2XA5A

Structure of substrate binding protein siap (a11n) in complex with neu5ac
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
309
structure length
309
Chain Sequence
b'ADYDLKFGMNNGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Structure of Substrate Binding Protein Siap (A11N) in Complex with Neu5Ac
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 126
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xa5A00
4O94A 4PC9A 4PGPA 4MHFA 2HZKA 4MAGA 4PE3A 4MIJA 4PETA 4MNIA 4MNPA 4P3LA 4N6KA 4PCDA 3U65A 2XXKA 4OVPA 2VPOA 4X8RA 4YZZA 4X04A 4PF8A 3B50A 4PF6A 4NG7A 4N8YA 4PDHA 4NF0A 4P1EA 4OVTA 5I7IA 2HPGA 4N15A 2ZZWA 4PFIA 4NN3A 4PFRA 4OA4A 4PAFA 4NQ8A 4LN5A 4N6DA 4XFEA 4O7MA 4OVQA 2CEXA 2XA5A 4MCOA 4MEVA 4OANA 4N17A 4P56A 4DI4B 4OVRA 4UABA 2WX9A 4PBQA 2PFYA 4XF5A 4O8MA 4P9KA 2CEYA 5LTCA 2ZZVA 2XWVA 4PAKA 4YICA 4OVSA 4PDDA 4MMPA 2V4CA 5CM6A 5IZZA 4DI3D 2XWOA 4P47A 3FXBA 2PFZA 4PAIA 4NX1A 2WYKA 2HZLA 2VPNA 4PBHA 2XWKA 5IGAA 4PFBA 4XEQA 4P1LA 3GYYA 4PGNA 5I5PA 4N8GA 5IM2A 4P8BA 4N4UA 4MNCA 4N91A 2XWIA 4NHBA 2ZZXA 4NAPA 2WYPA 4NGUA 4MX6A
chains in the Genus database with same CATH superfamily
3M3KA 3O6HA 3OXNA 3ODBA 4R2BA 1D3KA 4RJZA 1LLSA 3O6IA 3H6VA 1LBYA 4MLQA 4H45A 1B40A 1Y20A 4ZZAA 1Z7NE 4GVOA 2Y7IA 5KCJA 4OTEA 1RYOA 4JBZA 4JVCA 3S9NC 2WBDA 4AS4A 4OYVA 5I2NB 3EF7A 2UVGA 3KN3A 2RC7A 1YZ0A 3IO4A 4PF8A 3B50A 1URSA 4ESWA 2WKYA 3U72A 3FXUA 4U4XA 1NV0A 4PFRA 1VSOA 5AA4B 3ROJA 2E1SA 3CHGA 4HE1A 4MEVA 1B0LA 3H06B 4JDFA 1LBBA 2WX9A 3PMXA 2H9BA 4MJOA 1B5HA 4KI0E 3UK4A 3UN6A 4LATA 2I3WA 1IUDA 2YPNA 2D5WA 4OZ9A 3FBPA 3IOTA 3FXBA 1GGGA 4IR8A 3A09A 4LA9A 3RTFB 1B4HA 3O9PA 3C4MA 4PTKA 5IZ1A 5A5XA 1FBFA 1G0HA 2WBBA 1B3HA 4GD5A 2P3VA 1O7TA 5I5PA 1M5EA 4HE0A 4RXLA 4NF8B 1NV3A 3O6GA 1MXXA 3QUJA 3VV5A 1USYE 5I58A 3CRBA 1A54A 3M8UA 2XXWA 4EQBA 5CC2A 1EZPA 1K9YA 5CBSA 3R26A 1AL3A 1B1HA 4LONB 1D9YA 2JJKA 3HFUA 1MXVA 2Y7PA 5ET7A 4X48A 3KBRA 4DDDA 4X04A 2GHBA 2H25A 2UVJA 4NF0A 3PGFA 3R6UA 3K6UA 1DSNA 2ZZWA 3CG3A 2Q9TA 1DBZA 5TP9A 1MPBA 5FTHA 4R74A 3CFXA 2AL4A 1OLCA 4F3SA 3CFZA 1URGA 1DMBA 3QMFA 3T96B 4N6PA 2O7UA 4OEUA 5EYGA 3N6UA 2PYYA 1KWHA 2HXWA 4GWYA 3PMVA 2XX8A 2UVIA 3DELB 2XWKA 3EN3A 1Y3NA 1NV7A 4U2RA 2V84A 4GX6A 1B51A 1UTHA 5FBPA 3EHTA 1MQHA 4N4UA 2ZYOA 1FW0A 4LUBA 1S7YA 3C32A 1R9QA 1OVBA 4Q5TA 4PGPA 2AYSA 3CFLA 4FECA 1MXYA 3MC2A 4PQJA 2F6GA 5DTBA 4GF8A 1JVXA 4P3LA 5I59A 1IZ1A 2GQ1A 4H65A 3K6WA 1XS5A 4H5FA 2DYXA 1MM7A 1POTA 3TYHA 3ZKKA 3C33A 3PU5A 3MP6A 4QFNA 1LFHA 1EZ9A 2OZZA 5H8SA 2V93A 5I7IA 1FTLA 3K2DA 3KC1A 1UIVA 2DVCA 3KC0A 1EYIA 4O7MA 3RLFE 5HBCA 2PT2A 2ESNA 4JVDA 3IJXB 3U92A 2CMOA 4L17A 1LGBC 3RGYA 4KFQA 1NUZA 3PPQA 1FQCA 3SZPA 3N5LA 3TPAA 1O63A 4YICA 4FIMA 4IO6A 1D9VA 1GR2A 3K6VA 4N07A 3SERA 1RDYA 2P1SA 2O69A 3VVDA 4OQOA 3HN0A 3MW0A 1FQDA 5IKBA 1SDXA 3IJOB 4KXPA 1EH3A 3Q29A 1SW5A 3FJGA 3IR1A 3RT8A 3H03A 2O1MA 2ONKE 3T9VA 3RPWA 3CI8A 4PC9A 5JTYA 1FPEA 1B05A 1OMPA 2XXRA 1GVCA 4LP2B 2DWJA 4C1TA 2HXRA 3UORA 2I3VA 2DOJA 1PB7A 4NF5B 3E78A 2QVVA 1G0IA 3PUVE 4ZEFA 1DPPA 1ZJLA 4NF4B 1NH8A 1FPGA 1MH3A 5L8DA 3PUZE 4GX3A 4PF6A 5CBRA 3CVGA 1VFEA 2RF1A 1FBDA 3Q27A 2R71A 2HQ0A 3LUZA 3VLUA 2HFBA 3EPEA 1IXHA 1Q1KA 1H76A 3K01A 2X7PA 3PPPA 4BDNA 4NWCA 4I1DA 3T0JA 4BDLA 3GXAA 4H8JA 1POY1 1P1QA 2Q2AA 4N17A 2FIEA 3KN7A 3OSQA 2FIXA 3CSBA 1CE2A 1QUJA 3VFJA 2DVZA 1FTMA 2V3UA 1MDP1 4F18A 2R8TA 4XXUA 1MXWA 2RC8A 3G3GA 4QFLA 4AQ4A 1A8EA 2PT1A 2DS9A 3IB2A 4P11A 1A8FA 2OJTA 2HHMA 3I6VA 4AS5A 1FQEA 2QS1A 3M3FA 3B8BA 2Q8MA 4X1DA 4ZECA 4RPNA 2O1LA 4DE8A 2ZXTA 5JEIA 2Y84A 4G68A 2QL3A 4OFLA 4MBPA 2ZNUA 4ZZEA 1Y1ZA 3KG2A 3D4CA 1ZIUA 3TTMA 5BUUA 3I3VA 4ZEIA 4R6KA 5EQ9A 1N7WA 3QIMA 1INPA 1OIBA 4YKKA 2AL5A 4OVPA 4UA8A 3I5OA 3EQ1A 1SYHA 2XXHA 1JW5A 4EDPA 1P1OA 1Y4TA 3OMBA 5TPAB 1JEVA 2ABHA 2G29A 1S50A 4FAJA 2QS3A 3A3UA 2BJJX 1MY1A 2RC9A 4FJPA 2CEXA 4QXDA 2VOZA 2UXAA 4UABA 4UACA 2CEYA 4EUOA 1Y4CA 2XX7A 5J16A 3LR1A 4E0XA 3OEKA 2AIXA 5CI5A 1GV8A 1Q9DA 1UTBA 4G4PA 5EQ7A 4MLVA 2VPNA 4H8IA 5DT6A 1FQBA 2A5TB 2PVUA 2MKZA 1B6HA 3LC8A 1OQHA 5H8NA 4BDOA 4DCXA 3OO7A 3PD9A 2BJIA 3ZSFA 2F8DA 1RKMA 1I69A 2O84X 3JZJA 1B0HA 2I4CA 1DOTA 3PPRA 4MX6A 3ZKLA 2F36A 1FTAA 4KYEA 4ND9A 3ZS6A 4DXCA 2Y5KA 4PE3A 1R1NA 1R6ZA 2OWZA 4ZS9A 4BDMA 5AA2A 2PMSA 1T0KA 4OFOA 1ZMGA 2ANJA 1WDNA 1B2HA 4GWXA 4OHNA 1IXCA 1LB9A 3GZGA 2KLFA 1N76A 1IIWA 2Z23A 2P3NA 4TOZA 1I6BA 2QMXA 4ZEBA 5CMKA 1LFGA 2LAOA 2FBPA 2HPGA 4PFIA 4RK9A 4TLLB 4DXUA 1SQYA 2B65A 4LN5A 4F22A 1LBCA 1EYJA 1WODA 4OVQA 2QMWA 3C9HA 3LSFB 3SEVA 3JYRA 4XKRA 3BKIB 3TMGA 1SW4A 3G3IA 3TZAA 4N81A 1TXFA 1VFDA 1US5A 5AA1A 3QYTA 2O51A 3Q25A 2QFLA 2M8CA 1I6QA 1MQGA 3MZBA 4QFKA 1B32A 1B5JA 3UP9A 2Q89A 1NV6A 1M5DA 4PAIA 2KR0A 4NX1A 4NWDA 5I56A 1FTOA 3OEMA 3K0VA 2W7YA 1NNTA 4NF6B 5I84A 1SVXB 3SEWA 4M1VA 1H44A 3E4RA 4P8BA 4FBPA 3DP8A 4IB2A 3D1RA 5KDTB 4U1ZA 4YKIA 1MPCA 2WYPA 4NGUA 2F5XA 4OFJA 3E13X 1QVSA 4G8HA 2H98A 4YB6A 3IORA 4RPOA 2B3FA 3K1NA 2F6PA 3IB0A 3SEXA 3TUSA 3O2AA 1Y9UA 1ZKBA 5DEXA 2WEFA 3DLNA 5F24A 5I57A 1JNFA 3U94A 1MXZA 4YZZA 3FXRA 3S4UA 4LVQA 1NV2A 2I6EA 2F3DA 1R9LA 1FCKA 3VXBA 3FXQA 2GFEA 5CMBA 4H6DA 4OMBA 3B6QA 4AB5A 1L5TA 3FATA 2ZYNA 3UA8A 1FBHA 4OANA 4HXVA 1FPBA 1B1XA 1TFAA 3OO8A 1NKXA 4N13A 1A55A 3IX1A 4JB7A 2F34A 1IMAA 3KOSA 5KCJB 3H3GA 1D9QA 4IO7A 2ZNTA 5A5LA 1IEJA 4R6HA 2V4CA 1FBEA 2XWOA 5CMCA 3T1BA 4R73A 4LZ5A 3IOVA 4YU0A 1FBGA 1FJ9A 3FVKA 3TCGA 4PBHA 4QHQA 5AA2D 3HHFA 4GL8A 2QVRA 3MVZA 4ISUA 5ITOA 1MG1A 2THIA 3U8QA 2ALUA 2XWIA 3G3JA 1FJ6A 3OO6A 4G61A 4NAPA 2O6AA 4H5GA 5BWJA 1JVYA 2XHDA 3LSWA 1B7ZA 1N3XA 3QSLA 1FPIA 1SI1A 3WAFA 5DVJA 1B52A 3HO7A 3Q26A 2Y7RA 3BIGA 1B7UA 3HSTA 1IXGA 3F11A 2ZYMA 1SW2A 4GWOA 4OVJA 1VR5A 4JWOA 5A5XB 4P1EA 2CZLA 5B70A 4NN3A 3CR9A 3PV0E 1NUYA 3FJ7A 3FVOA 5I58B 1FRPA 1XC1A 2Y7KA 4P56A 4QSCA 3IAZA 1TT1A 3FUZA 3SESA 3DP6A 1PC3A 4C1UA 2PFYA 3CG1A 3S9MC 2PBWA 4FEDA 5F1QA 4I8CA 4EF1A 5H8QA 4OESA 4O3AA 4F1YA 4LZ7A 4OVSA 4F29A 1IMCA 3K4UA 1QJMA 3KFMA 4GWUA 1MQJA 1YXIA 5DYHA 3FVGA 4G77A 3CIJA 2X26A 3P7IA 1MQDA 1QULA 1F9BA 2I4BA 3FV2A 3ISPA 1FSAA 1CB6A 2DE4A 4PFBA 3GYYA 4HE2A 5TP9B 3KBZA 5IZ3A 2O7IA 5H8HA 1ZTYA 1AH5A 5CRYA 2XD3A 3IK6B 2P2AA 4NTLA 1XHYA 3U1OA 2ONRA 4PFWA 1I6AA 1P1UA 4MAGA 3RQTA 4R75A 4X9TA 1LFIA 1JETA 2VT5A 4I40A 4RYAA 4IY5A 1NI9A 2VPOA 3IL1B 3B6WA 2VD2A 3SDFA 2Z8EA 2CZHA 4LQ5A 3ILUB 4OWDA 2OBGA 4XTCQ 1B9JA 1UTHB 2A5SA 4OVTA 1LBXA 1FPFA 1B3GA 3RT6B 4KYDA 1ATGA 3KSJA 4R2FA 2QSXA 3ONMA 2VP1A 3KSXA 3Q28A 3IOWA 1ZBMA 2OX3A 2Q88A 4GFRA 3KN8A 3SETA 4ECFA 4O8MA 1PB8A 1SBPA 4Q30B 5I59B 3TODA 2OWSA 4DLDA 2FHYA 5FTIA 4HW8A 5ET6A 2OLBA 4MMPA 4ESXA 3OSRA 3TCHA 5I2KA 2WYKA 1P1NA 3U93A 1B3FA 3NOHA 4GL0A 5H8FA 2DWAA 1FBPA 4YAHX 3MSTA 4EXLA 1M5FA 1NV4A 2NUVA 1DPEA 3S9EA 2V25A 1IMBA 1ZLQA 4O94A 4YMAA 2IEEA 4XKQA 1NNFA 4OERA 4TLMB 3W9WA 2GRVA 2XXPA 2REJA 2Y7WA 3L6GA 4PETA 2PCRA 1MH4A 3TTRA 2UVHA 3T66A 2PX1A 2XXTA 2H5YA 3MAMA 4GIZA 3FV1A 1MM6A 4THIA 3OD7A 3UGWA 4F2QA 3G3KA 2YLNA 4Q0CA 1Y1MA 1LAFE 3N94A 3G7WA 4FATA 4YMBA 3OELA 1MQIA 1B3LA 1SI0A 1Y3QA 1LCFA 4F39A 3O28A 3KJTA 1VDWA 2FVZA 1OQGA 1MDQA 1JW1A 3A29A 1M5BA 4FORA 1JP4A 3GBBA 3MPLA 3RUMA 5JTYB 3MVWA 4DIGA 1BTJA 1LSTA 2XXVA 3MWBA 3EHSA 3BBRA 3MYUA 1SPIA 3K1PA 4PFTA 5M2VA 4P0GA 3T93B 4GOTA 2F35A 2FYIA 3IO6A 5ET8A 3PMWA 2XD2A 4HTGA 5IZZA 4JSDA 4IY6A 1K9ZA 4OXVA 5T3JA 5I2NA 5EQAA 3RPLA 2Q2CA 2DQVA 4ONYA 1FPDA 3C36A 3CSGA 4QFOA 3O29A 3RNNA 1BLFA 3O97A 2OK2A 1RDXA 3V8XB 4IO2A 3AXFA 3FJMA 1YAEA 5AA4A 2HEUA 4N91A 1JQFA 4F3PA 4NHBA 2YJPA 1A40A 2O68A 3RYDA 5ITPA 4QSEA 4OENA 4MHFA 2DXRA 2HZKA 1PEBA 4H0WA 4H46A 1NNKA 4MIJA 2FNCA 1IMFA 1QUKA 5L9OA 4QFPA 3W9VA 2XXQA 2I58A 2Z8FA 1FQFA 2H4IA 1MPDA 2I49A 4U21A 2I0CA 1KZ8A 1OVTA 4P0IA 3MUQA 5K2YA 1S9TA 3TQWA 3TAJA 4BDQA 4OA4A 3KEIA 4GWSA 1EZOA 4G68B 4F19A 1JW4A 2REGA 2L5VA 1YPNA 1H3DA 1XOCA 4MCOA 4ZEDA 3VE1B 4QF9A 2H99A 4DI4B 3HCQA 3C34A 4NMYA 3MZ1A 4NF8A 5FHMA 2GHAA 2KQZA 5EHMA 2NVUB 3SKPA 3L6HA 3JV9A 5LTCA 1EU8A 3IFCA 4F1UA 3FIRA 2RCBA 4MH5A 4LQ2A 3KGCA 3MZ9A 3TKDA 4JVIA 1B4ZA 1SW1A 1DK4A 5ICQA 1QKAA 4O3BA 5TU0A 2XXIA 3PUWE 1QUIA 1YYZA 3SEYA 3VVEA 4R6YA 3MPKA 4GRKA 1LAGE 1IITA 3OOAA 1FPJA 4G8MA 3RPLB 4KPTA 2Z22A 3TFLA 3BIHA 2OWTA 4C0RA 3KZGA 4TQUQ 2ZNSA 1BIYA 4KCCA 2ZYKA 1NH7A 2Z8DA 2UYEA 1URDA 5EYFA 1HSJA 4MNPA 4HCWA 4YKJA 1UTBB 3HHGA 1VE4A 2CZKA 1RDZA 4GX4A 2ONSA 3BFTA 3O66A 4GQOA 2OCUA 4N8YA 5H8NB 3IOUA 3QK6A 5DW8A 4KHZE 2NWJA 3V83A 1QW0A 4N15A 3TEPA 1NL5A 4ZDMA 4BLAA 1FQAA 1CNQA 3MVYA 3B6TA 1MY4A 1N0TA 1BKAA 1IQ7A 2F7BA 1EYKA 1A99A 4IGRA 4MFIA 1PBPA 1N84A 1PBQA 2B3BA 5AA2B 4QSDA 4P9KA 3GBAA 3VVFA 2ZZVA 3H6WA 1LCTA 3E9XA 4ELPA 5IAIA 2F97A 4ELOA 5EHSA 4U22A 4HS7A 3QXMA 1GTKA 5IGAA 4U23A 4RA1A 4P1LA 3IFAA 4WXJA 1AMFA 4XKPA 4F3BA 2F7CA 1B46A 4ZE8A 3LSLA 3WAEA 5CMMA 2QVUA 4F1VA 4KQPA 3KOTA 4O3CA 1SD3A 1US4A 1HSLA 2XXYA 4DZ1A 1KA0A 2XXKA 5DVFA 5I56B 1RYXA 3W15C 1FPKA 4PE5B 1NV1A 4NG7A 3H6TA 3RN8A 1B3EA 3H6UA 3K02A 3A3CA 1D4NA 4AB6A 1MRPA 2IA4A 3VLWA 3LBSA 4KCDA 4YB7A 4FEBA 1A7LA 4GBVA 5LOMA 3T9UA 4H1XA 4R72A 4PBQA 5I3SA 5EQ8A 4ZE9A 1SYIA 2XWVA 4ZEKA 2VD3A 2QPQA 5DEXB 3K1MA 4RK2A 5I57B 4IO3A 3VLVA 5J1DA 4NF5A 1IMEA 1ANFA 1B58A 1FTKA 2D3IA 4Z0IA 2PFZA 4Q8RA 4NF4A 5L9MA 2F3BA 3BFUA 2B4MA 3FZVA 4OEVA 4NE4A 2XX9A 3IB1A 4G2ZA 3MJNA 4PGNA 3MQ9A 3PPNA 3VXCA 5FHNA 3PPOA 1IMDA 4XKNA 3FASA 3ILTB 4PP0A 3QAXA 2V3QA 1XVYA 1B7HA 1MXUA 4QBAA 3T9HB 4KD5A 5HPQA 1PDAA 3D4GA 4PCDA 4X1BA 1XI6A 4EF2A 3PUYE 3U65A 4F2OA 1NMUA 1ELJA 1H45A 1DTZA 2VGQA 1P1WA 3OO9A 3LV0A 4GXSB 1AWBA 1XT8A 3PUXE 3S9LC 4GWWA 4POWA 2DP8A 2Y5LA 1LB8A 2CZIA 1LBZA 3E3KA 5DVIA 1FTJA 3RY3A 4GLIA 2FA7A 4XF5A 4E0WA 3MVXA 4FE8A 4MF3A 4U4SA 1MY2A 2NXOA 2V3TA 4PAKA 1NFTA 3C31A 3TTKA 3M3LA 1TFDA 1FPLA 2R6GE 2B4LA 3H4ZA 4I3EA 4G8NA 5CM6A 4ELQA 4DI3D 2R9JA 3TCFA 4BDRA 4F31B 3T9XB 4G68C 2DE3A 1LBWA 4OETA 1QGXA 3HPIA 5TPAA 4GWZA 5JK4A 5FHOA 1WVJA 3KJ7A 1UQWA 3K00A 4N8GA 5IM2A 2XXUA 4MNCA 4R9FA 1P99A 4POXA 2X7QA 2ZZXA 2UYFA 3GLBA 3THIA 1H43A 3TDJA 1USYH 1NUXA 4KYSA 5H8QB 1LAHE 4Z7EA 1UIUA 4DCYA 3ECRA 3EKIA 2QS4A 4EXKA 5AE4A 3TELA 1Z7ME 1YTVA 5LDZA 4K3FA 2RCAA 3C35A 4M4GA 4PFYA 4PDHA 3MP1A 4WEDA 1ZU0A 2A5TA 4I62A 5IZ3B 5H8HB 1Q35A 3B7DA 1N7XA 4PAFA 4N6DA 2ZMBA 2E0SA 4XFEA 4GBWA 4PFUA 1HSEA 4QRZA 4KR5A 3MP8A 1QKBA 1DTGA 1YCJA 4OVRA 1M5CA 5B7DA 2P0SA 1N04A 4HCYA 3USDA 3TTLA 2DWHA 5L9SA 3LSXA 5F7VA 3H7MA 1Y3PA 5ESYA 3MBPA 1PB9A 4PDDA 3E79A 2HCAA 2G93A 4LZ8A 4P47A 2D21A 2RINA 1II5A 2F7AA 1IXIA 2HAUA 2DE2A 2HZLA 4EQ7A 2Q74A 2I0BA 3S2VA 4ELRA 4YKPA 1B5IA 4RNSA 1N3WA 2DWIA 3FVNA 2HAVA 2Q8JA 1XVXA 1AOVA 3EHUA 1LAXA 1NNPA 4RY1A 4F3GA 5KZTA 3G3FA 3HV1A 3PTYA 3N6TA 5ELVA 1MY3A 4IGTA 4JWYA 3TTNA 4MNIA 3SEUA 2DSFA 4N6KA 1J1NA 3RTWB 3DP4A 4DXBA 4GXAA 3N26A 4JSOA 5I2KB 4EQ9A 4YB5A 3G3HA 5H8FB 3DM0A 3LUYA 4IO4A 3TQLA 5EYHA 4X8RA 2QRYA 1DCUA 4WEPA 3QUFA 5AA3A 2NOOA 2VHAA 4XIGQ 1BK4A 1NUWA 4NF6A 1MY0A 3V89B 4NQ8A 2GH9A 4JWXA 2QS2A 2XA5A 3FGSA 4NEDA 2F78A 5KDTA 5ET5A 1NV5A 2DXYA 4O7IA 3PD8A 2RKMA 2DDKA 3UIFA 3OENA 3K6XA 1BP5A 4WKMA 1JEUA 1MS7A 4I3YA 1LEVA 4IO5A 2QJEA 5K2XA 1KA1A 5ICTA 4R9GA 4I9DA 5HM4B 3FD3A 4XEQA 3R7XA 4U1OA 3VDFA 5ISUA 1O64A 3T22A 1AIVA 4H67A 1FBCA 3V5AA 2I48A 4JXIA 2XXXA 1LBVA 1OLAA 1TWYA
chains in the Genus database with same CATH topology
2QVUA 4F1VA 4MAGA 1LBYA 4X9TA 4H45A 5EQ9A 2VT5A 4JVCA 1INPA 4I40A 2WBDA 1KA0A 4AS4A 2XXKA 4OVPA 1NI9A 2VPOA 2CZHA 1YZ0A 1FPKA 4PF8A 3B50A 1NV1A 4NG7A 4OVTA 1NV0A 4PFRA 1LBXA 1FPFA 3ROJA 3CHGA 4HE1A 2CEXA 4GBVA 4QXDA 4MEVA 2OX3A 4UABA 2WX9A 4PBQA 5I3SA 5EQ8A 4O8MA 2CEYA 5J16A 4MJOA 2XWVA 2QPQA 2FHYA 5ET6A 5J1DA 4MMPA 1IMEA 3FBPA 1Q9DA 3FXBA 2PFZA 4IR8A 5EQ7A 2WYKA 2F3BA 2VPNA 3NOHA 1FBPA 2B4MA 2MKZA 3MSTA 4PTKA 5IZ1A 1FBFA 1G0HA 2WBBA 1NV4A 2BJIA 4PGNA 2P3VA 5I5PA 4HE0A 1IMBA 1NV3A 1IMDA 4MX6A 4O94A 1FTAA 2V3QA 3W9WA 1K9YA 2Y5KA 4PE3A 2OWZA 4PETA 2PCRA 4QBAA 4GWXA 4PCDA 2JJKA 3HFUA 1XI6A 3U65A 5ET7A 4X04A 2P3NA 3LV0A 4NF0A 2FBPA 2HPGA 1AWBA 1VDWA 2ZZWA 4PFIA 2FVZA 2Q9TA 1DBZA 3A29A 4GWWA 1JP4A 4LN5A 1EYJA 2Y5LA 4OVQA 2CZIA 1LBZA 4XF5A 3QMFA 4N81A 3MYUA 1SPIA 4PAKA 5EYGA 1FPLA 2QFLA 5ET8A 2B4LA 4I3EA 5CM6A 5IZZA 4DI3D 4GWYA 1NV6A 1K9ZA 5T3JA 4PAIA 2KR0A 4NX1A 5EQAA 3RPLA 1FPDA 2DE3A 1LBWA 2XWKA 1QGXA 1NV7A 4GX6A 4GWZA 5JK4A 5FBPA 1RDXA 4M1VA 4N8GA 5IM2A 4P8BA 4N4UA 4FBPA 4MNCA 3D1RA 4N91A 4NHBA 2ZZXA 2WYPA 4NGUA 3RYDA 2F5XA 4PGPA 1NUXA 4MHFA 2HZKA 4MIJA 4H46A 1IMFA 3EKIA 4P3LA 3W9VA 2GQ1A 2WEFA 5F24A 5LDZA 4YZZA 1KZ8A 4PDHA 1NV2A 2F3DA 5I7IA 5IZ3B 3KC1A 4OA4A 4PAFA 3KC0A 4N6DA 4XFEA 1EYIA 4GWSA 4F19A 4GBWA 4O7MA 2L5VA 4MCOA 1FBHA 4OANA 4HXVA 1FPBA 4DI4B 4JVDA 4OVRA 2KQZA 4HCYA 1IMAA 5LTCA 3IFCA 4F1UA 1NUZA 5ESYA 1D9QA 3SZPA 4YICA 4PDDA 5A5LA 3E79A 4JVIA 2V4CA 1FBEA 2XWOA 3T1BA 4P47A 1DK4A 1RDYA 1FBGA 1FJ9A 2DE2A 2HZLA 4PBHA 2Q74A 2QVRA 1YYZA 4KXPA 1FPJA 3RPLB 2XWIA 3BIHA 1FJ6A 4G61A 4NAPA 4PC9A 1FPEA 3PTYA 1FPIA 2HXRA 4MNIA 4MNPA 4HCWA 4N6KA 3E78A 3BIGA 2QVVA 1G0IA 2CZKA 1FPGA 1RDZA 4GX4A 5EYHA 4X8RA 4GX3A 1DCUA 4PF6A 4N8YA 5DW8A 4P1EA 1FBDA 4N15A 4NN3A 1BK4A 1NUWA 3LUZA 1CNQA 1NUYA 4NQ8A 3T0JA 1EYKA 2XA5A 1FRPA 4N17A 4P56A 2FIEA 2FIXA 2PFYA 5ET5A 1NV5A 4P9KA 4O7IA 2ZZVA 2DDKA 2DVZA 4F18A 2R8TA 4OVSA 1IMCA 4GWUA 4I3YA 1YXIA 1LEVA 1KA1A 2HHMA 4AS5A 3ISPA 1FSAA 5IGAA 2DE4A 4PFBA 4XEQA 4P1LA 3B8BA 3GYYA 2Q8MA 3IFAA 4HE2A 3KBZA 5IZ3A 1FBCA 1LBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O94 A;  4PC9 A;  4PGP A;  4MHF A;  2HZK A;  4MAG A;  4PE3 A;  4MIJ A;  4PET A;  4MNI A;  4MNP A;  4P3L A;  4N6K A;  4PCD A;  3U65 A;  2XXK A;  4OVP A;  2VPO A;  4X8R A;  4YZZ A;  4X04 A;  4PF8 A;  3B50 A;  4PF6 A;  4NG7 A;  4N8Y A;  4PDH A;  4NF0 A;  4P1E A;  4OVT A;  5I7I A;  2HPG A;  4N15 A;  2ZZW A;  4PFI A;  4NN3 A;  4PFR A;  4OA4 A;  4PAF A;  4NQ8 A;  4LN5 A;  4N6D A;  4XFE A;  4O7M A;  4OVQ A;  2CEX A;  2XA5 A;  4MCO A;  4MEV A;  4OAN A;  4N17 A;  4P56 A;  4DI4 B;  4OVR A;  4UAB A;  2WX9 A;  4PBQ A;  2PFY A;  4XF5 A;  4O8M A;  4P9K A;  2CEY A;  5LTC A;  2ZZV A;  2XWV A;  4PAK A;  4YIC A;  4OVS A;  4PDD A;  4MMP A;  2V4C A;  5CM6 A;  5IZZ A;  4DI3 D;  2XWO A;  4P47 A;  3FXB A;  2PFZ A;  4PAI A;  4NX1 A;  2WYK A;  2HZL A;  2VPN A;  4PBH A;  2XWK A;  5IGA A;  4PFB A;  4XEQ A;  4P1L A;  3GYY A;  4PGN A;  5I5P A;  4N8G A;  5IM2 A;  4P8B A;  4N4U A;  4MNC A;  4N91 A;  2XWI A;  4NHB A;  2ZZX A;  4NAP A;  2WYP A;  4NGU A;  4MX6 A; 
#chains in the Genus database with same CATH topology
 3M3K A;  3O6H A;  3OXN A;  3ODB A;  4R2B A;  1D3K A;  4RJZ A;  1LLS A;  3O6I A;  3H6V A;  1LBY A;  4MLQ A;  4H45 A;  1B40 A;  1Y20 A;  4ZZA A;  1Z7N E;  4GVO A;  2Y7I A;  5KCJ A;  4OTE A;  1RYO A;  4JBZ A;  4JVC A;  3S9N C;  2WBD A;  4AS4 A;  4OYV A;  5I2N B;  3EF7 A;  2UVG A;  3KN3 A;  2RC7 A;  1YZ0 A;  3IO4 A;  4PF8 A;  3B50 A;  1URS A;  4ESW A;  2WKY A;  3U72 A;  3FXU A;  4U4X A;  1NV0 A;  4PFR A;  1VSO A;  5AA4 B;  3ROJ A;  2E1S A;  3CHG A;  4HE1 A;  4MEV A;  1B0L A;  3H06 B;  4JDF A;  1LBB A;  2WX9 A;  3PMX A;  2H9B A;  4MJO A;  1B5H A;  4KI0 E;  3UK4 A;  3UN6 A;  4LAT A;  2I3W A;  1IUD A;  2YPN A;  2D5W A;  4OZ9 A;  3FBP A;  3IOT A;  3FXB A;  1GGG A;  4IR8 A;  3A09 A;  4LA9 A;  3RTF B;  1B4H A;  3O9P A;  3C4M A;  4PTK A;  5IZ1 A;  5A5X A;  1FBF A;  1G0H A;  2WBB A;  1B3H A;  4GD5 A;  2P3V A;  1O7T A;  5I5P A;  1M5E A;  4HE0 A;  4RXL A;  4NF8 B;  1NV3 A;  3O6G A;  1MXX A;  3QUJ A;  3VV5 A;  1USY E;  5I58 A;  3CRB A;  1A54 A;  3M8U A;  2XXW A;  4EQB A;  5CC2 A;  1EZP A;  1K9Y A;  5CBS A;  3R26 A;  1AL3 A;  1B1H A;  4LON B;  1D9Y A;  2JJK A;  3HFU A;  1MXV A;  2Y7P A;  5ET7 A;  4X48 A;  3KBR A;  4DDD A;  4X04 A;  2GHB A;  2H25 A;  2UVJ A;  4NF0 A;  3PGF A;  3R6U A;  3K6U A;  1DSN A;  2ZZW A;  3CG3 A;  2Q9T A;  1DBZ A;  5TP9 A;  1MPB A;  5FTH A;  4R74 A;  3CFX A;  2AL4 A;  1OLC A;  4F3S A;  3CFZ A;  1URG A;  1DMB A;  3QMF A;  3T96 B;  4N6P A;  2O7U A;  4OEU A;  5EYG A;  3N6U A;  2PYY A;  1KWH A;  2HXW A;  4GWY A;  3PMV A;  2XX8 A;  2UVI A;  3DEL B;  2XWK A;  3EN3 A;  1Y3N A;  1NV7 A;  4U2R A;  2V84 A;  4GX6 A;  1B51 A;  1UTH A;  5FBP A;  3EHT A;  1MQH A;  4N4U A;  2ZYO A;  1FW0 A;  4LUB A;  1S7Y A;  3C32 A;  1R9Q A;  1OVB A;  4Q5T A;  4PGP A;  2AYS A;  3CFL A;  4FEC A;  1MXY A;  3MC2 A;  4PQJ A;  2F6G A;  5DTB A;  4GF8 A;  1JVX A;  4P3L A;  5I59 A;  1IZ1 A;  2GQ1 A;  4H65 A;  3K6W A;  1XS5 A;  4H5F A;  2DYX A;  1MM7 A;  1POT A;  3TYH A;  3ZKK A;  3C33 A;  3PU5 A;  3MP6 A;  4QFN A;  1LFH A;  1EZ9 A;  2OZZ A;  5H8S A;  2V93 A;  5I7I A;  1FTL A;  3K2D A;  3KC1 A;  1UIV A;  2DVC A;  3KC0 A;  1EYI A;  4O7M A;  3RLF E;  5HBC A;  2PT2 A;  2ESN A;  4JVD A;  3IJX B;  3U92 A;  2CMO A;  4L17 A;  1LGB C;  3RGY A;  4KFQ A;  1NUZ A;  3PPQ A;  1FQC A;  3SZP A;  3N5L A;  3TPA A;  1O63 A;  4YIC A;  4FIM A;  4IO6 A;  1D9V A;  1GR2 A;  3K6V A;  4N07 A;  3SER A;  1RDY A;  2P1S A;  2O69 A;  3VVD A;  4OQO A;  3HN0 A;  3MW0 A;  1FQD A;  5IKB A;  1SDX A;  3IJO B;  4KXP A;  1EH3 A;  3Q29 A;  1SW5 A;  3FJG A;  3IR1 A;  3RT8 A;  3H03 A;  2O1M A;  2ONK E;  3T9V A;  3RPW A;  3CI8 A;  4PC9 A;  5JTY A;  1FPE A;  1B05 A;  1OMP A;  2XXR A;  1GVC A;  4LP2 B;  2DWJ A;  4C1T A;  2HXR A;  3UOR A;  2I3V A;  2DOJ A;  1PB7 A;  4NF5 B;  3E78 A;  2QVV A;  1G0I A;  3PUV E;  4ZEF A;  1DPP A;  1ZJL A;  4NF4 B;  1NH8 A;  1FPG A;  1MH3 A;  5L8D A;  3PUZ E;  4GX3 A;  4PF6 A;  5CBR A;  3CVG A;  1VFE A;  2RF1 A;  1FBD A;  3Q27 A;  2R71 A;  2HQ0 A;  3LUZ A;  3VLU A;  2HFB A;  3EPE A;  1IXH A;  1Q1K A;  1H76 A;  3K01 A;  2X7P A;  3PPP A;  4BDN A;  4NWC A;  4I1D A;  3T0J A;  4BDL A;  3GXA A;  4H8J A;  1POY 1;  1P1Q A;  2Q2A A;  4N17 A;  2FIE A;  3KN7 A;  3OSQ A;  2FIX A;  3CSB A;  1CE2 A;  1QUJ A;  3VFJ A;  2DVZ A;  1FTM A;  2V3U A;  1MDP 1;  4F18 A;  2R8T A;  4XXU A;  1MXW A;  2RC8 A;  3G3G A;  4QFL A;  4AQ4 A;  1A8E A;  2PT1 A;  2DS9 A;  3IB2 A;  4P11 A;  1A8F A;  2OJT A;  2HHM A;  3I6V A;  4AS5 A;  1FQE A;  2QS1 A;  3M3F A;  3B8B A;  2Q8M A;  4X1D A;  4ZEC A;  4RPN A;  2O1L A;  4DE8 A;  2ZXT A;  5JEI A;  2Y84 A;  4G68 A;  2QL3 A;  4OFL A;  4MBP A;  2ZNU A;  4ZZE A;  1Y1Z A;  3KG2 A;  3D4C A;  1ZIU A;  3TTM A;  5BUU A;  3I3V A;  4ZEI A;  4R6K A;  5EQ9 A;  1N7W A;  3QIM A;  1INP A;  1OIB A;  4YKK A;  2AL5 A;  4OVP A;  4UA8 A;  3I5O A;  3EQ1 A;  1SYH A;  2XXH A;  1JW5 A;  4EDP A;  1P1O A;  1Y4T A;  3OMB A;  5TPA B;  1JEV A;  2ABH A;  2G29 A;  1S50 A;  4FAJ A;  2QS3 A;  3A3U A;  2BJJ X;  1MY1 A;  2RC9 A;  4FJP A;  2CEX A;  4QXD A;  2VOZ A;  2UXA A;  4UAB A;  4UAC A;  2CEY A;  4EUO A;  1Y4C A;  2XX7 A;  5J16 A;  3LR1 A;  4E0X A;  3OEK A;  2AIX A;  5CI5 A;  1GV8 A;  1Q9D A;  1UTB A;  4G4P A;  5EQ7 A;  4MLV A;  2VPN A;  4H8I A;  5DT6 A;  1FQB A;  2A5T B;  2PVU A;  2MKZ A;  1B6H A;  3LC8 A;  1OQH A;  5H8N A;  4BDO A;  4DCX A;  3OO7 A;  3PD9 A;  2BJI A;  3ZSF A;  2F8D A;  1RKM A;  1I69 A;  2O84 X;  3JZJ A;  1B0H A;  2I4C A;  1DOT A;  3PPR A;  4MX6 A;  3ZKL A;  2F36 A;  1FTA A;  4KYE A;  4ND9 A;  3ZS6 A;  4DXC A;  2Y5K A;  4PE3 A;  1R1N A;  1R6Z A;  2OWZ A;  4ZS9 A;  4BDM A;  5AA2 A;  2PMS A;  1T0K A;  4OFO A;  1ZMG A;  2ANJ A;  1WDN A;  1B2H A;  4GWX A;  4OHN A;  1IXC A;  1LB9 A;  3GZG A;  2KLF A;  1N76 A;  1IIW A;  2Z23 A;  2P3N A;  4TOZ A;  1I6B A;  2QMX A;  4ZEB A;  5CMK A;  1LFG A;  2LAO A;  2FBP A;  2HPG A;  4PFI A;  4RK9 A;  4TLL B;  4DXU A;  1SQY A;  2B65 A;  4LN5 A;  4F22 A;  1LBC A;  1EYJ A;  1WOD A;  4OVQ A;  2QMW A;  3C9H A;  3LSF B;  3SEV A;  3JYR A;  4XKR A;  3BKI B;  3TMG A;  1SW4 A;  3G3I A;  3TZA A;  4N81 A;  1TXF A;  1VFD A;  1US5 A;  5AA1 A;  3QYT A;  2O51 A;  3Q25 A;  2QFL A;  2M8C A;  1I6Q A;  1MQG A;  3MZB A;  4QFK A;  1B32 A;  1B5J A;  3UP9 A;  2Q89 A;  1NV6 A;  1M5D A;  4PAI A;  2KR0 A;  4NX1 A;  4NWD A;  5I56 A;  1FTO A;  3OEM A;  3K0V A;  2W7Y A;  1NNT A;  4NF6 B;  5I84 A;  1SVX B;  3SEW A;  4M1V A;  1H44 A;  3E4R A;  4P8B A;  4FBP A;  3DP8 A;  4IB2 A;  3D1R A;  5KDT B;  4U1Z A;  4YKI A;  1MPC A;  2WYP A;  4NGU A;  2F5X A;  4OFJ A;  3E13 X;  1QVS A;  4G8H A;  2H98 A;  4YB6 A;  3IOR A;  4RPO A;  2B3F A;  3K1N A;  2F6P A;  3IB0 A;  3SEX A;  3TUS A;  3O2A A;  1Y9U A;  1ZKB A;  5DEX A;  2WEF A;  3DLN A;  5F24 A;  5I57 A;  1JNF A;  3U94 A;  1MXZ A;  4YZZ A;  3FXR A;  3S4U A;  4LVQ A;  1NV2 A;  2I6E A;  2F3D A;  1R9L A;  1FCK A;  3VXB A;  3FXQ A;  2GFE A;  5CMB A;  4H6D A;  4OMB A;  3B6Q A;  4AB5 A;  1L5T A;  3FAT A;  2ZYN A;  3UA8 A;  1FBH A;  4OAN A;  4HXV A;  1FPB A;  1B1X A;  1TFA A;  3OO8 A;  1NKX A;  4N13 A;  1A55 A;  3IX1 A;  4JB7 A;  2F34 A;  1IMA A;  3KOS A;  5KCJ B;  3H3G A;  1D9Q A;  4IO7 A;  2ZNT A;  5A5L A;  1IEJ A;  4R6H A;  2V4C A;  1FBE A;  2XWO A;  5CMC A;  3T1B A;  4R73 A;  4LZ5 A;  3IOV A;  4YU0 A;  1FBG A;  1FJ9 A;  3FVK A;  3TCG A;  4PBH A;  4QHQ A;  5AA2 D;  3HHF A;  4GL8 A;  2QVR A;  3MVZ A;  4ISU A;  5ITO A;  1MG1 A;  2THI A;  3U8Q A;  2ALU A;  2XWI A;  3G3J A;  1FJ6 A;  3OO6 A;  4G61 A;  4NAP A;  2O6A A;  4H5G A;  5BWJ A;  1JVY A;  2XHD A;  3LSW A;  1B7Z A;  1N3X A;  3QSL A;  1FPI A;  1SI1 A;  3WAF A;  5DVJ A;  1B52 A;  3HO7 A;  3Q26 A;  2Y7R A;  3BIG A;  1B7U A;  3HST A;  1IXG A;  3F11 A;  2ZYM A;  1SW2 A;  4GWO A;  4OVJ A;  1VR5 A;  4JWO A;  5A5X B;  4P1E A;  2CZL A;  5B70 A;  4NN3 A;  3CR9 A;  3PV0 E;  1NUY A;  3FJ7 A;  3FVO A;  5I58 B;  1FRP A;  1XC1 A;  2Y7K A;  4P56 A;  4QSC A;  3IAZ A;  1TT1 A;  3FUZ A;  3SES A;  3DP6 A;  1PC3 A;  4C1U A;  2PFY A;  3CG1 A;  3S9M C;  2PBW A;  4FED A;  5F1Q A;  4I8C A;  4EF1 A;  5H8Q A;  4OES A;  4O3A A;  4F1Y A;  4LZ7 A;  4OVS A;  4F29 A;  1IMC A;  3K4U A;  1QJM A;  3KFM A;  4GWU A;  1MQJ A;  1YXI A;  5DYH A;  3FVG A;  4G77 A;  3CIJ A;  2X26 A;  3P7I A;  1MQD A;  1QUL A;  1F9B A;  2I4B A;  3FV2 A;  3ISP A;  1FSA A;  1CB6 A;  2DE4 A;  4PFB A;  3GYY A;  4HE2 A;  5TP9 B;  3KBZ A;  5IZ3 A;  2O7I A;  5H8H A;  1ZTY A;  1AH5 A;  5CRY A;  2XD3 A;  3IK6 B;  2P2A A;  4NTL A;  1XHY A;  3U1O A;  2ONR A;  4PFW A;  1I6A A;  1P1U A;  4MAG A;  3RQT A;  4R75 A;  4X9T A;  1LFI A;  1JET A;  2VT5 A;  4I40 A;  4RYA A;  4IY5 A;  1NI9 A;  2VPO A;  3IL1 B;  3B6W A;  2VD2 A;  3SDF A;  2Z8E A;  2CZH A;  4LQ5 A;  3ILU B;  4OWD A;  2OBG A;  4XTC Q;  1B9J A;  1UTH B;  2A5S A;  4OVT A;  1LBX A;  1FPF A;  1B3G A;  3RT6 B;  4KYD A;  1ATG A;  3KSJ A;  4R2F A;  2QSX A;  3ONM A;  2VP1 A;  3KSX A;  3Q28 A;  3IOW A;  1ZBM A;  2OX3 A;  2Q88 A;  4GFR A;  3KN8 A;  3SET A;  4ECF A;  4O8M A;  1PB8 A;  1SBP A;  4Q30 B;  5I59 B;  3TOD A;  2OWS A;  4DLD A;  2FHY A;  5FTI A;  4HW8 A;  5ET6 A;  2OLB A;  4MMP A;  4ESX A;  3OSR A;  3TCH A;  5I2K A;  2WYK A;  1P1N A;  3U93 A;  1B3F A;  3NOH A;  4GL0 A;  5H8F A;  2DWA A;  1FBP A;  4YAH X;  3MST A;  4EXL A;  1M5F A;  1NV4 A;  2NUV A;  1DPE A;  3S9E A;  2V25 A;  1IMB A;  1ZLQ A;  4O94 A;  4YMA A;  2IEE A;  4XKQ A;  1NNF A;  4OER A;  4TLM B;  3W9W A;  2GRV A;  2XXP A;  2REJ A;  2Y7W A;  3L6G A;  4PET A;  2PCR A;  1MH4 A;  3TTR A;  2UVH A;  3T66 A;  2PX1 A;  2XXT A;  2H5Y A;  3MAM A;  4GIZ A;  3FV1 A;  1MM6 A;  4THI A;  3OD7 A;  3UGW A;  4F2Q A;  3G3K A;  2YLN A;  4Q0C A;  1Y1M A;  1LAF E;  3N94 A;  3G7W A;  4FAT A;  4YMB A;  3OEL A;  1MQI A;  1B3L A;  1SI0 A;  1Y3Q A;  1LCF A;  4F39 A;  3O28 A;  3KJT A;  1VDW A;  2FVZ A;  1OQG A;  1MDQ A;  1JW1 A;  3A29 A;  1M5B A;  4FOR A;  1JP4 A;  3GBB A;  3MPL A;  3RUM A;  5JTY B;  3MVW A;  4DIG A;  1BTJ A;  1LST A;  2XXV A;  3MWB A;  3EHS A;  3BBR A;  3MYU A;  1SPI A;  3K1P A;  4PFT A;  5M2V A;  4P0G A;  3T93 B;  4GOT A;  2F35 A;  2FYI A;  3IO6 A;  5ET8 A;  3PMW A;  2XD2 A;  4HTG A;  5IZZ A;  4JSD A;  4IY6 A;  1K9Z A;  4OXV A;  5T3J A;  5I2N A;  5EQA A;  3RPL A;  2Q2C A;  2DQV A;  4ONY A;  1FPD A;  3C36 A;  3CSG A;  4QFO A;  3O29 A;  3RNN A;  1BLF A;  3O97 A;  2OK2 A;  1RDX A;  3V8X B;  4IO2 A;  3AXF A;  3FJM A;  1YAE A;  5AA4 A;  2HEU A;  4N91 A;  1JQF A;  4F3P A;  4NHB A;  2YJP A;  1A40 A;  2O68 A;  3RYD A;  5ITP A;  4QSE A;  4OEN A;  4MHF A;  2DXR A;  2HZK A;  1PEB A;  4H0W A;  4H46 A;  1NNK A;  4MIJ A;  2FNC A;  1IMF A;  1QUK A;  5L9O A;  4QFP A;  3W9V A;  2XXQ A;  2I58 A;  2Z8F A;  1FQF A;  2H4I A;  1MPD A;  2I49 A;  4U21 A;  2I0C A;  1KZ8 A;  1OVT A;  4P0I A;  3MUQ A;  5K2Y A;  1S9T A;  3TQW A;  3TAJ A;  4BDQ A;  4OA4 A;  3KEI A;  4GWS A;  1EZO A;  4G68 B;  4F19 A;  1JW4 A;  2REG A;  2L5V A;  1YPN A;  1H3D A;  1XOC A;  4MCO A;  4ZED A;  3VE1 B;  4QF9 A;  2H99 A;  4DI4 B;  3HCQ A;  3C34 A;  4NMY A;  3MZ1 A;  4NF8 A;  5FHM A;  2GHA A;  2KQZ A;  5EHM A;  2NVU B;  3SKP A;  3L6H A;  3JV9 A;  5LTC A;  1EU8 A;  3IFC A;  4F1U A;  3FIR A;  2RCB A;  4MH5 A;  4LQ2 A;  3KGC A;  3MZ9 A;  3TKD A;  4JVI A;  1B4Z A;  1SW1 A;  1DK4 A;  5ICQ A;  1QKA A;  4O3B A;  5TU0 A;  2XXI A;  3PUW E;  1QUI A;  1YYZ A;  3SEY A;  3VVE A;  4R6Y A;  3MPK A;  4GRK A;  1LAG E;  1IIT A;  3OOA A;  1FPJ A;  4G8M A;  3RPL B;  4KPT A;  2Z22 A;  3TFL A;  3BIH A;  2OWT A;  4C0R A;  3KZG A;  4TQU Q;  2ZNS A;  1BIY A;  4KCC A;  2ZYK A;  1NH7 A;  2Z8D A;  2UYE A;  1URD A;  5EYF A;  1HSJ A;  4MNP A;  4HCW A;  4YKJ A;  1UTB B;  3HHG A;  1VE4 A;  2CZK A;  1RDZ A;  4GX4 A;  2ONS A;  3BFT A;  3O66 A;  4GQO A;  2OCU A;  4N8Y A;  5H8N B;  3IOU A;  3QK6 A;  5DW8 A;  4KHZ E;  2NWJ A;  3V83 A;  1QW0 A;  4N15 A;  3TEP A;  1NL5 A;  4ZDM A;  4BLA A;  1FQA A;  1CNQ A;  3MVY A;  3B6T A;  1MY4 A;  1N0T A;  1BKA A;  1IQ7 A;  2F7B A;  1EYK A;  1A99 A;  4IGR A;  4MFI A;  1PBP A;  1N84 A;  1PBQ A;  2B3B A;  5AA2 B;  4QSD A;  4P9K A;  3GBA A;  3VVF A;  2ZZV A;  3H6W A;  1LCT A;  3E9X A;  4ELP A;  5IAI A;  2F97 A;  4ELO A;  5EHS A;  4U22 A;  4HS7 A;  3QXM A;  1GTK A;  5IGA A;  4U23 A;  4RA1 A;  4P1L A;  3IFA A;  4WXJ A;  1AMF A;  4XKP A;  4F3B A;  2F7C A;  1B46 A;  4ZE8 A;  3LSL A;  3WAE A;  5CMM A;  2QVU A;  4F1V A;  4KQP A;  3KOT A;  4O3C A;  1SD3 A;  1US4 A;  1HSL A;  2XXY A;  4DZ1 A;  1KA0 A;  2XXK A;  5DVF A;  5I56 B;  1RYX A;  3W15 C;  1FPK A;  4PE5 B;  1NV1 A;  4NG7 A;  3H6T A;  3RN8 A;  1B3E A;  3H6U A;  3K02 A;  3A3C A;  1D4N A;  4AB6 A;  1MRP A;  2IA4 A;  3VLW A;  3LBS A;  4KCD A;  4YB7 A;  4FEB A;  1A7L A;  4GBV A;  5LOM A;  3T9U A;  4H1X A;  4R72 A;  4PBQ A;  5I3S A;  5EQ8 A;  4ZE9 A;  1SYI A;  2XWV A;  4ZEK A;  2VD3 A;  2QPQ A;  5DEX B;  3K1M A;  4RK2 A;  5I57 B;  4IO3 A;  3VLV A;  5J1D A;  4NF5 A;  1IME A;  1ANF A;  1B58 A;  1FTK A;  2D3I A;  4Z0I A;  2PFZ A;  4Q8R A;  4NF4 A;  5L9M A;  2F3B A;  3BFU A;  2B4M A;  3FZV A;  4OEV A;  4NE4 A;  2XX9 A;  3IB1 A;  4G2Z A;  3MJN A;  4PGN A;  3MQ9 A;  3PPN A;  3VXC A;  5FHN A;  3PPO A;  1IMD A;  4XKN A;  3FAS A;  3ILT B;  4PP0 A;  3QAX A;  2V3Q A;  1XVY A;  1B7H A;  1MXU A;  4QBA A;  3T9H B;  4KD5 A;  5HPQ A;  1PDA A;  3D4G A;  4PCD A;  4X1B A;  1XI6 A;  4EF2 A;  3PUY E;  3U65 A;  4F2O A;  1NMU A;  1ELJ A;  1H45 A;  1DTZ A;  2VGQ A;  1P1W A;  3OO9 A;  3LV0 A;  4GXS B;  1AWB A;  1XT8 A;  3PUX E;  3S9L C;  4GWW A;  4POW A;  2DP8 A;  2Y5L A;  1LB8 A;  2CZI A;  1LBZ A;  3E3K A;  5DVI A;  1FTJ A;  3RY3 A;  4GLI A;  2FA7 A;  4XF5 A;  4E0W A;  3MVX A;  4FE8 A;  4MF3 A;  4U4S A;  1MY2 A;  2NXO A;  2V3T A;  4PAK A;  1NFT A;  3C31 A;  3TTK A;  3M3L A;  1TFD A;  1FPL A;  2R6G E;  2B4L A;  3H4Z A;  4I3E A;  4G8N A;  5CM6 A;  4ELQ A;  4DI3 D;  2R9J A;  3TCF A;  4BDR A;  4F31 B;  3T9X B;  4G68 C;  2DE3 A;  1LBW A;  4OET A;  1QGX A;  3HPI A;  5TPA A;  4GWZ A;  5JK4 A;  5FHO A;  1WVJ A;  3KJ7 A;  1UQW A;  3K00 A;  4N8G A;  5IM2 A;  2XXU A;  4MNC A;  4R9F A;  1P99 A;  4POX A;  2X7Q A;  2ZZX A;  2UYF A;  3GLB A;  3THI A;  1H43 A;  3TDJ A;  1USY H;  1NUX A;  4KYS A;  5H8Q B;  1LAH E;  4Z7E A;  1UIU A;  4DCY A;  3ECR A;  3EKI A;  2QS4 A;  4EXK A;  5AE4 A;  3TEL A;  1Z7M E;  1YTV A;  5LDZ A;  4K3F A;  2RCA A;  3C35 A;  4M4G A;  4PFY A;  4PDH A;  3MP1 A;  4WED A;  1ZU0 A;  2A5T A;  4I62 A;  5IZ3 B;  5H8H B;  1Q35 A;  3B7D A;  1N7X A;  4PAF A;  4N6D A;  2ZMB A;  2E0S A;  4XFE A;  4GBW A;  4PFU A;  1HSE A;  4QRZ A;  4KR5 A;  3MP8 A;  1QKB A;  1DTG A;  1YCJ A;  4OVR A;  1M5C A;  5B7D A;  2P0S A;  1N04 A;  4HCY A;  3USD A;  3TTL A;  2DWH A;  5L9S A;  3LSX A;  5F7V A;  3H7M A;  1Y3P A;  5ESY A;  3MBP A;  1PB9 A;  4PDD A;  3E79 A;  2HCA A;  2G93 A;  4LZ8 A;  4P47 A;  2D21 A;  2RIN A;  1II5 A;  2F7A A;  1IXI A;  2HAU A;  2DE2 A;  2HZL A;  4EQ7 A;  2Q74 A;  2I0B A;  3S2V A;  4ELR A;  4YKP A;  1B5I A;  4RNS A;  1N3W A;  2DWI A;  3FVN A;  2HAV A;  2Q8J A;  1XVX A;  1AOV A;  3EHU A;  1LAX A;  1NNP A;  4RY1 A;  4F3G A;  5KZT A;  3G3F A;  3HV1 A;  3PTY A;  3N6T A;  5ELV A;  1MY3 A;  4IGT A;  4JWY A;  3TTN A;  4MNI A;  3SEU A;  2DSF A;  4N6K A;  1J1N A;  3RTW B;  3DP4 A;  4DXB A;  4GXA A;  3N26 A;  4JSO A;  5I2K B;  4EQ9 A;  4YB5 A;  3G3H A;  5H8F B;  3DM0 A;  3LUY A;  4IO4 A;  3TQL A;  5EYH A;  4X8R A;  2QRY A;  1DCU A;  4WEP A;  3QUF A;  5AA3 A;  2NOO A;  2VHA A;  4XIG Q;  1BK4 A;  1NUW A;  4NF6 A;  1MY0 A;  3V89 B;  4NQ8 A;  2GH9 A;  4JWX A;  2QS2 A;  2XA5 A;  3FGS A;  4NED A;  2F78 A;  5KDT A;  5ET5 A;  1NV5 A;  2DXY A;  4O7I A;  3PD8 A;  2RKM A;  2DDK A;  3UIF A;  3OEN A;  3K6X A;  1BP5 A;  4WKM A;  1JEU A;  1MS7 A;  4I3Y A;  1LEV A;  4IO5 A;  2QJE A;  5K2X A;  1KA1 A;  5ICT A;  4R9G A;  4I9D A;  5HM4 B;  3FD3 A;  4XEQ A;  3R7X A;  4U1O A;  3VDF A;  5ISU A;  1O64 A;  3T22 A;  1AIV A;  4H67 A;  1FBC A;  3V5A A;  2I48 A;  4JXI A;  2XXX A;  1LBV A;  1OLA A;  1TWY A; 
#chains in the Genus database with same CATH homology
 2QVU A;  4F1V A;  4MAG A;  1LBY A;  4X9T A;  4H45 A;  5EQ9 A;  2VT5 A;  4JVC A;  1INP A;  4I40 A;  2WBD A;  1KA0 A;  4AS4 A;  2XXK A;  4OVP A;  1NI9 A;  2VPO A;  2CZH A;  1YZ0 A;  1FPK A;  4PF8 A;  3B50 A;  1NV1 A;  4NG7 A;  4OVT A;  1NV0 A;  4PFR A;  1LBX A;  1FPF A;  3ROJ A;  3CHG A;  4HE1 A;  2CEX A;  4GBV A;  4QXD A;  4MEV A;  2OX3 A;  4UAB A;  2WX9 A;  4PBQ A;  5I3S A;  5EQ8 A;  4O8M A;  2CEY A;  5J16 A;  4MJO A;  2XWV A;  2QPQ A;  2FHY A;  5ET6 A;  5J1D A;  4MMP A;  1IME A;  3FBP A;  1Q9D A;  3FXB A;  2PFZ A;  4IR8 A;  5EQ7 A;  2WYK A;  2F3B A;  2VPN A;  3NOH A;  1FBP A;  2B4M A;  2MKZ A;  3MST A;  4PTK A;  5IZ1 A;  1FBF A;  1G0H A;  2WBB A;  1NV4 A;  2BJI A;  4PGN A;  2P3V A;  5I5P A;  4HE0 A;  1IMB A;  1NV3 A;  1IMD A;  4MX6 A;  4O94 A;  1FTA A;  2V3Q A;  3W9W A;  1K9Y A;  2Y5K A;  4PE3 A;  2OWZ A;  4PET A;  2PCR A;  4QBA A;  4GWX A;  4PCD A;  2JJK A;  3HFU A;  1XI6 A;  3U65 A;  5ET7 A;  4X04 A;  2P3N A;  3LV0 A;  4NF0 A;  2FBP A;  2HPG A;  1AWB A;  1VDW A;  2ZZW A;  4PFI A;  2FVZ A;  2Q9T A;  1DBZ A;  3A29 A;  4GWW A;  1JP4 A;  4LN5 A;  1EYJ A;  2Y5L A;  4OVQ A;  2CZI A;  1LBZ A;  4XF5 A;  3QMF A;  4N81 A;  3MYU A;  1SPI A;  4PAK A;  5EYG A;  1FPL A;  2QFL A;  5ET8 A;  2B4L A;  4I3E A;  5CM6 A;  5IZZ A;  4DI3 D;  4GWY A;  1NV6 A;  1K9Z A;  5T3J A;  4PAI A;  2KR0 A;  4NX1 A;  5EQA A;  3RPL A;  1FPD A;  2DE3 A;  1LBW A;  2XWK A;  1QGX A;  1NV7 A;  4GX6 A;  4GWZ A;  5JK4 A;  5FBP A;  1RDX A;  4M1V A;  4N8G A;  5IM2 A;  4P8B A;  4N4U A;  4FBP A;  4MNC A;  3D1R A;  4N91 A;  4NHB A;  2ZZX A;  2WYP A;  4NGU A;  3RYD A;  2F5X A;  4PGP A;  1NUX A;  4MHF A;  2HZK A;  4MIJ A;  4H46 A;  1IMF A;  3EKI A;  4P3L A;  3W9V A;  2GQ1 A;  2WEF A;  5F24 A;  5LDZ A;  4YZZ A;  1KZ8 A;  4PDH A;  1NV2 A;  2F3D A;  5I7I A;  5IZ3 B;  3KC1 A;  4OA4 A;  4PAF A;  3KC0 A;  4N6D A;  4XFE A;  1EYI A;  4GWS A;  4F19 A;  4GBW A;  4O7M A;  2L5V A;  4MCO A;  1FBH A;  4OAN A;  4HXV A;  1FPB A;  4DI4 B;  4JVD A;  4OVR A;  2KQZ A;  4HCY A;  1IMA A;  5LTC A;  3IFC A;  4F1U A;  1NUZ A;  5ESY A;  1D9Q A;  3SZP A;  4YIC A;  4PDD A;  5A5L A;  3E79 A;  4JVI A;  2V4C A;  1FBE A;  2XWO A;  3T1B A;  4P47 A;  1DK4 A;  1RDY A;  1FBG A;  1FJ9 A;  2DE2 A;  2HZL A;  4PBH A;  2Q74 A;  2QVR A;  1YYZ A;  4KXP A;  1FPJ A;  3RPL B;  2XWI A;  3BIH A;  1FJ6 A;  4G61 A;  4NAP A;  4PC9 A;  1FPE A;  3PTY A;  1FPI A;  2HXR A;  4MNI A;  4MNP A;  4HCW A;  4N6K A;  3E78 A;  3BIG A;  2QVV A;  1G0I A;  2CZK A;  1FPG A;  1RDZ A;  4GX4 A;  5EYH A;  4X8R A;  4GX3 A;  1DCU A;  4PF6 A;  4N8Y A;  5DW8 A;  4P1E A;  1FBD A;  4N15 A;  4NN3 A;  1BK4 A;  1NUW A;  3LUZ A;  1CNQ A;  1NUY A;  4NQ8 A;  3T0J A;  1EYK A;  2XA5 A;  1FRP A;  4N17 A;  4P56 A;  2FIE A;  2FIX A;  2PFY A;  5ET5 A;  1NV5 A;  4P9K A;  4O7I A;  2ZZV A;  2DDK A;  2DVZ A;  4F18 A;  2R8T A;  4OVS A;  1IMC A;  4GWU A;  4I3Y A;  1YXI A;  1LEV A;  1KA1 A;  2HHM A;  4AS5 A;  3ISP A;  1FSA A;  5IGA A;  2DE4 A;  4PFB A;  4XEQ A;  4P1L A;  3B8B A;  3GYY A;  2Q8M A;  3IFA A;  4HE2 A;  3KBZ A;  5IZ3 A;  1FBC A;  1LBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...