2XALA

Lead derivative of inositol 1,3,4,5,6-pentakisphosphate 2-kinase from a. thaliana in complex with adp and ip6.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
435
structure length
420
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICKEELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRNAWDSEPSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase is a Distant Ipk Member with a Singular Inositide Binding Site for Axial 2-Oh Recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 134
structure length 420
sequence length 435
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xalA01
2XAOA 3UDZA 2XANA 2XAMA 4LV7A 3UDSA 4AXFA 4AXCA 4AXDA 4AXEA 3UDTA 4AQKA 2XARA 2XALA
chains in the Genus database with same CATH superfamily
1GOLA 4WG5A 2JFLA 2H9VA 4GL9A 5I0BA 1ZMUA 4E20A 4DFUA 2ACXA 3HRFA 3N4TA 4YZDA 1ST0A 3OROA 3AC3A 2XAOA 4PF4A 4MK0A 3KA0A 3R30A 5EQEA 2WMVA 3LW0A 3WZKA 3ORIA 1WFCA 4FV2A 4DG0E 5AUUA 2ZFYA 3E63A 4NKSA 4BDEA 4Z16A 3NWWA 5FQDC 1FBNA 3BLRA 1H1SA 2XNGA 4MXOA 5HNBA 5IQGA 4C62A 4M12A 4EQCA 3DPKA 4H36A 3QWJA 2F7EE 2Y8OA 4ZY4A 2GQGA 4HNFA 1WCCA 4PMSA 5BYZA 2GFSA 4QYGA 4EOLA 3TZ7A 4TZRA 3HV5A 4YGAA 4E6QA 4OTHA 1YWRA 4BYIA 2C6IA 3AC2A 3D5XA 4J95A 4JAIA 1YOJA 3BQRA 1OL2A 2WZJA 3TKUA 5DR2A 3SXRA 5AUVA 2PZPA 3KL8A 3DZQA 3OOGA 2W96B 3MB6A 1WBWA 4XG6A 3V5QA 3UIUA 4ZK5A 5AX9A 2J0MB 2VZ6A 3P78A 5A4QA 3L8SA 5HE1A 3ORXA 4KA3A 3VWAA 4MBLA 2VAGA 4ZLZA 2YJRA 1OITA 3RZBA 2QURA 2I40A 4U42A 1ZRZA 3BGQA 4RPVA 4WD5A 4K6ZA 4M8TA 2VWYA 3I7BA 3MJ2A 4L52A 5BVKA 3DB6A 3VUIA 2WTVA 2YM3A 2CGVA 2SRCA 3R7YA 1QPCA 3DKOA 3DBDA 2YZAA 3EFKA 5HIBA 4LUDA 2BFXA 4UXLA 4I20A 2CNQA 5LMBA 3NCZA 3OVVA 4G9CA 4ONAA 4LGGA 4RRVA 2UW8A 4JDIA 5EM8A 1FOTA 4ZLOA 3W0SA 4E4LA 4FKSA 4O7YA 4UX9A 3W2SA 3QQUA 4AZEA 2YM6A 3P86A 2Z7QA 3COIA 4E1ZA 3G6GA 2GCDA 2HIWA 3RALA 1ZYLA 3MH0A 4BF2A 1SZMA 2LGCA 4A9SA 4ANQA 2XNPA 4LYNA 4C37A 3QRKA 3LAUA 4GSBA 4GT4A 4XG2A 4XP2A 4R3CA 3SD0A 3SLSA 4BCPA 5DT0A 1JPAA 3AC5A 2JAVA 3PE1A 1Q41A 1IEPA 3LJ2A 1S9JA 2YDKA 3PE2A 4GKHA 5CI7A 1YHVA 3VIDA 2X4FA 4S33A 4CKRA 5ANGA 1B38A 3R2BA 5DIAA 3A7JA 2XYUA 4FVQA 3AD6A 3GC7A 4PMTA 4NSTA 2W4KA 4AGDA 4HVDA 1PMVA 4DG3E 4EUTA 3DK6A 1APME 1YI4A 4FZDB 2OH4A 4QMLA 2XANA 1WMKA 2PHKA 4FGBA 5T68A 4BCNA 2QKWB 3TCPA 2VV9A 4MX9A 4YO6A 3IDPA 5H2UA 5HI2A 3FPMA 4E4XA 2WD1A 5LQFA 2WPAA 2Y4IC 4DHIB 2W5AA 3IDCA 2GMXA 4D28A 3OBJA 4GT3A 3KXMA 4J98A 1LUFA 5IDPA 4MXXA 2UZVA 1KE9A 1VJYA 3QBNA 5E92A 4EYMA 3OG7A 3EKKA 3BU3A 4BDIA 4ZTLA 3PWDA 3FLYA 5AV0A 4DE4A 1EH4A 2P2IA 5CAUA 2XRWA 3OXTA 2ZDUA 3D14A 3NFGB 3IPHA 4HPUE 4II5A 4W4WA 3QD2B 1WBSA 3V01A 4FTUA 3ZLYA 4AOJA 2C5NA 1DS5A 4FSZA 2Z60A 4S2ZA 2O64A 2Y4IB 4GU9A 4ID7A 4BN1A 1M14A 4K9YA 3DAEA 4YLKA 1FMKA 1OL5A 4FTOA 1PMUA 3N4UA 4YBJA 4D0WA 1URCA 4F0IA 1JAMA 2PZYA 2C3LA 4IVCA 1HCKA 4R1YA 3H0ZA 5FM2A 2BHHA 4EWQA 3Q5ZA 2B9FA 4GVAA 2V62A 3PJ1A 5E90A 3DS6A 1OZ1A 3TNPC 4WRGA 2HXQA 4L45A 5JGAA 4E8AA 5IUIA 4QTCA 4KAOA 4JQEA 3FXZA 3UVPA 4C38A 3PA5A 5DLSA 4BGHA 4IE9A 5A4CA 4IACA 2YA9A 2FA2A 2F7XE 2C5OA 5CSVA 2WQOA 4JDHA 4A9RA 2PVHA 1A06A 4G6OA 4L3JA 4AZFA 4ZSJA 2BZKB 4IX6A 4IWOA 4BB4A 4G16A 3RK5A 3IOKA 3AMAA 4O7WA 4O7RA 1OBGA 4CKJA 5DYJA 1U46A 2XM8A 4G3DA 4HGEA 4M3QA 5L6WL 3VHEA 4EOMA 2OBJA 1M17A 3QTXA 5CEIA 5D7AA 5K9IA 4FEXA 4S30A 2OJIA 3OY3A 4U9AA 5BMMA 4DGOA 1OIQA 4TYGA 3TMOA 2JC6A 4FEWA 3ERKA 4X3FA 4EEVA 2FSTX 4U0IA 4RVMA 2PVMA 1I44A 1PXIA 2WTIA 3QKKA 2Y7JA 5LVLA 4CCBA 2PWLA 2QOOA 4TWNA 2CSNA 2GDOA 5ACBC 4DITA 1T46A 4GH2A 4YR8A 2J5FA 3CY2A 3BE2A 2XNNA 2Y6OA 5J95A 3KQ7A 2XKFA 3PVGA 2KTYA 2X8EA 4JBQA 4F9WA 3ZFXA 2WMBA 3WILA 4MEDA 3FKOA 4Z9LA 3KB7A 4K11A 2R3HA 5FXSA 4AACA 2VTTA 2E9OA 3FLSA 5HX6A 3R9DA 1Q61A 4G3GA 4IX3A 3VS5A 4IW0A 4X3FC 5CQUA 3DT1A 4RQKA 4G3CA 3ULZA 5FP6A 1ZXEA 3OUKA 3I4BA 1JVPP 4AXDA 4C4HA 3F2NA 2QU5A 3LFAA 3GNIB 4A4XA 1K9AA 5HTBA 2GNIA 3MVJA 3BYVA 2G9XA 3LJ1A 1SVEA 4H1JA 4M97A 4XLVA 3QQFA 3T3UA 3WI6A 2CN8A 3EL7A 1KE6A 4AA4A 5CI6A 4RWLA 5DVRA 3SW7A 2E9VA 5IDNA 4NCTA 2X9FA 4YZCA 1GY3A 4KKHA 2GNLA 3NSZA 1H0WA 1XMLA 4YZNA 4QMWA 3C5IA 1OKYA 4LOPA 4UWYA 5TR6A 4M15A 5A14A 3R9HA 4AG8A 1P5EA 2EUFB 3RPVA 3ZU7A 4O7NA 4EZ7A 4OW8A 2I7QA 3IW7A 4AZVA 4EQMA 4G5JA 5K3YA 3DXPA 4ALWA 4RJ8A 1CTPE 5KCVA 3QALE 4F08A 5DOSA 3VQHA 3CQWA 5J8IA 4XX9A 2WU6A 3E64A 1PXLA 3R8UA 3SAYA 2BRHA 2UZNA 4MBJA 3KIOC 1P4FA 4DFBA 4FV1A 3AT4A 4RJ7A 3HRCA 3P1AA 3PG3A 5A4EA 3CTQA 2OW3A 4DEBA 3ULIA 4DC2A 3W0QA 2CLXA 2GNJA 3HV3A 5JFVA 3M11A 4IMYA 4F1OA 2ITPA 2QOKA 2XK8A 3V8SA 5A3XA 3V51A 4FL2A 4B9DA 4QMNA 3MGYA 3VBQA 4CV8A 2ESMA 4QRCA 4ZP5A 1YOMA 3I7CA 3MBLA 2FVDA 5CVHA 3ZM4A 4F0GA 4Z7HA 5CSWA 5I9WA 3FI4A 5J87A 4D4SA 4TNBA 3Q4CA 3TJDA 4B4LA 5JMSA 5AA8A 4GG7A 4K18A 3QC9A 3GC8A 2P4IA 2J0KA 3FZTA 3CJGA 3FMLA 3R7EA 4FJVA 4A4LA 3NUYA 4DGMA 4X0MA 5AAGA 2Y4PA 2I0YA 5IF1A 3E8DA 2VGOA 5HG9A 2BZJA 3TACA 4BBMA 2VX0A 4L53A 4JLCA 5JK3A 5FEDA 2B1PA 4MTAA 4LRMA 3P7AA 3MDYA 5CT0A 5E8ZA 1SMHA 1U4DA 3W0MA 5ANEA 4BCGA 2CMWA 5DA3A 1E1VA 1ZOGA 4EK3A 3FSFA 5IA0A 2W9ZB 1ATPE 4FTQA 4RFZA 1YW2A 4DEDA 4FZ7A 3KK8A 2A1AB 3W2CA 2BCJA 3QKMA 4RIWB 4PRJA 2WOTA 4FKLA 2WEVA 3MWUA 4OGRA 1P2AA 3QRTA 4GK2A 3A7HA 4XH6A 4EZ3A 2W1GA 3NVKI 2HOGA 3EN6A 2R5TA 2BDWA 3UPZA 3QFVA 2IPXA 4L68A 5M57A 1NXKA 2GNFA 2R7BA 4DINA 2W06A 2XARA 4PDYA 5HE3A 4AAAA 4CMOA 4EC8A 2OFVA 4XG9A 4Y72A 3COKA 3F5XA 3TYKA 2QOBA 4QYHA 5CEKA 3VN9A 1BYGA 3OXZA 3U51A 3PLAE 3Q9YA 2WTJA 3F2AA 2XK7A 3C9WA 5EOBA 3T9TA 1JSUA 2ZOQA 3RTPA 4AA0A 1CM8A 4AXFA 4EHZA 4EUUA 4YTFA 5KBQA 5BVEA 4C4EA 1H1RA 3TKHA 3MFTA 3Q4TA 3FXXA 4ACHA 2CGWA 4EI4A 1RJBA 5BQ0A 2UZUE 3MYGA 2J0IA 4RX8A 3ZXZA 4UY9A 5HZNA 2JBPA 2YM4A 4L00A 3POOA 2XVDA 5FEQA 4GT5A 5HG7A 2IG7A 2BVAA 3F88A 4ERWA 2VNYA 3AD4A 5C9CA 2PYWA 3WOWA 4F70A 2ZM1A 1RQQA 5LCJA 3ZRLA 4RX5A 2X1NA 2XKCA 4UWCA 4AQKA 3NX8A 3MI9A 2HENA 3VVHA 3BEAA 4BDFA 5DR6A 1ST4A 2ZYBA 3MA6A 3WZEA 4DT9A 2GHLA 3HZTA 2BROA 2JKOA 4KBKA 4CV9A 3Q2MA 2R3RA 5D9HA 4V0GB 3BBWA 5HBJA 2ZJWA 2WOUA 3DGKA 4IAFA 4OTQA 3A62A 4XV9A 3DCVA 3UYTA 3V5PA 1XQZA 4W4XA 1WVWA 1GJOA 3ZOSA 2J90A 3HVCA 4NH1A 4U79A 5L6PA 1H28A 3BHTA 2PZ5A 3DQWA 4CCUA 1Q4LA 2RFNA 3DY7A 3G6HA 4HGSA 3W10A 1PKDA 4A7CA 5BNJA 2YACA 1GZOA 4HPTE 4IANA 4ZJIA 2WIHA 3U55A 4XCUA 1XH6A 4ZJJA 3L8VA 3R00A 3PVUA 3V3VA 4GYGA 1NVRA 4F1TA 3DBQA 1DM2A 3KVWA 4FX3A 2ITVA 3FMMA 5KKRC 3F66A 3LFSA 4FKVA 4JX7A 4XG3A 3UYSA 3ZH8A 4FIIA 3QQJA 3E93A 4CXAA 4HYHA 1XWSA 2RF9A 4FV4A 3BCEA 2A27A 2NRUA 2QNJA 3JY0A 5IA5A 3TT0A 5LVPA 1V0OA 4I4FA 5HCXA 3UOLA 4QMSA 2R9SA 3RM6A 1QCFA 3AXWA 3KXGA 5E1EA 2AC3A 3F61A 2C5YA 3A7GA 4CD0A 2YIRA 2G01A 3OEZA 5IA4A 2QO7A 2BFYA 3ET7A 2H6DA 3H4JA 3MA3A 5DI1A 4EOIA 4ENXA 2CKOA 4N6ZA 4G3FA 5KKRB 3BLHA 4K8AA 4KUJA 1AGWA 3C0GA 3PIXA 2OKRA 2ITWA 4FK6A 4XUFA 5AV3A 2EB2A 3PJ2A 1F5QA 3UZTA 5FD2A 3FKLA 4IZ5A 4PWNA 3ROYA 5KBRA 3TV7A 4RJ4A 4QYYA 3DLSA 4D1SA 5IMEA 3Q3BA 3HL7A 2XK9A 3FBVA 2CGXA 3BYSA 3IW6A 3MIYA 4O91A 2O65A 4RA4A 3CSVA 4YC6A 5AIRA 5A9UA 4FIJA 5JGBA 3N4VA 4U44A 3C4XA 4I5CA 5E8VA 3LHJA 4FVPA 2YCQA 1MRYA 4QQ5A 5AMNA 3OBGA 1RW8A 4BCFA 4USEA 2C6KA 4AZTA 3HA8A 3E88A 4V04A 2F2UA 4Y8DA 3LM5A 4HYSA 2UVYA 1Y91A 2BHEA 4J96A 3EZVA 5BUIA 2YAAA 2RFDA 4ZTQA 2UZLA 5IQDA 4AE6A 3S2PA 1GNGA 4IVAA 4AN3A 2PULA 3CXWA 5HBEA 3ACJA 2PTKA 4RT7A 5C8MA 4YTCA 1OGUA 3KVXA 4EYJA 4CRSA 5IH4A 1JNKA 4FUYA 3PZEA 4O22A 5F95A 3TWJA 3TZ9A 5BUEA 4CTCA 3BE9A 5BVOA 4FIHA 3KY2A 2GNHA 2R0UA 3JVSA 4G6LA 4L3LA 2FSMX 4TKSA 2PVYA 2XZSA 3OP5A 2I6LA 4HCVA 4IFCA 3NNWA 4DH5A 1LPUA 3FL5A 2ZM3A 3FZRA 4ITHA 1W82A 3PPKA 4X2GA 5HCYA 3UE4A 2WTCA 4ANLA 4ZJVA 1YRPA 4I5PA 4IVBA 3WZUA 4BC6A 4O83A 2IZTA 1FVRA 2R2PA 3ATTA 1IAJA 3LXKA 1OIRA 1JLUE 1QPDA 2PVJA 4ZTMA 2WQBA 2Q0BA 4TW9A 4OBPA 3W0PA 2WIPA 2XIRA 3TV6A 4WIHA 3VONA 5M07A 4FUXA 5B2KA 3ZRKA 3QU0A 3BYUA 4QP9A 2HWPA 4AN2A 3VQUA 2O63A 5LARA 4JS8A 4FKGA 3I0OA 3C4WA 3QRIA 4JBOA 3WF8A 4DTKA 1TQPA 2XIYA 2OIBA 5CY3A 3QKLA 4MYGA 2W05A 4YTIA 1LEWA 3COMA 2JEDA 5LVOA 2JDRA 5EYCA 3FEGA 3UP2A 2R7IA 1OVEA 3BWFA 4YZMA 2FH9A 1ZY4A 4PL5A 3L1SA 4OUCA 1BUHA 4FV5A 5CSPA 4FICA 4M0ZA 4YTHA 4BTFA 5HD4A 2ITZA 5M4FA 3R04A 2BDJA 3QD3A 4EOPA 3BU6A 4YNOA 4IAAA 5IEYA 2J2IB 3HKOA 3FL4A 4BTJA 3QCQA 4DLJA 1OPLA 2ITXA 2YM7A 3LQ3A 1FGIA 3R0TA 4UALA 2B7AA 5IEVA 1TVOA 1TQIA 2QC6A 2VWBA 3GU5A 3LCKA 3Q4UA 4GK4A 4IQ6A 5EH0A 3TL8A 3ZUUA 1KE8A 5FTQA 3ACKA 4AS0A 2XP2A 3R63A 4APCA 4G5PA 2PK9A 2IW8A 3GQIA 5J1WA 4NL0A 3W55A 4C7TA 4XG4A 3H9RA 3PSDA 3VAPA 2VTIA 5AP3A 1PYXA 4D2RA 3GUBA 2XS0A 4LRJA 4R7HA 4IADA 4F09A 4U81A 4Z3VA 4QTBA 4LL5A 4FKJA 3R7VA 4EJNA 4R3PA 5A4TA 4FSTA 3U6HA 3KMUA 4AT4A 2W1DA 4WT6A 2R3IA 5KMLA 4O0UA 4M0YA 4TPTA 2YJSA 4MNFA 2IZRA 4EOQA 3G5DA 5L2SA 3KF4A 5J9ZA 3S0OA 3R02A 2JKMA 2OZOA 4EH4A 2Z02A 3PIZA 5KE0A 4TYHB 4PTGA 5JSMA 2X6DA 3TNQB 1R1WA 4I3ZA 2R3JA 1H1PA 1U59A 4GRBA 2GTMA 3HNGA 4GUEA 1W98A 3CTJA 4UYNA 5EQPA 2RG5A 4QMPA 3DFAA 4QMUA 4AA5A 2F49A 4WSYA 2G2IA 3ML1A 5KZ0A 1YOLA 2HW7A 4C4JA 5CXZA 2WU7A 2XKDA 3MV5A 4FA2A 3NW7A 5JKGA 3C4FA 4AXEA 5CU2A 2FO0A 4ZZOA 5ETFA 4M13A 3NFFB 2RKUA 4A9UA 3P23A 4E4MA 4RIYA 2VNWA 3GU8A 2VTPA 4MHAA 4JT3A 1H08A 5HEZA 3MFSA 1ZOHA 1XO2B 1J1CA 2B55A 4LG4A 5HGIA 4ZIMA 2FUMA 3NDMA 3V04A 5EYKA 1JKLA 2XYNA 3GC9A 4TRLA 2AEGA 3R1YA 4O6EA 4O86A 3VULA 5T3QA 3B2WA 3OT8A 5BUJA 5M51A 2JAMA 2A4LA 3T3VA 2QOIA 4ZMEA 4NK9A 1O9UA 1QPJA 3PJCA 3VS7A 5C26A 2AYPA 4QYFA 2UW3A 5EHYA 4EH7A 4FZAB 4K1BA 4YPDA 3VBTA 4J1RA 5FEEA 2PE2A 4P5QA 2PUPA 3CD3A 3NW6A 1ERKA 2IWIA 3V8TA 3FC1X 4RGJA 2ETMA 4W8DA 4RZWA 2BAKA 3NCGA 4YSMA 3QGYA 3C4CA 3OCTA 3VBXA 4E73A 3RK9A 3DAKA 1Q8UA 4AFJA 4F78A 3G2FA 4LM5A 3NW5A 5FXQA 4QOXA 1YKRA 3DZOA 4IX5A 4O2PA 4MD8E 2HZ4A 3MESA 3HUCA 2H34A 5GJGA 2GS7A 4BIDA 2PUNA 3I81A 2C3KA 4D58A 2JITA 5K5NA 5ANOA 3P4KA 3ZUVA 3C0IA 1SVHA 2VTRA 2EVAA 1O6KA 4NWMA 2F4JA 4RIYB 2UW0A 5GHVA 2V0DA 4NKAA 3G33A 4B7TA 3LE6A 2OICA 2WB8A 3TUBA 4C3PA 2YHVA 4IM3A 4AGUA 4AN9A 1CMKE 1NT2A 3ZO1A 4CQEA 3E3PA 4FL3A 3PXRA 4D55A 4LGHA 3D0EA 2XRUA 3O5AA 3VUMA 4E6CA 1W84A 4QMZA 4KSPA 1HCLA 1L8TA 1TKIA 3NEWA 4MD7E 3RAIA 3EQBA 3DBCA 4Y83A 4C4FA 4M84A 4IDTA 5CAPA 3W0OA 1H4LA 4DGGA 2BKKA 2WQEA 3UP7A 1GZKA 3CBLA 3EMGA 4ACMA 1IR3A 2R0IA 3ORPA 4C4IA 2BTRA 5DRDA 3K54A 4P90A 1PKGA 3A61A 4I93A 3NRMA 4F7NA 4C59A 4J71A 2GS6A 2IJMA 4WNOA 3RGFA 2W1FA 1OUKA 3AC1A 1J91A 1UNHA 3QUPA 2CKQA 4AXCA 2C6EA 3NVMB 4FT0A 4BGGA 4RBLA 1VYWA 3HRBA 5H8EA 5CEOA 5HU3A 4MWIA 5I9XA 5IQCA 1PXNA 1R78A 4D4RA 2E9UA 2RIOA 3AQVA 3PRIA 4HYIA 4EKKA 3QTZA 4CVAA 3EN9A 3TJCA 3UQCA 4JOAA 3NIEA 4WUAA 1YHWA 5KMNA 3NUSA 4AWIA 5AADA 2PMNX 3EHAA 3D7TA 5HBHA 4GV1A 4PP9A 4BICA 5IMXA 4FK3A 1JKSA 3EYHA 4DA5A 4BHZA 4B0GA 3MN3A 3QHWA 4FKQA 5ANJA 3PXFA 1ZOEA 5J1VA 2YITA 4I0TA 2GSFA 3GI3A 3NNUA 2OZAA 5CZIA 1BL7A 4JBPA 3ZYAA 1NW1A 4IHPA 4D9TA 4PY1A 1PXMA 2C3JA 4L43A 4AOTA 1KV1A 3EOCA 4U8ZA 1FINA 4J53A 5L8JA 5C4KA 3KN5A 1J7UA 1SNUA 4MXYA 2WNTA 3UVRA 3AGLA 4L6QA 2XNOA 2QLQA 3QTIA 2CDZA 3ZC5A 1CKPA 4AAYA 5ETAA 3HUBA 4WHZA 3W33A 5TF9A 4ANSA 2X0GA 5BVFA 2P3GX 1GZ8A 3U6JA 3V5LA 4EOOA 1QMZA 5EYDA 3RCDA 1OKZA 5IZFA 3RAWA 4XG7A 3R7OA 4JIKA 3QX2A 3RCJA 4RMZA 3K2LA 3FMDA 2VTAA 4DDGA 4FG8A 4FOBA 1MRVA 3HAVA 4Q5HA 4WA9A 4FBXA 4QMMA 4MAOA 3LMGA 4JVGA 1Q8YA 2HXLA 3M2WA 4ZTNA 3TN8A 3SRVA 2OXXA 1H25A 2P0CA 2OO8X 4MD9E 4RIXA 3W2PA 4FV7A 3W2RA 4AZWA 2XIXA 4NM0A 2XEYA 1XH5A 5IG1A 4U3YA 5F94A 4D5HA 2ZM4A 1BI7A 2UV2A 3MVHA 3QTSA 3TXOA 5G1XA 5CS6A 4TL0A 3PXZA 2YWVA 2J5EA 2G1TA 4GUBA 1GZNA 1OUYA 4QPSA 3UO6A 2OZAB 2YM5A 3GOKA 3R2YA 4J8NA 2O0UA 4M14A 5FM3A 4E93A 5HNIX 2R3PA 3IW8A 4W4VA 2J6MA 5AM7A 3BHYA 2JIUA 2X2LA 1VYZA 2PMOX 4FODA 2Z7RA 4LUEA 2B54A 3H10A 4NM7A 3RPSA 4AX8A 3AOXA 2P2HA 3DJ5A 5CYIA 2PPQA 1IASA 3SG9A 3SA0A 5TKDA 2CJMA 3ODZX 4FTIA 2WQNA 3QTQA 4YJTA 1ZY5A 4G6NA 5FGKA 5BX0A 2J51A 3OTVA 3D94A 3HX4A 2OJ9A 3A8WA 4GS6A 3W18A 3PLSA 5L3AA 4PX6A 2HELA 2WFYA 3LIJA 2GQRA 4ZY6A 3W32A 4DFNA 3PRFA 3QHRA 1NY3A 4LOOA 4KRDA 3OS3A 1M52A 1RDQE 5EHOA 5EDRA 4BZDA 1J1BA 3ZSGA 3G9NA 3Q32A 4FIGA 3PDTA 1PXKA 4ZSGA 3D9VA 4WNPA 1YVJA 4YJSA 4GK3A 2QO2A 2OG8A 3G90X 5CAQA 3GC0A 4ZTHA 3EB0A 3GFWA 4NTSA 1Q24A 3K3IA 3O17A 4CLIA 5EK7A 5JGDA 3RJCA 3FPQA 4X2FA 4YO4A 4EOJA 2ERZE 3CPCA 4I5MA 5ANDA 1H27A 2WELA 4O0VA 4G2FA 3SHEA 3HV4A 2QG5A 3BRBA 4FT7A 1DI9A 2ZMDA 5CSHA 2ZB1A 3NMUF 3FC2A 4QTDA 2VWUA 4BZOA 1E1XA 2YCFA 3QQKA 3UIXA 5A4LA 3ORTA 1B6CB 3DDPA 2XAMA 4NU1A 1FQ1B 3OW4A 2OF2A 3HV6A 4YZBA 4F9YA 3KFAA 3JVRA 3MVLA 4CNHA 5IU2A 3O8TA 2YABA 2VTHA 4FVRA 5D12A 3LFBA 4PNIA 3ZO4A 4F0FA 1JKTA 2EXMA 2YDIA 3BL9A 3UPXA 4LL0A 4RFYA 2V5QA 2EU9A 4HYUA 4RIOA 5KHWA 5G6VA 3F5PA 4IWQA 5CTPA 1XH8A 3FAAA 2BDFA 4P4CA 4QMOA 3B8QA 3CGOA 4WBOA 2UW4A 5HVYA 2BRMA 2RG6A 4JMQA 4FKRA 3EZRA 3R9NA 2VTNA 2BZIB 2HWOA 2OWBA 4O96A 3PUPA 3KXZA 5IUHA 1MQBA 3R8LA 2E2BA 4QP7A 2CGUA 3PG1A 2R3FA 3FY2A 2XJ2A 3MSSA 5EDQA 4BHNA 4PDOA 1FMOE 1WVYA 2O3PA 2WMTA 3LCSA 4YZ9A 4ZTSA 4X3FB 5DN3A 3UVQA 3QTRA 4MUQA 2JBOA 2ITNA 4KIOA 4AE9A 3M1SA 4UZDA 1PW2A 2PVNA 5CU3A 5HG5A 5B2LA 2G15A 5C01A 4X6RA 2QHNA 4HGLA 4KB8A 4K0YA 4M67A 4CZTA 3ITZA 3NAYA 4DHZA 4NUSA 4ASXA 4BDAA 4O7LA 4G3EA 5AUWA 2W0JA 3DJ6A 4H05A 2ZV7A 2QU6A 5J7HA 3VBYA 4RZVA 3ZDUA 3ZFMA 4NCTC 1H24A 5CALA 4FEVA 5GINE 5CLPA 1F3MC 3UNJA 4MXZA 3IK3A 3CEKA 2HZ0A 1G3NA 3U8WA 1LP4A 4HZRA 3KU2A 5HO8A 5AV2A 4O0SA 3VO3A 4E4NA 3DXNA 3OWJA 4NJDA 4KABA 4FT3A 4UZHA 5E4HA 3F3ZA 5HE0A 5CAVA 5LMKA 2UZTA 3P0MA 5B7VA 2PE0A 2UUEA 2IVTA 3EQRA 4IAIA 2XKEA 4FTKA 4G31A 4EBWA 2QOFA 2OU7A 2YCRA 4CKIA 5CF8A 3HEGA 5EW8A 2R3GA 5TOZA 3EYGA 5HESA 5EKOA 4EH2A 3FLNC 4C36A 3RKBA 3VJOA 3EN7A 3ORNA 4IEBA 3QF9A 3IW5A 3JPVA 4BCJA 3BU5A 4IAZA 4BDCA 3IDBA 4IH8A 3FY0A 4CSVA 5K5XA 4ANBA 4F6UA 4OLIA 2R3KA 3L9NA 4BCIA 4W8EA 3Q96A 5KHXA 1WBPA 2C5XA 3I1AA 3OOMA 4QP2A 3OWPA 4J7BA 3HMMA 5M06A 3TUDA 4LI5A 4Y73A 3L9LA 3WBLA 1F0QA 3H9FA 4NFNA 3G0EA 2I0VA 3E7VA 2X2KA 3JXWA 2PVRA 4KS7A 5LMKC 5GIPE 2DUVA 3QLFA 5HORA 4QTAA 5IQFA 2ERKA 3QTWA 4XP3A 2CPKE 2JDOA 1Q5KA 1A9UA 1AD5A 3VUHA 4B8LA 3EN4A 2YIWA 2XCHA 4N4SA 1VR2A 5D10A 1XBCA 2WAJA 3V5WA 4KIQA 4L7FA 3GCVA 5CENA 4DEIA 3UMWA 3CE3A 2W7XA 3KCKA 3DDQA 4NYEA 2IVUA 4OTFA 4EK5A 1XH9A 1YWNA 2IZUA 3GP0A 1ZYJA 2HZNA 3D5VA 2WMUA 4KBAA 5FBOA 5IA1A 3QZHA 4QNYA 4Y95A 2FSOX 2XUUA 3Q60A 3OMVA 3QYZA 3W8QA 3K5VA 2JKKA 2OSCA 4BCQA 3FI8A 5LJJA 4GEOA 2OJFE 5IUGA 3TNWA 1S9IA 4UBAA 3DU8A 3W16A 4YC8A 3LFQA 5CXHA 1UU7A 3QRUA 4I6BA 3RI1A 4GVJA 4NTTA 4E5WA 3FZPA 1R0PA 2VRXA 4GJ2A 2REIA 3H30A 3MH1A 4H39A 1GIJA 4JJRA 4B99A 2CHLA 3FYKX 3H9OA 4OBOA 4C2VA 5CVGA 4AP7A 1W0XC 4R77A 4DTAA 4AT5A 3AD5A 1ZLTA 4FSUA 5EHLA 4O27B 1YXUA 4N6YA 3L9PA 1Q3WA 5BYLA 3CQUA 2EWAA 4MBIA 4MKCA 1B39A 3AKKA 3KGAA 4MQ1A 3R1NA 4ANMA 3D7ZA 4BJJA 1V0PA 1PMEA 2QQ7A 2ZDTA 3DBFA 2OH0E 2UZDA 4DEHA 3VNTA 3KULA 3F2RA 3OUNB 4HCUA 4IX4A 4FKIA 4WNMA 3AC8A 5DPVA 5AP0A 1WAKA 2FB8A 2YDJA 3D83A 4YHFA 4ACDA 2DYLA 4FZ6A 4BI2A 5C8NA 3ZCLA 2X4ZA 3TIZA 4QP1A 1OBDA 1H26A 3UC4A 4DHJA 3MS9A 3MVMA 4FTJA 3V5JA 4FSRA 4ZOGA 3WYXA 2WEIA 5HNGA 3UNZA 1J3HA 1KSWA 3SG8A 1U54A 4BI0A 3EQDA 3DKGA 4ZSAA 3QXPA 5AX3A 3MPTA 3EIDA 3O50A 3OXIA 3FQEA 3UNKA 1SYKA 2QODA 4O84A 5GJFA 2WGJA 2W99B 4BBFA 3KKVA 2QVSE 2I0EA 2PUIA 2UZOA 4FSQA 3GVUA 2VTJA 3BEGA 3E5AA 5HIEA 3EFJA 3R21A 4AU8A 4GIHA 4QT1A 2NPQA 3Q9XA 3HLLA 2JFMA 4AGWA 2OK1A 3ZLSA 2QOLA 1M2PA 3KK9A 4BY9E 3PY1A 2QO9A 4DTBA 4XG8A 4DGLC 4J97A 3PFYA 3LQ5A 2ITOA 1WBTA 3FKNA 3U9CA 1Y6AA 5M44A 3RM7A 4FV9A 4X21A 2YIYA 3ALOA 5J9LA 3M42A 3Q9ZA 3ZEPA 4I24A 2OXDA 4EL9A 4CFMA 3LOKA 3G9LX 1FGKA 5KMJA 2LAVA 3KXHA 3UGCA 1FVTA 5BVWA 2Z8CA 5FDXA 5BV3A 1GIIA 4CFFA 4L7SA 4GYIA 3SDJA 1U54B 5ANKA 3A2CA 3PZHA 5AP7A 3TZMA 4ZLYA 5CT7A 3OTUA 4ITIA 2V7OA 4HVIA 4CFXA 3SGCA 5JRQA 1WBVA 2Q83A 1Y8GA 5IPJA 4IM2A 3E87A 3VBWA 1M7NA 4TYJA 3VC4A 4A4OA 1Z5MA 5JQ8A 3R9OA 3N51A 3ID6C 2C5VA 4I6HA 4L9IA 4I5HA 5AUYA 4USFA 3LFDA 1J7IA 3R1SA 2QR7A 2YZLA 4HVGA 1CKJA 3COHA 4WBBB 4RSSA 5AV4A 4BR3A 2BALA 4BKJA 3NYNA 5GJDA 3VUGA 3PP0A 4OTIA 5JN2A 4L44A 5M53A 2A0CX 2XALA 3C7QA 4O7VA 4YJUA 2W1ZA 4EH5A 3CGFA 2PZIA 3ZBFA 2WXVA 3UDTA 4JBVA 4S34A 3LXLA 4I0SA 3R8ZA 2J9MA 3NYVA 1BX6A 4IJ9A 4YHJA 4QMYA 4FEQA 3Q9WA 5E8SA 3UODA 5M4UA 1XBBA 4I23A 2VTQA 3A99A 4USDA 3ALNA 4IBMA 1R39A 1VLRA 3NS9A 1GAGA 2BIKB 5D7VA 3FJQE 3FYJX 5EI6A 3NIZA 4ACGA 3A4OX 4DBNA 2V55A 1REJA 3LVPA 1M2QA 5CVFA 4BCOA 4E7WA 2E9PA 3OHTA 4DH3A 4F1MA 3DNEA 3ENHA 4WUNA 2XK4A 1YXSA 3QLGA 2XBAA 4EC9A 3W2OA 4YSJA 4TY1A 4KSQA 5M08A 5LMAA 5M09A 3PSBA 4UYAA 4QP8A 4V05A 4FYOA 3RINA 3BV2A 4AF3A 1WVXA 3FZSA 2C68A 4YLLA 5E8UA 3VS3A 5I4NA 5AWMA 4BTMA 4QMQA 3TM0A 1JKKA 3E8EA 3T9IA 4D4YA 1YDTE 4FG9A 3OC1A 5EM7A 3F5GA 3EQFA 4I92A 4F99A 3LJ0A 3P7CA 1KE7A 2NO3A 3O7LD 3NYXA 1W7HA 3FMKA 3LXPA 3ANQA 3BGPA 4U6RA 3L9MA 4GFOA 2A19B 3PWYA 2B0QA 3WIGA 5FXRA 4DBXA 2OJJA 3PA3A 5DNRA 3IS5A 2UW7A 2BPMA 4IWDA 4BDJA 4G1WA 3F3VA 4IC7A 5FTGA 5J9YA 2DWBA 3KEXA 2QCSA 2R3OA 4A06A 4FOCA 4MCVA 4QNAA 4LMUA 2W1CA 4QQJA 2C47A 5H9BA 4AXAA 3TNIA 4BCMA 4TN6A 3FLQA 5E8XA 5L8KA 2XCKA 1W8CA 3TTIA 4ZTRA 2JKQA 2RFSA 2C6LA 3HECA 1IRKA 4BIEA 5DBXA 3RWQA 3C0HA 3ZZWA 2VO0A 2O8YA 3CLYA 2WMXA 4ASZA 3FXWA 5I9ZA 5LWNA 3QTUA 4H3BA 4DEEA 5FBNC 4BTKA 3BLAA 4MNEA 3O96A 3VRZA 5M56A 4ZEGA 3LQ8A 3HAMA 3R28A 3E7OA 4LDTA 3SOCA 3VHKA 3QUEA 5DWRA 4YJOA 4EH8A 5E8WA 4CT2A 2X9EA 5EG3A 4EJ7A 3LKMA 4C61A 4C3RA 2A2AA 5H8GA 4XRJA 3UG1A 3VUKA 5EOLA 5KMMA 3QCSA 5FDPA 3VW8A 3S1HA 5A6OA 3UIMA 3ZZEA 1Q62A 3HP5A 3QQHA 1G8SA 4CFNA 4CMTA 4RVLA 2YERA 2OI4X 2J0LA 3WF6A 4U97A 2Z7SA 5F20A 3VS0A 4EOSA 4H3QA 3ZFYA 4IDVA 2XF0A 3BIZA 3WF9A 4IZAA 3W8LA 5JEBA 5KX8A 2B53A 2VO3A 5HIDA 4JG6A 3NUNA 1OPJA 2ZV8A 5HE2A 4DT8A 4Z7GA 4F7LA 1YDSE 2XIKA 4BRXA 2PE1A 4XJ0A 4D1ZA 2BAQA 2CCIA 4FSYA 4EK8A 3MY1A 4IZYA 4P2KA 1OGYA 3L8PA 3IOPA 3OFMA 5CZHA 4DH7A 3GB2A 3VS2A 3HA6A 4U40A 4H58A 5B2MA 4O7ZA 3LM0A 4C4GA 1OL6A 3PIYA 5L2IA 2VTLA 3DFCB 4PQNA 4QYEA 4U80A 2PMIA 3D5WA 5AUZA 5CF4A 5CSXA 1XKKA 3BBTB 5F4NA 4D9UA 3A7IA 1K2PA 4PMMA 4AW2A 1H0VA 4BZNA 3QAME 4R5SA 1R0EA 5L2TA 1OI9A 2ZMCA 4ZAUA 1NVSA 4TWOA 4F9AA 4AW0A 3KREA 2PL0A 5EDPA 2Y0AA 3IKAA 4F4PA 3IECA 3IQ7A 1YDRE 2CCHA 3UO5A 2W9FB 2WQMA 4QMTA 3AMBA 3K3JA 3FMNA 3NR9A 4M69B 2OJGA 4PTCA 5ETCA 5M4IA 4FIFA 4ASEA 4Q2AA 3RPOA 5TO8A 3NUUA 5JFXA 3E92A 4L8MA 2X7FA 4U41A 4RQVA 4I41A 2WMWA 3DAJA 3BZ3A 3F7ZA 5HD7A 3FDNA 3FV8A 3MTLA 2H96A 3KRJA 3GT8A 3HV7A 3UG2A 2YISA 1ZYCA 3ZRMA 3PSCA 4FC0A 3S95A 5CU0A 1V1KA 2J7TA 3C1XA 5IH5A 5AP1A 4FEUA 1E9HA 3AG9A 5CQWA 5AA9A 5CEMA 4R78A 4F6SA 2X8IA 2YCSA 3EQIA 3MTFA 4HOKA 1T45A 4I6FA 5HVKA 2DS1A 5B0XA 5CEPA 2JIVA 4ITJA 1UNGA 2EB3A 4FTRA 4UXQA 4UV0A 4EH3A 2GNGA 3FMJA 5I9YA 4ZSLA 2ETKA 3ORKA 2UZBA 2WKMA 1YQJA 1PYEA 2PVFA 3TEIA 1WBNA 2B9HA 3DTCA 5M4CA 2PUUA 1H00A 4MH7A 4FV0A 4QO9A 3W0RA 2HW6A 2I1MA 3FZ1A 3O8PA 3WF5A 2VWWA 4PP7A 3PFQA 3QZGA 4OTWA 3PPZA 3SXSA 3UTOA 5DR9A 1CSNA 1PXOA 4I1ZA 4CFUA 4YUQA 3D4QA 2W1EA 3WIKA 1OL1A 4DFZE 4GIIA 1XMMA 2P55A 3OZ6A 4FKWA 4IVDA 4JDJA 3SQQA 3SC1A 3ZM9A 3QGWA 2NYAA 1ZMVA 2R3LA 4JR7A 4NM5A 1XR1A 5H8BA 5IH6A 3EH9A 2XBJA 3LLAA 5DT4A 2WTKC 3RPRA 2J0JA 3WZDA 1H1WA 3LCOA 3Q2JA 4FIEA 2VO6A 5F9EA 2JLDA 3ZMMA 4C33A 3DBEA 2VO7A 4GFGA 3R6XA 4GMYA 3ENMA 3OWKA 3I6WA 4RVKA 4DCEA 1NA7A 3ROCA 4RFMA 5HCZA 4QQTA 3AMYA 3RK7A 3PXQA 3UQGA 5CNOA 4N70A 4QP4A 3ETAA 3U54A 4GG5A 4MWHA 4L01A 5JZNA 3MH3A 4M7IA 1NVQA 5EKNA 1YXXA 1MP8A 3QCXA 3TTJA 3W2QA 3ORZA 2QG7A 2XJ1A 3C5UA 2WTKB 5I9VA 4FT9A 1OM1A 3MPMA 3R7IA 4EHEA 3AC4A 2VTMA 3HDNA 2O2UA 1IAHA 2JD5A 1BMKA 4IB5A 1YXVA 4PL4A 3L8XA 5DGZA 5IQAA 3GU6A 5GNKA 3FHRA 3BI6A 3O71A 3BWJA 2NRYA 5KO1A 4IC8A 2R3QA 3OWLA 1WBOA 3PPJA 4Z55A 1Q8ZA 2PMLX 1ZZ2A 3FSKA 5D1JA 4L3PA 4U7ZA 3BX5A 4YMJA 4TWCA 4ERKA 2X6EA 3TUCA 3OEFX 3ORMA 3C51A 3C4ZA 4WOVA 3BHVA 5DH3A 4XOYA 2WMSA 2CNUA 2C6TA 3VS4A 5L2WA 5AIKA 2B52A 4C0TA 3O7LB 3LMIA 5FTOA 4E6AA 2AC5A 3OCBA 5CEQA 3HMPA 3SW4A 1PF8A 4E26A 4XLIA 2ZAZA 3REPA 4AW5A 3QYWA 4FKTA 4H3PA 2QONA 4H1MA 4LV5A 4AZSA 4FZFB 3GU4A 4RJ6A 3FZOA 3OY1A 5CX9A 4ZSEA 4BDGA 2VWVA 3I6UA 4UB7A 4EKLA 4BI1A 2QOCA 2R4BA 4DH1A 3MFRA 5LOHA 3ODYX 4LFIA 2C1AA 1UV5A 4R6VA 3QRJA 2IVSA 2PVKA 3PA4A 3D7TB 2HK5A 2RFEA 5TT7A 3MJ1A 5I9UA 3AT3A 3G51A 4OTGA 3BYOA 4I22A 4DFLA 4NW5A 5HLNA 4ARKA 3QD4A 3E8NA 4ZS0A 3A8XA 3MFUA 3ATSA 4B8MA 5KMKA 2OIDA 3KXNA 4KKEA 4PUZA 5E8TA 1YHSA 3F9NA 4X6QC 5KUPA 3QC4A 4O7TA 2J4ZA 3RVGA 4YNEA 2F7ZE 2OXYA 3V6SA 2GS2A 4IAKA 5AP5A 5CNNA 4J99A 3VUDA 3KRWA 4J52A 4EORA 1PY5A 4F7SA 4X2KA 4R7BA 3F3WA 4K33A 1O6LA 3I5ZA 4L46A 4HGTA 4AW1A 5HTCA 5AUXA 5C1QB 5JFWA 3EQGA 1Q99A 1YWVA 3A7FA 2BRGA 3EFLA 4JAJA 4HVHA 3LCDA 2O5KA 3BHHA 3Q5IA 2V22A 3QQLA 4FKUA 3RAKA 3SVVA 4XNEA 5LXMA 1P14A 3VS6A 1PJKA 3QUDA 3DKFA 4B6LA 2GU8A 4QMXA 2W1HA 3K5UA 4JNWA 3O2MA 4BDKA 4QDEA 3RMFA 2WMRA 4RC2A 5FG8A 3GCSA 3PJ8A 4LQMA 1H1QA 2VUWA 4TYIA 3SRVB 4RIXB 4CG8A 1ZMWA 2OF4A 4ZS4A 1KV2A 1MQ4A 2VX1A 1UU8A 2YN8A 1KWPA 3I60A 3KRRA 3VS1A 4KWPA 3UO4A 2W4JA 2Q0NA 4RC3A 4R1VA 2CLQA 2VWIA 3DA6A 2WMQA 5DG5A 5KNJA 2W4OA 3P5JC 4D2SA 4ZXTA 3KF7A 3MB7A 4JR3A 4Q9ZA 3LFNA 2CKEA 2WMAA 4KINA 3ZLWA 4RJ5A 3GOPA 4DEAA 3NZ0A 4ENYA 5IISA 2ITQA 2JDSA 5JFSA 3NUPA 1OIYA 1PMNA 5IQIA 1UKIA 2GQSA 3CC6A 1FVVA 2QKRA 2R3NA 3F6XA 3PVWA 1UWJA 1BL6A 2YIXA 4IZ7A 1OKVA 3UIBA 3LFFA 4RJ3A 3THBA 3DLZA 3LMHA 2BUJA 3HYHA 4CMUA 3RHXA 3PUFC 4FTMA 2PY3A 3I0QA 2IO6A 4RWKA 1H8FA 3EJ1A 3OF0A 2GPHA 5IEXA 1JBPE 2IN6A 4RWIA 3UZPA 3D2IA 3QXOA 2BAJA 3NAXA 5HLPA 4KIPA 3SKCA 5I5ZA 1UWHA 4NT4A 3CIKA 2ITTA 5H3QA 3FMEA 4RLKA 4QEBA 3LFCA 4C2WA 3P9JA 4OR5A 3D15A 2NP8A 1YI3A 2YEXA 3CD8A 3FHIA 3JS2A 5HHWA 3ZC6A 1K3AA 5AAEA 2ETRA 3TNHA 4E5AX 4DAWA 4DCAA 2VWZA 4BVUA 3KN6A 4CG9A 4PTEA 1DI8A 1OMWA 3FLZA 1Q8WA 3KXXA 4LV8A 4XP0A 4J8MA 3RPYA 4DDIA 5DT3A 3LPBA 4IB0A 2ITYA 4FGRA 4DFYA 3UZRA 4ZZNA 3C13A 4X7QA 3TG1A 4O81A 5DRBA 3NUAA 3NUXA 3Q6UA 4O0TA 3JUHA 3TDVA 5HU9A 4O0XA 3EWHA 2YM8A 3TKIA 2C6MA 3TIYA 4UEUA 4A9TA 1Y57A 2GFCA 3HMIA 4DH8A 3EN5A 3FMHA 4OTRA 2F9GA 4AQCA 5FP5A 5IA2A 3PY3A 4IAYA 3E3BX 5FUTA 4FTLA 3F82A 3FI3A 4EHVA 3O0GA 1MUOA 3VBVA 3CPBA 3U4WA 5FLFA 4YU2A 2CKPA 4DN5A 4MVFA 2QOQA 2XH5A 4U43A 1KOBA 3R01A 1J7LA 3JY9A 3P79A 4QPAA 1CDKA 5CU4A 4CLJA 5ITAA 3GEQA 1XH7A 3NGAA 1MRUA 4FNZA 4Q9SA 5E9EA 5EM5A 5AAFA 3V6RA 5EFQA 1UKHA 1JOWB 3LCTA 3S00A 2FYSA 4PDSA 4RIWA 5D11A 4YC3A 5AEPA 2KULA 4FNXA 4BCHA 1UU3A 2HCKA 3CR0A 3MY5A 4F63A 4BBEA 2OIQA 2YIQA 4RX7A 2QD9A 2AUHA 1XH4A 3LFEA 2V7AA 5KMIA 3R8PA 1SNXA 1QL6A 2XMYA 3HDMA 4LV7A 2HZIA 3V8WA 3BLQA 3PP1A 4CEGA 3BKBA 3DXQA 3AKLA 3OCSA 4ZY5A 5CASA 3FE3A 4FE2A 3QD0A 3D5UA 5ANIA 1ND4A 3NNXA 4JXFA 3ZSIA 2X8DA 3ZO2A 3TDWA 2XA4A 1UA2A 2X39A 2ZV2A 3RWPA 2HY0A 3EQPA 4G9RA 5E91A 5AP2A 4JIAA 5GIOE 4BCKA 1KE5A 2YAKA 3UDBA 4FTTA 5IQEA 2XNEA 3POZA 2B9IA 5ETIA 4XV3A 3UDZA 4NZWB 3QCYA 3BV3A 4DLIA 3PY0A 3BELA 4O0RA 1QPEA 4O0WA 5JRSA 1OIUA 1U5QA 1YI6A 2XIZA 3GFEA 3HMNA 4WG4A 4N57A 3FLWA 3ZEWA 4BDBA 5CF5A 3RHKA 1LEZA 5CANA 4D1XA 2B9JA 5HICA 4Y85A 1UU9A 4NM3A 4APPA 5JQ5A 3JYAA 2IZSA 3II5A 4QMVA 4S32A 1ZYDA 3ORLA 1H01A 1TFFA 4FKPA 4C02A 5AV1A 5BVDA 3C4EA 4K77A 4BDDA 4OTDA 4YHTA 3SXFA 4DG2E 3VF9A 4V0GA 4ZZMA 3FQSA 3Q6WA 4CT1A 2EXCX 4JL9A 4GKIA 4JRNA 3Q04A 4RC4A 2PSQA 2GTNA 5CF6A 2WTDA 3BQCA 4G17A 3PVBA 1DAWA 1G8KA 1PXJA 2BIYA 2BRNA 4NFMA 4WNKA 1Y8YA 4WO5A 2VX3A 4BDHA 4QDVA 5LCKA 3GBZA 2F2CB 4I4EA 3PTGA 4O6LA 4Y46A 5A54A 1ZYSA 3O51A 3KRXA 3OCGA 4YJPA 5C8KA 1OKWA 2JDTA 4FV8A 3SV0A 1OECA 4Y5HA 3R71A 4JG7A 2W1IA 4AFEA 3FI2A 3HMOA 5T6KA 4YURA 4OBQA 3DB8A 4FSWA 3SOAA 2DQ7X 1Q8TA 3UBDA 5IQBA 3UQFA 3MH2A 2OLCA 3BHUA 3PJ3A 4CTBA 2GHGA 4U5JA 4I21A 3R83A 2XM9A 3NPCA 3ELJA 3R73A 1KOAA 4IJPA 1URWA 3B8RA 3E62A 4QP3A 4S31A 4JX3A 4C34A 5BPYA 3IG7A 3Q52A 1W83A 4AT3A 4CFVA 1XBAA 1OL7A 3RNYA 2IW6A 5HG8A 4C3FA 2UW9A 4XV1A 3H0YA 2Z7LA 4F9CA 2BTSA 2E9NA 1UVRA 2P33A 1IA8A 3WYYA 2QHMA 4FV6A 4MXCA 4X2NA 4WRSA 1G5SA 1XJDA 3QZIA 4CFWA 4BGQA 4ORKA 3WARA 5E7RA 1HOWA 5HLWA 2XB7A 2C6DA 2VU3A 3UOKA 4LMNA 2X7GA 4E6DA 4RX9A 4YJRA 3RNIA 3ZDIA 4FI1A 5C4LA 4KNBA 3KMWA 4RWJA 4YP8A 3Q4ZA 1ZARA 2ZVAA 3BL7A 4FNWA 3EKNA 3RP9A 4TWPA 4BJJB 3E8CA 5JH6A 1PHKA 3KULB 3DNDA 3GCUA 5ICPA 4UWBA 3F69A 3UOHA 4EK6A 1JSTA 2BKZA 3QQGA 1KUTA 2VTOA 4D0XA 3IW4A 3ZONA 3CCNA 3ZBXA 2Y9QA 4N0SA 4EQUA 4JQ7A 3BGZA 1Q97A 4YLJA 3D2KA 1ZAOA 4I94A 4A9YA 2X2MA 2Y6MA 4A07A 2JDVA 3CP9A 4I6QA 4GW8A 3DK7A 3TV4A 2VWXA 5EI2A 5BVNA 1CKIA 3O23A 5DFPA 3ZTXA 5J5SA 3U87A 3TZ8A 4IIRA 3HP2A 3U9NA 3C50A 2UZWE 4YJVA 1BI8A 4FL1A 1PRYA 4W4YA 3AGMA 4MXAA 3P08A 4EZ5A 4FR4A 4C35A 4XYFA 4IM0A 3UDSA 4DYMA 5K4IA 2UZEA 2RL5A 3WF7A 3A4PA 4L42A 4PV0A 4DEGA 2NNWB 4BIBA 2YWPA 3NNVA 4KBCA 4U45A 3ZHPC 4IFGA 5E8YA 2XJ0A 4NIFB 1RE8A 4XRLA 5AUTA 4RG0A 3UOJA 5EQYA 4QTEA 5AFVA 3S3IA 1G8JA 2PU8A 4R3RA 2C6OA 4GJ3A 5IQHA 5LVNA 3OW3A 3QL8A 4KD1A 3FUPA 2IW9A 3VRYA 4YBKA 2QI8A 3GU7A 3CJFA 2H8HA 2UW5A 4KS8A 4ASDA 5DE2A 2OFUA 3GENA 3UJGA 4KKGA 5EYMA 5JZJA 1L3RE 3CS9A 3I79A 3LZBA 4IWPA 3CY3A 2ZV9A 3GGFA 4YJQA 2PZRA 5EW3A 4FG7A 4FSMA 4D5KA 3R8MA 5EW9A 3W0NA 3I5NA 4EBVA 3EQHA 2C0IA 4FTNA 3V5TA 4NW6A 3IGGA 2XEZA 3JR1A 4IB1A 2XNBA 5EM6A 5EI8A 5L6OA 4EONA 1Z57A 2VTSA 3RAHA 4HW7A 2HAKA 3PYYA 4QP6A 5IA3A 2Z2WA 3G15A 4XEYA 3B2TA 1H07A 3P7BA 1VZOA 4YJNA 3VW6A 2CN5A 1P4OA 2OGVA 2R64A 4I0RA 3OD6X 1STCE 3EL8A 2R3MA 1REKA 4TXCA 3QA8A 2W17A 4WKQA 5E1SA 4FTCA 4TT7A 4FSNA 4HJOA 5AM6A 4ZMFA 2VD5A 2XK3A 4LRKA 2J50A 1TQMA 5DHJA 4F6WA 3QA0A 2QLUA 4HZSA 2XK6A 3F5UA 4GFMA 4OT5A 1BKXA 5LWMA 2QR8A 2C0OA 5BYYA 5F1ZA 1SM2A 4LOQA 4P7EA 5M55A 3H3CA 3IONA 2W5BA 4TNDA 4XBRA 3R9RA 3CKXA 4R5YA 1WZYA 4XS2A 4G34A 2JGZA 3F7WA 3MY0A 5ACKA 3ZXTA 4F64A 1JSVA 2UW6A 4DF3A 4FMQA 3MPAA 2C69A 4FYNA 3F3UA 1VEBA 1LR4A 4O0YA 1V0BA 1FPUA 4Y5QA 3WE8A 4QQCA 4U3ZA 1PXPA 4ACCA 4F65A 2WO6A 5AP6A 4AGCA 1AQ1A 4MQ2A 3ZLXA 5HKMA 1IG1A 3G0FA 3DKCA 3DK3A 1ZZLA 2BZHB 3F3TA 1M2RA 4PDPA 4AUAA 1Y6BA 3GCQA 3U4UA 1I09A 3DV3A 2XNMA 4KRCA 5AJQA 1JWHA 3DJ7A 2HY81 5AP4A 2VGPA 1R3CA 3PXYA 4RA5A 1ZWSA 4IB3A 3UC3A 4E5BA 4F7JA 3AKJA 4TYHA 1Z9XA 3QX4A 5CU6A 1UNLA 4O2ZA 5KZIA 3ZSHA 4F9BA 4X2JA 3R22A 2JIIA 5CAOA 2I0HA 3WE4A 4EWHA 4PNKA 4O21A 3DOGA 4RVTA 3DQXA 2GHMA 4JQ8A 5A6NA 4V01A 1IA9A 2F57A 3MW1A 4DFXE 3IGOA 3MIAA 4FNYA 3CKWA 4FTAA 2ITUA 3R1QA 3KRLA 4EH6A 2C4GA 4NJ3A 4EOKA 4JRVA 2YFXA 4GCJA 3R8VA 1A48A 2BMCA 2C3IB 4HCTA 3NYOA 3VF8A 3O8UA 2G2FA 4C58A 3U6IA 2WHBA 2BILB 2B4SB 3NLBA 3W1FA 2HYYA 3ZO3A 2C30A 4EHGA 4FT5A 3FWQA 3TI1A 3A60A 4EK4A 3KC3A 3Q53A 2QOHA 4BYJA 4CGAA 1XHAA 5HX8A 1Q3DA 2IVVA 4JG8A 2X81A 4MF1A 3GQLA 1M7QA 1GIHA 4I6LA 5HVJA 3T8OA 3WZJA 5C03A 4TYEA 4ALUA 5A46A 4HNIA 4OT6A 2W5HA 3UMXA 4DHFA 3FQHA 1JQHA 1U5RA 4RLLA 3IO7A 4ALVA 4O7SA 3CQEA 4MNEB 2UVZA 4FKOA 5L8LA 2ONLA 4YPSA 3ANRA 2FGIA 1X8BA 3OT3A 5CWZA 3R7UA 4PMPA 4PL3A 2BRBA 1O6YA 2RGPA 3KMMA 4HVSA 3BYMA 5C27A 5FRIA 4D4VA 3P5KA 2UVXA 3CTHA 5JT2A 5HQ0A 1OPKA 4XV2A 3EFWA 3LXNA 5DEYA 3ZS5A 3ZUTA 4CRLA 5KMOA 2X7OA 3S4QA 2WTWA 4UN0C 3PXKA 4X3JA 3HGKA 1G8AA 4Q5EA 1YXTA 3GCPA 4JDKA 3BPRA 3DTWA 3EQCA 3N9XA 1BLXA 3LLTA 2C1BA 4JI9A 4M68A 4O38A 4EH9A 2ONLC 3KCFA 4XOZA 3QZFA 4AOIA 2CNVA 1SVGA 4FV3A 4O82A 4R7IA 3GXLA 4XMOA 5BMSA 3SX9A 2FSLX 3VJNA 1DAYA 2C0TA 4TTHB 4XHKB 4K2RA 4WG3A 5LVMA 4DGNA 1OB3A 2ZB0A 4XBUA 5HO7A 2G2HA 4GU6A 3AT2A 5D41A 5K4JA 4L67A 4P5ZA 3QWKA 2VN9A 5DEWA 4CZUA 2BR1A 2PVLA
chains in the Genus database with same CATH topology
1GOLA 4WG5A 2JFLA 2H9VA 4GL9A 5I0BA 1ZMUA 4E20A 4DFUA 2ACXA 3HRFA 3N4TA 4YZDA 1ST0A 3OROA 3AC3A 2XAOA 4PF4A 4MK0A 3KA0A 3R30A 5EQEA 2WMVA 3LW0A 3WZKA 3ORIA 1WFCA 4FV2A 4DG0E 5AUUA 2ZFYA 3E63A 4NKSA 4BDEA 4Z16A 3NWWA 5FQDC 1FBNA 3BLRA 1H1SA 2XNGA 4MXOA 5HNBA 5IQGA 4C62A 4M12A 4EQCA 3DPKA 4H36A 3QWJA 2F7EE 2Y8OA 4ZY4A 2GQGA 4HNFA 1WCCA 4PMSA 5BYZA 2GFSA 4QYGA 4EOLA 3TZ7A 4TZRA 3HV5A 4YGAA 4E6QA 4OTHA 1YWRA 4BYIA 2C6IA 3AC2A 3D5XA 4J95A 4JAIA 1YOJA 3BQRA 1OL2A 2WZJA 3TKUA 5DR2A 3SXRA 5AUVA 2PZPA 3KL8A 3DZQA 3OOGA 2W96B 3MB6A 1WBWA 4XG6A 3V5QA 3UIUA 4ZK5A 5AX9A 2J0MB 2VZ6A 3P78A 5A4QA 3L8SA 5HE1A 3ORXA 4KA3A 3VWAA 4MBLA 2VAGA 4ZLZA 2YJRA 1OITA 3RZBA 2QURA 2I40A 4U42A 1ZRZA 3BGQA 4RPVA 4WD5A 4K6ZA 4M8TA 2VWYA 3I7BA 3MJ2A 4L52A 5BVKA 3DB6A 3VUIA 2WTVA 2YM3A 2CGVA 2SRCA 3R7YA 1QPCA 3DKOA 3DBDA 2YZAA 3EFKA 5HIBA 4LUDA 2BFXA 4UXLA 4I20A 2CNQA 5LMBA 3NCZA 3OVVA 4G9CA 4ONAA 4LGGA 4RRVA 2UW8A 4JDIA 5EM8A 1FOTA 4ZLOA 3W0SA 4E4LA 4FKSA 4O7YA 4UX9A 3W2SA 3QQUA 4AZEA 2YM6A 3P86A 2Z7QA 3COIA 4E1ZA 3G6GA 2GCDA 2HIWA 3RALA 1ZYLA 3MH0A 4BF2A 1SZMA 2LGCA 4A9SA 4ANQA 2XNPA 4LYNA 4C37A 3QRKA 3LAUA 4GSBA 4GT4A 4XG2A 4XP2A 4R3CA 3SD0A 3SLSA 4BCPA 5DT0A 1JPAA 3AC5A 2JAVA 3PE1A 1Q41A 1IEPA 3LJ2A 1S9JA 2YDKA 3PE2A 4GKHA 5CI7A 1YHVA 3VIDA 2X4FA 4S33A 4CKRA 5ANGA 1B38A 3R2BA 5DIAA 3A7JA 2XYUA 4FVQA 3AD6A 3GC7A 4PMTA 4NSTA 2W4KA 4AGDA 4HVDA 1PMVA 4DG3E 4EUTA 3DK6A 1APME 1YI4A 4FZDB 2OH4A 4QMLA 2XANA 1WMKA 2PHKA 4FGBA 5T68A 4BCNA 2QKWB 3TCPA 2VV9A 4MX9A 4YO6A 3IDPA 5H2UA 5HI2A 3FPMA 4E4XA 2WD1A 5LQFA 2WPAA 2Y4IC 4DHIB 2W5AA 3IDCA 2GMXA 4D28A 3OBJA 4GT3A 3KXMA 4J98A 1LUFA 5IDPA 4MXXA 2UZVA 1KE9A 1VJYA 3QBNA 5E92A 4EYMA 3OG7A 3EKKA 3BU3A 4BDIA 4ZTLA 3PWDA 3FLYA 5AV0A 4DE4A 1EH4A 2P2IA 5CAUA 2XRWA 3OXTA 2ZDUA 3D14A 3NFGB 3IPHA 4HPUE 4II5A 4W4WA 3QD2B 1WBSA 3V01A 4FTUA 3ZLYA 4AOJA 2C5NA 1DS5A 4FSZA 2Z60A 4S2ZA 2O64A 2Y4IB 4GU9A 4ID7A 4BN1A 1M14A 4K9YA 3DAEA 4YLKA 1FMKA 1OL5A 4FTOA 1PMUA 3N4UA 4YBJA 4D0WA 1URCA 4F0IA 1JAMA 2PZYA 2C3LA 4IVCA 1HCKA 4R1YA 3H0ZA 5FM2A 2BHHA 4EWQA 3Q5ZA 2B9FA 4GVAA 2V62A 3PJ1A 5E90A 3DS6A 1OZ1A 3TNPC 4WRGA 2HXQA 4L45A 5JGAA 4E8AA 5IUIA 4QTCA 4KAOA 4JQEA 3FXZA 3UVPA 4C38A 3PA5A 5DLSA 4BGHA 4IE9A 5A4CA 4IACA 2YA9A 2FA2A 2F7XE 2C5OA 5CSVA 2WQOA 4JDHA 4A9RA 2PVHA 1A06A 4G6OA 4L3JA 4AZFA 4ZSJA 2BZKB 4IX6A 4IWOA 4BB4A 4G16A 3RK5A 3IOKA 3AMAA 4O7WA 4O7RA 1OBGA 4CKJA 5DYJA 1U46A 2XM8A 4G3DA 4HGEA 4M3QA 5L6WL 3VHEA 4EOMA 2OBJA 1M17A 3QTXA 5CEIA 5D7AA 5K9IA 4FEXA 4S30A 2OJIA 3OY3A 4U9AA 5BMMA 4DGOA 1OIQA 4TYGA 3TMOA 2JC6A 4FEWA 3ERKA 4X3FA 4EEVA 2FSTX 4U0IA 4RVMA 2PVMA 1I44A 1PXIA 2WTIA 3QKKA 2Y7JA 5LVLA 4CCBA 2PWLA 2QOOA 4TWNA 2CSNA 2GDOA 5ACBC 4DITA 1T46A 4GH2A 4YR8A 2J5FA 3CY2A 3BE2A 2XNNA 2Y6OA 5J95A 3KQ7A 2XKFA 3PVGA 2KTYA 2X8EA 4JBQA 4F9WA 3ZFXA 2WMBA 3WILA 4MEDA 3FKOA 4Z9LA 3KB7A 4K11A 2R3HA 5FXSA 4AACA 2VTTA 2E9OA 3FLSA 5HX6A 3R9DA 1Q61A 4G3GA 4IX3A 3VS5A 4IW0A 4X3FC 5CQUA 3DT1A 4RQKA 4G3CA 3ULZA 5FP6A 1ZXEA 3OUKA 3I4BA 1JVPP 4AXDA 4C4HA 3F2NA 2QU5A 3LFAA 3GNIB 4A4XA 1K9AA 5HTBA 2GNIA 3MVJA 3BYVA 2G9XA 3LJ1A 1SVEA 4H1JA 4M97A 4XLVA 3QQFA 3T3UA 3WI6A 2CN8A 3EL7A 1KE6A 4AA4A 5CI6A 4RWLA 5DVRA 3SW7A 2E9VA 5IDNA 4NCTA 2X9FA 4YZCA 1GY3A 4KKHA 2GNLA 3NSZA 1H0WA 1XMLA 4YZNA 4QMWA 3C5IA 1OKYA 4LOPA 4UWYA 5TR6A 4M15A 5A14A 3R9HA 4AG8A 1P5EA 2EUFB 3RPVA 3ZU7A 4O7NA 4EZ7A 4OW8A 2I7QA 3IW7A 4AZVA 4EQMA 4G5JA 5K3YA 3DXPA 4ALWA 4RJ8A 1CTPE 5KCVA 3QALE 4F08A 5DOSA 3VQHA 3CQWA 5J8IA 4XX9A 2WU6A 3E64A 1PXLA 3R8UA 3SAYA 2BRHA 2UZNA 4MBJA 3KIOC 1P4FA 4DFBA 4FV1A 3AT4A 4RJ7A 3HRCA 3P1AA 3PG3A 5A4EA 3CTQA 2OW3A 4DEBA 3ULIA 4DC2A 3W0QA 2CLXA 2GNJA 3HV3A 5JFVA 3M11A 4IMYA 4F1OA 2ITPA 2QOKA 2XK8A 3V8SA 5A3XA 3V51A 4FL2A 4B9DA 4QMNA 3MGYA 3VBQA 4CV8A 2ESMA 4QRCA 4ZP5A 1YOMA 3I7CA 3MBLA 2FVDA 5CVHA 3ZM4A 4F0GA 4Z7HA 5CSWA 5I9WA 3FI4A 5J87A 4D4SA 4TNBA 3Q4CA 3TJDA 4B4LA 5JMSA 5AA8A 4GG7A 4K18A 3QC9A 3GC8A 2P4IA 2J0KA 3FZTA 3CJGA 3FMLA 3R7EA 4FJVA 4A4LA 3NUYA 4DGMA 4X0MA 5AAGA 2Y4PA 2I0YA 5IF1A 3E8DA 2VGOA 5HG9A 2BZJA 3TACA 4BBMA 2VX0A 4L53A 4JLCA 5JK3A 5FEDA 2B1PA 4MTAA 4LRMA 3P7AA 3MDYA 5CT0A 5E8ZA 1SMHA 1U4DA 3W0MA 5ANEA 4BCGA 2CMWA 5DA3A 1E1VA 1ZOGA 4EK3A 3FSFA 5IA0A 2W9ZB 1ATPE 4FTQA 4RFZA 1YW2A 4DEDA 4FZ7A 3KK8A 2A1AB 3W2CA 2BCJA 3QKMA 4RIWB 4PRJA 2WOTA 4FKLA 2WEVA 3MWUA 4OGRA 1P2AA 3QRTA 4GK2A 3A7HA 4XH6A 4EZ3A 2W1GA 3NVKI 2HOGA 3EN6A 2R5TA 2BDWA 3UPZA 3QFVA 2IPXA 4L68A 5M57A 1NXKA 2GNFA 2R7BA 4DINA 2W06A 2XARA 4PDYA 5HE3A 4AAAA 4CMOA 4EC8A 2OFVA 4XG9A 4Y72A 3COKA 3F5XA 3TYKA 2QOBA 4QYHA 5CEKA 3VN9A 1BYGA 3OXZA 3U51A 3PLAE 3Q9YA 2WTJA 3F2AA 2XK7A 3C9WA 5EOBA 3T9TA 1JSUA 2ZOQA 3RTPA 4AA0A 1CM8A 4AXFA 4EHZA 4EUUA 4YTFA 5KBQA 5BVEA 4C4EA 1H1RA 3TKHA 3MFTA 3Q4TA 3FXXA 4ACHA 2CGWA 4EI4A 1RJBA 5BQ0A 2UZUE 3MYGA 2J0IA 4RX8A 3ZXZA 4UY9A 5HZNA 2JBPA 2YM4A 4L00A 3POOA 2XVDA 5FEQA 4GT5A 5HG7A 2IG7A 2BVAA 3F88A 4ERWA 2VNYA 3AD4A 5C9CA 2PYWA 3WOWA 4F70A 2ZM1A 1RQQA 5LCJA 3ZRLA 4RX5A 2X1NA 2XKCA 4UWCA 4AQKA 3NX8A 3MI9A 2HENA 3VVHA 3BEAA 4BDFA 5DR6A 1ST4A 2ZYBA 3MA6A 3WZEA 4DT9A 2GHLA 3HZTA 2BROA 2JKOA 4KBKA 4CV9A 3Q2MA 2R3RA 5D9HA 4V0GB 3BBWA 5HBJA 2ZJWA 2WOUA 3DGKA 4IAFA 4OTQA 3A62A 4XV9A 3DCVA 3UYTA 3V5PA 1XQZA 4W4XA 1WVWA 1GJOA 3ZOSA 2J90A 3HVCA 4NH1A 4U79A 5L6PA 1H28A 3BHTA 2PZ5A 3DQWA 4CCUA 1Q4LA 2RFNA 3DY7A 3G6HA 4HGSA 3W10A 1PKDA 4A7CA 5BNJA 2YACA 1GZOA 4HPTE 4IANA 4ZJIA 2WIHA 3U55A 4XCUA 1XH6A 4ZJJA 3L8VA 3R00A 3PVUA 3V3VA 4GYGA 1NVRA 4F1TA 3DBQA 1DM2A 3KVWA 4FX3A 2ITVA 3FMMA 5KKRC 3F66A 3LFSA 4FKVA 4JX7A 4XG3A 3UYSA 3ZH8A 4FIIA 3QQJA 3E93A 4CXAA 4HYHA 1XWSA 2RF9A 4FV4A 3BCEA 2A27A 2NRUA 2QNJA 3JY0A 5IA5A 3TT0A 5LVPA 1V0OA 4I4FA 5HCXA 3UOLA 4QMSA 2R9SA 3RM6A 1QCFA 3AXWA 3KXGA 5E1EA 2AC3A 3F61A 2C5YA 3A7GA 4CD0A 2YIRA 2G01A 3OEZA 5IA4A 2QO7A 2BFYA 3ET7A 2H6DA 3H4JA 3MA3A 5DI1A 4EOIA 4ENXA 2CKOA 4N6ZA 4G3FA 5KKRB 3BLHA 4K8AA 4KUJA 1AGWA 3C0GA 3PIXA 2OKRA 2ITWA 4FK6A 4XUFA 5AV3A 2EB2A 3PJ2A 1F5QA 3UZTA 5FD2A 3FKLA 4IZ5A 4PWNA 3ROYA 5KBRA 3TV7A 4RJ4A 4QYYA 3DLSA 4D1SA 5IMEA 3Q3BA 3HL7A 2XK9A 3FBVA 2CGXA 3BYSA 3IW6A 3MIYA 4O91A 2O65A 4RA4A 3CSVA 4YC6A 5AIRA 5A9UA 4FIJA 5JGBA 3N4VA 4U44A 3C4XA 4I5CA 5E8VA 3LHJA 4FVPA 2YCQA 1MRYA 4QQ5A 5AMNA 3OBGA 1RW8A 4BCFA 4USEA 2C6KA 4AZTA 3HA8A 3E88A 4V04A 2F2UA 4Y8DA 3LM5A 4HYSA 2UVYA 1Y91A 2BHEA 4J96A 3EZVA 5BUIA 2YAAA 2RFDA 4ZTQA 2UZLA 5IQDA 4AE6A 3S2PA 1GNGA 4IVAA 4AN3A 2PULA 3CXWA 5HBEA 3ACJA 2PTKA 4RT7A 5C8MA 4YTCA 1OGUA 3KVXA 4EYJA 4CRSA 5IH4A 1JNKA 4FUYA 3PZEA 4O22A 5F95A 3TWJA 3TZ9A 5BUEA 4CTCA 3BE9A 5BVOA 4FIHA 3KY2A 2GNHA 2R0UA 3JVSA 4G6LA 4L3LA 2FSMX 4TKSA 2PVYA 2XZSA 3OP5A 2I6LA 4HCVA 4IFCA 3NNWA 4DH5A 1LPUA 3FL5A 2ZM3A 3FZRA 4ITHA 1W82A 3PPKA 4X2GA 5HCYA 3UE4A 2WTCA 4ANLA 4ZJVA 1YRPA 4I5PA 4IVBA 3WZUA 4BC6A 4O83A 2IZTA 1FVRA 2R2PA 3ATTA 1IAJA 3LXKA 1OIRA 1JLUE 1QPDA 2PVJA 4ZTMA 2WQBA 2Q0BA 4TW9A 4OBPA 3W0PA 2WIPA 2XIRA 3TV6A 4WIHA 3VONA 5M07A 4FUXA 5B2KA 3ZRKA 3QU0A 3BYUA 4QP9A 2HWPA 4AN2A 3VQUA 2O63A 5LARA 4JS8A 4FKGA 3I0OA 3C4WA 3QRIA 4JBOA 3WF8A 4DTKA 1TQPA 2XIYA 2OIBA 5CY3A 3QKLA 4MYGA 2W05A 4YTIA 1LEWA 3COMA 2JEDA 5LVOA 2JDRA 5EYCA 3FEGA 3UP2A 2R7IA 1OVEA 3BWFA 4YZMA 2FH9A 1ZY4A 4PL5A 3L1SA 4OUCA 1BUHA 4FV5A 5CSPA 4FICA 4M0ZA 4YTHA 4BTFA 5HD4A 2ITZA 5M4FA 3R04A 2BDJA 3QD3A 4EOPA 3BU6A 4YNOA 4IAAA 5IEYA 2J2IB 3HKOA 3FL4A 4BTJA 3QCQA 4DLJA 1OPLA 2ITXA 2YM7A 3LQ3A 1FGIA 3R0TA 4UALA 2B7AA 5IEVA 1TVOA 1TQIA 2QC6A 2VWBA 3GU5A 3LCKA 3Q4UA 4GK4A 4IQ6A 5EH0A 3TL8A 3ZUUA 1KE8A 5FTQA 3ACKA 4AS0A 2XP2A 3R63A 4APCA 4G5PA 2PK9A 2IW8A 3GQIA 5J1WA 4NL0A 3W55A 4C7TA 4XG4A 3H9RA 3PSDA 3VAPA 2VTIA 5AP3A 1PYXA 4D2RA 3GUBA 2XS0A 4LRJA 4R7HA 4IADA 4F09A 4U81A 4Z3VA 4QTBA 4LL5A 4FKJA 3R7VA 4EJNA 4R3PA 5A4TA 4FSTA 3U6HA 3KMUA 4AT4A 2W1DA 4WT6A 2R3IA 5KMLA 4O0UA 4M0YA 4TPTA 2YJSA 4MNFA 2IZRA 4EOQA 3G5DA 5L2SA 3KF4A 5J9ZA 3S0OA 3R02A 2JKMA 2OZOA 4EH4A 2Z02A 3PIZA 5KE0A 4TYHB 4PTGA 5JSMA 2X6DA 3TNQB 1R1WA 4I3ZA 2R3JA 1H1PA 1U59A 4GRBA 2GTMA 3HNGA 4GUEA 1W98A 3CTJA 4UYNA 5EQPA 2RG5A 4QMPA 3DFAA 4QMUA 4AA5A 2F49A 4WSYA 2G2IA 3ML1A 5KZ0A 1YOLA 2HW7A 4C4JA 5CXZA 2WU7A 2XKDA 3MV5A 4FA2A 3NW7A 5JKGA 3C4FA 4AXEA 5CU2A 2FO0A 4ZZOA 5ETFA 4M13A 3NFFB 2RKUA 4A9UA 3P23A 4E4MA 4RIYA 2VNWA 3GU8A 2VTPA 4MHAA 4JT3A 1H08A 5HEZA 3MFSA 1ZOHA 1XO2B 1J1CA 2B55A 4LG4A 5HGIA 4ZIMA 2FUMA 3NDMA 3V04A 5EYKA 1JKLA 2XYNA 3GC9A 4TRLA 2AEGA 3R1YA 4O6EA 4O86A 3VULA 5T3QA 3B2WA 3OT8A 5BUJA 5M51A 2JAMA 2A4LA 3T3VA 2QOIA 4ZMEA 4NK9A 1O9UA 1QPJA 3PJCA 3VS7A 5C26A 2AYPA 4QYFA 2UW3A 5EHYA 4EH7A 4FZAB 4K1BA 4YPDA 3VBTA 4J1RA 5FEEA 2PE2A 4P5QA 2PUPA 3CD3A 3NW6A 1ERKA 2IWIA 3V8TA 3FC1X 4RGJA 2ETMA 4W8DA 4RZWA 2BAKA 3NCGA 4YSMA 3QGYA 3C4CA 3OCTA 3VBXA 4E73A 3RK9A 3DAKA 1Q8UA 4AFJA 4F78A 3G2FA 4LM5A 3NW5A 5FXQA 4QOXA 1YKRA 3DZOA 4IX5A 4O2PA 4MD8E 2HZ4A 3MESA 3HUCA 2H34A 5GJGA 2GS7A 4BIDA 2PUNA 3I81A 2C3KA 4D58A 2JITA 5K5NA 5ANOA 3P4KA 3ZUVA 3C0IA 1SVHA 2VTRA 2EVAA 1O6KA 4NWMA 2F4JA 4RIYB 2UW0A 5GHVA 2V0DA 4NKAA 3G33A 4B7TA 3LE6A 2OICA 2WB8A 3TUBA 4C3PA 2YHVA 4IM3A 4AGUA 4AN9A 1CMKE 1NT2A 3ZO1A 4CQEA 3E3PA 4FL3A 3PXRA 4D55A 4LGHA 3D0EA 2XRUA 3O5AA 3VUMA 4E6CA 1W84A 4QMZA 4KSPA 1HCLA 1L8TA 1TKIA 3NEWA 4MD7E 3RAIA 3EQBA 3DBCA 4Y83A 4C4FA 4M84A 4IDTA 5CAPA 3W0OA 1H4LA 4DGGA 2BKKA 2WQEA 3UP7A 1GZKA 3CBLA 3EMGA 4ACMA 1IR3A 2R0IA 3ORPA 4C4IA 2BTRA 5DRDA 3K54A 4P90A 1PKGA 3A61A 4I93A 3NRMA 4F7NA 4C59A 4J71A 2GS6A 2IJMA 4WNOA 3RGFA 2W1FA 1OUKA 3AC1A 1J91A 1UNHA 3QUPA 2CKQA 4AXCA 2C6EA 3NVMB 4FT0A 4BGGA 4RBLA 1VYWA 3HRBA 5H8EA 5CEOA 5HU3A 4MWIA 5I9XA 5IQCA 1PXNA 1R78A 4D4RA 2E9UA 2RIOA 3AQVA 3PRIA 4HYIA 4EKKA 3QTZA 4CVAA 3EN9A 3TJCA 3UQCA 4JOAA 3NIEA 4WUAA 1YHWA 5KMNA 3NUSA 4AWIA 5AADA 2PMNX 3EHAA 3D7TA 5HBHA 4GV1A 4PP9A 4BICA 5IMXA 4FK3A 1JKSA 3EYHA 4DA5A 4BHZA 4B0GA 3MN3A 3QHWA 4FKQA 5ANJA 3PXFA 1ZOEA 5J1VA 2YITA 4I0TA 2GSFA 3GI3A 3NNUA 2OZAA 5CZIA 1BL7A 4JBPA 3ZYAA 1NW1A 4IHPA 4D9TA 4PY1A 1PXMA 2C3JA 4L43A 4AOTA 1KV1A 3EOCA 4U8ZA 1FINA 4J53A 5L8JA 5C4KA 3KN5A 1J7UA 1SNUA 4MXYA 2WNTA 3UVRA 3AGLA 4L6QA 2XNOA 2QLQA 3QTIA 2CDZA 3ZC5A 1CKPA 4AAYA 5ETAA 3HUBA 4WHZA 3W33A 5TF9A 4ANSA 2X0GA 5BVFA 2P3GX 1GZ8A 3U6JA 3V5LA 4EOOA 1QMZA 5EYDA 3RCDA 1OKZA 5IZFA 3RAWA 4XG7A 3R7OA 4JIKA 3QX2A 3RCJA 4RMZA 3K2LA 3FMDA 2VTAA 4DDGA 4FG8A 4FOBA 1MRVA 3HAVA 4Q5HA 4WA9A 4FBXA 4QMMA 4MAOA 3LMGA 4JVGA 1Q8YA 2HXLA 3M2WA 4ZTNA 3TN8A 3SRVA 2OXXA 1H25A 2P0CA 2OO8X 4MD9E 4RIXA 3W2PA 4FV7A 3W2RA 4AZWA 2XIXA 4NM0A 2XEYA 1XH5A 5IG1A 4U3YA 5F94A 4D5HA 2ZM4A 1BI7A 2UV2A 3MVHA 3QTSA 3TXOA 5G1XA 5CS6A 4TL0A 3PXZA 2YWVA 2J5EA 2G1TA 4GUBA 1GZNA 1OUYA 4QPSA 3UO6A 2OZAB 2YM5A 3GOKA 3R2YA 4J8NA 2O0UA 4M14A 5FM3A 4E93A 5HNIX 2R3PA 3IW8A 4W4VA 2J6MA 5AM7A 3BHYA 2JIUA 2X2LA 1VYZA 2PMOX 4FODA 2Z7RA 4LUEA 2B54A 3H10A 4NM7A 3RPSA 4AX8A 3AOXA 2P2HA 3DJ5A 5CYIA 2PPQA 1IASA 3SG9A 3SA0A 5TKDA 2CJMA 3ODZX 4FTIA 2WQNA 3QTQA 4YJTA 1ZY5A 4G6NA 5FGKA 5BX0A 2J51A 3OTVA 3D94A 3HX4A 2OJ9A 3A8WA 4GS6A 3W18A 3PLSA 5L3AA 4PX6A 2HELA 2WFYA 3LIJA 2GQRA 4ZY6A 3W32A 4DFNA 3PRFA 3QHRA 1NY3A 4LOOA 4KRDA 3OS3A 1M52A 1RDQE 5EHOA 5EDRA 4BZDA 1J1BA 3ZSGA 3G9NA 3Q32A 4FIGA 3PDTA 1PXKA 4ZSGA 3D9VA 4WNPA 1YVJA 4YJSA 4GK3A 2QO2A 2OG8A 3G90X 5CAQA 3GC0A 4ZTHA 3EB0A 3GFWA 4NTSA 1Q24A 3K3IA 3O17A 4CLIA 5EK7A 5JGDA 3RJCA 3FPQA 4X2FA 4YO4A 4EOJA 2ERZE 3CPCA 4I5MA 5ANDA 1H27A 2WELA 4O0VA 4G2FA 3SHEA 3HV4A 2QG5A 3BRBA 4FT7A 1DI9A 2ZMDA 5CSHA 2ZB1A 3NMUF 3FC2A 4QTDA 2VWUA 4BZOA 1E1XA 2YCFA 3QQKA 3UIXA 5A4LA 3ORTA 1B6CB 3DDPA 2XAMA 4NU1A 1FQ1B 3OW4A 2OF2A 3HV6A 4YZBA 4F9YA 3KFAA 3JVRA 3MVLA 4CNHA 5IU2A 3O8TA 2YABA 2VTHA 4FVRA 5D12A 3LFBA 4PNIA 3ZO4A 4F0FA 1JKTA 2EXMA 2YDIA 3BL9A 3UPXA 4LL0A 4RFYA 2V5QA 2EU9A 4HYUA 4RIOA 5KHWA 5G6VA 3F5PA 4IWQA 5CTPA 1XH8A 3FAAA 2BDFA 4P4CA 4QMOA 3B8QA 3CGOA 4WBOA 2UW4A 5HVYA 2BRMA 2RG6A 4JMQA 4FKRA 3EZRA 3R9NA 2VTNA 2BZIB 2HWOA 2OWBA 4O96A 3PUPA 3KXZA 5IUHA 1MQBA 3R8LA 2E2BA 4QP7A 2CGUA 3PG1A 2R3FA 3FY2A 2XJ2A 3MSSA 5EDQA 4BHNA 4PDOA 1FMOE 1WVYA 2O3PA 2WMTA 3LCSA 4YZ9A 4ZTSA 4X3FB 5DN3A 3UVQA 3QTRA 4MUQA 2JBOA 2ITNA 4KIOA 4AE9A 3M1SA 4UZDA 1PW2A 2PVNA 5CU3A 5HG5A 5B2LA 2G15A 5C01A 4X6RA 2QHNA 4HGLA 4KB8A 4K0YA 4M67A 4CZTA 3ITZA 3NAYA 4DHZA 4NUSA 4ASXA 4BDAA 4O7LA 4G3EA 5AUWA 2W0JA 3DJ6A 4H05A 2ZV7A 2QU6A 5J7HA 3VBYA 4RZVA 3ZDUA 3ZFMA 4NCTC 1H24A 5CALA 4FEVA 5GINE 5CLPA 1F3MC 3UNJA 4MXZA 3IK3A 3CEKA 2HZ0A 1G3NA 3U8WA 1LP4A 4HZRA 3KU2A 5HO8A 5AV2A 4O0SA 3VO3A 4E4NA 3DXNA 3OWJA 4NJDA 4KABA 4FT3A 4UZHA 5E4HA 3F3ZA 5HE0A 5CAVA 5LMKA 2UZTA 3P0MA 5B7VA 2PE0A 2UUEA 2IVTA 3EQRA 4IAIA 2XKEA 4FTKA 4G31A 4EBWA 2QOFA 2OU7A 2YCRA 4CKIA 5CF8A 3HEGA 5EW8A 2R3GA 5TOZA 3EYGA 5HESA 5EKOA 4EH2A 3FLNC 4C36A 3RKBA 3VJOA 3EN7A 3ORNA 4IEBA 3QF9A 3IW5A 3JPVA 4BCJA 3BU5A 4IAZA 4BDCA 3IDBA 4IH8A 3FY0A 4CSVA 5K5XA 4ANBA 4F6UA 4OLIA 2R3KA 3L9NA 4BCIA 4W8EA 3Q96A 5KHXA 1WBPA 2C5XA 3I1AA 3OOMA 4QP2A 3OWPA 4J7BA 3HMMA 5M06A 3TUDA 4LI5A 4Y73A 3L9LA 3WBLA 1F0QA 3H9FA 4NFNA 3G0EA 2I0VA 3E7VA 2X2KA 3JXWA 2PVRA 4KS7A 5LMKC 5GIPE 2DUVA 3QLFA 5HORA 4QTAA 5IQFA 2ERKA 3QTWA 4XP3A 2CPKE 2JDOA 1Q5KA 1A9UA 1AD5A 3VUHA 4B8LA 3EN4A 2YIWA 2XCHA 4N4SA 1VR2A 5D10A 1XBCA 2WAJA 3V5WA 4KIQA 4L7FA 3GCVA 5CENA 4DEIA 3UMWA 3CE3A 2W7XA 3KCKA 3DDQA 4NYEA 2IVUA 4OTFA 4EK5A 1XH9A 1YWNA 2IZUA 3GP0A 1ZYJA 2HZNA 3D5VA 2WMUA 4KBAA 5FBOA 5IA1A 3QZHA 4QNYA 4Y95A 2FSOX 2XUUA 3Q60A 3OMVA 3QYZA 3W8QA 3K5VA 2JKKA 2OSCA 4BCQA 3FI8A 5LJJA 4GEOA 2OJFE 5IUGA 3TNWA 1S9IA 4UBAA 3DU8A 3W16A 4YC8A 3LFQA 5CXHA 1UU7A 3QRUA 4I6BA 3RI1A 4GVJA 4NTTA 4E5WA 3FZPA 1R0PA 2VRXA 4GJ2A 2REIA 3H30A 3MH1A 4H39A 1GIJA 4JJRA 4B99A 2CHLA 3FYKX 3H9OA 4OBOA 4C2VA 5CVGA 4AP7A 1W0XC 4R77A 4DTAA 4AT5A 3AD5A