2XB2D

Crystal structure of the core mago-y14-eif4aiii-barentsz-upf3b assembly shows how the ejc is bridged to the nmd machinery
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
89
structure length
89
Chain Sequence
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EUKARYOTIC INITIATION FACTOR 4A-III
publication title Insights Into the Recruitment of the Nmd Machinery from the Crystal Structure of a Core Ejc-Upf3B Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 89
sequence length 89
chains with identical sequence Z
ec nomenclature
pdb deposition date 2010-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xb2D00
2DNKA 2MZJA 2GO9A 3TP2A 1YJ9S 2NLWA 2KVIA 3H2VE 2DITA 2JRSA 2DH9A 3MUVP 2FY1A 1U1PA 4C0OC 3CC7S 1SJQA 4PKDB 3OW2R 2KN4A 3THPA 3CF5Q 2YTCA 2M88A 2G4BA 1WG1A 3UD3P 1X5TA 1K9MT 2J76E 1KC8T 2LXUA 1VQ7S 3J7YU 1S72S 1IQTA 2DIVA 3BO3A 3CCQS 3MUTP 1M5PC 3CC4S 2CPJA 3R1LA 2RRAA 1K73T 2FPHX 2K3KA 1AUDA 1VQ9S 2DHGA 3NMRA 2EK6A 2LMIA 3HHNB 3SDEB 3UWTA 3CCJS 1VQ8S 1HD1A 1FHTA 1P1TA 3UCZP 1UAWA 3G8SA 2X1AA 3NS6A 4PR6A 1YIJS 2GHPA 1W2BR 3R27A 2N7CA 1H2TZ 2FHOB 2M8DB 3VAJA 3FEYB 1WI8A 2MKHA 4A8XA 1WELA 2L9WA 1VQKS 4Y0FA 2VOPA 2ADBA 2SXLA 1HA1A 2CQCA 2VOOA 1L3KA 3DXBA 2PE8A 1YJWS 1CVJA 2MJUA 3NS5A 1YHQS 5DM6Q 2CPIA 2MQPA 1M5KC 2RVJA 5H1SV 3ZZYA 2DGUA 2DISA 3B4DA 2ZJPQ 4LIRA 4IO9Q 5GAGU 4FXWA 2MGZA 2QA4S 2RRBA 4EGLA 4BS2A 2MXYA 3UE2A 3MDFA 1U6BA 1DZ5A 3LPYA 3MURP 2M4MA 1WWHA 2DHSA 3VAHA 5GVQA 1U2FA 1R8HA 2EVZA 1UP1A 4QPTA 1QM9A 1HL6A 1R8PA 4CQ1A 2KHCA 3UD4P 3G96A 3BS9A 1VC6A 2RU3A 3G6ES 1S79A 2MKSA 3SMZA 4F25A 3UCGA 3BO4A 2DGQA 1X4DA 2LA6A 1X4EA 4CH1A 2MZSA 1SJRA 2DNLA 1YTYA 3PIOQ 1JMTA 2L41A 3CMES 2DNGA 5DETA 3MUMP 1JJ4A 2AYBA 1P27B 3RW6A 3BO2A 4TU9A 5GAEU 2CQIA 4WCEQ 1WTBA 2KH9A 1YJNS 2KU7A 2HVZA 1WF2A 1M90T 2XB2D 2LQ5A 2M52A 2M7SA 1H2VZ 2MY8A 1VQ6S 1X4AA 3TYTA 2M9KA 5MLCV 1FT8A 1VQOS 2HGNA 1URNA 2CQDA 1VQNS 3NNAA 1KQSR 2MGZB 4QQBA 4V19X 5JVGQ 4W90B 2UP1A 1VQMS 3MXHP 3L3CA 2RUGA 3V4MA 3BEGB 2MZTA 3B4MA 3CCUS 2AD9A 1U1RA 1SJFA 2G1DA 5HL7Q 2JVOA 3CULA 2DGWA 1U1NA 3NNHA 1N54B 1X5OA 2N82B 2KXFA 2MPUA 3CXCR 2YH1A 3HI9A 5JVHQ 1KOHA 1D8ZA 3P5TL 1DBDA 2LKZA 3H2UB 3CCLS 2MB0B 1FJ7A 4Z2XA 4M5DB 2MQOA 3UCUP 2KYXA 3CCSS 2DIUA 1NJIT 2F9DA 5IQQA 1VC5A 2MZ1A 2YWKA 2RT3A 2DO0A 2MKJA 3IRWP 1Q81T 1PGZA 1JJHA 2E5GA 1Q86T 2RNEA 4TU8A 2M8HA 1X4GA 1FJEB 2ERRA 2CQ1A 2O3DA 1RK8A 1WF1A 3VALA 2J0QD 3G71S 2CPZA 1ZH5A 2F9JA 3S6EA 2N3OA 2D3OR 3Q2TC 1M5OC 4WKRA 5D77A 1N52B 1H6KX 5LSLA 2M0GB 2D9OA 5D78A 5DDQC 2QFJA 4YUDA 3TO8A 3Q2SC 4WFNQ 1YWXA 2N3LA 2DO4A 1ZZFA 2E5IA 2HZCA 1OWXA 2RS8A 4RU2A 3EGZA 2OTJS 2YH0A 1VQ5S 2RQ4A 2L08A 1WHVA 2ADCA 4YOEA 2DNQA 4YB1P 2LYVA 1X4HA 4PRFA 2I2YA 2DNHA 4UY8T 4TLQA 5DDOC 3NNCA 2E5HA 1OPIA 5IM0A 1Q7YT 3VAGA 1VBZA 1QVGR 2HYIB 1OO0B 2CPHA 2XSFA 4W92B 2MHNA 2CPYA 2MYFA 2Q79A 1WEXA 1VQPS 1FNXH 2DNZA 5CXTA 4F02A 2DNOA 3MD3A 2D9PA 3G9CA 2LECA 5CA5A 2EK1A 2AYMA 1KD1T 2DGXA 4WF9Q 4WFAQ 1M5VC 2CQHA 2DGVA 2KM8C 2J8AA 1VC0A 2KRRA 1VBYA 2HGLA 4CH0S 1X4CA 4TU7A 1U1MA 3N9UC 3CCRS 2DGTA 5EN1A 2YKAA 2MSSA 2X1GA 5GAHU 2VODA 2MKIA 5BJRA 2NZ4A 2I38A 3J7ZT 2JVRA 2OTLS 4FXVA 3CPWR 2KFYA 3LQVA 2MQLA 2X1BA 3EGNA 2K8GA 3MI7X 3VF0B 5FJ4A 3VAFA 5GADU 3CUNA 3VAKA 2E5JA 2DGOA 2LEBA 1XN9A 2OSQA 5LJ3Y 2XS7A 3P6YC 4IUFA 2F3JA 2XNRA 2J0SD 2MQQA 2MZQA 2CQBA 5IFMA 3I56S 1WHYA 2CQPA 2KRBA 4WFBQ 2B0GA 1HD0A 4OZ0A 3CCMS 2LXIA 1X5PA 1F9FA 1N88A 4IOCQ 2DHXA 5IM0B 4U67Q 2MKCA 2RS2A 1NU4A 2KG0A 3IWNC 1SJ4P 4ZKAA 3U1LA 2CJKA 3RW7A 2DNPA 3JB9k 2RQCA 2DHAA 2BZ2A 2CPFA 2DK2A 2KM8B 2DH8A 3US5A 1A9NB 5DDPC 2DGSA 2KXNB 5CYJA 2V94A 5GMKa 3CTRA 5HO4A 2PEHA 1X4BA 1O0PA 4LMZA 1H2UX 2G0CA 2MJNA 2CQ4A 2ZJQQ 2MSTA 1VQ4S 1UW4A 3S01A 2LA4A 1A7GE 2AYGA 1SXLA 4C7QA 2CPEA 2WBRA 4F26A 2KG1A 2CQ0A 1K8AT 1QVFR 1SJ3P 3D2WA 1ZZNA 1D9AA 4Y00A 4C4WA 2JWNA 3P3DA 5DDRC 2M2BA 3S8SA 1VBXA 4IOAQ 3ULHA 3R1HA 1DHMA 3PIPQ 1FXLA 2U2FA 1M1KT 2XS5A 2DNNA 3VAIA 1U6FA 4OZ1A 3U1MA 1U1OA 3CCES 2LCWA 3DLLQ 1WEZA 1JJ2R 1U1LA 1U1QA 1BY9A 2VONA 3CCVS 1DRZA 5LXRA 2MKKA 3K0JA 1WG4A 4P6QA 2CQGA 2DB1A 2FC8A 2DNYA 2DNRA 2CQ2A 2DH7A 1UFWA 3I55S 2MY7A 2KT5A 3MD1A 1FO1A 3CC2S 1N8RT 2OJ3A 1X0FA 1WF0A 4CIOA 2M70A 5LJ5Y 1WHWA 4QU7A 1YITS 4LJMA 2X1FA 1WG5A 2AYEA 1VQLS 3CD6S 5LSOA 4QU6A 2ZJRQ 1RKJA 2MQNA 1G2EA 2CQ3A 2LEAA 2MZRA 3P49B 2E44A 2U1AA 5ITHA 1FJCA 1U1KA 2HGMA 1PO6A 3SDEA 2KI2A 1WI6A 2DNMA 3G4SS 2CPXA 1NO8A 2MMYA 2FC9A 2QEXS 2A3JA 1Q82T 4WIIA 2KXHA 1X5SA 3THTA 4ERDA 3VAMA 3G8TA 5LXYA 1KOOA 5DM7Q 2OSRA 2XS2A 1OIAA 2XNQA 1YI2S 3FEXB 3S7RA 1WHXA 3CMAS 2BOPA 4UQTA 3EX7B 1X4FA 4ED5A 3MOJB 1B7FA 3ZZZA 1WEYA 2JX2A 2MQMA 2OIHA 2CPDA 4J5OA 3SXLA
chains in the Genus database with same CATH superfamily
2HHHJ 4Q8EA 3H4DA 4LVNP 3GIKA 2DH9A 2BKOA 2W1BA 1CJVB 1TAQA 2IJFA 1KBRA 2WW4A 4CTAB 5A2QY 3KMQA 4QWCA 2GAGC 1U8WA 3PNIA 3C2PA 2EFVA 1IR2A 1IQZA 1AUDA 1BE4A 2DY1A 4F4AA 3K59A 4OHYA 2F5GA 4H54A 3C3LA 1KP6A 4LRDA 1IBMJ 1Q5VA 3R5JB 1WELA 3S1TA 4YQWA 5HBMA 4KE5A 1LWEB 5I42B 3FFIA 2MQPA 1NJWA 3OBIA 3RRHA 4ECXA 4LIRA 2NCKL 5GAGU 1C0UB 2OPPB 1VRUB 4NA3A 1R8PA 2Z2YB 4P72A 3ONQA 1J2VA 4OI0A 1H0HB 2VJVA 3QQCD 2RE1A 4DV6J 3A3OB 5DETA 2KJVA 3MUMP 3OFGA 2DY9A 1BUXA 1YK9A 5D4PA 1JLCB 4A46A 2R3VA 2JSXA 1ELOA 2EFPA 4WIQA 1OSDA 1ZTTA 1S6PB 1CLFA 4LR8A 3JTOA 1VQOS 1FT8A 2GIFA 1REVA 4KGMA 1RT3A 2Q66A 4RX6A 2NPFA 2LQ9A 3AT1B 2MKYA 2JC1A 1Z2ZA 3OPKA 4DR3J 2DXDA 5HAOA 3LTOA 5JVHQ 2A1BA 3SSRA 4KTQA 3F41A 4M5DB 3AJ2A 1JWWA 1ICEB 3CCSS 1YZ6A 3UFCX 3GJSB 3GIJA 1Q81T 3CJ5A 4K59A 1V5IB 1U48A 1NK0A 1S1TA 4N77A 2IM1A 3WHIA 2ERRA 3BN7A 2KFNA 2PMWA 3BJYA 2CQ1A 2VIHA 3MTKA 4IR9A 3P4UB 4O3NA 4X4UA 3RBXA 3PX0A 4Q5VA 1H38A 2DEIA 2VFUA 2DCUB 2WSFC 4CP5A 1HNZF 2R2TA 3DNCA 4F4XA 5KT4A 2ASDA 3ZZRA 1N33F 2MHNA 2QRRA 2R7SA 2EEYA 1RHMB 1R27B 4DZ6A 4M5KA 1C1CB 3A8KA 2ZH2A 1XMQF 2J8AA 1Y3KA 3UVJB 3NP5A 4CH0S 2KO1A 4TU7A 2BV3A 3LP2A 2YKNB 5EN1A 3P5BP 3I0RA 3LW5C 1HBOA 2R8IA 4GVBA 3R6GB 2UUWA 2VPXB 4HHUA 1EKRA 4N8NA 5KFWA 3LQVA 1Y5LB 4PPZA 1QSYA 3VAFA 3PO5A 2E9TA 1H72C 3DLEA 2IA6A 3CIZA 1B99A 2KRBA 3KK1B 5ETMA 1D9DA 4RNOA 3OHBA 2RS2A 3VR1A 4ZN1A 2AX0A 4AXJA 2WK4A 3D1QA 3CO9A 3A3NB 2G0CA 1DLOA 3FKBA 2MSTA 4NA2A 3S01A 2BACA 2XLJA 1RA6A 1ZZNA 3MMJA 4Y00A 3M9NB 4DSKA 1UPMB 3PIPQ 1FXLA 1M1KT 4UZBA 3CCES 4USHA 4LBIA 2G2YA 3M1VB 3WC2A 4OV1A 4NMLA 1WDDA 5GADI 1GMUA 4ZVFA 2DNRA 2DH7A 2CWXA 3IXQA 2KT5A 3MD1A 4MAKA 4PXCA 2DXFA 3IRXA 3GG1A 4QU7A 1YITS 2AYEA 5FDLA 1G2EA 1DTQB 2QT7A 1HWKA 4OZLA 3MECA 3DGPB 5GMEA 2MMYA 3QJLA 1RTJB 3CJ4A 2IM3A 4JI1J 2WVFA 3KWMA 4UQGA 2C28A 2XNQA 1L3SA 4Y2CA 1NB2A 3D54A 1N4LA 4ED5A 1LK7A 4DR2F 2C2EA 2MQMA 1NBEB 4ZVEA 3W2VA 2OPQA 2NLWA 3NXZA 3PW7A 2AMCB 3NKYA 1G6BA 2YX1A 4YFUA 4RBTA 5EDWA 1FERA 3NGDA 3HJVA 1SQFA 3OXFA 1HHTP 4ANDA 1GEHA 3KXDA 2LMIA 3PRVA 2H1YA 4LT6A 1YSJA 1J5OA 2GHPA 2XMWA 4X4VA 4A8XA 4B3OB 2DTJA 1UWAA 1HWUA 4HR2A 3R8YA 1RLDA 2VFTA 4M94A 3SV3A 2BRKA 4LSNB 3H90A 1NSPA 2VD3A 1TL3B 2BM1A 2I1RA 3K7RA 2Z2ZA 4DPOA 4I2PA 4TYBA 2CG8A 4RR5A 4OYAA 4CQ1A 5KG0A 4URQU 2KZMA 1G4CA 4M63A 1SB6A 2FD2A 3CMES 2W4CA 3MEEA 1TU0B 2EBGA 4J9NA 2FGOA 3HVTB 2JNJA 4JI4F 1G7CB 4O3RA 1H2VZ 4UUXA 2MY8A 4RUCA 3MMAB 5MLCV 1URNA 5IWAF 1KQSR 1UCNA 3D1OA 3CCUS 5L1KA 5J2PA 3SV4A 3CULA 1HQEB 4J9LA 3MCNA 4P73A 2N82B 5HVHA 4WP8A 1AUSL 1SKRA 4DV4F 2JLEA 4QWDA 4KB7A 1F5CA 4DV3J 2V4JA 4IO1A 4CM0A 1IKWA 1WOOA 2RIJA 2HS4A 1MN7A 4ZVRB 1IKXB 2ZNZA 5B0GA 2J9DA 2R2SA 1NPRA 3OJUA 2JEIA 2W2QP 4OYZA 5HQLA 4Y28C 4NLVA 5DLGA 3L9ZA 3SQGB 1OWXA 2RQ4A 1HQUA 2DRDA 1UW9A 1EKSA 1IM4A 3MMBB 3Q23A 1QE1A 3A13A 3MM5A 1G1XA 4P71A 4DR7J 3ZTPA 1YRXA 2BE2B 1R0AB 3MD3A 2WB1D 2GA7A 3VGUA 4B9TA 3IAM9 1FRKA 2NS1B 1LOUA 3CEDA 1P9YA 1UA1A 2MKIA 4WK1A 3FJ2A 1GXLA 1NK5A 3V6DB 3OUYA 1CJTA 3PG9A 2MQLA 3N5BA 3DM2B 2P6SA 3CCZA 3GJRB 2PI4A 4F0KA 1NHVA 1VISA 3QRRA 3OTOJ 1YRUA 1YGYA 5A8RA 1RABB 3RG6A 4ZPBA 2KZZA 4U67Q 2FDNA 4F4WA 2KG0A 1B0PA 2YKQA 3QSYB 2W9BA 4U95A 4R5PA 5GAEI 2WBRA 3R5DA 4F2RA 1D9AA 2EW9A 5DDRC 2B9EA 2XWXA 2BANB 3MR7A 4DU7A 2EKNA 4AD6A 3W62A 5LMNF 1PILA 3AJ1A 1VYAA 2ZDOA 2ROPA 4ZVPB 2FJAB 3HULA 2ILZA 4IG3A 2PC6A 2OD4A 2GVZB 5HI7A 2ZKUA 2UUAJ 4P2MA 2N7YA 1N36F 3Q22A 4MK7A 4B02A 5L8RC 3QO9A 3QT8A 3JQKA 5ITHA 1PO6A 4OLOA 3TR5A 1JB0C 2PGCA 4HI1A 3AOAA 5E0OA 2LDYA 1IM6A 1S48A 3IO1A 3GILA 1X5SA 4USVA 2OSRA 1R0BG 4F36A 2GJ2A 1PBUA 1JLEA 2PA3A 1J27A 3ZZZA 4USTA 3CCTA 2Y9HA 3N6MA 2MZJA 1FEEA 3DRPA 4A47A 2FJXA 3D6FB 4UOCA 2BDPA 2VG5B 2DIVA 1FRIA 5D6GA 3HCXA 4C9DA 4FS2A 3AHPA 3SDEB 5T7LA 3PR4A 4O23A 2C3PA 4ZVUB 4DHVA 2ALYB 4K5SA 2F63A 3BF4A 3KK3A 2OKQA 1N32J 2GGPA 3HT3A 5DGAA 5DM6Q 4I68A 2FVCA 3Q8QB 4O4GB 2F8EX 2QJ3A 2OPSA 1RXOB 5EWGA 4X64F 2MXYA 4WE1A 3MM7A 1OY8A 1TK8A 1CQMA 1TUGB 1UP1A 2AU0A 1KVIA 4JI7J 4ZVGA 4K4YA 4O3OA 4DPXA 3PFOA 1HPZA 3W5YA 3G82B 1BXNA 3QLHA 5U47A 1WSVA 5M2RA 1RT5B 4K4ZA 2Q6BA 2H65B 2KH9A 3EZ5A 2M52A 1E6YB 3CJ0A 5KT3A 2JJ4D 5EX0A 4HEA9 3I0SB 2BE9B 3QGGA 4JV1A 2E7XA 4YB5A 4OJGA 2RAQA 1HARA 3NNAA 3I5BA 2A2DA 4L75A 4MIBA 1RWMB 1F5BA 3MOZA 4EBEA 1S4EA 1QAIA 1SJFA 4DV7J 3ENVA 3TA0A 2IDEA 2Q1LA 5HROA 1KOHA 2ZBRA 1PYTA 2UUBF 3KTQA 2ZBIA 3ET6B 4DS4A 5C2GA 1NJIT 4H4MA 4F0HA 1VC5A 1XNQJ 2LQ8A 3MEGB 2RD5C 3DHXA 4ES2A 2PD1A 1YJRA 3O44A 4TU8A 1X4GA 2DPIA 2K7JA 1ZAXA 2J0QD 1FRHA 3E2EA 4OV6A 4G1PA 2F1FA 2N4CA 2OGUA 1T3OA 2W8KA 4WKRA 4E8UA 2CXEA 1U7LA 1N52B 4K8RA 3HSGA 2D9OA 4KHRA 2FGCA 4I2QA 1RHKB 1UFLA 4ECYA 2CA9A 2Y1LB 2HZCA 2RS8A 3EPGA 4DG1A 3V6JA 2DNQA 2HQCA 3OHAA 5DDOC 1NJYA 3GPAA 4DV3F 2A18A 2GQ2A 4C8LA 2V68A 2B9WA 1XJWB 1OJ4A 4I69A 2DGVA 1RDRA 1T03B 4ZN3A 1RT6A 3I32A 2Y0BB 4N56A 3J7ZT 1R8AA 3R5BA 3FEZA 3BQ2A 2J0SD 1FK9B 2R8GA 2CUYA 1W26A 1AB8A 2XGQA 4CI0B 1RWVB 5IM0B 2HFNA 4LBPA 1SJ4P 3RGIA 1RBOB 2BZ2A 1LV5A 4FYVB 2OMLA 2MJNA 3EZUA 2RB7A 3AOCA 2LA4A 4PG8A 3B6BA 1JIHA 3KNGA 1M5SA 1GT8A 4QYZK 3KLVA 3D2WA 3AB4B 4DLGA 4J91A 3QWPA 3H20A 1U6ZA 3MAAA 1CULB 2HK3A 2NUHA 1GTEA 4MH8A 4LUBA 2OEJA 1U1QA 4LRCA 2HS0A 1S6PA 3PHTA 1YJVA 3R9LA 3PDNA 3TJ8A 4IG0A 2DB1A 3TAPA 1NK4A 3QATA 3FSIA 1S10A 4NL5A 1EX8A 4NXMJ 1X0FA 3IBWA 3HVWA 4HL9A 5KG7A 1WG5A 3KJQB 2MQNA 1E6VA 1Q4RA 3AB2B 4IQXA 2XULA 1RWWB 3OSPA 3FBFA 5C25A 2XTJP 1UMJA 2KI2A 2GV1A 2QL5B 4NLYA 3HF5A 3L4BC 4EYIB 4JI5F 4RW6B 4MT1A 5DM7Q 2YKOA 4W98A 4DCOB 3EX7B 2DRBA 8ATCB 5KFCA 4CLLA 2QA1A 3LA0A 4NRTA 4ZJLA 1T02A 5K8OA 1MWZA 4XPEA 3MUVP 3C46A 1WOSA 1S1VB 2ZOMA 1K9MT 4L73A 4KHPF 3K5NA 4Y6IA 1KQFB 2CDRB 1FKOB 2GMHA 2BJ3A 2O66A 1ZETA 2W7PA 1I3OB 2I5JA 1GX5A 2MLZA 3V81B 2D74B 4QPXA 2BUNA 2VQFJ 1Q7LB 3GFZA 4YR2A 4B3SF 3VVTA 3AA8A 3H7HB 4MIWA 2MDAA 1HBMB 3PRDA 1QSSA 3WBZA 3C6UB 1TL1B 3LPEA 2VKRA 2VOOA 2C2KB 5F3TA 3HX9A 4DL5A 2IVFB 3MR5A 3PX6A 2E7VA 3ZZYA 3UD5A 2QA4S 2MGZA 4ED1A 3MM9A 3LALA 1VQYA 1IJFB 2A10A 4DR6F 4NI2B 1H3DA 4O0IA 1MU2A 3BO4A 2F7VA 1FJGJ 1L3TA 1F3FA 3ISNC 1JJ4A 4B3RF 2NXUA 2AYBA 1D1UA 4L74A 3BSAA 4IQMA 1NHKL 4NLDA 3KJVA 1NK6A 1S97A 1D09B 1RP5A 1YG0A 1ZM3A 3UN2A 3MXHP 3KLFB 4IR1A 1T95A 1C1BB 1S99A 2DGWA 3CXCR 4PWUA 4CNZA 3TEGA 4FBUA 5IQQA 1Y11A 3OL8A 1FI4A 2XI3A 2WW8A 2RNEA 4WK3A 3ZZUA 3VGVA 1HWJA 1BQNB 2O3DA 1RK8A 2HNZA 3G71S 4U7CA 1CJUA 1RB0A 1KDNA 1IR1A 1ZS6A 4ZPAA 4KT0C 2H54B 2ZHOA 1DY3A 2DO4A 2HMIA 1TTHB 2LEPA 4NPOA 4P7VA 2L08A 4J9RA 2QLWA 1CEZA 4TLQA 5J2MB 2E5HA 1XNQF 3UDLA 3VAGA 2B7BB 2XSFA 1OY9A 4ZCIA 1ZAVA 5KFEA 3NBPA 1N34J 4RUHA 3M32A 5HP1A 2E1CA 5E3QA 3LGNA 5CA5A 2XO6A 4DV0F 4J9PA 3NAIA 1I5OB 4PWDB 2VQEJ 3SI8A 1VBKA 4ZPWR 3FRZA 1NEEA 1GMVA 3BQ0A 3IM8A 2DPJA 3TAQA 4X4NA 4OMFG 3OL9A 1P9QC 5GADU 2UXBJ 2L9DA 4TY9A 5KFQA 1JXLA 2MZQA 3M8PA 1LNQA 5D0EA 4NMXA 4WFBQ 1X5PA 1RTHB 5HQ8A 3VHQA 4ZKAA 2CJKA 2DHAA 1TFWA 2Z8QA 4J37A 1O5JA 1A9NB 5J2QB 2H51B 2NSBA 5DLFA 2CQ4A 1HMVA 4F26A 5A6PA 2GHVC 1N5YB 4RNMA 3G87A 1TKTB 2H4YB 3K57A 3Q8VA 3ULHA 4FNHA 4DN0A 2P9EA 1JLAA 1F3VA 4B3MF 1IBCB 3DI6A 4JI2F 3VTIA 4NLXA 3L95X 1WEZA 4EBCA 2AGPA 3CDUA 2MKKA 4OYWA 4UW2A 4C3LA 2CQGA 3KOAA 2AWZA 1G3OA 3UDVA 4DL6A 1RWKB 1S5ZA 1OY6A 4ED6A 4MK9A 3NY0A 2GAHC 1PC4A 1PYOB 2CNLB 3LGHA 2VKZG 4RO0A 2FLNA 2CADA 1IBLF 4F4KA 1XQIA 2CZ9A 4RZRA 5LMUJ 3E8OA 3CD5A 2QL7B 2ZHBA 3PKMA 4FN5A 4NCBA 5BXIA 3MCSA 5JUMA 3DOLB 1BQXA 1K1SA 2XCAA 2CJBA 4M8LA 4NLPA 4UUWA 2HHXA 4IRDA 2O5DA 1JLBB 1EETA 2YVSA 5JMNA 1SH3A 3EZOA 4LF5J 4NXMF 1TV6A 2KFZA 1FX4A 2WOMB 2KVQE 3BN4A 3MFIA 4QBUA 1R6VA 4F4YA 2M3DA 4FYWB 1RAEB 4YB6A 4RUBA 3MMBA 1SV5A 3LAMA 2IMWP 1Q8IA 4PR6A 5DZ6A 3EYZA 4KO0B 2QYCA 2ZEJA 4U9RA 2VOPA 3ZTRA 2PE8A 3M30B 3D3CJ 3TARA 2RKIA 1YHQS 5F8LA 4FBTA 2H5IB 3ISND 2LU1A 5KFYA 5KFZA 3HHEA 5KFIA 4ZP7A 1MN9A 4LF9F 3JTPA 3NGKA 3CSKA 3MDFA 3LPYA 3MPDA 1I1GA 3BKFA 1WWHA 2JDJA 2ZNYA 2JFDA 4CLZA 1ZOTA 2RF2A 3LP0A 2MZSA 4C0BA 3FBEA 4JUZA 2DNGA 5C24A 4WP9A 2AF6A 4RUAA 5HBMB 5C42A 4B9MA 2OAUA 4BWMA 3FFIB 3TA1A 2C2ZB 3P8BB 1F5AA 1BWEA 3CJ2A 4TY8A 5KFGA 2W9AA 3BR8A 1APSA 3BR9A 5BYSA 5EGYA 4EBDA 4DFPA 5HL7Q 3DOKA 4ZLLA 4JI8F 1BC6A 4OHXA 3O8WA 2J0WA 2H4WB 3M2VA 1QY7A 1S57A 4URGA 3KHHA 4F04B 4K0KF 2DR5A 5L9XA 3W65A 4M5IA 2WHOA 3IRWP 3GLJA 4KJIA 2HAFA 1JJHA 4OYPA 3CCWA 3EVMA 2XMAA 1WC4A 1REVB 1RT3B 2F9JA 4LR9A 4ILMA 3R2DJ 3GV7B 2UVVA 3MPUB 3DLGA 3FMBA 3MEDA 4DR5F 1ZPVA 5B0EA 2G0IA 4IRKA 2BE7D 4P75A 3PW5A 1GX6A 2ABYA 4C3KA 4YOEA 1VLOA 1FWLA 3R5AA 4LFCF 4N76A 5KFOA 4I64A 3THVA 4DQPA 2ACMA 2KDOA 4DR4J 2Q79A 2JEGA 5CXTA 1S1TB 2AYMA 3RYLA 4J9VA 4WF9Q 2IJRA 1NXIA 2PT0A 2KRRA 2HGLA 2QMUB 3CGIA 4GO7X 4YY3F 1C0TA 2FHMA 4O0NA 3D5MA 5HANA 4MMOA 1IBKJ 1XR6A 2HHPA 4L6V3 3M8QA 4O3PA 1XN9A 3HJFA 4IUFA 5THWA 1HW9A 2H48B 3T9ZA 1LW0B 2IM0A 3C66A 2HVHA 1N88A 1YQHA 3FK4A 3GIIA 3RW7A 2DNPA 1N34F 4WTOB 4LFBF 2V6AA 3C8YA 3SCIE 2CAJA 5L1JA 2F4VJ 5KT5A 5DDPC 4ZLNA 4PYDA 5HJYA 1YRTA 3TNVA 4J9MA 1UW4A 3BDPA 1RACB 2QSFA 4KIAA 4A4JA 2CPEA 1NCLA 5EHHA 3LP2B 3R5CA 4LRBA 3I0RB 2E66A 4JP8A 5FLXU 1HBOB 1QVFR 4GVBB 1HNVA 2M2BA 4DV5F 1VBXA 1AYEA 3BSCA 1RAJA 4ETXA 3DLEB 2JZ5A 2Q6CA 1KEKA 4F7VA 3PYFA 4IKAA 1WKKA 1GQEA 4GMKA 3DU6A 4P6QA 3M2RB 2JFKA 5DG8A 2CZ4A 1TZ0A 1U0HA 4AYBD 4FS1A 1DLOB 4M1KA 1NRKA 2QX0A 2U1AA 4ZP8A 5ETRA 4Y2AA 1FTRA 2WVCA 2ZVSA 2CPXA 4ZIVA 3JS9A 1JKHA 1RE1B 5CZXA 4RW8A 5E3CA 1KHWA 2KT3A 3FZ2A 2DNKA 2ATCB 3H2VE 4IRCA 1HNIA 3GV5B 4ED4A 3OVSA 3Q0AA 5FIIA 2BJ9A 3R97A 3NWGA 2OPRA 3IRXB 1XTZA 3OXLA 5FDLB 4WPAA 3DLKA 4NWBA 1S9EA 2CKWA 2K3KA 3GP9A 3H59A 4CLFA 2C1EB 1FTCA 5LMUF 3MECB 2Z30B 2BKNA 4MKAA 3IBCB 3A4TA 3G8SA 2XLKA 1CBKA 4B9SA 1W2BR 4G1IA 4Q0BA 3FEYB 1Z2LA 2CJYB 1U49A 3W7BA 5B0CA 5K8PA 4NA1A 4N47A 4F3QA 4X65F 4DQRA 1FD2A 1T03A 3W2VB 2OPQB 3LGMA 4CT9A 2O1PA 3HHLA 1KFDA 3LP1A 1FCAA 4FXWA 2XGPA 2LVWA 1HWIA 1WKJA 4FKXA 2V4QA 3MURP 2HLTA 3ETOA 4MYUA 1HR0J 1XMOF 4ATNA 1LWXA 4M5LA 1SJ1A 3NL0A 3I5CA 4Q43A 1J5OB 1X4EA 4OZ3A 4KGVB 2LDIA 4R8UA 5KG1A 1SC4B 3PZPA 2EC0A 4OZJA 1YJNS 2XB2D 4U8VA 2EC2A 3SCKE 1UJ5A 4NLOA 4OI6A 4NLUA 3D66A 2FHKA 1Q8KA 4BC7A 3BEGB 1P6TA 3UQSA 2MZTA 4I2PB 5DZ7A 1CULA 2BJ7A 3M8WA 3F0NA 1U26A 5HVFA 2N4DA 4ITSA 2UXDJ 2YH1A 4AE5A 4CDIA 3KLGA 3NGSA 3KHGA 1LFPA 3MEEB 2YWFA 5D8HB 1S12A 4KGXB 4OYIA 1MSWD 1RGVA 3RR8A 1VMBA 3V4IA 3IAS9 4ZMMA 1R0CB 1SI9A 3MCOA 1M5HA 3S6EA 2AZ1A 4ZLJA 2ZD1B 3M8YA 3SSQA 4YUDA 2HRTA 3Q2SC 4WFNQ 4YHHF 5ETSA 5J2PB 4ZPDA 3BB5A 4Y2KA 3C14A 2GW8A 1W7WA 4NZ7A 3SSSA 2Z57B 3NCQA 2I2YA 4LF8F 3KG1A 3KYLA 3A8JA 2A6MA 4EZ9A 1CPZA 4B08A 2V4JB 5DQIA 1QVGR 1N5VA 2VG7A 2QO3A 2CPYA 2VBWA 3IR7B 3QSIA 4LF4J 1B4SA 1AROP 1HFEL 4OX6A 2KM8C 3CJKA 2BXJA 2XZTB 4YB7A 1H73A 2RU9A 1NSAA 2X1GA 3C16A 2JLGA 2OTLS 4FXVA 3CPWR 4X62J 3PW0A 3G6XA 3KJNB 3MI7X 2AKWB 3GFXA 1HQUB 1RTIA 2YPYA 3OV7A 4ALZA 1QE1B 1WHYA 2B0GA 3CCMS 4ZK7M 3MM5B 3UR0A 3D6TB 5F8HA 3U1LA 3QGIA 4FKYA 4GRSA 4HHHA 1X31C 1SC1B 3L09A 4MTPA 4ZJQA 4IFYA 4ZP6A 1NMEB 3BGRA 4GKJJ 4DPTA 1SL2A 2KG1A 3B78A 3U02A 2CQ0A 1K8AT 1SJ3P 3ISZA 3AH6A 2FJWA 3RAQA 4C4WA 4OX9F 3W1YC 4TQSA 3OUYB 1CJTB 4WZQA 2ZBCA 2YKMA 4K5RA 1EHWA 3V2UC 2C22A 2E5LF 3DLLQ 5A8RB 2DR6A 2VFRA 4I0WA 2V9WA 1DRZA 4JV5F 4USMA 3JQMA 1FDDA 1TR0A 2HVEA 2DNYA 4AQYF 4NCGA 1U8SA 3K8VA 3RU0A 1UFWA 3OT9A 3W2WA 4V19J 2W9BB 1T05A 3HSJA 2WCXA 4HKQA 1K47A 1C1BA 3BKUA 1L3UA 4R5PB 9RUBA 3FUYA 3CJQA 1XERA 3MPVA 3G4SS 2QEXS 4QJVA 3FSYA 4Q2MA 4DUZJ 1KOOA 2GMLA 1SH2A 3J7Z5 3S7RA 4HH0A 4BHQA 5H9EJ 4OQJA 2DR7A 4IG3B 2OIHA 3MFHA 1UJ4A 3T1YF 3DU5A 2YXLA 1FNMA 2NREA 4U7UK 4E0DA 3D7SB 2OFGX 3AY0A 2OEKA 1TFYA 4DI6A 2YY3A 4Z7YA 3QO9B 3T6JA 2B51A 1VQ9S 2DHGA 2E1RA 4CYUA 4ED7A 1VQ8S 3VV2B 5AXLA 4DUTA 1UAWA 3KNAA 1FA0A 2AHOB 3NS6A 4NZ6A 1FVQA 1T9TA 2XY6A 1RLCL 2E1MC 3GSDA 4NEYA 2IBOA 4Y0FA 5KFSA 1FWKA 2FHJD 3GJQB 1IR0A 2SXLA 1TL7A 1D0EA 3OD2A 1F9HA 1JLEB 2J6UA 3POTA 4B9UA 4A8YA 4CCHA 4L76A 2AV5A 3IMQJ 3OVAA 3DRPB 5ETTA 2X51A 2HURA 4YDXA 2AEFA 3E01A 1R8HA 4RW9A 2EFGA 3MHYA 1VLYA 2MKSA 3ZC4A 4F25A 5HQMA 2LA6A 1S59A 5T7LB 3MPYA 1UEKA 2UU9J 1M0SA 4LFAF 2NYIA 1JXEA 1CC8A 4DX5A 4AUKA 1YX2A 1Q53A 1DAXA 2W25A 3KK3B 2GCFA 2GGPB 3HDSA 2A6OA 2ZH1A 3JYTA 2V8PA 3JAMU 5E3PA 4IFVA 3TQ1A 2DEJA 2OPSB 4DV2F 4LIWA 2HFSA 3MM7B 1WSRA 2ZITA 3L3CA 4J9KA 4ED2A 2RUGA 3CW2C 2V0NA 3BPSP 4KH0B 2W9CA 5G0RA 2NR0A 2YNGA 1N54B 4A48A 4WKYA 1XNRF 3P5TL 1HPZB 3H2UB 4PG4A 4UTGA 4ZVQB 4OL8A 3QLHB 5C5JA 3GONA 3K89A 2XLIA 2Z2MA 1EQMA 4P9SA 2V8HA 3CJ3A 3PO4A 5H9FJ 5BR8F 5KG4A 2AX1A 5F41A 2DD8S 2XCPA 2ZOFA 1I94J 2CPZA 4K2XA 4ZHRA 5D78A 1YWXA 3K8WA 4EYHB 4RU2A 1D8YA 1T3NA 4IDKA 3OVBA 5HROB 1NSQA 4KY3A 3DXSX 3AOBA 2DNHA 3AD8C 2M5YA 1JLQA 4H4MB 3W3SA 4ZCLA 2WOMA 1VBZA 3TQEA 5AJ3F 1DJ0A 4KFBB 4P7TA 2QTWA 2GFFA 3LWLA 4M5MA 1FNXH 2AGOA 1RTDA 3AFGA 2FTRA 2LECA 1NDKA 2K1RA 2XMKA 4ECWA 3GV8B 2J7KA 2P9GA 4FF3A 4IH5A 3JAMY 1MMDA 5HJXA 5KFDA 4I2QB 2AJ0A 2DXEA 2V50A 4DG1B 3VAKA 2LEBA 1O8BA 5GAGI 3QNWB 1B3TA 3QJJA 4DX6A 2CQBA 2CQPA 2W24A 2LXIA 2QSWA 2DHXA 4JI6J 5KFAA 2XO7A 4LF7F 1VIOA 2CNOB 5GMKa 2R7TA 2HWHA 2VPYB 1NNDA 1PSDA 1VQ4S 1RT6B 2XHWA 1RWUA 1WNEA 3CDWA 4E98A 1TVRA 3MWBA 4M95A 3M8ZA 3U1MA 2ZHAA 4M5JA 5B08A 1KQGB 5KT2A 4K4XA 4JI0J 3IM9A 4USJC 3WX4A 2R7WA 1U45A 4C8MA 2CQ2A 2FVPA 2NZCA 2OJ3A 2RH3A 5F8JA 3DLHA 1UKUA 4TYAA 4LJMA 2X1FA 1VQLS 5HSPA 1LWFA 2YNIA 4OIXA 2BRLA 2ZH6A 1FRJA 4I6AA 2ZM6J 2VHGA 2HNDA 1IVZA 1WI6A 2ATLA 3MAAB 1IWAA 1TUVA 4OHWA 4DL0C 1OIAA 1HQ2A 1KRPA 3MM8A 3MZIA 1HBUA 2JX2A 4IG0B 2KVIA 3SYZA 5IT0A 4FPIA 2M88A 2J76E 2QL9B 4NASA 4EFAC 3BO3A 1E6VB 1LWCA 1OQ6A 2FPHX 5DO2A 5IZHA 5E5NA 2KL8A 5C25B 5L1LA 4XDDA 4MJKA 2YPZA 1P1TA 2VA3A 2DBBA 2UUCJ 3GIMA 4DUZF 1HNXF 3W5XA 3KG0A 3W8PA 4KV8A 2CQCA 3GR1A 4DEZA 3GYXB 4EU0A 4X66J 3P96A 3I9V9 4ER8A 4ED3A 1BMQB 2J0XA 5CYQA 2C3MA 2AQ4A 3I9ZA 2HPUA 1R6YA 1S6UA 2M4MA 4TQRA 1U2FA 2EVZA 3VAHA 1JLGA 2I5JB 3UD4P 1X0PA 4DWIA 1NDPA 2Y8WA 3SMZA 3KDNA 1LW0A 1EAYC 1YTYA 5CCMA 3FZBA 2HLUA 3CO0P 4J9SA 4OHVA 4OZ5A 5IT4A 1NH7A 3IS9A 1QAJA 4NLWA 2X3GA 3D68A 1M90T 4QIVA 2IYGA 2Y8YA 8AT1B 2PFFB 2HGNA 3OFEA 4PXEA 3MM6A 1TK0A 2OI2A 2MGZB 3MM9B 2UP1A 2YWHA 2YWGA 3TJ9A 3VZIA 1XC9A 1N6QA 4GKKJ 1I6JA 2DVIA 3OFHA 3OTEA 2YNFA 3HI9A 1MU2B 2LKZA 2L3MA 2ZH4A 2B9YA 3M2RA 2AEMA 3CE8A 4FF2A 1CSJA 2DIUA 2F9DA 4C48A 3DLBA 3B82A 5E2QA 4ID8A 1AZSA 3KJVB 1S1UA 2I8EA 3KLHA 3BSOA 2P2CB 3VALA 2HQGA 1NH8A 3WDOA 5F9NA 1ZH5A 1TP7A 2FLPA 3Q2TC 4Z7CA 2CJQA 1TUWA 1N5TA 5I4MA 4KPYA 3DOMA 1FEHA 3EGZA 1IJEB 2YH0A 1SC3B 5E33A 4ED8A 4PRFA 1WC6A 3DCAA 2BW2A 3D1HA 5HATA 4XPCA 5F3ZA 4CH7A 2ZDPA 4QIWD 1EB0A 4CO5A 1V3ZA 1NZ8A 1ZA2B 2OUGA 3JSRA 2WZ1A 2MYFA 2IVYA 1PC5A 2J9DE 5IV3A 1QD1A 4QWBA 3QPIA 2FB0A 1M5VC 3AODA 4DV1F 3PJWA 3Q83A 1HI8A 1RHUB 2HNZB 1CJUB 4C8ZA 4OFZA 3QMQA 2YKAA 4JYAF 2B7CB 3UN3A 2HG4A 2VJUA 5ETQA 2HMIB 3R7NB 4DXLA 3CUNA 2DGOA 1CS4A 2XS7A 2HIYA 3Q86A 4A8MP 2K2PA 1HD0A 2COLA 3HHDA 4IOCQ 4WZMA 2FVRA 4DCJB 1NU4A 1RQ0A 2ZC4A 4ETZA 4HVZA 3NS7B 1RAIB 2DK2A 3NBPB 1V5VA 5HP1B 3M32B 3H0PA 5DG7A 1X4BA 3M6XA 1F2HA 1S0MA 1VDHA 2ASYA 4NYPA 4N41A 2KT2A 5L39A 1IN0A 4ZOSA 3B54A 4OZ1A 2V2VA 4LF6F 4QIFA 1JLFA 2HHHF 3R2CJ 5IC6B 4DFMA 1J5EJ 1JJ2R 3M8PB 1U1LA 1N48A 4YDDB 2YX7A 2ZZNA 2HHVA 3RRGA 1NAQA 3HVRA 2HAIA 2F4FA 2Z2LA 3ELHA 1Q5YA 1O51A 4HACA 1KS2A 4CRJA 5ETNA 3O6QA 1RWOB 3IGNA 2OH2A 1YBUA 1HMVB 3CD6S 4QU6A 5IOLA 3E3XA 4M5NA 3WIVA 1IBMF 3TVZA 2HGMA 2AJ2A 3KJFB 1KTVA 4ID5B 1DURA 2FC9A 1JLAB 4WFXA 4YN3B 3DI6B 3E51A 1NK7A 2HFVA 3TEHB 3MCMA 4ECZA 1UEUA 2NQPA 2PDAA 3HKZD 3W9IA 1TMJA 2HZVA 4PQAA 3KK2A 1WD6A 3K17A 2ZD1A 1F2GA 1LXJA 1X5TA 4P10A 1UEVA 3JSBA 3J7YU 4ZLPA 5IT9U 3Q8SB 2CPJA 2RRAA 2GJIA 3BYRA 2ZH7A 4HT5A 4DV6F 5J1NA 4ECRA 3HHNB 4AT1B 5CH7B 1Z1ZA 3H98A 4G6VB 4AL6A 1U4BA 3R27A 2Y0SD 4A8QA 1D3WA 3HLUA 5ETVA 2ADBA 1KVJA 3PYEA 1AA1B 2DR8A 1RADB 4ELVA 1YJWS 3IG1A 1CVJA 3OTCA 2B43A 1GXUA 1EETB 2CPIA 1M5KC 3QRQA 3D67A 1TV6B 2DISA 4IO9Q 3TVYA 4PYAA 1RT7A 4DR3F 3OR1A 1SIWB 2HHUA 4KRWA 1SV5B 3W9HA 4ANCA 1C4CA 1KNZA 1S6OA 4CH1A 3PIOQ 2R4FA 1NKCA 1HIYA 4WCEQ 1RT2A 3J81U 3ILIA 1V3RA 2P8IA 4ZPCA 3LAKA 2RKIB 4LRFA 3IWLA 3IWXA 1X4AA 3GE9A 3C19A 4RNFA 3NMAA 1NPPA 1SL1A 3HMJG 4C0HA 5D0HA 3TJAA 3HFKA 2POKA 3UPFA 2R7RA 4OJ3A 4PG5A 4IOBA 2GIQA 2KYZA 3OFFA 2G9OA 1X5OA 2XG8A 2RF2B 3LP0B 1ZM2A 5IT9Y 5M2PA 1D8ZA 4Z2XA 1TKDA 4DSLA 5C24B 3PW2A 4H4KA 2OP5A 2I6WA 2VASA 5J2NA 2CJAA 3LOUA 3RRKA 2A0FB 2YBVA 5C42B 4UT4A 1LXNA 2E5GA 2H9ZA 1Q86T 1N5QA 5DGBA 1XIQA 3PEHA 4UOFA 4TY8B 1NSKL 4Y65A 4O3QA 3WX8A 1Q8LA 1P1LA 4I67A 2C2MB 2N3OA 4L3KA 5B0DA 3BYPA 3GU0A 3M2UA 4PZVA 2Z58B 3HM9A 1RWXB 3I5AA 1TL5A 3DOKB 3JXOA 5L46A 2CJXB 1U47A 4WBFA 2RDIA 3GFYA 3M2VB 5HMXA 2HYIB 2D3O1 1FDNA 4ZP9A 1UVMA 2DNOA 4WXWA 3MGJA 1IKVA 4RKUC 5ETOA 1X4CA 4RBUA 3DLGB 3MEDB 4HI2A 1FNOA 2QV6A 5CABA 1RBAA 3BZQA 1XR5A 4KHMA 1YBAA 2OSQA 2XNRA 5K8NA 2XQCA 2QFIA 4HHJA 3TUZC 2KHDA 1WDTA 2MKCA 3DFEA 5G4DA 1HNZJ 3WIUA 3FBBA 2DH8A 3US5A 2E7WA 2LXFA 2R9LA 1N33J 2PEHA 2ZJQQ 4LVOP 1AT1B 1A7GE 1RT4A 3VQSA 4I7FA 1L3VA 3M7VA 1LW2A 1UFKA 3PHEA 1XMQJ 3ZFVA 4JI1F 1C0TB 3O2IA 3GSIA 2HBQB 4KGZB 3S8SA 3DKDA 2APOA 2NXJA 3M8QB 2HRYA 2XZWA 2QMWA 3UDCA 2Y1RI 5KFBA 5KT7A 2AJFE 1OQ3A 2YQ0A 3PCOB 2IRXA 4KGKA 1DTTA 4TVAB 3TUPA 3R5GA 1PJ7A 4RU9A 3KLEA 2FLOA 3BV8A 4CM2A 1F0XA 1SC6A 4HLBA 1B7YB 5E3RA 2LEAA 3MTJA 3GQCA 1XEZA 2OELA 3GB0A 2PMHA 1UWBB 2V2QA 2NPIA 3DRRA 3EDQB 2PMZD 1NDLA 2DNMA 4NLTA 1HNVB 2ROGA 2O67A 4QR0A 4ERDA 5HLFA 1S0VA 1SH0A 2EFNA 1HKAA 1J5EF 3IR5B 3CMAS 4C8KA 1VJQA 3UDEA 4ECTA 3N0VA 5HMYA 4HT7A 4KYZA 4BLGA 3JTNA 1K0TA 2B6AA 1BQMA 2VBYA 4R25A 5L9NA 1U1PA 3RR7A 5ETKA 1U0HB 2V8VA 3KUGA 1NPKA 1S72S 1PIEA 2G2ZA 5KFMA 3AQOA 3R1LA 1K73T 4NX9A 2VH7A 3N28A 3LWMA 4PG6A 1FESA 5A6WA 4RW7A 1K44A 2LQJA 4FDFA 4C2MA 3HFZB 2OEMA 4KFBA 1JKHB 1SQEA 1VR6A 1FXDA 2MKHA 1VQKS 4UF4A 4MYTA 3ILLA 3T9NA 1ROFA 3VQTA 2D1CA 4RW8B 1NK8A 1IKYA 3U1NA 2RDDA 4DR2J 1HNIB 1PG5B 2RUSA 4DX7A 3QRPA 3ZZOA 3C6TA 3FSXA 2OPRB 1RCXB 2Z4PA 2E9ZA 3DLKB 2FJDB 3OL7A 4QPTA 1S9EB 3RB0A 1T9VA 3EVWA 1SJRA 2FJBB 3BGLA 4Q0BB 4LSLA 3GCWP 4IH6A 4KC5A 1TL4A 1WF2A 1B0VA 3BKTA 1K1QA 1X9SA 4I1TA 3EM1A 2QLFB 3HHLB 2CQDA 3LP1B 2R7UA 3N79A 4UZCA 4PQUA 3Q8UA 5HN0A 3U27A 2BA9A 3N01A 2WRMA 4C11A 2ZWOA 5KFJA 3AXMA 4DFJA 3ZTQA 2AD9A 2RDJA 1LEOA 4CLSA 1F9EB 4EMDA 4N8OA 2WSCC 4DR7F 4Q45A 4R8UB 6AT1B 2MQOA 4DFKA 3I82A 1VK3A 1KONA 2RT3A 2HSEB 2RRNA 5KT6A 4JB8B 2JC0A 4CLWA 2GHWA 2JHEA 4WFYA 1FJEB 1IXKA 2FY8A 1PJ5A 2XYHB 3ZTOA 4JI4J 3PY8A 4ENOA 2G13A 4ZVSB 2IIHA 4PUOA 2F40A 2XMMA 3TZXA 2M0GB 1KLMA 4PABA 3QZ8A 2RQKA 3OTOF 5T14A 5IWAJ 2N3LA 3HO1A 3CDBA 1UJ6A 4H4OA 3OR2A 1KTQA 2HNYA 4YB1P 3HZEA 3KLGB 3TAMA 2PEBA 2XYPB 1OPIA 3QIPA 4OZ2A 1OO0B 2XMUA 5J1PA 3KLIA 1RJJA 4DV4J 3EJMA 2CDQA 2W4DA 3V4IB 4QOTA 4OJ1A 4M5HA 4FZVA 3T5KA 4DQIA 2QYGA 3RAMA 1SKSA 2I38A 2LFVA 4KPCA 3ITHA 4DDFA 2BOAA 3EGNA 3C14B 4C98A 4U8YA 2E5JA 5LJ3Y 1ZA1B 3P6YC 2UUAF 2HVDA 1FFWB 2V4RA 2VG7B 2AJ1A 2D3ZA 2KM8B 1TKZA 2DGSA 1R31A 4LMZA 1UZDA 1H2UX 5I3PA 3CJKB 5KOWA 1SIZA 3CD0A 2JEJA 3UNYA 4JOUA 2UUTA 2PIIA 4Q8FA 3C16B 3CIMA 1JX4A 1RCOB 4NYZA 2QMXA 1LKZA 4P52A 5GAHI 1RWPB 1U1OA 1RTIB 2AGQA 3HKWA 1OPZA 3K0JA 2ZBPA 4ANEA 3ZNUA 3CT9A 2WONA 3IFEA 3R6LB 2XBPA 4IFYB 4CLKA 1WHWA 1LQ9A 2G0JA 3BGRB 3CJ8A 3MR3A 3FQLA 2ROEA 3CVKA 2MZRA 5ETLA 2XMJA 5F0WA 4NLGA 1H7WA 5A0YB 2NXEA 2YKMB 3QIDA 4WWSA 3OL6A 3T5LA 2V8DA 3ADAC 3DRYA 1N32F 1HBNA 4OHZA 3P45B 3QZ7A 1YKWA 4C8YA 3W64A 1X4FA 3UN5A 1B7FA 5A76A 4PAAA 2CPDA 5LMNJ 3TP2A 1T9XA 4NCGB 4C0OC 4FVCA 3DGVA 2G4BA 3W2WB 1QAXA 1T05B 4JI7F 2QA2A 1RA7A 1T9UA 1IQTA 5I3UA 3TOQA 1UVLA 3QFWA 3HZGA 3CC4S 4DL7A 1GFWB 2W8LA 1Y0HA 3GCXP 1N36J 1GAOA 2D69A 4UOGA 3DDIA 1H2TZ 3JSYA 4X4QA 2HIQA 4NYOA 1B70B 2PA8D 1MLAA 2V2ZA 1FDAA 4Q7AA 4F3MA 1NHUA 1JQGA 3MEKA 2ZE2A 5BYQA 3EPIA 2MQ8A 5IV4A 3T3FA 3ETMA 3OTBA 4O4RA 4DL4A 4UOHA 4DV7F 2RRBA 1VI7A 5KG2A 4Y3CA 5DQHA 3BS9A 2IVMA 1KSPA 4CYUB 4NEZA 4FXDA 1QUVA 2DNLA 2FVSA 3GYGA 3J80U 4F3OA 3AD7C 4RNNA 4ZPVR 2FJEB 1TL7B 2VB6A 5A8KA 2BYCA 4CT8A 1RHJB 3POTB 4DS5A 5IQ6A 4B3TJ 1VQ6S 1VHIA 3TYTA 4DZDA 3EICA 3A1YG 4D3HA 2AW0A 2HHWA 3NGTA 2K3IA 3B4MA 3E01B 3QBCA 5IC4B 4RW9B 2G1DA 1WC1A 4X64J 1FXRA 4J7CA 1U1NA 3QFHA 5D15A 2D3UA 4OLPA 1HI0P 1DBDA 2QLJB 4CO1A 1SUQA 3M9OB 2QIFA 3PXGa 2IM2A 1TK5A 3N6NA 1DARA 2K06A 3JYTB 2AT1B 1Q0NA 4U6PA 1VIXA 5HMZA 3C15A 4ID5A 4IFVB 2J7WA 1MROA 5LSLA 1FD8A 2BJDA 4NZ0A 2W9CB 2DYAA 5G0RB 2YNGB 2E5IA 4GC6A 1WHVA 2RHQB 1NJZA 2J9EA 3PYDA 4ICLA 3DRSA 2XMVA 4DUYJ 4CO2A 2UUBJ 4IH7A 1WEXA 3J80Y 4YEAA 4ECSA 2WVDA 5KFVA 4CO0A 1KD1T 4QW9A 4WFAQ 1N0UA 1VC0A 1QTNB 2IC3A 2MHEA 3PV8A 4ZHRB 1S9GA 4CLUA 1CC7A 1S7IA 2CFXA 3TRGA 1ZTWA 2CVEA 4MFBA 4USKA 2BR0A 1XMBA 1NK9A 5ADZA 2BX6A 3K5OA 4IDKB 2IPOB 5D3GA 2VICA 4OZ0A 1JLQB 4C8OA 2KJWA 2HHQA 3RB4A 3HSZA 2EWHA 5E7OB 3GMGA 3TA2A 1NZAA 1S6QA 1RTDB 3BPDA 2YWWA 3CDEA 2HK2A 3BDEA 1O0PA 1IUJA 1RHQB 1VRTA 1KHVA 3LANA 1M1HA 2L48A 2K1RB 5CYMA 3K5LA 2WVBA 1VHFA 2FUG9 2AEJA 3P3DA 1BWVA 1A0OB 1S1WA 2X3DA 1Y00A 1EP4A 3NCRA 5B09A 5ETPA 3EE3A 3M6VA 3T19A 1BY9A 1XK8A 4ECVA 2FC8A 3BREA 2J7UA 3AD9C 3N5FA 1F1BB 3JSMA 1FO1A 4DSEA 3V5RA 4QIEA 4CO3A 4WU3A 3UNGC 2B5JA 1RKJA 3DYAA 4NOHA 2VQFF 2CQ3A 3P49B 2VA2A 1TVRB 5M2UA 1S76D 1HYSA 1NO8A 1ULRA 1T7PA 4OX8A 1V9OA 2UV8G 1Q82T 2KXHA 3VAMA 2LU2A 2B4UA 2HFUA 3ZXWA 2XS2A 1RT1A 3FEXB 4DL3A 2OHDA 1V3SA 2F65A 4UQTA 4DMZA 3AXKA 1WEYA 2HWIA 1T94A 4ZA1A 3EWGA 3CMQA 2GO9A 3A8IA 1CG2A 2GVDA 1QAYA 2KN4A 1UPPA 3T5JA 4O44B 4N7TA 2YTCA 2IJNA 1WG1A 4K4TA 2Z56B 2VG6A 1EIYB 2UV8A 1UETA 2LXUA 4OI1A 1RBLA 1V6HA 2HQFA 3CCQS 3RAXA 1LWFB 2YNIB 1FJGF 4URSA 1TKXA 2HNDB 2VDHA 3G2XA 3LH2S 3RZAA 5JXSA 2CG4A 4RNHA 2HWTA 2R8JA 1HA1A 2JL9A 3MM8B 3TZZA 4JI5J 4HH1A 1HBUB 2VC0A 4G1QA 1N5SA 5AE2A 1RHRB 3X1LB 2W2PP 2W01A 1PBAA 2EG2A 2DGUA 2BJ8A 1HWLA 2GQCA 3VZHA 1KKHA 4CNYA 3M6UA 4FF4A 2E29A 1GK8A 1U6BA 1RAAB 3L7UA 1LWCB 3R3TA 1HL6A 4KHPJ 3QJPA 3CJTA 2C2RA 4BCAA 2KKHA 1FKPA 5EX3A 3KHLA 1X4DA 4XAKA 3F73A 1NKEA 2B8QA 2CZVC 1YBTA 5KFRA 4OYOA 2C2OB 5CQGA 3CD7A 5GAEU 2LQBA 4KV8B 4B3SJ 3K5PA 3BBFA 1NM2A 2YKPA 2LQ5A 1NLKL 3U7JA 5F8MA 3UR3C 4L72B 5RUBA 2QN6B 4FP9A 3HD2A 5CYQB 4ZVOB 4RJVA 1Y5NB 4ZS6A 2HKEA 2W2NP 4I6YA 1WC3A 4QQBA 3QGHA 3V4MA 1PAEX 2FZKB 2XMTA 3NOCA 3W63A 1U1RA 3BBBA 1JLGB 1T9WA 2OD6A 1CQNA 4DR6J 3AAWB 5DS7A 2IYIA 2YQ1A 2KYXA 4DBQA 4ES3A 3RB6A 2MZ1A 4RWWA 4ED0A 3IS9B 4K4VA 4B3TF 2YNHB 3ENWA 4B3RJ 2VQEF 5K5MA 3I6PA 2M8HA 4QZVB 3PX4A 2HHTA 2BKPA 1Q79A 1F6TA 4ECUA 1VFJA 1YDLA 1UWBA 1GMWA 4ZJOA 3MM6B 1T8EA 1HLWA 3NLCA 4Y34A 1NB7A 3MMCA 4RL1A 3HT0A 2UXBF 2V69A 1CJKA 2J8SA 5DDQC 4G65A 1N6QB 5K14B 4B9LA 4FNIA 1VQ5S 1UTAA 1DQAA 2XSJA 2YNFB 2ADCA 3KG4A 3OTDA 4KKOA 2LYVA 4I56A 3TUJC 1U2RA 2AJ4A 4LF1A 1HHQA 2R7OA 1R7IA 4W92B 2HRUA 4OYXA 1VQPS 1VJWA 1AZSB 2HHSA 2YQ3A 5J1EA 1S1UB 2D9PA 2P6TA 4Y2IA 1OYDA 3KLHB 4K7QA 1BD6A 2BEFA 4JV0A 1S0OA 5A8WA 2YWEA 5B0BA 1AXQA 2DGTA 3HSDA 1U0SA 2VODA 1UA0A 2R7QA 5BJRA 1FRLA 7AT1B 3PVXA 3DOMB 3GZ7A 1RYRA 4HTJA 3EMTA 4QCLA 5F8NA 4ZVHA 2F3JA 4USUA 3N6LA 3BGOP 4C3MA 3I56S 5LM7E 4DUYF 3IGVA 1F9FA 2CWKA 1WC0A 4K4UA 2VBZA 3IWNC 2IAJA 4NLQA 3IP0A 1R8CA 2KXNB 2FJVA 1QLNA 4EEYA 3DDKA 3RBEA 5KFPA 2QLXA 2AYGA 3PFEA 5HK4A 4DV0J 2BJEA 1WKLA 5FLXY 1FRMA 3NOGA 4BWJA 3DMJA 1VOMA 1DHMA 2VPWB 2U2FA 3FRYA 2DNNA 1U6FA 2AIRB 3HFVA 3BGUA 1S1XA 1CS4B 2D41A 5CCLA 4YMEA 4LF5F 2AP6A 1TAUA 1HNWJ 5C2CA 4DPWA 1CJVA 3I55S 4DR1J 2MY7A 4RBVA 2HFZA 4CTAA 3D0HE 3EDRB 3HHLC 3DC2A 5F8GA 4ECQA 2ZJRQ 3L7PA 3HPOA 3H5SA 3HD1A 2QG9B 3M8RA 4C97A 2NXCA 4OZNA 5LXYA 4A8KA 1QTMA 1JLFB 5F0UA 4O3SA 1RU2A 1WHXA 5B0AA 4KR0B 4B3MJ 1LWEA 2B56A 2IHR1 5I42A 4JI2J 2QE5A 3T1AA 4P74A 5K20B 3K5MA 2IRUA 3HK2A 5B7WA 3THPA 1Y7PA 4HACB 2R2UA 2HQDA 1C0UA 3W60A 1RYSA 2OPPA 5AXNA 2V8GA 1VRUA 3MUTP 1M5PC 3IR6B 3NAHA 2JEFA 4U96A 1UVJA 1JJCB 4F8RA 2DR9A 1UVNA 3UCZP 3GJTB 1IBLJ 1P8GA 2N7CA 2FHOB 3TW0A 3VAJA 1WI8A 1IWGA 3A3PB 3TVKA 1L3KA 3F44A 1JLCA 2J5AA 3BGFA 3KK2B 3FCVA 2J6TA 2UVUA 4UY85 4DJBA 3FCHA 5D4OA 4HDGA 3SFUA 1EARA 5KFLA 1U24A 5GVQA 2DCLA 2XC9A 3DHWC 2VFVA 2UVWA 4DL2A 2ASJA 1S79A 1LFWA 3SCLE 2E1PA 4A8FA 3PM9A 1JMTA 4M5DA 4RWXA 3T6BA 1P27B 2GZOA 3RW6A 3EXCX 2VBXA 2XYGB 4NLRA 3B8HA 2UVRA 2M7SA 4DPYA 3IG1B 3AA9A 1C2PA 3VGTA 1S9FA 3DN9A 5H9EK 4B9NA 3BQ1A 2IMOA 3T1HJ 4HTIA 2WSEC 5I3QA 4W90B 1RT7B 1RAOA 5L38A 3OR1B 2PI5A 4OI3A 3WZ0A 4AFFA 3M6WA 4LF9J 4Z37A 3NNHA 2HBZB 5K8MA 4DR4F 3OQ2A 2F8MA 1GMWD 3L7OA 1ZBTA 2IBKA 4OYMA 1RT2B 1RWNB 3EGWB 3DRXA 2BQRA 3UI3A 1C1CA 2ALZA 1FVSA 3GYNA 3EGVA 3KFWX 3UVJA 4QYZJ 3H40A 1NJXA 5A0YA 1IBKF 2CNNB 2YKNA 2P9CA 1M5OC 1I51B 3FC9A 2VL1A 5AE3A 2QFJA 1SL0A 3T41A 1KR4A 2XM3A 1BLUA 2XY7A 3GWCA 1Y4ZB 1RSCA 3KKFA 4Y2MA 3KK1A 2F4VF 4KH1B 4JI8J 2WB4A 5J2NB 2WVEA 2EK1A 4K0KJ 4CZCA 4FYYB 1REGX 2W4PA 3GIRA 4ZCKA 1QSLA 4YR0A 2B9XA 1VBYA 1U1MA 3R7BB 4DSFA 4QR1A 5GAHU 1UVIA 2HBRB 3TUIC 2NZ4A 3M2UB 2KFYA 3QWUA 4DR5J 5FJ4A 4RPFA 3J81j 2CRLA 5KFNA 2ZC3A 4KQZA 2MQQA 2BVZA 2RJZA 2V63A 3M1VA 4TNOA 2ZZMA 2G1HA 2GS8A 4LFCJ 1X9MA 1Q1KA 5H9FK 4EO6A 3M8SA 5HO4A 5T41A 1IKVB 4QYRA 1WOPA 1DTQA 3G86A 2PSZA 1Y9OA 3RTVA 4USWA 3BSNA 2W2MP 2C42A 4P2FA 1ZM4A 4QR2A 3DGPA 3M4XA 3HHLD 4IOAQ 4YY3J 3R1HA 1RTJA 1R3NA 3VAIA 1NUEA 8RUCA 3J7AN 4X4OA 3CNQP 3M9MB 2LCWA 4ES1A 2E1AA 4RW4B 1QUPA 4JV2A 3SIPB 2ZH9A 4OI2A 3X3UA 3CC2S 1Y5IB 2M70A 4D3GA 1T0TV 1VCTA 5HVGA 3NRBA 1C4AA 4LFBJ 2NSCA 1RT4B 3H4BA 4I7FB 2E44A 1LW2B 1M1GA 1OSCA 1Q16B 2EFOA 2VV5A 4V1Ak 4B3OA 4RLEA 5JJBA 2BM0A 4DV5J 5C7PA 4PPDA 4PEOA 2BOPA 3PW4A 1HNWF 3MR6A 2Y3YA 1RAGB 2BQ3A 4FVMA 2EXUA 3ENAA 2DITA 4DR1F 1DTTB 1B0TA 2R42A 4LSNA 1NDCA 2VDIA 1HR0F 2XY5A 3KLEB 1TL3A 1Q95G 3LO3A 1EZZB 2BABA 2HFOA 4MKVA 5KTQA 4YP3A 3G6VA 4WYLA 2EK6A 3UWTA 3CCJS 1HD1A 3PR5B 3DRRB 4BDPA 2XZDB 1ITPA 2V34A 4OI4A 2CJ9A 3PJXA 2M8DB 1SKWA 5HLFB 2KTQA 2L9WA 5F8IA 1FE4A 2RILA 3WQPA 1FWPA 3HVTA 2GMJA 3NS5A 2B6AB 4AL5A 4MKBA 1BQMB 3MMAA 4DQSA 4F50A 3B4DA 2ZUGA 2FIUA 5KFHA 4PCQA 3UE2A 2VFSA 1DZ5A 2UXDF 1T11A 3SQOP 3OLBA 1HQEA 3G6ES 1H7XA 2HQ3A 2DGQA 4RW7B 2H5JB 2EPIA 2L41A 1W2IA 1W25A 2OO4A 4GVLA 3TWZA 4NCAA 1WTBA 2V5HG 1IKYB 2IY5B 4WP3A 2IRYA 1HI1A 3AQPA 2VZ9A 1RKIA 1IKXA 5CD4H 4X65J 2XHCA 1VQNS 4EI2A 1AFIA 3C6TB 4LR7A 2DRAA 2G2OA 4V19X 5JVGQ 4XK8C 4X4SA 1ZPWX 2EFQA 4X4TA 2L9NA 3SQGA 1SVDA 4F2SA 2E9RX 3V6HA 2P5VA 3VGSA 1XMOJ 1FJ7A 4OYBA 4XO0A 1JK9B 4LF4F 4LSLB 1SBRA 2YWKA 2C2NA 2DO0A 2D7SA 5D4NA 3UO0A 3NGUA 4X4PA 3D9BA 2BE2A 1R0AA 2OFHX 3DDNA 2PN6A 5FD1A 2ZKTA 3T1HF 1WF1A 3SEOA 2W7AA 4X62F 3BH7B 1XWLA 2D3OR 3JQJA 3D28A 4PQUB 2ACYA 4ILRA 4C11B 3V6DA 3I96A 1U02A 3TO8A 4DSIA 3CB4A 3DM2A 1O6XA 1X8DA 2FLLA 4WXOA 1FX2A 1FFSB 7FD1A 4GC7A 4WYWA 4ZDNA 4LQ9A 1Q7YT 1AFJA 1XR7A 4O44A 2CPHA 1YJ7A 3FQKA 2Q43A 1U2CA 4F02A 3LF0A 4GKJF 5DRKA 1R89A 2GIRA 3QT5A 3GG0A 5DJBA 2UXCJ 3CCRS 2HEKA 3ENQA 3H5YA 4PUOB 5HMWA 1WORA 1FDBA 1KLMB 2JVRA 5SZTA 1R8BA 1BGXT 4I4BA 4KAIA 1H98A 4FPRA 2BANA 2BW7A 2ZVIA 4PWWA 4H4OB 3OR2B 4PXBA 2HNYB 4YHHJ 3NCPA 3TAMB 4U7UD 1U09A 3QIPB 2GVZA 4DCPB 4QIGA 4LF8J 3JB9k 3KLIB 2XI2A 2CPFA 4KBIA 3A8EA 3D3BJ 2V9KA 3Q8YA 3W66A 4J9UE 4C7QA 1JNRB 4F0MA 2XWYA 2C3UA 2F8HA 3ITHB 2LP4A 5IXUA 1HHSA 3D4JA 3MAQA 2VONA 3CCVS 4JI3J 5AE1A 1N0VC 2V2KA 1WC5A 2BBEA 1TKZB 1WF0A 2UZAA 2VG5A 3CJRA 3PYGA 2KB2A 3N4WA 5AT1B 1SPBP 2IA0A 3BM7A 4J9QA 1U1KA 2H3EB 3SDEA 3DLJA 2ZH3A 2EI5A 4EZ6A 3CDAA 3BH6B 1X7VA 4WIIA 2HS3A 3THTA 4E2FB 3ZTSA 3G8TA 4K50A 4OX9J 2YNHA 1YI2S 2CIMA 4C8NA 1RAHB 3MOJB 2QC3A 3M05A 3SXLA 1FJCA 2E5LJ 4ELTA 1U25A 1GH8A 1KN6A 3H42A 5DQGA 3CC7S 1MMLA 1SJQA 4PKDB 4CO4A 3OW2R 2WONB 4O4GA 4JV5J 4FF1A 5KAKA 5K14A 1VQ7S 2JLFA 4AQYJ 3TZWA 4A8SA 2UU9F 2A2CA 1SQGA 2VC1A 4ZPTR 5LSRA 3PRBA 4OJHA 3O3LA 4WTYA 2X1AA 3G82A 3GR0A 1HBNB 1RT5A 4CWBA 2BJ1A 5KG5A 1Q78A 3DXBA 1E6YA 1UZHA 2JOQA 1WTFA 2W7OA 3F56A 3I0SA 2RVJA 5H1SV 1AW0A 2ZJPQ 3VVUA 2VF3A 2XEXA 3IA0A 3T1YJ 5BYRA 5I3UB 3VWSA 1VGYA 2GX8A 1QM9A 1OYEA 1H74A 4W4MA 2VU5A 5KFFA 3UCGA 3IN5A 3NWRA 2R7VA 3ET6A 3MAHA 3QYYA 4P2XA 3BO2A 1GXTA 4TU9A 1MWYA 1YVFA 2KU7A 3MEGA 4NE9C 4G3IA 1I94F 2FYXA 1K0VA 2ZE2B 3NG8A 3RJMB 1XBWA 4K4WA 2RMLA 2CYYA 3EUNA 3Q24A 1GNKA 3AJDA 3W9JA 3W5ZA 1MMNA 2PO4A 1RTZA 3NEKA 4LRAA 1MW7A 2HBYB 3SBMA 3PJ9A 2ZZTA 2PFDA 4DLEA 1WUUA 3CCLS 2MB0B 4Q44A 7FDRA 2ZH8A 4TKTA 1VK8A 2AJQA 3FMWA 5A8KB 1PAUB 5K9FA 2MKJA 4LFAJ 2NYHA 3FBCA 1HW8A 5KOXA 5EWEA 4HYKA 3LUYA 3QT6A 9ATCB 4R0JA 5KFXA 2FVQA 5MAOA 5CHCB 1YLXA 1BHNA 4B17A 2FHJA 5CD4A 4DV2J 1FFGB 3QAEA 3R7SB 4BBYA 4PXDA 3CWJA 3MR2A 1FK9A 3J7YI 1EQ0A 4S0MA 4JI6F 4NLSA 2C2DA 4X2BA 5CZVA 1SUQB 5IM0A 1XNRJ 3TI0A 5D4LA 3FGVA 2DNZA 3ILJA 4KSEB 4ELUA 3Q8RB 2CQHA 5BR8J 3C15B 1RZMA 2YX4A 4HDHA 3J7A1 2RSQA 1S77D 3SFGA 1MG7A 1MROB 3ZO7A 3CJSA 1WACA 4DX8H 4JI0F 3OJSA 2X1BA 3KDOA 1SKUB 2C3YA 3VF0B 4NXNJ 1UVKA 2Z0GA 4F4ZA 2GJFA 5IFMA 5KFTA 3ZZTA 3IBFB 2Y1JA 4ICLB 2QZ8A 3DRSB 4L3NA 1RISA 2RQCA 5CYJA 5AJ3J 5GMDA 2EBEA 2UXCF 2ZM6F 3ICLA 2IC3B 5KFUA 3G8QA 3PACA 1FE0A 2DT9A 1KFSA 4CLTA 4XTTA 3H25A 3H5XA 2R7XA 1S9GB 3EXYA 2NUUG 3EVOA 4MFBB 2JWNA 2DHHA 3ZZ0A 5B0FA 1OS5A 3A12A 4RW6A 1RI7A 4K4SA 1RU1A 3D0IE 5D3GB 4ZIWA 1YJTA 5LXRA 4QWAA 4I6WA 4USIA 3O5TB 2GNKA 3RUBL 1S6QB 3BBCA 3H5UA 1D9FA 1S1VA 1MNEA 1IKWB 1VRTB 5LJ5Y 1EJ7L 3HVAA 4AXIA 1FKOA 5LSOA 5CYMB 2CVIA 4LF7J 1YZ7A 4TN2A 2UUCF 3QAUA 3FDSA 1PKUA 5D0RA 2BQUA 2ZWPA 4R0EA 3V81A 3H8YA 1S1WB 5EUHA 4DF8A 2Y1IA 1HBMA 4X66F 3C6UA 1NKBA 1EP4B 1TL1A 4MKYA 4J90A 1RAFB 1B64A 4JI3F 3MPWA 4AL7A 1YJ9S 2J6SA 2RHSB 4K2JA 2JRSA 2FY1A 4TLRA 4DU8A 3JSMB 3CF5Q 3UD3P 2HVIA 4QW8A 1KC8T 4DPUA 1FF2A 2B5JB 3DYAB 4M5GA 1FRXA 2HZAA 3PKYA 2ZFHA 3K58A 4NI2A 2VUGA 3NMRA 4EWTA 4Q2LA 2W2OP 1FHTA 2DKOB 2LLZA 4EO8A 4FYDA 2RQMA 1HYSB 2H5EA 5KFKA 1YIJS 5L1IA 2AZ3A 4H4KC 1RT1B 1WJ9A 1QDUB 2WBMA 2HW3A 4YS2A 3T5HA 1Z4UA 1S0NA 2MJUA 4X4RA 5LOQA 6FDRA 4DOZA 2GVDB 4B9VA 2MEWA 4GKKF 2VG6B 3KUHA 3I31A 4EGLA 4BS2A 4LBHA 1ZM9A 2GO8A 1OMSA 3KLFA 2R8KA 2DHSA 3FCWA 2MLYA 2KHCA 3SZ2A 3G96A 1S7HA 3KMSA 2GQQA 1VC6A 2RU3A 1TKXB 1TQLA 4X84A 4JBCA 3ZNJ1 2V67A 3K2YA 3QT7A 2CQIA 1ZYQA 1HNXJ 2HVZA 3J81Y 2FZGB 1VS3A 4G1QB 2MTLA 3TX8A 3I87A 2O01C 1GTHA 2WAQD 2QGFB 1DQ8A 1VRQC 4LREA 3Q8PB 4N5SA 1BQNA 3V6KA 2M9KA 1DQ9A 2I9SA 1Y3JA 2ZOGA 4MK8A 1VQMS 2ZUAA 2DJWA 1YJUA 1S4FA 2JVOA 5E41A 4BC9A 4ILLA 1KWMA 2KXFA 2MPUA 2K7KA 1FKPB 5LT5A 4RW4A 3D6HB 4ZITA 3UCUP 5J2MA 4CLYA 4DN9A 1TMMA 4EK2A 4FYXB 2ZBQA 1UL3A 5KG6A 1MWQA 5KG3A 1A6LA 3TANA 2GC8A 3QGPA 1PGZA 3FNNA 2IDLA 4A8OA 4ZVTB 2FZCB 4PWDA 1Q8BA 4C6AA 4P2SA 2R2RA 3OSNA 3RB3A 2IFXA 3PTWA 2B8PA 5D77A 1PJ6A 1KQKA 3TZYA 4J9OA 1H6KX 3FVYA 5DG9A 4DSJA 1JNZB 1URRA 3D6MB 1ZZFA 1PYSB 4A8WA 2Q3PA 4WU2A 2OTJS 2ASLA 1L5UA 2VPZB 4LSZB 2MLXA 1X4HA 4PG7A 2HQIA 5SUHA 4UY8T 2WTFA 3NNCA 2JH3A 1RTHA 1Y10A 1ACMB 3ILOA 1N56A 3W8GA 2B4OA 2J9CA 3G9CA 5AXKA 5J2QA 1JXVA 4F67A 2DGXA 3I4PA 3O1LA 3KUEA 4YR3A 2QA4G 3IC1A 3SCJE 2I0XA 3MF5A 3KHRA 3N9UC 4QWEA 2MSSA 1N5YA 3MMCB 4GO5X 1CJKB 1TKTA 3I4HX 2EG1A 4WE1B 1TELA 2QLBB 2K8GA 2CNKB 3VCDA 5AXMA 2B3TB 1QJHA 2XSJB 1SCJB 3Q89A 1FKAF 3H2LA 4KKOB 3WC0A 1R43A 5E3AA 1F60B 2OLWA 2ZH5A 4TXSA 4EUVA 3D0GE 1PCAA 5A2QU 2ILYA 1S49A 4XIUA 3GFHA 5J1EB 1X60A 2V94A 3CTRA 4LQ3A 5CAAA 4DF4A 3GTYX 3HHKA 3RBZA 5A8WB 3TX0A 1SXLA 3HXMA 4LF2A 2BMBA 5EWFA 4DV1J 4IYQA 2OMOA 4DQQA 1VQSA 3OXGA 1LK5A 1RUSA 4NXNF 5IS2A 2XS5A 4JYAJ 3ZZPA 3DOLA 3OLAA 3NGRA 4MIAA 1X9WA 1DFDA 5LL6d 1T9YA 5D0GA 1JLBA 1WG4A 1KVKA 2IAJB 5F9LA 1N8RT 4ZCMA 4CIOA 3W61A 3G6YA 4CLPA 2EKYA 2C3OA 4NRUA 4WJBA 3PEJA 2FQQB 6FD1A 3DMJB 2NXNA 3HP6A 4KO0A 2A3JA 3UW1A 4WFZA 1S1XB 1KLNA 1ZAWA 2X7IA 4OX7A 3M30A 2B4VA 3RBDA 4LF6J 4XDCA 4J5OA 2B4PA 2R8HA
chains in the Genus database with same CATH topology
2QE5A 1EETA 3HKZD 2YVSA 4Q8EA 3H4DA 4LVNP 3T1AA 3GIKA 1SH3A 3K5MA 2DH9A 2IRUA 3HK2A 4NXMF 1TV6A 1TAQA 2IJFA 4PQAA 5B7WA 2KFZA 2WOMB 3KK2A 3THPA 1Y7PA 3BN4A 1WD6A 2ZD1A 1F2GA 3MFIA 2R2UA 1LXJA 4CTAB 5A2QY 1X5TA 3KMQA 4QBUA 4QWCA 1UEVA 1C0UA 3JSBA 1RYSA 3J7YU 2OPPA 4F4YA 5AXNA 2V8GA 3PNIA 2M3DA 1VRUA 4ZLPA 3MUTP 1M5PC 2EFVA 3C2PA 3IR6B 3NAHA 2JEFA 3Q8SB 2CPJA 2RRAA 2GJIA 1UVJA 1IQZA 2ZH7A 1AUDA 4HT5A 4YB6A 4DV6F 2DR9A 5J1NA 4ECRA 4F8RA 3MMBA 1SV5A 3HHNB 5CH7B 3LAMA 3K59A 4OHYA 1UVNA 1Z1ZA 3H98A 4G6VB 4H54A 2IMWP 3C3LA 3UCZP 4AL6A 1Q8IA 4PR6A 1U4BA 3EYZA 3R27A 1P8GA 2N7CA 2FHOB 2Y0SD 4KO0B 3TW0A 4A8QA 3VAJA 2QYCA 1WI8A 4U9RA 1D3WA 1WELA 3HLUA 3S1TA 4YQWA 2VOPA 2ADBA 1KVJA 5HBMA 4KE5A 2DR8A 3TVKA 1L3KA 4ELVA 2PE8A 1LWEB 3M30B 3F44A 1YJWS 3IG1A 1CVJA 5I42B 1JLCA 3OTCA 2B43A 3TARA 1GXUA 3FFIA 2RKIA 1EETB 1YHQS 2CPIA 2J5AA 2MQPA 1M5KC 5F8LA 3BGFA 4FBTA 1NJWA 1TV6B 3OBIA 3ISND 2DISA 3KK2B 2LU1A 3RRHA 5KFYA 2J6TA 2UVUA 5KFZA 4ECXA 4LIRA 4IO9Q 3HHEA 5KFIA 4ZP7A 3TVYA 5GAGU 4LF9F 3JTPA 1C0UB 4UY85 3NGKA 4DJBA 3FCHA 1RT7A 3CSKA 2OPPB 4DR3F 3MDFA 5D4OA 4HDGA 3SFUA 3LPYA 1VRUB 4NA3A 3OR1A 5KFLA 1I1GA 1SIWB 1U24A 1WWHA 5GVQA 4KRWA 2HHUA 2DCLA 1R8PA 2XC9A 3DHWC 2JDJA 2ZNYA 3ONQA 2VFVA 2JFDA 1J2VA 1SV5B 1ZOTA 4DL2A 2UVWA 4OI0A 1H0HB 1S79A 2RF2A 3LP0A 2ASJA 1LFWA 3SCLE 1C4CA 1KNZA 1S6OA 4CH1A 3PM9A 2MZSA 2RE1A 4C0BA 4A8FA 3PIOQ 1JMTA 2R4FA 4M5DA 4JUZA 2DNGA 5DETA 4RWXA 5C24A 3T6BA 2KJVA 3MUMP 3OFGA 1P27B 3RW6A 1NKCA 2AF6A 3EXCX 5D4PA 4WCEQ 1RT2A 4RUAA 2VBXA 4NLRA 3B8HA 5HBMB 1V3RA 5C42A 2UVRA 4B9MA 2M7SA 2OAUA 3IG1B 3AA9A 1JLCB 4A46A 4BWMA 4ZPCA 3LAKA 3FFIB 1C2PA 2RKIB 2JSXA 3TA1A 1S9FA 1ELOA 2EFPA 3DN9A 1OSDA 1ZTTA 3IWLA 3IWXA 1S6PB 1X4AA 1F5AA 1CLFA 4B9NA 1BWEA 3GE9A 3JTOA 1FT8A 3CJ2A 4TY8A 1VQOS 5KFGA 2W9AA 4RNFA 3BQ1A 3NMAA 3BR8A 1APSA 1REVA 2IMOA 1SL1A 3HMJG 4KGMA 4C0HA 1RT3A 3BR9A 2Q66A 4RX6A 3HFKA 2NPFA 4HTIA 2POKA 2WSEC 5I3QA 4W90B 2LQ9A 3UPFA 2R7RA 1RT7B 4OJ3A 5BYSA 5L38A 5EGYA 3OR1B 2PI5A 4PG5A 4OI3A 3WZ0A 4AFFA 4IOBA 4EBDA 4DFPA 2GIQA 3M6WA 2JC1A 2KYZA 1Z2ZA 3DOKA 3OFFA 5HL7Q 4Z37A 3OPKA 3NNHA 2G9OA 1X5OA 2XG8A 2RF2B 3LP0B 4JI8F 1BC6A 1ZM2A 5IT9Y 5JVHQ 4OHXA 5M2PA 1D8ZA 2A1BA 3SSRA 4KTQA 5K8MA 3F41A 2OTLS 4Z2XA 4M5DB 1TKDA 4DR4F 3O8WA 2J0WA 3OQ2A 4DSLA 3AJ2A 5C24B 2F8MA 3PW2A 1JWWA 3CCSS 4H4KA 3L7OA 2OP5A 3M2VA 1ZBTA 1QY7A 3UFCX 2IBKA 4URGA 3KHHA 4K0KF 2DR5A 2VASA 5L9XA 3GIJA 5J2NA 2CJAA 1RT2B 3LOUA 2WHOA 3RRKA 3IRWP 3EGWB 1Q81T 3CJ5A 4K59A 5C42B 4KJIA 1LXNA 3DRXA 1JJHA 2E5GA 1U48A 2BQRA 1NK0A 2H9ZA 1S1TA 3UI3A 4N77A 1Q86T 3CCWA 2IM1A 1C1CA 1N5QA 2ERRA 3BN7A 5DGBA 2ALZA 2KFNA 3BJYA 2CQ1A 3PEHA 1FVSA 3GYNA 3MTKA 4TY8B 4Y65A 4IR9A 3KFWX 4O3QA 1REVB 1Q8LA 1P1LA 4O3NA 4I67A 4QYZJ 1RT3B 2F9JA 2N3OA 3H40A 4ILMA 1NJXA 5A0YA 1IBKF 2YKNA 4X4UA 2P9CA 3GV7B 1M5OC 2UVVA 3DLGA 2B4PA 3FMBA 3MEDA 4DR5F 3PX0A 4Q5VA 1ZPVA 5B0EA 2VL1A 5AE3A 5B0DA 1H38A 3M2UA 2QFJA 1SL0A 3HM9A 1KR4A 3I5AA 1BLUA 2XY7A 1TL5A 3DOKB 4IRKA 2VFUA 2DCUB 3GWCA 1Y4ZB 2WSFC 3PW5A 1GX6A 2ABYA 4C3KA 4YOEA 3KKFA 1HNZF 1U47A 3R5AA 4LFCF 2R2TA 4Y2MA 3DNCA 4N76A 5KFOA 4F4XA 5KT4A 3KK1A 4I64A 2F4VF 2RDIA 3THVA 2ASDA 3GFYA 3M2VB 2WB4A 3ZZRA 5HMXA 4DQPA 1N33F 2HYIB 5J2NB 2MHNA 2QRRA 2KDOA 1FDNA 2Q79A 4ZP9A 2JEGA 5CXTA 1UVMA 2R7SA 2DNOA 1R27B 1S1TB 4WXWA 3MGJA 1C1CB 2EK1A 2AYMA 4CZCA 3RYLA 2W4PA 1IKVA 4WF9Q 4RKUC 4ZCKA 2ZH2A 1QSLA 1XMQF 2J8AA 4YR0A 2PT0A 2B9XA 2KRRA 1Y3KA 1VBYA 2HGLA 3NP5A 4CH0S 2KO1A 1X4CA 3CGIA 4TU7A 1U1MA 4GO7X 4YY3F 2BV3A 3LP2A 4RBUA 2YKNB 5EN1A 3I0RA 3LW5C 4DSFA 1HBOA 4QR1A 3DLGB 3MEDB 5GAHU 2R8IA 1UVIA 4HI2A 1FNOA 3TUIC 1C0TA 2UUWA 2VPXB 2QV6A 2NZ4A 2FHMA 3M2UB 4N8NA 5KFWA 3D5MA 3LQVA 2KFYA 1Y5LB 4MMOA 1XR6A 3QWUA 4PPZA 3BZQA 1XR5A 1QSYA 4KHMA 1YBAA 2HHPA 4L6V3 3VAFA 3M8QA 2CRLA 3PO5A 5FJ4A 4O3PA 5KFNA 2E9TA 3DLEA 2ZC3A 1XN9A 2OSQA 2IA6A 3HJFA 4KQZA 4IUFA 2XNRA 5THWA 3CIZA 5K8NA 2MQQA 2BVZA 2RJZA 1HW9A 4HHJA 3M1VA 3TUZC 2KRBA 3T9ZA 4TNOA 2KHDA 1LW0B 3KK1B 2IM0A 3C66A 2HVHA 1N88A 1YQHA 2MKCA 3DFEA 5G4DA 1D9DA 2ZZMA 4RNOA 3OHBA 2RS2A 3GIIA 3RW7A 3VR1A 2DNPA 2AX0A 1N34F 4AXJA 2WK4A 4LFBF 1X9MA 3D1QA 3C8YA 3SCIE 1Q1KA 5L1JA 5KT5A 2DH8A 3CO9A 3US5A 5DDPC 2E7WA 4EO6A 2LXFA 2R9LA 3M8SA 5HO4A 2PEHA 5T41A 1YRTA 2G0CA 1DLOA 1IKVB 2ZJQQ 3TNVA 4J9MA 2MSTA 4LVOP 4QYRA 4NA2A 1UW4A 3S01A 2BACA 2XLJA 3BDPA 1A7GE 1DTQA 3G86A 2QSFA 1RA6A 4KIAA 1RT4A 4A4JA 2PSZA 2CPEA 3VQSA 1Y9OA 4I7FA 5EHHA 3LP2B 3RTVA 1L3VA 3BSNA 3R5CA 1LW2A 3I0RB 2E66A 1HBOB 2C42A 3PHEA 1QVFR 1ZZNA 1ZM4A 3MMJA 3ZFVA 4JI1F 1C0TB 4Y00A 3O2IA 3M9NB 4DSKA 4QR2A 3DGPA 3M4XA 1HNVA 2M2BA 3HHLD 3S8SA 4DV5F 1VBXA 4IOAQ 2APOA 3R1HA 1RTJA 3PIPQ 1FXLA