2XAOA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase from a. thaliana in complex with ip5
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
404
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICKEELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase is a Distant Ipk Member with a Singular Inositide Binding Site for Axial 2-Oh Recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 128
structure length 404
sequence length 435
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xaoA01
2XANA 3UDSA 4LV7A 4AXEA 4AQKA 2XALA 4AXCA 4AXFA 2XAMA 3UDTA 2XARA 4AXDA 3UDZA 2XAOA
chains in the Genus database with same CATH superfamily
4O7YA 5A46A 3ELJA 2R4BA 1P5EA 2UZNA 3QQUA 4IX5A 2FUMA 4GMYA 4Q5HA 4IM3A 4WO5A 4DT9A 2VTSA 3NNVA 4CNHA 4I5HA 2W5BA 3GU4A 5HTCA 3KRLA 2HW7A 3A60A 2XYNA 5IQDA 4DFLA 5DEYA 4C3RA 4KS7A 3BQRA 4CV8A 2RFEA 1Q99A 3IOPA 3NVMB 5EM8A 2YISA 3HDNA 3OT8A 2HXQA 1IA8A 4ACHA 2BVAA 4PTCA 5HKMA 3FC1X 5BX0A 3G90X 4D0WA 5J9LA 3I60A 1Q41A 3CCNA 3Q2MA 3KF7A 2E9VA 4LL0A 4QPSA 1J7UA 3GENA 3KC3A 3WF6A 3OC1A 4O82A 3GVUA 5KZIA 4DA5A 1REKA 1W83A 3LMHA 3SV0A 3Q6UA 5HD7A 3IDCA 4GK4A 2BAKA 3R21A 1G5SA 1GZNA 3PSDA 4P2KA 4B8MA 4YTFA 2WTDA 2XP2A 3GI3A 4WRSA 2C0IA 3BZ3A 1V1KA 5LMBA 1Q3DA 3SAYA 2JKMA 3HP5A 3JUHA 4V05A 3VQHA 4XP3A 3C0GA 3P78A 3QTZA 2YFXA 4HJOA 1FMKA 2OBJA 4GG7A 3NYNA 5J87A 4XEYA 3GT8A 4BVUA 5LMKA 4X7QA 3AKKA 4XP2A 4TWPA 2QOQA 3K5VA 2X9EA 5FM3A 1YDTE 3CTJA 3ZM9A 4ANBA 4D4YA 1G3NA 3GB2A 3GQIA 2VO7A 3KRWA 4AQKA 3LQ3A 2QOFA 2HW6A 3IW4A 5CAQA 3DK7A 4I93A 1DAYA 3WIGA 4WA9A 1NY3A 2NPQA 3GBZA 3Q4ZA 3II5A 4R78A 2BTSA 3L9PA 4C61A 3A7IA 3BGPA 3RALA 1ND4A 5M57A 3MVHA 4QMZA 3W18A 3CQEA 4BDCA 4O7RA 4USFA 5B2LA 2JC6A 5CX9A 3DNEA 3L8XA 3PIYA 4GRBA 2R9SA 2NYAA 1BKXA 2XKFA 3PP0A 3RPOA 2OK1A 5C8KA 2B1PA 3IW6A 1XKKA 3DA6A 3BI6A 4MNEA 4I6QA 4B6LA 2CCIA 4ZZOA 5GNKA 5IQCA 2VV9A 3SXRA 4FTMA 2GS6A 5EDQA 4N70A 4AU8A 2KTYA 3TKUA 3VW6A 1H08A 5H9BA 3BU6A 1OBDA 4WD5A 3U8WA 2JAMA 5CALA 3U6JA 3UPZA 3HRBA 1PKGA 2WFYA 3RJCA 3FZRA 4ZTSA 3W32A 4AA0A 4CFXA 1H0VA 4QYEA 4F9CA 5DNRA 3UZPA 4HVIA 4XBUA 2UW3A 4E5BA 2YDKA 4ZY4A 2ZV9A 4I0SA 3S1HA 4V0GB 4DEBA 2LAVA 5BVWA 3MW1A 3L9MA 4EK5A 2J0LA 3UBDA 5JZJA 3O8TA 4NIFB 5JFVA 1Q61A 1OMWA 2UW7A 1YI6A 4EH4A 3LFCA 1E9HA 3V6SA 2R0UA 4PTGA 4BRXA 4D5HA 2PPQA 3DBFA 2G01A 4W4WA 2IZTA 5DFPA 2O8YA 5M07A 3LFSA 3C5UA 4KD1A 4WSYA 4RWJA 1K3AA 4PP9A 2Z60A 2XUUA 3EFKA 3QQKA 3R6XA 1VLRA 4QMOA 4FOCA 2RF9A 4GG5A 4DH7A 3CBLA 2VWBA 2V22A 4E1ZA 4IW0A 3HAVA 5G1XA 2VAGA 2YN8A 4G5PA 4XV9A 3NGAA 3R7VA 4U43A 2OXDA 4O0YA 2YWPA 3PJ3A 4KNBA 3R22A 2HY81 1H25A 4O91A 3QKLA 4A7CA 2B9IA 4CRSA 3LE6A 4X6QC 3TUDA 2O5KA 3BV3A 4TN6A 3PVWA 3FZTA 1OIRA 4OTFA 4BDBA 4ZIMA 5C01A 4ALUA 2P2HA 4H1JA 1YW2A 2W4KA 3LLAA 5CF4A 4TL0A 3Q32A 1CKIA 2ZM3A 2BRNA 4NH1A 2AEGA 3MY0A 2CN8A 4C3PA 1IEPA 2IVVA 4FT9A 3UMXA 5CXZA 4FYOA 3ZH8A 3BLRA 3FKLA 5EI6A 3DBDA 3P08A 4D9UA 4EH7A 1XH6A 2YM7A 5EM6A 3TV4A 2RKUA 4EHZA 3HMIA 4NJ3A 4G3CA 4R1VA 4BCJA 1PYXA 4KKEA 2OIDA 5KZ0A 3EJ1A 2UW8A 4JBQA 3CEKA 4BDGA 1J3HA 4M0YA 3WILA 4HVHA 2FSMX 4QMNA 2ZAZA 3TKHA 4ZLYA 1H26A 3O96A 1UU8A 4USDA 4KUJA 2VX0A 2R3GA 3ZS5A 1H01A 2V7OA 2UZTA 4E4MA 3RWQA 2UZEA 5HE3A 5AUWA 3R9DA 3MH0A 2PHKA 5FEEA 4AF3A 1IR3A 3ZFYA 3PXZA 2WIPA 5AP5A 4ZEGA 2OICA 1Q8UA 3QX2A 2B9JA 2ZDUA 3ZUUA 4I6LA 2G1TA 3FPQA 4YSJA 4PQNA 4YJQA 3DOGA 5CY3A 2J5EA 4FTRA 3UMWA 4RVTA 4HPTE 5BVOA 1XMMA 4GH2A 1ZZLA 5CLPA 2PE2A 3Q4TA 4GVJA 2A27A 4QTEA 3DJ5A 1NW1A 4UZHA 4E6CA 4ERKA 2XK3A 2C5OA 1NVRA 3C0IA 3MPMA 4FT0A 4JLCA 3DAJA 3ORXA 3CLYA 2VX3A 4W8EA 2J9MA 4ZXTA 4FV1A 2VTAA 2CJMA 4FTKA 4R5SA 4KKHA 4GKHA 5ANJA 3FQHA 4G6LA 2O64A 4S30A 3QTSA 4IX3A 5ANIA 4ZS4A 2G2FA 3PRIA 4RVKA 3LCDA 5F95A 2XIYA 4U40A 5IA1A 2B4SB 3CY3A 2WMVA 5FBOA 4D4VA 4DFYA 4X2JA 4IAYA 3MI9A 3HL7A 1IA9A 3A7GA 2WTWA 3PXFA 2C68A 4B7TA 1YXTA 3MFTA 3WZJA 2BHHA 3D2KA 4JNWA 5FXSA 5CQWA 3W2QA 4DITA 4O0XA 3FLNC 3A4OX 4L8MA 1V0BA 2WEVA 4RIWA 3GCQA 5AUUA 5LWNA 3VF9A 4AOIA 2QI8A 4JT3A 3AKJA 3ATSA 3F3ZA 4XJ0A 5EW8A 3Q52A 3EQCA 3JVRA 4LMNA 5FM2A 3AD5A 4I0RA 3P23A 4C37A 3AC2A 2IVTA 2PVJA 3MV5A 4XS2A 4CFFA 1MRYA 2C3IB 2CGUA 3RK5A 4G6NA 2Y9QA 4LRMA 4FKOA 3QU0A 2GQRA 3BYOA 5E90A 5HO8A 4MQ2A 2QOOA 1GNGA 4CFNA 4WT6A 3KXMA 4XCUA 2WMRA 3MVLA 4RC2A 2GFSA 4O84A 3KIOC 2Y8OA 4U3YA 5IQBA 2XS0A 5C8MA 5T6KA 2GNHA 4Z7GA 2PUPA 4F6WA 5IQFA 4CZUA 1PMNA 3QD2B 4ZJJA 3WF5A 4N57A 3F88A 4YGAA 4C33A 3R01A 3ROYA 2X81A 1K9AA 4FR4A 2R3JA 3BU3A 4FC0A 3IW7A 4E5AX 3L8PA 4QMYA 4A4LA 3H0ZA 4DAWA 5CVGA 2R3NA 4KS8A 1XHAA 1KOBA 3QUPA 5DIAA 1UV5A 2C6LA 1XH4A 2FSLX 4BTFA 3KMUA 4U97A 1UKHA 2EWAA 1AD5A 1M2RA 2YM5A 3U9NA 4F99A 4WG4A 2FB8A 2QKWB 3PG1A 4IM0A 5CTPA 4HVGA 5HZNA 4E73A 3C9WA 4YSMA 3D5VA 4W4XA 4CG9A 2R5TA 3PPKA 5E8XA 5A4TA 4MXXA 3QRTA 3VHEA 3G51A 3Q6WA 2H34A 4QNAA 5CF8A 5HNIX 4XOYA 2GTMA 3FLWA 3V5LA 3AKLA 3PFYA 2YZAA 3FMKA 5IEVA 4UBAA 4RQVA 4AT5A 4QMUA 2F7EE 4M84A 3MIYA 1F3MC 5IUHA 2G9XA 3OOGA 1OKZA 5FXQA 5DOSA 1WBVA 4BJJA 2QO2A 4FV2A 3QTIA 3TJCA 4ASZA 2QU5A 1ZAOA 3ZTXA 2QNJA 1BI8A 4P5QA 4IE9A 3EFLA 3QGYA 4LFIA 3FLQA 5C8NA 5FDXA 1GJOA 4NW6A 4I0TA 4CKJA 3FYKX 1OL7A 4FIGA 3OT3A 3RWPA 1JNKA 4O0TA 2X1NA 2JKKA 3GGFA 4IIRA 3KREA 3EL7A 3L9NA 4UALA 2ZJWA 3EIDA 5EHLA 3ZBFA 4YURA 2CLQA 1MRUA 4ORKA 4G34A 4DH3A 3LOKA 2P33A 2RFDA 3BGZA 4L43A 3FZ1A 4DGLC 2VWXA 3P5JC 4J8NA 2WMAA 4S31A 3V8SA 3UIMA 4J52A 4MXZA 3PXYA 4C4FA 2YM3A 3BWJA 5E8VA 4FEUA 5HLPA 4ERWA 5T68A 3FL5A 4K2RA 4F9YA 2ITQA 3POZA 5IUGA 3AT3A 1WAKA 3DT1A 3NW5A 3R8MA 5FBNC 2YIQA 3FI2A 3CTHA 3W33A 3I6WA 3RAWA 2X8EA 2UW0A 4D9TA 1ZXEA 3BYSA 3IW8A 4DBNA 1OKWA 2OIQA 4DTAA 3FUPA 1WVYA 2BIKB 4GFGA 5M09A 3LFAA 2Y4PA 3POOA 4J53A 5LCKA 4XNEA 3SQQA 4NYEA 5EI8A 4BCGA 4E6AA 4N6ZA 5KHWA 5IQAA 1OKVA 4EORA 5AP6A 5CSPA 3F7ZA 3DY7A 4EHVA 3CKWA 1NA7A 1OL2A 4LMUA 4ZTNA 3UO5A 3NWWA 2QHMA 3DV3A 3NYOA 4YJPA 3UIUA 5KMKA 4E7WA 3MVMA 3GU6A 2C4GA 3OFMA 4G31A 3JVSA 5EKOA 3IG7A 4DH8A 1O9UA 4ANQA 1GY3A 3MTFA 2WTJA 4FKGA 3ZEPA 3F2NA 4FKLA 3GXLA 4IAFA 4X21A 5CT0A 4EEVA 3OS3A 3IDBA 1WBTA 4JRNA 1P2AA 4MK0A 2FA2A 2A2AA 5EOBA 2C69A 3O17A 4L00A 5AEPA 5AP7A 2A4LA 1YVJA 4PDOA 5HGIA 5F20A 3RZBA 3LFBA 4DG0E 4DFXE 4MBJA 4E4NA 1WBPA 1FMOE 2EU9A 3D94A 1Q8TA 3G2FA 2F4JA 4QMSA 3EMGA 2PZ5A 5G6VA 3CQUA 3A8WA 3COIA 4IZYA 3GP0A 3BU5A 4XV2A 5AV0A 4I24A 3RK9A 1G8JA 4XH6A 2R3IA 3TZMA 4S32A 2WGJA 4LGGA 3V5PA 2ITXA 4JI9A 2ZB1A 4FSZA 4EL9A 1TKIA 4G1WA 2PY3A 3H9RA 4XOZA 3FYJX 5HQ0A 1H1PA 5I9XA 1H4LA 2CN5A 2HK5A 2XJ0A 4IDTA 3U55A 4FT5A 3VBXA 3PG3A 3UDSA 3DKOA 3DKGA 4J71A 4IWPA 4X3FA 4YZBA 4LQMA 3WF8A 3CGOA 3AGLA 3BIZA 4OTHA 5BNJA 3BQCA 3VS7A 5M4CA 3TZ7A 4BCPA 1KOAA 3TIYA 2QC6A 2OZOA 2ZVAA 3BYMA 1NT2A 4TYJA 4RX5A 2Q0BA 4CTCA 4FEXA 1NVQA 5CEMA 2JBPA 4CGAA 2BUJA 3E8EA 3SD0A 4F7LA 2C5XA 5L2IA 4I5CA 5DT3A 4BDEA 2IW6A 2C5NA 3EQHA 2VO0A 4EH8A 3O23A 2CMWA 3F3UA 4FV6A 3R8UA 4FSRA 3U4WA 3AOXA 4KB8A 1R1WA 4AOJA 2R3PA 5LMKC 3ATTA 2VWYA 3SOAA 4EONA 5BVFA 2WOUA 3QYZA 5CU4A 2RFSA 3AMAA 3DXQA 2WQEA 2ITZA 3D7TB 4YBKA 5F9EA 3VUMA 4H05A 4F64A 1JVPP 4RIWB 3SOCA 4FEWA 2XA4A 3OWLA 4N4SA 3K5UA 3DZQA 2PSQA 1WVXA 4WG5A 4I6BA 5AX9A 3HP2A 4EK4A 2WTKC 3A7FA 5KMNA 2RG6A 2G15A 3HMPA 5M51A 2CGXA 1LEWA 3SG8A 1LEZA 3KVXA 1A9UA 4Y83A 4ZLOA 2C6IA 3KXXA 1JSUA 2ETMA 2OFUA 3G6HA 3LXNA 2ETKA 1E1XA 1SMHA 3NIEA 4FIIA 4IC8A 5EHOA 2FVDA 2F49A 3VNTA 4G6OA 1M7QA 4E93A 2J5FA 1P4FA 4RJ4A 5GIPE 2W1FA 2ITNA 4BDIA 3HV3A 2JD5A 4BYJA 4YUQA 5I9ZA 3PLAE 2WQMA 3CQWA 4IZ7A 2C30A 3OZ6A 4TWOA 3UC3A 4EOMA 5CEIA 3UNJA 2OJJA 3HMMA 2W4OA 2YABA 5CSXA 4DEEA 2GS2A 2PE0A 2BHEA 2W5AA 5AFVA 5DN3A 4GK2A 1OL5A 3RGFA 2CLXA 3R9OA 3DLZA 4O6EA 5E8WA 2NRYA 3CPCA 3HYHA 3LMGA 4HZRA 5CAUA 4MH7A 4BCMA 5HBJA 3EZVA 5BPYA 2PZRA 4TYIA 2PULA 1PXNA 3E7OA 3OW4A 3Q9XA 4ANMA 4F09A 5M08A 1BI7A 1CDKA 3GUBA 3OTVA 2I40A 4FVPA 4YLJA 2B0QA 1IG1A 4U41A 5BUEA 4EYJA 2ZM4A 5CI6A 3HEGA 4P5ZA 4V0GA 1ZOEA 3KF4A 3OROA 4M7IA 3FSKA 3MFRA 3ZU7A 3BKBA 2QO9A 3TJDA 4AA4A 2EUFB 3D83A 5CSWA 1XH7A 3AT4A 3CJFA 3FZOA 2E9UA 3KXNA 4C4HA 3DAEA 4EOLA 4UWBA 3UVQA 4EH6A 4YP8A 4F4PA 1URCA 1UNHA 3DTCA 2VTHA 3KULA 2GDOA 2E2BA 1I09A 3LJ0A 3R2BA 4KA3A 4W4VA 2GPHA 5L2TA 2OJIA 2X4FA 3H9FA 1WBWA 2YM8A 4HGEA 4JS8A 4IADA 4RX7A 3CSVA 4U7ZA 2IZSA 2W9ZB 2GNJA 3ID6C 5KKRB 2BDWA 2PMLX 3I81A 4B8LA 2XIKA 2GNFA 2Z7QA 5EQPA 2QODA 5L6OA 4MD9E 2GS7A 1R78A 3RM7A 3JS2A 4PL3A 5EYMA 3KY2A 4D55A 5IPJA 1PMVA 3V3VA 3F7WA 2Y4IC 4BYIA 4JIKA 3OW3A 4MXYA 3T3UA 4DEGA 3TV7A 4PMMA 3DB6A 2R3LA 4WBBB 3T8OA 4CFMA 3MWUA 3ZO4A 2HWOA 3QUDA 4RC4A 3AGMA 3V04A 2CKPA 1R3CA 1XWSA 4J97A 5CEQA 5HVYA 4BCIA 3SC1A 4XV1A 2YITA 4OLIA 5FTQA 3HA6A 3KMWA 5C03A 1DS5A 2J0MB 3HNGA 4GU9A 4K6ZA 5HG7A 3VS2A 4FTQA 4EZ5A 3OWPA 3DU8A 2BCJA 3AC5A 5CF6A 4WKQA 1VR2A 4QP4A 3FI8A 4GW8A 1A48A 2W1ZA 2UV2A 2JDTA 4RIOA 5D1JA 1UNGA 5E1EA 5JZNA 3NAYA 3FMEA 3H10A 4YHJA 3BV2A 4D4RA 4BTJA 3RK7A 5CU3A 5TOZA 2QURA 3P86A 4JG7A 3MY5A 3ZRKA 5HIEA 3QRJA 4USEA 5JGAA 4RWKA 3RNIA 3W0QA 2GCDA 2ZM1A 1OUKA 2C0OA 3HMOA 3TNWA 1Y6AA 4RWLA 2W0JA 3UVPA 1OIQA 4FTLA 2ZMDA 4NTTA 3C1XA 3EQDA 1R39A 5IUIA 4CLIA 5EM5A 3R73A 1QPEA 4RLLA 2B9FA 4Y85A 4EK6A 4EOOA 5EM7A 3A7HA 3UQFA 3DDPA 5ETIA 3RAHA 5ICPA 5EYKA 3FMLA 3HUCA 2PMOX 2ZMCA 2GTNA 3MA3A 3CJGA 3LCSA 4DLJA 5AAFA 3HDMA 4RJ8A 4NCTA 5IDNA 4KIPA 2ONLC 4ZSEA 4JR3A 1H28A 2R0IA 5I9WA 1KUTA 4J8MA 3PDTA 4RC3A 4TYGA 3D9VA 4ZS0A 1H0WA 2ITWA 3ZM4A 2YACA 4O2PA 3U4UA 3PUPA 5FQDC 2IO6A 4IVAA 3SDJA 4EJ7A 4MBLA 4IX6A 5CQUA 2KULA 4MWHA 3FXZA 3MIAA 5A4QA 3AD6A 2BRMA 3R8ZA 1J1CA 4JMQA 3PXRA 3ODYX 4O96A 3W8LA 3R9NA 3EQBA 2VD5A 2ERKA 3ALNA 3KXGA 1DM2A 4FTCA 3FL4A 4L67A 4QQ5A 4QNYA 4ZJVA 2AYPA 4HVSA 2YJSA 3ZSHA 1OPKA 3CIKA 2A1AB 4EBWA 4R7BA 4EK3A 2YAAA 2GU8A 4IB5A 5EG3A 4BR3A 3TCPA 3AT2A 2AC5A 4X3FB 1AGWA 3AC8A 2YCSA 2ZB0A 1HCKA 3FMJA 3KK9A 2I0YA 2X8DA 3WOWA 4BDJA 5H8EA 5J1VA 5F1ZA 4MTAA 3ZDUA 4V01A 4Z16A 3I5NA 4O0VA 2WAJA 4ITHA 2Z7LA 4O7VA 3ZLSA 4PUZA 5L8KA 4FKIA 1ERKA 3EL8A 4OW8A 4EWHA 2IVSA 2CKQA 1U54A 1UU9A 2VWIA 1QCFA 2UW6A 3O0GA 4JDIA 2PVFA 2I0EA 1S9JA 3B2TA 3W1FA 5FEQA 2LGCA 3ANQA 5D7VA 4OR5A 3BLQA 1GAGA 2R7IA 2X6EA 5E4HA 4AX8A 4E8AA 3ENHA 4O7NA 4I1ZA 5AV1A 3GOPA 4K33A 3WE8A 3Q04A 3KK8A 4EC8A 5I0BA 4IWDA 1OB3A 3DBQA 2OJGA 4XRJA 4J95A 5KE0A 4A4XA 4DCEA 5C1QB 3A99A 3BEAA 1Q4LA 3WF7A 5EI2A 5LVNA 4CRLA 1RE8A 4FICA 2YHVA 2PZPA 3TNPC 5LVOA 3S0OA 4YJTA 2RIOA 4DEDA 5DRBA 2OKRA 5LVPA 3QD0A 1QPDA 3HKOA 3AG9A 2Z8CA 2HZ4A 3HZTA 3DGKA 3QRUA 5CXHA 4O2ZA 3UNKA 4UV0A 1XJDA 2PWLA 3AC4A 4BI2A 3F5UA 2UZBA 4NKSA 3UDZA 5IDPA 3NUYA 2J90A 2VRXA 2WTIA 3VAPA 5KMJA 2WMQA 5E8ZA 4FZ7A 2IJMA 3H3CA 2R3RA 3P1AA 5A4LA 2XCKA 4NUSA 3RCJA 3DPKA 4AWIA 4M15A 4YC8A 4UX9A 5D41A 2WEIA 3FLSA 2JAVA 1PMEA 5C4LA 3RAIA 5KBRA 4FSTA 2JIVA 1F5QA 3COMA 3VONA 2FYSA 5CAOA 2XMYA 2PUNA 4NFMA 5ETAA 4ACGA 4ASXA 3MS9A 4CT1A 5EKNA 3DCVA 4IVCA 4X2NA 1ST0A 3PVUA 3QZFA 4YZCA 2XB7A 3EHAA 4YJVA 2BRGA 3F3WA 3G33A 4OTGA 4I6HA 4E20A 4F7SA 2XNBA 1HOWA 5HBEA 4QP1A 3TV6A 3NUNA 1Q3WA 5BVNA 4PWNA 4WNKA 5IZFA 3DLSA 4A9SA 2YZLA 4ANSA 5DG5A 3SRVA 1B6CB 2RFNA 2XIZA 2XZSA 3FBVA 3HX4A 5HEZA 2QLQA 2DYLA 3VS5A 3ODZX 2V5QA 2G2HA 4MVFA 4OTWA 2WU7A 4FTTA 3TT0A 4GJ2A 2VWUA 3R28A 3CE3A 1JBPE 4J1RA 4MKCA 4R5YA 5AM7A 1LR4A 5IEXA 4GT5A 5TT7A 3MB7A 4IBMA 5H8GA 3SA0A 3SW7A 2PMNX 2VTRA 2PU8A 3KN5A 4R3RA 5AADA 3B2WA 1KE8A 3Q9YA 1FBNA 4YNOA 3UQGA 4YTCA 4DG2E 3PE1A 5JFXA 2W17A 5HU3A 3CP9A 4QEBA 2GNGA 5AV2A 2H6DA 3ZRMA 4AW0A 2OI4X 4J98A 4FTOA 2A19B 1S9IA 3ORTA 2VWVA 1MQ4A 2J51A 5IA2A 1CM8A 3KULB 3EN9A 3MY1A 1UU7A 5D12A 3BBTB 5CENA 3TUBA 3QCYA 1YWRA 5CU0A 5H2UA 3E64A 4ID7A 3LJ1A 5JRQA 4L3PA 5AP0A 1PXKA 1FINA 1JOWB 3LQ8A 2HYYA 2I7QA 3FMDA 2PE1A 2BKKA 4TYEA 4TNBA 3EN6A 2YM6A 3OWKA 3OBGA 1ATPE 3PE2A 2JIUA 3R9RA 3Q5IA 4D58A 5AIKA 1JAMA 3MTLA 3OCBA 4YO6A 1YQJA 5CU6A 4U44A 4AXFA 2CSNA 3NFFB 3FLYA 5EQYA 4GFMA 4JDKA 3QZHA 4FVRA 4ZY6A 3PLSA 4YMJA 2XAMA 2IN6A 3O71A 3ORIA 4AXAA 1ZMWA 2F7XE 3PY0A 4L7FA 3AXWA 4XP0A 1YXXA 2DUVA 4NL0A 4FSNA 3UDBA 3OEFX 3UJGA 1JPAA 1Q24A 2JIIA 4X2KA 3LVPA 4NZWB 1FGKA 4XBRA 3IW5A 2C1AA 4I5MA 3NR9A 3QTXA 4WG3A 3BYUA 4C59A 1H00A 3BELA 3TWJA 1XH9A 1APME 3TDVA 1M7NA 4BB4A 3PVBA 1FVRA 3TACA 3VUKA 2BFYA 3C4FA 4PNIA 1Q62A 3GC9A 5AWMA 2QLUA 4G2FA 2P2IA 1Y91A 2YDJA 3KRRA 4OBPA 4O86A 5BVDA 2J0JA 4Z55A 2Y0AA 2ZV8A 4FKSA 4KAOA 3WZUA 4QTCA 5IA0A 3OP5A 2PUUA 1UWHA 3EYHA 4FTNA 2XVDA 5FUTA 1OL1A 3EN7A 5E1SA 3R9HA 5DVRA 4C58A 3QCXA 2F7ZE 3M11A 4D5KA 3C4EA 2OG8A 2I6LA 4MD8E 5IU2A 4CKIA 2VTIA 2B9HA 4UN0C 4AAYA 5HTBA 3ZFMA 2VO6A 1ZOGA 1PJKA 4AZTA 3OOMA 5JQ8A 4GIHA 5DE2A 3W2OA 1ZZ2A 3OTUA 1JWHA 4FK6A 1VJYA 1TVOA 4RJ7A 4FGBA 3BGQA 4XG6A 3KXHA 5AP1A 3W10A 4EBVA 4CMTA 4YJRA 5I9VA 3R1QA 3UP7A 4FEVA 4G16A 4IHPA 3LM0A 4J96A 4A9UA 4AA5A 4TNDA 3FE3A 5A14A 1OL6A 3QC9A 2W9FB 3G0FA 3V01A 3VBTA 5KMOA 3VBQA 5IMEA 4IJ9A 1YWVA 4IAIA 1JSVA 5TF9A 5I9YA 3W16A 4F70A 2WTVA 1J1BA 3A8XA 2XNPA 1O6YA 5EOLA 4NU1A 4DDGA 4CMOA 3QF9A 3AMBA 5JH6A 5EDPA 4IZ5A 2EVAA 4FMQA 3PPJA 2REIA 3LIJA 3Q60A 2VTPA 3S00A 1WVWA 4FL3A 3QKKA 3NAXA 4IFGA 3ETAA 4QMLA 2X7GA 4AFJA 1JQHA 2YIRA 3LW0A 3D7TA 3QTWA 3CPBA 2J7TA 4NM7A 4FV3A 4NTSA 2HWPA 5M53A 5HE2A 3C7QA 5E8UA 2VUWA 5LMAA 2R3OA 4PV0A 2PZYA 4NKAA 2A0CX 4TXCA 3ZCLA 1PXOA 1WZYA 4LOQA 1GZOA 1U54B 2HCKA 4QTBA 4EH3A 4ZSAA 5JMSA 3D4QA 5HCZA 2OH0E 3F82A 1DI8A 1UNLA 1XBBA 2WD1A 4GK3A 4QMWA 4W8DA 3N4UA 5GJGA 1FVTA 4FZDB 4HCUA 5T3QA 3DZOA 1UKIA 5DH3A 4DINA 5K4JA 3KEXA 1YOJA 3R04A 4QPAA 5E8YA 4GKIA 5LVMA 1JKTA 3PUFC 5HX6A 4GL9A 2YM4A 2UZLA 2WKMA 3BYVA 4Y46A 4DHZA 3BBWA 3DAKA 3OCGA 3ZUVA 1SVGA 4L44A 2OZAB 3I1AA 4FNZA 2JBOA 3UZTA 5DR2A 3BE9A 4KIOA 1SZMA 3DFCB 4S2ZA 3UGCA 3BHUA 2O3PA 5L6WL 5L3AA 4E6QA 4A07A 3QWKA 4RVLA 3E63A 5FRIA 4BZDA 4DEIA 4O7SA 4DG3E 4QMXA 4LUEA 4YC3A 4ZTRA 4BI0A 5F94A 4CKRA 4BIDA 3TZ9A 1Z5MA 4U79A 4X3JA 2BZJA 3FAAA 3V5QA 3E8DA 1YHSA 3LFNA 3QTRA 2ITTA 4LM5A 4FV9A 2HZNA 4PX6A 3L9LA 3VJOA 1YWNA 4IANA 4RJ6A 5JFWA 2X7OA 3EQIA 4G9CA 4QMVA 3FMNA 3DK6A 3HMNA 1OIYA 3WE4A 3UDTA 3E8CA 4BBFA 2V62A 4X2FA 3OEZA 4FZ6A 5KBQA 3TKIA 1ZARA 4MQ1A 1KE5A 2XJ1A 3FQEA 4EHEA 1YHWA 4LOOA 4OT6A 4ASEA 3P7AA 4XUFA 2B54A 4G9RA 3R7YA 5KUPA 4JOAA 4JBOA 2BZIB 5FGKA 5EHYA 1U4DA 2ITPA 1KSWA 4ZSJA 4F9AA 3ZZWA 3D5WA 1JKSA 4FIHA 1WCCA 3GCSA 4QYFA 3SRVB 4UZDA 4YU2A 1URWA 4DTBA 1KWPA 3C13A 4EOPA 1PXLA 4QTDA 3ZC5A 3G5DA 4BKJA 5DLSA 1ZYLA 3NZ0A 2VX1A 5CEPA 4WBOA 4L9IA 5CZHA 3I0QA 2C0TA 1QPCA 3PY1A 3JPVA 5JGDA 5LWMA 4G17A 4FYNA 3N9XA 4ZY5A 3ZLYA 1ZYSA 4I5PA 1WFCA 3AQVA 3BCEA 5B0XA 4FV7A 4U5JA 5AV3A 4AT4A 3B8QA 4E4XA 5IF1A 2X2KA 5IQIA 4IB1A 4PDPA 3PXKA 4RSSA 1PYEA 1FPUA 4HCTA 3OXIA 3G9LX 3W55A 4M69B 1YXSA 4CVAA 4MHAA 5BYZA 3S95A 5E92A 4NM3A 1G8AA 3DXNA 4TZRA 4BN1A 4FA2A 3JR1A 4MXCA 4KSPA 5HIDA 3ZSGA 2JFMA 2BPMA 4RIXA 4AN2A 1EH4A 3KL8A 3LHJA 3LMIA 3VRYA 2VTMA 4K77A 5E8TA 2CKOA 2W06A 2WMUA 5TR6A 4DFZE 3E87A 4QMTA 5DRDA 4RWIA 4TKSA 2W99B 4TWNA 3NLBA 3W0SA 4YJUA 2UZUE 4WNPA 4WNOA 1L3RE 5GJDA 4AXCA 1KE7A 4H3BA 2ITOA 1FVVA 1W0XC 1OPLA 5HD4A 5IA5A 5L8JA 3TIZA 1YOLA 2XNEA 5GIOE 4D2SA 2BILB 3O7LB 2C6TA 4M3QA 3TZ8A 5ETFA 1ZY4A 4A06A 4DF3A 5JFSA 4LOPA 4IFCA 5FEDA 3S2PA 4FEQA 4RMZA 3FXXA 3Q4CA 3BL9A 4II5A 1T45A 2VGPA 4CFUA 3PTGA 5AUVA 5KMLA 2RGPA 3MPAA 4FX3A 3UC4A 2DWBA 2JFLA 2P55A 4FKRA 4ARKA 5FXRA 5K5NA 4CTBA 3L8SA 4IWOA 3U54A 2CNQA 4G3EA 4EK8A 3UOHA 2XEZA 5AM6A 2YERA 4Z7HA 4XLIA 3R2YA 2E9PA 5CF5A 4CQEA 3GNIB 4HGSA 3TNHA 3QGWA 2PYWA 4GYGA 3A61A 3QQFA 3MH1A 4AZSA 4H3QA 4H39A 1W82A 4FL2A 3RNYA 3VS3A 3ZSIA 4AN3A 2WMTA 4APPA 2PVRA 3C5IA 2GQSA 3BX5A 1H1QA 4NT4A 3RINA 4APCA 3R71A 1GIJA 3CS9A 1CSNA 2ERZE 2RG5A 4QQJA 4TRLA 3PJ1A 3RPRA 4ALWA 4TYHA 4MEDA 3BHHA 4EOQA 2C1BA 1MUOA 2B7AA 4HVDA 1ZMVA 1YRPA 3CKXA 1X8BA 3R63A 2C6EA 2H8HA 3GC0A 3NUUA 2UVYA 5IA3A 1SM2A 4ZTQA 4R77A 3KGAA 5HVJA 4AGCA 2WU6A 4YBJA 4AE9A 2C47A 2QOHA 3PJ8A 4R7HA 4ZK5A 4BGGA 3UIXA 1H1SA 2BRHA 5HIBA 3QWJA 4QO9A 2PVNA 2J0IA 3G6GA 3R7IA 4PY1A 5BQ0A 3TMOA 4FZFB 2WIHA 3MFSA 1TQPA 5JN2A 4RGJA 3VBWA 3VUIA 1H8FA 3MH2A 4FODA 1LP4A 4LRKA 3H30A 3KKVA 4R1YA 1XH8A 3R0TA 4CXAA 2Y6MA 5J95A 2P3GX 2I0VA 2OJ9A 3K2LA 2CPKE 5DR6A 3SGCA 4HYSA 3Q53A 1H1RA 2EXMA 4DFUA 1YDSE 2VTOA 3GCUA 4FNXA 4FT3A 4RFMA 3R7EA 3VQUA 4C7TA 3NEWA 4YPDA 4OUCA 5ITAA 3VIDA 4ASDA 5KX8A 4YO4A 1UA2A 4L53A 2GHMA 2R3HA 2QD9A 3HUBA 4Z9LA 1Q8YA 4A4OA 3D0EA 2XM9A 3CR0A 5L6PA 3IKAA 4YC6A 3U9CA 2WOTA 3I6UA 5D9HA 3TM0A 3WYXA 2B53A 2FSTX 4I3ZA 1KV1A 4N6YA 3ULIA 3PA4A 3EQGA 3HGKA 1UU3A 2XH5A 3T3VA 3FXWA 4GT3A 2ETRA 1A06A 3NNWA 4PNKA 4F0GA 3EYGA 4IAAA 1SNUA 4M8TA 4I22A 4G5JA 2R3KA 2PVLA 2C6OA 3O8PA 5CASA 1GZKA 1U5QA 2UZWE 1OECA 1OBGA 3A4PA 5EQEA 3JY0A 2JLDA 3RP9A 1OKYA 2XK9A 3PYYA 2PZIA 3DXPA 4L45A 1H07A 3OBJA 3RCDA 3CD3A 3VS1A 4ACCA 3MFUA 3RHKA 5DT0A 5I4NA 4HNFA 2XARA 2XRWA 4MXAA 3UODA 2GNIA 2NO3A 4JQ8A 3QZIA 3P0MA 3VUGA 3PWDA 1OGUA 2GMXA 3NYXA 3QBNA 3QQGA 4YTIA 5J1WA 5DR9A 3BHVA 4CLJA 4K8AA 4C2WA 4IVBA 2FSOX 3F5XA 2BFXA 4RFZA 4I4EA 4I94A 1ZLTA 5JSMA 4EQMA 4QP9A 2QG5A 2O65A 3O50A 4FV0A 4XG2A 2I0HA 4DGNA 4FKJA 4I92A 3TXOA 4EC9A 3HV6A 3QC4A 2CGVA 4ZSLA 2OO8X 3FEGA 3ZFXA 1W98A 3FMMA 4F63A 2DS1A 3N4VA 4AZEA 5AV4A 2OF4A 3RPVA 3PVGA 4RJ3A 2R64A 3U6IA 3Q9WA 4I21A 2PVKA 4C3FA 3EQRA 2C5YA 3COKA 2V55A 4XG3A 1J91A 5J7HA 3GCPA 5FG8A 2UW5A 3H0YA 4UXQA 2XRUA 5AX3A 4FSMA 5HG5A 4E6DA 3DKFA 4BGHA 3TNQB 1GOLA 1XH5A 4RA4A 3E7VA 4AW5A 2VTQA 4NFNA 3C50A 4MX9A 5GINE 4ZMFA 2F9GA 5TKDA 3ZXZA 3PPZA 2VO3A 3OHTA 4PDSA 1KV2A 4EWQA 4KKGA 3UOKA 3VVHA 2WNTA 4F9WA 4ACDA 4PMPA 1XO2B 5IISA 3UQCA 2XKEA 2FH9A 2VN9A 3TL8A 5E7RA 2CGWA 4P7EA 4AS0A 2IG7A 3SVVA 4CZTA 1IASA 5CS6A 3FHIA 3ALOA 5HBHA 4IM2A 4Y73A 4GEOA 4U45A 4BTKA 4C35A 3M1SA 3BE2A 4O83A 4FNWA 4HGTA 5BYLA 2GSFA 3QRKA 3LFEA 1PRYA 4FKWA 2OSCA 3TG1A 1GIHA 4G3DA 3HA8A 4L52A 5K3YA 2OXYA 2YCFA 4RIXB 3ITZA 4UXLA 3OF0A 4BZNA 4EOKA 2XK7A 3DTWA 4MF1A 2DQ7X 2GFCA 2BIYA 3TNIA 4M67A 3E92A 2XALA 4EHGA 2YCRA 2FGIA 5J5SA 2X6DA 3LFQA 4D1ZA 4BBMA 3UYTA 2RL5A 5M06A 1STCE 4V04A 4XMOA 2CKEA 4F6SA 4H1MA 5CEOA 4FIFA 4FKQA 3KQ7A 1DAWA 4UB7A 2VU3A 2VWWA 3GU8A 2O2UA 3ORZA 3ZUTA 4EQUA 4FUYA 3DFAA 4E4LA 3VS6A 4EOJA 4L01A 1O6LA 3R83A 3VUHA 2QR7A 3NX8A 5J9YA 4NWMA 3FJQE 3D14A 3KB7A 2YIXA 2XK6A 3ZEWA 3KN6A 1M2PA 2WHBA 2XAOA 3RKBA 4RQKA 4UWYA 4Z3VA 3ACJA 1BYGA 4FBXA 3FLZA 4FV8A 5CYIA 3QYWA 4YZDA 5HE1A 5LOHA 3WZKA 3RM6A 4DDIA 3UNZA 4ALVA 4JDJA 5DA3A 2QKRA 5L8LA 5ANDA 2ACXA 4M13A 2X0GA 3IPHA 4MNFA 3IONA 5CNOA 5CVHA 3S3IA 3VBYA 3W0PA 4D0XA 3KXZA 1TQMA 4DBXA 4DE4A 4Y8DA 4FKPA 3HV5A 3TEIA 2XF0A 2GHLA 2VTJA 2H9VA 4AAAA 3FI4A 4E5WA 2XKDA 3QTQA 4ZLZA 4GS6A 5CAPA 3E62A 2Z7RA 1I44A 4EH9A 2YA9A 3DDQA 4XRLA 2PVMA 4ZAUA 4GYIA 4ZTMA 4GV1A 4BC6A 5FD2A 4WUNA 3FZPA 4L42A 4TYHB 4FG7A 4KBKA 4BI1A 2BZKB 5I9UA 4DGMA 1PHKA 2ITYA 3VO3A 1L8TA 3F66A 1G8SA 3VW8A 5KMMA 1HCLA 1SVEA 2W1GA 4YPSA 2VTLA 3T9TA 3NS9A 2C5VA 4UWCA 4QOXA 2VNWA 3G0EA 4EH5A 4C2VA 5HORA 2HIWA 2F57A 2OJFE 4ZZMA 4GU6A 4O21A 4IB0A 3F5PA 4QP7A 3M42A 4AQCA 1MRVA 1R0PA 1ZRZA 3QLFA 4U42A 1Y57A 5A4EA 1T46A 3VBVA 3IQ7A 3OUNB 3I4BA 3GFEA 1BLXA 2BAJA 2QOKA 4J7BA 5D11A 4ACMA 5L2WA 4O6LA 3KFAA 4YLKA 3SLSA 3K3JA 4RX8A 1VZOA 4GCJA 4JG8A 5JEBA 3O51A 5C26A 4G3FA 2UVZA 4LGHA 3ORLA 2OZAA 2PL0A 4K0YA 2R2PA 3M2WA 4I6FA 4L3JA 4RLKA 5FTOA 2SRCA 3NW6A 5HE0A 4WIHA 1LUFA 1QPJA 4OBOA 3R8VA 3QD3A 3H4JA 1B39A 3SW4A 3NMUF 3ZMMA 3C4WA 1VYZA 3KVWA 2YIWA 1M2QA 3BEGA 4AG8A 4UYNA 2HENA 5AUXA 3D7ZA 5HICA 3MPTA 4DC2A 3ERKA 3ORNA 2ZDTA 4FE2A 3DB8A 5EW3A 4RFYA 2UZDA 2X2LA 2V0DA 3NW7A 1H1WA 5M4FA 2XNOA 5EFQA 3QFVA 3ZO1A 5I5ZA 3CGFA 3F5GA 3U6HA 4OTDA 4RZWA 4BICA 5BMMA 1IRKA 1FQ1B 5ACBC 4ZTHA 4Y5HA 4NM0A 4U3ZA 3TYKA 4IC7A 5DI1A 3ML1A 3QHWA 2CDZA 2Y7JA 1Z9XA 4FZAB 5M55A 4KSQA 3QXPA 4YZ9A 3CXWA 4CCBA 4DHFA 4FV4A 2O63A 3PIZA 3E8NA 4AP7A 3F2AA 5JQ5A 1IAJA 5E8SA 4CT2A 3F3VA 4K1BA 4FTIA 3G15A 3EN5A 4FUXA 3TTIA 3V8WA 1AQ1A 2QR8A 3D5XA 2QONA 2W1EA 3BRBA 3EFWA 3EH9A 4PDYA 3DNDA 4O22A 2YWVA 5KKRC 4AE6A 4F9BA 1P14A 4F7JA 3VHKA 3ZDIA 3KCKA 4IX4A 4XHKB 3ZRLA 4C4JA 2BDJA 2HXLA 5IQHA 3HV4A 3WI6A 3K3IA 2C3KA 4RZVA 3ORMA 4CV9A 4PP7A 3D2IA 3EB0A 3P4KA 5E9EA 4AUAA 2XANA 3TDWA 3LCTA 3Q3BA 4PRJA 2F2UA 3LJ2A 4FTJA 4RA5A 3FWQA 4G3GA 4U8ZA 3LXLA 4DCAA 3R00A 3T9IA 1MP8A 4AFEA 2IVUA 3Q96A 4BHNA 3ET7A 3SG9A 5KMIA 1ZYCA 4QDEA 5HCYA 2OXXA 5AAGA 1PXJA 3A62A 4JVGA 3ZLXA 4GFOA 2HAKA 2YCQA 3KMMA 4JX7A 4S33A 2UZVA 4I20A 5CVFA 5FP6A 3SX9A 4NM5A 4Q9SA 2WMWA 4AW2A 1XQZA 4GUEA 5M44A 4EOIA 1M17A 4L3LA 2YDIA 4S34A 3QQLA 2W1DA 4XLVA 4CMUA 4EUUA 1B38A 3ULZA 2R3FA 3Q9ZA 2XIXA 3DBEA 3HV7A 3UVRA 2WB8A 4JR7A 3I5ZA 4A9TA 3PSBA 1E1VA 3CD8A 3ORPA 3ZXTA 4ANLA 4DTKA 1YI4A 4FSYA 4K9YA 5A6NA 3BL7A 1XR1A 4L7SA 3AD4A 4BDFA 5HG8A 3THBA 4D2RA 5GHVA 1YI3A 5HNBA 2UZOA 3QA0A 4U81A 3HRCA 4QP3A 1JLUE 4QP8A 4EJNA 4QQTA 4IB3A 4CEGA 4X6RA 3KA0A 5H3QA 1K2PA 2X8IA 4LI5A 4O0UA 2JGZA 3VJNA 3OVVA 4DHJA 4DLIA 1TFFA 5AA9A 4JX3A 3CY2A 5ACKA 5F4NA 5IMXA 3EN4A 3VN9A 5EW9A 3JY9A 3DK3A 3EKNA 2WMBA 1JKLA 4F1MA 3RI1A 4QMPA 5IH5A 2YJRA 1VEBA 3HLLA 2W4JA 5FLFA 1MQBA 3W0OA 5K5XA 3NNUA 5H8BA 4O0SA 4AZWA 4FIEA 3U87A 3GQLA 2AUHA 5AMNA 5AUYA 4ITJA 3UG2A 4HYIA 1PXPA 4C4IA 4PMSA 2X9FA 2J50A 5IA4A 5CANA 4FV5A 2XNNA 5HVKA 5ANKA 2WZJA 3E88A 4K11A 4NSTA 4U9AA 1F0QA 3UTOA 4H36A 5A9UA 3IO7A 2ZV2A 3GEQA 4JL9A 1GZ8A 4I41A 3REPA 5K9IA 1WMKA 5JRSA 4BF2A 2GNLA 4X3FC 3FC2A 1CTPE 4YHTA 4EKLA 4O27B 3HVCA 2QHNA 4OTQA 5C9CA 4DN5A 2H96A 2J2IB 3GC7A 3RTPA 3VS4A 4O0RA 4A9YA 5HHWA 4EH2A 2O0UA 3MESA 2WXVA 5AIRA 4KINA 2PK9A 4RJ5A 3EKKA 1U46A 4YJSA 2XCHA 4J99A 4C4EA 4PL5A 5A4CA 2ONLA 2HY0A 2OIBA 2IZUA 2QQ7A 5DHJA 5JGBA 5L2SA 2PTKA 5HLWA 5AA8A 4M14A 3QCSA 4QDVA 3VULA 4F1OA 2YEXA 3PZEA 2IZRA 4OTRA 2R3MA 4N0SA 5HNGA 2EXCX 2VNYA 3MBLA 1FOTA 4WOVA 3WF9A 3WYYA 1ZOHA 3QZGA 4F7NA 3AC3A 4EKKA 1J7IA 1ST4A 1ZY5A 2QVSE 5CI7A 5CT7A 3NVKI 3EZRA 4F1TA 3N4TA 4DFNA 4P90A 2C6MA 2UUEA 2BR1A 4MCVA 4C0TA 4HNIA 2JDVA 3LQ5A 3QRIA 4IQ6A 4IWQA 2HZ0A 2R7BA 4FJVA 4TW9A 4PMTA 1ZWSA 5LJJA 1V0OA 3V8TA 4XYFA 4DEHA 3R1YA 1M52A 1YXUA 3VC4A 5LARA 3NRMA 3ZHPC 2BALA 3DJ7A 3FHRA 4DH1A 5M4UA 1H24A 3W0MA 2QOLA 4MD7E 2JITA 2R3QA 4XG9A 3W8QA 4AW1A 5TO8A 4C36A 3LAUA 3WZDA 5A3XA 4X0MA 5LVLA 3SHEA 1PXMA 5IH6A 2WMXA 4E26A 4NK9A 1PXIA 1H27A 2JDOA 2ZOQA 2JDRA 2OGVA 2F2CB 5DT4A 4ZSGA 3E5AA 3V5TA 5LQFA 4IVDA 4YR8A 3IK3A 3QTUA 4QMMA 3COHA 2WELA 5BMSA 5J8IA 1Q8WA 1R0EA 4A9RA 3EFJA 3OXZA 4DYMA 4MYGA 2VWZA 3CTQA 4BHZA 1PMUA 3FY0A 3E3BX 3LZBA 4IACA 4HZSA 3VS0A 2E9OA 4YLLA 2C3LA 3WBLA 1PF8A 4AACA 4BCNA 4C4GA 5LXMA 2WPAA 3QLGA 4FT7A 4QRCA 1BX6A 4TTHB 4YNEA 4EI4A 4RVMA 5IQEA 3FDNA 5LCJA 3OUKA 2QOCA 5E91A 2XK8A 5C27A 2OW3A 3NIZA 3PY3A 4YZNA 5EH0A 1SVHA 4FVQA 4L46A 5D10A 5EK7A 1U5RA 4AN9A 4D28A 5J9ZA 4XG4A 4ZTLA 1WBOA 2VZ6A 3NDMA 4UEUA 3L8VA 4XG7A 5HCXA 5DBXA 5CZIA 2WTKB 3UG1A 4I4FA 1KE9A 3ZO2A 3NCGA 4NW5A 4GUBA 3FSFA 4CFVA 4M0ZA 2UVXA 5KO1A 3E93A 3LXKA 2OLCA 2W1IA 4YTHA 3QQJA 3GOKA 5M4IA 4QMQA 3UP2A 4GJ3A 3C0HA 5A54A 2XM8A 2W1HA 1OPJA 3V5JA 3R8PA 2XIRA 4L68A 4JQEA 4FIJA 5BVKA 3NNXA 4MNEB 4QYYA 4EUTA 4YJNA 4QP2A 1W84A 3MVJA 2E9NA 3N51A 3NSZA 2Q0NA 3P9JA 3U51A 3V51A 4C62A 4D1XA 5FDPA 3OWJA 3ZONA 3QD4A 5IG1A 2PVHA 3SXFA 4KIQA 4HYUA 4JAIA 1JSTA 2CNUA 4RIYA 4F0FA 3LM5A 1XBCA 3BHYA 4O7ZA 3W0RA 5ETCA 3HAMA 4B0GA 3LXPA 2WQBA 3P5KA 4IZAA 5BUJA 2J0KA 4JAJA 4FKVA 4JRVA 3MGYA 2IW9A 4O7TA 4LYNA 2EB2A 3PA5A 5BV3A 2ZYBA 4IH8A 3JYAA 4ENYA 3NPCA 3NUPA 4IJPA 3ZLWA 1RQQA 3IGOA 2QCSA 4KABA 3R02A 3DBCA 2GQGA 3LFDA 5HU9A 2XNGA 2J4ZA 3WZEA 1Q97A 1G8KA 3A2CA 4IAKA 3V5WA 1Y8GA 3UO6A 2UW4A 3IGGA 4Y5QA 3S4QA 1TQIA 1V0PA 3D5UA 3ZBXA 4PF4A 4BZOA 5AJQA 2VTTA 3GC8A 5CNNA 1BMKA 2HZIA 2BKZA 1OITA 3LCKA 1O6KA 2Z02A 3PWYA 4R3PA 4B99A 5HO7A 3C51A 3Q4UA 4UY9A 1OGYA 5A6OA 4RBLA 4BDAA 2W1CA 3WIKA 4QT1A 3HECA 4PL4A 1PY5A 2NP8A 3PXQA 4JJRA 1M14A 2AC3A 3KCFA 1OIUA 5EYDA 4IEBA 5CSVA 5KCVA 3O7LD 2Y4IB 4DEAA 4QYHA 2XEYA 2ZFYA 3NUSA 3B8RA 2YAKA 3GU5A 4NCTC 2G2IA 4FTAA 5IH4A 3ORKA 1W8CA 2BRBA 4BIBA 4O0WA 4F6UA 3IDPA 2XJ2A 2WO6A 2X7FA 4AGDA 3WARA 4C38A 4FG8A 3PA3A 2WTCA 3GFWA 3DS6A 5M56A 4BY9E 3UOJA 5KHXA 2BMCA 3AMYA 4BIEA 1RDQE 1QL6A 4NJDA 3ZOSA 2VTNA 4IDVA 4AXEA 4DH5A 4JXFA 1OZ1A 2W7XA 4ZOGA 3I7BA 3ENMA 4U0IA 4MXOA 4R3CA 3UOLA 3UYSA 3UZRA 2BTRA 2QU6A 3H9OA 3FQSA 3PFQA 4ENXA 2PUIA 4WRGA 3A7JA 5C4KA 5CEKA 3R8LA 2UW9A 4XV3A 4BDHA 5KNJA 4FI1A 2QOIA 4ITIA 4M12A 1ZMUA 5AP4A 3PZHA 2B52A 2XNMA 5BUIA 4OTIA 5ANOA 1RJBA 3TUCA 1Q8ZA 4FG9A 3ZO3A 4AT3A 5JKGA 4FK3A 2WQNA 1OUYA 4Q5EA 5K4IA 1FGIA 2PVYA 4AGUA 4IMYA 4QP6A 2BAQA 4XG8A 3SXSA 1JKKA 4JG6A 4O38A 4LUDA 3R7OA 4OGRA 3NUAA 3BLHA 4BCKA 2CNVA 2WQOA 4HCVA 3DKCA 3MJ1A 3IS5A 2JEDA 4WUAA 2IW8A 5BYYA 3C4CA 3W2CA 4B4LA 3ROCA 3OG7A 2WMSA 4GVAA 1QMZA 4ZJIA 1VYWA 4I23A 4RPVA 1U59A 3KRXA 2ITVA 3CC6A 3FKNA 3GU7A 4QQCA 5AUTA 2IWIA 2GHGA 2IPXA 5ANEA 3UIBA 3HRFA 4HYHA 5EDRA 3E3PA 2P4IA 3FI3A 3FY2A 4R6VA 4JBPA 4M97A 3UPXA 3OY3A 4H58A 4WHZA 2W05A 1SYKA 4JIAA 3EQPA 3ANRA 4DT8A 2FO0A 4BCOA 1XBAA 2P0CA 4IAZA 3O8UA 4LV5A 2B55A 4LG4A 4LDTA 2W96B 3OCSA 4F65A 3OMVA 4AXDA 3F2RA 1OM1A 1ZYJA 2JDSA 3VRZA 4F78A 4AZVA 3FKOA 4KBCA 3RMFA 4CFWA 5DGZA 3F61A 3PP1A 4C34A 4M68A 4FOBA 3R7UA 4DHIB 4H3PA 3PIXA 4YHFA 4D4SA 4BGQA 1BUHA 5B2MA 4OBQA 2OF2A 1LPUA 2JKOA 4QYGA 3UO4A 1WBNA 4EYMA 1GIIA 4MUQA 3QA8A 2Q83A 2V7AA 4RRVA 2X2MA 4C02A 1PKDA 1Q5KA 4DFBA 1RW8A 4FSQA 1UVRA 3PSCA 3VUDA 3OCTA 4FGRA 4HGLA 4FTUA 4JBVA 2NNWB 2C6KA 3FV8A 1J7LA 3R1SA 5DPVA 4LV8A 3TTJA 1NXKA 3I0OA 2XBAA 4LL5A 1YXVA 4EZ3A 4BTMA 4TT7A 3JXWA 4ZP5A 2X4ZA 1YKRA 2BZHB 3LKMA 1CKPA 5AP3A 5HG9A 5FP5A 1OI9A 2JKQA 4XX9A 5HESA 5B2KA 3F69A 3W0NA 4D1SA 4KBAA 5AP2A 5HX8A 2OFVA 4ZMEA 3P79A 3G9NA 3AC1A 3MDYA 2PMIA 4RX9A 3ZZEA 4BCHA 4GIIA 4YJOA 1Z57A 4JDHA 4AGWA 4AOTA 4HPUE 1CKJA 3QAME 3EOCA 4O7LA 5ANGA 4ZZNA 2HOGA 2ITUA 5CWZA 3UE4A 3W2RA 4MBIA 3MB6A 3RPSA 3BHTA 2C6DA 2QO7A 1SNXA 3KRJA 2EB3A 2ESMA 5JT2A 3MH3A 1BL7A 2X39A 3RPYA 1Y8YA 2W5HA 3QHRA 3OXTA 1PW2A 3DQXA 3RAKA 4CCUA 3MSSA 5DWRA 4L6QA 1WBSA 1YHVA 4QTAA 4Q9ZA 2I1MA 3QXOA 4LRJA 5JK3A 2Z2WA 3F3TA 3LFFA 4JQ7A 4LV7A 4HOKA 4O81A 4RIYB 3PJCA 3SKCA 3ACKA 4FSWA 4B9DA 5GJFA 3MJ2A 2NRUA 2VGOA 4BDDA 3OY1A 4YZMA 3EWHA 4GT4A 4TWCA 5DEWA 3RVGA 4KWPA 1CMKE 3D15A 2YIYA 2OU7A 4K18A 3NCZA 5BVEA 4BJJB 5CSHA 5AAEA 2BDFA 3QKMA 3BWFA 3NUXA 3OD6X 4BCFA 1NVSA 2XKCA 3DJ6A 3LPBA 5CAVA 3FPMA 4P4CA 4DGOA 5AUZA 3W2PA 4BDKA 4EZ7A 4FL1A 3R30A 4MAOA 1DI9A 3PJ2A 4O7WA 4R7IA 3KU2A 3RHXA 3LLTA 2QOBA 3IECA 4BBEA 4RT7A 3W2SA 1Y6BA 5EYCA 3O2MA 4BCQA 3QCQA 4FKUA 3Q2JA 4U6RA 4OT5A 2CCHA 3QX4A 1P4OA 4FKTA 3K54A 3QALE 2OH4A 4Y95A 3BPRA 3L1SA 1YDRE 3R1NA 4EOSA 1BL6A 3QL8A 3I7CA 3NYVA 3MN3A 3O5AA 4PTEA 3GCVA 3I79A 4X2GA 4F08A 4CSVA 2C3JA 3C4ZA 1W7HA 3TI1A 4EQCA 5HI2A 3FMHA 4RG0A 2OWBA 4WNMA 4MWIA 5FTGA 3F9NA 4CD0A 3PRFA 2Z7SA 4Q2AA 4TPTA 5B7VA 2J6MA 4HW7A 1ZYDA 3LCOA 4GSBA 4TY1A 4Y72A 5IEYA 2ZV7A 3TN8A 5IQGA 5DYJA 3V6RA 2CHLA 3DQWA 3F6XA 2XBJA 1OVEA 4F0IA 4FNYA 4KRDA 3ZC6A 4FSUA 1UWJA 4W4YA 4ONAA 2HELA 3QUEA 5CU2A 2Y6OA 1XMLA 3C4XA 3NFGB 3ZYAA 5HLNA 4UYAA 4AZFA 3MA6A 3IOKA 2QG7A 3P7CA 5D7AA 3VWAA 4DGGA 1REJA 3FZSA 3QQHA 4U80A 3BLAA 2XK4A 3P7BA 3VF8A 1IAHA 1KE6A 3EQFA 4CG8A 1YOMA 3MYGA 3Q5ZA 2XYUA 2BROA 4KRCA
chains in the Genus database with same CATH topology
4O7YA 5A46A 3ELJA 2R4BA 1P5EA 2UZNA 3QQUA 4IX5A 2FUMA 4GMYA 4Q5HA 4IM3A 4WO5A 4DT9A 2VTSA 3NNVA 4CNHA 4I5HA 2W5BA 3GU4A 5HTCA 3KRLA 2HW7A 3A60A 2XYNA 5IQDA 4DFLA 5DEYA 4C3RA 4KS7A 3BQRA 4CV8A 2RFEA 1Q99A 3IOPA 3NVMB 5EM8A 2YISA 3HDNA 3OT8A 2HXQA 1IA8A 4ACHA 2BVAA 4PTCA 5HKMA 3FC1X 5BX0A 3G90X 4D0WA 5J9LA 3I60A 1Q41A 3CCNA 3Q2MA 3KF7A 2E9VA 4LL0A 4QPSA 1J7UA 3GENA 3KC3A 3WF6A 3OC1A 4O82A 3GVUA 5KZIA 4DA5A 1REKA 1W83A 3LMHA 3SV0A 3Q6UA 5HD7A 3IDCA 4GK4A 2BAKA 3R21A 1G5SA 1GZNA 3PSDA 4P2KA 4B8MA 4YTFA 2WTDA 2XP2A 3GI3A 4WRSA 2C0IA 3BZ3A 1V1KA 5LMBA 1Q3DA 3SAYA 2JKMA 3HP5A 3JUHA 4V05A 3VQHA 4XP3A 3C0GA 3P78A 3QTZA 2YFXA 4HJOA 1FMKA 2OBJA 4GG7A 3NYNA 5J87A 4XEYA 3GT8A 4BVUA 5LMKA 4X7QA 3AKKA 4XP2A 4TWPA 2QOQA 3K5VA 2X9EA 5FM3A 1YDTE 3CTJA 3ZM9A 4ANBA 4D4YA 1G3NA 3GB2A 3GQIA 2VO7A 3KRWA 4AQKA 3LQ3A 2QOFA 2HW6A 3IW4A 5CAQA 3DK7A 4I93A 1DAYA 3WIGA 4WA9A 1NY3A 2NPQA 3GBZA 3Q4ZA 3II5A 4R78A 2BTSA 3L9PA 4C61A 3A7IA 3BGPA 3RALA 1ND4A 5M57A 3MVHA 4QMZA 3W18A 3CQEA 4BDCA 4O7RA 4USFA 5B2LA 2JC6A 5CX9A 3DNEA 3L8XA 3PIYA 4GRBA 2R9SA 2NYAA 1BKXA 2XKFA 3PP0A 3RPOA 2OK1A 5C8KA 2B1PA 3IW6A 1XKKA 3DA6A 3BI6A 4MNEA 4I6QA 4B6LA 2CCIA 4ZZOA 5GNKA 5IQCA 2VV9A 3SXRA 4FTMA 2GS6A 5EDQA 4N70A 4AU8A 2KTYA 3TKUA 3VW6A 1H08A 5H9BA 3BU6A 1OBDA 4WD5A 3U8WA 2JAMA 5CALA 3U6JA 3UPZA 3HRBA 1PKGA 2WFYA 3RJCA 3FZRA 4ZTSA 3W32A 4AA0A 4CFXA 1H0VA 4QYEA 4F9CA 5DNRA 3UZPA 4HVIA 4XBUA 2UW3A 4E5BA 2YDKA 4ZY4A 2ZV9A 4I0SA 3S1HA 4V0GB 4DEBA 2LAVA 5BVWA 3MW1A 3L9MA 4EK5A 2J0LA 3UBDA 5JZJA 3O8TA 4NIFB 5JFVA 1Q61A 1OMWA 2UW7A 1YI6A 4EH4A 3LFCA 1E9HA 3V6SA 2R0UA 4PTGA 4BRXA 4D5HA 2PPQA 3DBFA 2G01A 4W4WA 2IZTA 5DFPA 2O8YA 5M07A 3LFSA 3C5UA 4KD1A 4WSYA 4RWJA 1K3AA 4PP9A 2Z60A 2XUUA 3EFKA 3QQKA 3R6XA 1VLRA 4QMOA 4FOCA 2RF9A 4GG5A 4DH7A 3CBLA 2VWBA 2V22A 4E1ZA 4IW0A 3HAVA 5G1XA 2VAGA 2YN8A 4G5PA 4XV9A 3NGAA 3R7VA 4U43A 2OXDA 4O0YA 2YWPA 3PJ3A 4KNBA 3R22A 2HY81 1H25A 4O91A 3QKLA 4A7CA 2B9IA 4CRSA 3LE6A 4X6QC 3TUDA 2O5KA 3BV3A 4TN6A 3PVWA 3FZTA 1OIRA 4OTFA 4BDBA 4ZIMA 5C01A 4ALUA 2P2HA 4H1JA 1YW2A 2W4KA 3LLAA 5CF4A 4TL0A 3Q32A 1CKIA 2ZM3A 2BRNA 4NH1A 2AEGA 3MY0A 2CN8A 4C3PA 1IEPA 2IVVA 4FT9A 3UMXA 5CXZA 4FYOA 3ZH8A 3BLRA 3FKLA 5EI6A 3DBDA 3P08A 4D9UA 4EH7A 1XH6A 2YM7A 5EM6A 3TV4A 2RKUA 4EHZA 3HMIA 4NJ3A 4G3CA 4R1VA 4BCJA 1PYXA 4KKEA 2OIDA 5KZ0A 3EJ1A 2UW8A 4JBQA 3CEKA 4BDGA 1J3HA 4M0YA 3WILA 4HVHA 2FSMX 4QMNA 2ZAZA 3TKHA 4ZLYA 1H26A 3O96A 1UU8A 4USDA 4KUJA 2VX0A 2R3GA 3ZS5A 1H01A 2V7OA 2UZTA 4E4MA 3RWQA 2UZEA 5HE3A 5AUWA 3R9DA 3MH0A 2PHKA 5FEEA 4AF3A 1IR3A 3ZFYA 3PXZA 2WIPA 5AP5A 4ZEGA 2OICA 1Q8UA 3QX2A 2B9JA 2ZDUA 3ZUUA 4I6LA 2G1TA 3FPQA 4YSJA 4PQNA 4YJQA 3DOGA 5CY3A 2J5EA 4FTRA 3UMWA 4RVTA 4HPTE 5BVOA 1XMMA 4GH2A 1ZZLA 5CLPA 2PE2A 3Q4TA 4GVJA 2A27A 4QTEA 3DJ5A 1NW1A 4UZHA 4E6CA 4ERKA 2XK3A 2C5OA 1NVRA 3C0IA 3MPMA 4FT0A 4JLCA 3DAJA 3ORXA 3CLYA 2VX3A 4W8EA 2J9MA 4ZXTA 4FV1A 2VTAA 2CJMA 4FTKA 4R5SA 4KKHA 4GKHA 5ANJA 3FQHA 4G6LA 2O64A 4S30A 3QTSA 4IX3A 5ANIA 4ZS4A 2G2FA 3PRIA 4RVKA 3LCDA 5F95A 2XIYA 4U40A 5IA1A 2B4SB 3CY3A 2WMVA 5FBOA 4D4VA 4DFYA 4X2JA 4IAYA 3MI9A 3HL7A 1IA9A 3A7GA 2WTWA 3PXFA 2C68A 4B7TA 1YXTA 3MFTA 3WZJA 2BHHA 3D2KA 4JNWA 5FXSA 5CQWA 3W2QA 4DITA 4O0XA 3FLNC 3A4OX 4L8MA 1V0BA 2WEVA 4RIWA 3GCQA 5AUUA 5LWNA 3VF9A 4AOIA 2QI8A 4JT3A 3AKJA 3ATSA 3F3ZA 4XJ0A 5EW8A 3Q52A 3EQCA 3JVRA 4LMNA 5FM2A 3AD5A 4I0RA 3P23A 4C37A 3AC2A 2IVTA 2PVJA 3MV5A 4XS2A 4CFFA 1MRYA 2C3IB 2CGUA 3RK5A 4G6NA 2Y9QA 4LRMA 4FKOA 3QU0A 2GQRA 3BYOA 5E90A 5HO8A 4MQ2A 2QOOA 1GNGA 4CFNA 4WT6A 3KXMA 4XCUA 2WMRA 3MVLA 4RC2A 2GFSA 4O84A 3KIOC 2Y8OA 4U3YA 5IQBA 2XS0A 5C8MA 5T6KA 2GNHA 4Z7GA 2PUPA 4F6WA 5IQFA 4CZUA 1PMNA 3QD2B 4ZJJA 3WF5A 4N57A 3F88A 4YGAA 4C33A 3R01A 3ROYA 2X81A 1K9AA 4FR4A 2R3JA 3BU3A 4FC0A 3IW7A 4E5AX 3L8PA 4QMYA 4A4LA 3H0ZA 4DAWA 5CVGA 2R3NA 4KS8A 1XHAA 1KOBA 3QUPA 5DIAA 1UV5A 2C6LA 1XH4A 2FSLX 4BTFA 3KMUA 4U97A 1UKHA 2EWAA 1AD5A 1M2RA 2YM5A 3U9NA 4F99A 4WG4A 2FB8A 2QKWB 3PG1A 4IM0A 5CTPA 4HVGA 5HZNA 4E73A 3C9WA 4YSMA 3D5VA 4W4XA 4CG9A 2R5TA 3PPKA 5E8XA 5A4TA 4MXXA 3QRTA 3VHEA 3G51A 3Q6WA 2H34A 4QNAA 5CF8A 5HNIX 4XOYA 2GTMA 3FLWA 3V5LA 3AKLA 3PFYA 2YZAA 3FMKA 5IEVA 4UBAA 4RQVA 4AT5A 4QMUA 2F7EE 4M84A 3MIYA 1F3MC 5IUHA 2G9XA 3OOGA 1OKZA 5FXQA 5DOSA 1WBVA 4BJJA 2QO2A 4FV2A 3QTIA 3TJCA 4ASZA 2QU5A 1ZAOA 3ZTXA 2QNJA 1BI8A 4P5QA 4IE9A 3EFLA 3QGYA 4LFIA 3FLQA 5C8NA 5FDXA 1GJOA 4NW6A 4I0TA 4CKJA 3FYKX 1OL7A 4FIGA 3OT3A 3RWPA 1JNKA 4O0TA 2X1NA 2JKKA 3GGFA 4IIRA 3KREA 3EL7A 3L9NA 4UALA 2ZJWA 3EIDA 5EHLA 3ZBFA 4YURA 2CLQA 1MRUA 4ORKA 4G34A 4DH3A 3LOKA 2P33A 2RFDA 3BGZA 4L43A 3FZ1A 4DGLC 2VWXA 3P5JC 4J8NA 2WMAA 4S31A 3V8SA 3UIMA 4J52A 4MXZA 3PXYA 4C4FA 2YM3A 3BWJA 5E8VA 4FEUA 5HLPA 4ERWA 5T68A 3FL5A 4K2RA 4F9YA 2ITQA 3POZA 5IUGA 3AT3A 1WAKA 3DT1A 3NW5A 3R8MA 5FBNC 2YIQA 3FI2A 3CTHA 3W33A 3I6WA 3RAWA 2X8EA 2UW0A 4D9TA 1ZXEA 3BYSA 3IW8A 4DBNA 1OKWA 2OIQA 4DTAA 3FUPA 1WVYA 2BIKB 4GFGA 5M09A 3LFAA 2Y4PA 3POOA 4J53A 5LCKA 4XNEA 3SQQA 4NYEA 5EI8A 4BCGA 4E6AA 4N6ZA 5KHWA 5IQAA 1OKVA 4EORA 5AP6A 5CSPA 3F7ZA 3DY7A 4EHVA 3CKWA 1NA7A 1OL2A 4LMUA 4ZTNA 3UO5A 3NWWA 2QHMA 3DV3A 3NYOA 4YJPA 3UIUA 5KMKA 4E7WA 3MVMA 3GU6A 2C4GA 3OFMA 4G31A 3JVSA 5EKOA 3IG7A 4DH8A 1O9UA 4ANQA 1GY3A 3MTFA 2WTJA 4FKGA 3ZEPA 3F2NA 4FKLA 3GXLA 4IAFA 4X21A 5CT0A 4EEVA 3OS3A 3IDBA 1WBTA 4JRNA 1P2AA 4MK0A 2FA2A 2A2AA 5EOBA 2C69A 3O17A 4L00A 5AEPA 5AP7A 2A4LA 1YVJA 4PDOA 5HGIA 5F20A 3RZBA 3LFBA 4DG0E 4DFXE 4MBJA 4E4NA 1WBPA 1FMOE 2EU9A 3D94A 1Q8TA 3G2FA 2F4JA 4QMSA 3EMGA 2PZ5A 5G6VA 3CQUA 3A8WA 3COIA 4IZYA 3GP0A 3BU5A 4XV2A 5AV0A 4I24A 3RK9A 1G8JA 4XH6A 2R3IA 3TZMA 4S32A 2WGJA 4LGGA 3V5PA 2ITXA 4JI9A 2ZB1A 4FSZA 4EL9A 1TKIA 4G1WA 2PY3A 3H9RA 4XOZA 3FYJX 5HQ0A 1H1PA 5I9XA 1H4LA 2CN5A 2HK5A 2XJ0A 4IDTA 3U55A 4FT5A 3VBXA 3PG3A 3UDSA 3DKOA 3DKGA 4J71A 4IWPA 4X3FA 4YZBA 4LQMA 3WF8A 3CGOA 3AGLA 3BIZA 4OTHA 5BNJA 3BQCA 3VS7A 5M4CA 3TZ7A 4BCPA 1KOAA 3TIYA 2QC6A 2OZOA 2ZVAA 3BYMA 1NT2A 4TYJA 4RX5A 2Q0BA 4CTCA 4FEXA 1NVQA 5CEMA 2JBPA 4CGAA 2BUJA 3E8EA 3SD0A 4F7LA 2C5XA 5L2IA 4I5CA 5DT3A 4BDEA 2IW6A 2C5NA 3EQHA 2VO0A 4EH8A 3O23A 2CMWA 3F3UA 4FV6A 3R8UA 4FSRA 3U4WA 3AOXA 4KB8A 1R1WA 4AOJA 2R3PA 5LMKC 3ATTA 2VWYA 3SOAA 4EONA 5BVFA 2WOUA 3QYZA 5CU4A 2RFSA 3AMAA 3DXQA 2WQEA 2ITZA 3D7TB 4YBKA 5F9EA 3VUMA 4H05A 4F64A 1JVPP 4RIWB 3SOCA 4FEWA 2XA4A 3OWLA 4N4SA 3K5UA 3DZQA 2PSQA 1WVXA 4WG5A 4I6BA 5AX9A 3HP2A 4EK4A 2WTKC 3A7FA 5KMNA 2RG6A 2G15A 3HMPA 5M51A 2CGXA 1LEWA 3SG8A 1LEZA 3KVXA 1A9UA 4Y83A 4ZLOA 2C6IA 3KXXA 1JSUA 2ETMA 2OFUA 3G6HA 3LXNA 2ETKA 1E1XA 1SMHA 3NIEA 4FIIA 4IC8A 5EHOA 2FVDA 2F49A 3VNTA 4G6OA 1M7QA 4E93A 2J5FA 1P4FA 4RJ4A 5GIPE 2W1FA 2ITNA 4BDIA 3HV3A 2JD5A 4BYJA 4YUQA 5I9ZA 3PLAE 2WQMA 3CQWA 4IZ7A 2C30A 3OZ6A 4TWOA 3UC3A 4EOMA 5CEIA 3UNJA 2OJJA 3HMMA 2W4OA 2YABA 5CSXA 4DEEA 2GS2A 2PE0A 2BHEA 2W5AA 5AFVA 5DN3A 4GK2A 1OL5A 3RGFA 2CLXA 3R9OA 3DLZA 4O6EA 5E8WA 2NRYA 3CPCA 3HYHA 3LMGA 4HZRA 5CAUA 4MH7A 4BCMA 5HBJA 3EZVA 5BPYA 2PZRA 4TYIA 2PULA 1PXNA 3E7OA 3OW4A 3Q9XA 4ANMA 4F09A 5M08A 1BI7A 1CDKA 3GUBA 3OTVA 2I40A 4FVPA 4YLJA 2B0QA 1IG1A 4U41A 5BUEA 4EYJA 2ZM4A 5CI6A 3HEGA 4P5ZA 4V0GA 1ZOEA 3KF4A 3OROA 4M7IA 3FSKA 3MFRA 3ZU7A 3BKBA 2QO9A 3TJDA 4AA4A 2EUFB 3D83A 5CSWA 1XH7A 3AT4A 3CJFA 3FZOA 2E9UA 3KXNA 4C4HA 3DAEA 4EOLA 4UWBA 3UVQA 4EH6A 4YP8A 4F4PA 1URCA 1UNHA 3DTCA 2VTHA 3KULA 2GDOA 2E2BA 1I09A 3LJ0A 3R2BA 4KA3A 4W4VA 2GPHA 5L2TA 2OJIA 2X4FA 3H9FA 1WBWA 2YM8A 4HGEA 4JS8A 4IADA 4RX7A 3CSVA 4U7ZA 2IZSA 2W9ZB 2GNJA 3ID6C 5KKRB 2BDWA 2PMLX 3I81A 4B8LA 2XIKA 2GNFA 2Z7QA 5EQPA 2QODA 5L6OA 4MD9E 2GS7A 1R78A 3RM7A 3JS2A 4PL3A 5EYMA 3KY2A 4D55A 5IPJA 1PMVA 3V3VA 3F7WA 2Y4IC 4BYIA 4JIKA 3OW3A 4MXYA 3T3UA 4DEGA 3TV7A 4PMMA 3DB6A 2R3LA 4WBBB 3T8OA 4CFMA 3MWUA 3ZO4A 2HWOA 3QUDA 4RC4A 3AGMA 3V04A 2CKPA 1R3CA 1XWSA 4J97A 5CEQA 5HVYA 4BCIA 3SC1A 4XV1A 2YITA 4OLIA 5FTQA 3HA6A 3KMWA 5C03A 1DS5A 2J0MB 3HNGA 4GU9A 4K6ZA 5HG7A 3VS2A 4FTQA 4EZ5A 3OWPA 3DU8A 2BCJA 3AC5A 5CF6A 4WKQA 1VR2A 4QP4A 3FI8A 4GW8A 1A48A 2W1ZA 2UV2A 2JDTA 4RIOA 5D1JA 1UNGA 5E1EA 5JZNA 3NAYA 3FMEA 3H10A 4YHJA 3BV2A 4D4RA 4BTJA 3RK7A 5CU3A 5TOZA 2QURA 3P86A 4JG7A 3MY5A 3ZRKA 5HIEA 3QRJA 4USEA 5JGAA 4RWKA 3RNIA 3W0QA 2GCDA 2ZM1A 1OUKA 2C0OA 3HMOA 3TNWA 1Y6AA 4RWLA 2W0JA 3UVPA 1OIQA 4FTLA 2ZMDA 4NTTA 3C1XA 3EQDA 1R39A 5IUIA 4CLIA 5EM5A 3R73A 1QPEA 4RLLA 2B9FA 4Y85A 4EK6A 4EOOA 5EM7A 3A7HA 3UQFA 3DDPA 5ETIA 3RAHA 5ICPA 5EYKA 3FMLA 3HUCA 2PMOX 2ZMCA 2GTNA 3MA3A 3CJGA 3LCSA 4DLJA 5AAFA 3HDMA 4RJ8A 4NCTA 5IDNA 4KIPA 2ONLC 4ZSEA 4JR3A 1H28A 2R0IA 5I9WA 1KUTA 4J8MA 3PDTA 4RC3A 4TYGA 3D9VA 4ZS0A 1H0WA 2ITWA 3ZM4A 2YACA 4O2PA 3U4UA 3PUPA 5FQDC 2IO6A 4IVAA 3SDJA 4EJ7A 4MBLA 4IX6A 5CQUA 2KULA 4MWHA 3FXZA 3MIAA 5A4QA 3AD6A 2BRMA 3R8ZA 1J1CA 4JMQA 3PXRA 3ODYX 4O96A 3W8LA 3R9NA 3EQBA 2VD5A 2ERKA 3ALNA 3KXGA 1DM2A 4FTCA 3FL4A 4L67A 4QQ5A 4QNYA 4ZJVA 2AYPA 4HVSA 2YJSA 3ZSHA 1OPKA 3CIKA 2A1AB 4EBWA 4R7BA 4EK3A 2YAAA 2GU8A 4IB5A 5EG3A 4BR3A 3TCPA 3AT2A 2AC5A 4X3FB 1AGWA 3AC8A 2YCSA 2ZB0A 1HCKA 3FMJA 3KK9A 2I0YA 2X8DA 3WOWA 4BDJA 5H8EA 5J1VA 5F1ZA 4MTAA 3ZDUA 4V01A 4Z16A 3I5NA 4O0VA 2WAJA 4ITHA 2Z7LA 4O7VA 3ZLSA 4PUZA 5L8KA 4FKIA 1ERKA 3EL8A 4OW8A 4EWHA 2IVSA 2CKQA 1U54A 1UU9A 2VWIA 1QCFA 2UW6A 3O0GA 4JDIA 2PVFA 2I0EA 1S9JA 3B2TA 3W1FA 5FEQA 2LGCA 3ANQA 5D7VA 4OR5A 3BLQA 1GAGA 2R7IA 2X6EA 5E4HA 4AX8A 4E8AA 3ENHA 4O7NA 4I1ZA 5AV1A 3GOPA 4K33A 3WE8A 3Q04A 3KK8A 4EC8A 5I0BA 4IWDA 1OB3A 3DBQA 2OJGA 4XRJA 4J95A 5KE0A 4A4XA 4DCEA 5C1QB 3A99A 3BEAA 1Q4LA 3WF7A 5EI2A 5LVNA 4CRLA 1RE8A 4FICA 2YHVA 2PZPA 3TNPC 5LVOA 3S0OA 4YJTA 2RIOA 4DEDA 5DRBA 2OKRA 5LVPA 3QD0A 1QPDA 3HKOA 3AG9A 2Z8CA 2HZ4A 3HZTA 3DGKA 3QRUA 5CXHA 4O2ZA 3UNKA 4UV0A 1XJDA 2PWLA 3AC4A 4BI2A 3F5UA 2UZBA 4NKSA 3UDZA 5IDPA 3NUYA 2J90A 2VRXA 2WTIA 3VAPA 5KMJA 2WMQA 5E8ZA 4FZ7A 2IJMA 3H3CA 2R3RA 3P1AA 5A4LA 2XCKA 4NUSA 3RCJA 3DPKA 4AWIA 4M15A 4YC8A 4UX9A 5D41A 2WEIA 3FLSA 2JAVA 1PMEA 5C4LA 3RAIA 5KBRA 4FSTA 2JIVA 1F5QA 3COMA 3VONA 2FYSA 5CAOA 2XMYA 2PUNA 4NFMA 5ETAA 4ACGA 4ASXA 3MS9A 4CT1A 5EKNA 3DCVA 4IVCA 4X2NA 1ST0A 3PVUA 3QZFA 4YZCA 2XB7A 3EHAA 4YJVA 2BRGA 3F3WA 3G33A 4OTGA 4I6HA 4E20A 4F7SA 2XNBA 1HOWA 5HBEA 4QP1A 3TV6A 3NUNA 1Q3WA 5BVNA 4PWNA 4WNKA 5IZFA 3DLSA 4A9SA 2YZLA 4ANSA 5DG5A 3SRVA 1B6CB 2RFNA 2XIZA 2XZSA 3FBVA 3HX4A 5HEZA 2QLQA 2DYLA 3VS5A 3ODZX 2V5QA 2G2HA 4MVFA 4OTWA 2WU7A 4FTTA 3TT0A 4GJ2A 2VWUA 3R28A 3CE3A 1JBPE 4J1RA 4MKCA 4R5YA 5AM7A 1LR4A 5IEXA 4GT5A 5TT7A 3MB7A 4IBMA 5H8GA 3SA0A 3SW7A 2PMNX 2VTRA 2PU8A 3KN5A 4R3RA 5AADA 3B2WA 1KE8A 3Q9YA 1FBNA 4YNOA 3UQGA 4YTCA 4DG2E 3PE1A 5JFXA 2W17A 5HU3A 3CP9A 4QEBA 2GNGA 5AV2A 2H6DA 3ZRMA 4AW0A 2OI4X 4J98A 4FTOA 2A19B 1S9IA 3ORTA 2VWVA 1MQ4A 2J51A 5IA2A 1CM8A 3KULB 3EN9A 3MY1A 1UU7A 5D12A 3BBTB 5CENA 3TUBA 3QCYA 1YWRA 5CU0A 5H2UA 3E64A 4ID7A 3LJ1A 5JRQA 4L3PA 5AP0A 1PXKA 1FINA 1JOWB 3LQ8A 2HYYA 2I7QA 3FMDA 2PE1A 2BKKA 4TYEA 4TNBA 3EN6A 2YM6A 3OWKA 3OBGA 1ATPE 3PE2A 2JIUA 3R9RA 3Q5IA 4D58A 5AIKA 1JAMA 3MTLA 3OCBA 4YO6A 1YQJA 5CU6A 4U44A 4AXFA 2CSNA 3NFFB 3FLYA 5EQYA 4GFMA 4JDKA 3QZHA 4FVRA 4ZY6A 3PLSA 4YMJA 2XAMA 2IN6A 3O71A 3ORIA 4AXAA 1ZMWA 2F7XE 3PY0A 4L7FA 3AXWA 4XP0A 1YXXA 2DUVA 4NL0A 4FSNA 3UDBA 3OEFX 3UJGA 1JPAA 1Q24A 2JIIA 4X2KA 3LVPA 4NZWB 1FGKA 4XBRA 3IW5A 2C1AA 4I5MA 3NR9A 3QTXA 4WG3A 3BYUA 4C59A 1H00A 3BELA 3TWJA 1XH9A 1APME 3TDVA 1M7NA 4BB4A 3PVBA 1FVRA 3TACA 3VUKA 2BFYA 3C4FA 4PNIA 1Q62A 3GC9A 5AWMA 2QLUA 4G2FA 2P2IA 1Y91A 2YDJA 3KRRA 4OBPA 4O86A 5BVDA 2J0JA 4Z55A 2Y0AA 2ZV8A 4FKSA 4KAOA 3WZUA 4QTCA 5IA0A 3OP5A 2PUUA 1UWHA 3EYHA 4FTNA 2XVDA 5FUTA 1OL1A 3EN7A 5E1SA 3R9HA 5DVRA 4C58A 3QCXA 2F7ZE 3M11A 4D5KA 3C4EA 2OG8A 2I6LA 4MD8E 5IU2A 4CKIA 2VTIA 2B9HA 4UN0C 4AAYA 5HTBA 3ZFMA 2VO6A 1ZOGA 1PJKA 4AZTA 3OOMA 5JQ8A 4GIHA 5DE2A 3W2OA 1ZZ2A 3OTUA 1JWHA 4FK6A 1VJYA 1TVOA 4RJ7A 4FGBA 3BGQA 4XG6A 3KXHA 5AP1A 3W10A 4EBVA 4CMTA 4YJRA 5I9VA 3R1QA 3UP7A 4FEVA 4G16A 4IHPA 3LM0A 4J96A 4A9UA 4AA5A 4TNDA 3FE3A 5A14A 1OL6A 3QC9A 2W9FB 3G0FA 3V01A 3VBTA 5KMOA 3VBQA 5IMEA 4IJ9A 1YWVA 4IAIA 1JSVA 5TF9A 5I9YA 3W16A 4F70A 2WTVA 1J1BA 3A8XA 2XNPA 1O6YA 5EOLA 4NU1A 4DDGA 4CMOA 3QF9A 3AMBA 5JH6A 5EDPA 4IZ5A 2EVAA 4FMQA 3PPJA 2REIA 3LIJA 3Q60A 2VTPA 3S00A 1WVWA 4FL3A 3QKKA 3NAXA 4IFGA 3ETAA 4QMLA 2X7GA 4AFJA 1JQHA 2YIRA 3LW0A 3D7TA 3QTWA 3CPBA 2J7TA 4NM7A 4FV3A 4NTSA 2HWPA 5M53A 5HE2A 3C7QA 5E8UA 2VUWA 5LMAA 2R3OA 4PV0A 2PZYA 4NKAA 2A0CX 4TXCA 3ZCLA 1PXOA 1WZYA 4LOQA 1GZOA 1U54B 2HCKA 4QTBA 4EH3A 4ZSAA 5JMSA 3D4QA 5HCZA 2OH0E 3F82A 1DI8A 1UNLA 1XBBA 2WD1A 4GK3A 4QMWA 4W8DA 3N4UA 5GJGA 1FVTA 4FZDB 4HCUA 5T3QA 3DZOA 1UKIA 5DH3A 4DINA 5K4JA 3KEXA 1YOJA 3R04A 4QPAA 5E8YA 4GKIA 5LVMA 1JKTA 3PUFC 5HX6A 4GL9A 2YM4A 2UZLA 2WKMA 3BYVA 4Y46A 4DHZA 3BBWA 3DAKA 3OCGA 3ZUVA 1SVGA 4L44A 2OZAB 3I1AA 4FNZA 2JBOA 3UZTA 5DR2A 3BE9A 4KIOA 1SZMA 3DFCB 4S2ZA 3UGCA 3BHUA 2O3PA 5L6WL 5L3AA 4E6QA 4A07A 3QWKA 4RVLA 3E63A 5FRIA 4BZDA 4DEIA 4O7SA 4DG3E 4QMXA 4LUEA 4YC3A 4ZTRA 4BI0A 5F94A 4CKRA 4BIDA 3TZ9A 1Z5MA 4U79A 4X3JA 2BZJA 3FAAA 3V5QA 3E8DA 1YHSA 3LFNA 3QTRA 2ITTA 4LM5A 4FV9A 2HZNA 4PX6A 3L9LA 3VJOA 1YWNA 4IANA 4RJ6A 5JFWA 2X7OA 3EQIA 4G9CA 4QMVA 3FMNA 3DK6A 3HMNA 1OIYA 3WE4A 3UDTA 3E8CA 4BBFA 2V62A 4X2FA 3OEZA 4FZ6A 5KBQA 3TKIA 1ZARA 4MQ1A 1KE5A 2XJ1A 3FQEA 4EHEA 1YHWA 4LOOA 4OT6A 4ASEA 3P7AA 4XUFA 2B54A 4G9RA 3R7YA 5KUPA 4JOAA 4JBOA 2BZIB 5FGKA 5EHYA 1U4DA 2ITPA 1KSWA 4ZSJA 4F9AA 3ZZWA 3D5WA 1JKSA 4FIHA 1WCCA 3GCSA 4QYFA 3SRVB 4UZDA 4YU2A 1URWA 4DTBA 1KWPA 3C13A 4EOPA 1PXLA 4QTDA 3ZC5A 3G5DA 4BKJA 5DLSA 1ZYLA 3NZ0A 2VX1A 5CEPA 4WBOA 4L9IA 5CZHA 3I0QA 2C0TA 1QPCA 3PY1A 3JPVA 5JGDA 5LWMA 4G17A 4FYNA 3N9XA 4ZY5A 3ZLYA