2X8RA

The structure of a family gh25 lysozyme from aspergillus fumigatus
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
209
structure length
209
Chain Sequence
TTVQGFDISNHQKSVNFEAAKKDGAQFVMIKATEGTTYKDTVFNSHYTGATKAGLLRGGYHFARPDKSTGSTQAKFFLKNGGGWSDDNRTLPGMLDIEYNPYGATCYGLSHSQMVAWIHDFVNEYHHATSRWPMIYTTADWWNRCTGNAKGFGDKCPLVLAAYSSSPPKTIPGDWKTWTIWQNSDKYKHGGDSDKFNGPMTQLRKLASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Family Gh25 Lysozyme from Aspergillus Fumigatus
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE
total genus 69
structure length 209
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x8rA00
4MJ2A 4AIEA 4AZGA 4D1JA 2O92A 3RILA 4FLOA 4TTGA 3BAKA 3U7BA 3AS0A 3TTOA 2J47A 4AZ7A 1SR0A 3I3EA 4MB4A 3W27A 2A3HA 3VOCA 2VNCA 4NI3A 4TOQA 3AMGA 2WC3A 4ZE4A 1E55A 3PTMA 2QHAA 1E4IA 1C3FA 1GOKA 1DWGM 3B9EA 1QPKA 3APGA 3WNKA 1JZ8A 1RD6A 1WAWA 2D1ZA 1LL7A 3PN8A 3N11A 1JI1A 3L4XA 3OGSA 4NF7A 4HTYA 1IZJA 1UQZA 1E6XM 3GM8A 2G3JA 4M80A 1LG1A 3A4XA 2ZX9A 2OSWA 3AMCA 5A8PA 4OKDA 1FFRA 4OZOA 1GJUA 2VRQA 4OUEA 2AAAA 1JYXA 4HP5A 1V6VA 5E0FA 3CUJA 3B9AA 5I23A 4P7LA 3OG2A 1E73M 1DWAM 1GHRA 4UQCA 2ZIDA 4H8UA 1HJWA 2ZWYA 1WDRA 2VRJA 4D6GA 4UQ9A 1U33A 1QNQA 1CWYA 5I77A 3AROA 3K8LA 4P7RA 3AOFA 2BHUA 3VD9A 1JZ6A 1CYGA 1ODUA 1I1WA 1QI4A 2CNCA 1V0LA 3THDA 2GJXB 1BGGA 2J7EA 3BCFA 4GI9A 2MANA 1H09A 2FGZA 2VURA 3BMWA 3GNPA 4F8XA 1U30A 2DSUA 1E4MM 1E72M 3VIKA 1CGWA 4PTXA 4AXNA 1XSJA 1W9PA 2WW5A 1E6SM 3WUGA 2WMIA 1HNYA 4GQRA 3WH6A 3RMEA 4OJYA 2ZOXA 3CLWA 4H8VA 1QW8A 4HPGA 4Z2IA 1P6WA 1V08A 5D9NA 3AMDA 4ZEPA 4WSJA 3WQVA 2V5DA 1W1TA 1A47A 1NWRA 4R27A 2EO7A 7CGTA 1ISZA 5M5DA 1HP5A 3KZSA 2X0HA 1ZU8A 3VIHA 1UR9A 2HVMA 4QLKA 1DWIM 2VX7A 4QDMA 1Q6CA 2WWCA 1JYNA 1V6YA 2PWDA 4X0VA 3RDKA 1CNVA 3MUZ1 1J10A 3RIKA 4LYPA 4BS0A 4ZE5A 2WHJA 4FLSA 5DO8A 4XUYA 1GOIA 1QNPA 3W24A 2CKSA 3KE0A 4B3LA 1W1YA 1XRVA 1UA3A 4X0NA 1OT1A 2J8FA 4H8HA 3WFZA 5GNZA 2PBGA 4YPJA 4NRRA 4AMCA 4HU0A 4UCFA 4GI6A 2YDSA 1UH4A 2WB5A 5HDRA 1UR8A 1V3MA 2BVTA 3II1A 3PZQA 4CCCA 3L2LA 1JG9A 4W93A 1HL8A 4YHEA 1KWKA 3BGAA 2CBIA 2J77A 2CKRA 4JCMA 3BH4A 2G3MA 5I78A 1VF8A 2ZXBA 1ISYA 4UOQA 4J3SA 1E6RA 2BY0A 1V6XA 2D22A 1W2VA 4P7QA 3WEMA 1E43A 2IUZA 4JAWA 4F66A 2BFGA 4P8XA 4CU7A 2QF8A 4XX6A 2EPLX 4L4PA 4HZ7A 4U3CA 3VNZA 7TAAA 4FLQA 4GIAA 3GH5A 1WZAA 3CUGA 3MSDA 4L4OA 5A6KA 3MKKA 4YHGA 4OOZA 5LA1A 1TR1A 1VBUA 4W8BA 2YL5A 5ECUA 2VCCA 5CPQA 1BFNA 1Q4NX 1MQRA 3ARWA 4D6IA 1E4NA 2F8QA 2UWFA 3M46A 4PTMA 4TX6A 2G4FA 6A3HA 1E0WA 2BXZA 4LX4A 3AICA 4JHZA 1M03A 1H0GA 4FK9A 1K9FA 1M01A 4JFVA 2FGLA 4JZ5A 3WQ6A 3G6MA 3HJEA 4HMDA 2XIBA 1OBAA 1EOMA 1AMYA 3ZJ8A 3OBAA 2J7BA 2NW0A 2V3FA 1ZL1A 2C0HA 3VPLA 4QLLA 1D2KA 3IAPA 4UFMA 4CGTA 4AD1A 4ML4A 1CDGA 1XH1A 1C8YA 2VX6A 1H1NA 2A3AA 3PZMA 5CGTA 4TVDA 3EBVA 3IJ9A 3VGGA 3TTQA 3G6LA 2O9TA 2DSVA 5AY7A 3VGDA 1WCGA 1E4LA 4D6EA 5LA0A 4U3AA 3AHYA 3WQ4A 4BQ3A 3VD7A 1OIFA 5EMYA 4RE3A 2C8NA 1TE1A 2EPNA 5DF0A 2PWEA 4S3KA 4PMYA 4C7GA 1G0CA 2QMJA 4PYSA 2VCBA 5EFFA 3ZO9A 3ZIZA 1CIUA 4MB5A 2YLLA 2VT0A 2A3BA 4WK9A 4CN4A 1GONA 3PTQA 2D23A 2ZX7A 2ZXDA 5CJ5A 3VMNA 5A2BA 2CHOA 1EO7A 3GBDA 1LJYA 3A6OA 1VRXA 5GNXA 1HKKA 3W29A 3SCNA 3WD0A 4UQAA 2W63A 2BV9A 5A94A 6TAAA 3FHAA 3PZGA 1UD4A 1VB9A 3WY1A 1KXHA 4WKHA 2PWFA 3AJ7A 1UZ4A 4PMRA 1FH9A 3PZ9A 3WH7A 3UERA 1TZ7A 5E6YA 1SMDA 4AW7A 3BXWA 3U57A 1JF5A 3ZM8A 3WL0A 3AIWA 3L2MA 1A3HA 2G41A 4HOXA 2BVYA 3GXIA 3VKKA 1W9BM 1J12A 4CD4A 1HX0A 3N04A 1J18A 1JNEA 3W0KA 5BXRA 5BXTA 4U2ZA 3FY1A 4JKLA 1EH9A 5IFPA 3TTSA 1N82A 3VGHA 1PIGA 4CN1A 4JFSA 5BCAA 2ZUWA 1GQIA 4FMVA 4QFUA 1HJUA 1NP2A 1EQPA 1U2YA 2VC9A 3PZIA 3OLIA 1EHAA 2OSXA 1V0NA 5EBAA 3B9DA 4JFUA 4M81A 5A2CA 1DHKA 4HA1A 5CZKA 4PTVA 5JUVA 1GQLA 4D71A 3W53A 1ZBKA 4LXFA 1MQPA 2DH2A 1E71M 1BGAA 1CBGA 1B31A 4QCFA 1EOKA 3CMGA 1SYTA 2YA0A 1WKYA 3KL0A 3SCWA 1ESWA 1KXQA 4LGXA 1XC6A 3RO8A 3O9NA 5IDIA 1MFVA 1PZ3A 1FP9A 3SUUA 2E8YA 1BVZA 1W3HA 2OSYA 4LYQA 3OLEA 3MUIA 1WNOA 4E8CA 2X8RA 4DWSB 3WEZA 4HMEA 3SCVA 2DSWA 1EA9C 3RJYA 4UNIA 1KXVA 3EDDA 3EMQA 2BY3A 1BLIA 3ZT7A 1EHNA 1EDGA 1ZJBA 4AD2A 1FHLA 3WNMA 4ACZA 2D24A 4AZ6A 2CIPA 2CITA 2W61A 4KRTA 4W5ZA 4MNMA 4PCTA 1MQQA 2D0FA 3AHVA 3MS8A 2BVDA 3ZT5A 3QHMA 5FIPA 2EXOA 4LPCA 6CGTA 1HXJA 3DHUA 5D8ZA 2OYMA 4X9YA 1GCYA 2WLYA 4M24A 2VQUA 1PX8A 5GQBA 2TAAA 3T0BA 1ECEA 4ZXLA 1R7OA 2YLAA 1RP9A 1HJXA 2WPGA 3VIIA 4LQ1A 2JF6A 2WYSA 1EGZA 1QNSA 4H2CA 1OCQA 1G1YA 3CUHA 3EMCA 5CLWA 1I75A 2WLZA 2VZVA 3AHXA 4IPNB 2AOSA 3OLGA 5I2UA 3CPUA 3NYDA 2QPSA 3WH5A 5IHRA 1CXIA 3N1AA 4KMQA 2NT1A 4CD8A 4CU8A 4AC1X 2J8GA 5HOSA 3KL3A 4PTWA 4Q22A 4UQBA 3WELA 5FKYA 2YL8A 3ALGA 1CGVA 1DEDA 5I5RA 1UYQA 3VTRA 3WF4A 5C70A 4JCLA 1OM0A 2VUYA 1E70M 2JIWA 3T2OA 4D6CA 3MUY1 3RM8A 2QV4A 3PBGA 1JD9A 3CIVA 3SURA 4GO9A 2VX5A 2X05A 2WMKA 2DPEA 3VIFA 1WZLA 4GI8A 1EQCA 1K9DA 3CMJA 1HL9A 5BROA 2CCRA 1R86A 2VR4A 3AZTA 4GINA 5A6MA 4XZBA 2YDRA 4GXPA 1CGTA 2WVVB 2XVNA 4PN2A 1UR2A 5A6BA 2UY2A 2QLYA 3AS3A 1CXEA 1F4HA 4AZCA 4EK7A 2Q8XA 5EFDA 3OGRA 5ABHA 2E8ZA 1HF6A 2Y4SA 1DWHM 1UQYA 3RCNA 1J01A 1BG4A 3CGTA 3MMUA 1GORA 1JZ5A 3FAXA 3LPOA 2Y24A 4M82A 1LG2A 9CGTA 2VZOA 4UFIA 3FNDA 1UD8A 5ABFB 1JAKA 1QI3A 1GPFA 2XUCA 5A1AA 2QMKA 4U33A 3EDKA 3SUTA 1HJVA 4HA4A 1O7AA 1VFOA 3WQ5A 1KR1A 1HT6A 3ZOAA 3GBEA 4QCEA 3WUFA 2DEPA 1NQ6A 4AD3A 3F4VA 3WKZA 2WZHA 1HKIA 4WKFA 2GSJA 3WDJA 2F61A 3AXHA 4CD6A 3WD3A 2E40A 2WKGA 1JD7A 5BXSA 4DWSA 5DMYA 5CQ1A 4Z2LA 1US3A 1OGSA 1UWTA 5A69A 1RPKA 2J7FA 1GOQA 3DHPA 1CGXA 3CHFA 2ZUUA 4UFKA 3LMYA 4RE4A 5HPCA 1E6NA 3AISA 4NSBA 2VR5A 1V6WA 3WF1A 1BQCA 1BPLB 1JXJA 1W91A 5A8OA 2ZUVA 4GPNA 3UG3A 3IJ7A 3PTKA 4P8WA 2WZEA 5TD4A 3UEQA 1CXKA 1YQ2A 1GW1A 1KCKA 3CUFA 1XH0A 1HKJA 3L4ZA 3GTNA 1E40A 1HJSA 1OGGA 3GNOA 5BYWA 3NDYA 5AYIA 3ZMRA 2X2YA 3MUAA 4WKAA 1TMQA 1OWQA 4AZHA 2WBGA 3NDZA 1B9ZA 1VJZA 3ZSTA 1VFFA 1NOUA 3D5HA 2GUYA 2PB1A 1JDDA 5ABFA 5IXEA 5CSYA 4MB1A 1UKTA 4PMNA 3OZOA 2BNJA 1US2A 4JFWA 1B30A 1J0KA 4M1RA 3ZJ6A 3WH8A 1JZ7A 4UZUA 5A6BD 1CGYA 1XCXA 2RGMA 1R85A 1H4PA 2UY3A 2VZUA 3SCQA 3MV01 2BY2A 3N13A 1AQ0A 1TCMA 1R87A 3ARYA 1LLOA 4U5IA 4U2YA 1CLXA 1DP0A 2D3NA 2PWGA 4M29A 3VILA 5JIPA 2YJQA 2WVVA 1G9HA 4D6FA 4W88A 1W9XA 2OYKA 2UY5A 4U5KA 1UWRA 5C71A 4BA0A 5JBDA 3ARVA 4MADA 3WH9A 3OIHA 4D6DA 3QOMA 5D4YA 4B3KA 1JZ4A 3LPPA 3CO4A 2EBNA 2E9BA 2XFYA 3QGVA 1CXFA 1W1PA 1V3IA 3MSGA 3PZTA 1UWUA 1TA3A 4W85A 1H3GA 5HBFA 3L4UA 4J3VA 5KEZA 1ZB5A 4ZXOA 2VZSA 2EEXA 4WJXA 4BQ2A 4KGLA 1CZ1A 3BAWA 3AXXA 1MFUA 2YA1A 3AIQA 3ZR5A 3W37A 2V5CA 1CXLA 2VTFA 1NWUA 3NSXA 2NSXA 3SUWA 4RE2A 1MW1A 4AEFA 2CBUA 1UZ1A 1GVIA 4PRWA 1AVAA 5A6AA 1JAEA 3WDQA 3CZKA 2RGLA 3ARRA 1GQKA 1CEOA 1Q6GA 4UFHA 1TG7A 5BRPA 1G94A 3ZJKA 3FN9A 4R5EA 1UD2A 1JL8A 3A47A 3AHTA 3CZEA 1UH3A 1FA2A 2VVNA 2WWDA 2VRKA 3QHNA 3WFLA 2EPMX 1GJWA 1H49A 5FD0A 4Q7NA 3MMWA 2DGAA 3MANA 4P7OA 3DECA 4WF7A 4AYSA 3WNNA 3CHEA 4CUCA 1NH6A 1PPIA 2J78A 4JFTA 1B0IA 1VJSA 1KGWA 3IK2A 3EDFA 4E4PA 3PZNA 1MW0A 2AMGA 4J3WA 1QVBA 3D3AA 1MXGA 4Y7EA 4P7NA 1C8XA 4GO8A 1UKQA 2Y5EA 1FFQA 2WVUA 4HMCA 2C7FA 1E3ZA 5CPSA 3NSMA 2GJPA 4AD4A 1BVNP 3TONA 3VD5A 4EE9A 4J3XA 4HZ8A 3UR8A 3WQWA 1KGUA 1B2YA 1WZMA 1WDPA 3BAIA 1UOKA 5BXPA 2Z1SA 3A4WA 1SMAA 3ARSA 2D0GA 2VOTA 4UOJA 1K6AA 3ARZA 3AFBA 3VIOA 1Q6FA 3VX0A 4EKJA 1Q6EA 1B3XA 1VEOA 3AS2A 1W2PA 1X1NA 3AIVA 1W3KA 2JIEA 3WNOA 1KBKA 3VO0A 4A4AA 3PZVA 3VIPA 2XM1A 1R7AA 2ZUNA 1ISWA 4PSRA 4OBRA 1IT0A 4N42A 2ESCA 3K1DA 1HKMA 2DT0A 4QLJA 5E70A 3WIJA 1OB0A 4K68A 1C90A 1HVXA 3PHAA 1B90A 3JUGA 3MO4A 1UKSA 3TOPA 4IM4A 1JDCA 1GVYA 3POCA 4V2XA 3DYPA 1HJQA 2XVLA 5LA2A 5CPTA 3ARTA 4LYRA 3ARQA 4DM2A 3N18A 1B3YA 4GZJA 3W4RA 3OLDA 7A3HA 3ZT6A 1L0PA 3WUEA 4DWSD 3VMOA 1NM9A 3WENA 1WDQA 2OWWA 3SCPA 3AIUA 1CTNA 4AIUA 1HIZA 1XD1A 3AS1A 3F5JA 1UKOA 2HISA 2ZWZA 2X1IA 1HN1A 1C92A 2XJ7A 2ZXAA 2VL4A 1NARA 2WNWA 2EQDA 4DUXA 1GOMA 1XV8A 4ATWA 1OD0A 4BQ4A 2XHYA 2WC4A 2OLHA 5D9MA 4D72A 4UQEA 1TUXA 2ZUMA 2BXYA 2YA2A 3T2PA 4DUVA 4UFLA 5A8QA 3BAYA 2E0PA 2EPOA 1TA3B 4M56A 2GDUA 2ZICA 5GNYA 2VJXA 3CHCA 4MNLA 1ZBWA 2W91A 2XSBA 5BRQA 1H41A 1E3XA 1X6LA 3F5LA 4CCDA 1MXDA 3BLPX 3AZSA 5M03A 2DDXA 2VI0A 1KGXA 3J7HA 4IPLA 2O9RA 4H04A 4W5UA 5A6JA 1I1XA 4HOWA 3AIEA 3VIJA 4UQDA 5EB8A 1EIBA 3GXMA 4J7RA 1JNDA 1QHZA 1J0JA 2XGBA 4PMVA 3VDBA 2ZX8A 1QOXA 1PAMA 3WN6A 1XH2A 4W8LA 3W25A 1AQMA 3HMCA 1UWSA 4GKLA 4FF5A 3K4DA 1L8NA 4H41A 2V38A 4JIEA 1H11A 2YL9A 4Z2JA 4DWSC 3S6TA 2J74A 5CLTA 3U7VA 4ACYA 1XHGA 4MDPA 4PMOA 2JALA 2O9OA 1CLVA 5ABEA 1KFWA 3CTTA 3SCSA 1WB0A 1DWFM 5I0DA 1GOWA 2WHMA 3GH4A 1GUVA 3WNLA 4HPHA 4AWEA 1PX3A 4W7VA 1MYRA 3QHOA 1J11A 3NJ3A 4WSKA 5LYRA 4A3HA 3SCRA 3GH7A 1EDQA 3LPFA 4V28A 5F7UA 3SUSA 5D9OA 4PEEA 4KWUA 2WMIB 1Z32X 1M04A 2ZX5A 1UH2A 1BG9A 3T09A 2WMHA 5E9AA 4ATLA 3W82A 2WSKA 3WDRA 3L4TA 1UHVA 5KZ6A 3CZGA 1XSIA 3PZOA 4UFJA 3VM7A 5A6LA 1VFUA 1V3KA 3ZR6A 1B1YA 3ZJ7A 1YHTA 1LF1A 4PMQA 4D1IA 2J7GA 1ITXA 3WUBA 4ACZB 2XG9A 2PBOA 2WK2A 4ZENA 1VBRA 1XYZA 3MU7A 1NOFA 3SEPA 1GZJA 3AMKA 2E4TA 1UD6A 4P8UA 2WSPA 4B9ZA 1VEPA 4JKMA 1V3HA 3WEOA 1J9YA 3U5YA 5E0CA 4CVWA 2YL6A 4PUEA 3VMPA 5FCZA 1W3JA 3ARUA 2PF0A 3BLKA 4YN5A 3IANA 1CENA 4HA3A 5I24A 4KH2A 2DIJA 3ZQ9A 4JHOA 1D3CA 1MW3A 1QNOA 2IXVA 3VINA 5E6ZA 4TXEA 2BHYA 3NIYA 3UCQA 2WBKA 3KWXA 1J0HA 2CEQA 1MVYA 4W7UA 1D7FA 3THCA 1ITCA 4J3UA 1W32A 4NZCA 3W6LA 3B8SA 1W9VA 1WZKA 1QHOA 1WO2A 4IISA 1HVQA 4B16A 1JF6A 4OIFA 2WHLA 1UD5A 1PJ9A 4DM1A 1JFXA 5BWFA 5I79A 1JIBA 2CHNA 1BYCA 1JXKA 4CU6A 3RM4A 5CGMA 2WM0A 1NWSA 3WBEA 1KQZA 3FAWA 2D3LA 2G3NA 3AI0A 8A3HA 3T0DA 4UTFA 2WCAA 3AIRA 1E0VA 1LQ0A 3HN3A 4UOZA 5JIWA 3BSHA 3KEHA 1UA7A 3VGBA 3I3BA 2EPKX 2JFEX 2O9PA 3NSNA 4KGJA 2J62A 4WLCA 2XIIA 2YBTA 3WF2A 2Z1KA 3UR7A 2GJRA 1NWTA 2D2OA 3U5UA 3WMCA 5HXMA 2CESA 3GDBA 1M7XA 2FDMA 3WF0A 1BYDA 2WAGA 5FL1A 1RP8A 1IZKA 3UESA 4AZCB 5FL0A 3E1F1 4MAVA 1X6NA 4BZYA 3M6DA 3VVGA 4AZIA 4PMXA 4CKQA 1H2JA 1E1FA 3K46A 1NOWA 2E9MA 4GZIA 1LWHA 1ISVA 3UG4A 3AQUA 2WKLA 2CERA 4D6HA 2XVKA 4AISA 2WMGA 1J0IA 1TVPA 1DWJM 2YKKA 5E09A 4N0RA 4A3YA 1QI5A 5CSUA 2DIEA 4FLRA 3T0AA 4B15A 1W9DM 3A4AA 1EXPA 3IAQA 2OYLA 4DUWA 3WSUA 2YOCA 3GNRA 2OWXA 3W6MA 1UWIA 1KR0A 3NUKA 1BHGA 1F4AA 4OBSA 2WC7A 1UR1A 5FOOA 4C7FA 3VUPA 3RM9A 3F5KA 4MJ4A 4XV0A 4ZFMA 4Z2HA 4IUGA 1BF2A 4QP0A 4UR9A 3SIMA 4PBGA 3ARPA 2J79A 4MNJA 3ARXA 5A3HA 2J7DA 4H7VA 5DT5A 2CBJA 4EANA 5C8BB 1XCWA 1LL6A 3CBWA 1C93A 3QOKA 1FOBA 4F9DA 5JBEA 4Z2KA 3PZUA 4MDOA 1G5AA 4V27A 5A2AA 3M07A 3UG5A 1E9LA 1OGBA 1GQJA 1CPUA 1R8LA 1W9UA 5DEZA 2XFRA 1JZ3A 3FHQA 5AC4A 4XZWA 1PIFA 3CZJA 2D0HA 3CZ8A 1VIWA 1C7SA 2Y8KA 1Y7VA 1GHSA 3KL5A 4CCEA 2VZTA 1QBAA 1QNRA 4MPKA 2ZUSA 3ECQA 4W7WA 2GK1B 4F9JA 1E6PA 4KRUA 1J0ZA 2XTKA 3DYMA 2DQXA 1XSKA 1KXTA 3POHA 3TA9A 2W62A 1JGIA 3VIGA 4AEEA 3MV11 2XFFA 1E5JA 4W87A 2G3IA 1JYWA 1KQYA 3LPGA 3WDIA 3TTYA 5I6SA 3AIBA 1Q6DA 1V3LA 3CHDA 2WXDM 2XM2A 2PWHA 4PUDA 1VEMA 5DT7A 1NP0A 1QI2A 3VDHA 2VO5A 4OOUA 5CG0A 2BHZA 3OB8A 1KB3A 4W8AA 1E5NA 2F2HA 3VDAA 3FW6A 1V03A 3AMLA 3N9KA 3IJ8A 2W92A 2VX4A 1UD3A 3TP4A 2FHBA 3O2LA 1E1EA 1M53A 2CYGA 3RJXA 4MB3A 3VNYA 2X09A 2YBUA 4MTVA 1KBBA 4Z2GA 4TTUA 3WDHA 1MWOA 1MW2A 1GNXA 5D8WA 1OINA 2WCSA 5HNNA 1QBBA 2Y2WA 3EMZA 1BAGA 2XWEA 3HU7A 3W26A 3WQ8A 2JEPA 2WCGA 4EAMA 2XSAA 3SUVA 1E56A 1FP8A 4AIOA 1FHDA 1UUQA 2GFTA 1UR0A 1E15A 4AD5A 4AZBA 1ODZA 4P8VA 3VD4A 4BCEA 2WZIA 2J4GA 1UR4A 1JYVA 1KCLA 2DT1A 3BMVA 3L4WA 1WPCA 4B9YA 2XYLA 2J75A 4BF7A 2BS9A 1LL4A 2EJ1A 3K4AA 2XVGA 2OWCA 1V02E 5A8NA 2ZX6A 1ZS2A 2VQTA 2GDVA 1JI2A 4M8UA 3WL1A 5IHSA 1WE5A 3EDEA 4AD0A 1FH8A 2E9LA 2VVSA 3AYSA 4PMZA 1BSIA 8CGTA 1RH9A 5DFAA 3FXYA 1PX4A 1TFVA 3BSGA 1QI0A 4AZ5A 1S46A 1BYBA 4JL1A 3WMBA 1WP6A 3K8KA 3WD1A 2ZUTA 1ISXA 5D9PA 5A8MA 3WMSA 4ATDA 4TVCA 4PCSA 1LWJA 1OSEA 1C8QA 2XVPA 3T2QA 1E6QM 3BAJA 4D6JA 1CGUA 3SCUA 2V3DA 2DT2A 4PMUA 1BYAA 1E6ZA 3W28A 1ZBVA 5ABGA 2Y8VA 3WF3A 1PEZA 2WMFA 2CPUA 2GVYA 1PZ2A 5JBFA 4JL2A 4TUFA 1CECA 3T08A 2FHCA 3A3HA 4E2OA 3CH9A 1QHPA 3QR3A 4CVUA 1XYFA 5A6SA 4HOZA 4NRSA 1GOOA 5GPRA 1K9EA 2A3EA 1CXHA 3VX1A 3O6AA 4GQQA 3BCDA 2XWDA 3M7SA 1TVNA 3AXIA 3I3DA 1UWQA 1G01A 1V0KA 3ALFA 2GK1A 2JF7A 1SFSA 2XGIA 3WNPA 3SCTA 5AYBA 1J0YA 4W89A 3L4VA 1AQHA 2CBVA 5HPOA 1B3ZA 4TX8A 3VGFA 3N12A 3OZPA 2G8ZA 1VAHA 4WIWA 1C7TA 1UKPA 1H5VA 4C7DA 3N17A 2JEQA 1VFMA 4BQ5A 1DTUA 2CXGA 4XB3A 2WVTA 3W38A 4PMDA 1W1VA 1K9TA 2JE8A 4JKKA 1WDSA 1W3LA 2YDQA 1FH7A 3VIMA 4J27A 1EDTA 2WHKA 3CZLA 1KWGA 4S3JA 4CD7A 2J7HA 2W4XA 3WDPP 1V02A 2WANA 3ZSSA 3GXDA 3W81A 3AHZA 5M3WA 5CXPA 2GJXA 3VGEA 3EDJA 2WMJA 4AY1A 4HZ6A 2V3EA 4HU8A 5M17A 1E0XA 1ZJAA 1ZBCA 2ZXQA 4RL3A 2V3GA 3GXFA 2PC8A 3DYOA 3S2CA 3RPMA 1XD0A 4U31A 3MMDA 3WBAA 2VCAA 4GZEA 5AC5A 1OD8A 3GZAA 1O6IA 4F79A 1H0IA 3N15A 3VU2A 2FH8A 3EYPA 2NT0A 4J3TA 4MAZA 2D20A 2DSZA 3OA5A 3GYCA 2W66A 3WD4A 3DC0A 2A3CA 3AYRA 2DSKA 2PI6A 2WVSA 2YIHA 3WD2A 3VD3A 1HP4A 1EO5A 1JZ2A 4UZSA 3SCOA 4J28A 3BC9A 3CUIA 2E3ZA 4CN6A 3NCOA 5A95A 1V6UA 2CETA 1VENA 2B31A 2BY1A 4QAWA 3UETA 2FH6A 2FHFA 2DT3A 1QW9A 3VM5A 1OT2A 5IFTA 2ZE0A 1JDAA 1XGZA 4E8DA 2W67A 5I3DA 3BAXA 3OGVA 1B3WA 4CD5A 2J7CA 2DH3A 1V3JA 1PBGA 3AZRA 3K8MA 2W5FA 2XPKA 1C91A 3L4YA 4PSPA 4W86A 1IV8A 3VDCA 1V0MA 2UY4A 4MNKA 1OIMA 1BTCA 2J25A 2X0YA 1B3VA 2QPUA 1JFHA 2IXUA 4URIA 2VMFA 1UG6A 4TVUA 4W84A
chains in the Genus database with same CATH superfamily
1LORA 4MJ2A 4AIEA 2A4AA 4ZA0A 4C6MA 3TYBA 4FLOA 1FWSA 1U5VA 3U7BA 2C13A 4JTLA 4MYXA 2J47A 3IVTA 4AZ7A 1Z9AA 3TSMA 3BTNA 1NTHA 4F0RA 1OFRA 1XW8A 4MB4A 1NDVA 2QDGA 2A3HA 3VOCA 4JY9A 5HJXA 2VNCA 4A3QA 3W1XA 4TOQA 3W7IA 4K1WA 4UBPC 2Z7KA 1NFBA 4B92A 4F3HA 3PTMA 6PTDA 1LM1A 3B9EA 1DWGM 3G1DA 3APGA 3WNKA 4Q7BA 1Q6OA 1JZ8A 2D1ZA 4GOAA 3BG3A 3FS2A 1JI1A 2PUZA 2CW6A 1Q6QA 4N7QA 1KO0A 2Y88A 3M43A 2G3JA 1VCVA 2AGKA 3AMCA 4OKDA 1VBJA 3RR1A 1GJUA 2QVNA 4XKYB 1JYXA 3L65A 4HP5A 4NJGA 1V6VA 4I9AA 5AC8A 5I23A 3C4UA 4L1WA 3LDVA 4BI6A 1GHRA 4RR4A 1HJWA 1TREA 1AW1A 3N2CA 3W7HA 1U33A 4JNMA 1J5SA 1UROA 1S5WA 3K8LA 4A29A 1PS9A 1K6WA 4O52A 5EMUA 1QPNA 3VD9A 1ODUA 3MCMA 3GTXA 2RDWA 3WLNA 3GXNA 1SZRA 3D0CA 1XQKA 2GJXB 3W22A 3FJ6A 4JQ1A 1BGGA 2P3EA 1XLMA 3BMWA 2FPYA 3GNPA 1U30A 5DMMA 2XN0A 1Z89A 3OPSA 3S5SA 1KW1A 1BRLB 2X1SA 1TPEA 3GIYA 3MY9A 4AXNA 1XSJA 2Q6ZA 1W9PA 3F2CA 3KTSA 1E6SM 4PUKA 4X2RA 2W27A 3N6QA 4IJCA 3BJFA 4GQRA 6XIAA 4ERGA 5CEWA 2BGSA 5REQB 5DY2A 2Z7GA 1P6WA 2OGJA 1V08A 4DXXA 3IIZA 4WSJA 1W1TA 1IE7C 1ZPTA 3UJFA 4LTSA 4FXRA 7CGTA 3PUDA 1HP5A 2IQDA 2PP0A 4MKVA 3VIHA 2HVMA 3CK5A 3M1ZA 1TWSA 3VABA 4QDMA 4AFYA 1JYNA 5K9XA 4XK2A 3R11A 4BF9A 2EGZA 3RNDA 1GOIA 3WK2A 3VNMA 2PDCA 3TSBA 3WLIA 3S1XA 1UA3A 1GG0A 4X0NA 3GZ3A 3T44A 1OT1A 5AC7A 4JGDA 2VDHA 4Q4RA 1TTPA 2OKTA 3KX6A 2PBGA 3LHUA 3EKGA 1UH4A 2WB5A 1OX6A 3II1A 3PZQA 3RPDA 1VCGA 5KZMA 5E9XA 1JG9A 4W93A 4YHEA 4I8YA 4H9TA 2G3MA 1TX0A 3WK3A 4V1YA 4J3SA 1E6RA 2Z1WA 3A4JA 1PTAA 1W2VA 3P3BA 3HFYA 5EY5A 3WEMA 1M65A 1E43A 2IUZA 3LA4A 4K7VA 3V3WA 4P8XA 4EP8C 1EX1A 4PCPA 4RXGA 1YE6A 4L4PA 4U3CA 1V51A 1W1B1 4JTTA 3MKKA 4YHGA 2NQJA 1TR1A 4W8BA 2Y62A 5ECUA 1L6YA 5CPQA 1BFNA 4YYCA 1BXCA 1TV2A 4D6IA 2ZRXA 5K3VA 4KWVA 1E0WA 4JQ4A 2HS8A 4LX4A 3FYPA 3ITXA 5CBJA 1M03A 2RFGA 1H0GA 3LRMA 4DUOA 3EEGA 1M01A 4JFVA 3LTPA 4JZ5A 1KRBC 4HK6A 2VEGA 2HROA 2YW4A 4HMDA 4CNOA 4H2HA 2NX3A 2NW0A 1FVPA 1Q6RA 4ZQPA 4GYKA 3WLQA 2ZZ7A 4UFMA 4F0SA 4AD1A 1QU4A 3T4WA 5LIXX 2C1IA 1XH1A 3PBWA 1W5PA 2FB2A 1NAL1 2A3AA 3DBPA 3T4CA 5CGTA 3EBVA 3IJ9A 5L9FA 5I3HA 1WXJA 3P2VA 2YBVA 2BOFX 4FZIA 2O9TA 3O0KA 3VGDA 2NWSA 5F1VA 3BK0A 2E67A 2W0UA 4J2MA 5LA0A 4U3AA 3WQ4A 1Q2SA 3VD7A 3A64A 1FCBA 1KCZA 2E6FA 4RV8A 3DFSA 4C7GA 3G1RA 4PYSA 3FYYA 2YLLA 1A5SA 4Y6GA 3FIGA 4AWTA 3PTQA 3TAOA 1NY1A 3SR7A 2ZXDA 3VMNA 1E1CB 4C5YA 1B9BA 3GBDA 1R3SA 1VRXA 4QBXA 3SCNA 4UQAA 2W63A 2BV9A 3NM1A 4KEMA 6TAAA 3PZGA 4KCVA 1VB9A 1KXHA 4F4RA 2ASHA 3HQOA 1A5AA 4S23A 3QV7A 1I9CB 4H19A 1GJPA 1YDYA 4LYKA 1PWMA 4ZTYA 1F61A 3TV8A 4HIBA 5FJOA 2X30A 3TWBA 3PPHA 4NAFB 3L2MA 2ZDRA 2G41A 2OU4A 4DPQA 2XINA 4XAZA 4Y9OA 3GXIA 4YWSA 1WOBA 6REQA 1J18A 2PGWA 5BXTA 1EH9A 4CN1A 3PB2A 3N73A 2ZUWA 2X1UA 1KFKA 3WYZA 4FMVA 3CLMA 3FEMA 3GU9A 2E5BA 3UFYA 5I02A 4B5UA 1V0NA 5A2CA 1IQ8A 2WO5A 3LHZA 1OFEA 4PTVA 2OOGA 4LEFA 1QPQA 4LXFA 2DH2A 3H70A 4QCFA 5TAOA 4ZQOA 1WBJA 1NSJA 2GVLA 1AH0A 4GX9A 4DJEA 2J88A 1KXQA 5AOUA 1XC6A 3RO8A 5IDIA 1NDZA 2E8YA 3L5AA 4AVNA 4UTKA 2OSYA 1B3OA 1K7FA 1RJQA 4Z1AA 1WNOA 3PP7A 3L68A 1XLBA 4DWSB 1KBLA 4HMEA 3EKZA 3EMQA 3GFYA 1K8XA 3IWPA 1VZWA 1EHNA 4Z17A 2Z1BA 4AD2A 3V0TA 2CITA 4Q33A 3ZT5A 5CPMA 1NEYA 3EPOA 5FIPA 2EXOA 6CGTA 5D8ZA 2J66A 3PJWA 3W1NA 3G0UA 1BWLA 2WLYA 5CJNA 5BOEA 1PX8A 4C6LA 2ZDSA 1HJXA 3A22A 4O14A 2JF6A 1EGZA 4HSHA 5TIMA 4PODA 3QV8A 3EMCA 4J40A 2QUNA 1LLWA 4S3AA 1IYXA 3T0CA 5I2UA 3CPUA 3NYDA 3WH5A 5IHRA 1NQKA 4XZHA 4ZQCA 2VD9A 3KL3A 1XIMA 3UZZA 3ZS4A 2PFHA 1OY0A 2YL8A 3GVVA 3XISA 4R7JA 4XBSA 1DEDA 4AB4A 1QOPA 4WY0F 4GH1A 1ZTVA 3GIPA 3E6EA 4KIRA 2E28A 2YPIA 1XX1A 1I8JA 4EXAA 1YXCA 4YYFA 4DY1A 1XKYA 4GO9A 3SURA 1SO3A 4LC8A 3VIFA 1WZLA 2FVMA 1U5JA 4H6KA 4F2BA 4KWWA 5BROA 2CCRA 1O5KA 4XZBA 2NUYA 4GXPA 1O94A 4FB7A 4Z1CA 2WVVB 3SN4A 3OYXA 4PN2A 4XTIA 5A6BA 2V81A 1F4HA 2XFWA 4EK7A 1XIJA 1WBHA 1UQYA 2FVKA 4NT0A 3FAXA 4XD4A 4RZ4A 5KETA 2PS2A 4S3CA 1LG2A 9CGTA 4UFIA 3GKFA 2IKHA 3QV9A 5ABFB 1JAKA 1QI3A 3PAOA 4AHPA 2TPSA 3FX4A 3CC1A 5A1AA 4JTFA 2CLKA 1RV8A 5CPNA 4R9XA 3SUTA 4HA4A 4CNSA 3WQOA 4NJHA 1IXOA 1VFOA 1YPFA 1EF3A 3AWOA 1ZCCA 2DEPA 1NQ6A 4AD3A 2NQHA 1B54A 3LV6A 4C1LA 2H8ZA 3PJUA 3ABSA 4ZR8A 4ILSA 3P14A 5BXSA 1US3A 5C2XA 1FWFC 2Z24A 4UTMA 1RPKA 1TB3A 3FCPA 2Z1XA 5HPCA 1N8IA 2VR5A 1BPLB 1JXJA 1XDJA 1DXIA 1W91A 1YX1A 3GDMA 1AZ2A 1O5QA 3CB3A 3NQ2A 2RHGA 3KRBA 1X39A 4O0KA 4DYJA 5TD4A 2Z2UA 1FWBC 5IRPA 1GW1A 1XLLA 2NQ9A 5C55A 1XH0A 2QCMA 1HKJA 3RLGA 2PDWA 3MCOA 1AK5A 3NA8A 3KOZA 1AUSL 4WVXA 3QTGA 4O1AA 3W7KA 1OGGA 5BYWA 5BMXA 2QIWA 4YVVA 2IPGA 2OKOA 3M0MA 2ISVA 4I5XA 1ZSXA 2VGFA 1S1RA 2PU0A 1B9ZA 1OK6A 4CNTA 3S47A 1REQA 1VFFA 3W7GA 2YW3A 3EOSA 1EJXC 2PB1A 5CSYA 3BICA 4A8RA 3MJYA 2BNJA 4JFWA 1B30A 2QJNA 3U3HA 2GVGA 2V9DA 4UZUA 4CEXC 3N25A 3MT1A 5D33A 3EWUA 1CGYA 1XCXA 1XBVA 3R0KA 5I09A 1XIIA 1H4PA 3H22A 3KBWA 2BLEA 2UY3A 2PDIA 2BY2A 3QRHA 1LLOA 1IXQA 2IKJA 3RCYA 5ABTA 4DJDA 2UY5A 3DI1A 4BA0A 5JBDA 3ARVA 3CAWA 1D8WA 1MEWA 2REQA 3OIHA 3E0VA 1MRAA 1XLFA 1E9YB 3WZ0E 1RQHA 3LPPA 4PULA 1ADSA 5F1UA 2E9BA 3I7SA 1QDSA 3VNLA 5C7HA 5C2GA 1TA3A 3UXIA 3PANA 4I6KA 4OUIA 5AECA 5D02A 2VZSA 3BLDA 1P4CA 4BQ2A 4QHRA 3ABXA 3W1QA 1MFUA 3ZR5A 1CXLA 1VRDA 1NWUA 1FHVA 1ENUA 1MW1A 2CBUA 1E9ZB 4I7WA 5IM51 1AVAA 2H90A 3JS3A 3UR2A 3WDQA 1DTNA 1L6WA 5CSRA 1CEOA 1AD4A 1Q6GA 5HANA 3GR7A 4DWDA 3ZJKA 4KEZA 3AHTA 3S1GA 1UH3A 3IJDA 2HXTA 2WWDA 3LEPA 3WFLA 2TRSA 2EJAA 2X1RA 3QR1A 2C71A 3P62A 4P2VA 1CLKA 3W7JA 4GYPC 2BMBA 2DGAA 3DECA 2NXHA 4ZL1A 4CUCA 2J78A 1W3IA 1QATA 3O07A 5KMYA 1DQUA 2ZRYA 3EDFA 1P0EA 4GYFA 4E4PA 1F8IA 3D3AA 4P7NA 5FJJA 3QGKC 3A5FA 3NSMA 1BVNP 3BW4A 2FZDA 4EE9A 1S2WA 3UR8A 1O60A 4Q8MA 4ORIA 3PSWA 3GDRA 2CLHA 3A4WA 4UTUA 3RU8X 1J6OA 4Q8PA 3ISIX 5SWUA 1J4EA 4UOJA 4S3GA 2B7QA 3WLKX 1A5BA 3ONBA 1VEOA 1X1NA 3COTA 2JIEA 3WNOA 3VO0A 4A4AA 2OZ8A 4DO5A 1I2NA 3W7EA 1IGSA 2XM1A 2ZUNA 2CWNA 4B4HA 2FMNA 3K1DA 4QLJA 1OB0A 4TIMA 1F05A 1J79A 3KAOA 3PVFA 4IFKB 2YCLB 4NX0A 4GC4A 3G24A 4ZBCA 3TC6A 3DYPA 1HJQA 5IOBA 3DGRA 5LA2A 5CPTA 3FVMA 3GE7A 3ARQA 2OZ3A 3MW7A 4L1XA 5CZTA 1OQFA 1XL9A 5EA9A 4AMAA 2Q02A 3N18A 1UASA 3ZT6A 2GSEA 4DWSD 1NM9A 1OCNA 1SVDA 3CNYA 3ZWSA 2XH2A 4IP7A 5DBUA 2WNWA 4DUXA 1R3QA 1F9CA 3GLCA 1YPXA 4GK8A 2WC4A 1TUXA 5C7VA 1ML1A 3OZMA 4Q32A 4Z1DA 3Q45A 1UPMB 2EPOA 4KWOA 2Z0IA 1LYXA 4DJDD 3FDGA 3L66A 3YPIA 2W91A 1LOLA 3NPWA 3NZ1A 1H41A 4E8GA 3BLPX 3V0UA 1B5TA 3AZSA 1KGXA 3T0TA 2XH0A 3DFTA 2QCNA 3VC6A 2QCHA 4GGHA 5U7SA 3C2YA 1QWGA 1QFEA 2VFDA 4LBRA 4YVPA 1BXBA 3RX4A 4EPEC 3B8DA 2OPJA 1V4YA 3N14A 2VDIA 4PMVA 4JYEA 2AMXA 3WN6A 3E2SA 2OR2A 3HMCA 3KBSA 3IV8A 4FF5A 1YTKA 4H41A 1H11A 5LHFA 1FCUA 2PLMA 3BPWA 5LGZA 3LY0A 4PMOA 1ZENA 1OCJA 1DWFM 1GOWA 3QZAA 4HPHA 3WQCA 3FKRA 5FJUA 1MYRA 3QHOA 5LYRA 3STGA 4GVHA 3GH7A 3LPFA 4E2BA 5I3FA 4UNKA 4ZB0A 3T09A 4OT7A 2WMHA 1TRIA 4LS2A 3W82A 4PA8A 2ISDA 2WSKA 1UHVA 3ENLA 1Q7QA 3QSTA 3NQGA 3WJZA 1S2AA 1V3KA 3N2OA 3QPEA 4DXKA 3W76A 4PMQA 1XGDA 4ACZB 2XG9A 5A5WA 1VBRA 1KLZA 1BF6A 1UMLA 4Z1BA 2R1NA 3HQNA 3ABQA 1VYPX 1DE5A 1XLAA 2WSPA 4I90A 1Q13A 1TR9A 1V3HA 2P10A 4CVWA 3N2XA 5FCZA 3ARUA 4GIEA 2CLEA 5KTLA 1FWHC 2VFIA 4KH2A 2ZC8A 4LAUA 2DIJA 5HMDA 3ZQ9A 4JHOA 3ES8A 1LBLA 3MBFA 3LHVA 2IXVA 3HM7A 4TXEA 3NIYA 1JCYA 2WBKA 3S5NA 3L12A 1H60A 1U22A 4GQBA 3B8SA 3CL6A 3OOQA 4I7VA 1WO2A 1IIHA 1K8YA 1C29A 1N55A 2HV5A 1UD5A 1TPWA 5BWFA 3WLHA 2A7PA 2NQLA 4CU6A 4YLWA 2WM0A 3WLTA 2D3LA 4QS6A 2BOGX 3AI0A 8A3HA 3DG7A 2F38A 3AIRA 3PBVA 2XN2A 3R25A 4UOZA 4FF7A 3BSHA 3RYSA 1UOZA 2OODA 3TVAA 4IIGA 3I3BA 1ONXA 5I00A 1MDRA 2GJRA 3G3MA 4LCRA 3CASA 1PUDA 5FL1A 4IG2A 4AIBA 2QT3A 3SADA 1OC7A 1L9WA 4BZYA 3M6DA 4AZIA 3DGBA 4GY1A 1D9EA 1T6MA 3CEUA 3WJWA 2P5NA 5DMLA 1W8GA 2CERA 4XTDA 1JPMA 3EXTA 4HYRA 1JDEA 1FWWA 4YJ5A 3T8LA 4LUTA 1S38A 1FQ0A 1TE6A 4G7FA 4U10A 4B5WA 4RCXA 2DIEA 4FLRA 3T0AA 5G2HA 3A4AA 4DUWA 2OO0A 3UBPC 3S4TA 3W6MA 5D2WA 1UWIA 3NUKA 1F4AA 3GYEA 2WC7A 1YBQA 5FOOA 2DZUA 3RM9A 3F5KA 3RO6A 4MJ4A 1XF0A 4ZFMA 4LS1A 2PDQA 3ARPA 5A3HA 2J7DA 5CAHA 2YXXA 1SGJA 3GS6A 2KZHA 1WOAA 4NYYA 4QEHA 3E0LA 4X60A 3NFUA 3ANUA 3LSCA 3WLSA 4ICCX 3UG5A 5C9XA 1SFJA 3I4EA 2P88A 3ITGA 3UZWA 1F76A 2D0HA 3CZ8A 4M0XA 1VIWA 4JX4A 1THFD 1Y7VA 1GHSA 3M0YA 1ZCOA 3UZYA 3QMRA 4DF2A 3KZPA 1DPMA 3R13A 4W7WA 4F9JA 3NQ7A 4KRUA 1J0ZA 1H50A 3P82A 1YXDA 4M7SA 4EVZA 3QF0A 3MV11 4W87A 4BR1A 3GNXA 3GVRA 4ZOAA 3EOLA 2QNEA 1V3LA 2WXDM 3E02A 3NQDA 3QJAA 5JXQA 3B8TA 5DT7A 4X3ZA 2V68A 5CG0A 2I9EA 2B0MA 1KB3A 2GLKA 2ZRVA 1E5NA 3FW6A 3TFXA 5CBBA 4QE1A 3RCMA 3IJ8A 1J6PA 4ZODA 1QW7A 3V75A 1PIIA 4CQ8A 5LHEA 4O11A 4K8GA 3IIVA 2X09A 4Q4OA 5GJMA 1KBBA 2FZMA 3CIXA 3I7QA 4Z2GA 4DPPA 2OZTA 4B4FA 2CZDA 3L9CA 3W83A 1GNXA 1TRDA 1FCVA 3KVLA 4RKAA 1J2BA 5FEXA 3N2BA 1QBBA 3E38A 3PUGA 3UXAA 4CQDA 2WCGA 3MQTA 4NAFA 4EAMA 4HHMA 4ZOCA 5LIWX 2YDAA 2QUVA 5HNRA 2V2DA 1EYEA 2OOFA 1E15A 3MTWA 2JK2A 5DX7A 3WLJA 4BCEA 1KFBA 3OVRA 4C1KA 3MHUA 1JYVA 4HNTA 1KCLA 2V5BA 1RSCA 1SO6A 2XYLA 4POCA 2J75A 4GKTA 2BS9A 4NZ5A 3C0LA 3KS6A 3TC3A 1MUCA 4DB7A 4MIMA 3V35A 2HE8A 2ZTJA 1LOQA 3TEVA 1HO1A 2AKMA 1S2CA 4JN6A 3CYVA 4IQLA 4NIRA 1RH9A 2Y85A 4IGMA 2BXVA 1TFVA 4N2YA 1POJA 1S46A 4DLFA 4C6DA 5G4HC 4J1OA 3LGEA 1OYBA 3WD1A 3KRUA 2ZUTA 2XN1A 3LCGA 1FKXA 1LWJA 1OSEA 1XINA 3FV9A 3NEHA 4Q4KA 3W6YA 3BAJA 2VGIA 5G1YA 3HPSA 5JQ9A 1Y5XA 1PEZA 1V93A 3QKZA 3LNPA 2GVYA 5JBFA 2V2CA 2ZRUA 4TUFA 4LALA 4Y9MA 1QHPA 1CB7B 3TZFA 3RITA 5A6SA 3RAOA 4HOZA 4KFPA 2XU2A 1TPC1 2HJPA 4C6IA 1I2OA 1K9EA 2A3EA 3CT7A 3VX1A 2YB4A 4E4FA 1UMYA 3AXIA 3I3DA 2F7FA 2X42A 2WZTA 3HGJA 5AYBA 3E2QA 2YFOA 3TYDA 1XRFA 1AQHA 3DHFA 1LLZA 2CLFA 2VEMA 4HCHA 2PDFA 4I6VA 5CZJA 4H1ZA 4IIDA 4XKYA 3W1MA 3G77A 5F2IA 5T91A 5CH9A 3H6OA 1VAHA 2BSLA 1C7TA 4I7UA 2PGFA 4C7DA 4TU1A 2E1DA 4E3TA 2PTWA 2QAFA 1VFMA 1DTUA 3L7RA 2CXGA 8XIAA 5RUBA 3W38A 4BK9A 1EJVC 2JE8A 1XGEA 1ZRQA 4S3FA 1EDTA 2WHKA 1KWGA 3P7YA 4S3JA 4E2DA 4FIRA 3GVQA 4LUSA 1V02A 2WANA 1UIOA 4UTWA 3ZSSA 3CL8A 2C91A 3AHZA 5CXPA 3WO8A 3DG3A 2GJXA 4GIRA 3VGEA 3MJMA 4IL0A 4LUIA 4HZ6A 2V3EA 5GJPA 1E0XA 3B03A 3GSMA 5D2VA 2PC8A 3DYOA 3K5XA 3MC5A 3RPMA 4CQAA 3ORWA 3MMDA 3GNDA 3W74A 5AC5A 3GZAA 1O6IA 3P60A 4F79A 1H0IA 3FEQA 2NT0A 4J3TA 2DSZA 4QGCA 3WD4A 3D6NA 3AO0A 5EYWA 2WVSA 3WD2A 3OO2A 4O18A 1S5TA 1SFLA 3N6HA 1EZ2A 4O53A 3SCOA 3CUIA 4O50A 5A95A 1V6UA 1QOQA 5F2GA 3VM5A 4R85A 2ISSA 2ZE0A 2C1HA 3WK0A 2VHLA 2W67A 4AVOA 3JR2A 1TPVA 1B3WA 4KEUA 4GWEA 1XXXA 2O55A 2YR1A 2XPKA 1C91A 3UJRA 4PSPA 4W86A 1IEXA 3NQFA 1Z69A 4L6OA 2Y5JA 1KM4A 4NL1A 2UY4A 1TZ9A 2IS7A 1ZZMA 4H9VA 1BTCA 4XIMA 3VOJA 2QPUA 3TJLA 3DFYA 4B5TA 2PDBA 1I6NA 3OEXA 4MY8A 2VMFA 4TVUA 2VYOA 4W84A 3RXZA 3KBNA 2C1GA 4D1JA 2P50A 2F2KA 3G3DA 1WA3A 1UZDA 5I03A 1TJPA 3BJSA 5HQMA 2E7FA 2ALRA 1OZMA 4FSAA 3RN6A 3AMGA 1DE6A 2WC3A 4ZE4A 4KW2A 2QHAA 1C3FA 2QGYA 4IOTA 2V67A 4GE8A 1RD6A 3PN8A 3SY1A 3N11A 1XBYA 3OGSA 4NF7A 4ES4A 3ONCA 4ENLA 2WM1A 4M80A 1TIWA 4GFSA 5A8PA 5KSWA 4OZOA 1DKWA 4C6FA 2VRQA 4OUEA 4ERAA 1A5MC 2AAAA 3W2UA 1GPWA 1EJSC 1FWRA 2BWGA 4O57A 3B97A 2PRHA 1OG0A 1VH7A 3CV2A 4P7LA 3TQ0A 4NXKA 3WMLA 4O8AA 2ZWYA 1WDRA 2VRJA 4LY4A 4NZ1A 1CWYA 2XGZA 1XPYA 5FEPA 4ZCWA 3ES7A 2BHUA 1O1ZA 1IWBA 1CYGA 3W84A 1I1WA 1QI4A 2CNCA 1V0LA 1Z7AA 5AZ0A 3BCFA 4GI9A 1H09A 2V5JA 1R47A 4DZIA 3JRKA 1CGWA 1RVGA 4LFYA 2W9MA 2DJLA 3UCDA 3A12A 2WW5A 3WUGA 3NM3A 3M16A 4OJYA 2WQPA 4PB3A 3HOJA 2ZOXA 2C18A 1VQTA 4Z2IA 3AUOA 3E0IA 6ALDA 3VUSA 1NWRA 4R27A 3N9SA 2DZVA 3LBCA 1ZU8A 2I57A 4IMDA 1R30A 1PDZA 3SSZA 4S3BA 3KP1A 3SIZA 1Q6CA 4XIAA 2GOKA 1V6YA 1EB3A 1CNVA 3VFCA 5BWAA 1KRCC 4LYPA 5HR6A 4BS0A 3M5XA 4FLSA 4A35A 4XUYA 4GJIA 1V7YA 3O1NA 2CKSA 3HMJG 2A7RA 3KE0A 3LHTA 4HJFA 4B3LA 4TMBA 5CZ0A 1YTEA 3APTA 5DELA 5LNUA 4DZ5A 2PLJA 3WFZA 2DORA 4YPJA 1P7TB 4G56A 3BE7A 4D8LA 4AMCA 3R7MA 4B2DD 2YDSA 3R58A 1KM0A 2I5QA 1V3MA 1ZGDA 4KETA 4B90A 4JIQA 5T9CE 3B8UA 2ONEA 4AYGA 3U2OA 2CBIA 4NI8A 3GHSA 1EL3A 4ZQRA 3PR2A 2D2JA 4WY0B 1VPXA 3IJIA 4WOQA 1ISYA 1I0DA 2BY0A 4JTRA 4P7QA 3BO9A 3M47A 4NNBA 3ITCA 3VE7A 1MI3A 1FY6A 4JTEA 4XX6A 3SY5A 1NDYA 4UMAA 1DQXA 3V4BA 1EF2A 3GH5A 1EBGA 2BDQA 4UNLA 4L4OA 1PKNA 4XZIA 3C2RA 2VCCA 3I65A 2Q71A 2GL5A 5AHEA 1E4NA 1VGAA 2F8QA 3M0ZA 5FESA 4ZTXA 2UWFA 3M46A 4R53A 5AHNA 6A3HA 2BXZA 3CXOA 1UB3A 3AICA 2RKXA 4FK9A 2GUBA 3RU6A 3V5CA 3WQ6A 4IF2A 3G6MA 2DW6A 3OBKA 1W5NA 1AMYA 1C9DA 1Z41A 4O19A 3VPLA 4A2RA 4QLLA 5JVLA 4CCZA 1D2KA 3C0SA 3IAPA 4CGTA 4ML4A 5C6MA 1KNWA 1BVWA 1C8YA 1GW9A 3U2CA 1H1NA 3NQ8A 3RHGA 3LM7A 3SECA 3VGGA 3TTQA 3QSRA 2QCDA 2DSVA 2QCEA 1E4LA 3ZWTA 5BW6A 1H5YA 3AHYA 1OIFA 5EMYA 5L6UA 2R14A 5DF0A 3QGAC 4CNNA 4XBKA 3HA1A 5AFDA 3GHUA 3OHIA 4K7YA 4BEQA 4MB5A 3TMLA 2A3BA 2AL2A 2D69A 3GTHA 1RCOB 4WK9A 4CN4A 2C14A 5H8UA 1H7RA 1L8PA 1ZNNA 1SJAA 3MP5A 3VC5A 4Q7IA 2VD8A 3LRLA 3T55A 4ZQMA 3GAKA 3WY1A 3VKBA 4WKHA 2CXEA 5EMJA 2INZA 4G5DA 4PMRA 5CG7A 4EXQA 1BD0A 2P1FA 2V0TA 1Q7MA 3N6JA 5HAOA 4AW7A 3P8JA 3BXWA 4LCQA 1JF5A 3WBYA 5D32A 3AIWA 2A1YA 3G8EA 1A3HA 4HOXA 4X9SA 4UXDA 2VEFA 1W9BM 4LNYA 1J12A 3UA4A 2P76A 1HX0A 3N04A 3L0GA 3W0KA 5BXRA 3O3RA 1RJPA 2NVAA 5IFPA 3TTSA 3W01A 1N82A 1QT1A 3VGHA 1PIGA 4BHYA 4BWLA 4LJ3A 2OXNA 3I7RA 3S5ZA 3OLIA 4GGBA 1JGMA 5EBAA 3B9DA 2HNHA 4M81A 1DHKA 1KFCA 1SUXA 4HA1A 3N4FA 3IRDA 3W7RA 1GQLA 1MUMA 1ZBKA 2ANUA 1MQPA 3W53A 4DJFD 4O54A 3WBXA 4MHBA 1SYTA 2YA0A 4PRRA 4DJFA 3RG6A 2C0AA 1ESWA 4LGXA 3QW4B 2HZGA 4LB3A 4OTKA 1PKMA 3GW3A 1LDCA 2OX4A 4S1FA 3EX3A 2GQAA 3R12A 4E8CA 3NURA 3WEZA 3SCVA 2VENA 4A6GA 4US6A 3STEA 1XYMA 1KXVA 3EDDA 2BY3A 2AGTA 1KKRA 1BLIA 3ZT7A 5BMWA 3BQ6A 2Y0FA 2JKPA 4LANA 4ACZA 2ATSA 4AZ6A 4W5ZA 2W61A 3ERPA 2CLPA 4KRTA 3VCRA 4B91A 3MS8A 2AQVA 2A3LA 2E6DA 4EACA 1UZHA 4LPCA 3QY6A 2OYMA 4X9YA 1GCYA 3RGTA 2VWSA 5GQBA 1ECEA 2YLAA 4GISA 3CJPA 1XG3A 2OTDA 3C2EA 3PJTA 4HNCA 4N9BA 1R2TA 4K38A 2WYSA 3WBWA 3CT2A 4H2CA 1G1YA 4O15A 3CUHA 4DVOA 5U4NA 4FOJA 3MHFA 2VZVA 4FNUA 3AHXA 1QR7A 2FVLA 2GGIA 1QK2A 3URNA 4IPJA 1PCKA 3N1AA 1UPPA 4KMQA 4IMGA 4K3ZA 2NT1A 3W86A 2I16A 1EWEA 4AC1X 2J8GA 1OHLA 3CPRA 3KRSA 3BLIA 4PTWA 3URBA 4IJBA 1UYQA 2NX9A 1IHIA 2QULA 4DX3A 2J27A 3IPWA 2PDJA 4JCLA 1AW2A 3RRXA 2JIWA 1AD1A 3CM4A 1FWIC 2E25A 2G3FA 3CIVA 3O05A 2VX5A 2PDXA 5CKSA 3LLDA 3IJ6A 4GI8A 1ZJHA 4CLMA 4IWWA 5ENLA 4LUJA 1R86A 2VR4A 3AZTA 1NVMA 3E49A 2FDSA 1H63A 1H61A 1UR2A 3H2CA 1CXEA 1ZHAA 2Q8XA 2REQB 1F3XA 5ABHA 2E8ZA 1HF6A 5FAGA 4DXVA 1DWHM 3P74A 1F73A 2R1LA 3RCNA 1BG4A 5FEZA 4FNSA 3GW0A 5J8LA 3OODA 2MUCA 1AODA 2F9RA 5MKGB 3P8IA 3S2JA 4NHVA 3FLUA 3VAVA 1UD8A 3M0VA 1GPFA 2ZZ6A 4EOUA 4JX6A 4QR6A 1GEQA 1D3GA 1PB0A 4JR5A 3R43A 1VCFA 3GXPA 3LCFA 1BKSA 5F4XA 4U28A 3DKLA 2GWGA 1A49A 3WQ5A 1KR1A 3LQGA 4LF1A 3WUFA 4QCEA 3MDWA 1IIGA 4LW7A 2H3DA 3M41A 3WKZA 1GVFA 3EOOA 4GY0A 4MKNA 3EA2A 4LH8A 3VKAA 4CD6A 3WD3A 2FQIA 2Y7EA 1HO4A 1JD7A 1S5MA 2Y8UA 4KS0A 3OZYA 4OQVA 4JQ2A 1W8SA 3LU2A 3E5PA 1GOQA 2A21A 1G7VA 3TJIA 1KM6A 4PEKA 5DQPA 1E6NA 3VZZA 1JPKA 1U1UA 3QVQA 3AISA 3EWZA 1P0NA 2FFIA 5D2XA 5E5CA 3WF1A 1BQCA 1RBOB 4OU1A 4GPNA 2OEJA 4K6AA 5FAJA 3IVUA 3B04A 3PTKA 1G4SA 3P6LA 4FP1A 4P8WA 2ZYFA 1WUFA 1O1HA 4MZYA 4C65A 1PWLA 1CXKA 2I14A 1W5MA 3MVIA 1KCKA 3MO7A 1Q8JA 2R94A 4GXWA 3VK5A 4NY2A 4R88A 1GVEA 2ZZ1A 5DCDA 1HJSA 3QQ0A 4KFOA 4O4VA 5AYIA 2P53A 3ZMRA 2UV8G 2EF9A 4ZO7A 4Q8QA 4QIUA 4AZHA 3NDZA 1M41A 1NJJA 1VJZA 4B5SA 3S83A 2PDPA 1LT8A 1SW3A 3PSVA 1JDDA 4FNRA 4KCUA 4PMNA 1MDLA 4B5NA 2LLEA 1US2A 3LB0A 4HU3A 5MHBA 1P6BA 5FF0A 4X61A 3M0IA 3O0FA 1RY8A 4DQWA 3SRFA 3FFSA 2I1OA 2OLAA 3W2JA 3OJGA 5EL1A 3LMZA 3MV01 3GU1A 3FK4A 4ML9A 1AQ0A 1TCMA 3ZFHA 3ARYA 4U5IA 4OGZA 1CLXA 1R9ZA 2D3NA 3VILA 3O63A 4HPJA 4RNIA 1VS1A 4HB7A 2BBFA 4GY7A 1IR1A 1Z8AA 4D6FA 4W88A 1W9XA 1UWRA 4BY3A 4MADA 3WH9A 4D6DA 3BCJA 4KCTA 1D8CA 3KBVA 2CU0A 2QV5A 1HGWA 4MZ8A 3CO4A 3MMTA 1RJRA 2EBNA 4UTJA 1Q5MA 4XZNX 2QCLA 2GZXA 3O16A 4JEQA 4LVGA 3QGVA 2EPHA 3G1HA 3C8NA 1CB2A 4K39A 1UWUA 2NWRA 4GUFA 4W85A 1H3GA 2BASA 3INPA 3ATZA 2WNQA 1I2RA 3L4UA 3TW7A 3G1XA 4ZXOA 5MF5A 2EEXA 1YMYA 2Y1HA 4WOZA 3BAWA 1XG4A 3AIQA 2V5CA 2VTFA 2ZA2A 3F4NA 4EXBA 4LRSA 4NP7A 3HURA 2NXGA 4HN8A 1H7NA 4YU1A 3GTIA 4PRWA 4JYDA 2X7WA 3LBOA 4MZ1A 5A6AA 2G95A 2QCFA 1GQKA 3TZNA 1AJ2A 4LVDA 3UPWA 2WNZA 4UFHA 1G94A 3A47A 2VVNA 3QHNA 3D47A 2W6RA 1GJWA 3DDMA 1H49A 3NL2A 3ATYA 2F6KA 3NTYA 3BGJA 5D38A 4WF7A 6ENLA 4ZSUA 2I17A 3WNNA 2CFFA 4JFTA 4Z1YA 2GOUA 3PZNA 3TOYA 3TTEA 3TCEA 1QVBA 1FUYA 2EKCA 1FXPA 3ICJA 2TMDA 4H83A 4UR8A 1QK0A 1AFSA 3W7LA 4DYKA 3PY2A 5CPSA 4LAKA 4AD4A 1W31A 3HZ3A 3TSDA 5EGRA 3WQWA 1B2YA 1BEUA 3PPFA 3BAIA 1UOKA 1YXYA 3LZ5A 4GBDA 3ARSA 4C6EA 3CV6A 4L7ZA 3WLPA 7REQA 1VD6A 2VOTA 4CQ9A 2Q09A 4IFOA 4FX7A 1Q6FA 4ZO8A 3AS2A 1B3XA 2HVOA 3AIVA 1W3KA 3T9PA 3P5ZA 3PZVA 2PDGA 3G1AA 1FDZA 1A5UA 3KRZA 4JXCA 1ISWA 3S9ZA 2ESCA 3IS4A 2DT0A 3KXQA 1C90A 3PHAA 3MO4A 3TOPA 1JDCA 3TYAA 3R8RA 3QMTA 1F2JA 2ZA3A 1B3YA 3W4RA 3OLDA 7A3HA 3NQBA 2YSWA 4JN8A 3W1AA 4UUIA 1FWGC 3WENA 3W88A 3B8IA 1HIZA 4MWAA 2YCKX 1XD1A 4H3DA 4ZVJA 1UKOA 2HISA 3LHWA 4ADSA 1TPB1 2X1IA 1HN1A 4JIRA 4RDVA 1QO2A 3LLXA 4WGHA 2ZXAA 3K4WA 4HNUA 2EQDA 3TC7A 2JQXA 2QIIA 1XV8A 1OD0A 4FEZA 4F0KA 3BANA 4O13A 3QLDA 2EAWA 4UQEA 2ZUMA 4PUNA 1RALA 2BXYA 1N8FA 4DUVA 5A8QA 3JU2A 5FA5A 1GVOA 3GVGA 3DC8A 4QQ3A 1I60A 1KM2A 3WQDA 2DUXA 4QE4A 4MNLA 4IIFA 1IT7A 5BRQA 4CCDA 1MXDA 3M44A 4MSSA 2DDXA 1ZUAX 4H04A 4AEOA 3AWNA 3OA3A 2POZA 1TV4A 3VIJA 4C6CA 3BLEA 3QYQA 3H26A 1ME9A 1JNDA 4Y9NA 4RW3A 3B0UX 1KTBA 2HEJA 2XGBA 1KV8A 3KCJA 1PAMA 5F4SA 4RZ6A 2JGQA 4DAIA 2PWUA 1UJPA 1AQMA 1PHWA 1NU5A 3FJLA 3R4IA 2YGYA 2V38A 2IKIA 4JIEA 2B7NA 1X96A 2NQ5A 4Z2JA 3EX6A 1EPVA 2JALA 4H6EA 3LRKA 1KFWA 3SCSA 3HGOA 2O4MA 3WLRA 1X6UA 1PX3A 1UP2A 5M1TA 3SGGA 3TYZA 9XIAA 1YBQB 3QV6A 3G1VA 1VIZA 3W07A 1PDYA 1PYMA 4V28A 3S3GA 4LUYA 5D9OA 1Z32X 1GGOA 4F2TA 2X40A 3V5FA 3PUEA 5KZ6A 3CZGA 3PZOA 4FNPA 4UFJA 5A6LA 4GQGA 2R8WA 1VFUA 4IG2B 2ZC1A 3ZJ7A 2NVCA 3GR8A 1VFLA 4D1IA 2J7GA 1F5ZA 3WUBA 3LS9A 2PBOA 1CX9A 1XYZA 6TIMA 3MU7A 4OV4A 1EJ7L 1NOFA 3LG3A 3O6YX 4RE0A 2QZRA 3SEPA 2E4TA 4HN4A 1UD6A 4H00A 4P8UA 4BKNA 4YL2A 4WZHA 3FVDA 5HUPA 4GUHA 2E09A 4IP5A 2YL6A 1QTWA 4PUEA 3VMPA 4XAPA 3S1WA 3S42A 5F4WA 3V7PA 2PF0A 3BLKA 3NPVA 2V30A 4K36A 4YN5A 3PK7A 1TPH1 3IANA 5CJMA 1CENA 1D3CA 1T8XA 3S9YA 2PDLA 3LCHA 4A05A 3GG8A 5CC6A 3KWXA 2OCZA 3BJTA 4AY8A 4W7UA 5C0QA 4TMCA 1ITCA 2YX0A 3QM3A 3W6LA 4NUWA 4XD3A 3BZGA 1IXPA 1QHOA 3N29A 4FHAA 1TWWA 3LOTA 2QCCA 2Z25A 3THAA 4OIFA 2CHNA 2QXWA 4JIPA 1JXKA 3BURA 2DY3A 1WUEA 4WGXA 3MYOA 2FB3A 4V33A 2VR2A 4S3EA 2WCAA 1E0VA 5LNWA 5JIWA 1Z48A 3UWWA 3NDOA 4LV9A 1DJGA 2EPKX 2JFEX 4WLCA 5AHLA 3WF2A 2Z1KA 3UR7A 1EZWA 1NWTA 1HGYA 3U5UA 5HXMA 2FZNA 3ITYA 3EEZA 2FDMA 2WAGA 3UA3A 4N4QA 1P7TA 4RXFA 3GFZA 3HTWA 4MAVA 1YRRA 1WAUA 1HL2A 3DH7A 5J5RA 5H8PA 1H2JA 1E1FA 2E9MA 1TV7A 4GZIA 4NX5A 2OLSA 3MCNA 3UNDA 3UG4A 2WKLA 3EA3A 3G5EA 4OV9A 1OF6A 4PBEA 3W85A 5TF0A 2AAMA 4N0RA 1ME8A 2PGEA 5CSUA 4B15A 1VBGA 5T8GA 1EXPA 3GC2A 2OYLA 2YOCA 2Y63A 3GNRA 3PC0A 2ALDA 2Z1VA 4KFNA 3UW6A 4ADUA 1UJQA 1UR1A 1EPXA 3VZXA 4C7FA 5F2LA 4XV0A 3NXFA 3MPGA 1BF2A 2IMRA 2I56A 4LV4A 4PBGA 2BVWA 2AQOA 4MNJA 4XAYA 4OFCA 1I4NA 4H7VA 2ZA1A 2X0SA 5DT5A 3NQVA 1OCBA 1XC4A 1DIKA 4EANA 1LL6A 3BL3A 2CZFA 3CBWA 4LVAA 3A21A 1G4TA 4Z2KA 1OX4A 4MDOA 1G5AA 4V27A 3GHRA 1E9LA 1CPUA 4C6NA 1R8LA 2XFRA 3FHQA 3LN3A 4XZWA 4QJ4B 3M9YA 4WDUA 5E93A 3NQAA 2VELA 4QISA 1C7SA 2Y8KA 3R0DA 4CCEA 4LT9A 1QNRA 2HBXA 2OQLA 1DORA 3EZ4A 3RLVA 3ECQA 2GPTA 3CHVA 4DJED 2VM8A 1UWAA 3GRIA 3TA9A 5FJRA 2VFFA 4FAMA 2ON3A 3LENA 1JGIA 2PGRA 3KOXA 2XFFA 4KESA 2QJIA 3LPGA 3WDIA 1QPRA 1KFEA 3R94A 5I3GA 2RJGA 3CHDA 1VLWA 2CC0A 4LB4A 4UTTA 2PWHA 4PUDA 3VDHA 2J6XA 5K9CA 4JIIX 2P0IA 4C6QA 3STCA 2Q3RA 4W8AA 3BG5A 2QW5A 4YMZA 3S8HA 1YIXA 2EG6A 3LM3A 5CCZA 3CAKA 4JYFA 2W92A 4PUUA 1UD3A 4JTUA 2FHBA 1SZGA 3O2LA 4HYVA 4ALDA 4O28A 2CYGA 1EFZA 3MVTA 4MB3A 1TWZA 3EWCA 5HMFA 4O4WA 3XIMA 3DBNA 3LI1A 5D8WA 2FPTA 4IP4A 2CHRA 1OINA 1B4EA 3M5VA 3NGFA 5HNNA 3EXRA 1BAGA 3HU7A 3W26A 1UC4A 2Y7FA 2ADAA 1E56A 3NNTA 1FP8A 4AIOA 1FHDA 4L1GA 2SFPA 1TJRA 3PWAA 1R2SA 2NVDA 1LOSA 2GFTA 1UR0A 4ASTA 2PDHA 1ITQA 2Y7DA 4JPGA 4M7TA 3V0SA 3VD4A 2CZVA 4L61A 1JCMP 4FO4A 4JEJA 3MZNA 1WPCA 4IUOA 4B9YA 3NVDA 1MSSA 1W56A 3K4AA 4WR3A 1DJQA 2XVGA 1V02E 3QKEA 1GYLA 2VQTA 1SW0A 3MDUA 5IHSA 3LV5A 4MFEA 4WDXA 4AD0A 3WK1A 2E9LA 4WX2A 2VVSA 3SSJA 1OFOA 4PMZA 1J93A 3LLFA 4LUSB 4DRSA 3PG9A 3OBEA 4MF4A 1W6TA 1H51A 2OT1A 4H6QA 4HQVA 2XIMA 1GVRA 1TV3A 3WMBA 3K8KA 1ISXA 2QQ6A 4RX0A 4PCSA 1FWNA 4PB4A 4UR7A 4GC3A 2R6OA 1ZAIA 1S1PA 4JTAA 3UD6A 4FNQA 2PZ0A 3K13A 3S9IA 1XIBA 3W1UA 3W28A 2X41A 1AJZA 2Y8VA 2WMFA 5D09A 3D3FA 1PZ2A 1X98A 4JL2A 3T08A 3EWBX 5I07A 3A3HA 3T05A 1QUMA 3EX2A 4E2OA 3CH9A 3HV8A 3QR3A 4JQ3A 3BLLA 2JKEA 5C9RA 3ITOA 3B9OA 1GOOA 1VFHA 5GPRA 4OECA 4WXZA 4I9JA 4DO6A 1NF7A 1DXEA 3BCDA 5HWNA 4HNLA 1KC7A 1YYAA 2JF7A 1SFSA 3WNPA 4GD0A 1WQ5A 4JX5A 1AJ0A 3V16A 2GQ3A 5DCEA 1I0BA 3G18A 4W89A 1H7OA 1EWDA 3H54A 4ZGYA 2CBVA 4EWND 4TX8A 4QSHA 4IGNA 4MLRA 1A0CA 3NZPA 4R7WA 1K7XA 3ANVA 4YTTA 3UJ2A 4E38A 3MI6A 5FJIA 3OZPA 2WPBA 2G8ZA 1YDNA 4DF0A 2ZRWA 1UKPA 1TPFA 4IX2A 3WQGA 1F3EA 3N17A 3DG6A 1O95A 3KCLA 4AX7A 3TA6A 4PGLA 4Z42C 5LGXA 2WVTA 2FFCA 3DAQA 4K37A 1UR3M 1FH7A 1N7KA 4H8NA 3CZLA 4FX8A 3CL7A 4JTIA 2W4XA 4C1NB 3WDPP 2VGGA 4B2DA 1OG6A 4HBKA 1OFDA 4GYPA 5M3WA 1H62A 2PD9A 3TKFA 4HU8A 2RH9A 4CEUC 5AVNA 2ZXQA 4FIQA 3GXFA 4G2DA 1XD0A 4E3VA 1TQJA 3WBAA 1V6TA 4V1XA 3PWIA 5K9DA 3N15A 4YNGA 3IRSA 5CBIA 3QZEA 2D20A 4RNJA 1EUAA 3GYCA 4L64A 1A0EA 2GGHA 2XH7A 1HP4A 3GC4A 4UZSA 4MFDA 2CETA 4IGHA 2ACUA 2BZNA 4DBWA 2Q01A 2FHFA 5HWMA 1QW9A 3VYLA 1KV5A 3W1PA 1JDAA 1HQTA 4YTSA 1UUMA 3CS2A 3L21A 3OGVA 1AL7A 4CD5A 1QXLA 2DH3A 4QJ1A 3W00A 3AZRA 3VCNA 1AH3A 3KFTA 3R10A 2FPVA 4JNYA 1IV8A 5C9WA 3QBUA 1V0MA 4RLIA 3R5EA 3M4HA 1OK4A 3STPA 1MUWA 3TXZA 2J25A 2X0YA 1O4UA 1B3VA 4E5TA 2IXUA 5LZLA 4ICMA 1Y65A 1QPOA 3VKDA 5DY3A 4C91A 3RILA 1A5KC 5AZ1A 5I7GA 3TH6A 3GG7A 1IEIA 3LZ3A 4NI3A 1Q4WA 3E9AA 3TLQA 1E4IA 1GOKA 4UMBA 3TR2A 1WAWA 3FGCB 3L4XA 4H9MA 4FOUA 4HTYA 3MUXA 3U0HA 1UQZA 2E5CA 3GM8A 2FIQA 5CPLA 5EBUA 1LG1A 3MI3A 2ZX9A 2G97A 2OSWA 1XBZA 1ADOA 2QR6A 3GWQA 5EMKA 4QEEA 1W37A 4IT1A 1LQ2A 1KKOA 3C3NA 1E73M 2FMOA 4UQCA 3AUJA 3A9IA 3TU9A 1W5QA 4D6GA 4IQJA 4UQ9A 3BWWA 1RUSA 5I77A 4ORMA 4O1FA 3I10A 3R79A 3LNMA 3AOFA 2Q8LA 5B80A 1YNYA 1JZ6A 1YNQA 4DZHA 3IACA 2A6LA 4GZ7A 1FKWA 2BGNE 2FGZA 2VURA 1K3UA 4F8XA 2DSUA 1E4MM 3BV7A 1E72M 4DBEA 3FA4A 3HQPA 4RK8A 5DLCA 2XH4A 4O16A 1H7XA 5BOFA 4GCXA 1EEPA 2WMIA 1G4EA 1HNYA 3WH6A 3RMEA 5HJLA 1RLCL 2Y70A 4PH6A 1QW8A 3PBMA 3AMDA 4ZEPA 3UWZA 2V5DA 3MKVA 4JS3A 4GACA 5HR7A 3M0XA 3GUGA 1A47A 2EO7A 3KZSA 3OYZA 4WSHA 1XDMA 3IUDA 1AW5A 3ZYZA 2A7NA 3ITVA 1M3UA 1MNSA 4X0VA 4QROA 4KERA 1R3TA 1J10A 3MUZ1 1FWAC 4C6PA 3RIKA 3JVAA 2WHJA 3S6DA 3TJ4A 3TCSA 3O15A 1MNZA 1XRVA 2W79A 1XCFA 1W5OA 3H24A 2F6UA 5GNZA 4DLMA 3CB8A 4HU0A 3K30A 2HQAA 3LBMA 4C6JA 2DZWA 2BVTA 1XIEA 2BG5A 3R8HA 5I3IA 5HUOA 3CIWA 4L9ZA 1KWKA 3BGAA 1IF2A 3L0KA 2J77A 3BH4A 3LGGA 2EKGA 1VFTA 2ZXBA 2YCLA 4UOQA 3DESA 1GZGA 4AVFA 1E51A 3PAJA 4XVEA 4XVDA 2ZADA 3TYEA 3UXLA 4F66A 3GFXA 4G8TA 4CU7A 3UWEA 2QF8A 3UVAA 2I5GA 3NO1A 4WJEA 1WZAA 4RZBA 3UYCA 4Q8OA 3MSDA 1SFTA 5A6KA 4OOZA 1GT8A 1QNVA 5LA1A 5I3JA 5AC6A 1MQRA 2HS6A 3ARWA 2AKZA 5IBXC 3TR9A 4TX6A 4LVBA 3MSRA 4YTQA 5K4XA 3G22A 3I6EA 2PDUA 4JHZA 2PSNA 1K9FA 1F3TA 2FGLA 3E3HA 1VKFA 1L2UA 3HJEA 1QAPA 1OBAA 4IQEA 3RR4A 1A5NC 1J2WA 3RX3A 3BW2A 1ZL1A 5LXXA 4RUBA 4NJKA 3SW6A 1JRCA 4H6RA 1W1ZA 2JBMA 5ECVA 2VX6A 5D2TA 4LWWA 3PNUA 3NYZA 3PZMA 4PR4A 4TVDA 4IFRA 9XIMA 3FA3A 3G6LA 3HPAA 1T7LA 4PBFA 4M6UA 5HWJA 2HPMA 1T41A 4BQ3A 4QG8A 4BEUA 1FWEC 2V2HA 2X7VA 2PWEA 1PO9A 4S3KA 4ZB2A 1OFPA 4PMYA 4IIBA 1G0CA 2QMJA 2VCBA 3ZO9A 3ZIZA 4Q4QA 4X22A 2OB3A 1LRNA 2FZBA 3VXGA 4MWAB 3T8QA 1GONA 1X1OA 1Z6KA 2D23A 2ZX7A 3Q58A 3CH0A 5A2BA 2YZ5A 1EO7A 2D2HA 3A6OA 3UZXA 5A94A 2ACRA 7TIMA 1M1BA 4IX0A 4XAGA 1VPYA 2PWFA 3C61A 2FYMA 1UZ4A 4IGSA 4IQDA 1FH9A 4NILA 1P48A 3UERA 3FSTA 1RAKA 4L4MA 1TZ7A 5E6YA 3KVJA 2FJUB 2WJEA 3U57A 1YNPA 2VOMA 1D3HA 2FTYA 2R91A 1MO0A 1JQVA 1IGWA 3L5MA 4CD4A 1FHUA 3CO8A 3PJXA 3FY1A 4JKLA 8TIMA 4JFSA 4MYAA 3UPBA 1GQIA 4UMCA 2F6XA 4QFUA 1HJUA 1EQPA 1EHAA 2OSXA 4I3GA 3MWAA 5AVHA 3NZQA 4D71A 4UWMA 5CSSA 1CBGA 3KTXA 1EOKA 2W3ZA 2PODA 3CMGA 1WKYA 3KBJA 1MMFA 1XUUA 3TN3A 1TYGA 3TXVA 3G0XA 1EJWC 1R3YA 5BOOA 2J6VA 4O10A 2RDXA 2A2IA 2P0OA 3MI2A 5C54A 3O9NA 4L80A 1FP9A 5G1MA 2I7GA 1BVZA 4LYQA 1RK5A 7XIMA 3MUIA 4M5PA 4RV3A 1KM1A 4FXSA 4FI4A 1JUEA 2E5DA 1EA9C 4UNIA 3O06A 4WDWA 3P0WA 3GY1A 2P8CA 1TTJA 1FHLA 2YCIX 2D24A 2CIPA 3H4GA 3VE9A 1W0MA 4FPSA 4MNMA 1MQQA 2D0FA 2BVDA 2HWGA 3QHMA 1HXJA 3DHUA 1P43A 1GG1A 1FTXA 2DUAA 4M24A 5MKGA 2TAAA 1RLDA 1Q45A 3EX4A 2PDMA 4ZXLA 3UJSA 1RP9A 2QYGA 1NIUA 1TX2A 4LQ1A 4X2PA 4AWSA 1QNSA 4GIYA 1XRSA 5DRCA 2C15A 2PE4A 3GD6A 3W7MA 3N2TA 1XYAA 5CLWA 2WLZA 4ZOBA 1Q65A 4LEQA 3KLKA 7ENLA 3QQWA 1HTIA 1L6GA 4FR1A 4CU8A 1TVLA 3C6CA 5HOSA 1EBHA 1KM3A 3H2FA 3SDOA 4UQBA 5FKYA 3ALGA 1HUVA 3WF4A 5C70A 4KCWA 4N9DA 3QTPA 3PFRA 2VUYA 4IPIA 4X63A 4L6DA 2ZVIA 3C56A 3MUY1 4XG1A 2BGQA 5H8MA 3RM8A 4DBDA 3PBGA 1JD9A 3W7CA 1IXNA 2X05A 3WQFA 2WMKA 4EF8A 3TFCA 5GVJA 1TJ1A 4JBRA 4F40A 1K9DA 2XISA 1HL9A 1HZYA 3CMJA 4H7CA 1GVQA 4F0LA 1S5NA 2NLIA 5A6MA 2YDRA 3QMSA 1CGTA 2XVNA 1R0MA 4N4PA 3VOGA 2QLYA 4D8AA 4Q6JA 5EFDA 3P84A 3VOIA 2Y4SA 3QLLA 1J01A 3WJXA 5H2ZA 1Z3NA 3TUUA 2Y24A 4M82A 1L6FA 3H55A 1KFLA 2ZE3A 2B81A 3GDTA 1I2QA 1R38A 3KHDA 4Q8TA 4REQB 4DN1A 2QMKA 2XIOA 4U33A 2XIQA 2R1MA 3EDKA 4O1DA 5FJPA 4ZFCA 4IJRA 4K1GA 1O7AA 2NZLA 3RUBL 3PBUA 4IXHA 3ZOAA 1HT6A 3HGRA 4O17A 1ME7A 1NFGA 2WZHA 4WKFA 2GSJA 3MB9A 4NZJA 3WDJA 4G7EB 1K77A 3CQHA 2R24A 2E40A 2Z27A 5I3KA 1BTMA 4F0MA 5CQ1A 1AA1B 4Z2LA 3G1SA 1OGSA 3NWRA 2CZEA 3TN4A 3LXAA 3CQIA 4O0ZA 3LMYA 4RE4A 1MZHA 5CC3A 2Z29A 4NSBA 3EWWA 2H9AB 3B8VA 4KEVA 2ZUVA 1W3NA 1AZ1A 5BZAA 3TQPA 1PHQA 3CWOX 3UEQA 3CUFA 3SN0A 4Z0SA 3Q67A 3L4ZA 3SY8A 3GTNA 1E40A 1PL9A 1EUNA 1GEHA 3U4FA 3NDYA 4MLJA 4OWGA 1ZQ5A 1S3TC 3H53A 1Q63A 3HV9A 4HNOA 1A53A 1TMQA 1OWQA 2PU1A 3LCLA 1DYSA 2WBGA 2ZKMX 4GI4A 1NOUA 4YVXA 2GUYA 3P80A 5FI8A 4DZAA 1J8VA 5JH2A 1UKTA 4LVFA 1RR2A 3GG0A 2DJXA 3C2VA 1S39A 1YW1A 3WH8A 1YEYA 1EC7A 1ICQA 4TR9A 1VYRA 4AY7A 1R85A 1O68A 2G5WA 4MUZA 3W3OA 4QJ5B 3AXMA 3JZUA 4GJ1A 2QDDA 2VZUA 3SCQA 3W2NA 1XS2A 4Z0JA 1EC8A 3ABZA 4DELA 1Q6LA 4U2YA 1FBAA 2PWGA 2EHHA 4IIHA 2YJQA 4FX6M 1OFQA 1G9HA 4JTHA 2DW7A 4AU0A 1HKWA 4U5KA 1KTNA 3EB3A 5C71A 3UU0A 1A0DA 5LNRA 1JZ4A 2C3ZA 8XIMA 3T1GA 1EIXA 2XFYA 1JCJA 3DFPA 7REQB 1CXFA 3U48A 2G96A 2H3BA 2PEVA 2VUNA 4XUGA 4KQNA 4J3VA 2HPIA 5KEZA 1ZB5A 1I45A 1PKYA 1EJTC 4KGLA 3JW7A 3AXXA 2YA1A 3W37A 4QQUA 1TPDA 2NSXA 3SUWA 5J04A 4RE2A 4K8EA 1H1YA 1R9YA 4AEFA 1CCWB 3H4WA 3N34A 3CQ0A 3H2AA 4IMFA 4WHBA 4NASA 1A5CA 1PCWA 2RAGA 1XIGA 2GQ9A 2RJHA 5LSMA 1TG7A 2R1PA 3NL6A 1Q3NA 3FN9A 4R5EA 4NZ4A 3OVPA 1F74A 4AF0B 3RF9A 3D46A 2GUUA 1FA2A 3AU2A 2VRKA 4OBTA 5REQA 5KITA 1OF8A 4I9TA 1NF0A 4Q7NA 3R1ZA 1SM9A 3MANA 1GTHA 4OVXA 1GYNA 1ZP3A 3HPZA 4AYSA 3CHEA 3KOYA 2ZZ3A 5M2FX 2NQZA 1PKLA 1KGWA 3IK2A 5FF7A 4JTSA 5BNKA 1MW0A 2EG8A 2AMGA 3V18A 4Y7EA 4EIVA 1C8XA 1OC6A 4Y8FA 1UKQA 2Y5EA 4O1EA 2Z4GA 1E3ZA 1IEWA 2GJPA 3TONA 4HZ8A 2D73A 4DO4A 4CQBA 3GDKA 4A21A 2FLIA 5HA7A 1WZMA 2OT0A 3CWHA 3W1LA 3IGXA 2Z1SA 4G9PA 2D0GA 1CI1A 1GQNA 3AFBA 2PTXA 1TPUA 1QRQA 5C9ZA 4EKJA 1W2PA 1Y5WA 1MXSA 4RJEA 1G6CA 4XO7A 1KBKA 3GC5A 1GKPA 4AX6A 3LTSA 3VIPA 5DANA 4Y2WA 4L9XA 4PSRA 1IT0A 4N42A 4OBRA 1MEHA 4AHOA 1P6CA 1QJWA 3WIJA 3RK8A 4K68A 3WQEA 3T81A 5CC5A 3W2LA 3JUGA 1IWAA 4V2XA 4Y90A 4JY8A 2XVLA 1L2QA 3ARTA 4LYRA 3EAUA 5CPOA 2DQWA 3GKAA 3OQEA 4RDWA 3A13A 4QNEA 4GZJA 1R3VA 4LCSA 3LHYA 3VMOA 4H9UA 3SCPA 3L2IA 2PD5A 1CTNA