2XAOA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase from a. thaliana in complex with ip5
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
404
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICKEELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase is a Distant Ipk Member with a Singular Inositide Binding Site for Axial 2-Oh Recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 128
structure length 404
sequence length 435
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xaoA01
2XANA 4AXDA 4AXCA 2XALA 3UDTA 2XAMA 4LV7A 3UDZA 2XAOA 4AXEA 4AQKA 4AXFA 2XARA 3UDSA
chains in the Genus database with same CATH superfamily
3NIZA 2ZB1A 3NWWA 2O64A 2Z7RA 5HG7A 3T3VA 4MTAA 3KXHA 4C59A 3UIBA 2CLXA 4AW0A 4D9TA 2XK7A 5D9HA 1PXJA 5C8MA 4HCTA 4ZSLA 2VTOA 5C27A 3OTUA 2QKWB 1P4OA 5I9ZA 4KUJA 4YJQA 4DC2A 3DBEA 1DI9A 4MHAA 3R8MA 1UNGA 3G9LX 4PMTA 4UYNA 2YA9A 3IG7A 3N9XA 4Y46A 3SG8A 4FZAB 5AM7A 3OP5A 1OPLA 2H9VA 5E1SA 2QHNA 2CLQA 1WBOA 4I5CA 3R1YA 4U3YA 3BKBA 4IM0A 4PQNA 3FY2A 3BHTA 2GFCA 4G6LA 2IG7A 4QDVA 2W5BA 4EK8A 1W8CA 3AC5A 3OCSA 2QU5A 4HYSA 3ORNA 3H0YA 3BGPA 3A60A 2FB8A 2X81A 4PF4A 4O38A 5IQAA 4ERKA 2I40A 1IA8A 3QLGA 3UPXA 3VS1A 2XYNA 2JLDA 3PA4A 1Q8UA 3MA3A 1XQZA 2UZLA 1KE5A 3II5A 4O2PA 2HYYA 3Q5IA 4NUSA 4D9UA 2XAOA 3HNGA 3OS3A 2FGIA 3A4OX 4GFMA 2ETKA 4BF2A 4BHZA 4YURA 1R0PA 4O7YA 4S31A 3ZO2A 1Q99A 3TXOA 2QOQA 2BHEA 5A4EA 4L52A 4JS8A 5EW8A 1VR2A 2WTJA 4B8MA 4BDHA 4FSMA 1URWA 4I0SA 2XK3A 4LQMA 3UZPA 3WARA 4XLVA 3E64A 5JFXA 4LL0A 5BVWA 3TIYA 4FUXA 1JLUE 3RNYA 5JH6A 3KRJA 4FV7A 3FI3A 3MV5A 4EQCA 1IRKA 3IGOA 4RIOA 4TNDA 2YZAA 2BFYA 4AW5A 3C0HA 4DFBA 1ZRZA 2X8DA 3GVUA 4I4EA 5AV4A 5HGIA 5I9YA 3DKOA 4CRSA 4FE2A 4TY1A 4D58A 1PXNA 5AIRA 4ZY6A 4C35A 2IZUA 3F3VA 5EI8A 3HUBA 5HE3A 4FNWA 5AJQA 2PHKA 4ZTHA 1Y91A 5EDPA 3PP0A 1G8KA 4NK9A 3EFWA 5KKRC 5AV0A 5BVEA 4IDVA 4W4WA 2BALA 4I22A 4Q9ZA 5C9CA 4X2JA 4L42A 3HZTA 1CM8A 4X3FA 3DZOA 1O6KA 3MIAA 4E4XA 2QC6A 4FSUA 3VO3A 4QTBA 5M53A 4KKHA 5ANKA 2XH5A 3W2CA 4ANBA 1UA2A 3GU4A 1M52A 4F9WA 1ZXEA 2XUUA 3NFGB 4NTTA 1CMKE 3BIZA 3V5TA 3NYOA 4G9CA 4R7HA 3UMWA 4MYGA 4R3PA 2W1DA 3TNQB 4A9SA 5CYIA 5FQDC 1OL1A 4HGEA 5L8JA 3ZLSA 5LMKA 3TKUA 3I0OA 3W0RA 4R3CA 3MFUA 2OICA 3D2IA 3SVVA 2PU8A 1YXVA 3EQIA 4R1VA 2B7AA 3W1FA 4IQ6A 3M11A 4FSQA 3IO7A 4K33A 3W0QA 1H4LA 4XRLA 4C3RA 5JSMA 3SA0A 3PRFA 2WQBA 3E7VA 4FV4A 3P4KA 3TN8A 1Q3DA 4ASXA 1B6CB 2B55A 4TZRA 4YTFA 3E8EA 3I5ZA 1SVEA 3L9LA 3PJ3A 1H01A 5BUEA 3DBDA 4YNEA 4GYIA 3EN6A 4C4JA 2CGXA 1NT2A 1M7NA 2ITTA 3MTLA 4NM0A 4FSYA 5IA4A 2OZOA 1P5EA 3DDPA 5BPYA 4USFA 2ITXA 4ZLOA 1F3MC 3BHYA 2YIRA 4GUBA 4KKGA 2ETMA 4AP7A 3ERKA 4QP1A 5JZJA 2VTLA 2J90A 4FKQA 4FV2A 4JG7A 5FTGA 5HU9A 1Y8YA 4DFYA 3PA3A 1R78A 3DY7A 3P9JA 5FD2A 5DT3A 3PLSA 4YJPA 2IWIA 4M3QA 2HIWA 5M4FA 4LOQA 2RF9A 1URCA 4P5ZA 4AX8A 3W8QA 4ACHA 3PSBA 4ANMA 5L3AA 1Q8WA 4FKPA 2H34A 3ZOSA 2OG8A 2Z2WA 3GQIA 4FNYA 2QNJA 3EB0A 2XA4A 3KN6A 3NX8A 3AKJA 1Q8ZA 4HGLA 4OTQA 5DT4A 4DE4A 4ZXTA 4QYEA 3ZS5A 2C3IB 2R3GA 4FNZA 2JIUA 1LR4A 5LVMA 4I3ZA 3HV5A 3KA0A 1G3NA 4AG8A 4O81A 4YJUA 3ZYAA 2CKOA 2CCIA 4FSTA 4HNFA 4CD0A 2BRMA 1QCFA 3L9PA 3LE6A 4HW7A 2B4SB 2GNJA 1PMNA 4FICA 3FXZA 3BYSA 3UIUA 3SXRA 2C4GA 2EWAA 1PHKA 3ODZX 4GK2A 1DI8A 4UWBA 4ZSEA 5AAGA 2NYAA 4F08A 5KMLA 3AG9A 3JUHA 5K4IA 1PMVA 4D4VA 3LFEA 5EDRA 2RFSA 3QTWA 3PE2A 3OROA 4L00A 4U42A 5BQ0A 3E8CA 2Y6OA 4CT1A 3ATSA 3MVJA 4JOAA 1QPEA 1LEZA 2OU7A 3NRMA 3P78A 4EUUA 1A06A 2G9XA 4J99A 4LRJA 3QC9A 5I9XA 1Q41A 2HY0A 4AS0A 4NKAA 5I9UA 3EQHA 2OJGA 1H27A 3MPAA 2PZRA 4N6ZA 3SOCA 2J0KA 4F6SA 2JFMA 5IH6A 5H2UA 3RAIA 4AWIA 4GG7A 2PY3A 5IDNA 4Y5HA 2YZLA 3PVUA 4QMPA 4RX8A 4CMUA 4DCAA 4IX5A 4I5PA 2CNVA 2HXQA 5F9EA 4YZ9A 4D5KA 4I94A 5HKMA 5ANIA 3M42A 1JSUA 2ZM4A 3EHAA 3LXLA 5DNRA 4DGLC 5AA8A 5IH4A 2XARA 4AT5A 2RFNA 5AV1A 4BCMA 1J1CA 5KKRB 3R22A 3TYKA 2X8IA 2BDFA 2Q0BA 3UC4A 4DFUA 3EMGA 3DAKA 3NYXA 2XEZA 5HBJA 4MUQA 3LFFA 3D83A 4AZEA 3BPRA 3LQ3A 3O2MA 2ITWA 2WMQA 2YM7A 3LKMA 4O0YA 1Q62A 2W17A 3HV4A 3ZLYA 4IHPA 1TQPA 3ZRKA 2C6DA 3ORXA 4FG9A 2XKFA 4M0ZA 4J96A 3DJ5A 2O63A 3FYKX 3KF7A 4ZTQA 3S95A 3WF8A 3L8XA 1XH5A 5H8BA 3HGKA 3R6XA 2W5AA 3W33A 3QD3A 1OBGA 4U97A 4GS6A 4QTAA 1XBBA 5JEBA 1RDQE 4AOTA 5KBRA 1XBAA 5HG5A 3BI6A 3AMYA 1H1RA 3OXTA 3FI2A 3W10A 1OVEA 3UQFA 4HYUA 2VWWA 4C33A 4IFCA 1JBPE 1NW1A 5AUVA 4A4OA 4DF3A 3H4JA 3LVPA 4RBLA 3O8TA 4UWYA 5LWNA 4XV2A 1ZZLA 3FI4A 5DEYA 1GNGA 4RVKA 2GQSA 4FKSA 2NPQA 4PY1A 4H3QA 5LCJA 5JRQA 2A0CX 1WMKA 4C0TA 3G0EA 3IPHA 1VJYA 1UKIA 1V0OA 3FXXA 3PXRA 3TACA 4AXCA 3UP2A 3PRIA 3E8NA 5CSXA 1T45A 4GMYA 4X2GA 3UVRA 4EHZA 2OK1A 3TNIA 2HK5A 3EKKA 2ITVA 4I41A 2QONA 3DJ7A 3F5UA 1H1PA 2PVKA 3QTIA 4P90A 3UOLA 2BUJA 5AX9A 4EOOA 3OCBA 3OWLA 5HCZA 3VJNA 3PLAE 5KZ0A 2QOBA 1ZWSA 2YM8A 5AUUA 4EOQA 3GENA 3F5GA 3IDBA 3NLBA 2H8HA 3BEAA 4ZLYA 3EN5A 2J6MA 2VWYA 2J2IB 5HIBA 3VONA 3ZU7A 3GCPA 3DLSA 2ZM1A 4FKGA 5IZFA 4QRCA 4DEAA 3GC0A 4RWKA 5B0XA 4ALUA 1KE6A 1ZMWA 4NJ3A 1H1SA 2PUPA 1ZYDA 2REIA 4TRLA 5HEZA 3F3UA 1PXPA 4FTCA 4FKRA 2C6OA 3I81A 4QP9A 4BTKA 3KVXA 4R6VA 3VIDA 3MWUA 4CKRA 3BGQA 3LCTA 1F5QA 4BY9E 2DYLA 4TT7A 5A3XA 3ENMA 4IX3A 2OIBA 4KB8A 3UYSA 4I6HA 1MQBA 3QZIA 3R9OA 3VAPA 4BIDA 4DHJA 1O6LA 4O7RA 2YFXA 4G9RA 4X6RA 3QRJA 4PWNA 1OPJA 1IR3A 3OT3A 4NZWB 4FOBA 1W98A 3UJGA 4NL0A 2XNMA 5HICA 5IDPA 5GIOE 5J1WA 2BZHB 3C4EA 1PW2A 3KKVA 4G3CA 2E9UA 1TQIA 3I5NA 3LCDA 4GKHA 4U81A 4HVSA 3CIKA 3R0TA 3DCVA 5BVOA 3GFWA 1OUKA 3VS2A 4YHJA 2XM9A 4FG7A 2ZFYA 4K18A 4RJ3A 4YZCA 3QD2B 3Q4TA 4RLLA 3NDMA 5KZIA 3NCGA 3FE3A 5M09A 2OF4A 3AC8A 3E3PA 2FA2A 1HCKA 3MYGA 2UVXA 4IAFA 4R3RA 3ZXZA 2E9NA 4IX6A 5ANDA 4FC0A 2WTKC 3FSFA 3QHWA 3U9NA 4AN3A 2GQGA 4AAYA 2PWLA 2C6LA 4U8ZA 5E8WA 1DS5A 3IKAA 4I6QA 3THBA 4JNWA 5CNNA 4C4EA 3GOPA 3S00A 1QL6A 4L44A 2ITQA 3P08A 3A4PA 2F2CB 2VN9A 3MJ1A 4PX6A 2PE1A 3HLLA 2PUNA 3NUUA 3F88A 2ZAZA 3PXKA 4MK0A 4B9DA 4HZSA 1XKKA 3FMEA 5M55A 1A9UA 3SXSA 5F94A 3FZPA 2WOUA 2W4OA 4FJVA 5AP1A 2YJRA 5D12A 1IASA 3OY3A 4J71A 5FTOA 3VVHA 5CI6A 4E5AX 4F1OA 3DPKA 3TDVA 5EW3A 4ZMFA 3F2RA 3TWJA 4V0GA 3FMNA 4HVGA 4XG2A 3QX2A 4MD9E 3FKLA 3KULB 5JFSA 3RJCA 3TV4A 4OLIA 1GJOA 2VWIA 5B2MA 3P1AA 3AD4A 3VHKA 4AACA 3TTIA 1SMHA 1NVSA 4AA0A 4EJNA 4MBJA 4JR7A 3UG1A 3EQCA 5M44A 4IEBA 4CVAA 4FX3A 3D0EA 3PVWA 4QP3A 1WBPA 4YNOA 1PRYA 1SVGA 5IQBA 5HLWA 3QTRA 3E5AA 2HZIA 4N0SA 4E4NA 4CLJA 3ELJA 3UYTA 1PYEA 4YC6A 4DT9A 4E20A 3BWJA 4IAYA 2C47A 3NYVA 3VQUA 1PF8A 4FZ6A 4XYFA 5EFQA 4JVGA 4RX9A 3DT1A 4WBBB 3CTJA 4DBNA 2XB7A 4AGCA 5D7VA 1APME 3GEQA 4EZ5A 4FVPA 3WE4A 3V01A 3SDJA 4QP7A 2OKRA 1NVRA 3DOGA 1SVHA 3PXZA 2YISA 3WZDA 5B7VA 3D5UA 3MVHA 3W0SA 4KRCA 1M2QA 2WB8A 5FEEA 5IQEA 2ZYBA 2BAKA 3PUPA 3UZRA 2UW4A 5BV3A 4G5PA 5IISA 5HG8A 2J0LA 4L46A 4W8DA 4IAKA 4RA5A 3KIOC 3Q96A 5FP5A 2XNGA 5K9IA 2IO6A 3FZ1A 4X0MA 4RA4A 2AYPA 5CU2A 4AXEA 5HORA 2OZAB 1FOTA 3ZRLA 5KX8A 2W1ZA 1TVOA 2LGCA 1EH4A 3TL8A 4F7NA 3NCZA 4TW9A 2PTKA 2XP2A 3OBJA 3O5AA 4I20A 3V6RA 3WF9A 5M51A 4QYYA 2NP8A 2V55A 1M7QA 5DRDA 2I0YA 3JVRA 5EM8A 5HIDA 1W82A 3W16A 4X2FA 3CP9A 2J50A 4RQVA 2YCRA 2PULA 4AGDA 5L2TA 3QGYA 4EC8A 3EQFA 3BQCA 2IN6A 4I4FA 3ULZA 3A7HA 4OR5A 3KEXA 2R3LA 4CMTA 3QF9A 3D7ZA 5E9EA 1YI6A 1KUTA 1NVQA 1ZOGA 2I6LA 3LPBA 5DHJA 3RHKA 5CF6A 5CLPA 5M4UA 5K5XA 4PRJA 3F5XA 4IJPA 4TYHA 4R5YA 4LGHA 3VRYA 5AX3A 4U80A 4WNPA 3CJGA 2PL0A 3ZBXA 4EH4A 2IVUA 4KS8A 4CQEA 1BLXA 4FYOA 4OBOA 3AGLA 3MY1A 3TMOA 2VWVA 2JKKA 4QTEA 4EC9A 3TUDA 1FVVA 4LOOA 3F82A 3GOKA 4IFGA 2VNWA 2GPHA 5CSWA 3BRBA 4YBKA 3CS9A 4MKCA 3Q53A 2WEVA 4Q2AA 3QZHA 4YO4A 1PXLA 3Q9XA 3OW4A 2UZTA 3QXOA 3HV7A 3O23A 4MAOA 3U51A 4Z55A 3ZSHA 3PPKA 4BDEA 2WTKB 4RX7A 1M14A 2OW3A 2IZSA 4FKOA 5D1JA 3U4UA 3DAJA 4EONA 2G2IA 4BI2A 1XHAA 1Q61A 1OIQA 5DR2A 4NM5A 4FMQA 4E4LA 3HL7A 4BCPA 4D55A 4J8MA 2V7AA 2WMUA 3COKA 3HECA 3PP1A 3SKCA 5AMNA 3A2CA 5CAPA 2FUMA 2EU9A 4YBJA 2R3JA 3EFJA 1U59A 3D7TA 2FSTX 3R9HA 2IZTA 5KO1A 3A8XA 4W4YA 4DGNA 2Z7LA 3UODA 3FKOA 3DU8A 1STCE 3C1XA 3PE1A 4UY9A 2WAJA 4MX9A 5DN3A 4USDA 3JY9A 4UYAA 2C6KA 1I44A 2BKZA 5LOHA 4AF3A 1H24A 4AZTA 2B1PA 1WVWA 4ZIMA 3EJ1A 1AD5A 1PXKA 2C5VA 2Z60A 4GRBA 3R73A 4GVAA 3Q4ZA 4YHTA 3UOKA 4F4PA 3HP2A 5CF8A 1L8TA 5CEIA 3EQBA 4JIAA 4AFEA 2B9JA 2JGZA 4F9BA 4AE6A 3BV2A 2C3KA 1UVRA 2QI8A 3G2FA 2J7TA 4M97A 3WF6A 3M1SA 4G31A 2UZWE 2WIPA 4G5JA 3TZ8A 3C9WA 3LJ1A 3UGCA 4AN9A 5FM2A 1J3HA 1WBSA 4JDHA 4BCIA 4JQEA 4AAAA 3U6IA 5J9LA 5AP4A 5IF1A 5EYDA 2BDWA 3RTPA 5IQIA 1YI3A 2X7OA 5EHYA 2W06A 3SXFA 3WYXA 3BU3A 3KVWA 4UWCA 3MA6A 5L8KA 3OXZA 4IWPA 4A06A 3TNWA 1R39A 3NEWA 3CBLA 5A4CA 4B0GA 4IACA 3MBLA 4QQJA 3R7UA 3ZXTA 4X7QA 3E3BX 3IOPA 4F6UA 1IG1A 4QQ5A 3G90X 4PUZA 4X6QC 3KN5A 4FKVA 2C6IA 4KBKA 2WIHA 5FBNC 2ERKA 3FY0A 4KIOA 2W1EA 1OM1A 1P14A 4UX9A 4O83A 4CRLA 5C1QB 2I1MA 2Z8CA 2J0MB 1R0EA 1YHWA 3O7LD 5C01A 4M14A 3AKLA 3BCEA 3OXIA 2GNGA 3QXPA 3ZC6A 2C5NA 1TQMA 2BIYA 2UW5A 4CG9A 4WUAA 4FV1A 3FC2A 3HAMA 1YVJA 4A07A 5CXZA 3BL7A 3VBTA 4NW5A 4ZZOA 4G3DA 5CU4A 3EYGA 1OMWA 2BDJA 2O65A 2J5FA 2UZBA 3OT8A 3RK7A 3A7JA 4ANLA 3OEFX 3F9NA 3MVMA 3ZTXA 5IH5A 3UO5A 3OMVA 4L3PA 4L9IA 3R04A 4MWHA 2WU7A 2QURA 4RT7A 2YIWA 3EQDA 5LVPA 4ITIA 4YLJA 2I0VA 3SD0A 3VBXA 4BBEA 2YABA 1XBCA 1BKXA 4U41A 4MXCA 5E7RA 1ZY5A 5M06A 2X4ZA 1T46A 4ASEA 2QOKA 3EKNA 4BN1A 3RHXA 3NUYA 4BTMA 2J9MA 3GGFA 4QMSA 1OIRA 2I7QA 4D2SA 2ZJWA 5M4CA 3BBWA 4PV0A 3NS9A 2UW9A 2AUHA 5C4LA 1YDRE 3S4QA 4W4XA 2YAAA 5M4IA 1GZ8A 5T3QA 2P2IA 3G6GA 3S0OA 3AT2A 3K5VA 2CDZA 2ONLA 1LUFA 4RRVA 2R3QA 3ROYA 2QOFA 3LOKA 5CZHA 3FLNC 4RVLA 1JQHA 2XKDA 3BLHA 3DTWA 3GU5A 3QCQA 5D7AA 4WT6A 3QA0A 2Q83A 4BCFA 3CGFA 4IC7A 3ZUUA 4G17A 2XJ2A 3RK5A 4BDBA 4F6WA 3EFLA 1XH8A 3DBQA 4QO9A 3EZRA 1PXIA 4GJ2A 4JX7A 2QQ7A 5F95A 3SV0A 5L2WA 2ITNA 4FTAA 3EN4A 2PVNA 3QKLA 1GZOA 5ETIA 4X2NA 5DE2A 2UZVA 2Z7SA 4BICA 2ITYA 5H8GA 2C3JA 4MBLA 5JGAA 1UU3A 2YDIA 3QWJA 1U5QA 2WZJA 5GHVA 4EWQA 3HMPA 5GNKA 4IWQA 4G6OA 4L7SA 1JKLA 5IQHA 4GG5A 5DPVA 5A46A 3V3VA 3QC4A 4O27B 3OG7A 4MD8E 2WQOA 2QLUA 1K9AA 2JKMA 1ZOHA 2Y6MA 3HMMA 2Y4IC 4QQCA 5FEDA 5HD7A 3QQKA 3FLZA 3ZUTA 4RJ7A 5E4HA 5JGDA 1Q97A 3GXLA 2VTHA 1ZMUA 5DR9A 5KMMA 2JEDA 2VWZA 3QX4A 4M67A 3U55A 3O71A 3VC4A 2ZM3A 3AMAA 2OH0E 4L67A 4LM5A 4ACGA 4F09A 3BLQA 4XS2A 4O7NA 5CASA 4G6NA 3R8UA 4ERWA 5ACBC 4QTDA 4F7JA 3HAVA 2Y0AA 1M2PA 1ZZ2A 1GZKA 2VTTA 3W0OA 1JWHA 3KREA 4AOIA 3QYWA 4DHFA 3ORLA 3PWDA 5HU3A 5I9VA 5CQWA 1R3CA 4O0XA 3FEGA 2HCKA 2YM4A 3QCYA 5C8KA 4YZNA 1OUYA 5IUIA 4F65A 1WBWA 4YHFA 2C0IA 4RIYA 1ST4A 3D94A 3MDYA 4GT4A 2F7XE 1FVTA 2VTAA 4I24A 5C4KA 3VBYA 5AAEA 3B8QA 3LM0A 4BGHA 4HVHA 4CKIA 4TWNA 4CXAA 4CLIA 3UIMA 5HCYA 5LJJA 3N51A 5IQFA 4GFGA 4BKJA 3LIJA 2PYWA 4GIHA 4ZTRA 1MQ4A 4FVQA 4C02A 4QMUA 1W0XC 4D0WA 4EH7A 5IQDA 3TZ7A 2W0JA 4I6BA 5IG1A 3NGAA 3TJCA 3HA8A 4E6DA 3WOWA 1HCLA 4AZSA 2WEIA 2UW7A 3ZO1A 5TOZA 3D9VA 2AC3A 3KXZA 4WRGA 2WGJA 5J7HA 4BTFA 3HDNA 2R7IA 3BBTB 4M7IA 2W7XA 3V6SA 4LDTA 4WBOA 4FV8A 4OTRA 4HNIA 4KBAA 2B9HA 4TWOA 5EK7A 4AZVA 1KWPA 1VEBA 3AOXA 4BCNA 3K54A 4KSPA 4FIFA 3G5DA 3IQ7A 4HCVA 2UUEA 4NCTC 3VS3A 4BYJA 3U87A 2W1IA 3ANQA 5LQFA 2BRBA 2LAVA 5J95A 3OCTA 4BCHA 5CU0A 1G8AA 4AZWA 2I0HA 3D15A 2GTNA 4IB3A 5T68A 1ZAOA 3BLAA 3ZZEA 2QODA 2HAKA 3HUCA 4DFNA 1XH4A 4A4XA 5A9UA 4BDDA 3R1SA 1Z9XA 4AA4A 5DH3A 1CDKA 3WILA 2BFXA 4H05A 3GC9A 5IPJA 3W2RA 1FVRA 2W96B 4C62A 4DH8A 5HCXA 3A7FA 2R2PA 4U5JA 4MNEB 3OFMA 4KKEA 3KMWA 3RP9A 4QP4A 5EI2A 1H0VA 2HZ4A 5AFVA 3MSSA 5AWMA 3W2QA 2QOIA 1DAYA 3CJFA 2Y9QA 4NKSA 4QQTA 3ORPA 5EQYA 3ORKA 5DT0A 2WOTA 1HOWA 2PVHA 3G15A 3NNWA 3QHRA 3AT3A 2GNIA 2FH9A 3FLSA 2HXLA 3RVGA 2Z7QA 4QPSA 5E8TA 3UNKA 4F63A 2GNFA 3KCFA 1YI4A 1JPAA 3F5PA 3SHEA 5KE0A 3BLRA 2XS0A 3FV8A 4MXYA 3UOJA 2Q0NA 4FEXA 3UG2A 1OKVA 4DBXA 3G6HA 5G6VA 3Q32A 2V0DA 3ZBFA 3FC1X 5KNJA 4B8LA 4BDAA 4XG3A 4ASDA 4F0GA 5JK3A 3EQGA 1SNXA 3COIA 5DGZA 4XH6A 1IAHA 4BI1A 3NFFB 4DEEA 4LV5A 4C4IA 3W32A 2BVAA 3PDTA 3TM0A 1NA7A 4A9RA 4BBFA 3EL7A 1U46A 3ZSGA 4DLJA 5F20A 3A62A 3MTFA 3LJ0A 2JITA 5DIAA 4QYGA 3NSZA 1YDTE 3QTZA 4FV9A 4J7BA 4P7EA 5FBOA 3ZRMA 4BDCA 3O0GA 2P0CA 4RC3A 2OI4X 4KS7A 4I0TA 2WMBA 4JI9A 4QMNA 4R7BA 1H26A 4KIQA 2EB3A 2BMCA 4WNOA 4A4LA 4IBMA 3DGKA 1UNHA 2Y4IB 4ZZMA 5C26A 3LXNA 2GNHA 2VTRA 2XKEA 3FMKA 3W0PA 3R2BA 3S1HA 4ORKA 3QALE 5CVFA 5L2IA 4IADA 4EL9A 4JBVA 4LV7A 5BVFA 4IC8A 3U6JA 1B39A 3G51A 2XRWA 3V5QA 4BR3A 4TTHB 5M57A 3BZ3A 2OXDA 3QQJA 4PMPA 3PFQA 3QD4A 1H25A 1S9JA 2CGUA 3MN3A 4AE9A 5GJDA 4L68A 4BI0A 5KHXA 5JGBA 3RMFA 5CX9A 4DYMA 2HZNA 3C51A 3OOGA 3O96A 3DQWA 3TTJA 2V22A 3KRWA 4Y85A 3N4TA 5JKGA 1OECA 5AEPA 1JNKA 4XV3A 3QRUA 1M2RA 4RX5A 1JSTA 3FJQE 3R8ZA 5K4JA 1J1BA 3DKFA 3E62A 4MCVA 2EB2A 3VF8A 4OTFA 3HDMA 4U0IA 4MXZA 4DT8A 2W1FA 3VS6A 4M68A 4MF1A 2ITOA 1XO2B 4EHVA 4YLLA 4Z7HA 3FL5A 2W9ZB 3FL4A 4FV0A 3UDTA 5L8LA 4D1XA 3VNTA 2IW8A 4CG8A 3UMXA 3JS2A 4F7LA 3EFKA 4DTKA 4D28A 2UW6A 4U44A 4CV8A 2WQNA 4M84A 4M8TA 3RPVA 3G0FA 1GIIA 5BUJA 3A7GA 1JKTA 3PY3A 5A4LA 5IA5A 4OT5A 2AEGA 3KGAA 4JDKA 5CVHA 4NJDA 5KMOA 3QUPA 4IWOA 4FOCA 3ORIA 2PUIA 4XOZA 4N6YA 4RIXB 5A4TA 3E93A 3AXWA 5LMAA 3RI1A 2X2KA 3R71A 5JZNA 4CSVA 4PP9A 1SNUA 4GU6A 4FR4A 4QMTA 4RIWB 1FQ1B 5HLNA 3PJ1A 2YHVA 2YJSA 3JY0A 3WZKA 4CKJA 1PKDA 3RM6A 4DEHA 4TN6A 2WD1A 3RZBA 3F3WA 2QO7A 4HGSA 3UPZA 3UVPA 3ZM9A 3R02A 3WYYA 2XJ1A 1YWNA 4O0UA 5HE0A 3AC4A 1H28A 1LP4A 4XRJA 3ZUVA 5DG5A 3UQGA 5FUTA 3FMHA 4XG6A 3UO6A 3ZLWA 3MIYA 4JL9A 2XEYA 1QPJA 2R3RA 5HTCA 3W55A 3GT8A 3Q6WA 2XIXA 4JLCA 4BCQA 2VO3A 4N4SA 2HZ0A 4DFXE 3WBLA 2C30A 3N4VA 4CGAA 3RINA 3MI9A 4TNBA 4WRSA 2QOOA 4ACDA 3GCUA 5H9BA 2WTDA 3BWFA 3ZMMA 2RG6A 3FPMA 5BUIA 4FKUA 2PZ5A 3CPBA 3I0QA 3L8SA 4E6AA 4EUTA 4JIKA 5DFPA 4RWJA 2B9FA 3R2YA 4O96A 5DI1A 3DKCA 3S2PA 4FTUA 5CU6A 5GJGA 2HWOA 4IAIA 3B8RA 1QMZA 2QCSA 2JAMA 3PVGA 3M2WA 4F99A 3PG3A 4XNEA 5F1ZA 4EH3A 3PG1A 4R78A 3T8OA 4EH6A 1Q8TA 4IM3A 4XLIA 3R8LA 3NAYA 3MS9A 3KC3A 2JIIA 2RKUA 3C4ZA 5J9ZA 4DLIA 5AP2A 5EW9A 4EHEA 4YR8A 4ITJA 4ONAA 2WNTA 4IAAA 4ZTNA 3R7YA 4EBVA 1WBVA 3KB7A 4RFYA 2XANA 3T9IA 1WVXA 4MXXA 5BMMA 2XVDA 3R9RA 3F3TA 3VHEA 4DTBA 4OTIA 3OWKA 3QRTA 1L3RE 2C5YA 2R3PA 2WU6A 3QTXA 5CENA 4DITA 2UW0A 2C69A 1CKJA 3QYZA 4FTIA 3CKWA 2P2HA 4O0WA 1IA9A 1WBNA 4FIHA 4ZTLA 3GC8A 3QRIA 5IQCA 2RGPA 4RC4A 3ZDIA 4BIBA 1BYGA 4K8AA 4TYIA 3FZTA 3ZFYA 3HV3A 4YSMA 2YIYA 3P5KA 4CEGA 3F7WA 1ND4A 4FZFB 2XCHA 4YC3A 3VUMA 4EOMA 4PDYA 3Q60A 2YDJA 5HI2A 5KMKA 1BL7A 4ZY4A 4MNEA 5T6KA 3ODYX 2GS6A 3LFCA 3EN9A 4U3ZA 4RQKA 4WHZA 4F70A 2CHLA 1VYZA 4E7WA 3QD0A 2GCDA 3R01A 3RAKA 2UW8A 4XBRA 1YXTA 5HESA 4XP2A 2UZUE 2CN8A 4DEGA 2NNWB 3VBVA 3POOA 3HP5A 4X3FC 4CZUA 2J5EA 3V8WA 1JKSA 3DZQA 4NFMA 2Z02A 4OTHA 2BTRA 5CEPA 3MFTA 2EXMA 5CF5A 4Z3VA 5CXHA 2VU3A 2P55A 3CXWA 3R30A 4BZNA 3QQUA 5AUXA 4KD1A 2JFLA 3BELA 3MGYA 3QTSA 4JRNA 4EK4A 5LVOA 4RVMA 2BHHA 3F69A 5ACKA 4U43A 3I1AA 3CCNA 2ZDUA 4LV8A 1WVYA 4EQUA 4KWPA 3LAUA 5LMKC 3WZUA 4BBMA 2ZV7A 3BL9A 3HVCA 2UW3A 2FYSA 3NUSA 4RSSA 1XR1A 4G34A 3ZLXA 2W5HA 2VTNA 2PZYA 5EKOA 4E5WA 2V62A 3MH0A 3POZA 4FV3A 4E6CA 1Y8GA 2W4KA 4DEBA 5FXQA 1PJKA 1ZYCA 2WTVA 4OTGA 1H1WA 4WSYA 4GK4A 3W2SA 4D1SA 1ZYJA 3IDPA 3LFDA 1G8SA 3OBGA 3PIYA 4UALA 3A8WA 2H6DA 4YZMA 4OW8A 5AP0A 3NAXA 2OIDA 4OBPA 3DJ6A 3ETAA 3W18A 2CMWA 4EOIA 5CQUA 4M13A 1J7LA 2I0EA 3FYJX 2GS7A 3IGGA 4NWMA 4BJJB 3ACKA 5KUPA 3AMBA 1H8FA 3FMDA 3NW7A 3P7BA 4FK3A 3SRVB 4WOVA 2JDRA 2YCQA 3BU6A 2C5XA 2YITA 3H9FA 4WNKA 1MRVA 5A54A 3IONA 1P2AA 3NPCA 1V0BA 5K5NA 3NMUF 4BDGA 5FEQA 1OIUA 2V7OA 3CQEA 2XAMA 4QNYA 5DYJA 2VO0A 3IS5A 4E8AA 4IVBA 2G15A 4AW2A 3BE9A 4RJ8A 5GJFA 1H0WA 3FZRA 2YEXA 3I7BA 4TYGA 1G5SA 4XG9A 3AC1A 4K2RA 2CN5A 3BEGA 3P23A 2WPAA 3PPZA 2CGVA 3ITZA 3C13A 3VW6A 4BGGA 4C38A 1V0PA 4DEIA 3CGOA 3OTVA 2YN8A 4JR3A 5EYCA 2XNBA 4XV1A 2WMWA 3BU5A 3NW5A 2VX1A 4ANQA 4B6LA 2F2UA 4KINA 2X7GA 3DQXA 3V04A 3DDQA 3QKKA 3WZJA 4PNKA 1Z5MA 4K11A 3NUXA 3TUCA 4CFFA 3PVBA 2YIXA 2ERZE 3PSDA 1U4DA 2PVJA 4WA9A 4ZSGA 3CE3A 4FV6A 3F61A 4HVDA 3GCSA 3KMMA 3FMMA 3HRCA 1YXXA 4AFJA 4F64A 2XIZA 4FEWA 2XRUA 4IWDA 5A6OA 3L9NA 4FKTA 3F6XA 4HJOA 5E91A 1YRPA 3VRZA 3VBWA 3U8WA 3COMA 4H1JA 4M69B 1IAJA 1OZ1A 2J0IA 2JBPA 4O0SA 5F4NA 4U79A 3V5JA 3V8SA 3UOHA 4MBIA 4RC2A 2OFVA 4D4RA 4ACCA 5ANGA 1GAGA 4RIXA 3LM5A 5DWRA 4BDIA 4YLKA 2GTMA 4R5SA 3V5PA 3Q5ZA 2QOLA 4IB5A 4IZ5A 1UWHA 4JXFA 4PDSA 4X21A 5CEQA 3RCJA 4D0XA 3KXGA 3MW1A 5HG9A 4G16A 4KRDA 5AA9A 5EYKA 4EH5A 4QMVA 4E5BA 2RFEA 2XALA 3DFAA 5CWZA 3V5WA 2BCJA 4WNMA 3I7CA 1RQQA 4DN5A 4RPVA 3RPRA 3GNIB 4EOSA 4MVFA 4O6LA 2GSFA 3UDBA 3IECA 3D4QA 4PP7A 3D5WA 3AD5A 4WG3A 4JX3A 2XF0A 5ANOA 4V01A 4JG8A 2F9GA 3LZBA 3UNZA 2X2MA 2WTCA 1SM2A 1KE7A 3R7VA 3ZFMA 3PY1A 2B54A 3QCSA 4EYJA 3VN9A 4G3GA 3PSCA 3ALNA 4U7ZA 3QWKA 4EKKA 1CKPA 2QLQA 4O91A 2W1HA 2PUUA 2C3LA 5AAFA 2VWBA 5B2KA 3TKIA 4IDTA 1JOWB 2B0QA 2OF2A 1JAMA 1K3AA 2IW6A 3D5XA 3Q04A 4NW6A 4RZWA 2E9OA 2DQ7X 3O17A 4ZLZA 2H96A 3Q9WA 5JN2A 3C0IA 4JAJA 5DRBA 2X4FA 2ITPA 3P7CA 4FT5A 4DHIB 3EQRA 2WXVA 3TG1A 2R3FA 1VZOA 4APPA 2DUVA 3HMOA 3IW4A 3BQRA 4RJ4A 4F7SA 1FGKA 3G9NA 4BDKA 4FIIA 4GH2A 2YCSA 3HRBA 3PTGA 2X7FA 4QP6A 5HHWA 2XK6A 4MXAA 3V8TA 4M12A 2Y8OA 4XCUA 1KV1A 4GL9A 3ATTA 5HX6A 3GCVA 4CCUA 2XK9A 2Y7JA 2BAQA 3KRLA 4J8NA 2BRHA 2W1CA 5IEYA 3UDZA 4CNHA 1MUOA 1YOJA 3TI1A 4EOKA 4OT6A 5EHLA 3HV6A 4H3BA 5I5ZA 4RWLA 4IB0A 3R9DA 2ZB0A 4JT3A 4PMSA 2XYUA 5D11A 4GKIA 2OGVA 4O21A 4J1RA 3WIKA 4E26A 1Y57A 4JRVA 3WE8A 4NM7A 2VZ6A 4K0YA 4FTRA 3OY1A 4EH8A 3PY0A 3DNDA 1OL6A 1M17A 2XK4A 3ET7A 4L3JA 4ZP5A 4FKWA 4ID7A 4Z7GA 4DHZA 4PTCA 2NRYA 1CSNA 3NUAA 3C7QA 5AUTA 2OBJA 2VX3A 3RAWA 4DG2E 3QUEA 2WMAA 3SAYA 4DH3A 4J97A 4UEUA 2IPXA 3TNPC 5FG8A 4AUAA 2IVSA 2PSQA 2VD5A 4FA2A 5IUGA 3IW5A 4KNBA 5CS6A 4F1TA 3QAME 3G33A 2QOHA 3DK6A 5TT7A 5KCVA 3KRRA 1FMKA 3VF9A 2A27A 5FXSA 3FI8A 1REJA 3N4UA 4QTCA 5CALA 2F7EE 4WIHA 3SQQA 4CCBA 4PTEA 4P2KA 3SX9A 4EBWA 2OH4A 3R83A 3EQPA 1QPCA 3AKKA 3LW0A 3OWJA 5EM7A 2F7ZE 4EH9A 1TKIA 4D2RA 4MXOA 3QCXA 4FEUA 4L3LA 5AUZA 3ZHPC 3MESA 3OD6X 3MJ2A 5L6PA 4RG0A 4FSNA 4GT3A 4BHNA 4DCEA 3KULA 4I23A 2XBJA 4H58A 3KFAA 3BE2A 4DGGA 3FBVA 3CTHA 5BNJA 4I6FA 3F2NA 1H08A 4FNXA 1U5RA 1GIHA 3AD6A 2BZKB 4JQ8A 4IMYA 4F1MA 1UV5A 2HELA 4PDOA 3LFQA 3P86A 1XMLA 3F3ZA 2HENA 4KIPA 2WMSA 5DVRA 4P5QA 2W9FB 2PMNX 4NU1A 3MVLA 2RG5A 2PK9A 1V1KA 1H1QA 4C4GA 3HMNA 4NM3A 3NNUA 3LFSA 3PJ2A 4DEDA 3BYMA 2VGPA 2G2HA 3FXWA 5H8EA 3MH1A 2CCHA 4YJTA 3GU8A 5DA3A 4FTMA 4DDIA 3GFEA 4IZAA 3ORTA 4IW0A 3TV7A 4BYIA 2YAKA 4C58A 5BYYA 5C8NA 3FQSA 3PXYA 4TWPA 3WZEA 1OI9A 4MEDA 4P4CA 4R7IA 5BX0A 1KSWA 1GOLA 2BR1A 4WO5A 3TT0A 5BMSA 5AP5A 2CNUA 3DXNA 4YC8A 3C4WA 3ULIA 3RM7A 2P33A 4O7LA 4YJNA 1O9UA 4O0TA 5HVJA 4A9YA 2YCFA 3SRVA 4BDJA 5CAQA 2IVTA 2GHMA 4O2ZA 5J5SA 4LMUA 2J4ZA 4FBXA 2CJMA 3NW6A 4C2VA 4JDIA 5L2SA 3PJCA 1I09A 4C7TA 5JQ5A 2ACXA 3CD3A 4XMOA 3DK7A 3OUNB 4I93A 1K2PA 1DAWA 3B2WA 2OZAA 4CFXA 4D4YA 4IVAA 3FLWA 5HVKA 1RW8A 4I92A 5ANJA 4LMNA 1OPKA 4L43A 4GVJA 3KY2A 1WZYA 3KK9A 4L01A 4EH2A 4N70A 4EZ7A 5IMXA 4XV9A 2VGOA 3RALA 3UNJA 2GQRA 5HVYA 4WG5A 5BVDA 4C2WA 5IQGA 3GQLA 3E8DA 2R0IA 4G2FA 3VUDA 1YDSE 4GSBA 5JFWA 3Q4UA 1KOAA 1LPUA 3QZFA 3EIDA 2QD9A 2O3PA 3R28A 4GFOA 4ZJIA 3VS5A 1BX6A 4L7FA 3ZDUA 4HOKA 4YU2A 4FV5A 4MH7A 4F9CA 3RWPA 3R1NA 1UWJA 4C3FA 2ITUA 4BVUA 4L53A 3L8PA 3EWHA 2OO8X 2RFDA 4FL2A 4OUCA 3I60A 2HWPA 3MY5A 3PFYA 2NO3A 3OCGA 5M56A 2GS2A 4FTOA 5KMNA 3ML1A 2QOCA 4ZSAA 2CSNA 5HTBA 4YTHA 3A7IA 4X3JA 4A9UA 4AQCA 2DWBA 3AGMA 4MQ1A 4HZRA 1CKIA 2V5QA 2PZIA 4IX4A 3MB7A 2J51A 3FLYA 3GU7A 5LCKA 4G1WA 3NYNA 3LLTA 4JBPA 3Q2MA 4V05A 4EYMA 3SLSA 3ORZA 3ZC5A 2PE0A 2R3OA 3A99A 2QHMA 3DXPA 4ZOGA 5E8VA 3NIEA 2YWPA 2CKPA 4GK3A 3WF5A 3VBQA 3PWYA 4CZTA 1YWVA 3JR1A 4O0VA 2OJIA 2VX0A 2CGWA 4FG8A 4TYJA 2JC6A 3R00A 1GIJA 1UU7A 3HRFA 3R8PA 4ENYA 3QQGA 1FINA 2O0UA 5AUWA 4UZHA 4EK3A 4U6RA 2IZRA 4IM2A 4CFMA 4UZDA 2A19B 2PMOX 2ZVAA 4LFIA 3L1SA 1H00A 2BRGA 3IW8A 3QZGA 2P3GX 2ZMCA 3NUNA 1A48A 5ETAA 3CLYA 4LL5A 1JVPP 2RL5A 4QEBA 4S32A 2IJMA 4D5HA 2HOGA 2OIQA 3DNEA 5HLPA 3DXQA 4FKIA 1Q5KA 4DAWA 2QG7A 3KQ7A 3QU0A 2QVSE 4CTBA 1UNLA 4DH5A 3ZEWA 2A1AB 2X39A 5CNOA 4AQKA 2RIOA 3H9RA 2JIVA 2WMRA 4U40A 3ZSIA 3L9MA 5E8SA 1OKZA 3LCOA 4CFWA 2O5KA 3FZOA 4MQ2A 5JRSA 3PIXA 2OJ9A 4EEVA 1OKWA 4QT1A 4K9YA 3ALOA 4MD7E 4MWIA 4I5HA 4RWIA 5EH0A 3UO4A 4J52A 4EKLA 2OWBA 5HO7A 2W99B 4C3PA 4YJVA 3LQ5A 3UIXA 4E93A 2JDTA 3LFAA 3IDCA 2EUFB 4XG8A 3FAAA 4YJRA 4ZK5A 2R64A 5FRIA 4O84A 3OZ6A 5HE1A 3R7EA 4USEA 4XX9A 3NZ0A 5BVKA 3HEGA 1JSVA 4YO6A 4CFNA 4Y73A 4YJOA 4QNAA 5EOBA 3PJ8A 1U54B 4B4LA 4BZOA 3QBNA 1KE9A 2WMVA 2WELA 3HX4A 3KXNA 3O8PA 3FSKA 4FUYA 4QMZA 3UQCA 4FTLA 4Q5EA 4Y5QA 1DM2A 4YPDA 5FDXA 3QTQA 1LEWA 3I79A 2F4JA 4EOJA 1XJDA 1RJBA 2KULA 3JVSA 4IZ7A 1NXKA 3NR9A 4PL4A 5TKDA 3MH3A 4DA5A 3UC3A 4BC6A 1XH7A 4B99A 5FDPA 2GMXA 1ZYLA 1ST0A 3R21A 2PPQA 5IEXA 2GU8A 3QQLA 3QGWA 1BI8A 4S34A 4YGAA 4Z9LA 4XBUA 3LFBA 1YKRA 4ZTMA 3OWPA 3DAEA 5ICPA 2X1NA 3ZEPA 4FYNA 4K77A 5KHWA 3OC1A 2ZOQA 3PXQA 3ZFXA 4IZYA 3CKXA 2E2BA 2XZSA 4V0GB 4AT4A 3LQ8A 3FLQA 4GV1A 2HW7A 3BHVA 2QR8A 5DOSA 4UXQA 3TKHA 4OGRA 2ETRA 4S30A 3EOCA 3CC6A 3U4WA 5CY3A 2J0JA 2XM8A 5GIPE 2JD5A 2XKCA 2PVLA 4EOPA 4IE9A 2WTWA 2ZV9A 4FTJA 4JBOA 3DBCA 3CTQA 3ENHA 3MY0A 4UXLA 4YZDA 4CFVA 3CQUA 2EVAA 3C0GA 3Q6UA 4NTSA 2C1AA 4O6EA 4FKLA 5CSPA 5AIKA 5DBXA 5IA2A 4LI5A 2W05A 3QL8A 3V51A 4EHGA 2R3HA 2XNEA 4CT2A 2YERA 4IIRA 4HYHA 3UTOA 5FLFA 4FGRA 4HPUE 4PL3A 4DFLA 2VTPA 4NSTA 1YHSA 4O7ZA 2XIYA 3FWQA 5LVLA 1P4FA 3VUGA 3WI6A 1Z57A 1X8BA 3EYHA 4FZ7A 4AXDA 3SG9A 3PZHA 2CKEA 4FL3A 3W0MA 3DV3A 3T3UA 3IOKA 4FVRA 5CI7A 4BIEA 4O7TA 4FTQA 5KMIA 3IW6A 4BCJA 2IVVA 3D14A 3RK9A 2WFYA 4H36A 3PPJA 4YUQA 4JDJA 4J95A 2VTJA 4WUNA 4QYFA 2BZJA 4X2KA 4FSZA 4TXCA 5G1XA 5CEKA 2QKRA 5EOLA 2VWXA 1XMMA 3TV6A 5J1VA 4QMWA 5E8ZA 3EZVA 1WAKA 1OL5A 2NRUA 3LMHA 4JAIA 3GI3A 4ANSA 3REPA 1BL6A 4KBCA 4ASZA 3RPSA 3AQVA 1YOMA 4NH1A 4M0YA 3KRXA 4Y8DA 3OW3A 4QP2A 4O82A 4I21A 4C34A 5TO8A 4BGQA 1OL7A 3LCSA 2GFSA 4DH7A 4ALWA 3FZSA 3P5JC 3ANRA 1UU9A 4C4FA 5E1EA 4OTDA 4LUEA 3PXFA 3DA6A 3HYHA 5J8IA 4AGWA 2YM5A 4QOXA 1PMUA 5E8UA 3CD8A 3CSVA 4XJ0A 5IMEA 2PE2A 2QO9A 2WTIA 2Y4PA 2YM3A 4FODA 2R3KA 4BB4A 3GU6A 4RLKA 1MRYA 3UP7A 4APCA 5M08A 2XNPA 5GINE 1SYKA 4LRKA 1PXMA 4KABA 2FSOX 5A6NA 4FIEA 2FO0A 5D10A 4TYHB 4Y95A 3TDWA 2ONLC 2G2FA 3O8UA 4O7VA 5AV2A 3F7ZA 3SW4A 3BV3A 2YACA 5FTQA 4FIGA 3UDSA 4EI4A 5FM3A 5IU2A 5HE2A 4U45A 2UV2A 5JFVA 3C5UA 4UN0C 2FVDA 4GU9A 1E9HA 3D2KA 4AT3A 4FTTA 2E9VA 4Y83A 4AA5A 4TL0A 3P79A 5JT2A 4UV0A 3ZM4A 1VLRA 4OTWA 2GNLA 3R8VA 3RCDA 5CF4A 5HNIX 4FEVA 3CEKA 4L45A 4B7TA 3I4BA 3TZ9A 4EOLA 1CTPE 4O86A 3H10A 4IJ9A 3RPOA 3BGZA 4J98A 4II5A 4YTCA 1JKKA 4JG6A 3VS4A 2YWVA 3SW7A 2JKQA 3TEIA 3VWAA 4L6QA 3VUKA 4QPAA 4C61A 4LYNA 4I1ZA 2R3IA 2C6TA 2FSLX 4BCGA 4FIJA 4BCOA 4FT0A 1OB3A 1F0QA 1BMKA 4G3FA 3GBZA 1ZY4A 4FTKA 3IK3A 5AV3A 1REKA 4PTGA 3EN7A 3UE4A 3DS6A 3E92A 1PMEA 3SOAA 2X6DA 2R7BA 3D7TB 4FZDB 2UZOA 3R9NA 3GP0A 4TKSA 3MFSA 3GUBA 1S9IA 4ZS0A 3KU2A 2OSCA 5J87A 3H30A 1Q4LA 3E63A 4G3EA 5EKNA 2VV9A 4ZAUA 3S3IA 3CY2A 5ETFA 4AOJA 2QR7A 3DK3A 3PUFC 5EDQA 1Q8YA 2OJFE 2O8YA 2HW6A 5E90A 2BAJA 2C6MA 1R1WA 2WMXA 5EM6A 2OLCA 3COHA 5CTPA 5EQEA 1XH9A 2JKOA 2IW9A 1MP8A 3C5IA 4BDFA 4YZBA 4ZZNA 2C0TA 4DFZE 1VYWA 5CSHA 2O2UA 3KCKA 4MNFA 4BZDA 1WCCA 3GCQA 3W0NA 5CAOA 1WFCA 5AADA 3IW7A 1XH6A 4XUFA 3UBDA 4E73A 3TIZA 2G1TA 1IEPA 3U6HA 4W4VA 3DB6A 1W84A 1XWSA 5E8YA 3DFCB 4I0RA 5CAVA 4K1BA 3I6WA 4L8MA 1U54A 1YQJA 3NUPA 4F78A 3AT4A 1Y6AA 2F49A 4CTCA 5I0BA 2W4JA 2OFUA 1PYXA 3RPYA 5B2LA 4LUDA 3ORMA 4YTIA 2A2AA 5IA0A 5ANEA 3K2LA 5KMJA 1W7HA 5DR6A 2C1BA 4QDEA 2BRNA 3H3CA 4TWCA 4QMOA 3FMJA 4M15A 5HQ0A 3LXKA 1FPUA 2X6EA 4AGUA 4RJ6A 4JQ7A 2C68A 3PIZA 3BHUA 5L6WL 2PMLX 3D5VA 5HO8A 1Y6BA 4EWHA 5HD4A 1YOLA 3LJ2A 2P4IA 5AP6A 4S33A 5BYLA 3VS0A 2KTYA 1J7UA 4R77A 4YJSA 3W8LA 4N57A 4HCUA 4GIIA 3FKNA 2XJ0A 3ZO3A 3TJDA 2PVMA 3GB2A 3E87A 1BUHA 3LMGA 4LG4A 3TNHA 2UZNA 1MRUA 1Q24A 2YM6A 1PXOA 2ESMA 3AC2A 4WKQA 3Q9YA 2GHLA 3JXWA 2WKMA 1ZYSA 4Y72A 2E9PA 4NIFB 5C03A 4DGMA 3V5LA 1OGYA 1OGUA 3K5UA 4C36A 1ZARA 2B9IA 4PNIA 4GJ3A 2AC5A 4TYEA 2F57A 5CANA 1YXUA 4DINA 5HBEA 3R1QA 3K3JA 4FL1A 5K3YA 4A7CA 3VJOA 3MFRA 3HKOA 3Q3BA 2C6EA 2WO6A 1ZOEA 3U9CA 1WBTA 3OOMA 4R1YA 3B2TA 3NNXA 5EM5A 5I9WA 2OXYA 3NVKI 4CFUA 2XK8A 4NFNA 2QG5A 4AN2A 4D1ZA 4Z16A 5ETCA 2B53A 4FK6A 5J9YA 1ZLTA 1UU8A 3ZONA 4UBAA 5AM6A 1E1VA 3LMIA 1ATPE 2PVYA 5DLSA 3P0MA 2R3MA 4XOYA 4EK5A 2UVZA 3UVQA 4FSWA 5IEVA 5LMBA 2R4BA 3R63A 4J53A 2CNQA 4WG4A 1YHVA 4YP8A 2ZV8A 4ZJVA 5H3QA 4XP3A 3VUIA 5L6OA 5LVNA 4AZFA 5EI6A 4QMMA 2HY81 3OUKA 3BYVA 4O0RA 3C50A 2C0OA 3QA8A 4RVTA 4KSQA 3ID6C 5EG3A 3CQWA 5CT7A 3DTCA 4O22A 1OIYA 3EH9A 2VTMA 4JBQA 3F66A 3TZMA 3OVVA 2BZIB 3NNVA 4FKJA 4ENXA 3E88A 3P7AA 4FSRA 5AP7A 2EXCX 3RGFA 1H07A 5TR6A 3CR0A 3MPTA 5IA1A 5JMSA 4K6ZA 1GZNA 4WD5A 2CPKE 3LHJA 4LGGA 4LRMA 2QU6A 4RIWA 4EZ3A 1Q3WA 3ACJA 4U9AA 4V04A 4XEYA 2JBOA 3DKGA 2VTQA 4ITHA 4NCTA 4F0IA 2R5TA 4EQMA 2BROA 3LCKA 5EQPA 5A14A 3K3IA 3ZZWA 1YW2A 4D4SA 2X9FA 3CY3A 2BIKB 4OBQA 3SGCA 4AW1A 3ROCA 3QLFA 1G8JA 1B38A 1AGWA 2BPMA 4YMJA 3PYYA 4ZS4A 3O7LB 4QP8A 4RFMA 2X9EA 2JDVA 2VNYA 3UZTA 1QPDA 4ACMA 2OJJA 2WQEA 1J7IA 4C4HA 5I4NA 2B52A 4TPTA 3L8VA 2JAVA 2G01A 3BYOA 5AP3A 4BRXA 2R9SA 1PKGA 5IUHA 1FMOE 4RFZA 4S2ZA 5KBQA 5ITAA 2GHGA 3WF7A 5HIEA 5AUYA 2XIRA 5HNBA 4RZVA 4ZTSA 4YSJA 2BILB 2VRXA 3DBFA 3I6UA 3QTUA 2JDOA 3QQHA 4RIYB 4EK6A 5A4QA 4IVCA 4Q5HA 3E7OA 1J91A 4X3FB 4ZSJA 3RAHA 3HMIA 2VO6A 4XHKB 4IVDA 5E92A 5CAUA 2XMYA 3O51A 5CU3A 4W8EA 2X2LA 5BYZA 2YDKA 4ZY5A 2GDOA 4GW8A 3LFNA 4JJRA 4QMQA 1TFFA 2X0GA 4GUEA 3W2OA 4I6LA 3MH2A 2FSMX 3MB6A 3WIGA 2DS1A 4FEQA 3LLAA 5CVGA 5HNGA 3VUHA 4KA3A 4BCKA 4O7WA 3VW8A 4F0FA 4IH8A 3R7OA 1OBDA 2W1GA 3FUPA 5LARA 3T9TA 3KXMA 1KV2A 3TCPA 2VTIA 5FGKA 4HYIA 3FMLA 3KXXA 3RNIA 4DTAA 3Q9ZA 4DDGA 2VUWA 2ZMDA 3ZO4A 5BVNA 4IANA 3FDNA 2PZPA 3HA6A 4F9YA 4FT3A 3ZCLA 3PA5A 3KF4A 5E8XA 2YIQA 3H9OA 3PZEA 4H39A 3NVMB 4QMYA 2ITZA 4HPTE 4JMQA 2QO2A 4Q9SA 1W83A 2R3NA 2XIKA 4E4MA 1OKYA 2ZDTA 4O7SA 1ERKA 3F2AA 3OEZA 2BTSA 4ZEGA 3VQHA 5CZIA 3DLZA 4C37A 3FHRA 2VO7A 4AXFA 3EL8A 3A61A 3AC3A 4LOPA 2PVFA 3VULA 3Q2JA 4DGOA 1ZMVA 2WMTA 4RMZA 5FP6A 4CMOA 2VAGA 5EYMA 2A4LA 3KK8A 4ZMEA 3FHIA 4QMXA 5HBHA 4CV9A 5M07A 2ZV2A 2UVYA 4FI1A 1SZMA 2C5OA 2VTSA 3BHHA 1RE8A 1OITA 3OF0A 3QKMA 4QMLA 3U54A 4DG3E 4F9AA 3FQHA 4UB7A 1BI7A 4IAZA 4RGJA 5DEWA 3KMUA 4IB1A 4DH1A 2VWUA 2UZEA 1GY3A 3BX5A 3TUBA 4FTNA 3QQFA 3MPMA 4GT5A 1PY5A 5CEMA 3H0ZA 4AXAA 4FGBA 3VS7A 2JDSA 4E1ZA 4EJ7A 3DB8A 5EHOA 5LXMA 4GCJA 4YPSA 2XNOA 5FXRA 3JYAA 4FT7A 4XG7A 3Q52A 4E6QA 3QUDA 5LWMA 1O6YA 3FQEA 4PL5A 5TF9A 3C4CA 4ALVA 3O50A 1KOBA 1UKHA 3C4XA 3JPVA 4RJ5A 5IA3A 3KL8A 4HGTA 5JQ8A 4GYGA 1KE8A 1NY3A 4NYEA 1E1XA 4XG4A 3OHTA 4PMMA 4ZJJA 4PDPA 3FPQA 3R7IA 3QRKA 3RKBA 2PMIA 3BYUA 3C4FA 5CSVA 2PVRA 3W2PA 4BTJA 3ZH8A 5HX8A 5HZNA 3LXPA 4ARKA 2CKQA 1FGIA 2BKKA 2X8EA 5CT0A 5D41A 2R0UA 2WQMA 1FBNA 4I5MA 4A9TA 2XCKA 1AQ1A 4H1MA 4XP0A 3CPCA 4DG0E 3RWQA 4EORA 2XNNA 1OL2A 4FT9A 4HVIA 3QFVA 4GEOA 4QYHA 4AU8A 4BJJA 3SC1A 5CEOA 2WHBA 2UZDA 4H3PA 4KAOA 1YWRA 3Q4CA 1YXSA 3GC7A 2OXXA 4NT4A 2XBAA 2SRCA
chains in the Genus database with same CATH topology
3NIZA 2ZB1A 3NWWA 2O64A 2Z7RA 5HG7A 3T3VA 4MTAA 3KXHA 4C59A 3UIBA 2CLXA 4AW0A 4D9TA 2XK7A 5D9HA 1PXJA 5C8MA 4HCTA 4ZSLA 2VTOA 5C27A 3OTUA 2QKWB 1P4OA 5I9ZA 4KUJA 4YJQA 4DC2A 3DBEA 1DI9A 4MHAA 3R8MA 1UNGA 3G9LX 4PMTA 4UYNA 2YA9A 3IG7A 3N9XA 4Y46A 3SG8A 4FZAB 5AM7A 3OP5A 1OPLA 2H9VA 5E1SA 2QHNA 2CLQA 1WBOA 4I5CA 3R1YA 4U3YA 3BKBA 4IM0A 4PQNA 3FY2A 3BHTA 2GFCA 4G6LA 2IG7A 4QDVA 2W5BA 4EK8A 1W8CA 3AC5A 3OCSA 2QU5A 4HYSA 3ORNA 3H0YA 3BGPA 3A60A 2FB8A 2X81A 4PF4A 4O38A 5IQAA 4ERKA 2I40A 1IA8A 3QLGA 3UPXA 3VS1A 2XYNA 2JLDA 3PA4A 1Q8UA 3MA3A 1XQZA 2UZLA 1KE5A 3II5A 4O2PA 2HYYA 3Q5IA 4NUSA 4D9UA 2XAOA 3HNGA 3OS3A 2FGIA 3A4OX 4GFMA 2ETKA 4BF2A 4BHZA 4YURA 1R0PA 4O7YA 4S31A 3ZO2A 1Q99A 3TXOA 2QOQA 2BHEA 5A4EA 4L52A 4JS8A 5EW8A 1VR2A 2WTJA 4B8MA 4BDHA 4FSMA 1URWA 4I0SA 2XK3A 4LQMA 3UZPA 3WARA 4XLVA 3E64A 5JFXA 4LL0A 5BVWA 3TIYA 4FUXA 1JLUE 3RNYA 5JH6A 3KRJA 4FV7A 3FI3A 3MV5A 4EQCA 1IRKA 3IGOA 4RIOA 4TNDA 2YZAA 2BFYA 4AW5A 3C0HA 4DFBA 1ZRZA 2X8DA 3GVUA 4I4EA 5AV4A 5HGIA 5I9YA 3DKOA 4CRSA 4FE2A 4TY1A 4D58A 1PXNA 5AIRA 4ZY6A 4C35A 2IZUA 3F3VA 5EI8A 3HUBA 5HE3A 4FNWA 5AJQA 2PHKA 4ZTHA 1Y91A 5EDPA 3PP0A 1G8KA 4NK9A 3EFWA 5KKRC 5AV0A 5BVEA 4IDVA 4W4WA 2BALA 4I22A 4Q9ZA 5C9CA 4X2JA 4L42A 3HZTA 1CM8A 4X3FA 3DZOA 1O6KA 3MIAA 4E4XA 2QC6A 4FSUA 3VO3A 4QTBA 5M53A 4KKHA 5ANKA 2XH5A 3W2CA 4ANBA 1UA2A 3GU4A 1M52A 4F9WA 1ZXEA 2XUUA 3NFGB 4NTTA 1CMKE 3BIZA 3V5TA 3NYOA 4G9CA 4R7HA 3UMWA 4MYGA 4R3PA 2W1DA 3TNQB 4A9SA 5CYIA 5FQDC 1OL1A 4HGEA 5L8JA 3ZLSA 5LMKA 3TKUA 3I0OA 3W0RA 4R3CA 3MFUA 2OICA 3D2IA 3SVVA 2PU8A 1YXVA 3EQIA 4R1VA 2B7AA 3W1FA 4IQ6A 3M11A 4FSQA 3IO7A 4K33A 3W0QA 1H4LA 4XRLA 4C3RA 5JSMA 3SA0A 3PRFA 2WQBA 3E7VA 4FV4A 3P4KA 3TN8A 1Q3DA 4ASXA 1B6CB 2B55A 4TZRA 4YTFA 3E8EA 3I5ZA 1SVEA 3L9LA 3PJ3A 1H01A 5BUEA 3DBDA 4YNEA 4GYIA 3EN6A 4C4JA 2CGXA 1NT2A 1M7NA 2ITTA 3MTLA 4NM0A 4FSYA 5IA4A 2OZOA 1P5EA 3DDPA 5BPYA 4USFA 2ITXA 4ZLOA 1F3MC 3BHYA 2YIRA 4GUBA 4KKGA 2ETMA 4AP7A 3ERKA 4QP1A 5JZJA 2VTLA 2J90A 4FKQA 4FV2A 4JG7A 5FTGA 5HU9A 1Y8YA 4DFYA 3PA3A 1R78A 3DY7A 3P9JA 5FD2A 5DT3A 3PLSA 4YJPA 2IWIA 4M3QA 2HIWA 5M4FA 4LOQA 2RF9A 1URCA 4P5ZA 4AX8A 3W8QA 4ACHA 3PSBA 4ANMA 5L3AA 1Q8WA 4FKPA 2H34A 3ZOSA 2OG8A 2Z2WA 3GQIA 4FNYA 2QNJA 3EB0A 2XA4A 3KN6A 3NX8A 3AKJA 1Q8ZA 4HGLA 4OTQA 5DT4A 4DE4A 4ZXTA 4QYEA 3ZS5A 2C3IB 2R3GA 4FNZA 2JIUA 1LR4A 5LVMA 4I3ZA 3HV5A 3KA0A 1G3NA 4AG8A 4O81A 4YJUA 3ZYAA 2CKOA 2CCIA 4FSTA 4HNFA 4CD0A 2BRMA 1QCFA 3L9PA 3LE6A 4HW7A 2B4SB 2GNJA 1PMNA 4FICA 3FXZA 3BYSA 3UIUA 3SXRA 2C4GA 2EWAA 1PHKA 3ODZX 4GK2A 1DI8A 4UWBA 4ZSEA 5AAGA 2NYAA 4F08A 5KMLA 3AG9A 3JUHA 5K4IA 1PMVA 4D4VA 3LFEA 5EDRA 2RFSA 3QTWA 3PE2A 3OROA 4L00A 4U42A 5BQ0A 3E8CA 2Y6OA 4CT1A 3ATSA 3MVJA 4JOAA 1QPEA 1LEZA 2OU7A 3NRMA 3P78A 4EUUA 1A06A 2G9XA 4J99A 4LRJA 3QC9A 5I9XA 1Q41A 2HY0A 4AS0A 4NKAA 5I9UA 3EQHA 2OJGA 1H27A 3MPAA 2PZRA 4N6ZA 3SOCA 2J0KA 4F6SA 2JFMA 5IH6A 5H2UA 3RAIA 4AWIA 4GG7A 2PY3A 5IDNA 4Y5HA 2YZLA 3PVUA 4QMPA 4RX8A 4CMUA 4DCAA 4IX5A 4I5PA 2CNVA 2HXQA 5F9EA 4YZ9A 4D5KA 4I94A 5HKMA 5ANIA 3M42A 1JSUA 2ZM4A 3EHAA 3LXLA 5DNRA 4DGLC 5AA8A 5IH4A 2XARA 4AT5A 2RFNA 5AV1A 4BCMA 1J1CA 5KKRB 3R22A 3TYKA 2X8IA 2BDFA 2Q0BA 3UC4A 4DFUA 3EMGA 3DAKA 3NYXA 2XEZA 5HBJA 4MUQA 3LFFA 3D83A 4AZEA 3BPRA 3LQ3A 3O2MA 2ITWA 2WMQA 2YM7A 3LKMA 4O0YA 1Q62A 2W17A 3HV4A 3ZLYA 4IHPA 1TQPA 3ZRKA 2C6DA 3ORXA 4FG9A 2XKFA 4M0ZA 4J96A 3DJ5A 2O63A 3FYKX 3KF7A 4ZTQA 3S95A 3WF8A 3L8XA 1XH5A 5H8BA 3HGKA 3R6XA 2W5AA 3W33A 3QD3A 1OBGA 4U97A 4GS6A 4QTAA 1XBBA 5JEBA 1RDQE 4AOTA 5KBRA 1XBAA 5HG5A 3BI6A 3AMYA 1H1RA 3OXTA 3FI2A 3W10A 1OVEA 3UQFA 4HYUA 2VWWA 4C33A 4IFCA 1JBPE 1NW1A 5AUVA 4A4OA 4DF3A 3H4JA 3LVPA 4RBLA 3O8TA 4UWYA 5LWNA 4XV2A 1ZZLA 3FI4A 5DEYA 1GNGA 4RVKA 2GQSA 4FKSA 2NPQA 4PY1A 4H3QA 5LCJA 5JRQA 2A0CX 1WMKA 4C0TA 3G0EA 3IPHA 1VJYA 1UKIA 1V0OA 3FXXA 3PXRA 3TACA 4AXCA 3UP2A 3PRIA 3E8NA 5CSXA 1T45A 4GMYA 4X2GA 3UVRA 4EHZA 2OK1A 3TNIA 2HK5A 3EKKA 2ITVA 4I41A 2QONA 3DJ7A 3F5UA 1H1PA 2PVKA 3QTIA 4P90A 3UOLA 2BUJA 5AX9A 4EOOA 3OCBA 3OWLA 5HCZA 3VJNA 3PLAE 5KZ0A 2QOBA 1ZWSA 2YM8A 5AUUA 4EOQA 3GENA 3F5GA 3IDBA 3NLBA 2H8HA 3BEAA 4ZLYA 3EN5A 2J6MA 2VWYA 2J2IB 5HIBA 3VONA 3ZU7A 3GCPA 3DLSA 2ZM1A 4FKGA 5IZFA 4QRCA 4DEAA 3GC0A 4RWKA 5B0XA 4ALUA 1KE6A 1ZMWA 4NJ3A 1H1SA 2PUPA 1ZYDA 2REIA 4TRLA 5HEZA 3F3UA 1PXPA 4FTCA 4FKRA 2C6OA 3I81A 4QP9A 4BTKA 3KVXA 4R6VA 3VIDA 3MWUA 4CKRA 3BGQA 3LCTA 1F5QA 4BY9E 2DYLA 4TT7A 5A3XA 3ENMA 4IX3A 2OIBA 4KB8A 3UYSA 4I6HA 1MQBA 3QZIA 3R9OA 3VAPA 4BIDA 4DHJA 1O6LA 4O7RA 2YFXA 4G9RA 4X6RA 3QRJA 4PWNA 1OPJA 1IR3A 3OT3A 4NZWB 4FOBA 1W98A 3UJGA 4NL0A 2XNMA 5HICA 5IDPA 5GIOE 5J1WA 2BZHB 3C4EA 1PW2A 3KKVA 4G3CA 2E9UA 1TQIA 3I5NA 3LCDA 4GKHA 4U81A 4HVSA 3CIKA 3R0TA 3DCVA 5BVOA 3GFWA 1OUKA 3VS2A 4YHJA 2XM9A 4FG7A 2ZFYA 4K18A 4RJ3A 4YZCA 3QD2B 3Q4TA 4RLLA 3NDMA 5KZIA 3NCGA 3FE3A 5M09A 2OF4A 3AC8A 3E3PA 2FA2A 1HCKA 3MYGA 2UVXA 4IAFA 4R3RA 3ZXZA 2E9NA 4IX6A 5ANDA 4FC0A 2WTKC 3FSFA 3QHWA 3U9NA 4AN3A 2GQGA 4AAYA 2PWLA 2C6LA 4U8ZA 5E8WA 1DS5A 3IKAA 4I6QA 3THBA 4JNWA 5CNNA 4C4EA 3GOPA 3S00A 1QL6A 4L44A 2ITQA 3P08A 3A4PA 2F2CB 2VN9A 3MJ1A 4PX6A 2PE1A 3HLLA 2PUNA 3NUUA 3F88A 2ZAZA 3PXKA 4MK0A 4B9DA 4HZSA 1XKKA 3FMEA 5M55A 1A9UA 3SXSA 5F94A 3FZPA 2WOUA 2W4OA 4FJVA 5AP1A 2YJRA 5D12A 1IASA 3OY3A 4J71A 5FTOA 3VVHA 5CI6A 4E5AX 4F1OA 3DPKA 3TDVA 5EW3A 4ZMFA 3F2RA 3TWJA 4V0GA 3FMNA 4HVGA 4XG2A 3QX2A 4MD9E 3FKLA 3KULB 5JFSA 3RJCA 3TV4A 4OLIA 1GJOA 2VWIA 5B2MA 3P1AA 3AD4A 3VHKA 4AACA 3TTIA 1SMHA 1NVSA 4AA0A 4EJNA 4MBJA 4JR7A 3UG1A 3EQCA 5M44A 4IEBA 4CVAA 4FX3A 3D0EA 3PVWA 4QP3A 1WBPA 4YNOA 1PRYA 1SVGA 5IQBA 5HLWA 3QTRA 3E5AA 2HZIA 4N0SA 4E4NA 4CLJA 3ELJA 3UYTA 1PYEA 4YC6A 4DT9A 4E20A 3BWJA 4IAYA 2C47A 3NYVA 3VQUA 1PF8A 4FZ6A 4XYFA 5EFQA 4JVGA 4RX9A 3DT1A 4WBBB 3CTJA 4DBNA 2XB7A 4AGCA 5D7VA 1APME 3GEQA 4EZ5A 4FVPA 3WE4A 3V01A 3SDJA 4QP7A 2OKRA 1NVRA 3DOGA 1SVHA 3PXZA 2YISA 3WZDA 5B7VA 3D5UA 3MVHA 3W0SA 4KRCA 1M2QA 2WB8A 5FEEA 5IQEA 2ZYBA 2BAKA 3PUPA 3UZRA 2UW4A 5BV3A 4G5PA 5IISA 5HG8A 2J0LA 4L46A 4W8DA 4IAKA 4RA5A 3KIOC 3Q96A 5FP5A 2XNGA 5K9IA 2IO6A 3FZ1A 4X0MA 4RA4A 2AYPA 5CU2A 4AXEA 5HORA 2OZAB 1FOTA 3ZRLA 5KX8A 2W1ZA 1TVOA 2LGCA 1EH4A 3TL8A 4F7NA 3NCZA 4TW9A 2PTKA 2XP2A 3OBJA 3O5AA 4I20A 3V6RA 3WF9A 5M51A 4QYYA 2NP8A 2V55A 1M7QA 5DRDA 2I0YA 3JVRA 5EM8A 5HIDA 1W82A 3W16A 4X2FA 3CP9A 2J50A 4RQVA 2YCRA 2PULA 4AGDA 5L2TA 3QGYA 4EC8A 3EQFA 3BQCA 2IN6A 4I4FA 3ULZA 3A7HA 4OR5A 3KEXA 2R3LA 4CMTA 3QF9A 3D7ZA 5E9EA 1YI6A 1KUTA 1NVQA 1ZOGA 2I6LA 3LPBA 5DHJA 3RHKA 5CF6A 5CLPA 5M4UA 5K5XA 4PRJA 3F5XA 4IJPA 4TYHA 4R5YA 4LGHA 3VRYA 5AX3A 4U80A 4WNPA 3CJGA 2PL0A 3ZBXA 4EH4A 2IVUA 4KS8A 4CQEA 1BLXA 4FYOA 4OBOA 3AGLA 3MY1A 3TMOA 2VWVA 2JKKA 4QTEA 4EC9A 3TUDA 1FVVA 4LOOA 3F82A 3GOKA 4IFGA 2VNWA 2GPHA 5CSWA 3BRBA 4YBKA 3CS9A 4MKCA 3Q53A 2WEVA 4Q2AA 3QZHA 4YO4A 1PXLA 3Q9XA 3OW4A 2UZTA 3QXOA 3HV7A 3O23A 4MAOA 3U51A 4Z55A 3ZSHA 3PPKA 4BDEA 2WTKB 4RX7A 1M14A 2OW3A 2IZSA 4FKOA 5D1JA 3U4UA 3DAJA 4EONA 2G2IA 4BI2A 1XHAA 1Q61A 1OIQA 5DR2A 4NM5A 4FMQA 4E4LA 3HL7A 4BCPA 4D55A 4J8MA 2V7AA 2WMUA 3COKA 3HECA 3PP1A 3SKCA 5AMNA 3A2CA 5CAPA 2FUMA 2EU9A 4YBJA 2R3JA 3EFJA 1U59A 3D7TA 2FSTX 3R9HA 2IZTA 5KO1A 3A8XA 4W4YA 4DGNA 2Z7LA 3UODA 3FKOA 3DU8A 1STCE 3C1XA 3PE1A 4UY9A 2WAJA 4MX9A 5DN3A 4USDA 3JY9A 4UYAA 2C6KA 1I44A 2BKZA 5LOHA 4AF3A 1H24A 4AZTA 2B1PA 1WVWA 4ZIMA 3EJ1A 1AD5A 1PXKA 2C5VA 2Z60A 4GRBA 3R73A 4GVAA 3Q4ZA 4YHTA 3UOKA 4F4PA 3HP2A 5CF8A 1L8TA 5CEIA 3EQBA 4JIAA 4AFEA 2B9JA 2JGZA 4F9BA 4AE6A 3BV2A 2C3KA 1UVRA 2QI8A 3G2FA 2J7TA 4M97A 3WF6A 3M1SA 4G31A 2UZWE 2WIPA 4G5JA 3TZ8A 3C9WA 3LJ1A 3UGCA 4AN9A 5FM2A 1J3HA 1WBSA 4JDHA 4BCIA 4JQEA 4AAAA 3U6IA 5J9LA 5AP4A 5IF1A 5EYDA 2BDWA 3RTPA 5IQIA 1YI3A 2X7OA 5EHYA 2W06A 3SXFA 3WYXA 3BU3A 3KVWA 4UWCA 3MA6A 5L8KA 3OXZA 4IWPA 4A06A 3TNWA 1R39A 3NEWA 3CBLA 5A4CA 4B0GA 4IACA 3MBLA 4QQJA 3R7UA 3ZXTA 4X7QA 3E3BX 3IOPA 4F6UA 1IG1A 4QQ5A 3G90X 4PUZA 4X6QC 3KN5A 4FKVA 2C6IA 4KBKA 2WIHA 5FBNC 2ERKA 3FY0A 4KIOA 2W1EA 1OM1A 1P14A 4UX9A 4O83A 4CRLA 5C1QB 2I1MA 2Z8CA 2J0MB 1R0EA 1YHWA 3O7LD 5C01A 4M14A 3AKLA 3BCEA 3OXIA 2GNGA 3QXPA 3ZC6A 2C5NA 1TQMA 2BIYA 2UW5A 4CG9A 4WUAA 4FV1A 3FC2A 3HAMA 1YVJA 4A07A 5CXZA 3BL7A 3VBTA 4NW5A 4ZZOA 4G3DA 5CU4A 3EYGA 1OMWA 2BDJA 2O65A 2J5FA 2UZBA 3OT8A 3RK7A 3A7JA 4ANLA 3OEFX 3F9NA 3MVMA 3ZTXA 5IH5A 3UO5A 3OMVA 4L3PA 4L9IA 3R04A 4MWHA 2WU7A 2QURA 4RT7A 2YIWA 3EQDA 5LVPA 4ITIA 4YLJA 2I0VA 3SD0A 3VBXA 4BBEA 2YABA 1XBCA 1BKXA 4U41A 4MXCA 5E7RA 1ZY5A 5M06A 2X4ZA 1T46A 4ASEA 2QOKA 3EKNA 4BN1A 3RHXA 3NUYA 4BTMA 2J9MA 3GGFA 4QMSA 1OIRA 2I7QA 4D2SA 2ZJWA 5M4CA 3BBWA 4PV0A 3NS9A 2UW9A 2AUHA 5C4LA 1YDRE 3S4QA 4W4XA 2YAAA 5M4IA 1GZ8A 5T3QA 2P2IA 3G6GA 3S0OA 3AT2A 3K5VA 2CDZA 2ONLA 1LUFA 4RRVA 2R3QA 3ROYA 2QOFA 3LOKA 5CZHA 3FLNC 4RVLA 1JQHA 2XKDA 3BLHA 3DTWA 3GU5A 3QCQA 5D7AA 4WT6A 3QA0A 2Q83A 4BCFA 3CGFA 4IC7A 3ZUUA 4G17A 2XJ2A 3RK5A 4BDBA 4F6WA 3EFLA 1XH8A 3DBQA 4QO9A 3EZRA 1PXIA 4GJ2A 4JX7A 2QQ7A 5F95A 3SV0A 5L2WA 2ITNA 4FTAA 3EN4A 2PVNA 3QKLA 1GZOA 5ETIA 4X2NA 5DE2A 2UZVA 2Z7SA 4BICA 2ITYA 5H8GA 2C3JA 4MBLA 5JGAA 1UU3A 2YDIA 3QWJA 1U5QA 2WZJA 5GHVA 4EWQA 3HMPA 5GNKA 4IWQA 4G6OA 4L7SA 1JKLA 5IQHA 4GG5A 5DPVA 5A46A 3V3VA 3QC4A 4O27B 3OG7A 4MD8E 2WQOA 2QLUA 1K9AA 2JKMA 1ZOHA 2Y6MA 3HMMA 2Y4IC 4QQCA 5FEDA 5HD7A 3QQKA 3FLZA 3ZUTA 4RJ7A 5E4HA 5JGDA 1Q97A 3GXLA 2VTHA 1ZMUA 5DR9A 5KMMA 2JEDA 2VWZA 3QX4A 4M67A 3U55A 3O71A 3VC4A 2ZM3A 3AMAA 2OH0E 4L67A 4LM5A 4ACGA 4F09A 3BLQA 4XS2A 4O7NA 5CASA 4G6NA 3R8UA 4ERWA 5ACBC 4QTDA 4F7JA 3HAVA 2Y0AA 1M2PA 1ZZ2A 1GZKA 2VTTA 3W0OA 1JWHA 3KREA 4AOIA 3QYWA 4DHFA 3ORLA 3PWDA 5HU3A 5I9VA 5CQWA 1R3CA 4O0XA 3FEGA 2HCKA 2YM4A 3QCYA 5C8KA 4YZNA 1OUYA 5IUIA 4F65A 1WBWA 4YHFA 2C0IA 4RIYA 1ST4A 3D94A 3MDYA 4GT4A 2F7XE 1FVTA 2VTAA 4I24A 5C4KA 3VBYA 5AAEA 3B8QA 3LM0A 4BGHA 4HVHA 4CKIA 4TWNA 4CXAA 4CLIA 3UIMA 5HCYA 5LJJA 3N51A 5IQFA 4GFGA 4BKJA 3LIJA 2PYWA 4GIHA 4ZTRA 1MQ4A 4FVQA 4C02A 4QMUA 1W0XC 4D0WA 4EH7A 5IQDA 3TZ7A 2W0JA 4I6BA 5IG1A 3NGAA 3TJCA 3HA8A 4E6DA 3WOWA 1HCLA 4AZSA 2WEIA 2UW7A 3ZO1A 5TOZA 3D9VA 2AC3A 3KXZA 4WRGA 2WGJA 5J7HA 4BTFA 3HDNA 2R7IA 3BBTB 4M7IA 2W7XA 3V6SA 4LDTA 4WBOA 4FV8A 4OTRA 4HNIA 4KBAA 2B9HA 4TWOA 5EK7A 4AZVA 1KWPA 1VEBA 3AOXA 4BCNA 3K54A 4KSPA 4FIFA 3G5DA 3IQ7A 4HCVA 2UUEA 4NCTC 3VS3A 4BYJA 3U87A 2W1IA 3ANQA 5LQFA 2BRBA 2LAVA 5J95A 3OCTA 4BCHA 5CU0A 1G8AA 4AZWA 2I0HA 3D15A 2GTNA 4IB3A 5T68A 1ZAOA 3BLAA 3ZZEA 2QODA 2HAKA 3HUCA 4DFNA 1XH4A 4A4XA 5A9UA 4BDDA 3R1SA 1Z9XA 4AA4A 5DH3A 1CDKA 3WILA 2BFXA 4H05A 3GC9A 5IPJA 3W2RA 1FVRA 2W96B 4C62A 4DH8A 5HCXA 3A7FA 2R2PA 4U5JA 4MNEB 3OFMA 4KKEA 3KMWA 3RP9A 4QP4A 5EI2A 1H0VA 2HZ4A 5AFVA 3MSSA 5AWMA 3W2QA 2QOIA 1DAYA 3CJFA 2Y9QA 4NKSA 4QQTA 3ORPA 5EQYA 3ORKA 5DT0A 2WOTA 1HOWA 2PVHA 3G15A 3NNWA 3QHRA 3AT3A 2GNIA 2FH9A 3FLSA 2HXLA 3RVGA 2Z7QA 4QPSA 5E8TA 3UNKA 4F63A 2GNFA 3KCFA 1YI4A 1JPAA 3F5PA 3SHEA 5KE0A 3BLRA 2XS0A 3FV8A 4MXYA 3UOJA 2Q0NA 4FEXA 3UG2A 1OKVA 4DBXA 3G6HA 5G6VA 3Q32A 2V0DA 3ZBFA 3FC1X 5KNJA 4B8LA 4BDAA 4XG3A 4ASDA 4F0GA 5JK3A 3EQGA 1SNXA 3COIA 5DGZA 4XH6A 1IAHA 4BI1A 3NFFB 4DEEA 4LV5A 4C4IA 3W32A 2BVAA 3PDTA 3TM0A 1NA7A 4A9RA 4BBFA 3EL7A 1U46A 3ZSGA 4DLJA 5F20A 3A62A 3MTFA 3LJ0A 2JITA 5DIAA 4QYGA 3NSZA 1YDTE 3QTZA 4FV9A 4J7BA 4P7EA 5FBOA 3ZRMA 4BDCA 3O0GA 2P0CA 4RC3A 2OI4X 4KS7A 4I0TA 2WMBA 4JI9A 4QMNA 4R7BA 1H26A 4KIQA 2EB3A 2BMCA 4WNOA 4A4LA 4IBMA 3DGKA 1UNHA 2Y4IB 4ZZMA 5C26A 3LXNA 2GNHA 2VTRA 2XKEA 3FMKA 3W0PA 3R2BA 3S1HA 4ORKA 3QALE 5CVFA 5L2IA 4IADA 4EL9A 4JBVA 4LV7A 5BVFA 4IC8A 3U6JA 1B39A 3G51A 2XRWA 3V5QA 4BR3A 4TTHB 5M57A 3BZ3A 2OXDA 3QQJA 4PMPA 3PFQA 3QD4A 1H25A 1S9JA 2CGUA 3MN3A 4AE9A 5GJDA 4L68A 4BI0A 5KHXA 5JGBA 3RMFA 5CX9A 4DYMA 2HZNA 3C51A 3OOGA 3O96A 3DQWA 3TTJA 2V22A 3KRWA 4Y85A 3N4TA 5JKGA 1OECA 5AEPA 1JNKA 4XV3A 3QRUA 1M2RA 4RX5A 1JSTA 3FJQE 3R8ZA 5K4JA 1J1BA 3DKFA 3E62A 4MCVA 2EB2A 3VF8A 4OTFA 3HDMA 4U0IA 4MXZA 4DT8A 2W1FA 3VS6A 4M68A 4MF1A 2ITOA 1XO2B 4EHVA 4YLLA 4Z7HA 3FL5A 2W9ZB 3FL4A 4FV0A 3UDTA 5L8LA 4D1XA 3VNTA 2IW8A 4CG8A 3UMXA 3JS2A 4F7LA 3EFKA 4DTKA 4D28A 2UW6A 4U44A 4CV8A 2WQNA 4M84A 4M8TA 3RPVA 3G0FA 1GIIA 5BUJA 3A7GA 1JKTA 3PY3A 5A4LA 5IA5A 4OT5A 2AEGA 3KGAA 4JDKA 5CVHA 4NJDA 5KMOA 3QUPA 4IWOA 4FOCA 3ORIA 2PUIA 4XOZA 4N6YA 4RIXB 5A4TA 3E93A 3AXWA 5LMAA 3RI1A 2X2KA 3R71A 5JZNA 4CSVA 4PP9A 1SNUA 4GU6A 4FR4A 4QMTA 4RIWB 1FQ1B 5HLNA 3PJ1A 2YHVA 2YJSA 3JY0A 3WZKA 4CKJA 1PKDA 3RM6A 4DEHA 4TN6A 2WD1A 3RZBA 3F3WA 2QO7A 4HGSA 3UPZA 3UVPA 3ZM9A 3R02A 3WYYA 2XJ1A 1YWNA 4O0UA 5HE0A 3AC4A 1H28A 1LP4A 4XRJA 3ZUVA 5DG5A 3UQGA 5FUTA 3FMHA 4XG6A 3UO6A 3ZLWA 3MIYA 4JL9A 2XEYA 1QPJA 2R3RA 5HTCA 3W55A 3GT8A 3Q6WA 2XIXA 4JLCA 4BCQA 2VO3A 4N4SA 2HZ0A 4DFXE 3WBLA 2C30A 3N4VA 4CGAA 3RINA 3MI9A 4TNBA 4WRSA 2QOOA 4ACDA 3GCUA 5H9BA 2WTDA 3BWFA 3ZMMA 2RG6A 3FPMA 5BUIA 4FKUA 2PZ5A 3CPBA 3I0QA 3L8SA 4E6AA 4EUTA 4JIKA 5DFPA 4RWJA 2B9FA 3R2YA 4O96A 5DI1A 3DKCA 3S2PA 4FTUA 5CU6A 5GJGA 2HWOA 4IAIA 3B8RA 1QMZA 2QCSA 2JAMA 3PVGA 3M2WA 4F99A 3PG3A 4XNEA 5F1ZA 4EH3A 3PG1A 4R78A 3T8OA 4EH6A 1Q8TA 4IM3A 4XLIA 3R8LA 3NAYA 3MS9A 3KC3A 2JIIA 2RKUA 3C4ZA 5J9ZA 4DLIA 5AP2A 5EW9A 4EHEA 4YR8A 4ITJA 4ONAA 2WNTA 4IAAA 4ZTNA 3R7YA 4EBVA 1WBVA 3KB7A 4RFYA 2XANA 3T9IA 1WVXA 4MXXA 5BMMA 2XVDA 3R9RA 3F3TA 3VHEA 4DTBA 4OTIA 3OWKA 3QRTA 1L3RE 2C5YA 2R3PA 2WU6A 3QTXA 5CENA 4DITA 2UW0A 2C69A 1CKJA 3QYZA 4FTIA 3CKWA 2P2HA 4O0WA 1IA9A 1WBNA 4FIHA 4ZTLA 3GC8A 3QRIA 5IQCA 2RGPA 4RC4A 3ZDIA 4BIBA 1BYGA 4K8AA 4TYIA 3FZTA 3ZFYA 3HV3A 4YSMA 2YIYA 3P5KA 4CEGA 3F7WA 1ND4A 4FZFB 2XCHA 4YC3A 3VUMA 4EOMA 4PDYA 3Q60A 2YDJA 5HI2A 5KMKA 1BL7A 4ZY4A 4MNEA 5T6KA 3ODYX 2GS6A 3LFCA 3EN9A 4U3ZA 4RQKA