWZA 1H5YA 4UB9A 1UH3A 3QPEA 5AZ1A 4EPDC 1JULA 4UZUA 1X1OA 1BAGA 4J1OA 2CC0A 3W7LA 5EMMA 3S2LA 3SM0A 1LOLA 1A5OC 3BQ5A 3W3OA 1E0UA 3ARYA 1GVOA 2WVVA 3C2YA 3EOOA 4E2DA 4ERAA 2G5WA 1F61A 3UNDA 5DRCA 1NEYA 5CPQA 1GVFA 4DF2A 3W53A 3L2MA 1FWBC 3BLEA 3PSWA 2VFFA 2HTMA 4F0RA 1X7FA 4AZHA 3AISA 3AYRA 3WLJA 3CO8A 2PLCA 5HAOA 2FB2A 4M24A 5FEWA 3S2NA 4W84A 1XJBA 3JZUA 3QGKC 3G1YA 4M80A 1HL8A 4GIEA 3WDQA 4GVGA 2G8ZA 1FHVA 1DJZA 1XSJA 4EF8A 1UMYA 4JIRA 4CQ9A 3KRSA 3N9RA 3WH9A 2ISSA 2PF0A 3MMTA 1P43A 3T8LA 3OZOA 5DF0A 5AC4A 3RPTA 3DX5A 4MVAA 2FHCA 3LNPA 4O18A 2D73A 5E70A 4TV5A 4B4FA 5GNYA 1TWDA 1DV7A 3M5VA 3GG0A 3PTMA 3S9YA 5DBTA 3CC1A 4Q22A 1F4AA 3C2VA 3NFUA 3SEPA 2ZUNA 1ONXA 3NSXA 2Z2UA 3W7RA 3CQIA 3A12A 3BAYA 3NYZA 4JTRA 3TXZA 3VGBA 3N9SA 4TR9A 1R3QA 3KBMA 1ZCCA 1W5OA 1SU5A 4E2VA 2Z24A 2PTWA 3FVMA 1A5LC 4AXNA 3GH4A 2WXDM 1YPXA 2B4GA 3S2CA 4DQWA 1NWTA 5CC3A 1F3XA 4JTLA 1VPYA 3LPFA 5CGMA 3OVRA 1XYFA 3AIQA 3W00A 4IQLA 2A5HA 4ZBCA 1XYCA 2Y7FA 4D6GA 5DT5A 4AZIA 1ZP4A 4LV4A 3PAJA 4FNQA 3FY1A 4N9CA 3OQ8A 5M17A 2PEVA 1L9WA 2JGYA 5C5YA 3UXIA 5CC7A 4FA3A 3EB4A 3E0IA 3ME3A 3UEQA 3EB2A 4JQ3A 2Y63A 1CXHA 1G4EA 6REQA 1NDWA 1LL6A 2VQTA 3NXFA 4NAEB 4IPPA 3R79A 3WQWA 1RV8A 3I65A 2Z1BA 1GTEA 3TSDA 5CZSA 3MKKA 1Q3NA 4IMDA 3M0IA 2EF9A 1D7FA 3IANA 1W1ZA 2PCEA 2R1KA 4HGXA 4B3ZA 3NGJA 4W8LA 3BZJA 1ONWA 2FZ8A 3H2FA 2CBJA 1VKFA 4TV6A 4A35A 1F6YA 3G0SA 3URAA 1E55A 1EJSC 1XR2A 3FXGA 1YKWA 1P0EA 1DHKA 1MRQA 1XYZA 2DZTA 3P14A 2PU1A 5EA9A 2CPUA 1OCBA 3TZFA 3VX1A 1ITQA 1N8FA 3GXFA 3PFRA 1C29A 2PTDA 3TR2A 4TO8A 3K8LA 1EDGA 4JTEA 1A49A 1NOUA 1E72M 2FDMA 1JL8A 3EAUA 5CAHA 5TAOA 4YXGA 2Z1WA 3TMQA 3VZYA 3R0KA 1KB3A 3IAPA 2TYSA 4W8AA 4H2CA 1NM9A 1V93A 3ARVA 4MAZA 4RW3A 3ZJKA 3R25A 3PB2A 1NQ6A 3A3XA 3RF9A 4GVFA 1QOXA 2DZXA 4GI4A 3S8HA 4BWLC 1VPQA 3QV8A 3S1GA 4OE7A 3BGJA 2XGZA 3IUDA 4Z42C 3O7UA 1Y5WA 4MY1A 2PD5A 5DMMA 4JL2A 3QC0A 3G1SA 3SN1A 4WXZA 2J7HA 3U0HA 2HDJA 2HVNA 4JN8A 3BWWA 4GYPA 3VUPA 4DHGA 3KLLA 1YXCA 3NZPA 3PZTA 3R5EA 3LLDA 2V9DA 4HSHA 1KBLA 5H6HA 3VINA 5A8NA 5HULA 3WK0A 5LHEA 1IXNA 4V27A 5D32A 4L1WA 1H7WA 3RXZA 1F6PA 3LHZA 3PBUA 1YPIA 4OOUA 5AHLA 3E2RA 1TR1A 1S5NA 3RLGA 2PURA 4IMGA 2E8YA 3TTSA 4JTAA 3HGSA 4N02A 4MY8A 1IHIA 3KBSA 5A6TC 3WLTA 2QDGA 4Y96A 1US2A 4W9TA 3QHMA 1PDZA 2VCAA 2Y5SA 3S9ZA 1JPMA 2OZ0A 4W87A 4ZGYA 1H2JA 3BPWA 1EHNA 5DCDA 3QZAA 4MNMA 3V18A 2D3NA 1POJA 2BOFX 5I3IA 3KOZA 1ICQA 2EEXA 1W5PA 3OHIA 1W3TA 1AH3A 2Y8KA 4F0MA 3ZT5A 4Z1AA 1JDEA 1QI3A 4RNIA 3N73A 4H1ZA 2YCKX 2WZIA 3WSUA 3CQHA 3H53A 1DQWA 4ORIA 4HYWA 4AD5A 1B5TA 4HNUA 6PTDA 4A4AA 3NVDA 1JGIA 2ASHA 1A50A 2QPXA 4JTIA 5CSSA 4K39A 3M0MA 1AD1A 5F2MA 3EKLA 1V02A 3BJSA 3C61A 3SUUA 1EJWC 2C6QA 4JDYA 1DWAM 4JNYA 2DZAA 3LMYA 2G3NA 3SSJA 4S1FA 5IDZA 3A5VA 1J0JA 2NQ9A 3UYIA 1W1B1 1PX8A 3WUGA 1V3JA 1DYSA 3IJ8A 1NF0A 4NXSA 1MO0A 3B4YA 1QK0A 3EMCA 1S1PA 4GABA 3EDDA 1B4KA 4ERGA 4HJWA 1S5WA 4ZR8A 3VM5A 3WL1A 2YA1A 4LNYA 3VNDA 2VFIA 3EOUA 1BVWA 4B9YA 1OX4B 3WNOA 9RUBA 2BWGA 3DU0A 3PUDA 4DLFA 1OWQA 3BLDA 3K46A 3E02A 3Q4DA 2PDIA 1R38A 4FNRA 3UT0A 1OGBA 4M19A 1Q6QA 4NZ4A 3FCPA 1TPH1 5F1VA 4TUFA 1MXDA 3VKJA 3SCTA 4C1NA 4IMCA 5MKGB 1D3HA 1EHAA 5ABHA 4N6EA 3RRXA 2AQOA 1E71M 4PRWA 5GNZA 1BF2A 1VBHA 1AH4A 5I5RA 1HG3A 4HZMA 3T9PA 5B7ZA 5HMSA 4B16A 4A8IA 1FFQA 3SY1A 3PNZA 4GYKA 2G3JA 3GIYA 2VFEA 5EFDA 4GVIA 2O4QA 3W1NA 1JXJA 2G3IA 4BK9A 5EFFA 2Q8ZA 1PAMA 4PMYA 5LA2A 3DXIA 3HA1A 2W6RA 5CLWA 1X97A 2PDWA 3WQ4A 2YSWA 3OVGA 3FAWA 1ZL1A 1CLVA 1JDFA 3IK2A 3ZYZA 2FJUB 4AHQA 5LSMA 4Q4KA 4Q6XA 2VC7A 1XYLA 2Z27A 4D6JA 2VUNA 4PUUA 3OIXA 4QEEA 2D69A 2V3FA 1QI4A 3V5CA 2DP3A 4R88A 1TPEA 2IQ0A 5EL1A 5I3FA 1IZCA 3ZVIA 3H7UA 1EXBA 1OBAA 1TZ9A 3MKCA 3QR3A 5LIUX 5BOOA 1UZ1A 3BURA 3ZSTA 3KBNA 5CPTA 3C56A 4M6QA 5DQPA 4YCOA 1WNOA 3HPAA 1EZWA 3VFCA 2Q3OA 3HZ3A 5BRQA 4U4MA 2WO5A 4IPLA 1Q65A 3HO8A 1YLVA 1ICSA 4JTHA 3XINA 2ZVRA 4GQ0A 3PZMA 5XIMA 2BBFA 1PKNA 4EP8C 5EPDA 1XC4A 4J9JA 3WMCA 4WJ8A 3OLDA 1PBGA 3TJIA 1Q8AA 4N6FA 4Y7EA 3FSTA 1OINA 4K1WA 5F2GA 3WG6A 2HNHA 1GZ1A 1W1A1 1ODUA 3ORWA 4PC8A 1TPVA 4IOTA 4YS1A 3BGAA 2A4AA 3BJFA 5HINA 4AWEA 4QS5A 1PJ9A 4TMBA 4ADSA 2ZZ4A 3MU7A 4MHBA 5D9PA 4QNWA 3NURA 3GFYA 4E8DA 1QWKA 4WXYA 4L4MA 4YHGA 3J7HA 3RX3A 2A6NA 3QFEA 3QPZA 5GNXA 4FZIA 3RX4A 7ENLA 4BFAA 4RR4A 3QY7A 4Q7BA 2WMFA 5EMJA 5HATA 3T08A 2AOSA 4NYUA 1EF3A 5CJMA 4GC3A 3C52A 1P7TA 3S47A 4TVUA 4IGNA 2AL1A 1JZ2A 3TYDA 1UW9A 3UA4A 3CV7A 1EP3A 1GOOA 2NUXA 4W89A 3L67A 5JU6A 1J4EA 3NQVA 3ITCA 2PDLA 5LNVA 2WM0A 3QY8A 1POKA 2CHRA 3IJ9A 4B5VA 2WYSA 3SCNA 2P3EA 3AIVA 5J8LA 1O60A 4JYFA 1CB2A 3NPWA 2D2JA 3HPSA 2E28A 4M6VA 4H04A 5C9XA 2XIBA 4JY9A 4S3CA 3GNXA 1GQNA 5DBUA 2ZDRA 4PSPA 1Q6RA 2GK1A 3LM3A 3AYTA 1JCMP 3L5AA 4JFVA 4X63A 2C19A 4XO7A 3KL5A 1WO2A 5KZDA 3M5ZA 1JYVA 1S46A 2WZHA 4OT7A 3VIKA 5FOOA 1LCOA 1MQPA 1PTAA 2D0GA 4QCEA 3I3BA 1I75A 3B3DA 5K4ZA 3EWCA 3EX4A 2ATMA 3W2KA 2V5DA 3QQ0A 2C0AA 2VOMA 2ODOA 2ACSA 1H09A 3VNZA 2QF8A 3M0LA 1SZRA 2OYKA 2INEA 2QQ6A 3VK5A 4E3TA 3L68A 2JK2A 3SQLA 3ICJA 4H3DA 3VOJA 3W7MA 4PE8A 1WQ5A 3UZWA 1SO3A 4DWSD 5CZKA 2NV2A 4O8RA 1DXIA 1VPXA 4F0HA 4HNVA 3B4UA 1FVPA 2YXGA 1A5BA 5H8UA 4JTUA 4C6QA 1ITXA 4JFTA 1SUXA 2ACQA 1RJRA 4LYQA 3TCSA 2I5QA 4WIWA 2EBNA 4MKSA 2EKGA 4DUXA 1ZAHA 1AJ2A 4M1RA 2XU2A 4K2SA 3VO0A 3E0FA 1LLZA 3RM8A 3MQTA 4MLRA 1XCXA 4X3ZA 3TTOA 1GQIA 1TTJA 5C7HA 2E9BA 2V5KA 3CH0A 3QLDA 1EJXC 1VYPX 3GE7A 2I1OA 3ZLFA 3NQDA 4U28A 3OVPA 1XG4A 3GLCA 3VILA 3GHTA 3RHGA 2CHOA 3WBEA 3QH2A 1UASA 4ZB5A 2Q8LA 1V77A 2W91A 2DZPA 4AU0A 1QHPA 1VIZA 3OO2A 3OP2A 1TE1A 3RU6A 1BG9A 2DDXA 3OLEA 3ZJ6A 1T7LA 4F8XA 1NP2A 2CU0A 1UZHA 3N6HA 4K7YA 4YPJA 2F6KA 2Q01A 1AQ0A 3SIMA 4KWOA 2VZTA 3N19B 1W54A 3CYVA 3GTXA 1E0WA 4WOQA 3AI0A 1E6PA 4WOZA 4XZIA 1XIHA 1FY6A 2QCCA 4URIA 3JUGA 1O5KA 3R7MA 2BXYA 4PUEA 3KOXA 2ZVIA 2REQB 3NTYA 3A47A 2WQDA 4IPIA 5GVJA 3O16A 2QCGA 3LCHA 1EBHA 2RHGA 3FNDA 4I9JA 2PUZA 5FJJA 4EX4A 1MUWA 1OM0A 4RE4A 4PUDA 3R0UA 1AODA 3GXIA 4LGXA 2CFFA 4XZMX 3BGGA 2GSEA 1QNRA 1RQBA 4KPLA 3O0FA 2ZUSA 1EF2A 2VMFA 1EH9A 5DMNA 1CGWA 3UJEA 5C7VA 2X2YA 4LY4A 3ABZA 1JD7A 3NPUA 5E9AA 3FK4A 2AMGA 3MVTA 1Q7QA 2OB3A 3AFBA 2BXZA 3CEUA 3CTLA 5H2ZA 4LCSA 4B2DD 2FMOA 2OG9A 4NRSA 1W3IA 1S2VA 1YTKA 3G1RA 3IIPA 4QFUA 4Q8VA 4LEFA 1F74A 4PMOA 5I79A 3GHUA 4L6DA 3LSCA 3LYEA 1ADSA 3B05A 1JCLA 3FA4A 3GC4A 2YFNA 4HKPA 4O1AA 5I7GA 2XSBA 4ZOBA 4L1XA 1KFCA 2O9RA 2DW6A 4IIDA 4V2XA 1R8LA 3SB0A 4EXQA 4IUGA 3IGSA 5CQ1A 3RN6A 3TW9A 1NY1A 2ZTKA 5JBFA 3R11A 1E6SM 2UY4A 1WOBA 5K9CA 4LUSA 4E4FA 5M2FX 3PPCA 2VT0A 3GFXA 3VU2A 3WDRA 3EWXA 4XUGA 2AAMA 2W92A 4A8NA 1F3TA 1RSCA 4LAKA 2DVTA 4AY8A 4CD8A 4MB3A 2ZZ6A 2DT1A 2WMIA 3DI0A 1JQVA 4HCLA 4XWUA 5TNVA 4GI6A 1TQXA 3UNTA 3BAJA 2P88A 1TPC1 1JDCA 4Q8OA 1O66A 4O0ZA 4YTTA 4IIFA 2FIQA 3LTYA 1NTHA 1IR1A 1YTEA 3TN5A 4H83A 1QFEA 3EDEA 5AFDA 4CCEA 1QI2A 1Y5VA 2PWEA 1K9EA 3HG5A 1UH2A 2ACUA 3G1XA 1IF2A 1Z7AA 3REQA 4NZFA 5A6SA 4GIYA 2PS2A 3FIGA 1XFCA 1MEIA 2BB0A 1TV4A 2RKXA 1PCKA 3P5ZA 1C7TA 3PBVA 4UR8A 2DORA 4YL2A 2BY3A 1J0YA 4X2PA 1L6GA 9XIMA 2W79A 5D03A 1FCUA 3HQ1A 3GTFA 1VAHA 4R9OA 4C7GA 1UWRA 2YCJA 3CZLA 1TA3B 2OQYA 4ZB2A 1TB3A 3APYA 1ZHAA 3KOFA 3P0XA 2A7PA 2ZZ3A 3G18A 3DYPA 3PZGA 4NT0A 5DCEA 3AXXA 1V3IA 2XM2A 4UFJA 3LRMA 4JZ5A 4EF9A 1E9IA 3GBEA 2BY2A 4FX8A 3TN3A 2GGJA 4S23A 3MMWA 5JXQA 3FDKA 4EAYA 2PLKA 4OFCA 4AZ7A 3ES8A 1VFOA 4DX3A 1UYQA 3EKZA 4FLSA 3G8RA 1HTIA 4WR3A 2OVLA 1IQ8A 4ZO9A 4J3WA 2O55A 2PRLA 1A5MC 5ABGA 2BXVA 3VOGA 3ZT7A 4S39A 4UCGA 4H6RA 2UBPC 5AC7A 4W7WA 3CEPA 4J3UA 3DIPA 4LAOA 3FYYA 2VRJA 5FI8A 1V51A 3C0JA 5JVLA 3LGDA 4H8NA 4QDWA 1P1XA 3E0WA 1SFSA 4AXKA 3H22A 3W25A 3YPIA 3W7OA 5FJRA 3AICA 3BCFA 2OEJA 5SWUA 2GJNA 4N4QA 3WL0A 1LORA 1E5NA 1MMFA 1N55A 1J2WA 1FOBA 2NVAA 3HPXA 4UUIA 3UJ2A 1V3LA 4LUYA 3TMLA 1FHLA 1KLYA 3SFWA 1BPLB 3KUMA 1RCXB 5DMLA 1VS1A 3PZQA 3I6RA 3AROA 3UXAA 1VBRA 5ABFA 3S9IA 2XG9A 4Q7NA 4W4QA 4XAPA 4J3VA 1JFXA 5F4XA 4F4RA 3RM9A 4NG3A 4F48A 4Q8NA 2J27A 1C92A 4O0QA 3V36A 3TAKA 2C1IA 3BG3A 2NSXA 4MPKA 2E8ZA 3S6DA 4OWGA 2GVJA 5D30A 1CXKA 4WSJA 2CZVA 1Z89A 3H24A 2OYLA 2DJLA 3RIKA 5K3VA 3HM7A 4U5KA 2CLOA 1Z44A 2HZGA 3MCMA 3P80A 3UBPC 2OWCA 2W5FA 3L4VA 1F6KA 4ZTYA 4P7NA 5F4SA 4KT2A 1HGWA 1M7JA 3TYBA 4UTTA 4QCFA 3PS7A 3U2OA 1LRNA 3T1GA 3OG2A 1LBFA 4ERIA 3ATZA 3AXMA 2FVLA 1J0ZA 3M6DA 1D3GA 1Y5XA 6TIMA 1RZMA 3R4IA 3NCOA 3U57A 4UWMA 1KLZA 3AIUA 3SIZA 3FS2A 4B90A 4Q3MA 3MYPA 1K03A 3NDOA 4NXKA 2YXOA 3MANA 3ZWSA 1TE6A 5I77A 3MI6A 3WFLA 1ITUA 4X2RA 4PYSA 3VOHA 1W1TA 4F66A 3KZPA 3FKKA 3H7VA 2YOCA 3W2JA 1F4HA 1EYEA 3N34A 2VYOA 3WQ6A 4M56A 2F9RA 3VKCA 7XIMA 3VA8A 1HO1A 5HXMA 4I9AA 1E56A 5K9DA 1GCYA 3GXTA 3NWRA 2GOKA 3B9OA 3FHAA 2IMRA 4CQCA 3P60A 3SW6A 2FGZA 5AC6A 3LSBA 2NQ5A 3M47A 5HQMA 4US5D 2Z29A 3H55A 4GYPC 3B0XA 4ACYA 4DWDA 2RH9A 5CC5A 2BX7A 4MM1A 2FDSA 3MUY1 3U2ZA 1EC7A 3O6AA 2HK1A 1E51A 2ATSA 2ZRXA 2VRKA 4OVXA 3GM8A 4W8BA 1IGSA 4Q4PA 3WYZA 1G9HA 2OOGA 2QV5A 3GHRA 1K7FA 1DTUA 1LQ2A 3XISA 3RR1A 4EIVA 4CNSA 3VC6A 4HK7A 2WV8A 1MUMA 3W1MA 2PZNA 1CECA 5LHFA 4C7DA 3IWPA 3NGFA 4Q8TA 5E1QA 4XZBA 3WQOA 3RAOA 2QCMA 1DVJA 2BS9A 2HS6A 3L66A 1H7OA 3JRKA 5AVNA 3TOYA 1TVPA 2PDQA 2VDHA 2EG6A 3N4EA 3UVIA 4LJ3A 3L2LA 3VOFA 3CM4A 2GQ9A 2FZBA 1D3CA 2D0HA 2ZWZA 3DFPA 3UQNA 4A8LA 4GNJA 5KETA 3TWBA 5I23A 3M0YA 2QJGA 3M0VA 1ISYA 1DJHA 3VUSA 2FVMA 1JGMA 1MW2A 1X96A 3IIOA 3EMQA 1ZBVA 5C71A 4GQRA 1LWHA 5BU9A 3GKAA 1MEHA 3CT7A 1R9YA 5D2WA 2E5CA 2WWCA 3RLHA 3DI1A 9CGTA 5I24A 3DOPA 1DWHM 4KERA 1Q7ZA 2GJPA 1WKEA 1O5QA 1OIFA 4TOQA 4EXBA 2PU0A 4C5YA 4E38A 1ZCOA 4ZEPA 1TX0A 3IRSA 2OLSA 1UR9A 2GJRA 4JD4A 4JS3A 4BQ5A 4B91A 4GG9A 2HCVA 2CBUA 1G67A 3T4WA 1RXOB 3IARA 1NIUA 4B5XA 3MBFA 1BQCA 2PGWA 3PAOA 1P6WA 1ECEA 1KM2A 3ALGA 4UQEA 1UPMB 2VM8A 1Q7MA 2WCAA 1GYMA 1OZMA 6A3HA 2C1HA 5A1AA 1VEMA 1SW0A 2B7NA 4NAEA 4HNNA 1R6WA 3KTXA 4S3JA 1QATA 4Q4MA 1YNPA 4Y9NA 2F61A 1I0BA 2VHLA 4RZ6A 3W71A 5JBDA 3CL6A 3QSTA 5JQ9A 3EXSA 4UTIA 3STCA 4C91A 3CPUA 2QJIA 3VNLA 3P3BA 2IKGA 4GWEA 2X2GA 4M82A 3T6CA 4DZHA 1AL7A 2QULA 4UMBA 4F0SA 2P0OA 1UQZA 1IXQA 4LYPA 3O2LA 1OFBA 3GVQA 3ANYA 3BOXA 3RPMA 3N13A 3GXPA 3LRLA 3SCVA 4A3QA 4NI3A 2A85A 2CZ5A 1VH7A 1L0PA 4IX0A 1RK5A 2Y89A 1FWTA 1T0OA 3FVDA 5I03A 1UWSA 3TN4A 3BLOA 3NZRA 2GVEA 2VEKA 2GUUA 3SQSA 2CZDA 3GH5A 2EAWA 4EANA 3WH6A 3MI3A 2WZTA 3LI0A 1BKSA 1KM6A 1X8CA 1IT0A 3ZWTA 1GVRA 4GYFA 3WLRA 1ISWA 4XBKA 5JH2A 1UR4A 3JS3A 2ZUUA 3SR7A 4YVXA 4NNBA 3I68A 4DJEA 2WLZA 4GUHA 4IGMA 4Z08A 1W5NA 2OQLA 4NQ1A 1JYWA 4O10A 2VVSA 1XS2A 1DXFA 1XXXA 3A21A 4FSAA 3WQVA 3SRFA 4GCAA 4JDBA 3WJZA 1CNVA 3MUAA 1TRDA 2YL6A 1US0A 5BMXA 1J5SA 5A2CA 4G8TA 2Z7GA 2OT1A 3EX3A 1Q6FA 2WBKA 3PBYA 2ZXBA 4FNTA 4D6IA 3MJYA 1RVGA 3UWEA 4XKYB 1J12A 3WUEA 1KCLA 5D4YA 4DN1A 2WSYA 4M8UA 1J0IA 3IV8A 2HXTA 2DJXA 3E2SA 1UWTA 5F7UA 4XAZA 5JH1A 2XYLA 1ZLPA 1JPIA 4S3GA 4C6BA 3EX1A 5T91A 1M04A 3W1PA 3ZSSA 4JIIX 5XIAA 4LVBA 3ISIX 1DHPA 3Q45A 3HV9A 1JUBA 3APTA 7TAAA 1K8XA 4DWSB 3CU2A 4Q8WA 3MHFA 1O5XA 1HVQA 2B7OA 3MS8A 1PO9A 2E9MA 4IP5A 1CENA 2J66A 4F0LA 4GY0A 1U5VA 1K3UA 3RO6A 3QQWA 4V33A 4W85A 1EIBA 4L6HA 2X7VA 4IG2B 5H8MA 2QVNA 3HJEA 2CXEA 5C0QA 3PTDA 4E8GA 5CSRA 2XH4A 1XLAA 3VNMA 4JFSA 1R7OA 2OSXA 2E9LA 2P5NA 2WC4A 1K6AA 3GTNA 4B9ZA 4CU6A 3W9ZA 4WSHA 2I5GA 4HU0A 3W24A 5CH9A 3CIXA 1IV8A 3H12A 3SZ8A 4B5WA 4I7WA 2I16A 1OEPA 4JTFA 1Q66A 2OR2A 5AY7A 3VDBA 3Q94A 1FKXA 3D6NA 2R8WA 3QQ1A 5CSUA 3THAA 4JTDA 1GQKA 4UTLA 4L4OA 2ZC1A 4QROA 1FWHC 2WMHA 1VHNA 1RH9A 4I90A 4YWIA 3ZMRA 4HOZA 3TLLA 1ZRQA 3UD6A 1R2TA 4O50A 4XAGA 1VB9A 4NY2A 3I7RA 4BA0A 2X1IA 4XX6A 5AOUA 1S3TC 1BGAA 3T40A 1TWIA 1OX5A 3AHVA 1ZGDA 2QJMA 3TN6A 1VFLA 1EXPA 3CLMA 1LQ0A 1Y65A 1OX4A 1V08A 3BAKA 2FZMA 1NFGA 3LY0A 4JTJA 2J6VA 4NILA 4TX6A 1T8QA 4O1CA 3SBFA 4LRSA 3BC9A 4JIHA 3SCWA 1M01A 3CK5A 1F76A 5MKGA 3LM7A 5I6SA 2VURA 1A0CA 3W29A 4CQBA 2GDQA 2NV1A 4RLIA 2V8ZA 2ZCGA 2J47A 4YVPA 1W1PA 1XYAA 3MV01 1QBBA 3APGA 1XM3A 1K8ZA 2C79A 2FTYA 1A47A 1CLXA 4X9YA 4DBWA 2WPGA 3GNOA 4FLQA 4KEVA 3M0KA 4Q4QA 2PRHA 3NA8A 3G2GA 4IM4A 2G97A 1B3VA 4DXVA 1BG4A 4IFOA 4LB4A 1YX1A 2ZYFA 1DE5A 2CITA 4HU3A 1BYDA 1X98A 1OYBA 4P7QA 3W7KA 3TJ4A 1AMKA 2DZWA 1XW8A 3M7SA 5CPSA 1L6YA 3DKLA 1YMYA 3W82A 4MGGA 3WD0A 1KD0A 2A3EA 3GVGA 3U7BA 1TFVA 1M7PA 1H7XA 3UXLA 1JRBA 3W1RA 3ITXA 3MUZ1 1BVZA 2NQZA 2XZ9A 3M0XA 1G01A 2D23A 3MCNA 4NIRA 4Y9OA 3G77A 4I7UA 3AJ7A 3E5BA 1LBLA 2ZE0A 3CIVA 4WKHA 1RUSA 1TV3A 5A6BA 2XJ7A 3N25A 3OLGA 3N12A 3S5NA 3SCQA 4CEXC 1MW3A 3L4ZA 5C2CA 2CIPA 4Y6GA 3JU2A 5K7JA 1GZGA 5CGTA 4PEKA 4UOZA 2ESCA 1YXDA 1H49A 1FWDC 1HIZA 1TIMA 3EPMA 4I6VA 3WQCA 1TYGA 2RFGA 2WNNA 2VI0A 4UTWA 4CEUC 3SJNA 1W1VA 4QRNA 2GOUA 3NL6A 1REQA 4MKVA 1P0KA 1VCGA 4HHMA 5KINA 5CEWA 3STEA 3LI1A 3P6LA 3PUOA 4EWJA 1EJTC 3FA5A 2C16A 2NUWA 3VD9A 3EOEA 4IICA 3BXWA 3G0XA 1MQQA 4JKKA 3GXMA 3UPBA 4PCSA 5B7YA 1FTXA 2XH0A 4UCFA 5BMWA 2WNQA 3UERA 2YL8A 2OT0A 3JZEA 3EDFA 4ONVA 4OJYA 1KV8A 4LF2A 3I3DA 4ZENA 1C9WA 3L0KA 4IPNB 3GNPA 4DJFA 5IRPA 2VC5A 4XG1A 1ECQA 2D1ZA 5CZTA 1LOQA 3WDHA 5FD0A 1AZ1A 1RJQA 2TMDA 2RGLA 1E4LA 4Z2HA 4TXEA 3BSGA 3C2OA 1A80A 3WH5A 3T0AA 4DXXA 3BW2A 1LZOA 5DMYA 1E6RA 2VX7A 3LCLA 1OHLA 1V0NA 2PGEA 3CWNA 3NDZA 2DH3A 4RE2A 4UFKA 4JFUA 2G96A 3GTIA 5LA1A 1UR3M 5HQLA 3AHXA 3B8IA 4KH2A 3W4RA 2YBVA 4F9JA 1BD0A 1AL8A 2QUTA 3AXHA 5G2HA 3QV7A 3BQ6A 1A3XA 3EDKA 1U30A 1TPWA 3S3GA 1R3TA 3B8DA 1UKTA 2YW4A 4RCXA 4DVOA 1GPFA 4PMZA 2HEJA 3R6IA 1WZLA 5IOBA 1D7KA 1HW6A 3IPWA 3ATYA 1JYXA 2A7NA 2DSVA 1XIFA 3MP5A 3IIZA 4C6NA 4GXWA 1XIJA 2BMBA 3STFA 1PX3A 4RL3A 1TV2A 6XIAA 4WGHA 2WWDA 1JYNA 2XGBA 4ZQOA 1A0EA 3WH7A 4FIQA 3TUUA 5IM51 4GH3A 3ZLGA 2V67A 2CLPA 4X60A 2YA2A 1XIBA 1BTMA 4LALA 2QT3A 2AKZA 4G7EA 2A79A 4JIQA 3GDBA 4AC1X 3AIWA 1O94A 1K02A 4GUFA 1J9YA 1GPWA 5TF0A 1UA3A 3N2XA 3PG9A 3WIJA 2QZRA 4F2TA 2J75A 4JFWA 1XC6A 1CGXA 3NYDA 2DZUA 1KTCA 4RUBA 3QGVA 4HZ6A 5GPRA 4HCHA 1G69A 4DUOA 3W88A 3CO4A 1I1WA 1U1UA 3HG2A 1JDDA 4IISA 4DYJA 3QMSA 3TFXA 1VF8A 2D2OA 1BRLB 3T09A 3WJWA 4UQAA 3ITYA 4Q8QA 3S42A 5LIWX 5CBJA 3BG5A 2OX4A 2PLMA 3TE9A 4XD4A 1S5TA 3SY8A 1LLWA 4H6KA 5C2XA 4TVCA 4W88A 4H9XA 1J96A 5BXRA 3TIMA 1F07A 1XX1A 2V5JA 3LBOA 4GUJA 2OJPA 1VQTA 4NJGA 4DYKA 4RW5A 4FOUA 3D3AA 1PWLA 1JZ6A 2WHLA 1PCWA 3BARA 1WZAA 5FJOA 1V6UA 3GVWA 3DC0A 4HB7A 2JKAA 4OQVA 1A5UA 5EBUA 1TTQA 3OBEA 2QDEA 1W2VA 2HJPA 1O1ZA 1Q8JA 1EGZA 3DERA 5DXYA 4ES4A 3KOYA 2ISVA 3KVLA 2Z2AA 1F8IA 1KFBA 4L56A 3A9BA 3P84A 1A4LA 3T2QA 1VP5A 1MDLA 3NO3A 4H7ZA 1IXPA 1I45A 5I3HA 2XIMA 3ZJ7A 3WCZA 1OFRA 4PTNA 3KL3A 4HMEA 2RJHA 3W7PA 2IQTA 4JYDA 2P76A 3VD4A 1JUEA 2D22A 2CLIA 4Q33A 4AAJA 1QAPA 3V35A 1GOKA 3S5SA 4QM1A 3LEPA 1E4NA 3GXNA 2PE4A 3TNBA 5LGZA 2RDWA 1V03A 1QCWA 2MANA 1OVDA 1I60A 1QOPA 3W7JA 5A6LA 1AZ2A 1E4IA 1SO5A 4UTJA 5CSYA 2VX4A 4J35A 4LVDA 2VCCA 3WELA 4LANA 5KTLA 5LZLA 1BXCA 1ML1A 4ATLA 2Z1XA 3W7QA 1KXHA 3F03K 3OJGA 3GX9A 3QR0A 1ONRA 1FFRA 3PJUA 4HYRA 2DGAA 1ZS2A 1QO5A 3E9AA 4PUMA 3CZ8A 4CGTA 3HQOA 4FP1A 3VX0A 1OQFA 3CBWA 4Z1CA 4WZHA 3U2CA 1KFLA 4ZOEA 2XVGA 1P0NA 5G4HC 3VM7A 3CMFA 1DTNA 1X1ZA 4ICCX 4IP7A 1JI1A 2ANUA 1V7YA 3UA3A 3F2CA 4EXAA 2VCBA 1W2PA 2FYMA 3C0SA 1V6TA 3SO7A 3VAVA 1YDOA 4E2OA 4GXMA 1PZ2A 2IXVA 2VRQA 1JPKA 1DORA 3UWWA 5EGRA 1EYWA 1A3HA 1UR8A 4GKTA 3QKZA 5E5CA 3F4VA 1XH2A 4GK8A 3EEGA 5BOEA 4UC5A 3VGHA 1NVMA 3THUA 5TD4A 5AYZA 3MP3A 4MUZA 4XBJA 4WHBA 1UC4A 4JR5A 3KOWA 3CL7A 3NQAA 5K9XA 4M7TA 2I56A 3UZYA 3SCRA 4NZJA 3KE0A 3W1AA 4D6HA 3TC7A 3MWAA 1JR1A 4N7QA 2OZ3A 3S6OA 2EGZA 1PZ1A 2Z2BA 4QHRA 4DUVA 1DEDA 1ZSXA 3OYZA 4M6UA 3CT2A 2VEGA 1BLIA 1OZQA 1KCZA 3ENLA 4PB4A 5T9CE 3NSMA 1Z41A 3VPLA 1HN1A 3ALFA 5JIPA 2IPWA 4KFNA 1LG2A 1BWKA 2DIJA 2XIIA 1TA3A 3K8KA 4DBSA 3DG7A 3CIWA 1OX6A 3W2UA 4LCQA 3S1WA 3B97A 1VFHA 4WDXA 1ELSA 4HU4A 4I8DA 3SJ3A 3ID7A 1OABA 1H3GA 4GGBA 4O19A 2ZE3A 1PIFA 1S5MA 1QPNA 3DENA 3PPFA 1K4HA 1KNWA 2J7FA 4U2YA 3THCA 1PDYA 2ZUWA 3PJTA 1H11A 3UR5A 1UHVA 3M0HA 7TIMA 1T8XA 4AF0A 4YNGA 4QG9A 4ZMGA 3EX6A 2ISWA 3HBLA 3OZYA 4CN4A 5DELA 4M51A 4HOWA 3ARSA 3KDOA 3VDGA 3R8HA 3EPOA 4BJHA 5K2ZA 1WUFA 7CGTA 5AVHA 2G41A 1ALDA 3N17A 1EEXA 2P1FA 3KCLA 5C8BB 4HVXA 3CAQA 2Y88A 2X1RA 3FAXA 3O8AA 4IHCA 5JIWA 3WZ0E 2OODA 5HNNA 2VEPA 4LS1A 3L7RA 4Z1BA 3AYSA 5L6UA 5I09A 5U7SA 1B2YA 5FESA 4R27A 2ZFAA 3WUFA 4HTYA 3V0SA 3WDIA 3PC0A 1I0DA 1NU5A 3G1FA 4NHVA 3WQGA 4K8GA 4FXFA 4O14A 1TO3A 2Z25A 1K7XA 3TA6A 4PCTA 1XFBA 4QEHA 1EGMA 3HMJG 4NASA 3QMTA 1XD0A 2WJEA 1RA5A 2I14A 3BOFA 3EXTA 3E38A 4OUEA 4PBGA 1JPDX 3WF1A 2WSPA 4N9EA 4JNMA 2JE8A 3H6OA 3W1TA 2YLAA 2WB5A 2VKZG 2Y8UA 1J2BA 3JVAA 1SZNA 5HWNA 4R3UA 5CPLA 3BK0A 2FFIA 3H2MA 2PCQA 3P74A 4QG6A 1P48A 2RDTA 2CKSA 3M1ZA 4LU0A 2VR4A 1V6XA 4GISA 3CAKA 4QISA 4S2BA 1DJWA 4Z2JA 1J8VA 4F2BA 1QNOA 3LPPA 2CZFA 3B9EA 4JL1A 4DJDD 4OV4A 4XAFA 1NFBA 2XWEA 3CQKA 2DY3A 2GGIA 4L80A 4IMAA 3BAXA 4HZ7A 3LMZA 1XBXA 5EMYA 1H0IA 4PH6A 1UA7A 2VC9A 1BVNP 5CXPA 3H4GA 2BHUA 3DN5A 1E1CB 3QV9A 1GT8A 4JGDA 2FFCA 1XLJA 4NNAA 3WLHA 1JXKA 3FN9A 3PPGA 2EPLX 1SO6A 1QHOA 3CJPA 2VZSA 1FDZA 1TV5A 2IKIA 3RMJA 1XICA 4PR4A 1FWJC 2GGEA 4AD4A 3H26A 3W7DA 3H2EA 3MHGA 3T4CA 1TV8A 2BDQA 3OZPA 5ECVA 2D0FA 3RK8A 4E2BA 2VZUA 3WF4A 2WVUA 2ZRZA 5AHFA 2PI6A 3PY2A 3N29A 4PTMA 1U22A 2JEQA 4O8AA 1DE6A 1E3ZA 1HZYA 3VIPA 4GNVA 2UV8G 3T0CA 1Q4NX 4DJEC 1CDGA 3TYZA 1SFJA 4FLRA 4IFKB 5KEZA 3A4XA 2Y85A 3H4XA 1VCFA 4M81A 1E15A 3WBYA 5CAKA 1XH1A 4Y8EA 2XH7A 2WCGA 3GR4A 3PN8A 3K4DA 1DQUA 3VVGA 4C6PA 5FA5A 3OGVA 3T44A 3N2BA 2QF7A 3FX4A 3M4HA 4DIAA 3DYMA 8XIAA 2V5LA 3IRDA 1MSSA 1XBYA 4ACZB 3KCJA 2UY5A 2BZNA 2IW0A 5EYWA 5KZEA 2VDGA 2FZDA 1BGGA 3PUGA 3WBAA 4HU8A 4C6JA 4FK9A 3ITGA 1K9DA 1JZ5A 1JZ4A 3FJ6A 1BSLA 2A3CA 1V3KA 3SRHA 4I5RA 5ECUA 1KGWA 2J13A 2A7RA 3KBWA 5D2VA 4PL2A 4QE4A 1TWSA 4CD7A 1PKLA 1EJ7L 3MB9A 1XIDA 1O5RA 4FNSA 3TEVA 2QVHA 3DFYA 3UJFA 4QJ1A 3L5LA 3GVRA 3T0DA 3G1AA 2XDFA 3UCCA 4REQA 1OK6A 4TX9A 1G94A 2W61A 3OGSA 3DG6A 4GIAA 1E70M 3DBNA 1LWIA 3TQ0A 1C3FA 4IF2A 1RJPA 4PB5A 2WJDA 2G95A 5B80A 1H62A 3ABRA 2JFEX 3OIHA 1O6IA 3VKDA 3VKAA 2WAGA 2OYMA 3L12A 4XSMA 3S46A 3L4YA 4H00A 1XV8A 2G4JA 4J3SA 5IFTA 3BW3A 3DUGA 3F4DA 3CB8A 4D6FA 3BZGA 2YLLA 2C1GA 4CNNA 3EOLA 1TPDA 3VCRA 1D2KA 4XIAA 1UR0A 5D38A 4AWUA 5A8QA 4MWAD 1CB7B 4D1JA 1QTWA 1UKOA 2XSXA 4UFIA 4BQ2A 1MZRA