2XALA

Lead derivative of inositol 1,3,4,5,6-pentakisphosphate 2-kinase from a. thaliana in complex with adp and ip6.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
435
structure length
420
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGITSGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICKEELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRNAWDSEPSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase is a Distant Ipk Member with a Singular Inositide Binding Site for Axial 2-Oh Recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 134
structure length 420
sequence length 435
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xalA01
4AXFA 2XANA 2XAOA 4AQKA 4AXDA 2XALA 3UDSA 4AXCA 3UDTA 2XARA 3UDZA 4AXEA 4LV7A 2XAMA
chains in the Genus database with same CATH superfamily
2W0JA 2BAJA 3BHTA 2Z8CA 4L68A 1CMKE 4LRMA 3FLYA 2Z7SA 3PA3A 5G1XA 5C8MA 3UDTA 3GVUA 5EW3A 3HDNA 2R3MA 4L3PA 3AMBA 4YTFA 4EBVA 1KE5A 4ITHA 1CKPA 2J2IB 1YXUA 3V8SA 1JBPE 1M2QA 4PNIA 4M84A 4Y85A 3ZBXA 2P33A 3ITZA 1QPDA 1XJDA 2UZEA 4E7WA 3VJNA 4L3JA 5CEPA 1OZ1A 2AC3A 4G3FA 2IVTA 1PXIA 4OTHA 4NCTA 1KOBA 3W0MA 4E20A 4JLCA 2OGVA 4G5JA 4CCUA 2XIZA 3F3TA 4F63A 2H34A 2XK8A 3COMA 4LV5A 3DB6A 4ZTNA 4M3QA 3MA3A 4WT6A 1APME 3GT8A 3HMPA 1K2PA 4RIWA 5GJFA 3A8XA 3QQUA 4OR5A 5IG1A 2Y4IB 3SG9A 3NWWA 1M2RA 4FVPA 3KA0A 2R4BA 4BDEA 3LM0A 3PPZA 3K3JA 3FC1X 3Q9XA 4XX9A 3ULZA 3KXNA 2QO2A 3W0NA 4X6RA 4CD0A 1SZMA 2P4IA 2W4JA 3EQGA 3F7ZA 3ZO4A 5BVKA 2UV2A 3A60A 4ANBA 4DEEA 4L01A 3TZ7A 4NUSA 5CXHA 4AAAA 4AZEA 3PJCA 4KBCA 4XJ0A 3HGKA 4M0YA 3O96A 1UWHA 4AS0A 1QCFA 4FIJA 4KBKA 4ZTSA 3MY5A 1ERKA 2NNWB 4YURA 5AA9A 3ZLSA 3R2BA 2XNEA 2IZSA 3W2SA 3RM7A 4F7SA 4X3FA 4OTFA 2W1EA 3C13A 2F9GA 1OL7A 4RJ8A 2XK4A 1SNUA 2YM4A 3LKMA 4WA9A 2W9FB 5E4HA 5C8NA 4FI1A 2CNUA 1U5QA 4YZMA 1CKJA 2PVFA 3F61A 3RK9A 3N4TA 4BCIA 4CFWA 4E6AA 5BMSA 5IQGA 5JKGA 4LRKA 4J71A 3G5DA 3TNQB 3QC9A 3GC7A 3MN3A 4I0RA 4WD5A 4BDDA 4DGOA 2BRNA 4X2KA 3ATSA 2G1TA 3FL5A 3OZ6A 4DG2E 5CSPA 3PLAE 5FM2A 3QBNA 3G33A 2E9VA 3IOKA 3FZ1A 5BQ0A 1JVPP 4I94A 4RJ6A 2JC6A 2O63A 4U3YA 3RPOA 5AIKA 4LV7A 3FHIA 4TWOA 1L8TA 1ZLTA 4ZTLA 2WMXA 3AC8A 3QHRA 4FNXA 4R3PA 3SOAA 4CTBA 3TCPA 3FMMA 1YWVA 1JLUE 3GB2A 2IJMA 4G1WA 5I9UA 3VNTA 1PHKA 5L2IA 1VYZA 2H9VA 3PJ2A 2QR7A 3ORPA 3VHKA 2BZKB 2DS1A 3U51A 2JDSA 4QO9A 3NGAA 5CT0A 2C6MA 4RLKA 2R9SA 3GCUA 4AXFA 2QOKA 4USEA 4Z9LA 5A3XA 4Q5EA 3SOCA 4Z16A 4OTGA 2PZPA 4ZY6A 1YWNA 4HVDA 3BU5A 4ZJIA 4B9DA 3SLSA 3ORKA 4JX7A 4O0YA 5CF4A 4DEAA 2GSFA 4FKUA 3S3IA 3ZONA 4L7FA 3CY3A 4RSSA 5M44A 3PVUA 5FEDA 4OBPA 3OW3A 3QRTA 3TNIA 3ORTA 3BE2A 3M2WA 1J7IA 2E9PA 3DXPA 3WARA 4ITIA 4ZTQA 4RMZA 3VUGA 4C35A 2X9FA 4C0TA 5ICPA 3FZRA 4KNBA 2WTJA 4U97A 4FR4A 4YLJA 3VO3A 1TKIA 2QKWB 4BCJA 3N4VA 3D15A 1OGYA 3I0OA 3DAEA 2OXYA 4DEGA 4DH7A 1DAWA 1PF8A 2ITYA 4PL5A 3DQXA 2VTTA 4GH2A 4E5BA 5CF6A 2BTSA 3HA6A 2C3KA 4G3DA 3MY0A 4AG8A 3F2RA 2XRUA 4GJ2A 4MXCA 4ANSA 1Q3WA 3EZRA 3NZ0A 4EH6A 3F3ZA 3DBQA 2QODA 2C6IA 4UWCA 4X0MA 2WQMA 5IUIA 4GKHA 2R3HA 4YZBA 2W5AA 3RP9A 5E8XA 2UW4A 3FBVA 5IF1A 3PJ3A 2QR8A 4KIOA 3NSZA 3R8LA 4QMQA 2C69A 4G6OA 5AUYA 4FTRA 3F2AA 3TKUA 3PDTA 2VTJA 4M12A 2BIKB 2YFXA 4ALVA 5G6VA 3DBDA 2BHEA 3ZXTA 4ZMEA 3AT3A 4CV8A 3UQCA 4F70A 2CGUA 1P14A 4J98A 4FMQA 2DQ7X 3CQUA 4IVAA 5GJDA 4AOJA 4M97A 2CNVA 4L8MA 2E9UA 3NNXA 3QX4A 3Q52A 4FNWA 4K6ZA 3PG3A 4YJUA 4B8LA 2HWPA 5E8SA 3SX9A 3OTUA 4E6CA 3O0GA 3C1XA 1YI4A 2W1HA 4CTCA 2F57A 1P2AA 2UZLA 4EONA 3BU6A 3POZA 5CI7A 3SD0A 3ZSHA 2J9MA 3R30A 5ANOA 3MFRA 2EB3A 3LZBA 4H3QA 1ZYCA 3W8QA 3EN4A 4F6UA 2FSOX 3NRMA 3JVRA 4FSMA 2WMTA 4CMUA 5GIPE 3IW7A 2HIWA 3C4CA 1OKZA 2QVSE 2R3KA 2VV9A 3PPKA 4W4XA 3VBXA 2PMOX 4IFCA 3K5UA 4Y5HA 4BZOA 2QOBA 4YU2A 3G0FA 5AUWA 2YWVA 5FP6A 4BDGA 3C4XA 1M7QA 2VGOA 4GT5A 4F64A 4J8MA 1R3CA 3IQ7A 4ZIMA 3R00A 4HGLA 3NS9A 2QURA 5BUEA 4FV8A 1Q8YA 3PXRA 3SGCA 5EYDA 3MH1A 1BUHA 1H0WA 4HYIA 5AIRA 3UG2A 3KULA 4CT2A 4C4FA 3R7VA 3NUYA 3NLBA 5JGAA 1QPJA 3D2IA 4X3FB 4TL0A 3AGMA 5AUUA 4PMMA 2C30A 5CYIA 3HV5A 4S2ZA 3UZTA 5HESA 3LFBA 2YA9A 3OUKA 4AGWA 3AMAA 2RFNA 4WOVA 2EU9A 1WVYA 4X7QA 4YHFA 3FLZA 2PVHA 3PXZA 3QUPA 4P7EA 5EI6A 3TIYA 2HZIA 1U54A 4BY9E 4NJ3A 5I4NA 3EHAA 1B39A 2O5KA 3OROA 3ZSIA 4BYIA 4Z7GA 2YDJA 1GIJA 5CQUA 3BRBA 2WQOA 5BVEA 5CI6A 4M69B 4BN1A 3NYXA 4P2KA 2C6TA 2RG6A 3JS2A 1M14A 4GSBA 4XG4A 3S00A 5EDQA 4PQNA 3F69A 4I41A 3RPSA 4BCPA 3A7JA 4FYNA 1H1RA 4GUBA 3GCPA 4C59A 2BCJA 2WIPA 4PV0A 4BBFA 1TVOA 3ETAA 3G6HA 5TF9A 4F7JA 4IAIA 4E1ZA 2X4FA 5H8EA 2X9EA 2BRGA 2A27A 3LMHA 3NEWA 4FEVA 3OEFX 4XS2A 5EQPA 3GNIB 5HQ0A 3G9LX 4FKIA 3OVVA 4EOJA 2YAAA 3Q4UA 3QQKA 1ST0A 4K2RA 3A8WA 3FI3A 3QL8A 4G2FA 3MFUA 5HVYA 3CD3A 3QU0A 2CGVA 2WPAA 1IG1A 4CQEA 5JGBA 2R3GA 2GQRA 3ZFXA 2XAOA 2BDFA 3GU6A 4FSZA 2XKEA 4H1JA 2GDOA 3O8PA 4LUDA 4L44A 4QMPA 4QTCA 2OZAA 5E9EA 3VS5A 3F2NA 2QU6A 1H1PA 3MVHA 4JBVA 4XG9A 2WMBA 2JEDA 1H07A 5FTGA 2R3RA 4IW0A 2HENA 4NTSA 3JPVA 1P4OA 2ZVAA 3KN6A 3ORLA 4YJTA 5I9XA 5KX8A 3O17A 5CENA 1XHAA 4IC7A 1G5SA 4H3BA 3ZO2A 2C6DA 3CTQA 2PZYA 3DGKA 3PSBA 5DT4A 3BGQA 1HOWA 3BCEA 3E92A 3VUIA 4A4OA 4D2RA 4KKGA 5HO8A 3D83A 1H1QA 2FSMX 4DN5A 3FMKA 3RK5A 5IMEA 4IC8A 2UUEA 4E4NA 1XH7A 5BUJA 3QCXA 1OI9A 4Y83A 4DTAA 2B9HA 2GS7A 2WMWA 4D2SA 5I9ZA 3AC1A 4E4LA 3UC3A 3UO5A 3HECA 3RAIA 4NWMA 1OIRA 3EFLA 5DVRA 2OF2A 3AMYA 3HZTA 1JSUA 5KHXA 4IWQA 2XB7A 3CJGA 4O6LA 4WG5A 2C6KA 3KFAA 3EYGA 2R3QA 2W1ZA 2X2LA 5IQEA 1OPJA 3EYHA 2CCHA 4I6FA 3I7CA 4QMMA 2GHLA 4W8EA 1V1KA 3GCVA 3QHWA 3Q53A 3LFDA 5EHYA 3RI1A 5JMSA 3IDCA 4TYIA 4O7NA 3UVRA 4AXCA 4UN0C 4YZNA 3VBTA 5HNGA 2UW0A 5DN3A 3VW6A 4O84A 5J7HA 4R78A 3VS7A 4NH1A 3KC3A 2QOIA 2B0QA 2NRUA 2PPQA 2VX0A 2I40A 4DITA 4QQCA 3GC0A 4C3FA 3DQWA 2W06A 4FKLA 3OY1A 5FUTA 4OLIA 2ITPA 2V22A 3HP2A 4TWNA 4YJOA 4HW7A 3R02A 3NAXA 3IECA 4IVCA 4N6ZA 3WF9A 3JR1A 3C5IA 4FT7A 3FAAA 3D7TA 3DOGA 3BL9A 3QA0A 5CVFA 4FV7A 2W96B 2Z02A 5AUTA 4EWQA 2OH0E 1SMHA 5JRSA 2UW5A 1WZYA 4YO4A 2JFLA 4UV0A 4Z3VA 4Z7HA 4O6EA 3O71A 4KKEA 4QMUA 3EMGA 4MD7E 3R21A 2B9IA 1PKGA 1BX6A 2O2UA 3O23A 4IADA 5E1EA 1H26A 4XP2A 3QZIA 2GPHA 4NL0A 3ALNA 2QOOA 4MWHA 3FI2A 3Q5IA 4MXZA 3ZUUA 1OM1A 4FBXA 2VTMA 4DFYA 4XOYA 4L46A 4CG9A 1Y91A 2PU8A 4DLIA 4UX9A 3C50A 4E8AA 4ALUA 2Y7JA 4BB4A 4U7ZA 4W4WA 4ZEGA 2ZJWA 5CEMA 3KULB 4II5A 2IVSA 4IMYA 1OIQA 1BL6A 3ZEPA 3DKOA 1S9IA 3RALA 4QQJA 2WU7A 2XMYA 5TT7A 4BDKA 3GI3A 5KMMA 1STCE 4IJPA 3FC2A 3OW4A 3OWKA 3QKLA 2A2AA 4YLKA 5F95A 3RHKA 2XK6A 3G51A 1YXTA 4QP8A 1Q5KA 1ZMUA 3MH0A 1U54B 3CXWA 4UY9A 3MGYA 4C02A 2RFEA 1DS5A 2FYSA 2CNQA 1YI6A 2GHMA 2XNPA 4I24A 1MRYA 5CF8A 2XAMA 4MCVA 4CMOA 3C7QA 3R0TA 3COKA 3P79A 4XBUA 2VX3A 3FY0A 3G0EA 3C4ZA 1REKA 3QTUA 1TQIA 4HGEA 5IDPA 5J9ZA 3KRRA 4D1XA 1K3AA 3ZRLA 4AGCA 1W83A 3BELA 5D11A 3R8PA 3W2RA 4AXAA 3EWHA 3TV6A 3TUBA 4PX6A 2F49A 4BKJA 1PMEA 2HXLA 4JG8A 2PHKA 4TXCA 3NNVA 4FUYA 4NKSA 3Q4CA 4FIHA 2XCKA 2ITQA 3RNYA 4ZSAA 2FO0A 4QPAA 2VGPA 4UEUA 4BIDA 1H00A 3NCZA 2Z7RA 4MVFA 4O0XA 5GHVA 4JRNA 3ZLXA 3PIYA 3ZRMA 4C3RA 4YBJA 2OZAB 4O2PA 3TACA 5FXSA 3DZQA 4BCKA 5HE2A 2X0GA 5AM7A 2R7IA 2YCRA 2QG7A 4IAAA 4O0UA 3VS1A 5HEZA 2G01A 2QOQA 2UZBA 3I81A 3NFGB 3RGFA 5CU4A 5A4QA 4WBBB 3TZ9A 5JT2A 3PLSA 1H08A 5DRBA 3LFFA 3V8WA 1FGKA 1GOLA 1YDTE 3BZ3A 5HE1A 2VRXA 4FNYA 2BHHA 4KB8A 4OTRA 3FPQA 4CV9A 4XLVA 1M17A 2QOCA 4DG0E 5IQFA 4AT3A 3L8PA 1X8BA 3MYGA 4YZCA 4I5CA 4L9IA 4E4MA 5LVNA 4FV5A 2YISA 4D5KA 1E1VA 3F9NA 1BYGA 3LFSA 4GYIA 4ZTMA 5LVMA 4HYSA 3K2LA 4GIHA 3PIXA 5JZNA 2OICA 4EZ5A 2C6OA 3SDJA 3OBJA 5AMNA 3VRZA 3NMUF 4YSJA 5KBQA 3PE2A 4FSWA 3H0YA 4GYGA 5EDRA 2ITXA 3NNUA 3W0PA 4F9CA 4CLJA 5KMJA 4FVRA 3TTJA 3FLNC 2ZMDA 4XOZA 3OFMA 2J51A 2JDRA 2UZWE 4YBKA 3GU5A 3MY1A 4GU9A 2UW8A 3I6UA 2GMXA 1YW2A 2X4ZA 1Y57A 4GU6A 3ZM9A 3VHEA 2XIYA 4CKIA 5DHJA 3ERKA 2XIKA 3G90X 5E8TA 4ARKA 4BHZA 1MQ4A 3BQRA 3LVPA 4TZRA 4MNFA 5EHOA 4FKWA 1G8AA 2BDWA 5EM8A 2WTIA 3RNIA 3UO6A 5JEBA 3EKKA 5FTOA 3NIZA 3LXPA 5L2TA 4B99A 5LOHA 2X2KA 1WFCA 3EL8A 3VS3A 5KMOA 1VLRA 1PYXA 4F09A 4O83A 2XALA 2XNMA 4DHJA 4EH2A 5KMLA 3CSVA 3FDNA 1H01A 1LEZA 1PW2A 4GFOA 3BYSA 5C1QB 1NW1A 3PPJA 5CANA 1UU9A 4FG7A 3F66A 3DKCA 3Q4TA 2YITA 4C37A 1OL5A 4FNZA 1Z5MA 3OD6X 3FHRA 2BZIB 4YC8A 4HYHA 3MJ1A 2OXXA 4RVTA 3A7HA 1Q41A 3MJ2A 4FSRA 4ZSJA 5CXZA 4BTKA 2C4GA 3PSDA 2VUWA 4ZY4A 3HP5A 2CLXA 5J5SA 1JKKA 3OWLA 4GFGA 1YOJA 2ZV7A 5D10A 4F4PA 5DGZA 4IH8A 4EOIA 3EQCA 2VWYA 3MPTA 4FT9A 4N0SA 5D41A 3FXWA 5H8GA 5A6OA 2XM9A 3WILA 4EHGA 4JAJA 4AGUA 3NFFB 3LJ2A 2Y4IC 4FTQA 4H36A 4BTFA 3FQEA 2XK9A 3CPBA 5BVNA 3PE1A 2J6MA 3WYYA 3CGOA 4IAFA 4UALA 2GFSA 3E5AA 4IAYA 4ZTHA 5EYKA 5IA1A 5BNJA 5E1SA 2WQNA 1GNGA 5EOBA 3LFNA 5HG5A 3QQHA 3OHTA 5FDXA 3UVQA 2ZOQA 2YDIA 3O2MA 3UIUA 5AFVA 3DAKA 2KULA 3R9OA 4IWDA 1OECA 4L00A 1OPKA 2UZTA 3U4UA 1TFFA 1YI3A 1XMLA 2IZRA 3T9TA 3QTWA 5A14A 1YRPA 3KEXA 4BTMA 5I9YA 5IH6A 4QMVA 3SC1A 3OCSA 3ZDIA 1OL2A 1PY5A 3E8CA 3GOKA 4IIRA 5AAFA 3PWYA 3FMNA 3T3UA 3L9LA 4RLLA 4L42A 5FD2A 5AX3A 1B38A 1OL6A 4H39A 5CVGA 2BMCA 3W0RA 2CKQA 2ZAZA 3ZFMA 2FH9A 4YJSA 4PTCA 5E92A 5ITAA 4JMQA 3QWJA 4XRJA 5CSXA 4HNIA 2JLDA 4X21A 4GK4A 3WF7A 2V7OA 4FZ6A 5KNJA 2HXQA 4GT4A 2PYWA 5LWNA 1ATPE 5KKRC 1HCLA 1BI8A 1HCKA 4U42A 4JDHA 4FT3A 2CCIA 2QCSA 2HY81 4AW2A 3B2TA 3ALOA 1XH9A 5LJJA 3S0OA 2WTDA 3P5JC 4J7BA 1H24A 2R0IA 4LOQA 4BHNA 4GRBA 5IA2A 5DG5A 5E90A 4AA0A 4RJ3A 5EK7A 3CEKA 2GNJA 3DJ5A 3T8OA 2X1NA 2PE1A 3HUBA 3QKMA 4J99A 4R77A 3RPVA 4RGJA 3PVGA 4FEXA 2B4SB 4CEGA 4QNAA 1I44A 4MUQA 2JAVA 3F5XA 4FEWA 5KMKA 3ANQA 5IQCA 4TW9A 5HG9A 4J52A 3QTQA 5IQDA 1OIUA 1U5RA 5CLPA 5HE3A 3BV3A 3GP0A 3ZFYA 1FINA 2FSLX 1YKRA 4IM3A 4KUJA 4FVQA 5FRIA 4MD9E 4AW5A 4DEDA 3BLAA 1KE6A 2GS6A 3TKHA 4C4EA 3Q9ZA 3HMNA 3ODYX 3UJGA 2XANA 3PFQA 3Q2MA 4OBOA 4RZVA 3FKNA 4APCA 4H05A 5AP5A 3FKLA 4FZ7A 3IO7A 4J1RA 4PRJA 4P90A 4E93A 4QYGA 4EOSA 4CZUA 4WHZA 2OIDA 4XP3A 4IJ9A 4QDEA 3V5LA 1YDSE 5HBEA 4F9WA 2X8EA 1H1SA 5HCXA 4R5YA 5E8ZA 1UU3A 4IAKA 3QALE 4O27B 4FV6A 2Q0BA 4V0GA 3HA8A 3MFSA 3OC1A 1YHWA 5M4UA 3UOJA 5F94A 3QCYA 1WVWA 3V04A 1ZOEA 3NYVA 5F1ZA 2QD9A 2FVDA 4G6LA 4IQ6A 1VZOA 3QTXA 2JIVA 4ACMA 4NM5A 3QUDA 4HCTA 3D0EA 3IG7A 3WZJA 4NK9A 4U0IA 3CE3A 4EKLA 3EN7A 3PRFA 1YQJA 4F7LA 4M15A 1OL1A 2QOHA 2R3OA 2OI4X 3WF8A 4KS7A 1ZOGA 5AV3A 3CGFA 4QQ5A 3BWJA 5I9WA 5EQEA 4BCFA 2WTWA 4IANA 4QYYA 4USFA 4PP7A 2XIRA 4AQKA 5CAUA 3K5VA 3VW8A 3H9OA 3ELJA 1KV1A 2FB8A 4FX3A 4ONAA 3LXLA 3MI9A 5ANKA 3Q9WA 4JIAA 2W4OA 4RWJA 5DYJA 3VUKA 4KS8A 5IDNA 2YZLA 2W05A 3JY9A 3O5AA 1R0EA 4ANQA 2WB8A 2ITZA 2G2FA 3VC4A 4LGGA 2VWZA 2PK9A 3PUPA 5FBOA 5LMAA 4BDHA 3KVXA 3COHA 5KMNA 3EQPA 4YJQA 1WBPA 2X81A 3H4JA 3L9NA 4FTUA 3UMWA 4EUTA 3DCVA 4AACA 2QLUA 5H3QA 3C4FA 5F9EA 3I6WA 4NFNA 1AD5A 5EDPA 3AG9A 3G6GA 4ZJJA 4DEBA 3R7IA 2PVYA 4Q2AA 1YHSA 1JAMA 4O21A 4RX7A 3VS6A 4EOOA 4ZLYA 2PVRA 4TYHB 2CKEA 3QF9A 2Y4PA 3EL7A 3O8UA 3QLGA 2RIOA 4BCNA 2Z2WA 5E8YA 4QMTA 3LQ3A 3DDQA 4YZ9A 3NUNA 4LL5A 4YPDA 3W16A 4FK6A 4BICA 4DDGA 3TUDA 1RQQA 4FKVA 5BPYA 4KRCA 4IX5A 4TT7A 4YC6A 4I3ZA 1URWA 2BR1A 5KUPA 3DXQA 1GZOA 4OT5A 2C1AA 1W0XC 2ITOA 3Q2JA 3KK9A 2GU8A 4FTOA 2QNJA 4FIIA 5B0XA 3SG8A 2QO7A 5DE2A 2BAQA 3SQQA 2HY0A 4NSTA 5AP2A 4C62A 1OUKA 2JITA 4O7SA 2BRHA 3E8NA 2UW7A 1P5EA 5CX9A 3LM5A 3ZC6A 3LMIA 1T46A 4G3CA 4CCBA 3LLAA 1V0PA 5HI2A 3UP7A 3MH3A 5AADA 5DR2A 2O64A 1YXXA 3R2YA 4RFYA 5DOSA 4CMTA 3A7GA 5JFWA 3R01A 3FSFA 4U45A 4EEVA 5JH6A 5T3QA 4GJ3A 1BI7A 2C47A 4G31A 3SXFA 4L43A 4AP7A 3DKFA 5JFXA 2P3GX 2BFYA 3C0GA 3TNWA 3R9NA 5DEYA 4MTAA 1JWHA 2J0MB 2QKRA 3KXGA 4MAOA 3RWQA 3F88A 4U41A 1YVJA 2IW6A 5GNKA 4F6SA 4R7IA 4W4YA 4ZSGA 4E6QA 4IVDA 1XQZA 2B55A 3B8QA 4F78A 4BC6A 2XIXA 5HD4A 3OT3A 1BKXA 2WMUA 3EQHA 1XH5A 4DEHA 1DM2A 4EYJA 4I0TA 4BDCA 4RWIA 4DA5A 2ZV2A 4KWPA 3E3BX 4JVGA 3L9PA 4FTKA 5A4CA 5EH0A 2B9FA 4NTTA 2IPXA 4RRVA 4BDJA 4KKHA 5CSWA 4B0GA 4LM5A 2X6EA 3BHYA 4QTBA 3TZMA 4RVKA 1CDKA 2QG5A 4AW1A 1PXKA 3BI6A 1PJKA 2GTMA 4WNMA 1ZY5A 5KZIA 5AUZA 2BALA 3VWAA 2XH5A 2AYPA 4R7BA 4YTCA 3BBWA 5J95A 2XJ2A 3LCDA 4NW6A 4CFVA 2G2HA 4LL0A 1XO2B 5K5NA 3KN5A 4GW8A 4YJVA 5H9BA 5FTQA 3VUHA 3C5UA 4FKGA 1QPEA 2PY3A 4DFZE 4U81A 2EB2A 5EQYA 2X7FA 5HLPA 1JKTA 3A7FA 5HLNA 5L8JA 4R7HA 2XVDA 3PXQA 4I22A 4V04A 4MQ1A 4YMJA 4V0GB 2W9ZB 4Y5QA 4ZLOA 3PJ8A 4JR3A 2CN8A 5DWRA 3N9XA 5AP0A 3QLFA 3FMEA 3UNJA 4B7TA 2GCDA 2YACA 1WCCA 4NM3A 3KCKA 2KTYA 3LXKA 1P4FA 3MFTA 2XNNA 3IW6A 5IMXA 2ZDUA 3CTJA 3BBTB 5M53A 2PSQA 3OS3A 1GZNA 2XKCA 4DGMA 1RDQE 2VWIA 4Z55A 4ZS0A 4FG8A 4RIWB 4AZSA 2OKRA 3UPXA 4ZTRA 1V0OA 2PL0A 4M13A 4XV2A 5A54A 2HK5A 4G9RA 3BHUA 4LOOA 4ZJVA 3TG1A 4EQMA 4NFMA 1LUFA 2W1IA 4ID7A 2CKPA 4M8TA 5E7RA 3CY2A 3MB6A 2O3PA 2UVZA 4AZVA 3BU3A 3QC4A 1PXLA 5AP3A 1OUYA 4MXYA 3OXZA 3SRVA 2VTSA 3R28A 5CF5A 3S95A 3VS4A 2XK7A 2WTKB 4GS6A 1H4LA 4QMNA 4AF3A 5M08A 2P55A 3DNEA 4JQEA 4OUCA 4Y72A 2OK1A 3KXZA 4Q9ZA 1Q8WA 3JYAA 4FSYA 2ZM4A 3L1SA 3N51A 4ITJA 4WSYA 3GU4A 3FYJX 5FEEA 1Q8TA 3OP5A 5EM6A 2YM7A 5IQBA 5HGIA 3FLQA 2OIBA 3FMHA 3I5ZA 5LQFA 1Q4LA 3FKOA 3R1SA 4EL9A 3ZSGA 2IW8A 3OTVA 4FV9A 4IZAA 4FZDB 5AV2A 4IB5A 4JBQA 2UW9A 1J1CA 5A4LA 3QD0A 3NAYA 4C61A 4LQMA 4XG3A 2DWBA 3FI4A 4UXQA 3IONA 3AKLA 4LDTA 5TKDA 4IEBA 5M4IA 3QD4A 3HV7A 5LVPA 2GNLA 4A9YA 4ASDA 2ONLA 2XNGA 2QQ7A 1FBNA 3AD4A 4O2ZA 2YDKA 3QKKA 4RBLA 1MUOA 3ROYA 2XNOA 4DCEA 4E73A 4EC9A 5EYCA 2E9OA 3U4WA 3U54A 2R3LA 2Y8OA 4AZTA 3O7LB 5DBXA 4QMWA 4OW8A 4JDJA 3NUPA 3AKKA 3KCFA 4LGHA 3VUDA 5L3AA 4APPA 3ZO3A 4UB7A 3FSKA 1TQPA 3RTPA 1SNXA 1CKIA 5CNOA 3UNZA 1UV5A 1A9UA 1DI9A 3E64A 2UW3A 2J0LA 3KF7A 5BVDA 3UOHA 5DH3A 5DT0A 1DAYA 3AQVA 4DGLC 1JSTA 1A48A 5FEQA 2IZUA 5J8IA 4FOCA 2HYYA 2ZM1A 4A7CA 2FA2A 2ITNA 3AT2A 3UBDA 5IUGA 2P0CA 5EKOA 3F5UA 3FMJA 4FT5A 1KV2A 4TWCA 1H1WA 4FGRA 4RVLA 4BDAA 4O38A 4DINA 5HIBA 4GUEA 3FUPA 3V5QA 4EKKA 2QU5A 3AXWA 3ET7A 3A2CA 3KXXA 4RX8A 3SKCA 3JUHA 3NX8A 3MBLA 4K18A 3DJ7A 3FYKX 4PL3A 3RWPA 5BUIA 2C3IB 4K0YA 1ZYLA 4U6RA 1WBVA 3EIDA 2BKKA 3I7BA 4FV2A 3TDWA 4MKCA 3EN5A 3KMUA 3LCOA 2I0YA 2Y6MA 3NW5A 4MHAA 5HHWA 3R7UA 3ZUTA 1SVEA 5HCZA 4DH8A 3BQCA 4YTHA 4RIOA 2ITVA 3FPMA 2UZUE 4RZWA 3PY3A 2IW9A 3HUCA 4YJPA 2ERKA 4JQ7A 3CLYA 2VTAA 5LCKA 2OJIA 4EJ7A 5CALA 5AM6A 2HZNA 2IZTA 2QI8A 3RINA 4JG7A 3LXNA 5B2LA 4JQ8A 1W98A 4QMXA 5DR6A 3BE9A 2ITTA 4Y73A 3EQDA 4LV8A 1WBSA 3QRUA 4DTBA 1UA2A 2IWIA 3BYUA 2UVXA 4IE9A 3ATTA 4I92A 2VTPA 5IZFA 4JXFA 4AUAA 3WYXA 3CQEA 1ZXEA 3Q60A 2VO7A 4O86A 4JJRA 4TNBA 3E63A 5AAEA 4IB1A 2BKZA 2B52A 3BEAA 3MDYA 1Y6AA 4RFMA 3WZKA 3GU8A 4EK6A 5HNIX 4FV4A 2WQBA 4YO6A 1OBGA 4XEYA 1PYEA 4AFJA 4WIHA 4EOKA 4FL1A 1NY3A 2YN8A 2PVJA 1KSWA 3HDMA 2XKFA 1SM2A 2C5XA 1U59A 3R71A 4J53A 2ZM3A 3FXXA 3KQ7A 2JKQA 4QEBA 2PUPA 4FTTA 4MXXA 1R78A 2WZJA 3QQLA 5IEVA 4RIYA 5KZ0A 4AT5A 4JDKA 4R6VA 5EHLA 3FI8A 4UWBA 4PDOA 5FG8A 2BIYA 4OTIA 4IZYA 3UYTA 4AXEA 2BILB 4FKOA 4F9AA 3OCGA 4P4CA 4A9UA 3HRBA 1PMNA 4BBMA 4JR7A 2PZ5A 4DGNA 2ZMCA 1KOAA 2OSCA 3LIJA 3W32A 3WE4A 4HPTE 2EVAA 4O22A 4NU1A 2B7AA 2WFYA 3RAWA 1XH8A 5JQ5A 1LR4A 1OKWA 2R3FA 4GKIA 3PP0A 5EOLA 3ACJA 3DK7A 3EJ1A 5ETAA 3RHXA 2WMVA 3OOGA 3ZM4A 4Y8DA 3D5UA 2W1CA 4NW5A 1O6LA 2V7AA 3Q9YA 1WMKA 3ZH8A 3VQHA 3H9FA 3UDBA 3R9HA 3QYZA 1FPUA 2X2MA 2R64A 3PY0A 4R3RA 3VF8A 4ACDA 3ENHA 3DBEA 3AGLA 3LJ0A 4RQVA 2GQGA 5HBJA 1GJOA 4XYFA 3D5VA 4BI2A 3R22A 5DFPA 5I0BA 1OB3A 3PUFC 3WBLA 5IH5A 2OXDA 2VO3A 5DRDA 2XCHA 1ZRZA 4AU8A 1VJYA 3PJ1A 4J8NA 1FVTA 3BYOA 5HX6A 4FC0A 1J7UA 3KY2A 2OFVA 2WIHA 1AQ1A 1U4DA 2XRWA 4P5ZA 5E8VA 5FLFA 3ZC5A 2CLQA 3R7EA 4XV3A 4TN6A 2XARA 2YJSA 3V5PA 2CDZA 2JFMA 3A7IA 4RFZA 2IVVA 3UMXA 5JZJA 2OO8X 2VWVA 2XA4A 4K77A 3I4BA 3LHJA 5CU2A 4QP1A 4CLIA 1E1XA 2H96A 2B9JA 5IU2A 3BIZA 1BLXA 5CWZA 3FY2A 3GOPA 5BVOA 4HOKA 2ZV8A 5AX9A 4RWKA 2PVLA 2PWLA 3KF4A 4DT8A 4FV3A 4Y46A 3VUMA 3FQSA 3TEIA 3V6SA 4GT3A 2WHBA 1SVHA 3KK8A 1G8JA 5HU3A 3KREA 5AUVA 3OT8A 1KE8A 3FXZA 3DFAA 3KU2A 3F7WA 3PVWA 3OCTA 4O0SA 4CZTA 5KBRA 5LVOA 2J5FA 1Q99A 3EQBA 3UQFA 3A61A 3VONA 4HCUA 1JQHA 2CGXA 1XMMA 4PY1A 3OG7A 3ZBFA 4BCMA 4WNKA 4YP8A 4ACHA 4OGRA 3UQGA 3Q04A 3W0QA 2RGPA 5HD7A 5CASA 4DEIA 1MRVA 3V5JA 2ETRA 4RC4A 4HVIA 2I7QA 4NYEA 1FMKA 2YHVA 3C51A 3CQWA 4G3GA 2VX1A 2A1AB 2YIWA 3KIOC 4KAOA 5A9UA 5K5XA 3JXWA 1U46A 3UP2A 4YJRA 4EHVA 3BKBA 4CNHA 3DXNA 4C4IA 4EBWA 4XG6A 1OKVA 1NVQA 2VZ6A 3CJFA 3OWJA 1ND4A 2XEYA 4HGTA 4QMZA 4EJNA 1YOMA 5J1VA 2BDJA 4JG6A 5BVWA 3MPMA 3QD2B 2BTRA 1ZWSA 3CPCA 3FMLA 3P23A 4DE4A 4JRVA 1O6YA 2YM3A 2Z7QA 3DNDA 3REPA 3NVKI 5J87A 3HV3A 2WNTA 4QPSA 3BV2A 3GCSA 3EFJA 4JBPA 4XH6A 3P7AA 1NA7A 2YCQA 3LOKA 4YZDA 5K9IA 4CFMA 3D4QA 4BCGA 4D0XA 2R7BA 3COIA 5K4IA 4O91A 2DYLA 4N57A 5BYZA 3QZHA 1JOWB 4E4XA 4YR8A 4TY1A 1JNKA 3MTFA 3SV0A 4AZWA 3D7TB 4DFLA 4ORKA 4IWPA 1W7HA 3HMMA 4EK3A 1KWPA 5JSMA 5C8KA 2BZHB 4FTMA 3U55A 4BRXA 3TL8A 3UOKA 5EW9A 3U6JA 4PMSA 4FSNA 3GQLA 3NVMB 1OGUA 4YNOA 4EI4A 3POOA 1FVRA 4I0SA 4O7WA 3TJCA 5TO8A 2XZSA 3OOMA 4FIGA 3UDSA 2YIRA 4AXDA 3E62A 3D94A 4C3PA 4N4SA 2ZDTA 4RIYB 2VTNA 4RX5A 3UZRA 4MBIA 4FKJA 1M7NA 3EOCA 4QYHA 2ZV9A 4K1BA 4O7LA 3R8UA 3AC5A 4R1YA 2JIUA 3GUBA 3WI6A 2UZVA 2R3IA 3ML1A 5EG3A 4EUUA 3LMGA 5CZHA 3DPKA 5GIOE 4YJNA 1GIHA 2VN9A 1UKIA 4G5PA 4H3PA 4KIQA 1KE7A 4XRLA 2Z7LA 4D4VA 2OWBA 2XM8A 4LRJA 4FT0A 3W2QA 3V3VA 3DS6A 4MD8E 5AV1A 4RC3A 4HZRA 5L8KA 2PULA 4A4LA 4IZ5A 3EKNA 5ANDA 2BAKA 3P08A 4I1ZA 3GEQA 1RW8A 4ZY5A 4V01A 2WQEA 3KRJA 4PDPA 1PXJA 1BL7A 1IEPA 1PRYA 4IM2A 3ACKA 2J4ZA 4DAWA 3C0HA 4EOQA 4IFGA 4AN2A 4O96A 2PMLX 2G9XA 3K54A 3E93A 3PA5A 4E6DA 1VEBA 3QRJA 3NW6A 4AAYA 3HKOA 5D1JA 2HW7A 4EH8A 1UU7A 1REJA 3GU7A 2NRYA 4D4RA 4PNKA 2ESMA 4MBJA 4XP0A 2HELA 3W0OA 2PVMA 3B8RA 4HVHA 2E2BA 4C2VA 4K8AA 2G2IA 2VWBA 1JKLA 4JNWA 3ZS5A 3P7CA 2I6LA 2V62A 1LEWA 2PVNA 5J9LA 4QYEA 1PXPA 4GFMA 4I5HA 4D1SA 1J3HA 3DTCA 1PXMA 5KO1A 1XH4A 4QMOA 4IX4A 4D9UA 4H58A 5M56A 4RG0A 3HX4A 4FTCA 4D28A 4CVAA 3DK3A 3BYVA 4KSPA 4O7TA 4FTAA 5FXQA 4AOTA 4DH5A 3Q6UA 1O6KA 3GC9A 3VVHA 5T6KA 1JKSA 4FTNA 1LPUA 4M67A 5AP1A 3RVGA 4BIEA 4X2JA 5ANEA 4S32A 3DTWA 2VD5A 3BPRA 3JY0A 1Y8GA 5EW8A 5ACBC 3RKBA 3TNHA 5FXRA 4LOPA 5EI8A 5CSVA 5C9CA 3UC4A 3EN9A 3QAME 4HVGA 4TNDA 4NJDA 5M4FA 3SVVA 3ZMMA 4BGGA 4DGGA 5D7AA 5CAOA 3BLQA 3S2PA 2R0UA 1CSNA 4ZS4A 5ETFA 1XBCA 5FDPA 3H30A 4XCUA 3O50A 1KE9A 3HRCA 4K11A 2WU6A 2C5YA 2ZYBA 4W8DA 4USDA 3PWDA 4U43A 5FM3A 5LVLA 4YPSA 2WTCA 1OBDA 4QP9A 4X3JA 5JK3A 4RJ7A 3R1QA 5HTCA 1WBTA 3F82A 3Q6WA 2J0KA 2O0UA 2WMQA 3KMWA 4I21A 4J96A 3SHEA 3UZPA 4F0GA 5CU0A 2PMNX 2OJGA 4YSMA 4CFFA 4F65A 5B2MA 4DBNA 3M11A 4QYFA 4B4LA 5IEXA 2JIIA 5HIDA 1GZKA 4CFNA 2J5EA 2WKMA 3ZDUA 3GC8A 2V0DA 4JOAA 3BEGA 5IQAA 3G2FA 2VO6A 3TI1A 3UIMA 4EOPA 5M4CA 3JVSA 5CSHA 5DLSA 3MA6A 4YNEA 3RCJA 2WGJA 2ITUA 3D7ZA 4AN3A 3A62A 3W8LA 3PG1A 1R1WA 3GENA 4UYAA 4WKQA 1R39A 2F7ZE 3AC4A 5TR6A 3U8WA 5CEKA 3QXOA 1OITA 2RFDA 4P5QA 1IR3A 2LGCA 4ZXTA 4AOIA 3AD6A 2ACXA 4ZZMA 4BDFA 3SW7A 4ZK5A 4FIEA 4RA5A 3WIGA 2WELA 1ZOHA 2C5NA 3W33A 1G8SA 3LLTA 2FUMA 5AP7A 2XNBA 4EH5A 2VTHA 4IBMA 3BGPA 3UODA 5H8BA 1Q8ZA 3NYOA 5HBHA 3R8ZA 3IK3A 4MYGA 3NNWA 1ZMWA 5C4LA 1ST4A 5BYLA 3ORZA 2SRCA 4M68A 5HICA 1Q8UA 5BV3A 2UZNA 4GG7A 3IW5A 3EZVA 1GAGA 2ETKA 3GCQA 3LFQA 4BI0A 5HLWA 3IW4A 4BTJA 1UNHA 2WOUA 2YIQA 4U9AA 4GMYA 4K9YA 1UNLA 4EQUA 2W1GA 5JFVA 3I60A 4B6LA 5LXMA 3LPBA 4YGAA 4D9TA 2HWOA 3OEZA 4PF4A 4XG2A 3WE8A 3MTLA 4KRDA 4AWIA 3R04A 2F4JA 4ACCA 4F9BA 1O9UA 4L7SA 4RVMA 4FSTA 5ETIA 3W2CA 1F3MC 4NCTC 5DI1A 3TMOA 3L8VA 4ZP5A 3ZEWA 4YUQA 3KMMA 4LG4A 4JL9A 3CTHA 3UOLA 3R8MA 5E8UA 4TYGA 2OW3A 5DIAA 1Q62A 2FSTX 1WVXA 3A4OX 2XK3A 3FLWA 4RX9A 4D55A 4DYMA 4EH4A 2QOLA 3BHVA 4AGDA 5AV4A 5IA4A 4YC3A 4QP7A 5LMKC 3D5XA 3MVLA 2JBOA 4YHTA 1IA9A 1PXNA 2YERA 4MNEA 5E91A 1K9AA 4O82A 3R7OA 2PZIA 2B1PA 4GVJA 3TV7A 5KMIA 4ANMA 5CY3A 2YAKA 3TIZA 2I1MA 5LWMA 4X2NA 5CNNA 3ZZEA 4ANLA 4EZ7A 2WTKC 3H3CA 2BRMA 2NPQA 2EWAA 5GINE 3AC3A 2WD1A 3I0QA 3LW0A 3NUAA 4M14A 3TYKA 4KINA 4YTIA 5GJGA 5HTBA 4GK2A 4X3FC 2FGIA 4CRSA 1RJBA 3KRWA 2I0EA 3QTIA 4LFIA 3CCNA 3KKVA 5D9HA 2BRBA 4FZFB 2YIXA 3QUEA 2IN6A 5CAVA 2YABA 4O7YA 3VS2A 3UE4A 3SXSA 4XG8A 1PMUA 2Y0AA 5FQDC 5KKRB 1ZARA 1YOLA 5HE0A 3TZ8A 3KGAA 2A19B 2VO0A 3HL7A 2C0TA 3LQ8A 4L52A 1URCA 5EM7A 5ACKA 5J9YA 5ETCA 3IDPA 5C03A 3V8TA 2HCKA 4FZAB 2C1BA 2VTOA 1NXKA 3NUXA 4IZ7A 5HCYA 2F7EE 3TJDA 1H0VA 3P78A 3P0MA 3QQGA 4KIPA 4I93A 3DK6A 4RQKA 1IRKA 4DFXE 2Q83A 3KB7A 4AE9A 1PXOA 3VBVA 4DH1A 3HV4A 3UIBA 3PTGA 3II5A 1QPCA 4E26A 2X8DA 3R7YA 2BUJA 4BCQA 1OMWA 1NT2A 3ZYAA 3GXLA 3MVJA 5H2UA 2XBJA 1I09A 1ZY4A 3N4UA 5DA3A 3ZRKA 3G9NA 4ACGA 3UNKA 4F0FA 2OBJA 3KRLA 3OBGA 5F4NA 2PUNA 4HVSA 4IVBA 3KL8A 1W8CA 2GNHA 3BYMA 4CSVA 1IAHA 4OTWA 3BWFA 2BROA 3F3WA 1Z9XA 3VBYA 2NYAA 4N6YA 3EB0A 5L6OA 5L8LA 5IEYA 4IB0A 4R3CA 4ENYA 2AUHA 2I0HA 2R2PA 2CSNA 4C34A 2YEXA 5ANGA 4IWOA 4FSQA 3VIDA 4XLIA 4TWPA 3UYSA 2XYNA 3NUUA 1FMOE 2WTVA 2XEZA 3E8EA 3QZGA 4RA4A 1UU8A 1WBOA 4U8ZA 3LCTA 3E7VA 4D1ZA 4EQCA 4EK4A 2J50A 3FMDA 5L2WA 4G16A 4TTHB 4XV9A 5JQ8A 3WZDA 1Q3DA 1Q97A 1WBNA 2JDOA 4FGBA 4S31A 4EHZA 4ZMFA 4A9RA 3NW7A 4F9YA 5DEWA 4UZHA 4BJJA 3MWUA 2OFUA 3ZUVA 2OJFE 4BYJA 2QO9A 3P9JA 3PVBA 2NP8A 4ZLZA 4LYNA 3UTOA 4PUZA 2JDVA 2PUUA 5CZIA 3HNGA 2XF0A 1E9HA 2WEVA 1Q61A 4UWYA 4GCJA 5T68A 2G15A 2AC5A 4MK0A 5FP5A 4F1TA 2HAKA 2J0JA 2O8YA 4NKAA 5C4KA 3ZU7A 3HLLA 3DA6A 2OLCA 3EFKA 4NM0A 5HO7A 4DTKA 4NT4A 2VTLA 3F5GA 2R3JA 1XR1A 3IW8A 3QQFA 2GHGA 3C9WA 3KRXA 2JKOA 4PP9A 2RF9A 2ERZE 3TN8A 4DG3E 3SA0A 4BZDA 1J1BA 4PDYA 3MB7A 2XJ0A 4GV1A 3PZHA 3SAYA 2WMAA 3MPAA 2QLQA 4O7VA 2R5TA 2GNGA 5A6NA 4JBOA 3TT0A 4C4HA 4XUFA 4ZZNA 3MW1A 3R1NA 3GFEA 1Q24A 4QDVA 3O7LD 4NM7A 3FEGA 4F1OA 4HYUA 2Y9QA 5HX8A 3IS5A 4CG8A 5JRQA 4BDBA 2LAVA 4XNEA 4MNEB 1GIIA 1NVSA 5CVHA 3DAJA 2EXCX 2C5OA 4ZSEA 1Z57A 2OZOA 3K3IA 4N70A 4R5SA 3FV8A 1YDRE 5CEQA 2OJ9A 4BIBA 2UW6A 4J97A 3QGYA 2XJ1A 4FKSA 1L3RE 4QP4A 3KXMA 2C5VA 3EN6A 1YWRA 5M55A 3TKIA 4EORA 2JAMA 1XH6A 3LFAA 1ZZ2A 5KHWA 1CM8A 3IDBA 3E3PA 1MQBA 3M1SA 1OVEA 4ASZA 2BPMA 2GNIA 3AKJA 4ZOGA 3ZHPC 4XV1A 1XBBA 4WNOA 4FL2A 5EYMA 4A4XA 5LMBA 2YJRA 3MSSA 3NIEA 4FTIA 3R63A 4YHJA 4DHIB 4EH7A 3VBWA 3W2PA 3PZEA 3MH2A 3Q3BA 3PXKA 4I20A 3MESA 1M2PA 2CPKE 3FQHA 4HCVA 4RT7A 2BFXA 3O51A 4BCOA 5EI2A 3CR0A 3LFCA 4KBAA 4QT1A 3CIKA 3THBA 3E7OA 2UZOA 5LARA 5M07A 1LP4A 2XYUA 2ONLC 4C38A 5HVJA 3UDZA 2CGWA 5CU6A 2VTIA 2DUVA 4O7RA 4U80A 5CU3A 5E8WA 3R83A 4BVUA 2WOTA 2XBAA 4ENXA 4PMPA 1OIYA 4D4YA 4ERKA 1V0BA 3EQRA 4DFNA 1BMKA 4IX6A 3KXHA 3IGGA 3LAUA 5IA0A 3IKAA 3QRKA 4KABA 4QQTA 3EFWA 3FE3A 3IOPA 3GBZA 5CT7A 4LMNA 3T9IA 4QNYA 2W99B 3D9VA 4WRSA 2PE2A 1Y6BA 3HMIA 4EOMA 2YZAA 4UYNA 1JPAA 1ZYDA 2XS0A 3CP9A 3I79A 4QP3A 3ZLWA 3R9DA 5AA8A 2WEIA 4S33A 5IA5A 1VR2A 1FVVA 3FLSA 4YLLA 4JIKA 4U40A 5C01A 5TOZA 4F99A 4WG4A 4FA2A 2OJJA 4F6WA 4O0TA 4PTEA 4A07A 1MRUA 3U9NA 4D5HA 4WO5A 3P4KA 3NUSA 4O7ZA 4MH7A 2GQSA 3F3VA 4JI9A 5LCJA 2C6LA 2F2CB 3PA4A 4ALWA 1QL6A 3MVMA 5CEIA 3ORNA 3VAPA 4AFEA 4NIFB 4AQCA 4DFBA 4FUXA 2Z60A 4BI1A 4A06A 4Q9SA 4S34A 5DR9A 3FZSA 2QHMA 2X8IA 2GTNA 3DFCB 1PKDA 2WXVA 4RJ4A 3WOWA 1WAKA 3U6HA 4CKRA 2CMWA 4XBRA 5D12A 2CJMA 3CKXA 4BJJB 4C4JA 4QMLA 2PUIA 1F5QA 5HG7A 4MEDA 4I5PA 4C33A 4I6QA 4NZWB 3TM0A 3DBFA 4GEOA 5EKNA 3H0ZA 2WMSA 4I5MA 2VU3A 4M0ZA 3QTZA 5HU9A 5K4JA 4C4GA 2WAJA 3QRIA 4ERWA 4OBQA 2Y6OA 4AN9A 3ULIA 3ORMA 3LFEA 4IB3A 4C2WA 2EUFB 3AC2A 4X2GA 4DF3A 3SRVB 2J7TA 4D4SA 2W17A 2V5QA 3TTIA 1OKYA 5I9VA 1GZ8A 3D14A 2H6DA 2W1DA 2ZFYA 4I23A 2YIYA 1XKKA 5DT3A 2A0CX 3RJCA 2ZB0A 5DNRA 4EH9A 5CAQA 3F6XA 4AT4A 4C58A 4U44A 3W0SA 5JN2A 4EOLA 4IDTA 3U6IA 4FTJA 3DV3A 2X6DA 3W55A 3W10A 4CGAA 3DKGA 4CT1A 2RL5A 4DT9A 4EHEA 3PIZA 3SW4A 4CFUA 3GFWA 4GVAA 5IH4A 4D0WA 4BDIA 1UVRA 4HPUE 2W5HA 3TV4A 2J0IA 4HJOA 1ZYJA 4IAZA 3HYHA 4I4FA 3ZCLA 5HVKA 3R6XA 3T3VA 3MIAA 4TYEA 3PXFA 2B53A 4RJ5A 4O0RA 3P5KA 4JDIA 4O0VA 5HNBA 3UIXA 5HORA 4F7NA 4WBOA 4L53A 3RCDA 2X7GA 4FG9A 5CTPA 4FE2A 3HV6A 3S4QA 1ZMVA 4PWNA 3A99A 4EH3A 3LCKA 4QOXA 3TDVA 4U5JA 1YXSA 3ZO1A 4AZFA 2QHNA 5F20A 5CEOA 4G3EA 4BR3A 3S1HA 2I0VA 3NR9A 4PL4A 3OCBA 5BYYA 3SXRA 2P2HA 2ITWA 4DH3A 5KCVA 2XP2A 1SYKA 4CRLA 3OMVA 4KA3A 3V51A 5LMKA 3DY7A 2ZB1A 3QYWA 3IGOA 5ANIA 5AUXA 3UO4A 1W82A 3P86A 2YCFA 3ZLYA 2RFSA 3MS9A 4MWIA 3QGWA 4F08A 2VWUA 1FQ1B 4EZ3A 3BX5A 4MX9A 4QP6A 4G6NA 2VNYA 5IQHA 3AD5A 4R1VA 2QOFA 4WUAA 2JDTA 2C3LA 3V01A 4E5WA 3D5WA 3LQ5A 4A9TA 3OF0A 4MF1A 4IDVA 1FOTA 1XBAA 3FZTA 1M52A 3DJ6A 4QMYA 3W18A 3RPYA 4PDSA 1PMVA 3AT4A 3CD8A 4FJVA 3OXTA 4QMSA 3TUCA 4EK8A 4OT6A 4AA4A 1W84A 3P7BA 4FODA 3F3UA 3RAKA 2CHLA 3TXOA 2OF4A 3VF9A 3UGCA 5HIEA 5IISA 2VTQA 3F5PA 3R1YA 4I6HA 3PFYA 3PY1A 5M09A 1FGIA 3WZUA 1UNGA 5IPJA 4RC2A 3HAMA 5FGKA 3QWKA 2P2IA 4EWHA 5AEPA 3PXYA 5AV0A 3Q96A 5A4TA 4WNPA 4XG7A 4TYJA 4DCAA 4CXAA 2R3PA 1H27A 2OU7A 3ROCA 2F2UA 4WUNA 4PMTA 3V5WA 3WIKA 3BL7A 3HEGA 1J7LA 3DBCA 1AGWA 3EQFA 4OTDA 2VNWA 2IG7A 2PE0A 2WMRA 1KUTA 4KD1A 5J1WA 1XWSA 2C6EA 1YHVA 2C0OA 3FZOA 1G3NA 3G15A 4TPTA 5B7VA 5HZNA 2PZRA 2WO6A 2JKMA 4RIXA 2A4LA 4BBEA 4PTGA 2EXMA 4FL3A 4AX8A 2QONA 2J90A 4XMOA 5AP6A 1UWJA 4ASEA 3R8VA 3VBQA 2JBPA 1UKHA 4UZDA 2QC6A 4B8MA 3BGZA 4LMUA 1IAJA 1DI8A 1H25A 4L6QA 3P1AA 3ZOSA 4JT3A 2W7XA 3PP1A 4WG3A 3DU8A 1ZAOA 4ZAUA 3GGFA 5M06A 4FSUA 2R3NA 4FKQA 1TQMA 5L6WL 4HZSA 2E9NA 1NVRA 4FK3A 3NPCA 3VRYA 3RMFA 4F1MA 4Q5HA 2UZDA 3MV5A 1IASA 3W1FA 3TNPC 2ETMA 4ZZOA 4IACA 4L45A 4O0WA 1J91A 4L67A 3CS9A 5EM5A 2C0IA 3CKWA 3ID6C 3ODZX 4GL9A 3A4PA 2GS2A 4UBAA 4QTAA 2RG5A 5D7VA 3ANRA 2HOGA 2GFCA 4U79A 4M7IA 4F0IA 3W2OA 2VWWA 3L8XA 1CTPE 2NO3A 4C36A 5FBNC 3NYNA 5KE0A 3LJ1A 1MP8A 2VTRA 2W1FA 4I4EA 4AW0A 3EQIA 2V55A 5BVFA 5AJQA 5M57A 3ENMA 4LI5A 5K3YA 5HKMA 2X7OA 2HZ0A 4RPVA 4OTQA 3DLZA 5M51A 5AP4A 3V6RA 2YWPA 3FJQE 2B54A 4FKTA 5AAGA 4LUEA 3B2WA 2JGZA 1H28A 3UPZA 3L8SA 2VAGA 4FKRA 1QMZA 1WBWA 3KVWA 2O65A 4FKPA 4G34A 5BMMA 2JD5A 4C7TA 5L2SA 5CAPA 2YM5A 2OG8A 5HG8A 3RPRA 3QA8A 1G8KA 4G17A 2UVYA 3UG1A 5C27A 3HAVA 3Q32A 2CKOA 4IHPA 5I5ZA 4K33A 5JFSA 2YCSA 4MQ2A 4MXAA 3RK7A 4DDIA 3DDPA 5C26A 5DPVA 4FYOA 1IA8A 3V5TA 4FTLA 3FL4A 3UVPA 2REIA 3E88A 4BZNA 4DHZA 3M42A 1YXVA 3C4WA 3H9RA 2CN5A 4X2FA 3MIYA 4AA5A 4TKSA 1GY3A 1S9JA 1ZYSA 4H1MA 3TWJA 3QTRA 5CS6A 3IPHA 2F7XE 1B6CB 4JAIA 3VS0A 4FIFA 2HZ4A 2GNFA 2H8HA 4DHFA 4L3LA 2PTKA 4IX3A 3R73A 4I6LA 4RWLA 3PYYA 3OXIA 4S30A 3PRIA 3GQIA 3DB8A 4FEQA 2YM8A 2W4KA 4TYHA 4DBXA 3AOXA 3RZBA 3QCSA 3CBLA 4AE6A 1SVGA 1Y8YA 1OPLA 3QX2A 4GG5A 2Q0NA 4EK5A 2PMIA 1F0QA 3WF6A 5IQIA 4EYMA 2OH4A 4J95A 3E8DA 3VN9A 4G9CA 4GK3A 4BGHA 3VULA 4FV1A 4O81A 3I5NA 3QFVA 1VYWA 2RKUA 1A06A 2W5BA 3OY3A 5BX0A 3QXPA 2HW6A 4V05A 4QTDA 4CFXA 3LCSA 3DLSA 4D58A 3NDMA 4WRGA 4ZSLA 5A4EA 2YM6A 4E5AX 2IVUA 1ZZLA 4GIIA 5IA3A 3DT1A 3RM6A 3OUNB 3Q4ZA 5A46A 3QCQA 3C0IA 5L6PA 3HMOA 3O8TA 4DLJA 2AEGA 3BLHA 3DZOA 3OWPA 4HNFA 4QRCA 4FOBA 3HVCA 3WZEA 3U87A 3VJOA 5ANJA 4BGQA 4DFUA 3LE6A 3VQUA 3QD3A 1R0PA 2PVKA 3BLRA 2BVAA 4JX3A 4JS8A 3H10A 4EC8A 4FICA 4X6QC 1T45A 2C68A 2JKKA 4UXLA 1H8FA 2XKDA 4W4VA 5EFQA 2IO6A 5B2KA 3WF5A 2BZJA 3ORXA 1RE8A 4ASXA 3ORIA 3ZXZA 2VWXA 3QZFA 4BCHA 3FZPA 3D2KA 3ZTXA 3Q5ZA 4I6BA 2X39A 4QTEA 4QP2A 4FEUA 2XUUA 3E87A 3EH9A 3I1AA 4RIXB 4KSQA 3NCGA 4MXOA 3R9RA 4DC2A 4MBLA 4Y95A 1EH4A 4BF2A 2C3JA 3FWQA 3HRFA 4U3ZA 5AWMA 4CKJA 5JGDA 3RAHA 3BHHA 3CC6A 3ZZWA 4IM0A 3C4EA 5CQWA 3PSCA 5IUHA 4HGSA 4XHKB 3U9CA 3QTSA 4A9SA 4FV0A 4TRLA 1JSVA 2OIQA 3QQJA 3L9MA
chains in the Genus database with same CATH topology
2W0JA 2BAJA 3BHTA 2Z8CA 4L68A 1CMKE 4LRMA 3FLYA 2Z7SA 3PA3A 5G1XA 5C8MA 3UDTA 3GVUA 5EW3A 3HDNA 2R3MA 4L3PA 3AMBA 4YTFA 4EBVA 1KE5A 4ITHA 1CKPA 2J2IB 1YXUA 3V8SA 1JBPE 1M2QA 4PNIA 4M84A 4Y85A 3ZBXA 2P33A 3ITZA 1QPDA 1XJDA 2UZEA 4E7WA 3VJNA 4L3JA 5CEPA 1OZ1A 2AC3A 4G3FA 2IVTA 1PXIA 4OTHA 4NCTA 1KOBA 3W0MA 4E20A 4JLCA 2OGVA 4G5JA 4CCUA 2XIZA 3F3TA 4F63A 2H34A 2XK8A 3COMA 4LV5A 3DB6A 4ZTNA 4M3QA 3MA3A 4WT6A 1APME 3GT8A 3HMPA 1K2PA 4RIWA 5GJFA 3A8XA 3QQUA 4OR5A 5IG1A 2Y4IB 3SG9A 3NWWA 1M2RA 4FVPA 3KA0A 2R4BA 4BDEA 3LM0A 3PPZA 3K3JA 3FC1X 3Q9XA 4XX9A 3ULZA 3KXNA 2QO2A 3W0NA 4X6RA 4CD0A 1SZMA 2P4IA 2W4JA 3EQGA 3F7ZA 3ZO4A 5BVKA 2UV2A 3A60A 4ANBA 4DEEA 4L01A 3TZ7A 4NUSA 5CXHA 4AAAA 4AZEA 3PJCA 4KBCA 4XJ0A 3HGKA 4M0YA 3O96A 1UWHA 4AS0A 1QCFA 4FIJA 4KBKA 4ZTSA 3MY5A 1ERKA 2NNWB 4YURA 5AA9A 3ZLSA 3R2BA 2XNEA 2IZSA 3W2SA 3RM7A 4F7SA 4X3FA 4OTFA 2W1EA 3C13A 2F9GA 1OL7A 4RJ8A 2XK4A 1SNUA 2YM4A 3LKMA 4WA9A 2W9FB 5E4HA 5C8NA 4FI1A 2CNUA 1U5QA 4YZMA 1CKJA 2PVFA 3F61A 3RK9A 3N4TA 4BCIA 4CFWA 4E6AA 5BMSA 5IQGA 5JKGA 4LRKA 4J71A 3G5DA 3TNQB 3QC9A 3GC7A 3MN3A 4I0RA 4WD5A 4BDDA 4DGOA 2BRNA 4X2KA 3ATSA 2G1TA 3FL5A 3OZ6A 4DG2E 5CSPA 3PLAE 5FM2A 3QBNA 3G33A 2E9VA 3IOKA 3FZ1A 5BQ0A 1JVPP 4I94A 4RJ6A 2JC6A 2O63A 4U3YA 3RPOA 5AIKA 4LV7A 3FHIA 4TWOA 1L8TA 1ZLTA 4ZTLA 2WMXA 3AC8A 3QHRA 4FNXA 4R3PA 3SOAA 4CTBA 3TCPA 3FMMA 1YWVA 1JLUE 3GB2A 2IJMA 4G1WA 5I9UA 3VNTA 1PHKA 5L2IA 1VYZA 2H9VA 3PJ2A 2QR7A 3ORPA 3VHKA 2BZKB 2DS1A 3U51A 2JDSA 4QO9A 3NGAA 5CT0A 2C6MA 4RLKA 2R9SA 3GCUA 4AXFA 2QOKA 4USEA 4Z9LA 5A3XA 4Q5EA 3SOCA 4Z16A 4OTGA 2PZPA 4ZY6A 1YWNA 4HVDA 3BU5A 4ZJIA 4B9DA 3SLSA 3ORKA 4JX7A 4O0YA 5CF4A 4DEAA 2GSFA 4FKUA 3S3IA 3ZONA 4L7FA 3CY3A 4RSSA 5M44A 3PVUA 5FEDA 4OBPA 3OW3A 3QRTA 3TNIA 3ORTA 3BE2A 3M2WA 1J7IA 2E9PA 3DXPA 3WARA 4ITIA 4ZTQA 4RMZA 3VUGA 4C35A 2X9FA 4C0TA 5ICPA 3FZRA 4KNBA 2WTJA 4U97A 4FR4A 4YLJA 3VO3A 1TKIA 2QKWB 4BCJA 3N4VA 3D15A 1OGYA 3I0OA 3DAEA 2OXYA 4DEGA 4DH7A 1DAWA 1PF8A 2ITYA 4PL5A 3DQXA 2VTTA 4GH2A 4E5BA 5CF6A 2BTSA 3HA6A 2C3KA 4G3DA 3MY0A 4AG8A 3F2RA 2XRUA 4GJ2A 4MXCA 4ANSA 1Q3WA 3EZRA 3NZ0A 4EH6A 3F3ZA 3DBQA 2QODA 2C6IA 4UWCA 4X0MA 2WQMA 5IUIA 4GKHA 2R3HA 4YZBA 2W5AA 3RP9A 5E8XA 2UW4A 3FBVA 5IF1A 3PJ3A 2QR8A 4KIOA 3NSZA 3R8LA 4QMQA 2C69A 4G6OA 5AUYA 4FTRA 3F2AA 3TKUA 3PDTA 2VTJA 4M12A 2BIKB 2YFXA 4ALVA 5G6VA 3DBDA 2BHEA 3ZXTA 4ZMEA 3AT3A 4CV8A 3UQCA 4F70A 2CGUA 1P14A 4J98A 4FMQA 2DQ7X 3CQUA 4IVAA 5GJDA 4AOJA 4M97A 2CNVA 4L8MA 2E9UA 3NNXA 3QX4A 3Q52A 4FNWA 4K6ZA 3PG3A 4YJUA 4B8LA 2HWPA 5E8SA 3SX9A 3OTUA 4E6CA 3O0GA 3C1XA 1YI4A 2W1HA 4CTCA 2F57A 1P2AA 2UZLA 4EONA 3BU6A 3POZA 5CI7A 3SD0A 3ZSHA 2J9MA 3R30A 5ANOA 3MFRA 2EB3A 3LZBA 4H3QA 1ZYCA 3W8QA 3EN4A 4F6UA 2FSOX 3NRMA 3JVRA 4FSMA 2WMTA 4CMUA 5GIPE 3IW7A 2HIWA 3C4CA 1OKZA 2QVSE 2R3KA 2VV9A 3PPKA 4W4XA 3VBXA 2PMOX 4IFCA 3K5UA 4Y5HA 4BZOA 2QOBA 4YU2A 3G0FA 5AUWA 2YWVA 5FP6A 4BDGA 3C4XA 1M7QA 2VGOA 4GT5A 4F64A 4J8MA 1R3CA 3IQ7A 4ZIMA 3R00A 4HGLA 3NS9A 2QURA 5BUEA 4FV8A 1Q8YA 3PXRA 3SGCA 5EYDA 3MH1A 1BUHA 1H0WA 4HYIA 5AIRA 3UG2A 3KULA 4CT2A 4C4FA 3R7VA 3NUYA 3NLBA 5JGAA 1QPJA 3D2IA 4X3FB 4TL0A 3AGMA 5AUUA 4PMMA 2C30A 5CYIA 3HV5A 4S2ZA 3UZTA 5HESA 3LFBA 2YA9A 3OUKA 4AGWA 3AMAA 2RFNA 4WOVA 2EU9A 1WVYA 4X7QA 4YHFA 3FLZA 2PVHA 3PXZA 3QUPA 4P7EA 5EI6A 3TIYA 2HZIA 1U54A 4BY9E 4NJ3A 5I4NA 3EHAA 1B39A 2O5KA 3OROA 3ZSIA 4BYIA 4Z7GA 2YDJA 1GIJA 5CQUA 3BRBA 2WQOA 5BVEA 5CI6A 4M69B 4BN1A 3NYXA 4P2KA 2C6TA 2RG6A 3JS2A 1M14A 4GSBA 4XG4A 3S00A 5EDQA 4PQNA 3F69A 4I41A 3RPSA 4BCPA 3A7JA 4FYNA 1H1RA 4GUBA 3GCPA 4C59A 2BCJA 2WIPA 4PV0A 4BBFA 1TVOA 3ETAA 3G6HA 5TF9A 4F7JA 4IAIA 4E1ZA 2X4FA 5H8EA 2X9EA 2BRGA 2A27A 3LMHA 3NEWA 4FEVA 3OEFX 4XS2A 5EQPA 3GNIB 5HQ0A 3G9LX 4FKIA 3OVVA 4EOJA 2YAAA 3Q4UA 3QQKA 1ST0A 4K2RA 3A8WA 3FI3A 3QL8A 4G2FA 3MFUA 5HVYA 3CD3A 3QU0A 2CGVA 2WPAA 1IG1A 4CQEA 5JGBA 2R3GA 2GQRA 3ZFXA 2XAOA 2BDFA 3GU6A 4FSZA 2XKEA 4H1JA 2GDOA 3O8PA 4LUDA 4L44A 4QMPA 4QTCA 2OZAA 5E9EA 3VS5A 3F2NA 2QU6A 1H1PA 3MVHA 4JBVA 4XG9A 2WMBA 2JEDA 1H07A 5FTGA 2R3RA 4IW0A 2HENA 4NTSA 3JPVA 1P4OA 2ZVAA 3KN6A 3ORLA 4YJTA 5I9XA 5KX8A 3O17A 5CENA 1XHAA 4IC7A 1G5SA 4H3BA 3ZO2A 2C6DA 3CTQA 2PZYA 3DGKA 3PSBA 5DT4A 3BGQA 1HOWA 3BCEA 3E92A 3VUIA 4A4OA 4D2RA 4KKGA 5HO8A 3D83A 1H1QA 2FSMX 4DN5A 3FMKA 3RK5A 5IMEA 4IC8A 2UUEA 4E4NA 1XH7A 5BUJA 3QCXA 1OI9A 4Y83A 4DTAA 2B9HA 2GS7A 2WMWA 4D2SA 5I9ZA 3AC1A 4E4LA 3UC3A 3UO5A 3HECA 3RAIA 4NWMA 1OIRA 3EFLA 5DVRA 2OF2A 3AMYA 3HZTA 1JSUA 5KHXA 4IWQA 2XB7A 3CJGA 4O6LA 4WG5A 2C6KA 3KFAA 3EYGA 2R3QA 2W1ZA 2X2LA 5IQEA 1OPJA 3EYHA 2CCHA 4I6FA 3I7CA 4QMMA 2GHLA 4W8EA 1V1KA 3GCVA 3QHWA 3Q53A 3LFDA 5EHYA 3RI1A 5JMSA 3IDCA 4TYIA 4O7NA 3UVRA 4AXCA 4UN0C 4YZNA 3VBTA 5HNGA 2UW0A 5DN3A 3VW6A 4O84A 5J7HA 4R78A 3VS7A 4NH1A 3KC3A 2QOIA 2B0QA 2NRUA 2PPQA 2VX0A 2I40A 4DITA 4QQCA 3GC0A 4C3FA 3DQWA 2W06A 4FKLA 3OY1A 5FUTA 4OLIA 2ITPA 2V22A 3HP2A 4TWNA 4YJOA 4HW7A 3R02A 3NAXA 3IECA 4IVCA 4N6ZA 3WF9A 3JR1A 3C5IA 4FT7A 3FAAA 3D7TA 3DOGA 3BL9A 3QA0A 5CVFA 4FV7A 2W96B 2Z02A 5AUTA 4EWQA 2OH0E 1SMHA 5JRSA 2UW5A 1WZYA 4YO4A 2JFLA 4UV0A 4Z3VA 4Z7HA 4O6EA 3O71A 4KKEA 4QMUA 3EMGA 4MD7E 3R21A 2B9IA 1PKGA 1BX6A 2O2UA 3O23A 4IADA 5E1EA 1H26A 4XP2A 3QZIA 2GPHA 4NL0A 3ALNA 2QOOA 4MWHA 3FI2A 3Q5IA 4MXZA 3ZUUA 1OM1A 4FBXA 2VTMA 4DFYA 4XOYA 4L46A 4CG9A 1Y91A 2PU8A 4DLIA 4UX9A 3C50A 4E8AA 4ALUA 2Y7JA 4BB4A 4U7ZA 4W4WA 4ZEGA 2ZJWA 5CEMA 3KULB 4II5A 2IVSA 4IMYA 1OIQA 1BL6A 3ZEPA 3DKOA 1S9IA 3RALA 4QQJA 2WU7A 2XMYA 5TT7A 4BDKA 3GI3A 5KMMA 1STCE 4IJPA 3FC2A 3OW4A 3OWKA 3QKLA 2A2AA 4YLKA 5F95A 3RHKA 2XK6A 3G51A 1YXTA 4QP8A 1Q5KA 1ZMUA 3MH0A 1U54B 3CXWA 4UY9A 3MGYA 4C02A 2RFEA 1DS5A 2FYSA 2CNQA 1YI6A 2GHMA 2XNPA 4I24A 1MRYA 5CF8A 2XAMA 4MCVA 4CMOA 3C7QA 3R0TA 3COKA 3P79A 4XBUA 2VX3A 3FY0A 3G0EA 3C4ZA 1REKA 3QTUA 1TQIA 4HGEA 5IDPA 5J9ZA 3KRRA 4D1XA 1K3AA 3ZRLA 4AGCA 1W83A 3BELA 5D11A 3R8PA 3W2RA 4AXAA 3EWHA 3TV6A 3TUBA 4PX6A 2F49A 4BKJA 1PMEA 2HXLA 4JG8A 2PHKA 4TXCA 3NNVA 4FUYA 4NKSA 3Q4CA 4FIHA 2XCKA 2ITQA 3RNYA 4ZSAA 2FO0A 4QPAA 2VGPA 4UEUA 4BIDA 1H00A 3NCZA 2Z7RA 4MVFA 4O0XA 5GHVA 4JRNA 3ZLXA 3PIYA 3ZRMA 4C3RA 4YBJA 2OZAB 4O2PA 3TACA 5FXSA 3DZQA 4BCKA 5HE2A 2X0GA 5AM7A 2R7IA 2YCRA 2QG7A 4IAAA 4O0UA 3VS1A 5HEZA 2G01A 2QOQA 2UZBA 3I81A 3NFGB 3RGFA 5CU4A 5A4QA 4WBBB 3TZ9A 5JT2A 3PLSA 1H08A 5DRBA 3LFFA 3V8WA 1FGKA 1GOLA 1YDTE 3BZ3A 5HE1A 2VRXA 4FNYA 2BHHA 4KB8A 4OTRA 3FPQA 4CV9A 4XLVA 1M17A 2QOCA 4DG0E 5IQFA 4AT3A 3L8PA 1X8BA 3MYGA 4YZCA 4I5CA 4L9IA 4E4MA 5LVNA 4FV5A 2YISA 4D5KA 1E1VA 3F9NA 1BYGA 3LFSA 4GYIA 4ZTMA 5LVMA 4HYSA 3K2LA 4GIHA 3PIXA 5JZNA 2OICA 4EZ5A 2C6OA 3SDJA 3OBJA 5AMNA 3VRZA 3NMUF 4YSJA 5KBQA 3PE2A 4FSWA 3H0YA 4GYGA 5EDRA 2ITXA 3NNUA 3W0PA 4F9CA 4CLJA 5KMJA 4FVRA 3TTJA 3FLNC 2ZMDA 4XOZA 3OFMA 2J51A 2JDRA 2UZWE 4YBKA 3GU5A 3MY1A 4GU9A 2UW8A 3I6UA 2GMXA 1YW2A 2X4ZA 1Y57A 4GU6A 3ZM9A 3VHEA 2XIYA 4CKIA 5DHJA 3ERKA 2XIKA 3G90X 5E8TA 4ARKA 4BHZA 1MQ4A 3BQRA 3LVPA 4TZRA 4MNFA 5EHOA 4FKWA 1G8AA 2BDWA 5EM8A 2WTIA 3RNIA 3UO6A 5JEBA 3EKKA 5FTOA 3NIZA 3LXPA 5L2TA 4B99A 5LOHA 2X2KA 1WFCA 3EL8A 3VS3A 5KMOA 1VLRA 1PYXA 4F09A 4O83A 2XALA 2XNMA 4DHJA 4EH2A 5KMLA 3CSVA 3FDNA 1H01A 1LEZA 1PW2A 4GFOA 3BYSA 5C1QB 1NW1A 3PPJA 5CANA 1UU9A 4FG7A 3F66A 3DKCA 3Q4TA 2YITA 4C37A 1OL5A 4FNZA 1Z5MA 3OD6X 3FHRA 2BZIB 4YC8A 4HYHA 3MJ1A 2OXXA 4RVTA 3A7HA 1Q41A 3MJ2A 4FSRA 4ZSJA 5CXZA 4BTKA 2C4GA 3PSDA 2VUWA 4ZY4A 3HP5A 2CLXA 5J5SA 1JKKA 3OWLA 4GFGA 1YOJA 2ZV7A 5D10A 4F4PA 5DGZA 4IH8A 4EOIA 3EQCA 2VWYA 3MPTA 4FT9A 4N0SA 5D41A 3FXWA 5H8GA 5A6OA 2XM9A 3WILA 4EHGA 4JAJA 4AGUA 3NFFB 3LJ2A 2Y4IC 4FTQA 4H36A 4BTFA 3FQEA 2XK9A 3CPBA 5BVNA 3PE1A 2J6MA 3WYYA 3CGOA 4IAFA 4UALA 2GFSA 3E5AA 4IAYA 4ZTHA 5EYKA 5IA1A 5BNJA 5E1SA 2WQNA 1GNGA 5EOBA 3LFNA 5HG5A 3QQHA 3OHTA 5FDXA 3UVQA 2ZOQA 2YDIA 3O2MA 3UIUA 5AFVA 3DAKA 2KULA 3R9OA 4IWDA 1OECA 4L00A 1OPKA 2UZTA 3U4UA 1TFFA 1YI3A 1XMLA 2IZRA 3T9TA 3QTWA 5A14A 1YRPA 3KEXA 4BTMA 5I9YA 5IH6A 4QMVA 3SC1A 3OCSA 3ZDIA 1OL2A 1PY5A 3E8CA 3GOKA 4IIRA 5AAFA 3PWYA 3FMNA 3T3UA 3L9LA 4RLLA 4L42A 5FD2A 5AX3A 1B38A 1OL6A 4H39A 5CVGA 2BMCA 3W0RA 2CKQA 2ZAZA 3ZFMA 2FH9A 4YJSA 4PTCA 5E92A 5ITAA 4JMQA 3QWJA 4XRJA 5CSXA 4HNIA 2JLDA 4X21A 4GK4A 3WF7A 2V7OA 4FZ6A 5KNJA 2HXQA 4GT4A 2PYWA 5LWNA 1ATPE 5KKRC 1HCLA 1BI8A 1HCKA 4U42A 4JDHA 4FT3A 2CCIA 2QCSA 2HY81 4AW2A 3B2TA 3ALOA 1XH9A 5LJJA 3S0OA 2WTDA 3P5JC 4J7BA 1H24A 2R0IA 4LOQA 4BHNA 4GRBA 5IA2A 5DG5A 5E90A 4AA0A 4RJ3A 5EK7A 3CEKA 2GNJA 3DJ5A 3T8OA 2X1NA 2PE1A 3HUBA 3QKMA 4J99A 4R77A 3RPVA 4RGJA 3PVGA 4FEXA 2B4SB 4CEGA 4QNAA 1I44A 4MUQA 2JAVA 3F5XA 4FEWA 5KMKA 3ANQA 5IQCA 4TW9A 5HG9A 4J52A 3QTQA 5IQDA 1OIUA 1U5RA 5CLPA 5HE3A 3BV3A 3GP0A 3ZFYA 1FINA 2FSLX 1YKRA 4IM3A 4KUJA 4FVQA 5FRIA 4MD9E 4AW5A 4DEDA 3BLAA 1KE6A 2GS6A 3TKHA 4C4EA 3Q9ZA 3HMNA 3ODYX 3UJGA 2XANA 3PFQA 3Q2MA 4OBOA 4RZVA 3FKNA 4APCA 4H05A 5AP5A 3FKLA 4FZ7A 3IO7A 4J1RA 4PRJA 4P90A 4E93A 4QYGA 4EOSA 4CZUA 4WHZA 2OIDA 4XP3A 4IJ9A 4QDEA 3V5LA 1YDSE 5HBEA 4F9WA 2X8EA 1H1SA 5HCXA 4R5YA 5E8ZA 1UU3A 4IAKA 3QALE 4O27B 4FV6A 2Q0BA 4V0GA 3HA8A 3MFSA 3OC1A 1YHWA 5M4UA 3UOJA 5F94A 3QCYA 1WVWA 3V04A 1ZOEA 3NYVA 5F1ZA 2QD9A 2FVDA 4G6LA 4IQ6A 1VZOA 3QTXA 2JIVA 4ACMA 4NM5A 3QUDA 4HCTA 3D0EA 3IG7A 3WZJA 4NK9A 4U0IA 3CE3A 4EKLA 3EN7A 3PRFA 1YQJA 4F7LA 4M15A 1OL1A 2QOHA 2R3OA 2OI4X 3WF8A 4KS7A 1ZOGA 5AV3A 3CGFA 4QQ5A 3BWJA 5I9WA 5EQEA 4BCFA 2WTWA 4IANA 4QYYA 4USFA 4PP7A 2XIRA 4AQKA 5CAUA 3K5VA 3VW8A 3H9OA 3ELJA 1KV1A 2FB8A 4FX3A 4ONAA 3LXLA 3MI9A 5ANKA 3Q9WA 4JIAA 2W4OA 4RWJA 5DYJA 3VUKA 4KS8A 5IDNA 2YZLA 2W05A 3JY9A 3O5AA 1R0EA 4ANQA 2WB8A 2ITZA 2G2FA 3VC4A 4LGGA 2VWZA 2PK9A 3PUPA 5FBOA 5LMAA 4BDHA 3KVXA 3COHA 5KMNA 3EQPA 4YJQA 1WBPA 2X81A 3H4JA 3L9NA 4FTUA 3UMWA 4EUTA 3DCVA 4AACA 2QLUA 5H3QA 3C4FA 5F9EA 3I6WA 4NFNA 1AD5A 5EDPA 3AG9A 3G6GA 4ZJJA 4DEBA 3R7IA 2PVYA 4Q2AA 1YHSA 1JAMA 4O21A 4RX7A 3VS6A 4EOOA 4ZLYA 2PVRA 4TYHB 2CKEA 3QF9A 2Y4PA 3EL7A 3O8UA 3QLGA 2RIOA 4BCNA 2Z2WA 5E8YA 4QMTA 3LQ3A 3DDQA 4YZ9A 3NUNA 4LL5A 4YPDA 3W16A 4FK6A 4BICA 4DDGA 3TUDA 1RQQA 4FKVA 5BPYA 4KRCA 4IX5A 4TT7A 4YC6A 4I3ZA 1URWA 2BR1A 5KUPA 3DXQA 1GZOA 4OT5A 2C1AA 1W0XC 2ITOA 3Q2JA 3KK9A 2GU8A 4FTOA 2QNJA 4FIIA 5B0XA 3SG8A 2QO7A 5DE2A 2BAQA 3SQQA 2HY0A 4NSTA 5AP2A 4C62A 1OUKA 2JITA 4O7SA 2BRHA 3E8NA 2UW7A 1P5EA 5CX9A 3LM5A 3ZC6A 3LMIA 1T46A 4G3CA 4CCBA 3LLAA 1V0PA 5HI2A 3UP7A 3MH3A 5AADA 5DR2A 2O64A 1YXXA 3R2YA 4RFYA 5DOSA 4CMTA 3A7GA 5JFWA 3R01A 3FSFA 4U45A 4EEVA 5JH6A 5T3QA 4GJ3A 1BI7A 2C47A 4G31A 3SXFA 4L43A 4AP7A 3DKFA 5JFXA 2P3GX 2BFYA 3C0GA 3TNWA 3R9NA 5DEYA 4MTAA 1JWHA 2J0MB 2QKRA 3KXGA 4MAOA 3RWQA 3F88A 4U41A 1YVJA 2IW6A 5GNKA 4F6SA 4R7IA 4W4YA 4ZSGA 4E6QA 4IVDA 1XQZA 2B55A 3B8QA 4F78A 4BC6A 2XIXA 5HD4A 3OT3A 1BKXA 2WMUA 3EQHA 1XH5A 4DEHA 1DM2A 4EYJA 4I0TA 4BDCA 4RWIA 4DA5A 2ZV2A 4KWPA 3E3BX 4JVGA 3L9PA 4FTKA 5A4CA 5EH0A 2B9FA 4NTTA 2IPXA 4RRVA 4BDJA 4KKHA 5CSWA 4B0GA 4LM5A 2X6EA 3BHYA 4QTBA 3TZMA 4RVKA 1CDKA 2QG5A 4AW1A 1PXKA 3BI6A 1PJKA 2GTMA 4WNMA 1ZY5A 5KZIA 5AUZA 2BALA 3VWAA 2XH5A 2AYPA 4R7BA 4YTCA 3BBWA 5J95A 2XJ2A 3LCDA 4NW6A 4CFVA 2G2HA 4LL0A 1XO2B 5K5NA 3KN5A 4GW8A 4YJVA 5H9BA 5FTQA 3VUHA 3C5UA 4FKGA 1QPEA 2PY3A 4DFZE 4U81A 2EB2A 5EQYA 2X7FA 5HLPA 1JKTA 3A7FA 5HLNA 5L8JA 4R7HA 2XVDA 3PXQA 4I22A 4V04A 4MQ1A 4YMJA 4V0GB 2W9ZB 4Y5QA 4ZLOA 3PJ8A 4JR3A 2CN8A 5DWRA 3N9XA 5AP0A 3QLFA 3FMEA 3UNJA 4B7TA 2GCDA 2YACA 1WCCA 4NM3A 3KCKA 2KTYA 3LXKA 1P4FA 3MFTA 2XNNA 3IW6A 5IMXA 2ZDUA 3CTJA 3BBTB 5M53A 2PSQA 3OS3A 1GZNA 2XKCA 4DGMA 1RDQE 2VWIA 4Z55A 4ZS0A 4FG8A 4RIWB 4AZSA 2OKRA 3UPXA 4ZTRA 1V0OA 2PL0A 4M13A 4XV2A 5A54A 2HK5A 4G9RA 3BHUA 4LOOA 4ZJVA 3TG1A 4EQMA 4NFMA 1LUFA 2W1IA 4ID7A 2CKPA 4M8TA 5E7RA 3CY2A 3MB6A 2O3PA 2UVZA 4AZVA 3BU3A 3QC4A 1PXLA 5AP3A 1OUYA 4MXYA 3OXZA 3SRVA 2VTSA 3R28A 5CF5A 3S95A 3VS4A 2XK7A 2WTKB 4GS6A 1H4LA 4QMNA 4AF3A 5M08A 2P55A 3DNEA 4JQEA 4OUCA 4Y72A 2OK1A 3KXZA 4Q9ZA 1Q8WA 3JYAA 4FSYA 2ZM4A 3L1SA 3N51A 4ITJA 4WSYA 3GU4A 3FYJX 5FEEA 1Q8TA 3OP5A 5EM6A 2YM7A 5IQBA 5HGIA 3FLQA 2OIBA 3FMHA 3I5ZA 5LQFA 1Q4LA 3FKOA 3R1SA 4EL9A 3ZSGA 2IW8A 3OTVA 4FV9A 4IZAA 4FZDB 5AV2A 4IB5A 4JBQA 2UW9A 1J1CA 5A4LA 3QD0A 3NAYA 4C61A 4LQMA 4XG3A 2DWBA 3FI4A 4UXQA 3IONA 3AKLA 4LDTA 5TKDA 4IEBA 5M4IA 3QD4A 3HV7A 5LVPA 2GNLA 4A9YA 4ASDA 2ONLA 2XNGA 2QQ7A 1FBNA 3AD4A 4O2ZA 2YDKA 3QKKA 4RBLA 1MUOA 3ROYA 2XNOA 4DCEA 4E73A 4EC9A 5EYCA 2E9OA 3U4WA 3U54A 2R3LA 2Y8OA 4AZTA 3O7LB 5DBXA 4QMWA 4OW8A 4JDJA 3NUPA 3AKKA 3KCFA 4LGHA 3VUDA 5L3AA 4APPA 3ZO3A 4UB7A 3FSKA 1TQPA 3RTPA 1SNXA 1CKIA 5CNOA 3UNZA 1UV5A 1A9UA 1DI9A 3E64A 2UW3A 2J0LA 3KF7A 5BVDA 3UOHA 5DH3A 5DT0A 1DAYA 3AQVA 4DGLC 1JSTA 1A48A 5FEQA 2IZUA 5J8IA 4FOCA 2HYYA 2ZM1A 4A7CA 2FA2A 2ITNA 3AT2A 3UBDA 5IUGA 2P0CA 5EKOA 3F5UA 3FMJA 4FT5A 1KV2A 4TWCA 1H1WA 4FGRA 4RVLA 4BDAA 4O38A 4DINA 5HIBA 4GUEA 3FUPA 3V5QA 4EKKA 2QU5A 3AXWA 3ET7A 3A2CA 3KXXA 4RX8A 3SKCA 3JUHA 3NX8A 3MBLA 4K18A 3DJ7A 3FYKX 4PL3A 3RWPA 5BUIA 2C3IB 4K0YA 1ZYLA 4U6RA 1WBVA 3EIDA 2BKKA 3I7BA 4FV2A 3TDWA 4MKCA 3EN5A 3KMUA 3LCOA 2I0YA 2Y6MA 3NW5A 4MHAA 5HHWA 3R7UA 3ZUTA 1SVEA 5HCZA 4DH8A 3BQCA 4YTHA 4RIOA 2ITVA 3FPMA 2UZUE 4RZWA 3PY3A 2IW9A 3HUCA 4YJPA 2ERKA 4JQ7A 3CLYA 2VTAA 5LCKA 2OJIA 4EJ7A 5CALA 5AM6A 2HZNA 2IZTA 2QI8A 3RINA 4JG7A 3LXNA 5B2LA 4JQ8A 1W98A 4QMXA 5DR6A 3BE9A 2ITTA 4Y73A 3EQDA 4LV8A 1WBSA 3QRUA 4DTBA 1UA2A 2IWIA 3BYUA 2UVXA 4IE9A 3ATTA 4I92A 2VTPA 5IZFA 4JXFA 4AUAA 3WYXA 3CQEA 1ZXEA 3Q60A 2VO7A 4O86A 4JJRA 4TNBA 3E63A 5AAEA 4IB1A 2BKZA 2B52A 3BEAA 3MDYA 1Y6AA 4RFMA 3WZKA 3GU8A 4EK6A 5HNIX 4FV4A 2WQBA 4YO6A 1OBGA 4XEYA 1PYEA 4AFJA 4WIHA 4EOKA 4FL1A 1NY3A 2YN8A 2PVJA 1KSWA 3HDMA 2XKFA 1SM2A 2C5XA 1U59A 3R71A 4J53A