2X8TA

Crystal structure of the abn2 h318a mutant
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
443
structure length
443
Chain Sequence
b'KPIFKEVSVHDPSIIETNGTFYVFGSHLASAKSNDLMQWQQLTTSVSNDNPLIPNVYEELKETFEWAQSDTLWAADVTQLADGKYYMYYNACRGDSPRSAMGVAVADNIEGPYKNKGIFLKSGMEGTSSDGTPYDATKHPNVVDPHTFFDKDGKLWMVYGSYSGGIFILEMNPKTGFPLPGQGYGKKLLGGNHSRIEGPYVLYNPDTQYYYLYLSYGGLDATGGYNIRVARSKKPDGPYYDAEGNPMLDVRGKGGTFFDDRSIEPYGVKLMGSYTFETENEKGTGYVSPGANSAYYDEKTGRSYLIFHTRFPGRGEEHEVRVHQLFMNKDGWPVAAPYRYAGETLKEVKQKDITGTYKLIQHGKDISADIKQTINIQLNKNHTISGEMTGTWRKTGKNTADITLAGKKYNGVFLRQWDSVREKNVMTFSVLNTSGEAVWGSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-ALPHA-1,5-ARABINANASE
publication title New Evidence for the Role of Calcium in the Glycosidase Reaction of Gh43 Arabinanases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 128
structure length 443
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.99: Arabinan endo-1,5-alpha-L-arabinosidase.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF16369 GH43_C C-terminal lipocalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.10 Mainly Beta Beta Barrel Lipocalin Lipocalin 2x8tA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 2x8tA01
2X8SA 4KCBA 3OM4A 3ZXKA 2QQUA 3QEDA 4D47A 4EQVA 3VT2A 5FMCA 4N2RA 3KF3A 3LIHA 1Y7BA 1VKDA 3AKHA 3WN2A 4KC8A 3SC7X 3OM2A 4NOVA 1UYPA 2QQVA 3CU9A 5A7VB 5JOZA 5FK7A 3QZ4A 5A8DA 1GYEB 3UGHA 2YFTA 3LIGA 4AK6A 3VSZA 3TAWA 5JOWA 2AEYA 5JOXA 4U6BA 4FFHA 4UDKA 5AY9A 4O8OA 1ST8A 3PIJA 4UDKE 2X8FA 3VT0A 3VSFA 3OM6A 3BYLA 2EXHA 4U6DA 4PVIA 5FKBA 5A8CA 1JIWI 4N4BA 4O8PA 3LEMA 4KC7A 3R4YA 5B6TA 4ONZA 2AEZA 5FLWA 3ZXLA 2EXJA 5FMBA 3WPYA 2B4WA 4PVAA 2EXIA 2OXBA 3D5ZA 1Y9MA 3U75A 3LFIA 3WPZA 5FMDA 3OM7A 5GLRA 3AKIA 3KF5A 1WL7A 1OYGA 3R67A 3WN0A 3WPVA 3P2NA 3LDKA 5GLKA 4QQSA 3KSTA 3WASA 2YFRA 3D5YA 1GYDB 2VDTA 5GLOA 4COTA 3BYNA 3NQHA 3WAUA 4KMIA 5C0PA 1PT2A 3WATA 5GLLA 3U14A 3PIGA 5FKCA 1Y4WA 1UV4A 1W2TA 3AKFA 3BYKA 3C7HA 5ANNA 3WMZA 2X8TA 4AK5A 3BYJA 5AYCA 3UGGA 3QEEA 4UDJA 5FIXA 3VSSA 3LV4A 3C7GA 3QC2A 3WMYA 5JOYA 4UDGA 3QEFA 4FFFA 3RWKX 2ADEA 4MLGA 3ZXJA 4O8NA 3C7OA 3K1UA 4FFGA 4N2ZA 3VSRA 3OM5A 5GLQA 4AK7A 1YRZA 2ADDA 3D60A 2RN4A 3D61A 5GLPA 4FFIA 1GYHA 3UGFA 4N1IA 5GLNA 1YI7A 3R4ZA 3C7FA 1YIFA 3VT1A 3C7EA 2YFSA 2XQRA 4UDIA 5GLMA 3LDRA 5A7VA 1SMPI 1Y9GA 5B6SA 2EXKA 5AYDA 5AYEA 4KCAA 1W18A 3C2UA 3WN1A 2QQWA 3AKGA 2AC1A 3WPUA 3LF7A 5FK8A
chains in the Genus database with same CATH superfamily
4ORXA 2UZ2A 4N2RA 1VWOB 4YDBA 2RTKA 1SY0A 4HPDA 4YKMA 5LJHA 1AVGI 2RTRB 3VG7A 3ZW2A 4K19A 1MOYA 1RBPA 3LIGA 3G7XA 4PJ2A 5AY9A 1KT6A 4O49A 2OVEA 3T2XA 2C1QA 1VWPB 2FRSA 3NPOA 4XMHA 3OE3A 1SLGB 5K68A 4CDEA 1Y53X 1I78A 1DZKA 2DJGA 5GLRA 1MDCA 4B55A 5IRWA 1DF3A 4Y59A 2RTNB 4U9CA 3R67A 1O8VA 3S26A 2RTLA 3WASA 2YFRA 3FA6A 2UYWA 3FLLA 1Y4WA 2L68A 1OSPO 3WZOA 1PMPA 2E4JA 5L8IA 3TGCA 2QMIA 3ZXJA 1SWCA 1BEBA 1S2PA 2JOZA 4WHIA 3LHNA 2OVDA 5GLPA 4XMGA 5GLNA 2G78A 2YFSA 4Y0SA 5GLMA 1O1UA 4GDAA 2KTSA 1DFVA 5B10O 4QRLA 3LTWA 1IFCA 4CDFA 1HBPA 5EPQA 1T0VA 4ORYA 2MJIA 2JW1A 1YP7A 3RY1A 2Z4HA 1Y7BA 4BVMA 3OM2A 1X8OA 1SREA 3SZJA 2FR2A 1GYEB 5LKEA 3NQKA 1NDJA 4HWMA 2AEYA 1MVGA 2OVAA 4ODDA 1BWYA 1KT4A 5AQ6A 3MVFA 4IRWA 4EQAC 4BX6B 3RDOA 3BYLA 1NC9A 3FW5A 2EXHA 3BSZE 5F6ZA 3LEMA 4GUZA 3AEHA 4GGZA 2OYBO 4YBPA 4AZMA 2WUTA 4M6SA 1HXZA 3NADA 2RTCB 3JSQA 2GTLO 3VG2A 5HZ8A 1VYGA 5F1EA 3ZQ3A 5HZ6A 4ORUA 3WAUA 4LZVA 4FBVA 3SLOA 3D9WA 3AKFA 5KICA 2QO6A 3TZSA 3BYJA 4AZRA 2LBAA 5FIXA 2WEWA 2IZDB 1SRIA 3H3IA 4JNJA 1GT5A 1U18A 4Z2PA 1BSQA 2WWPA 3QQ2A 4GNWA 1SRGA 5GLQA 2ADDA 3O22A 4YCHA 3SOTA 4NV8A 4QZTA 1SLFB 4OMWA 3RE6A 1DF8A 3AKGA 1A3YA 4ZR2A 3FA9A 2M4LA 3VHHA 2MO5A 2RCTA 1YUPA 4BJ8A 4KC8A 1ACDA 1EW3A 4MVKA 5A7VB 4O3XB 5L3YA 2A13A 3T1DA 1LELA 3VSZA 3HTYA 1AVEA 3EBKA 4O8OA 1PBYA 2Y32A 2IZJA 1KL4A 4C5PA 2HKDA 1E02A 4KC7A 5HCDC 4I6SA 2Q39A 5D4AA 2AF5A 1Y9MA 1DZJA 5EDBA 3AKMA 3RWXA 3FA7A 4KT5A 3C78X 5GLKA 4ZHFA 2X55A 1ML7A 4TKBA 1GYDB 3PQSA 4QYPA 3U14A 2X8TA 5H9NA 3FENA 4HFOA 2YMSA 5LJCA 3UEVA 4XMDA 2IZAA 2X34A 5KHPA 1N0SA 2CAMA 4WFUA 4N1IA 4ML7B 4YFQA 1Y9GA 1STSB 1HMSA 1OEKA 1W5RA 2X8SA 3RY2A 3VE2A 1QABE 1EPAA 1SLDB 1VKDA 3PH6A 1QY1A 1SXYA 1ADLA 3VPJE 2YFTA 4ORSA 3APXA 3Q6LA 4YH0A 1PBOA 3TAWA 1LFOA 4U8UN 1KL3A 4Y0PA 3WJEA 2IZEB 1BBPA 3D96A 1JJUA 4ZFXA 1ZNHA 4O8PA 3NP1A 2FHNX 4RUNA 3VHMA 4HPAA 2JN3A 1TOUA 3OM7A 1JBHA 1N9YA 3P2NA 1SA8A 4IAWA 4GDZA 1I06A 4EFGA 1SWAA 4GRJA 1G85A 1SWRA 2R56A 3VSSA 3C7GA 1STPA 1FDQA 2X32A 5EDCA 3ZW0A 1VWRB 1CBIA 3QEFA 3VG3A 2IZIA 3N91A 4U8UM 4FQBB 5C0NA 4LZUA 4GKCA 4BOEA 3RSWA 3ZUIA 4TLJA 3ZW1A 3UGFA 1VYFA 5B29A 1GX8A 1IJ8A 3FIDA 5FQ8E 4CPFA 3FEKA 3QKGA 3HWFA 4IB6A 4YGHA 4BGFA 3ZZVA 4ZH6A 4D6AA 3S5VA 3PH5A 3TF6A 2ACOA 2MF6A 2AH7X 4MVIA 3WYPA 3VGWA 1K3BA 5JOWA 4U6BA 1NP4A 3KQ0A 2QO4A 3RDQA 4OELA 2Q2PA 4ALBA 4UDKE 3VSFA 2LA7A 3P6HA 3FMZA 4WFVA 4ONZA 5HA0A 1EUOA 2EXJA 2FT9A 2RQ0A 1SWEA 1IKEA 4O9SA 1WL7A 2BT9A 1GT4A 3F8AA 3CBSA 5LJGA 4EEJA 2BHVA 3NQHA 3B2KA 4Y0RA 3STMX 1JQPA 4QGWA 1UV4A 5ANNA 2BS5A 4UDJA 3PQUA 3WYQA 4CPHB 3RDSA 2KD2A 5F2BA 3P6GA 2F73A 2KTDA 1I9HA 1YWBA 1N4JA 4N2ZA 1ZRYA 1HXLA 4ZHGA 5C2MA 3TGAA 3WZQA 3D60A 5BYPA 2OF8A 3RDMA 2A5CA 3BX8A 2JMBA 1S7DA 2A0AA 1PTSA 1LF7A 1XCAA 4INNA 1ZNKA 4ZCBA 5K67A 4UDIA 5H9KA 1KFFA 4ORWA 5K06A 3ZWEA 1LKEA 5IO5A 4KCBA 1BRQA 1GKAB 3RZYA 2G7BA 3SZHA 1YWAA 2A2UA 5FMCA 4BX5B 3FDCA 1STRB 3PPTA 3VHIA 1TOWA 2OY8A 3F9DA 5BVTA 5JOZA 4IAXA 3EW1A 2RTBB 5AJBA 1I05A 4YGZA 4UDKA 3BX7A 3EW2A 3KFHA 4ON1A 3WXQA 4U6DA 4LQZA 4QGXA 3V8UA 4O4UA 2OXBA 4FBRA 2W2AA 4MVLA 3MBTA 3WPZA 4EXZA 2FTBA 1TL2A 1OYGA 1OEJA 2WQ9A 2NNEA 3WPVA 2WR6A 3LDKA 3P6EA 1IW2A 1IIUA 4BQUA 5C0PA 3VE1A 4L1NA 3WMZA 3QEEA 3IA8A 2ZAIA 4UDGA 1UYNX 3JQOA 4ZH9A 4NV7A 5HCEC 3D61A 3P6CA 3WJBA 5HTEA 1JJXA 2DJFA 1OBQA 2W2FA 3WJGA 3U03A 3C2UA 1B56A 2AC1A 2A2GA 3LF7A 1LDOA 3ZXKA 2N93A 2ACPX 3CR6A 4OKAA 4BX6A 3LIHA 1SLEB 3WJFA 2AVIA 4NNTA 4OS0A 1CBSA 3CU9A 1GX9A 4HPBA 3APWA 1NP1A 4GK9A 3X00A 3HOLA 1JYDA 3T6FA 2RTHB 5A8CA 5FKBA 2C1SA 3D97A 3HK1A 3ZXLA 1BJ7A 1UZ2X 3FR2A 5FENA 3O19A 1DC9A 2QM9A 4QYNA 1LIBA 4MEEA 4GU8A 2Q4NA 3FR5A 4O3ZA 4OS8A 4ID2A 3KFIA 4DQ4A 1I4UA 4CK4A 4NW4A 3STKA 1I04A 1FJ1E 3C7HA 3B2HA 1B0OA 2RTFB 2WEXA 4DQ3A 4GJSA 4NYRA 3D4RA 1RSTB 2ASNX 4CDCA 2X45A 2LBVA 3PP6A 5HZ9A 1Y55X 1KXOA 3E3CA 1KQXA 2DM5A 4GNYA 1T68X 4I95A 4XMFA 3HWGA 5A7VA 4ORRA 4ZHDA 3UEUA 3FA8A 1E2TA 1VWHB 2QQUA 1JZUA 2YG2A 3RDXA 2X56A 3D95A 2R73A 3PECA 3AKHA 3SC7X 2I5VO 2A8GA 4FBOA 1W6FA 5JOXA 1KZXA 3MX7A 3OM6A 4PVIA 4YFPA 3C76X 3R4YA 5HAEA 1RXJA 3WJCA 4EDEA 1VYOA 2XKLA 1VWQB 1D3SA 2VDTA 1GT1A 1AQBA 3STNA 4MVEA 1IKJA 5FKCA 1H91A 1VWFB 2VFBA 1KOIA 1MUPA 3RWKX 2ADEA 4MLGA 4O8NA 1KT7A 3WZPA 1E06A 2CBSA 1O1VA 2FHLA 3MM0A 2QCBA 4IB7A 1G74A 5D45A 5KIDA 1N7YA 3MG5A 3DTQA 1W18A 3WN1A 2HNXA 4Z2VA 3FIQA 1G5WA 1EIIA 2WPUA 3OM4A 4EQVA 1A57A 5IRUA 4YDAA 3T2WA 2G5LA 1ALBA 3VG5A 4AW8A 2FS7A 1BRPA 1OPAA 1GXAA 1EXSA 3APVA 3TGBA 4NNSA 2FKJA 2K23A 4A60A 5F7GA 5IO6A 1DZMA 1N43A 5FMBA 3OBLA 4TJZA 2RTDB 1FENA 2A3FX 1X71A 3CBCA 3AKIA 4BCSA 4I3BA 3EM0A 4GZVA 3BDRA 4GGRA 1PT2A 3PIGA 1LNMA 2QOMA 1EALA 1W4TA 5EEDA 1QG5A 3EC5A 1RSUB 2AT8X 3BY0A 1SXUA 1JV4A 2L67A 3NX2A 4CSBA 1SWQA 4U8UO 5L8OA 1NQNA 3RE5A 1BSYA 1R0UA 1GYHA 5FAZA 3WOVA 1VWCB 1AB0A 3LDRA 1SMPI 4O3YA 4YFRA 2EXKA 4L3RA 5LJBA 4KCAA 1BLRA 2OVSA 2JU7A 2LKKA 5FK8A 1SWLA 2MM3A 1LIDA 5DPQA 1CRBA 4GETA 4JGLA 1TW4A 1P6PA 4ES7A 1DZPA 4YBUA 2RD7C 1UYPA 4XMCA 2OFBA 1VWJB 3QZ4A 1JJJA 4AK6A 3CKGA 4AYHA 3EYCA 3U9PC 4BX7B 5JD2A 2VFCA 2RTAA 1Z24A 1GM6A 3ELXA 2IZHB 3WVMA 3NQ3A 1ZNEA 2RCQA 1MM9A 5LJDA 1RAVA 3B2IA 4CPHA 5LJKA 3UAQA 3Q34A 3BLGA 2Q2MA 4TKJA 4ALOA 5AYCA 3AUMO 4ZGUA 3QC2A 4RUUA 1SWHA 1SWNA 4FGIB 1TVQA 1GKAA 4TQ2A 1YRZA 1OPBA 2RTPB 4BX5A 4PSQA 2IZGB 1YI7A 1LCVA 3BU9A 5CE4A 5HTDA 1T8VA 1ERBA 2CZTA 5HCCC 1SY1A 1VWLB 3SAOA 3NBXX 4D47A 1SWOA 2Y3FA 5IRAA 2KT4B 1BSOA 1JMZA 3F6ZB 3SZIA 1OBUA 3KF3A 4QAEA 1RLBE 3SLTA 4KH8A 4HPCA 5H9LA 3CWKA 4LKPA 3RDUA 1X8UA 2JU3A 1OEEA 1A18A 1YIVA 5B3MO 5CHKA 1VWBB 2RTIB 2POAA 3FW4A 2FLJA 3S60A 1HBQA 1LIEA 1UREA 2BS6A 3BRNA 1QQSA 5B2AO 5DG4A 3WN0A 2OF9A 4I9SA 2XSTA 5GLOA 1AELA 4AK5A 1ERXA 4AZNA 3ZUOA 2IZKA 1ICNA 1VWIB 5B27A 1UYOX 5JR8A 4FFFA 1GT3A 1B8EA 3OM5A 4AK7A 3P02A 2RTJA 2IZFB 3JS1A 5AJCA 3APUA 1SWJA 4Y0QA 1X8PA 3AKNA 5F6BA 5AYEA 4AZQA 4ZHCA 3WPUA 5IO7A 4N7DA 2QO5A 1D2UA 2AKQA 3L4RA 1HMTA 5CSEA 2RTEB 3HWDA 1SY3A 1VWDB 3WN2A 1FTPA 1NQMA 5A8DA 5D48A 3UGHA 3UEWA 2NP1A 3OJYC 1ZNDA 1QWDA 1B4MA 1Y9LA 4MISA 3PIJA 2X8FA 1N9MA 4IB8A 5BVSA 2R74A 1CBQA 2BC3A 4N4BA 5B6TA 1VWKB 2RTOB 1YWDA 4U3QA 4NLIA 4U46A 3U75A 1KQWA 5B11O 3KF5A 3RKGA 2ZAGA 2OY5O 3WBGA 2AMMX 4GJVA 2LB6A 1MK5A 4BBOA 1SWKA 1W2TA 2CBRA 4NLJA 1E00A 2Y3EA 5HA1A 2F01A 1RXKA 1RXHA 1IFBA 1S44A 5HZ5A 1SRFA 3HWEA 3K1UA 1X89A 1VWNB 2RN4A 2GTFX 1KL5A 1X8NA 1LICA 3B2JA 4OMXA 2MWHA 4IB9A 2AT6X 4R0BA 1FELA 2GTLN 2QQWA 3PEDA 3VU1A 5F58A 1HY2A 3VT2A 1KGLA 4GE1A 1JYJA 1LPJA 4I9RA 2AL0X 1SWGA 1GGLA 4ZHHA 2QQVA 4Z28A 5LJEA 1SWTA 2BSZA 3KFFA 3IFBA 2HLVA 4ZJ0A 5HZQA 1WBIA 2ANSA 3FYFA 3NX1A 5FQ6E 1GX3A 2NNDA 4Y5DA 3WPYA 1SY2A 2B4WA 3EMMA 4CPIA 2EXIA 2G8CO 3GE2A 4ARHA 1Y0GA 1VWGB 2GTLM 4OS3A 2OFRX 4YKOA 2Q9SA 4QQSA 1VWMB 3P6FA 4QGVA 4COTA 4KMIA 2L5PA 1SWPA 2RTMA 4XMEA 1YP6A 4I3CA 1U17A 4EKVA 2ALLX 3LV4A 4YGGA 3C77X 1HMRA 3B2LA 1EIOA 1SRJA 4FFGA 1EI5A 3WZNA 3CQNA 3T6LA 1QFVA 5LKFA 3KFGA 3KVNA 1G7NA 1YIFA 5AEOA 2XQRA 3FEPA 3BS2A 1DV9A 4GD9A 1QY0A 4YMYA 1SXXA 4IBAA 3QEDA 1ZNLA 3I0AA 3CKFA 2I5ZO 2A5BA 2OY1O 4JO6A 3GAQA 2FGSA 2HYSA 2CZUA 5B5FA 3WJDA 2OZQA 2HMBA 1LUQA 4DCBA 4I3DA 4WBKA 4CV7A 2OFMX 1SWUA 2NNQA 3VG4A 5HBSA 3PDFA 5HWZA 4QZUA 3D5ZA 5FMDA 3NR3A 2AT3X 4CPEA 1ZNGA 2WQAE 3OD9A 3BYNA 4A8ZA 2X4MA 2IZCB 5EZ2A 3BYKA 4D6BA 2FR3A 1QFTA 2W2BA 2AT0X 1KZWA 3FELA 2BLGA 3VG6A 3WMYA 1NBXA 5CYBA 5FQ7E 2EU7X 2AT5X 3VSRA 4N7CA 1SWFA 2IZLB 1K24A 4JHQA 3C7FA 3VT1A 1X8QA 3NQ9A 4NP1A 4GGTA 3HPEA 2IFBA 5AYDA 1E5PA 1XKIA 1Y52X 2QOSC 4UU3A 5FFHA 4BX7A 2RTQB 3SLJA 4GH7A 4YVBA 1LCZA 2O62A 2F09A 1JMXA 2K62A 3ELZA 4KIIA 1A2DA 3FR4A 1MEPA 4FFHA 3RBYA 1HQPA 3CMPA 3CQRA 3VT0A 2RA6A 2CM4A 2PY1A 4TKHA 1Y9TA 5FLWA 4O3WA 1HN2A 1WUBA 5H8TA 1PM1X 3LFIA 2FKGA 2P8GA 1AVDA 4AZOA 3I17A 3UEXA 2VDFA 5D8JA 1OBPA 4O4XA 1HQQA 2CM9A 3D5YA 1LCWA 4QQ1A 1LIFA 1EQDA 3WATA 5GLLA 2GJ5A 4TNNA 3UGGA 1YWCA 3K3LA 3DSZA 4M7MA 4OEMA 4LKTA 4CDDA 3C7OA 2JGSA 4DNEA 1MX8A 1VWAB 3P6DA 3HOEA 4Z2OA 2GH7A 1CBRA 3KZAA 2HZQA 1BM5A 3R4ZA 5EEEA 1TXLA 1NGLA 1SRHA 3ZW0B 1FE3A 2GC9A 2X46A 1FEMA 2ZSCA 4ZGFA 3ZW1B 2LFOA 4IMNA 4A1HA 2OY7A 4Z27A 4NOVA 4A1YA 4O4SA 5FK7A 1L6MA 2JU8A 3BU1A 2WSJA 2KW1A 1VPRA 1CJ5A 2IZBA 3EBWA 3S5XA 4UU2A 2OL7A 1ST8A 5IXGA 2C4IA 2RTGB 2Z4IA 1ICMA 1SXWA 1JIWI 4I60A 2AEZA 2OL8O 4IABA 4PVAA 3P24A 4YCEA 1SWDA 1MX7A 2MHDA 1QY2A 4NYQA 4IMOA 1KT5A 3KSTA 5B5GA 4Z6JA 1SWBA 5H9AA 3O2YA 1KT3A 3U0DA 1SWSA 5D47A 2OL6O 2FS6A 1EPBA 5JOYA 1LDQA 1VWEB 4AZPA 2OFAA 4QNIA 4FFIA 4O4OA 5L8NA 3C7EA 2PI3O 3PK2A 5BVQA 5B6SA 1PEEA 4MIRA 2FWVA 2L9CA 3ZI8A 2G79A 1U0XA 2HZRA
chains in the Genus database with same CATH topology
1EIIA 5F58A 3OM4A 4ORXA 3ZZVA 4EQVA 4ZH6A 4D6AA 3VT2A 1A57A 4YDAA 3S5VA 4N2RA 1KGLA 4GE1A 1ALBA 1JYJA 3VG5A 1LPJA 4I9RA 4AW8A 2AL0X 4YDBA 2FS7A 3PH5A 1GGLA 3TF6A 2ACOA 1BRPA 1OPAA 1GXAA 4HPDA 1SY0A 2AH7X 4ZHHA 1EXSA 3APVA 4MVIA 2QQVA 4YKMA 3TGBA 5LJHA 1AVGI 5LJEA 3VG7A 4NNSA 3ZW2A 4K19A 1RBPA 3LIGA 2K23A 4A60A 3G7XA 5JOWA 4U6BA 4PJ2A 1NP4A 3KQ0A 2QO4A 3KFFA 5AY9A 5F7GA 3IFBA 2Q2PA 5IO6A 4ALBA 4UDKE 1KT6A 2HLVA 4O49A 4ZJ0A 3VSFA 2OVEA 2LA7A 5HZQA 3P6HA 2ANSA 3FMZA 3FYFA 1DZMA 3NX1A 2FRSA 5FQ6E 2NNDA 4WFVA 3NPOA 4ONZA 5HA0A 1EUOA 4XMHA 3OE3A 2EXJA 5FMBA 3WPYA 1SY2A 2B4WA 3OBLA 4TJZA 3EMMA 2FT9A 2EXIA 2RQ0A 3GE2A 1DZKA 1FENA 4ARHA 2A3FX 1X71A 3CBCA 1IKEA 1MDCA 2GTLM 4O9SA 4OS3A 3AKIA 1WL7A 5GLRA 2OFRX 1DF3A 4I3BA 4U9CA 2BT9A 3R67A 1O8VA 4YKOA 1GT4A 3S26A 3F8AA 2Q9SA 3CBSA 3EM0A 4GZVA 5LJGA 4EEJA 2YFRA 4QQSA 3WASA 3P6FA 4QGVA 2BHVA 4COTA 3NQHA 3BDRA 3B2KA 4Y0RA 4KMIA 3STMX 3WN1A 2L5PA 1PT2A 4XMEA 3FA6A 3FLLA 4QGWA 3PIGA 1Y4WA 1YP6A 2L68A 1LNMA 1UV4A 5ANNA 2BS5A 4I3CA 1U17A 1PMPA 2ALLX 4UDJA 3PQUA 3FIQA 3LV4A 2E4JA 2KD2A 5L8IA 4YGGA 3TGCA 1EALA 5EEDA 1QG5A 3C77X 1HMRA 2QMIA 2F73A 2AT8X 2KTDA 3P6GA 1G5WA 3B2LA 3BY0A 1EIOA 1YWBA 3ZXJA 1SXUA 1JV4A 2L67A 1BEBA 3NX2A 1ZRYA 4CSBA 4FFGA 4N2ZA 1S2PA 4U8UO 5L8OA 1EI5A 2JOZA 4WHIA 4ZHGA 3LHNA 3TGAA 3PEDA 2OVDA 3D60A 5BYPA 5GLPA 1BSYA 1R0UA 1GYHA 3CQNA 1QFVA 4XMGA 3BX8A 5GLNA 2JMBA 1S7DA 2A0AA 5FAZA 5LKFA 3WOVA 3KFGA 1G7NA 1LF7A 1AB0A 1XCAA 2G78A 4INNA 5AEOA 1ZNKA 1YIFA 2XQRA 4Y0SA 4ZCBA 2YFSA 4UDIA 5H9KA 5GLMA 3FEPA 3LDRA 1SMPI 3BS2A 4O3YA 1DV9A 4YFRA 4ORWA 5K06A 2EXKA 4L3RA 5LJBA 1QY0A 1O1UA 2KTSA 3ZWEA 4KCAA 4YMYA 1DFVA 1BLRA 1LKEA 1SXXA 2OVSA 2JU7A 4IBAA 5IO5A 4QRLA 2LKKA 5FK8A 1IFCA 1HBPA 5EPQA 4KCBA 1BRQA 1GKAB 1T0VA 1ZNLA 1LIDA 2G7BA 2MM3A 3I0AA 3RZYA 4ORYA 3QEDA 2MJIA 2JW1A 1YWAA 1CRBA 2A2UA 4GETA 5DPQA 4JGLA 5FMCA 1YP7A 1TW4A 1P6PA 2Z4HA 1Y7BA 4BVMA 4ES7A 1DZPA 3PPTA 4YBUA 2RD7C 3GAQA 1UYPA 3OM2A 1TOWA 2HYSA 3F9DA 4XMCA 5BVTA 2CZUA 1X8OA 5JOZA 4IAXA 3QZ4A 2FR2A 1GYEB 5LKEA 1JJJA 3NQKA 3WJDA 4AK6A 5AJBA 2OZQA 4AYHA 4HWMA 2AEYA 3EYCA 1I05A 1MVGA 2OVAA 4ODDA 4YGZA 1KT4A 2HMBA 3U9PC 1BWYA 4UDKA 3BX7A 5AQ6A 3KFHA 3MVFA 4I3DA 4WBKA 4ON1A 4CV7A 2OFMX 4EQAC 2NNQA 3BYLA 3FW5A 2EXHA 3BSZE 3VG4A 3WXQA 4U6DA 5F6ZA 1Z24A 3LEMA 1GM6A 3ELXA 4LQZA 5HBSA 3WVMA 4QGXA 3NQ3A 1ZNEA 4YBPA 4AZMA 2RCQA 2WUTA 4M6SA 3V8UA 5LJDA 4O4UA 5HWZA 2OXBA 4FBRA 4QZUA 3D5ZA 2W2AA 4MVLA 3MBTA 3B2IA 5LJKA 4EXZA 5FMDA 3WPZA 2FTBA 3NR3A 3UAQA 2AT3X 3BLGA 3NADA 3JSQA 1ZNGA 2GTLO 1OEJA 3VG2A 2WQ9A 5HZ8A 1OYGA 2NNEA 2WQAE 3WPVA 1VYGA 2WR6A 2Q2MA 3P6EA 5F1EA 3ZQ3A 3LDKA 5HZ6A 1IW2A 4ORUA 1IIUA 3OD9A 4BQUA 3BYNA 4LZVA 3WAUA 4FBVA 5C0PA 4A8ZA 3VE1A 4L1NA 5EZ2A 3AKFA 4D6BA 5KICA 3BYKA 2FR3A 2QO6A 3WMZA 4TKJA 1QFTA 3TZSA 4ALOA 2W2BA 2AT0X 1KZWA 3BYJA 4AZRA 5AYCA 3FELA 3QEEA 2LBAA 5FIXA 3IA8A 2WEWA 4ZGUA 2BLGA 3VG6A 3H3IA 2ZAIA 3QC2A 3WMYA 4RUUA 5CYBA 1GT5A 1U18A 4UDGA 3JQOA 1BSQA 5FQ7E 2WWPA 4ZH9A 2EU7X 2AT5X 3VSRA 4FGIB 4GNWA 1TVQA 4N7CA 5GLQA 1GKAA 4TQ2A 5HCEC 1YRZA 2ADDA 1OPBA 3O22A 3D61A 4YCHA 3P6CA 4PSQA 3WJBA 5HTEA 3SOTA 1YI7A 1JJXA 3C7FA 4QZTA 3VT1A 1X8QA 1OBQA 3NQ9A 3BU9A 5CE4A 5HTDA 2W2FA 4NP1A 4OMWA 2IFBA 3WJGA 5AYDA 1T8VA 2CZTA 1ERBA 5HCCC 1SY1A 3U03A 3C2UA 1B56A 3AKGA 1A3YA 1E5PA 1XKIA 2QOSC 2A2GA 4ZR2A 3SAOA 3NBXX 2AC1A 3LF7A 3FA9A 4UU3A 3ZXKA 5FFHA 4D47A 2M4LA 2N93A 2KT4B 2ACPX 1BSOA 3F6ZB 3CR6A 4GH7A 1OBUA 2O62A 2F09A 4QAEA 3KF3A 3LIHA 2MO5A 2RCTA 3WJFA 1YUPA 4NNTA 1RLBE 4KH8A 4KC8A 4OS0A 4HPCA 1ACDA 1CBSA 1EW3A 4MVKA 5H9LA 3CU9A 5A7VB 2K62A 3CWKA 1GX9A 4O3XB 4LKPA 2A13A 3ELZA 4KIIA 3T1DA 1A2DA 4HPBA 3FR4A 3APWA 3VSZA 1NP1A 4GK9A 3HTYA 4FFHA 3EBKA 1X8UA 4O8OA 2JU3A 1OEEA 3RBYA 1A18A 1HQPA 3CMPA 3HOLA 3CQRA 1YIVA 3VT0A 1JYDA 2RA6A 2CM4A 2PY1A 5FKBA 5A8CA 1E02A 4TKHA 1Y9TA 2POAA 4KC7A 5HCDC 3D97A 4I6SA 5FLWA 2Q39A 3HK1A 3ZXLA 4O3WA 1BJ7A 3FW4A 1UZ2X 2FLJA 1HN2A 3S60A 3FR2A 1HBQA 1LIEA 1UREA 5D4AA 3O19A 2BS6A 3BRNA 1QQSA 5FENA 5H8TA 1DC9A 1DZJA 1PM1X 5EDBA 1Y9MA 3LFIA 2QM9A 2P8GA 4QYNA 3AKMA 1LIBA 3RWXA 4AZOA 3I17A 3FA7A 4GU8A 2Q4NA 4KT5A 5DG4A 3UEXA 3FR5A 4O3ZA 3C78X 4OS8A 3WN0A 4ID2A 5D8JA 5GLKA 1OBPA 4ZHFA 4O4XA 1ML7A 2CM9A 3KFIA 4DQ4A 3D5YA 1I4UA 4I9SA 4NW4A 3STKA 4CK4A 2XSTA 3PQSA 4QQ1A 4TKBA 1LIFA 5GLOA 1AELA 1EQDA 4QYPA 1I04A 3WATA 5GLLA 2GJ5A 3U14A 4TNNA 3C7HA 3B2HA 4AK5A 2X8TA 1ERXA 1B0OA 4AZNA 3ZUOA 5H9NA 3UGGA 2WEXA 1YWCA 3K3LA 3FENA 4HFOA 1ICNA 3DSZA 2YMSA 4M7MA 3UEVA 4DQ3A 4XMDA 5B27A 5LJCA 4NYRA 4LKTA 3D4RA 5JR8A 4FFFA 1GT3A 1B8EA 3C7OA 2ASNX 3OM5A 4AK7A 2X45A 3P02A 5KHPA 1MX8A 1N0SA 2LBVA 3PP6A 3JS1A 3P6DA 4WFUA 5HZ9A 3HOEA 1KXOA 3E3CA 1KQXA 2DM5A 5AJCA 4N1IA 1CBRA 3KZAA 2HZQA 1T68X 3APUA 4GNYA 4Y0QA 1X8PA 4I95A 1BM5A 3R4ZA 4XMFA 5EEEA 3AKNA 1TXLA 4ML7B 4YFQA 5F6BA 3HWGA 5A7VA 1Y9GA 4ORRA 4ZHDA 1HMSA 1NGLA 1OEKA 3UEUA 3ZW0B 2GC9A 1FE3A 5AYEA 2X46A 1FEMA 4AZQA 4ZHCA 3WPUA 5IO7A 3FA8A 4N7DA 2X8SA 2QO5A 1D2UA 2QQUA 1JZUA 2AKQA 2YG2A 3L4RA 3D95A 3VE2A 1HMTA 4ZGFA 3ZW1B 2LFOA 4IMNA 1QABE 2R73A 3HWDA 1EPAA 1SY3A 4A1HA 1VKDA 3PECA 3AKHA 3WN2A 3SC7X 4NOVA 3PH6A 4FBOA 1FTPA 4A1YA 4O4SA 1QY1A 1L6MA 1SXYA 1ADLA 5FK7A 5A8DA 3VPJE 2JU8A 3BU1A 5D48A 3UGHA 2YFTA 3UEWA 4ORSA 2NP1A 3APXA 3Q6LA 3OJYC 2WSJA 1PBOA 1ZNDA 4YH0A 3TAWA 5JOXA 1KZXA 1QWDA 2KW1A 1VPRA 1LFOA 1B4MA 1CJ5A 3EBWA 3S5XA 1Y9LA 4U8UN 4UU2A 4Y0PA 1ST8A 4MISA 3PIJA 3MX7A 3WJEA 2X8FA 3D96A 1BBPA 3OM6A 2Z4IA 1ICMA 1SXWA 4IB8A 5BVSA 4PVIA 4YFPA 2R74A 1JIWI 4ZFXA 1ZNHA 1CBQA 3C76X 3NP1A 4N4BA 4O8PA 3R4YA 5B6TA 4RUNA 5HAEA 2AEZA 4IABA 1YWDA 4HPAA 3P24A 4NLIA 4U3QA 4YCEA 4PVAA 3WJCA 3U75A 2JN3A 1TOUA 1KQWA 3OM7A 1JBHA 1MX7A 2MHDA 3KF5A 3RKGA 1QY2A 2ZAGA 4EDEA 4NYQA 4IMOA 3WBGA 2AMMX 1KT5A 3P2NA 1SA8A 2XKLA 2LB6A 3KSTA 1D3SA 2VDTA 1GT1A 4IAWA 1AQBA 3STNA 4GDZA 1I06A 4MVEA 4EFGA 1IKJA 4GRJA 5H9AA 1G85A 3O2YA 1H91A 5FKCA 1W2TA 1KT3A 2CBRA 3U0DA 1KOIA 1MUPA 5D47A 4NLJA 2FS6A 1E00A 2R56A 3VSSA 1EPBA 3C7GA 5HA1A 1FDQA 5JOYA 5EDCA 3ZW0A 1IFBA 1S44A 1CBIA 3QEFA 3VG3A 3RWKX 5HZ5A 2ADEA 4MLGA 3HWEA 3N91A 4U8UM 3K1UA 4FQBB 4O8NA 5C0NA 1KT7A 4LZUA 4GKCA 4AZPA 1E06A 2CBSA 1X89A 4BOEA 2RN4A 4QNIA 1O1VA 3RSWA 3ZUIA 2GTFX 4O4OA 4TLJA 1GYDB 3ZW1A 4FFIA 1VYFA 5B29A 1GX8A 3UGFA 5L8NA 1X8NA 5FQ8E 3C7EA 1LICA 3B2JA 5BVQA 4OMXA 5B6SA 4IB7A 1G74A 2MWHA 5D45A 4IB9A 1PEEA 3FEKA 5KIDA 3QKGA 4MIRA 2AT6X 2FWVA 3HWFA 3DTQA 4R0BA 2GTLN 1FELA 1W18A 2L9CA 2HNXA 4IB6A 3ZI8A 4YGHA 2G79A 2QQWA 1U0XA 2HZRA 3VU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8S A;  4KCB A;  3OM4 A;  3ZXK A;  2QQU A;  3QED A;  4D47 A;  4EQV A;  3VT2 A;  5FMC A;  4N2R A;  3KF3 A;  3LIH A;  1Y7B A;  1VKD A;  3AKH A;  3WN2 A;  4KC8 A;  3SC7 X;  3OM2 A;  4NOV A;  1UYP A;  2QQV A;  3CU9 A;  5A7V B;  5JOZ A;  5FK7 A;  3QZ4 A;  5A8D A;  1GYE B;  3UGH A;  2YFT A;  3LIG A;  4AK6 A;  3VSZ A;  3TAW A;  5JOW A;  2AEY A;  5JOX A;  4U6B A;  4FFH A;  4UDK A;  5AY9 A;  4O8O A;  1ST8 A;  3PIJ A;  4UDK E;  2X8F A;  3VT0 A;  3VSF A;  3OM6 A;  3BYL A;  2EXH A;  4U6D A;  4PVI A;  5FKB A;  5A8C A;  1JIW I;  4N4B A;  4O8P A;  3LEM A;  4KC7 A;  3R4Y A;  5B6T A;  4ONZ A;  2AEZ A;  5FLW A;  3ZXL A;  2EXJ A;  5FMB A;  3WPY A;  2B4W A;  4PVA A;  2EXI A;  2OXB A;  3D5Z A;  1Y9M A;  3U75 A;  3LFI A;  3WPZ A;  5FMD A;  3OM7 A;  5GLR A;  3AKI A;  3KF5 A;  1WL7 A;  1OYG A;  3R67 A;  3WN0 A;  3WPV A;  3P2N A;  3LDK A;  5GLK A;  4QQS A;  3KST A;  3WAS A;  2YFR A;  3D5Y A;  1GYD B;  2VDT A;  5GLO A;  4COT A;  3BYN A;  3NQH A;  3WAU A;  4KMI A;  5C0P A;  1PT2 A;  3WAT A;  5GLL A;  3U14 A;  3PIG A;  5FKC A;  1Y4W A;  1UV4 A;  1W2T A;  3AKF A;  3BYK A;  3C7H A;  5ANN A;  3WMZ A;  2X8T A;  4AK5 A;  3BYJ A;  5AYC A;  3UGG A;  3QEE A;  4UDJ A;  5FIX A;  3VSS A;  3LV4 A;  3C7G A;  3QC2 A;  3WMY A;  5JOY A;  4UDG A;  3QEF A;  4FFF A;  3RWK X;  2ADE A;  4MLG A;  3ZXJ A;  4O8N A;  3C7O A;  3K1U A;  4FFG A;  4N2Z A;  3VSR A;  3OM5 A;  5GLQ A;  4AK7 A;  1YRZ A;  2ADD A;  3D60 A;  2RN4 A;  3D61 A;  5GLP A;  4FFI A;  1GYH A;  3UGF A;  4N1I A;  5GLN A;  1YI7 A;  3R4Z A;  3C7F A;  1YIF A;  3VT1 A;  3C7E A;  2YFS A;  2XQR A;  4UDI A;  5GLM A;  3LDR A;  5A7V A;  1SMP I;  1Y9G A;  5B6S A;  2EXK A;  5AYD A;  5AYE A;  4KCA A;  1W18 A;  3C2U A;  3WN1 A;  2QQW A;  3AKG A;  2AC1 A;  3WPU A;  3LF7 A;  5FK8 A; 
#chains in the Genus database with same CATH topology
 4ORX A;  2UZ2 A;  4N2R A;  1VWO B;  4YDB A;  2RTK A;  1SY0 A;  4HPD A;  4YKM A;  5LJH A;  1AVG I;  2RTR B;  3VG7 A;  3ZW2 A;  4K19 A;  1MOY A;  1RBP A;  3LIG A;  3G7X A;  4PJ2 A;  5AY9 A;  1KT6 A;  4O49 A;  2OVE A;  3T2X A;  2C1Q A;  1VWP B;  2FRS A;  3NPO A;  4XMH A;  3OE3 A;  1SLG B;  5K68 A;  4CDE A;  1Y53 X;  1I78 A;  1DZK A;  2DJG A;  5GLR A;  1MDC A;  4B55 A;  5IRW A;  1DF3 A;  4Y59 A;  2RTN B;  4U9C A;  3R67 A;  1O8V A;  3S26 A;  2RTL A;  3WAS A;  2YFR A;  3FA6 A;  2UYW A;  3FLL A;  1Y4W A;  2L68 A;  1OSP O;  3WZO A;  1PMP A;  2E4J A;  5L8I A;  3TGC A;  2QMI A;  3ZXJ A;  1SWC A;  1BEB A;  1S2P A;  2JOZ A;  4WHI A;  3LHN A;  2OVD A;  5GLP A;  4XMG A;  5GLN A;  2G78 A;  2YFS A;  4Y0S A;  5GLM A;  1O1U A;  4GDA A;  2KTS A;  1DFV A;  5B10 O;  4QRL A;  3LTW A;  1IFC A;  4CDF A;  1HBP A;  5EPQ A;  1T0V A;  4ORY A;  2MJI A;  2JW1 A;  1YP7 A;  3RY1 A;  2Z4H A;  1Y7B A;  4BVM A;  3OM2 A;  1X8O A;  1SRE A;  3SZJ A;  2FR2 A;  1GYE B;  5LKE A;  3NQK A;  1NDJ A;  4HWM A;  2AEY A;  1MVG A;  2OVA A;  4ODD A;  1BWY A;  1KT4 A;  5AQ6 A;  3MVF A;  4IRW A;  4EQA C;  4BX6 B;  3RDO A;  3BYL A;  1NC9 A;  3FW5 A;  2EXH A;  3BSZ E;  5F6Z A;  3LEM A;  4GUZ A;  3AEH A;  4GGZ A;  2OYB O;  4YBP A;  4AZM A;  2WUT A;  4M6S A;  1HXZ A;  3NAD A;  2RTC B;  3JSQ A;  2GTL O;  3VG2 A;  5HZ8 A;  1VYG A;  5F1E A;  3ZQ3 A;  5HZ6 A;  4ORU A;  3WAU A;  4LZV A;  4FBV A;  3SLO A;  3D9W A;  3AKF A;  5KIC A;  2QO6 A;  3TZS A;  3BYJ A;  4AZR A;  2LBA A;  5FIX A;  2WEW A;  2IZD B;  1SRI A;  3H3I A;  4JNJ A;  1GT5 A;  1U18 A;  4Z2P A;  1BSQ A;  2WWP A;  3QQ2 A;  4GNW A;  1SRG A;  5GLQ A;  2ADD A;  3O22 A;  4YCH A;  3SOT A;  4NV8 A;  4QZT A;  1SLF B;  4OMW A;  3RE6 A;  1DF8 A;  3AKG A;  1A3Y A;  4ZR2 A;  3FA9 A;  2M4L A;  3VHH A;  2MO5 A;  2RCT A;  1YUP A;  4BJ8 A;  4KC8 A;  1ACD A;  1EW3 A;  4MVK A;  5A7V B;  4O3X B;  5L3Y A;  2A13 A;  3T1D A;  1LEL A;  3VSZ A;  3HTY A;  1AVE A;  3EBK A;  4O8O A;  1PBY A;  2Y32 A;  2IZJ A;  1KL4 A;  4C5P A;  2HKD A;  1E02 A;  4KC7 A;  5HCD C;  4I6S A;  2Q39 A;  5D4A A;  2AF5 A;  1Y9M A;  1DZJ A;  5EDB A;  3AKM A;  3RWX A;  3FA7 A;  4KT5 A;  3C78 X;  5GLK A;  4ZHF A;  2X55 A;  1ML7 A;  4TKB A;  1GYD B;  3PQS A;  4QYP A;  3U14 A;  2X8T A;  5H9N A;  3FEN A;  4HFO A;  2YMS A;  5LJC A;  3UEV A;  4XMD A;  2IZA A;  2X34 A;  5KHP A;  1N0S A;  2CAM A;  4WFU A;  4N1I A;  4ML7 B;  4YFQ A;  1Y9G A;  1STS B;  1HMS A;  1OEK A;  1W5R A;  2X8S A;  3RY2 A;  3VE2 A;  1QAB E;  1EPA A;  1SLD B;  1VKD A;  3PH6 A;  1QY1 A;  1SXY A;  1ADL A;  3VPJ E;  2YFT A;  4ORS A;  3APX A;  3Q6L A;  4YH0 A;  1PBO A;  3TAW A;  1LFO A;  4U8U N;  1KL3 A;  4Y0P A;  3WJE A;  2IZE B;  1BBP A;  3D96 A;  1JJU A;  4ZFX A;  1ZNH A;  4O8P A;  3NP1 A;  2FHN X;  4RUN A;  3VHM A;  4HPA A;  2JN3 A;  1TOU A;  3OM7 A;  1JBH A;  1N9Y A;  3P2N A;  1SA8 A;  4IAW A;  4GDZ A;  1I06 A;  4EFG A;  1SWA A;  4GRJ A;  1G85 A;  1SWR A;  2R56 A;  3VSS A;  3C7G A;  1STP A;  1FDQ A;  2X32 A;  5EDC A;  3ZW0 A;  1VWR B;  1CBI A;  3QEF A;  3VG3 A;  2IZI A;  3N91 A;  4U8U M;  4FQB B;  5C0N A;  4LZU A;  4GKC A;  4BOE A;  3RSW A;  3ZUI A;  4TLJ A;  3ZW1 A;  3UGF A;  1VYF A;  5B29 A;  1GX8 A;  1IJ8 A;  3FID A;  5FQ8 E;  4CPF A;  3FEK A;  3QKG A;  3HWF A;  4IB6 A;  4YGH A;  4BGF A;  3ZZV A;  4ZH6 A;  4D6A A;  3S5V A;  3PH5 A;  3TF6 A;  2ACO A;  2MF6 A;  2AH7 X;  4MVI A;  3WYP A;  3VGW A;  1K3B A;  5JOW A;  4U6B A;  1NP4 A;  3KQ0 A;  2QO4 A;  3RDQ A;  4OEL A;  2Q2P A;  4ALB A;  4UDK E;  3VSF A;  2LA7 A;  3P6H A;  3FMZ A;  4WFV A;  4ONZ A;  5HA0 A;  1EUO A;  2EXJ A;  2FT9 A;  2RQ0 A;  1SWE A;  1IKE A;  4O9S A;  1WL7 A;  2BT9 A;  1GT4 A;  3F8A A;  3CBS A;  5LJG A;  4EEJ A;  2BHV A;  3NQH A;  3B2K A;  4Y0R A;  3STM X;  1JQP A;  4QGW A;  1UV4 A;  5ANN A;  2BS5 A;  4UDJ A;  3PQU A;  3WYQ A;  4CPH B;  3RDS A;  2KD2 A;  5F2B A;  3P6G A;  2F73 A;  2KTD A;  1I9H A;  1YWB A;  1N4J A;  4N2Z A;  1ZRY A;  1HXL A;  4ZHG A;  5C2M A;  3TGA A;  3WZQ A;  3D60 A;  5BYP A;  2OF8 A;  3RDM A;  2A5C A;  3BX8 A;  2JMB A;  1S7D A;  2A0A A;  1PTS A;  1LF7 A;  1XCA A;  4INN A;  1ZNK A;  4ZCB A;  5K67 A;  4UDI A;  5H9K A;  1KFF A;  4ORW A;  5K06 A;  3ZWE A;  1LKE A;  5IO5 A;  4KCB A;  1BRQ A;  1GKA B;  3RZY A;  2G7B A;  3SZH A;  1YWA A;  2A2U A;  5FMC A;  4BX5 B;  3FDC A;  1STR B;  3PPT A;  3VHI A;  1TOW A;  2OY8 A;  3F9D A;  5BVT A;  5JOZ A;  4IAX A;  3EW1 A;  2RTB B;  5AJB A;  1I05 A;  4YGZ A;  4UDK A;  3BX7 A;  3EW2 A;  3KFH A;  4ON1 A;  3WXQ A;  4U6D A;  4LQZ A;  4QGX A;  3V8U A;  4O4U A;  2OXB A;  4FBR A;  2W2A A;  4MVL A;  3MBT A;  3WPZ A;  4EXZ A;  2FTB A;  1TL2 A;  1OYG A;  1OEJ A;  2WQ9 A;  2NNE A;  3WPV A;  2WR6 A;  3LDK A;  3P6E A;  1IW2 A;  1IIU A;  4BQU A;  5C0P A;  3VE1 A;  4L1N A;  3WMZ A;  3QEE A;  3IA8 A;  2ZAI A;  4UDG A;  1UYN X;  3JQO A;  4ZH9 A;  4NV7 A;  5HCE C;  3D61 A;  3P6C A;  3WJB A;  5HTE A;  1JJX A;  2DJF A;  1OBQ A;  2W2F A;  3WJG A;  3U03 A;  3C2U A;  1B56 A;  2AC1 A;  2A2G A;  3LF7 A;  1LDO A;  3ZXK A;  2N93 A;  2ACP X;  3CR6 A;  4OKA A;  4BX6 A;  3LIH A;  1SLE B;  3WJF A;  2AVI A;  4NNT A;  4OS0 A;  1CBS A;  3CU9 A;  1GX9 A;  4HPB A;  3APW A;  1NP1 A;  4GK9 A;  3X00 A;  3HOL A;  1JYD A;  3T6F A;  2RTH B;  5A8C A;  5FKB A;  2C1S A;  3D97 A;  3HK1 A;  3ZXL A;  1BJ7 A;  1UZ2 X;  3FR2 A;  5FEN A;  3O19 A;  1DC9 A;  2QM9 A;  4QYN A;  1LIB A;  4MEE A;  4GU8 A;  2Q4N A;  3FR5 A;  4O3Z A;  4OS8 A;  4ID2 A;  3KFI A;  4DQ4 A;  1I4U A;  4CK4 A;  4NW4 A;  3STK A;  1I04 A;  1FJ1 E;  3C7H A;  3B2H A;  1B0O A;  2RTF B;  2WEX A;  4DQ3 A;  4GJS A;  4NYR A;  3D4R A;  1RST B;  2ASN X;  4CDC A;  2X45 A;  2LBV A;  3PP6 A;  5HZ9 A;  1Y55 X;  1KXO A;  3E3C A;  1KQX A;  2DM5 A;  4GNY A;  1T68 X;  4I95 A;  4XMF A;  3HWG A;  5A7V A;  4ORR A;  4ZHD A;  3UEU A;  3FA8 A;  1E2T A;  1VWH B;  2QQU A;  1JZU A;  2YG2 A;  3RDX A;  2X56 A;  3D95 A;  2R73 A;  3PEC A;  3AKH A;  3SC7 X;  2I5V O;  2A8G A;  4FBO A;  1W6F A;  5JOX A;  1KZX A;  3MX7 A;  3OM6 A;  4PVI A;  4YFP A;  3C76 X;  3R4Y A;  5HAE A;  1RXJ A;  3WJC A;  4EDE A;  1VYO A;  2XKL A;  1VWQ B;  1D3S A;  2VDT A;  1GT1 A;  1AQB A;  3STN A;  4MVE A;  1IKJ A;  5FKC A;  1H91 A;  1VWF B;  2VFB A;  1KOI A;  1MUP A;  3RWK X;  2ADE A;  4MLG A;  4O8N A;  1KT7 A;  3WZP A;  1E06 A;  2CBS A;  1O1V A;  2FHL A;  3MM0 A;  2QCB A;  4IB7 A;  1G74 A;  5D45 A;  5KID A;  1N7Y A;  3MG5 A;  3DTQ A;  1W18 A;  3WN1 A;  2HNX A;  4Z2V A;  3FIQ A;  1G5W A;  1EII A;  2WPU A;  3OM4 A;  4EQV A;  1A57 A;  5IRU A;  4YDA A;  3T2W A;  2G5L A;  1ALB A;  3VG5 A;  4AW8 A;  2FS7 A;  1BRP A;  1OPA A;  1GXA A;  1EXS A;  3APV A;  3TGB A;  4NNS A;  2FKJ A;  2K23 A;  4A60 A;  5F7G A;  5IO6 A;  1DZM A;  1N43 A;  5FMB A;  3OBL A;  4TJZ A;  2RTD B;  1FEN A;  2A3F X;  1X71 A;  3CBC A;  3AKI A;  4BCS A;  4I3B A;  3EM0 A;  4GZV A;  3BDR A;  4GGR A;  1PT2 A;  3PIG A;  1LNM A;  2QOM A;  1EAL A;  1W4T A;  5EED A;  1QG5 A;  3EC5 A;  1RSU B;  2AT8 X;  3BY0 A;  1SXU A;  1JV4 A;  2L67 A;  3NX2 A;  4CSB A;  1SWQ A;  4U8U O;  5L8O A;  1NQN A;  3RE5 A;  1BSY A;  1R0U A;  1GYH A;  5FAZ A;  3WOV A;  1VWC B;  1AB0 A;  3LDR A;  1SMP I;  4O3Y A;  4YFR A;  2EXK A;  4L3R A;  5LJB A;  4KCA A;  1BLR A;  2OVS A;  2JU7 A;  2LKK A;  5FK8 A;  1SWL A;  2MM3 A;  1LID A;  5DPQ A;  1CRB A;  4GET A;  4JGL A;  1TW4 A;  1P6P A;  4ES7 A;  1DZP A;  4YBU A;  2RD7 C;  1UYP A;  4XMC A;  2OFB A;  1VWJ B;  3QZ4 A;  1JJJ A;  4AK6 A;  3CKG A;  4AYH A;  3EYC A;  3U9P C;  4BX7 B;  5JD2 A;  2VFC A;  2RTA A;  1Z24 A;  1GM6 A;  3ELX A;  2IZH B;  3WVM A;  3NQ3 A;  1ZNE A;  2RCQ A;  1MM9 A;  5LJD A;  1RAV A;  3B2I A;  4CPH A;  5LJK A;  3UAQ A;  3Q34 A;  3BLG A;  2Q2M A;  4TKJ A;  4ALO A;  5AYC A;  3AUM O;  4ZGU A;  3QC2 A;  4RUU A;  1SWH A;  1SWN A;  4FGI B;  1TVQ A;  1GKA A;  4TQ2 A;  1YRZ A;  1OPB A;  2RTP B;  4BX5 A;  4PSQ A;  2IZG B;  1YI7 A;  1LCV A;  3BU9 A;  5CE4 A;  5HTD A;  1T8V A;  1ERB A;  2CZT A;  5HCC C;  1SY1 A;  1VWL B;  3SAO A;  3NBX X;  4D47 A;  1SWO A;  2Y3F A;  5IRA A;  2KT4 B;  1BSO A;  1JMZ A;  3F6Z B;  3SZI A;  1OBU A;  3KF3 A;  4QAE A;  1RLB E;  3SLT A;  4KH8 A;  4HPC A;  5H9L A;  3CWK A;  4LKP A;  3RDU A;  1X8U A;  2JU3 A;  1OEE A;  1A18 A;  1YIV A;  5B3M O;  5CHK A;  1VWB B;  2RTI B;  2POA A;  3FW4 A;  2FLJ A;  3S60 A;  1HBQ A;  1LIE A;  1URE A;  2BS6 A;  3BRN A;  1QQS A;  5B2A O;  5DG4 A;  3WN0 A;  2OF9 A;  4I9S A;  2XST A;  5GLO A;  1AEL A;  4AK5 A;  1ERX A;  4AZN A;  3ZUO A;  2IZK A;  1ICN A;  1VWI B;  5B27 A;  1UYO X;  5JR8 A;  4FFF A;  1GT3 A;  1B8E A;  3OM5 A;  4AK7 A;  3P02 A;  2RTJ A;  2IZF B;  3JS1 A;  5AJC A;  3APU A;  1SWJ A;  4Y0Q A;  1X8P A;  3AKN A;  5F6B A;  5AYE A;  4AZQ A;  4ZHC A;  3WPU A;  5IO7 A;  4N7D A;  2QO5 A;  1D2U A;  2AKQ A;  3L4R A;  1HMT A;  5CSE A;  2RTE B;  3HWD A;  1SY3 A;  1VWD B;  3WN2 A;  1FTP A;  1NQM A;  5A8D A;  5D48 A;  3UGH A;  3UEW A;  2NP1 A;  3OJY C;  1ZND A;  1QWD A;  1B4M A;  1Y9L A;  4MIS A;  3PIJ A;  2X8F A;  1N9M A;  4IB8 A;  5BVS A;  2R74 A;  1CBQ A;  2BC3 A;  4N4B A;  5B6T A;  1VWK B;  2RTO B;  1YWD A;  4U3Q A;  4NLI A;  4U46 A;  3U75 A;  1KQW A;  5B11 O;  3KF5 A;  3RKG A;  2ZAG A;  2OY5 O;  3WBG A;  2AMM X;  4GJV A;  2LB6 A;  1MK5 A;  4BBO A;  1SWK A;  1W2T A;  2CBR A;  4NLJ A;  1E00 A;  2Y3E A;  5HA1 A;  2F01 A;  1RXK A;  1RXH A;  1IFB A;  1S44 A;  5HZ5 A;  1SRF A;  3HWE A;  3K1U A;  1X89 A;  1VWN B;  2RN4 A;  2GTF X;  1KL5 A;  1X8N A;  1LIC A;  3B2J A;  4OMX A;  2MWH A;  4IB9 A;  2AT6 X;  4R0B A;  1FEL A;  2GTL N;  2QQW A;  3PED A;  3VU1 A;  5F58 A;  1HY2 A;  3VT2 A;  1KGL A;  4GE1 A;  1JYJ A;  1LPJ A;  4I9R A;  2AL0 X;  1SWG A;  1GGL A;  4ZHH A;  2QQV A;  4Z28 A;  5LJE A;  1SWT A;  2BSZ A;  3KFF A;  3IFB A;  2HLV A;  4ZJ0 A;  5HZQ A;  1WBI A;  2ANS A;  3FYF A;  3NX1 A;  5FQ6 E;  1GX3 A;  2NND A;  4Y5D A;  3WPY A;  1SY2 A;  2B4W A;  3EMM A;  4CPI A;  2EXI A;  2G8C O;  3GE2 A;  4ARH A;  1Y0G A;  1VWG B;  2GTL M;  4OS3 A;  2OFR X;  4YKO A;  2Q9S A;  4QQS A;  1VWM B;  3P6F A;  4QGV A;  4COT A;  4KMI A;  2L5P A;  1SWP A;  2RTM A;  4XME A;  1YP6 A;  4I3C A;  1U17 A;  4EKV A;  2ALL X;  3LV4 A;  4YGG A;  3C77 X;  1HMR A;  3B2L A;  1EIO A;  1SRJ A;  4FFG A;  1EI5 A;  3WZN A;  3CQN A;  3T6L A;  1QFV A;  5LKF A;  3KFG A;  3KVN A;  1G7N A;  1YIF A;  5AEO A;  2XQR A;  3FEP A;  3BS2 A;  1DV9 A;  4GD9 A;  1QY0 A;  4YMY A;  1SXX A;  4IBA A;  3QED A;  1ZNL A;  3I0A A;  3CKF A;  2I5Z O;  2A5B A;  2OY1 O;  4JO6 A;  3GAQ A;  2FGS A;  2HYS A;  2CZU A;  5B5F A;  3WJD A;  2OZQ A;  2HMB A;  1LUQ A;  4DCB A;  4I3D A;  4WBK A;  4CV7 A;  2OFM X;  1SWU A;  2NNQ A;  3VG4 A;  5HBS A;  3PDF A;  5HWZ A;  4QZU A;  3D5Z A;  5FMD A;  3NR3 A;  2AT3 X;  4CPE A;  1ZNG A;  2WQA E;  3OD9 A;  3BYN A;  4A8Z A;  2X4M A;  2IZC B;  5EZ2 A;  3BYK A;  4D6B A;  2FR3 A;  1QFT A;  2W2B A;  2AT0 X;  1KZW A;  3FEL A;  2BLG A;  3VG6 A;  3WMY A;  1NBX A;  5CYB A;  5FQ7 E;  2EU7 X;  2AT5 X;  3VSR A;  4N7C A;  1SWF A;  2IZL B;  1K24 A;  4JHQ A;  3C7F A;  3VT1 A;  1X8Q A;  3NQ9 A;  4NP1 A;  4GGT A;  3HPE A;  2IFB A;  5AYD A;  1E5P A;  1XKI A;  1Y52 X;  2QOS C;  4UU3 A;  5FFH A;  4BX7 A;  2RTQ B;  3SLJ A;  4GH7 A;  4YVB A;  1LCZ A;  2O62 A;  2F09 A;  1JMX A;  2K62 A;  3ELZ A;  4KII A;  1A2D A;  3FR4 A;  1MEP A;  4FFH A;  3RBY A;  1HQP A;  3CMP A;  3CQR A;  3VT0 A;  2RA6 A;  2CM4 A;  2PY1 A;  4TKH A;  1Y9T A;  5FLW A;  4O3W A;  1HN2 A;  1WUB A;  5H8T A;  1PM1 X;  3LFI A;  2FKG A;  2P8G A;  1AVD A;  4AZO A;  3I17 A;  3UEX A;  2VDF A;  5D8J A;  1OBP A;  4O4X A;  1HQQ A;  2CM9 A;  3D5Y A;  1LCW A;  4QQ1 A;  1LIF A;  1EQD A;  3WAT A;  5GLL A;  2GJ5 A;  4TNN A;  3UGG A;  1YWC A;  3K3L A;  3DSZ A;  4M7M A;  4OEM A;  4LKT A;  4CDD A;  3C7O A;  2JGS A;  4DNE A;  1MX8 A;  1VWA B;  3P6D A;  3HOE A;  4Z2O A;  2GH7 A;  1CBR A;  3KZA A;  2HZQ A;  1BM5 A;  3R4Z A;  5EEE A;  1TXL A;  1NGL A;  1SRH A;  3ZW0 B;  1FE3 A;  2GC9 A;  2X46 A;  1FEM A;  2ZSC A;  4ZGF A;  3ZW1 B;  2LFO A;  4IMN A;  4A1H A;  2OY7 A;  4Z27 A;  4NOV A;  4A1Y A;  4O4S A;  5FK7 A;  1L6M A;  2JU8 A;  3BU1 A;  2WSJ A;  2KW1 A;  1VPR A;  1CJ5 A;  2IZB A;  3EBW A;  3S5X A;  4UU2 A;  2OL7 A;  1ST8 A;  5IXG A;  2C4I A;  2RTG B;  2Z4I A;  1ICM A;  1SXW A;  1JIW I;  4I60 A;  2AEZ A;  2OL8 O;  4IAB A;  4PVA A;  3P24 A;  4YCE A;  1SWD A;  1MX7 A;  2MHD A;  1QY2 A;  4NYQ A;  4IMO A;  1KT5 A;  3KST A;  5B5G A;  4Z6J A;  1SWB A;  5H9A A;  3O2Y A;  1KT3 A;  3U0D A;  1SWS A;  5D47 A;  2OL6 O;  2FS6 A;  1EPB A;  5JOY A;  1LDQ A;  1VWE B;  4AZP A;  2OFA A;  4QNI A;  4FFI A;  4O4O A;  5L8N A;  3C7E A;  2PI3 O;  3PK2 A;  5BVQ A;  5B6S A;  1PEE A;  4MIR A;  2FWV A;  2L9C A;  3ZI8 A;  2G79 A;  1U0X A;  2HZR A; 
#chains in the Genus database with same CATH homology
 1EII A;  5F58 A;  3OM4 A;  4ORX A;  3ZZV A;  4EQV A;  4ZH6 A;  4D6A A;  3VT2 A;  1A57 A;  4YDA A;  3S5V A;  4N2R A;  1KGL A;  4GE1 A;  1ALB A;  1JYJ A;  3VG5 A;  1LPJ A;  4I9R A;  4AW8 A;  2AL0 X;  4YDB A;  2FS7 A;  3PH5 A;  1GGL A;  3TF6 A;  2ACO A;  1BRP A;  1OPA A;  1GXA A;  4HPD A;  1SY0 A;  2AH7 X;  4ZHH A;  1EXS A;  3APV A;  4MVI A;  2QQV A;  4YKM A;  3TGB A;  5LJH A;  1AVG I;  5LJE A;  3VG7 A;  4NNS A;  3ZW2 A;  4K19 A;  1RBP A;  3LIG A;  2K23 A;  4A60 A;  3G7X A;  5JOW A;  4U6B A;  4PJ2 A;  1NP4 A;  3KQ0 A;  2QO4 A;  3KFF A;  5AY9 A;  5F7G A;  3IFB A;  2Q2P A;  5IO6 A;  4ALB A;  4UDK E;  1KT6 A;  2HLV A;  4O49 A;  4ZJ0 A;  3VSF A;  2OVE A;  2LA7 A;  5HZQ A;  3P6H A;  2ANS A;  3FMZ A;  3FYF A;  1DZM A;  3NX1 A;  2FRS A;  5FQ6 E;  2NND A;  4WFV A;  3NPO A;  4ONZ A;  5HA0 A;  1EUO A;  4XMH A;  3OE3 A;  2EXJ A;  5FMB A;  3WPY A;  1SY2 A;  2B4W A;  3OBL A;  4TJZ A;  3EMM A;  2FT9 A;  2EXI A;  2RQ0 A;  3GE2 A;  1DZK A;  1FEN A;  4ARH A;  2A3F X;  1X71 A;  3CBC A;  1IKE A;  1MDC A;  2GTL M;  4O9S A;  4OS3 A;  3AKI A;  1WL7 A;  5GLR A;  2OFR X;  1DF3 A;  4I3B A;  4U9C A;  2BT9 A;  3R67 A;  1O8V A;  4YKO A;  1GT4 A;  3S26 A;  3F8A A;  2Q9S A;  3CBS A;  3EM0 A;  4GZV A;  5LJG A;  4EEJ A;  2YFR A;  4QQS A;  3WAS A;  3P6F A;  4QGV A;  2BHV A;  4COT A;  3NQH A;  3BDR A;  3B2K A;  4Y0R A;  4KMI A;  3STM X;  3WN1 A;  2L5P A;  1PT2 A;  4XME A;  3FA6 A;  3FLL A;  4QGW A;  3PIG A;  1Y4W A;  1YP6 A;  2L68 A;  1LNM A;  1UV4 A;  5ANN A;  2BS5 A;  4I3C A;  1U17 A;  1PMP A;  2ALL X;  4UDJ A;  3PQU A;  3FIQ A;  3LV4 A;  2E4J A;  2KD2 A;  5L8I A;  4YGG A;  3TGC A;  1EAL A;  5EED A;  1QG5 A;  3C77 X;  1HMR A;  2QMI A;  2F73 A;  2AT8 X;  2KTD A;  3P6G A;  1G5W A;  3B2L A;  3BY0 A;  1EIO A;  1YWB A;  3ZXJ A;  1SXU A;  1JV4 A;  2L67 A;  1BEB A;  3NX2 A;  1ZRY A;  4CSB A;  4FFG A;  4N2Z A;  1S2P A;  4U8U O;  5L8O A;  1EI5 A;  2JOZ A;  4WHI A;  4ZHG A;  3LHN A;  3TGA A;  3PED A;  2OVD A;  3D60 A;  5BYP A;  5GLP A;  1BSY A;  1R0U A;  1GYH A;  3CQN A;  1QFV A;  4XMG A;  3BX8 A;  5GLN A;  2JMB A;  1S7D A;  2A0A A;  5FAZ A;  5LKF A;  3WOV A;  3KFG A;  1G7N A;  1LF7 A;  1AB0 A;  1XCA A;  2G78 A;  4INN A;  5AEO A;  1ZNK A;  1YIF A;  2XQR A;  4Y0S A;  4ZCB A;  2YFS A;  4UDI A;  5H9K A;  5GLM A;  3FEP A;  3LDR A;  1SMP I;  3BS2 A;  4O3Y A;  1DV9 A;  4YFR A;  4ORW A;  5K06 A;  2EXK A;  4L3R A;  5LJB A;  1QY0 A;  1O1U A;  2KTS A;  3ZWE A;  4KCA A;  4YMY A;  1DFV A;  1BLR A;  1LKE A;  1SXX A;  2OVS A;  2JU7 A;  4IBA A;  5IO5 A;  4QRL A;  2LKK A;  5FK8 A;  1IFC A;  1HBP A;  5EPQ A;  4KCB A;  1BRQ A;  1GKA B;  1T0V A;  1ZNL A;  1LID A;  2G7B A;  2MM3 A;  3I0A A;  3RZY A;  4ORY A;  3QED A;  2MJI A;  2JW1 A;  1YWA A;  1CRB A;  2A2U A;  4GET A;  5DPQ A;  4JGL A;  5FMC A;  1YP7 A;  1TW4 A;  1P6P A;  2Z4H A;  1Y7B A;  4BVM A;  4ES7 A;  1DZP A;  3PPT A;  4YBU A;  2RD7 C;  3GAQ A;  1UYP A;  3OM2 A;  1TOW A;  2HYS A;  3F9D A;  4XMC A;  5BVT A;  2CZU A;  1X8O A;  5JOZ A;  4IAX A;  3QZ4 A;  2FR2 A;  1GYE B;  5LKE A;  1JJJ A;  3NQK A;  3WJD A;  4AK6 A;  5AJB A;  2OZQ A;  4AYH A;  4HWM A;  2AEY A;  3EYC A;  1I05 A;  1MVG A;  2OVA A;  4ODD A;  4YGZ A;  1KT4 A;  2HMB A;  3U9P C;  1BWY A;  4UDK A;  3BX7 A;  5AQ6 A;  3KFH A;  3MVF A;  4I3D A;  4WBK A;  4ON1 A;  4CV7 A;  2OFM X;  4EQA C;  2NNQ A;  3BYL A;  3FW5 A;  2EXH A;  3BSZ E;  3VG4 A;  3WXQ A;  4U6D A;  5F6Z A;  1Z24 A;  3LEM A;  1GM6 A;  3ELX A;  4LQZ A;  5HBS A;  3WVM A;  4QGX A;  3NQ3 A;  1ZNE A;  4YBP A;  4AZM A;  2RCQ A;  2WUT A;  4M6S A;  3V8U A;  5LJD A;  4O4U A;  5HWZ A;  2OXB A;  4FBR A;  4QZU A;  3D5Z A;  2W2A A;  4MVL A;  3MBT A;  3B2I A;  5LJK A;  4EXZ A;  5FMD A;  3WPZ A;  2FTB A;  3NR3 A;  3UAQ A;  2AT3 X;  3BLG A;  3NAD A;  3JSQ A;  1ZNG A;  2GTL O;  1OEJ A;  3VG2 A;  2WQ9 A;  5HZ8 A;  1OYG A;  2NNE A;  2WQA E;  3WPV A;  1VYG A;  2WR6 A;  2Q2M A;  3P6E A;  5F1E A;  3ZQ3 A;  3LDK A;  5HZ6 A;  1IW2 A;  4ORU A;  1IIU A;  3OD9 A;  4BQU A;  3BYN A;  4LZV A;  3WAU A;  4FBV A;  5C0P A;  4A8Z A;  3VE1 A;  4L1N A;  5EZ2 A;  3AKF A;  4D6B A;  5KIC A;  3BYK A;  2FR3 A;  2QO6 A;  3WMZ A;  4TKJ A;  1QFT A;  3TZS A;  4ALO A;  2W2B A;  2AT0 X;  1KZW A;  3BYJ A;  4AZR A;  5AYC A;  3FEL A;  3QEE A;  2LBA A;  5FIX A;  3IA8 A;  2WEW A;  4ZGU A;  2BLG A;  3VG6 A;  3H3I A;  2ZAI A;  3QC2 A;  3WMY A;  4RUU A;  5CYB A;  1GT5 A;  1U18 A;  4UDG A;  3JQO A;  1BSQ A;  5FQ7 E;  2WWP A;  4ZH9 A;  2EU7 X;  2AT5 X;  3VSR A;  4FGI B;  4GNW A;  1TVQ A;  4N7C A;  5GLQ A;  1GKA A;  4TQ2 A;  5HCE C;  1YRZ A;  2ADD A;  1OPB A;  3O22 A;  3D61 A;  4YCH A;  3P6C A;  4PSQ A;  3WJB A;  5HTE A;  3SOT A;  1YI7 A;  1JJX A;  3C7F A;  4QZT A;  3VT1 A;  1X8Q A;  1OBQ A;  3NQ9 A;  3BU9 A;  5CE4 A;  5HTD A;  2W2F A;  4NP1 A;  4OMW A;  2IFB A;  3WJG A;  5AYD A;  1T8V A;  2CZT A;  1ERB A;  5HCC C;  1SY1 A;  3U03 A;  3C2U A;  1B56 A;  3AKG A;  1A3Y A;  1E5P A;  1XKI A;  2QOS C;  2A2G A;  4ZR2 A;  3SAO A;  3NBX X;  2AC1 A;  3LF7 A;  3FA9 A;  4UU3 A;  3ZXK A;  5FFH A;  4D47 A;  2M4L A;  2N93 A;  2KT4 B;  2ACP X;  1BSO A;  3F6Z B;  3CR6 A;  4GH7 A;  1OBU A;  2O62 A;  2F09 A;  4QAE A;  3KF3 A;  3LIH A;  2MO5 A;  2RCT A;  3WJF A;  1YUP A;  4NNT A;  1RLB E;  4KH8 A;  4KC8 A;  4OS0 A;  4HPC A;  1ACD A;  1CBS A;  1EW3 A;  4MVK A;  5H9L A;  3CU9 A;  5A7V B;  2K62 A;  3CWK A;  1GX9 A;  4O3X B;  4LKP A;  2A13 A;  3ELZ A;  4KII A;  3T1D A;  1A2D A;  4HPB A;  3FR4 A;  3APW A;  3VSZ A;  1NP1 A;  4GK9 A;  3HTY A;  4FFH A;  3EBK A;  1X8U A;  4O8O A;  2JU3 A;  1OEE A;  3RBY A;  1A18 A;  1HQP A;  3CMP A;  3HOL A;  3CQR A;  1YIV A;  3VT0 A;  1JYD A;  2RA6 A;  2CM4 A;  2PY1 A;  5FKB A;  5A8C A;  1E02 A;  4TKH A;  1Y9T A;  2POA A;  4KC7 A;  5HCD C;  3D97 A;  4I6S A;  5FLW A;  2Q39 A;  3HK1 A;  3ZXL A;  4O3W A;  1BJ7 A;  3FW4 A;  1UZ2 X;  2FLJ A;  1HN2 A;  3S60 A;  3FR2 A;  1HBQ A;  1LIE A;  1URE A;  5D4A A;  3O19 A;  2BS6 A;  3BRN A;  1QQS A;  5FEN A;  5H8T A;  1DC9 A;  1DZJ A;  1PM1 X;  5EDB A;  1Y9M A;  3LFI A;  2QM9 A;  2P8G A;  4QYN A;  3AKM A;  1LIB A;  3RWX A;  4AZO A;  3I17 A;  3FA7 A;  4GU8 A;  2Q4N A;  4KT5 A;  5DG4 A;  3UEX A;  3FR5 A;  4O3Z A;  3C78 X;  4OS8 A;  3WN0 A;  4ID2 A;  5D8J A;  5GLK A;  1OBP A;  4ZHF A;  4O4X A;  1ML7 A;  2CM9 A;  3KFI A;  4DQ4 A;  3D5Y A;  1I4U A;  4I9S A;  4NW4 A;  3STK A;  4CK4 A;  2XST A;  3PQS A;  4QQ1 A;  4TKB A;  1LIF A;  5GLO A;  1AEL A;  1EQD A;  4QYP A;  1I04 A;  3WAT A;  5GLL A;  2GJ5 A;  3U14 A;  4TNN A;  3C7H A;  3B2H A;  4AK5 A;  2X8T A;  1ERX A;  1B0O A;  4AZN A;  3ZUO A;  5H9N A;  3UGG A;  2WEX A;  1YWC A;  3K3L A;  3FEN A;  4HFO A;  1ICN A;  3DSZ A;  2YMS A;  4M7M A;  3UEV A;  4DQ3 A;  4XMD A;  5B27 A;  5LJC A;  4NYR A;  4LKT A;  3D4R A;  5JR8 A;  4FFF A;  1GT3 A;  1B8E A;  3C7O A;  2ASN X;  3OM5 A;  4AK7 A;  2X45 A;  3P02 A;  5KHP A;  1MX8 A;  1N0S A;  2LBV A;  3PP6 A;  3JS1 A;  3P6D A;  4WFU A;  5HZ9 A;  3HOE A;  1KXO A;  3E3C A;  1KQX A;  2DM5 A;  5AJC A;  4N1I A;  1CBR A;  3KZA A;  2HZQ A;  1T68 X;  3APU A;  4GNY A;  4Y0Q A;  1X8P A;  4I95 A;  1BM5 A;  3R4Z A;  4XMF A;  5EEE A;  3AKN A;  1TXL A;  4ML7 B;  4YFQ A;  5F6B A;  3HWG A;  5A7V A;  1Y9G A;  4ORR A;  4ZHD A;  1HMS A;  1NGL A;  1OEK A;  3UEU A;  3ZW0 B;  2GC9 A;  1FE3 A;  5AYE A;  2X46 A;  1FEM A;  4AZQ A;  4ZHC A;  3WPU A;  5IO7 A;  3FA8 A;  4N7D A;  2X8S A;  2QO5 A;  1D2U A;  2QQU A;  1JZU A;  2AKQ A;  2YG2 A;  3L4R A;  3D95 A;  3VE2 A;  1HMT A;  4ZGF A;  3ZW1 B;  2LFO A;  4IMN A;  1QAB E;  2R73 A;  3HWD A;  1EPA A;  1SY3 A;  4A1H A;  1VKD A;  3PEC A;  3AKH A;  3WN2 A;  3SC7 X;  4NOV A;  3PH6 A;  4FBO A;  1FTP A;  4A1Y A;  4O4S A;  1QY1 A;  1L6M A;  1SXY A;  1ADL A;  5FK7 A;  5A8D A;  3VPJ E;  2JU8 A;  3BU1 A;  5D48 A;  3UGH A;  2YFT A;  3UEW A;  4ORS A;  2NP1 A;  3APX A;  3Q6L A;  3OJY C;  2WSJ A;  1PBO A;  1ZND A;  4YH0 A;  3TAW A;  5JOX A;  1KZX A;  1QWD A;  2KW1 A;  1VPR A;  1LFO A;  1B4M A;  1CJ5 A;  3EBW A;  3S5X A;  1Y9L A;  4U8U N;  4UU2 A;  4Y0P A;  1ST8 A;  4MIS A;  3PIJ A;  3MX7 A;  3WJE A;  2X8F A;  3D96 A;  1BBP A;  3OM6 A;  2Z4I A;  1ICM A;  1SXW A;  4IB8 A;  5BVS A;  4PVI A;  4YFP A;  2R74 A;  1JIW I;  4ZFX A;  1ZNH A;  1CBQ A;  3C76 X;  3NP1 A;  4N4B A;  4O8P A;  3R4Y A;  5B6T A;  4RUN A;  5HAE A;  2AEZ A;  4IAB A;  1YWD A;  4HPA A;  3P24 A;  4NLI A;  4U3Q A;  4YCE A;  4PVA A;  3WJC A;  3U75 A;  2JN3 A;  1TOU A;  1KQW A;  3OM7 A;  1JBH A;  1MX7 A;  2MHD A;  3KF5 A;  3RKG A;  1QY2 A;  2ZAG A;  4EDE A;  4NYQ A;  4IMO A;  3WBG A;  2AMM X;  1KT5 A;  3P2N A;  1SA8 A;  2XKL A;  2LB6 A;  3KST A;  1D3S A;  2VDT A;  1GT1 A;  4IAW A;  1AQB A;  3STN A;  4GDZ A;  1I06 A;  4MVE A;  4EFG A;  1IKJ A;  4GRJ A;  5H9A A;  1G85 A;  3O2Y A;  1H91 A;  5FKC A;  1W2T A;  1KT3 A;  2CBR A;  3U0D A;  1KOI A;  1MUP A;  5D47 A;  4NLJ A;  2FS6 A;  1E00 A;  2R56 A;  3VSS A;  1EPB A;  3C7G A;  5HA1 A;  1FDQ A;  5JOY A;  5EDC A;  3ZW0 A;  1IFB A;  1S44 A;  1CBI A;  3QEF A;  3VG3 A;  3RWK X;  5HZ5 A;  2ADE A;  4MLG A;  3HWE A;  3N91 A;  4U8U M;  3K1U A;  4FQB B;  4O8N A;  5C0N A;  1KT7 A;  4LZU A;  4GKC A;  4AZP A;  1E06 A;  2CBS A;  1X89 A;  4BOE A;  2RN4 A;  4QNI A;  1O1V A;  3RSW A;  3ZUI A;  2GTF X;  4O4O A;  4TLJ A;  1GYD B;  3ZW1 A;  4FFI A;  1VYF A;  5B29 A;  1GX8 A;  3UGF A;  5L8N A;  1X8N A;  5FQ8 E;  3C7E A;  1LIC A;  3B2J A;  5BVQ A;  4OMX A;  5B6S A;  4IB7 A;  1G74 A;  2MWH A;  5D45 A;  4IB9 A;  1PEE A;  3FEK A;  5KID A;  3QKG A;  4MIR A;  2AT6 X;  2FWV A;  3HWF A;  3DTQ A;  4R0B A;  2GTL N;  1FEL A;  1W18 A;  2L9C A;  2HNX A;  4IB6 A;  3ZI8 A;  4YGH A;  2G79 A;  2QQW A;  1U0X A;  2HZR A;  3VU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...