2XB2D

Crystal structure of the core mago-y14-eif4aiii-barentsz-upf3b assembly shows how the ejc is bridged to the nmd machinery
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
89
structure length
89
Chain Sequence
b'PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EUKARYOTIC INITIATION FACTOR 4A-III
publication title Insights Into the Recruitment of the Nmd Machinery from the Crystal Structure of a Core Ejc-Upf3B Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 89
sequence length 89
chains with identical sequence Z
ec nomenclature
pdb deposition date 2010-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xb2D00
3BO4A 1M5PC 5LJ5Y 2G0CA 4Y00A 2EK6A 3S01A 3J7YU 3R1HA 5GAGU 3BO2A 3IWNC 4F25A 4TU7A 1ZZNA 2VOPA 2M7SA 2XS2A 2PEHA 5DDPC 1WI6A 2E44A 3LQVA 2M88A 2XB2D 2DNZA 3VAIA 2MKJA 2E5JA 2NLWA 3JB9k 2ZJRQ 1YHQS 2JWNA 1KOOA 2GO9A 4UQTA 2DHSA 2LYVA 1WF1A 2LECA 5DM7Q 2MQOA 4J5OA 2OSRA 2KM8C 2EVZA 1H2UX 2QFJA 2XS7A 1N88A 1VQOS 2CQ2A 1YWXA 3SXLA 2M9KA 2KXNB 3S8SA 2CQPA 2CPZA 1X4GA 3UWTA 2DHGA 4OZ0A 5GADU 4M5DB 3NNHA 2KRRA 3US5A 4ERDA 1QM9A 3TP2A 2SXLA 2OSQA 1YITS 1IQTA 5D78A 1NJIT 1N8RT 1S79A 1VC0A 4QPTA 2MZ1A 3DLLQ 2KH9A 1WELA 4TLQA 3P49B 1RK8A 5LXYA 2OTJS 1UAWA 4OZ1A 2A3JA 2FHOB 1Q82T 1VQ8S 3H2UB 3B4DA 5CA5A 2CPJA 2MSTA 3TYTA 1JJHA 3UE2A 3G4SS 1U1MA 3EGZA 4UY8T 3MOJB 1WG5A 1WF0A 1ZH5A 2GHPA 2ERRA 2MKIA 2DIVA 2X1FA 2DGUA 1U6FA 2KHCA 2MB0B 4YB1P 1X4AA 2FC8A 1X4HA 2DIUA 4PKDB 2DO0A 1F9FA 3BO3A 1WG1A 1SJQA 2PE8A 3BEGB 3D2WA 1WI8A 3G71S 1WF2A 1WHYA 4IUFA 4P6QA 4A8XA 1Q86T 2LEBA 1FHTA 4YOEA 2XNQA 2VONA 2DGTA 2RQCA 5MLCV 2L41A 2DNYA 2MYFA 2KFYA 2KU7A 2MKKA 2XS5A 1N52B 1FNXH 2KYXA 2JVOA 5GAEU 1X4DA 2CQ1A 4RU2A 3CCVS 3VAFA 3TO8A 4LJMA 3MD3A 3FEYB 2M52A 2D9OA 4C7QA 3VAKA 2RQ4A 4EGLA 1KQSR 4U67Q 2KT5A 2LXIA 3MURP 3PIOQ 1U2FA 2BZ2A 2DGXA 1A9NB 2HGNA 1WTBA 3CCUS 2J76E 2MQQA 2NZ4A 3UCZP 1UW4A 2MGZA 1M90T 2L08A 2M8HA 1P1TA 2U1AA 3CF5Q 2J8AA 1VQNS 4YUDA 3THPA 3OW2R 2LKZA 1SXLA 2AD9A 3G8TA 2N82B 1HA1A 3RW6A 2E5GA 4TU9A 4ZKAA 1L3KA 1AUDA 3VALA 2DK2A 2RS8A 1SJ4P 1WHVA 1YI2S 2MZSA 1FJCA 1X5SA 3CULA 3CC2S 2DNOA 3ZZYA 2MKCA 2MSSA 3VF0B 1NO8A 4W90B 5IFMA 5IM0A 2MXYA 1FO1A 1X5TA 2LA6A 2DNPA 3CCQS 2HZCA 2LXUA 2FC9A 3CXCR 1VQ5S 1W2BR 2CQ3A 1K8AT 1X4BA 2DGWA 3VAMA 2DITA 2MZQA 2FPHX 3CMAS 3NNCA 2DGQA 2YKAA 1YTYA 2F9JA 1VQ9S 2CQHA 2CJKA 2D3OR 1R8PA 3I55S 4CQ1A 2KXFA 1WEZA 4CH1A 2VODA 1YJNS 1WEXA 2K3KA 1X4FA 2MY8A 3MUTP 1K73T 5DETA 5CYJA 1B7FA 4LIRA 1HD1A 5HL7Q 2BOPA 4CIOA 2ZJQQ 5LJ3Y 4FXWA 2M8DB 4F26A 1VQ6S 2MZTA 2N7CA 2DISA 1YJWS 3B4MA 3UCGA 1URNA 1XN9A 1VBZA 1M5KC 2I38A 1YJ9S 4W92B 2J0SD 2LCWA 3PIPQ 2AYBA 2RRBA 1VBYA 3HHNB 3J7ZT 3CCJS 1U1OA 1N54B 2E5IA 1U1PA 3P3DA 2U2FA 3P6YC 2KRBA 2J0QD 1M1KT 2I2YA 2MKSA 3SDEA 3L3CA 2HGLA 2MPUA 3NNAA 3MI7X 1JJ4A 2D9PA 2LA4A 2MQMA 2OTLS 1A7GE 2JVRA 1KD1T 4LMZA 1X4EA 1PO6A 2KI2A 3MDFA 4WFNQ 1DZ5A 4WKRA 1WHWA 2HGMA 3V4MA 3SMZA 3UD4P 1PGZA 2MQLA 3THTA 1FT8A 5GMKa 3MD1A 5BJRA 4V19X 5ITHA 3MXHP 4Y0FA 1UFWA 4C4WA 3FEXB 2KVIA 3CD6S 2LEAA 2WBRA 2MHNA 3CMES 3R27A 2KM8B 2MGZB 2Q79A 3G8SA 3LPYA 5DDRC 5GAHU 2VOOA 1QVFR 1D8ZA 3CCMS 3EGNA 4PRFA 1FXLA 2DO4A 1VQ4S 1JMTA 2B0GA 2DNRA 1WEYA 1VQ7S 1U1RA 2RRAA 2KG0A 3VAHA 2M0GB 1DRZA 1VQPS 2DH8A 4FXVA 1H6KX 2RU3A 2X1BA 4QU7A 5IQQA 1S72S 2CQGA 2M2BA 2F9DA 5IM0B 5H1SV 1VQMS 3G6ES 2MJNA 1BY9A 1NU4A 5JVHQ 2EK1A 5CXTA 3UCUP 2JRSA 2DGSA 1H2VZ 2DNHA 3P5TL 3MUVP 1Q7YT 3G96A 2MQPA 2XNRA 3VAJA 2MZRA 3IRWP 3CC4S 5DM6Q 1VC6A 2G4BA 2DNLA 1VQKS 2DNNA 2CQIA 1R8HA 4CH0S 2CPDA 5LSLA 2RS2A 2ADCA 2N3LA 2CQ0A 4BS2A 4IOAQ 5EN1A 2LQ5A 3R1LA 1K9MT 5FJ4A 2CPEA 2QA4S 2OIHA 3N9UC 3H2VE 1YIJS 2KG1A 3I56S 1UP1A 2DGVA 3NS5A 4Z2XA 3CCLS 1DBDA 2CQCA 2X1AA 4WIIA 3VAGA 1U1KA 2DNMA 2XSFA 4WCEQ 1M5VC 2CQDA 1FJEB 1G2EA 3S6EA 2DH9A 2L9WA 1VC5A 2AYGA 2HYIB 1KC8T 1ZZFA 2YH0A 2RT3A 5HO4A 2F3JA 1X0FA 2M4MA 2ADBA 2DGOA 1RKJA 3BS9A 3SDEB 2CPYA 1SJFA 3ULHA 2O3DA 1CVJA 3UD3P 4WFBQ 3NMRA 2DNKA 4F02A 2DNQA 2OJ3A 3CC7S 1KOHA 1Q81T 2RNEA 2RUGA 3K0JA 5LXRA 3ZZZA 1M5OC 3MUMP 1WWHA 2MKHA 2HVZA 2DHAA 4C0OC 2MY7A 2MJUA 1X5OA 4WFAQ 3CCRS 1HD0A 1OIAA 2KXHA 1P27B 1X5PA 1OO0B 2MZJA 1VQLS 2YTCA 2E5HA 1WHXA 3Q2SC 2K8GA 4ED5A 2CQBA 2CPXA 4IOCQ 3G9CA 2JX2A 2CPIA 2YWKA 1DHMA 1HL6A 4PR6A 3RW7A 3DXBA 1QVGR 1FJ7A 4TU8A 1D9AA 1H2TZ 3CPWR 2QEXS 3CCES 5D77A 1U1LA 2M70A 1U1QA 1SJ3P 4IO9Q 2N3OA 2CQ4A 2DHXA 3HI9A 2CPFA 3S7RA 1X4CA 5JVGQ 2X1GA 2V94A 1U1NA 2DNGA 2CPHA 2G1DA 4QQBA 4QU6A 3CTRA 1O0PA 4WF9Q 1SJRA 3CUNA 2RVJA 2AYMA 2MQNA 5DDQC 1OWXA 2LMIA 1U6BA 2YH1A 3Q2TC 2DH7A 1OPIA 3EX7B 3NS6A 2FY1A 3CCSS 5GVQA 2ZJPQ 3U1MA 2DB1A 5LSOA 5DDOC 1VBXA 1WG4A 2MMYA 2AYEA 3U1LA 2UP1A 2KN4A 1JJ2R
chains in the Genus database with same CATH superfamily
4DLEA 4RR5A 3M8PA 3TAMB 2GVZB 2UUCF 3N4WA 2K7KA 4FYDA 4PUOA 3LWMA 1T3NA 4O3PA 5IWAF 3EVWA 4ILLA 4C8KA 4LSLA 1YHQS 1KOOA 4UQTA 4O0IA 3GR0A 3LWLA 3K5MA 3KHRA 2OPPA 3HHKA 2WZ1A 3D6MB 4USWA 3CCTA 1T95A 2FJVA 4LSZB 4B3SJ 1XNQF 5GAEI 2MEWA 3I6PA 4HHJA 5A8RB 3H98A 4WJBA 4IFYA 1JJHA 2PMWA 1RI7A 3H7HB 1WG5A 1CJKB 2WOMA 4FNHA 4URGA 1RYSA 3AD7C 2ZH4A 3MMBB 2J0XA 5HROB 4DFKA 1PJ6A 1MROB 4FYVB 3SV3A 1T9VA 1M1GA 2FLPA 3OTOF 1FHTA 2VONA 2DXFA 3U7JA 4X64F 4ZVUB 2HHPA 4QZVB 3Q8PB 1ZM9A 1X4DA 2CQ1A 3H8YA 3H20A 3MD3A 4QJVA 1RT1A 1VYAA 3UI3A 3PCOB 4WU3A 4K4WA 2Z2MA 1A9NB 1C4AA 1LNQA 3BGOP 3CCWA 1IKWA 5KOWA 2ASDA 4K8RA 3I96A 2M5YA 4Q8EA 3CF5Q 3NS7B 1TMMA 4OHVA 4X4VA 4KQZA 3OW2R 1AB8A 3C46A 1AUDA 2IDEA 2DK2A 3QIDA 2DR6A 1NSPA 1Q5YA 3FDSA 3KLIB 4YDDB 4LF2A 4G1QA 2QLFB 4X65F 2LXUA 1LXJA 3ZXWA 4RNMA 3GYNA 1HPZB 2Z2ZA 1SKUB 4KV8B 4B08A 2FPHX 4NL5A 1VQ9S 2F9JA 2VG7B 3H5UA 3BH6B 1QJHA 5AE1A 2VODA 1TV6B 2K3KA 3C14A 1NUEA 2DBBA 3EUNA 2HS4A 2R7TA 3AT1B 2XULA 4MMOA 2MZTA 2DISA 5F3ZA 3C2PA 1S0OA 1HWIA 1FA0A 2XMJA 4LRBA 1U1OA 2LU1A 3A12A 5CZXA 3KLHB 2EWHA 5A2QY 1M1KT 4UOHA 4MYTA 2QZ8A 4Y28C 2CJQA 3AAWB 1HQUA 4TY8A 3M30B 2NUHA 2JEGA 4K7QA 1YRTA 2PA8D 4NLYA 2GJIA 3QRRA 3MECA 2AEMA 5GAHU 2VOOA 3CCMS 3EGNA 2RUSA 2DO4A 4OJ3A 3TNVA 2XBPA 2HLTA 1TL1A 1VQ7S 2NS1B 4OHYA 1NK9A 1K0VA 3HDSA 2Q6BA 2C2DA 1P9QC 1NJYA 1Q8LA 2AJFE 1NZ8A 2MJNA 3KLGB 1KP6A 1R6VA 5CZVA 5H9FJ 4U7CA 3GU0A 3QAUA 1H2VZ 2EFPA 4Y2CA 1XR7A 4DUZJ 1RAHB 4P7TA 3HVTB 2DNNA 3K17A 4NXNF 2V9KA 3R1LA 2WCXA 1N6QA 1HW9A 2OIHA 1KLMB 2KG1A 1JXLA 3I56S 1KR4A 2CQCA 2LFVA 9RUBA 3VTIA 2CQDA 5AXNA 3DRXA 2L9WA 3TAMA 2GVZA 3QGGA 3HD1A 2XMTA 3CJ2A 1SKWA 2GIFA 3IAM9 5HO4A 2YKOA 1NKBA 2Z57B 1RKJA 1VK3A 1BE4A 3PJ9A 1F3VA 3NMRA 2HRUA 4RL1A 4C0OC 2MJUA 4X4TA 3ZTRA 3FFIB 1OO0B 2LQ8A 3OR1B 5D0GA 3IGNA 1QUPA 4ED5A 4UZBA 1LEOA 2BRKA 5KAKA 1HL6A 1VLOA 5A8RA 3JSYA 3UR3C 4WYWA 4GKJF 3QNWB 3PRBA 4KHRA 2X1GA 2DNGA 2HNYB 1EJ7L 1CJKA 1UEVA 2E9ZA 2IJRA 3RTVA 5D4LA 5GADI 2DRDA 4MFBB 2GQCA 1FVQA 2JDJA 3MMBA 3R3TA 5HROA 1N0VC 1MROA 3Q8QB 5DRKA 4YY3F 4NXMJ 1U6ZA 3VGTA 3BO4A 2HBQB 1WSVA 3TUJC 1QE1B 4K0KJ 3R1HA 3H2LA 2B9EA 4F25A 4LF9F 4NLXA 2V8GA 1GXUA 2NXCA 2GHVC 2ZH1A 2E5JA 1CPZA 1W26A 1K1SA 3M6VA 1YBTA 2L48A 2MQ8A 3CSKA 4QIGA 3FRYA 3V6HA 2GW8A 4FYWB 2H48B 4HEA9 4A46A 4N47A 1K0TA 1H2UX 4DL4A 4RUBA 1VCTA 4OYWA 4OZ0A 1ZM3A 3BGLA 1MMNA 2B4VA 3KLIA 1NDPA 3NGDA 1S79A 3D6HB 5M2UA 2ZDPA 2CADA 1WC0A 2FLOA 1HPZA 1TL5A 5JJBA 2BRLA 4KV8A 2ZH7A 2VG7A 5BYRA 2DGUA 5CD4A 1TV6A 4GC7A 3RJMB 4CO5A 1T9TA 3G71S 4ZOSA 3TI0A 2W2MP 1AFIA 5ETPA 4DZ6A 1DQAA 3EVMA 3ZTOA 3NWGA 1DTQB 2KVQE 4I0WA 3KLHA 4KC5A 1CJUB 1N52B 4A8SA 1WC1A 2UXDF 5IS2A 1N48A 3SSQA 2ASLA 4KGZB 3TJ9A 3QGHA 3M30A 2C28A 2GMLA 2G2OA 1Q4RA 5E0OA 2CVEA 4ZIWA 5E3QA 4WP8A 2L08A 1UFKA 2AIRB 3JTOA 5FLXY 3RW6A 1VRTB 1Y0HA 3GE9A 2BYCA 1V6HA 4MH8A 3ZZYA 1T7PA 3NOGA 4YEAA 3VF0B 1KQFB 2MXYA 1Q8IA 3KLGA 3TAPA 1SC3B 1KTQA 1VQ5S 3M9OB 2IJFA 4LR9A 2PO4A 3HVTA 3I55S 1NJXA 1NK8A 4CNYA 3W2VB 1F9HA 2HIYA 4L72B 4USUA 5IT9Y 3M2UB 2QLBB 1LXNA 1KLMA 4QOTA 4FXWA 3GV7B 5HI7A 3HXMA 2WSEC 1WDDA 3M9MB 3EPIA 2R7UA 4GKKF 3HP6A 7AT1B 1RTJB 2P8IA 1FVSA 3JYTB 2YNFB 1TFYA 3HLUA 4J9RA 2MKSA 2R8IA 2CJYB 2JJ4D 4USJC 4DQQA 2HGLA 4IDKB 2DCLA 3VQSA 1RSCA 3TJ8A 3TZYA 3TVKA 3MDFA 4WFNQ 4JI4F 4PQAA 4DR1J 4M5IA 4UZCA 4GC6A 3MXHP 4C4WA 1TELA 3G86A 2ZH6A 2DPIA 1GH8A 3OR1A 1EZZB 4P73A 4LFBF 4IH5A 1RB0A 1VHIA 3WC0A 3AA8A 5DGAA 2A0FB 3VAHA 4CCHA 2C2MB 1GT8A 4AQYF 2UUAJ 1KONA 1HNWF 3FKBA 4NEYA 5T7LB 1NU4A 1RCXB 2HNYA 2YXLA 4GO7X 2DGSA 1XMQJ 4FDFA 2MQPA 4MFBA 2R2SA 1GMUA 3R5BA 1R8HA 5LSLA 4C48A 4EYIB 3HT0A 4KAIA 1WKKA 4QR1A 1U09A 2WB4A 4DSJA 1QE1A 2NXUA 1RP5A 3K7RA 2QMUB 4HVZA 3VWSA 4F36A 2E7WA 3D9BA 1P6TA 4RWWA 3TANA 4EWTA 2ADBA 3FZ2A 1XEZA 1QAJA 4OHWA 2B8QA 1KQKA 3OFFA 1OS5A 1X8DA 4B3SF 3CGIA 1FCAA 4OMFG 1IJFB 2ZH2A 2YQ1A 4JI2J 4KHPJ 2ALZA 1FF2A 2CPIA 3IAS9 4ZPWR 3DNCA 3N01A 3IG1B 2IBKA 3QJPA 3CCZA 4I6AA 4ZK7M 1XJWB 2R2RA 2DHXA 4DOZA 4AYBD 1NHUA 2ZH3A 3DOKB 3W9HA 1HLWA 2IRYA 2VF3A 1WOSA 2Y0SD 4N77A 2QT7A 4YR0A 1OPIA 5A6PA 4YP3A 3BH7B 4Y3CA 1DTQA 5ETTA 4QIVA 1CJUA 1X0PA 5KFHA 2ACYA 4QWEA 2O01C 5F8GA 2DNZA 4HI1A 2EC2A 1KKHA 5F0UA 2MQOA 1RT6B 2EVZA 4DPUA 5EX0A 3W60A 5J1EB 2M9KA 3R97A 5HJYA 5HLFB 1VRTA 2J8SA 2KRRA 3PO5A 3H40A 4I2PB 1N5VA 1IQTA 4H4KA 6AT1B 1N8RT 2MZ1A 3P49B 1SVDA 3QT8A 3H4BA 2OTJS 4EYHB 3H2UB 3O1LA 5A8WB 5AE2A 1S9FA 2QLXA 4LUBA 1ZH5A 3RBZA 3K8VA 1S7HA 2KHCA 4GRSA 3W2VA 3UVJB 3IM9A 2FC8A 4DSEA 4DV5F 4ZP9A 3AH6A 3FRZA 2YNGB 1X9SA 4DV6J 4QYZK 2YBVA 4JV2A 1FNOA 4J9SA 2BA9A 1RTJA 3CVKA 2BQ3A 2YNFA 4FYYB 3BR9A 4A8QA 4IDKA 4CT8A 2D9OA 2ZH8A 3FMWA 5B7WA 2JOQA 4WK1A 2F4FA 1AYEA 1KHWA 2IM1A 1CULB 4WU2A 4UOGA 2EC0A 5J2MB 2FUG9 2RS8A 4ELVA 3TOQA 4DUZF 1X5SA 1WC4A 4N76A 3R5JB 2W25A 1T11A 5LOQA 5T7LA 1SH2A 4NLQA 1O8BA 3TR5A 2AEJA 1W2BR 3R2DJ 2YKAA 4NCAA 5GAHI 4B3MF 4Q7AA 2W01A 3EVOA 3EJMA 4JOUA 3ZZ0A 1ROFA 4AE5A 3D6FB 3J7A1 1S6QB 4FPIA 3KYLA 4FF1A 4JBCA 3PHTA 3H42A 4RUAA 4OZNA 1FRJA 2V2VA 3K59A 2F1FA 4MKVA 1RACB 3QLHB 3CCJS 1NM2A 4LT6A 3P3DA 4EEYA 3P6YC 2XYGB 5ETKA 4NLWA 3CEDA 1JLGB 3T19A 4DF4A 1JJ4A 3SFUA 1GXLA 2PD1A 5A8KB 3BZQA 3WX8A 2HLUA 4CNZA 4RW4B 2MHNA 3TZZA 1MG7A 4BHQA 2QE5A 3H25A 2PA3A 5KFEA 1XR5A 3IG1A 3UNGC 3DYAB 4ANEA 3B54A 3HJVA 3ADAC 4B02A 2DH8A 4ZCIA 1H6KX 2X1BA 5H1SV 3AD8C 1FI4A 3C66A 2ZKUA 2EK1A 3UCUP 5EWEA 2EFNA 3ZC4A 4NMLA 3DOKA 4NZ7A 1Q7YT 4K0KF 3JXOA 2VZ9A 4NCBA 3K5NA 5EN1A 1UWBB 4FBUA 3OL6A 1UP1A 1REVB 4AD6A 2GO8A 1QAYA 4J9PA 2BJ3A 2RT3A 2DXEA 2M4MA 2BR0A 1REGX 3T6JA 3UD3P 2FZGB 2DNQA 1WACA 1RT6A 4ED0A 4I67A 5J1EA 1NKEA 4ECRA 4DEZA 5HLFA 2J6UA 4CT9A 4F7VA 2CJ9A 4I2PA 4HHHA 3G9CA 3D3CJ 4EBEA 4KIAA 2YWKA 4OX8A 4ANDA 3AJDA 2J0WA 5JUMA 4LF7J 1Z2LA 5A8WA 5CCLA 3PFOA 2I1RA 1ACMB 1NH8A 4YFUA 3H4DA 4K2JA 5IQ6A 1N32J 3UVJA 1I51B 4DCJB 2BABA 2HAFA 1S5ZA 1RU1A 2F7VA 4EUVA 3D0IE 2YNGA 1FRKA 1RUSA 4JI1J 5KFFA 4CM0A 2W2PP 3R7BB 1FRMA 2W9AA 3C15B 3P45B 3LQVA 1RCOB 2BJDA 1WF1A 3G6XA 2LQ9A 4X4PA 3E3XA 1CULA 3S8SA 3DLGB 5J2MA 4ED3A 3JS9A 1S57A 1S77D 1GMVA 1S6PB 3GIJA 1NJIT 4M95A 3M6WA 5SZTA 3DLBA 1RK8A 1FDAA 1CJVB 3RB4A 4LRFA 4PWUA 5E3AA 1U1MA 3KJVB 1VJWA 2GGPB 3WHIA 1SI9A 3MPYA 3QO9B 3PJWA 1QTNB 4ED6A 4L6V3 1S6QA 1WNEA 3KLEB 2D69A 1NPRA 4O0NA 2E1PA 4DR1F 1IWAA 2ZH5A 3QLHA 4LFCJ 3GG0A 4RNOA 2MLXA 5HQLA 3OR2B 4C0BA 1JLGA 4WZQA 5A8KA 5F9NA 3VAKA 1V5VA 1B99A 2KT5A 1OMSA 3BB5A 2QO3A 4RW4A 3O5TB 3BREA 2ZZNA 2MQQA 2UUAF 2U1AA 4J7CA 3K8WA 2UZAA 4Z7CA 2E7VA 1MMDA 1HA1A 4DL7A 4ZKAA 3S1TA 1XMQF 1RWMB 2AKWB 3DYAA 2MZSA 1N36J 1NSAA 1TU0B 3AA9A 2NSBA 2HVDA 4W90B 1OPZA 3BGFA 3NNCA 3ZZUA 4EFAC 3V4IB 2RRNA 1H38A 1IUJA 2BKPA 5D6GA 2HVEA 3HK2A 1UWBA 2PSZA 3MM5B 3SFGA 4CIOA 3QWUA 4L76A 1REVA 2CNNB 1FERA 3ZFVA 4ECVA 2RRBA 1N54B 1U1PA 2HHWA 4ZVEA 2QL5B 3BSOA 4C6AA 5D3GB 4LMZA 3FEXB 3PX0A 3CMES 3DRPB 2BX6A 2IMOA 4HDHA 2VHGA 2JFDA 1ZETA 3CE8A 5KFPA 1PCAA 2C1EB 3EPGA 2Q6CA 2COLA 5HMYA 2V68A 3W7BA 4DR5J 1SIZA 4PXBA 2V67A 2RDIA 1Y11A 2KFZA 4I4BA 4OHZA 2BBEA 2OO4A 1IVZA 1PYSB 5DS7A 4C0HA 2RSQA 3GWCA 3JAMY 4R25A 4HLBA 2WAQD 4Z7YA 1LV5A 2VBYA 4B3TJ 1S1UB 1J27A 4ZLJA 1E6VB 2X7IA 4P9SA 1U1KA 2DNMA 1FJEB 1G2EA 4ID5B 2BOAA 5KT5A 2YH0A 2LEPA 2NYHA 4MKYA 3C15A 3T1YJ 4WYLA 2O3DA 4DUTA 4IRCA 5I42B 2DNKA 4F02A 3LAKA 4QR2A 2GVDB 3V6DB 4RKUC 4CTAB 2OEJA 3DLGA 1X5PA 1ZBTA 5KG6A 3TUIC 4OX9J 1PBAA 2NYIA 1NHVA 5KFJA 3OVAA 3GG1A 2GHWA 1TUVA 1RT2B 1S6PA 4QPXA 3G6VA 2ZM6J 2V0NA 2XWXA 1CJVA 2RD5C 4O44B 3KJVA 2CRLA 4U96A 1G6BA 2G1DA 5C5JA 1L5UA 2GGPA 1GMWA 3TAQA 3OSPA 4X66J 2AYMA 2ROEA 3QO9A 5KFIA 4CO3A 2RF2B 2JEIA 3NGTA 5DDOC 2I8EA 3KLEA 2QG9B 4RBVA 3B8HA 2P9CA 5F41A 2AMCB 3SZ2A 1HKAA 3OR2A 4DR7J 4URSA 4KGMA 3OPKA 4F0MA 4CLPA 2ZJRQ 4OZJA 3ETOA 5C2GA 1G3OA 4JP8A 3JSMB 5DQHA 5IT0A 1U8WA 3US5A 4Q8FA 3TP2A 3R2CJ 3C16B 1GK8A 2OSQA 1P8GA 2GIRA 5CH7B 1NDLA 2D41A 4DQIA 4DV4J 1U45A 4K59A 2MSTA 4UY8T 1BQNB 4ZPTR 3V4IA 2HQGA 3FNNA 3OXGA 4YB1P 4BBYA 3MM5A 3BO3A 3L7PA 5IZHA 3BEGB 3X3UA 2MHEA 2EXUA 4ECSA 3U1NA 3PYEA 1VFJA 5LL6d 2LEBA 1NK7A 2XI2A 1HI8A 4NRTA 5KFGA 1VOMA 2KFYA 2XMMA 2MKKA 2AEFA 4E8UA 3N5BA 5IV4A 4DL6A 3H0PA 1ICEB 4PYAA 1RT7B 5ETNA 5KFDA 2M52A 2C2RA 5D3GA 4TNOA 2DGXA 2HMIB 1SIWB 3MPDA 2HGNA 4LRAA 3E51A 3DRPA 1VQNS 1LWFB 2H65B 2HG4A 1BLUA 1U2RA 3TRGA 4F4XA 3N6NA 3L7OA 1UVIA 5IFMA 4DX8H 3KDOA 4PG6A 3RAXA 2ZHBA 2AF6A 4N5SA 3DFEA 4NA2A 3HSDA 2XZDB 5D4OA 4FXDA 2CQHA 2YKNB 2W7PA 2ZUAA 5CYJA 3HVWA 4C97A 1S1UA 1FD8A 2BDPA 4FPRA 2CZVC 4ZPAA 2PI5A 2GQ2A 2IDLA 1BD6A 1E6VA 2I38A 4ID5A 3VR1A 1A0OB 2ZHOA 3ZZPA 3PIPQ 2AYBA 3GJRB 5F9LA 5KFAA 2FVRA 1YQHA 3GJTB 2E1AA 3NNAA 5I42A 3M05A 1KD1T 3TEHB 2KI2A 2GVDA 1WHWA 3BBFA 3V6DA 2RQMA 1CQNA 4MK8A 4ECTA 2AU0A 4CTAA 5BJRA 5ITHA 3C6UB 2KVIA 3KG1A 2FVPA 3G8SA 3FCWA 1DAXA 4M8LA 4FF4A 4U8VA 3EM1A 4B9UA 1DRZA 5JXSA 4DL0C 2R7QA 5AXMA 1JLBB 2CQGA 3KK3B 5L1KA 4O44A 3G6ES 1SQFA 3UD5A 3MAQA 2P9EA 1DTTB 1KLNA 4JI1F 5J1PA 2RF2A 3IP0A 5L1IA 1EKSA 2CQ0A 2YWWA 4ECYA 2PC6A 1K9MT 2QA4S 2UXCJ 4K5SA 1Z4UA 1RAOA 2F8MA 1IBMJ 3OXLA 3AXKA 3KTQA 4N41A 8AT1B 2HRYA 2YY3A 4O3QA 3BS9A 3DHWC 2VBZA 3R5AA 2VKRA 4JI3J 2KO1A 2OJ3A 1GXTA 1KOHA 1FWKA 3JQKA 5KG4A 3JSMA 1C0UB 3JQMA 3TARA 3F0NA 1WHXA 1LWEB 4KYZA 3C16A 4UOCA 3IMQJ 3OL9A 2BMBA 2ASJA 2DR8A 1O5JA 2P5VA 1H2TZ 3FC9A 1SJ3P 2NPIA 2N3OA 4USTA 2W2OP 3I32A 3S7RA 2WONB 3V6KA 1BQNA 2G13A 2ZZMA 3CB4A 4QQBA 3MR6A 1HNVB 1HBOB 3RAQA 5F8JA 2GJFA 2L9DA 4R0EA 2XMWA 3ZZRA 1RAIB 5KTQA 2J9DA 2AJQA 2R7XA 3BKTA 4LFCF 1VGYA 5KT7A 3UFCX 4D3GA 4DV2J 2MMYA 4USIA 1TK8A 4IRKA 1T05B 1Y3JA 3S01A 2CNLB 5GAGU 2UUCJ 4O4GB 4DV3J 3FK4A 2RHSB 3J81U 1RT7A 5DDPC 5IWAJ 3QJLA 2E44A 3RRGA 1N0UA 3SIPB 2JWNA 4KKOB 4JI5J 1EARA 5B09A 2QJ3A 1RWUA 4MIBA 2DRBA 1QTMA 2CQ2A 4ILRA 1Q5VA 2XZTB 1LWFA 1NK5A 3QFWA 4NRUA 1FKOB 4F2SA 4QIFA 1BXNA 3GFZA 1SKRA 1WELA 2D74B 1TKZB 4OZ1A 5EUHA 2B56A 4K4YA 3PVXA 2YKNA 2V4QA 1V5IB 5F3TA 3D5MA 3IR7B 3OBIA 1WG1A 4ZVOB 3GJQB 2YX7A 3OTOJ 4CM2A 4J9KA 4YOEA 3SBMA 4ZN3A 1HNIB 2KYZA 2XHWA 1RLDA 2AW0A 1FNXH 3QFHA 4TLRA 3CCVS 2V4RA 4DR5F 4X62F 1V3SA 4K5RA 2LXIA 4C8OA 3C6UA 5KFWA 4DUYF 1UJ4A 3NGKA 3HFZB 3K89A 3M8QB 6FDRA 4YUDA 3GFXA 2XSJB 3KJQB 2FLLA 3MGJA 4X4NA 3CJSA 1WHVA 4TVAB 4PG4A 3OQ2A 3CC2S 1GQEA 2DNOA 4IH7A 2MSSA 4B3TF 1PAEX 4DDFA 1JLBA 4ZPBA 3KK3A 3EDRB 3D0GE 3DDNA 4X65J 2HHSA 4L3NA 2VBWA 4Y2MA 2VICA 1IBKJ 2UUBF 1DTTA 2K1RB 4DS4A 1F9EB 2F4VJ 3F44A 3PTWA 4YN3B 2BXJA 3HFVA 4CQ1A 1WEZA 1TL4A 3DMJB 1S0MA 1RTZA 1BGXT 3GJSB 2ROGA 2BV3A 1X9MA 5F8MA 4OJ1A 2HZAA 2HVHA 4O3NA 5DG7A 5ETMA 2EBEA 4AXIA 1RTDB 3BM7A 2V4JB 2HPUA 4UT4A 2B4OA 4EI2A 4ZP8A 2Z58B 5H9EJ 4MKBA 4FKYA 4OX9F 4M5HA 1JXEA 1A7GE 2JVRA 2ZDOA 3V4MA 4ETXA 5GMKa 3MD1A 4Y0FA 2ZM6F 2LEAA 1C0UA 4Q43A 3THVA 2MGZB 5F8IA 4EO8A 2ZOFA 5F8NA 2GCFA 4ED4A 2QV6A 1LWEA 2B0GA 2BVZA 4R5PB 4X66F 4DV1F 4WTYA 4KRWA 4WWSA 2CWKA 3BQ1A 4PEOA 4ZJQA 1FRIA 1BY9A 3PJXA 2WONA 3SYZA 4DF8A 3MM6B 2ATCB 1R31A 1HBOA 2W1BA 3SQOP 1SB6A 5BYSA 2VBXA 2CQIA 3KG0A 2K06A 3M9NB 1B0VA 2HWTA 4B9TA 4NXNJ 1NKCA 2GJ2A 4KY3A 1U47A 2ZOGA 1T05A 2FHKA 4DV7F 4RNNA 4O4GA 1KC8T 4I7FB 2F8EX 2W9CB 3ULHA 1CVJA 4KKOA 5KT2A 4DCPB 2OPSB 3P96A 1VI7A 4J37A 4NOHA 4P71A 3GB0A 3PW0A 4DV4F 2DCUB 2BW2A 4OYMA 4PQUB 4OJHA 1FKOA 3NL0A 4O3OA 4LVOP 3PV8A 1YJ7A 2B9WA 3QGPA 1EX8A 2RU9A 3EMTA 5KFUA 4IRDA 1TKZA 4W4MA 4EBDA 2PMHA 1T3OA 3R6LB 1D9FA 1G1XA 2ZE2B 1AW0A 2OD6A 2J6TA 4NYPA 2XO6A 4KGVB 2JHEA 2HS0A 4C3KA 4ZPVR 4OL8A 3SSRA 2V8PA 1RAAB 1I5OB 1SQEA 1JX4A 2AJ0A 1HNIA 1HWUA 4UUWA 3IWNC 1ZZNA 1FX4A 5K5MA 1QAIA 2V8HA 2VOPA 2B9XA 3VVUA 2PEHA 2DEIA 1WI6A 2DJWA 3JB9k 3AOBA 4ZCLA 1NAQA 2DHSA 3CJ5A 2LECA 2X3GA 4C8LA 1YLXA 3GP9A 1AXQA 3M8QA 2XSJA 4ERDA 2Q1LA 4MJKA 1FFGB 5KT6A 3LH2S 2Y8YA 2B4UA 1ITPA 2F8HA 1BWEA 3IO1A 2XMUA 4QPTA 3KHGA 1FK9B 1J5EJ 3W64A 3MCMA 5KFZA 3V2UC 1VQ8S 4X4SA 3TJAA 1R89A 1R0BG 1X7VA 1WKLA 3RR7A 2BACA 4NA1A 2K1RA 5LT5A 2ERRA 1OYDA 2RQKA 1B70B 5J2QB 3OJSA 1NCLA 2O66A 1U6FA 2Z30B 4PG7A 6FD1A 3NAIA 1RAGB 2XZWA 2MB0B 3DMJA 3L9ZA 1RHKB 2XY7A 2I5JB 4PYDA 1KHVA 4ZIVA 1VHFA 4ANCA 4YHHJ 3W8GA 3RR8A 4A47A 3D4JA 1RTDA 2V4JA 2C42A 2RQCA 5J2PB 5LM7E 3IRXB 2E29A 2LLZA 1RDRA 3GIRA 1NH7A 2UXDJ 3D54A 3VAFA 4WP3A 1S97A 5CQGA 1BQXA 1DY3A 3W5ZA 3R5GA 3M6XA 2UV8A 4A8KA 5K9FA 2MGZA 3Q8YA 1HBUB 3CIZA 4WXWA 4NE9C 5E3CA 4R5PA 4X4RA 1FJCA 5E7OB 3QRPA 1JK9B 1B3TA 4OYOA 5U47A 1NO8A 2HHTA 2VASA 2W7OA 2HQ3A 1SC1B 4GMKA 2UXCF 2E7XA 3MM6A 4P72A 1H73A 4WXOA 1IBMF 1ZA2B 3N28A 3NY0A 3MAHA 2OP5A 3Q24A 2R7RA 2R7SA 2MY8A 1MU2B 1K73T 3FSXA 2G0IA 4LIRA 4G1IA 2ZJQQ 1VQ6S 4JI3F 4DR6J 2GMJA 2D3ZA 1XN9A 1H0HB 4RO0A 1M5KC 2HQCA 4WBFA 2M3DA 4ENOA 4USKA 4I7FA 3R7SB 3LGHA 3OHAA 2EW9A 2W9CA 2D9PA 2OPSA 4KO0B 5ETSA 2A1BA 3KLVA 2UUWA 4NLDA 2WBRA 2KM8B 2Q79A 4PQUA 2IC3B 3R9LA 5IC6B 2VV5A 5F8HA 2ZH9A 3JQJA 1QSSA 3KMQA 1U7LA 1UEKA 4A8YA 4FS2A 4DMZA 3DRSB 1IWGA 1HNWJ 4ECZA 2C3MA 2ZE2A 4F4KA 4WKYA 5G0RB 3AJ2A 3FQKA 3P5TL 1GMWD 2XNRA 1ZOTA 1IR2A 3U02A 1Y9OA 4DV3F 2NSCA 4CH0S 2RS2A 4JI6J 1S1WB 4QIEA 3IN5A 3QBCA 4DS5A 2CPEA 1FWLA 1UPMB 3RRKA 1YZ6A 4JI5F 3PX6A 3HZGA 1K44A 3A3PB 2CNKB 2BJEA 2IJNA 3CDAA 1SUQB 3SDEB 1Q1KA 3W1YC 2HKEA 2B4PA 1ZA1B 2RUGA 2YQ0A 2DHAA 4GVBB 3PG9A 3HHLB 1R0CB 3OTDA 1SL0A 3Q2SC 5GAGI 2BKNA 4PR6A 4M5NA 4ZVFA 2IMWP 1D9AA 2YWFA 3N5FA 4I64A 1FFWB 3PNIA 2QSWA 5CYMB 1VQSA 1YZ7A 2JL9A 5J2QA 4DQPA 1OWXA 2LMIA 3GONA 3K5PA 1HHSA 3J80Y 2I5JA 5BXIA 3EX7B 3ILIA 2F5GA 3U1MA 1FDBA 3BPSP 1M5SA 1B4SA 5J2PA 2RH3A 3M2VB 3BO2A 3IRXA 4TU7A 2UVWA 3TVYA 2XS2A 2C2NA 2IM2A 2FGCA 2B7CB 2VJUA 5KFQA 2P6SA 3KXDA 3AY0A 2AV5A 2XGPA 3OJUA 3MM7B 5EGYA 3BGUA 1V3ZA 4E2FB 1HBUA 1SH3A 4M5DB 1IBKF 1MWZA 2RMLA 1S10A 1RLCL 1OY8A 1S76D 1FJGJ 9ATCB 3CJ3A 4OI6A 2F4VF 4TQSA 4TLQA 3NEKA 5LXYA 4BWMA 3UDEA 4X4UA 2G9OA 4XTTA 2EKYA 4J9LA 4PPDA 1FNMA 2GHPA 5HP1B 5EHHA 3OLBA 4FKXA 2K2PA 1MU2A 1BHNA 3H5SA 1SL1A 3R6GB 4DV5J 2A18A 1WF2A 3W65A 3OSNA 3NCQA 2L41A 1PYTA 2LXFA 4CH7A 2OHDA 2WSCC 4RU2A 4KO0A 4DR3J 3T41A 4BC9A 3GFHA 4FZVA 5LSRA 3UN2A 1F2GA 1LW0B 2IC3A 4F04B 1SXLA 2HZVA 4BLGA 2OMLA 1GEHA 4ECWA 1YJVA 4M63A 3CULA 3DRSA 4ZCMA 2DNPA 1C1BB 4RW9B 3DLJA 1WOPA 2CQ3A 2DGWA 5G0RA 2DGQA 4B3MJ 2CFXA 2KXFA 4K4VA 3UN3A 1S1WA 4PG5A 5HQ8A 2M8DB 3A8EA 3OXFA 3LTOA 1URNA 3QMQA 1TTHB 3N79A 3PO4A 4I56A 3J7ZT 1UTAA 3CMQA 3JSBA 1SUQA 2J0QD 3SDEA 5KG3A 1TAQA 1UVNA 4N8OA 3HVRA 2VFUA 1RABB 3UD4P 4GVBA 2MQLA 2HIQA 3ENAA 3HHLA 3M32B 2R2TA 4DZDA 1LWXA 3R27A 3LPYA 1LOUA 3Q8SB 3MMJA 2W2QP 4ZJLA 1WEYA 3MF5A 2M0GB 2AQ4A 3LPEA 2CWXA 3G87A 3J7AN 4MTPA 2N4CA 2M2BA 3NBPB 2VPZB 5KFRA 4JYAJ 1VQMS 4Q0BB 3OL8A 5CYMA 3BDPA 1N5TA 5CAAA 1IJEB 2DYAA 2A2CA 1VC6A 4HH0A 2WVEA 1OJ4A 2LU2A 3BQ0A 4OYPA 2H5EA 2BE2B 3HSGA 2XMKA 4J9UE 3DRRB 4ECUA 4Z2XA 3G8QA 4FVCA 5EDWA 2NQPA 3M2VA 1HFEL 3PYGA 2WVCA 1Q78A 2BANB 1PILA 4DPOA 1CS4B 2FVSA 1TL3B 4K2XA 1YGYA 2R8GA 1VJQA 1WWHA 3Q8UA 2ZD1B 3MM7A 1J5EF 2KXHA 1U0HB 3SQGB 5I4MA 2HBYB 1U26A 4M5DA 3KJNB 1Q7LB 2CPXA 4N56A 2Q66A 2LVWA 4H4KC 3CD5A 3RW7A 4CO0A 5KFCA 1U1LA 5D77A 1IR1A 3KNGA 1Y10A 1LW2B 1I94J 4YHHF 3ONQA 3EGWB 5HP1A 5KOXA 4MT1A 2GNKA 1SJRA 2CG8A 3VVTA 5DDQC 3Q2TC 3NAHA 2DH7A 2IVYA 4OYAA 1D8YA 2OFGX 4K4XA 3O8WA 2KT3A 1HHTP 1SJ1A 4Y65A 2UP1A 2KN4A 1JJ2R 5EWGA 3MFIA 1Y5LB 2IRXA 4LBHA 4X84A 4CWBA 1YJUA 2QLWA 3DDIA 3PW4A 1ZAXA 4Q2MA 4QWDA 4QR0A 3MEKA 4M1KA 1RWXB 1NZAA 1FKPB 3EGVA 3HT3A 2OMOA 4ZS6A 4XDCA 4MAKA 1LW0A 3TUPA 3H5XA 4OQJA 3DLKB 1X4GA 1JNZB 5LMUF 1F6TA 1UZDA 3DM2B 4KH1B 3A8KA 1BQMB 4KH0B 3DLLQ 1KNZA 3HO1A 1FE0A 2OUGA 2ZEJA 1C1BA 4RW9A 2HBZB 3PYFA 4DR6F 3UE2A 4QYZJ 3AJ1A 1WF0A 2H4YB 4IH6A 2QYCA 3RBDA 2C2KB 2ZWOA 2OD4A 3M8WA 3QSYB 2WRMA 2DIUA 3OFGA 4CLZA 4GO5X 1NJZA 3EE3A 1F9FA 2XG8A 3ISZA 3OL7A 1HIYA 2R8KA 2C3YA 1HBNB 1NHKL 3MR2A 3JSRA 1ULRA 3FFIA 3OUYB 4OFZA 2YQ3A 4WPAA 3MPVA 3VCDA 3CIMA 1RBAA 1GX6A 4C7QA 2H5IB 2RQ4A 1UA0A 2R7VA 3N6LA 4DV0J 2AZ1A 2XO7A 3M32A 2NZ4A 1R0AB 1M90T 2J8AA 3TUZC 2J9CA 4I1TA 2AGOA 3PKMA 3NWRA 5ETLA 1EHWA 2FJBB 4CO2A 4H4MB 2EG2A 2A2DA 3NGUA 4ZVHA 3FVYA 2DEJA 1HR0F 4F67A 4RUCA 3NBPA 4JI6F 1X5TA 4Q0BA 3MEEB 4O3SA 4TY9A 4F0HA 2Z4PA 4JI7J 1OQ3A 2VL1A 4J9MA 3ZZTA 1RTIB 3HSZA 4OYIA 3K5OA 4LR7A 5AT1B 3DXSX 2ZC3A 3KKFA 3ICLA 5A76A 2BE2A 4FS1A 2IVFB 4LQ9A 2I0XA 3T3FA 3DRRA 5FIIA 1MNEA 3SCJE 1UCNA 4MYUA 4W92B 4ED1A 5D15A 2ZFHA 2FVCA 2BANA 3PEJA 4HI2A 1CS4A 1S49A 4IQXA 4ZLNA 1TL3A 5BR8J 3AHPA 3LP1B 4QWBA 3SMZA 2UU9F 2ZD1A 3THTA 2J5AA 4JV0A 1U0HA 3BPDA 3SQGA 2APOA 1D8ZA 4PUOB 3I82A 4PRFA 3BN7A 3E8OA 2KKHA 3UO0A 2VDHA 1U48A 3NMAA 2OPPB 1VQPS 5IQQA 4WK3A 2F9DA 1LW2A 4PXDA 5B08A 2ZNZA 4L73A 4A48A 1LFWA 2DNHA 2MZRA 5DM6Q 3UN5A 2EI5A 2B51A 2MDAA 2IYGA 3NRBA 2FY8A 1VR6A 2ACMA 3A3OB 2EEYA 4KE5A 2Y1LB 4FF3A 4O3RA 1RWKB 2DGVA 1U2CA 1NBEB 4DPWA 1TUGB 2R4FA 1YJTA 1S6UA 1RWNB 2AYGA 1VRUB 2X3DA 3GIKA 2NR0A 1QLNA 1RHUB 4HR2A 1R6YA 2FD2A 1RE1B 3D3BJ 1FJGF 5GMDA 1FKPA 1R43A 5K8PA 3RZAA 1N4LA 2PT0A 5C25B 3DLKA 4O4RA 1MN9A 3VGSA 1RJJA 2V5HG 5G4DA 1VLYA 2CQBA 3NG8A 2FZCB 4DL3A 3DM2A 5E3RA 1BQMA 5ADZA 4OX6A 4YR3A 2HFZA 3M2UA 3WZ0A 4CLSA 5H9EK 4CLYA 1IN0A 5JVGQ 5AXLA 4HH1A 3D66A 3CJQA 1AUSL 3CTRA 4DXLA 3Q8RB 2IA0A 3JYTA 2VDIA 4P2MA 4KJIA 2C3OA 1KSPA 4I2QB 1HWKA 2NCKL 5I3PA 2XLKA 2FHMA 4NI2B 4DR3F 2BJ1A 2AZ3A 1BUXA 1HBNA 3T5HA 2ZWPA 3AD9C 2H9ZA 2VIHA 1B64A 4UQGA 3J7YU 5KFSA 4NEZA 1TL7B 3OUYA 4AT1B 3QIPB 3Q0AA 2POKA 4LF6J 4L74A 2UV8G 4ZVGA 4ETZA 3VAIA 2NLWA 2FIUA 2GC8A 3J80U 2LYVA 4WFZA 1M0SA 5BYQA 1F60B 3HF5A 3MTJA 1R0AA 3SXLA 3QWPA 2KXNB 3IC1A 5HN0A 1EQMA 2G1HA 1KFDA 4LF1A 1TAUA 1VRQC 4H4MA 2DY1A 4OI3A 1L3SA 2HWHA 1SC4B 3D7SB 3QAEA 5HATA 3CO9A 1SC6A 4A8OA 3K58A 3M8YA 1OY6A 2AGPA 1U49A 2PDAA 3MEEA 4LBPA 4QWAA 2NXJA 3FJ2A 5DZ6A 1K47A 1XIQA 3FZBA 1RTIA 1X4AA 4CRJA 1NDCA 1X4HA 3MR7A 2V2KA 3D2WA 3PZPA 4KFBB 4OLPA 4CYUB 5D0HA 1IKYB 3K57A 4UY85 2GAGC 1EETB 3C8YA 2XHCA 3FSIA 3IS9B 1GNKA 2YPYA 4TKTA 2XQCA 1HMVB 2E1RA 2R8JA 1WJ9A 4J91A 3W5XA 3PW7A 5E33A 1KN6A 4LJMA 4EK2A 3FEYB 1SPBP 2LP4A 1PAUB 3LP1A 4DSIA 3DRYA 2BQUA 1MLAA 2M8HA 4JYAF 1P1TA 1NEEA 1FEHA 3MCSA 1JLFB 4ZVPB 1NSKL 4JI0J 3OTCA 3GIIA 5B0FA 3ZNJ1 2OH2A 4EZ6A 1SJ4P 1YI2S 1JWWA 2RAQA 2DPJA 2MKCA 4IYQA 1C1CB 1JKHB 1APSA 2HZCA 4DN0A 1YK9A 4RJVA 2X51A 5FD1A 1K8AT 4DFPA 3CNQP 2JNJA 4OHXA 3QQCD 5L1LA 2W4DA 2FJEB 4NPOA 2BOPA 1F5AA 4E0DA 1NK0A 1IKXB 1VRUA 2J0SD 1XC9A 1NPPA 2FJXA 4CZCA 5MAOA 1MW7A 2I2YA 2YWEA 3I4HX 1UVMA 1XERA 4ER8A 1YRXA 4WKRA 3MAAB 5AXKA 2KZMA 5C25A 2Y9HA 1F5BA 1QVFR 5F8LA 2IBOA 1I94F 1QUVA 1VQ4S 5D4PA 1JMTA 3J81Y 1XBWA 2CG4A 1MMLA 4G6VB 3SCKE 5D0EA 2JC0A 4YB5A 1Z2ZA 3LP2B 5IM0B 4S0MA 3M7VA 5CXTA 2XYPB 2FJWA 1ZS6A 3MUVP 3VAJA 3PACA 2KHDA 2DNLA 2E66A 5T14A 3IBWA 4I2QA 3DI6B 4QW9A 3O6QA 2OKQA 4NI2A 2GAHC 1MSWD 3CCLS 2J6SA 1FEEA 4RW6B 5IOLA 1U4BA 5SUHA 3I9V9 2N7YA 2DH9A 1TL7A 3N6MA 3QIPA 1X60A 4FVMA 3QJJA 2JEJA 1TKTB 3LGNA 2W24A 3UNYA 4Y2KA 2ATLA 2OEKA 2ZBRA 4X4OA 2NXNA 3CC7S 2JSXA 4C9DA 2MKHA 4PXEA 4ED8A 4WFAQ 1TKDA 2MZJA 5EX3A 2E5HA 2KL8A 4R8UB 2FHJA 3ZTQA 1F2HA 3T9ZA 2E9RX 2HWIA 2IYIA 4NYOA 1QVGR 1GX5A 1H7XA 3MMCB 2Z0GA 4RPFA 5L38A 4RU9A 4F3OA 1JB0C 3M6UA 2CQ4A 2L3MA 2FZKB 2Y8WA 4LREA 3I5AA 1I3OB 4CI0B 5B0GA 1PKUA 1YJRA 5KG2A 2UUTA 4K4SA 3IGVA 2YPZA 3EZ5A 3ILJA 3GFYA 3GYGA 5K8MA 4F2RA 1SV5B 3EZUA 4KFBA 3U1LA 4CYUA 1PBUA 1IKYA 1EETA 1FXRA 1ZPVA 4DV0F 1VDHA 4ZA1A 3IS9A 4B9NA 1JJCB 3NKYA 5C7PA 2C2EA 4LVNP 2M7SA 1HMVA 3CWJA 2WVFA 4ECQA 4NLPA 1UA1A 1TP7A 2V9WA 3DC2A 1EB0A 1YX2A 1RWOB 3A1YG 1JLFA 3C3LA 2VQEF 2CPZA 2AX1A 3NNHA 1NSQA 1DQ9A 4JI7F 3M8RA 4NWBA 3IR5B 3CJRA 3A3NB 4ZHRB 3W5YA 3D1QA 1C1CA 1JKHA 2QX0A 3G82B 4DPYA 2VFSA 2Y1IA 2W7AA 3I4PA 1CJTB 4OX7A 5KFOA 3OVSA 3G4SS 3RBEA 5JMNA 1TFWA 2X1FA 2VC0A 2Q43A 2XLIA 3AB2B 3GILA 3RU0A 3OLAA 3T1AA 4M5MA 3FUYA 4C8NA 4C2MA 1V3RA 4AL5A 5B0EA 2J9EA 3GCXP 5BR8F 5L1JA 1Q86T 4G65A 4C3MA 1IKXA 3BN4A 2Z8QA 4B17A 2DGTA 1D3WA 3H5YA 4C3LA 4BC7A 2VD3A 1QY7A 2R3VA 4X62J 4DWIA 4K4UA 3MAAA 3OTBA 2WTFA 3V6JA 3HHLD 5KFBA 4DUYJ 1UW4A 4V1Ak 3POTB 1SL2A 3IBCB 1FRXA 4DLGA 3TX8A 3NOCA 1XWLA 3EDQB 4U7UD 3FEZA 3LP2A 5IM0A 3OFHA 4LRCA 2J7KA 4DR4F 4M5JA 1C0TB 1FO1A 3Q22A 4DCOB 2FC9A 2CXEA 2HNZB 2XCPA 2UUBJ 4HT7A 4M5KA 1X4BA 1FRLA 1WD6A 1GTHA 3R8YA 2D3OR 1WEXA 4DBQA 3MM9B 5DETA 1B7FA 1K1QA 3DI6A 4ZP7A 4ZLPA 1O6XA 3TA2A 1F0XA 3W2WB 1IM4A 2H3EB 1LFPA 4RW6A 2PFFB 3KWMA 2O1PA 2VQFJ 1TKXB 2E1CA 3CJ0A 4F4ZA 2L9NA 4OZLA 1TKTA 2PGCA 4DL5A 3L3CA 4EMDA 2MPUA 4YDXA 2V8VA 5KG0A 1KVJA 1UPPA 2VPWB 2OPQB 1FT8A 3PFEA 1Q95G 2ILZA 7FDRA 1UFWA 4YB6A 2QSFA 4QYRA 1JQGA 4R8UA 2HHUA 2OFHX 2H5JB 1Q8BA 1FDDA 2DNRA 1DFDA 4DV1J 4OZ2A 2ILYA 4YR2A 3MMCA 1RXOB 3T5KA 3G2XA 3GQCA 4HACB 3PW2A 3P5BP 2C2ZB 2J7UA 1IBLJ 2JFKA 3A8IA 4NMXA 3V81B 3IRWP 1Q8KA 3WQPA 4P2XA 3CD0A 1CC8A 1LWCB 3LW5C 2KDOA 1S1VB 4LF6F 1SH0A 2WBMA 4KR0B 1SV5A 1KRPA 3L7UA 3W8PA 5KT3A 4TYBA 5H9FK 3NS5A 1DBDA 1JLEB 4WIIA 5HJXA 5AJ3J 4HKQA 1E6YB 2QRRA 2XSFA 4ILMA 1UETA 1IQZA 3S6EA 4DV7J 3ET6B 4H4OB 3ISND 2BKOA 3NLCA 1XR6A 2KJVA 2I9SA 2JLGA 3C19A 1X0FA 4MKAA 3QRQA 1R8AA 4AFFA 3KUEA 4WFBQ 5B0AA 1B0TA 2RNEA 2R8HA 4P7VA 2MKYA 4DX6A 4CO4A 1XMOJ 2AP6A 1VQLS 1S9GB 2K8GA 3J7YI 3KK1B 2ZZTA 2JX2A 1N56A 4BWJA 4ZHRA 3TZXA 4TN2A 1FJ7A 2CZ9A 4MIWA 3G82A 2H4WB 2VPXB 1QD1A 3HI9A 2W4CA 4IOBA 1CLFA 1CJTA 3LOUA 2HQFA 2V94A 2FJDB 2CPHA 4AL6A 1RAFB 1VS3A 3DOMB 3MM8B 1U6BA 4NLUA 1PYOB 4ZP6A 3OT9A 3RYLA 2MTLA 3LAMA 2DB1A 1IBCB 2AYEA 2VUGA 4LSNB 2HK2A 3F41A 1TVRB 4NASA 3GSDA 1GFWB 4B3RJ 1KDNA 2HS3A 1Y00A 5HQMA 4JI0F 5M2PA 1XQIA 1ZM4A 2M88A 2RKIB 2V2QA 2MKJA 2YX1A 4LR8A 2W4PA 2HHHJ 4QCLA 4J90A 1P1LA 2QFJA 2JZ5A 1VQOS 3ILOA 3L09A 3POTA 2DHGA 2WW4A 3M2RB 3E2EA 2R7WA 1S1TB 3Q23A 3TX0A 1FE4A 4IR9A 1IM6A 3AXMA 1VC0A 4C98A 3AFGA 1C0TA 2A3JA 2FHOB 2OPRB 2QA2A 1Q82T 2HNZA 3TYTA 2A6OA 1WORA 4OYZA 3FCHA 2ZBPA 3HHDA 2PI4A 5HMXA 3MM9A 4F4AA 3TZWA 3KOAA 4PKDB 4CP5A 5D4NA 4Q44A 1UJ6A 3W2WA 4IUFA 1S7IA 4P6QA 4DX7A 4NLVA 1UVKA 5DQGA 1TKXA 4M5LA 5MLCV 1TQLA 2VB6A 2RILA 4X4QA 2ZOMA 3RB6A 4PWDB 4QWCA 3ENWA 2GX8A 1RT2A 1RT4B 1T9YA 2OPQA 3PIOQ 1VBKA 5E41A 3CW2C 3GSIA 1WTBA 4R0JA 3CDBA 2KB2A 1L3VA 1FFSB 2FB0A 2AD9A 1IR0A 1W7WA 2BJ9A 2JEFA 3NCRA 3W9JA 1L3KA 1JIHA 3HKZD 2DVIA 2V6AA 4HACA 4I68A 2HFVA 3ZNUA 4RZRA 4ZDNA 3D28A 1RAEB 2P2CB 3CXCR 3QGIA 3V81A 3FBEA 4HT5A 2DITA 1N34J 1FDNA 4V19J 5ETRA 3Q83A 2CJKA 4PPZA 3OHBA 4C8YA 2GMHA 1LWCA 3MUTP 2VFRA 3IFEA 1S1VA 2ALYB 2Y1JA 1JLEA 4USVA 2XTJP 4A8MP 3B4MA 1E6YA 4OI0A 4A4JA 1UEUA 1YJ9S 3ET6A 4XDDA 4H4OA 3R5CA 3HHNB 1U25A 5KG7A 3T5JA 3O44A 4F3QA 1N33J 3T5LA 4LIWA 3EICA 4NA3A 3I9ZA 4I6YA 5CABA 1KQGB 2ABYA 3MI7X 7FD1A 2MQMA 3SCIE 2OTLS 1VQYA 1DZ5A 2FVQA 1N5SA 3EZOA 5C24B 3W62A 2CDQA 1Y5IB 4JV5J 3E01B 1S9GA 2VH7A 1FXLA 1UKUA 3KK1A 4CLUA 4CLLA 1OY9A 1SCJB 2QLJB 4WZMA 5THWA 3UDLA 1NK6A 4RW7B 4WTOB 1CG2A 2PN6A 1CQMA 5JVHQ 4DN9A 1KTVA 3PY8A 1FX2A 3VGVA 3DOMA 4J9OA 3R5DA 1JNRB 3MM8A 4RLEA 2ZHAA 2N3LA 4RNFA 1CBKA 5FJ4A 3DLHA 2CIMA 5L46A 2IHR1 3H2VE 2GZOA 3RB3A 5LMNJ 4LSNA 4U9RA 2HMIA 1A6LA 1TVRA 2DXDA 4Y2IA 2HYIB 1ZZFA 2BQRA 1V9OA 2RKIA 1SJFA 4N8NA 3KJFB 1RKIA 4URQU 3KMSA 4RUHA 1P9YA 1RADB 2A6MA 2R42A 3WBZA 3M2RA 3SI8A 1S1TA 1VMBA 2QA4G 2YNIB 2BE7D 4ZPDA 4ZPCA 4RBTA 2QEXS 3HSJA 3DHXA 1U1QA 3CJTA 5L9NA 2OPRA 1QAXA 1X4CA 1W2IA 1U1NA 1ZPWX 3GLJA 1O0PA 2DRAA 3CDEA 2MQNA 5A2QU 3CJKB 2YH1A 2DR7A 1UWAA 1JLQB 3NS6A 1SBRA 4JUZA 4XIUA 3FSYA 4O23A 4NXMF 1HNXJ 2V34A 2DY9A 1FKAF 1D1UA 1Q16B 2CJXB 3D68A 2G0CA 2EK6A 2BJ7A 1KWMA 4PWDA 1WC3A 1RWVB 3HVAA 4NCGB 2NXEA 1C2PA 1NXIA 3DCAA 2GO9A 1RT4A 2IY5B 1Q53A 2HNDB 3ENQA 5DM7Q 4FF2A 5K8OA 2XS7A 1FD2A 1YSJA 3KG4A 2RJZA 1SQGA 1HQ2A 4K4ZA 3QPIA 4DU7A 1UVJA 1UFLA 4NLSA 4U6PA 1YG0A 1AZSB 2VKZG 3WIVA 2IIHA 1QM9A 2CNOB 2XCAA 2F40A 2RHQB 1VK8A 3LO3A 4UOFA 2QIFA 3MMAB 2XWYA 3HX9A 3QT7A 3IXQA 3PXGa 1YRUA 5HAOA 3MOJB 4QBUA 2DIVA 4LF4J 2VQFF 4OJGA 4JV1A 4D3HA 4F4WA 4WIQA 2PE8A 3P4UB 2KT2A 2HFSA 2KTQA 2ZBIA 4A8XA 3OFEA 3OV7A 4PZVA 2XNQA 2CZ4A 2F65A 2DR9A 3ZO7A 4YB7A 3TO8A 4C8MA 1T0TV 4BCAA 4ZMMA 3GCWP 5C24A 4ES2A 1HYSB 4KT0C 1DARA 3E01A 4UW2A 5ETQA 4RX6A 3I0SB 2E5GA 4TU9A 1IBLF 3BQ2A 1HQEB 4LBIA 2VA2A 1HNVA 4J9NA 1HI1A 3DOLB 2HHVA 1N5QA 1X9WA 2GFFA 2C3PA 1RWPB 5A0YB 3UDCA 2ZKTA 4RW7A 4I6WA 4DHVA 2V50A 4Y2AA 2LA6A 2MLYA 3CCQS 4CLFA 3CJ8A 1RTHB 3GIMA 5DJBA 2MZQA 1R8CA 5HVHA 5AJ3F 2DHHA 3IM8A 3MEGB 2LQJA 3HFKA 1H7WA 2NUUG 1X4FA 1RQ0A 1YVFA 2G2ZA 3KHLA 5HL7Q 1MWQA 5LJ3Y 2WVBA 3PYDA 4LFAJ 4MK9A 3MEDB 2QTWA 2QN6B 3KUHA 1UW9A 2R2UA 2LCWA 4RWXA 2VJVA 2YWGA 4DU8A 3MTKA 2CJAA 8ATCB 1XMOF 3AQOA 2KRBA 3VZHA 2C2OB 5HANA 1X4EA 3PRDA 4EO6A 2QC3A 3HKWA 4ZN1A 3J7Z5 4YMEA 2ZNYA 3I87A 1HNZJ 3ZTPA 2QFIA 2YNIA 2GIQA 2FHJD 2GV1A 5KT4A 2CAJA 2DR5A 1U02A 4ES3A 2RU3A 4QU7A 5DO2A 2W8KA 2N4DA 2W8LA 4B9MA 4EU0A 4IG3B 3PR4A 3TQEA 3CJKA 3WIUA 4B3RF 5AE3A 2WVDA 1JLQA 4BS2A 4IOAQ 3J81j 3BYRA 1S9EB 3N9UC 2B43A 4PAAA 4CDIA 8RUCA 3MOZA 3DU5A 4CLWA 1M5VC 4PXCA 5CHCB 2HHHF 5FLXU 5E3PA 1EAYC 1OQ6A 1Z1ZA 1WC6A 4NCGA 4NZ0A 3SV4A 5L39A 2HNDA 3CDWA 3TA1A 2B7BB 4KBIA 3WX4A 2ZVSA 3MUMP 4JI8J 2E1MC 2KJWA 2BEFA 4J9VA 4ZVSB 3CCRS 4JI2F 2B5JB 4KHPF 1P27B 1G7CB 2YTCA 1AZSA 1F3FA 3GR1A 1ZAWA 5D0RA 2IAJB 1J5OB 3CPWR 1KVKA 1HWLA 3MMAA 5IT9U 2M70A 2VG5B 1S48A 4DPTA 2GQQA 3DKDA 1FWPA 2FQQB 2WHOA 1TK0A 3HMJG 4DSKA 1Q0NA 4KHMA 2AT1B 4ITSA 2RVJA 4U7UK 3IA0A 2IVMA 4DSFA 4NZ6A 2FJAB 3CCSS 3MPWA 5IXUA 5LSOA 1VBXA 4OIXA 3TQ1A 4QIWD 3B78A 1WUUA 4HYKA 3CD7A 4J9QA 3NP5A 1ZM2A 3DLEB 4LQ3A 2FYXA 4G1PA 1ZTTA 5HMWA 1D0EA 3FGVA 5CCMA 4Q5VA 5B0CA 2KM8C 1HYSA 2R7OA 1N88A 2HW3A 4Q45A 1YWXA 3HHEA 3I0SA 4HHUA 1HQEA 4Q2LA 5LMUJ 4PABA 1CC7A 1AA1B 4UTGA 1N34F 2K3IA 3JTPA 1OSDA 2SXLA 2YVSA 1T94A 3R7NB 3DOLA 4WP9A 5A0YA 5T41A 1KBRA 3HCXA 2EKNA 1FTRA 4ZVTB 1RTHA 2EFQA 3RBXA 5RUBA 3MR3A 3EGZA 4CLKA 4OV6A 3MEGA 2VU5A 4FP9A 5HSPA 4FNIA 1N33F 3M8ZA 3P8BB 2NZCA 4CLTA 5KFXA 3MEDA 4OYXA 4DV6F 3VHQA 2OI2A 4P2SA 2DTJA 1URRA 4B9LA 3TVZA 1HI0P 1S59A 2HFOA 2KU7A 4JV5F 1RT5B 4ATNA 3MR5A 2JVOA 5KFLA 2MLZA 3FBBA 4DI6A 3M4XA 4I69A 2HRTA 3HHLC 3Q89A 4U67Q 5DLGA 4ECXA 4EZ9A 2EFOA 3UCZP 5I3UB 4XK8C 3THPA 2YNHB 4ZLLA 2ZVIA 3G8TA 1HW8A 3VALA 2J9DE 1QDUB 1S4FA 1JLCB 4DQSA 4BDPA 2E5LJ 5EWFA 1HR0J 4DQRA 1HBMB 3H59A 4RW8B 5IC4B 3CJ4A 5M2RA 2QYGA 3NXZA 5DZ7A 4USHA 2ZBCA 5LMNF 2LQBA 2P9GA 4IG3A 3VAMA 1S99A 3MCNA 3CMAS 3BSNA 1YTYA 2PFDA 2H51B 5C42B 3EYZA 1YJNS 2C22A 1XTZA 1S4EA 1UVLA 1S9EA 2JLFA 1YJWS 4ES1A 2D1CA 1WKJA 1NLKL 3ETMA 2XYHB 2IM3A 5E5NA 2E5IA 1TZ0A 4MK7A 3B82A 2VPYB 1OYEA 1T02A 4HTJA 1H74A 1KS2A 3GV5B 2UU9J 4RBUA 1FK9A 1WDTA 5KFVA 4U95A 3AQPA 2B5JA 2V63A 4WE1B 3UQSA 5DDRC 1GTEA 2KFNA 4KSEB 3QT5A 4UF4A 4N7TA 4DR2J 2KG0A 2IAJA 1J5OA 5A6WA 4H54A 3QYYA 1PJ7A 5DQIA 2ZC4A 3L4BC 1DURA 2VG5A 3DDKA 4KB7A 3O2IA 1F5CA 4IO1A 4OZ5A 3CT9A 2UXBJ 3H90A 1HNXF 2Y0BB 2D3UA 2B8PA 3T1HJ 1PJ5A 1DQ8A 3MZIA 2VFVA 1UMJA 3W61A 5CYQB 1GAOA 1Y5NB 2LQ5A 4HL9A 2NPFA 2IA6A 1VIOA 1LQ9A 3BJYA 4ZVRB 3ISNC 2WK4A 3MCOA 4KGXB 3DLEA 1T9WA 3BDEA 3B6BA 3ZTSA 4B3OB 4AL7A 2CPYA 2QGFB 1IXKA 3KDNA 3PX4A 2BJ8A 2E9TA 2CDRB 1U0SA 3HD2A 5LXRA 5FDLB 2B9YA 5DG8A 2JC1A 2HVZA 3NCPA 1X5OA 2AWZA 4E98A 1HD0A 1OIAA 2LDIA 4GVLA 3IR6B 3GMGA 1PIEA 4LF5J 1U8SA 2DD8S 3GV8B 2XMVA 1DHMA 4XPEA 4LF4F 3DXBA 4QW8A 3SEOA 3QT6A 4TU8A 2D3O1 3D1OA 3CCES 1RHRB 4IO9Q 1G4CA 2O5DA 1NJWA 1I1GA 4P75A 5HK4A 4LF7F 3GZ7A 5F0WA 2XLJA 4AXJA 3PEHA 3LANA 2AJ4A 3CUNA 4P2FA 1C4CA 1N32F 4F50A 2GA7A 1N5YB 3PDNA 2JLEA 5L8RC 2HHXA 3T9NA 2ZUGA 3VGUA 4C8ZA 1RU2A 3DGPB 2EBGA 3D6TB 1DLOB 1RT5A 3WC2A 2OLWA 1TUWA 2BW7A 1D9DA 1R27B 1M1HA 3N0VA 3F56A 1XNRJ 2XY6A 2J7WA 4XAKA 2OSRA 2Z2YB 3FCVA 1KVIA 3KLFB 1EIYB 5I3UA 3UPFA 2YNHA 4OZ3A 3UWTA 1L3UA 3BKFA 3KHHA 1RHMB 2QA1A 1HWJA 4ZJOA 1JLCA 1YITS 4LRDA 1KFSA 4ID8A 5D78A 2B6AB 4DSLA 1HBMA 4FYXB 1JLAB 4RW8A 3B4DA 5CA5A 3BKUA 4C11B 2CJBA 4LFAF 1J2VA 1FTCA 3BGRB 4IQMA 3RUBL 4JB8B 2AJ2A 1Q79A 5C42A 1LK5A 2YWHA 2CYYA 3CO0P 2KZZA 2DO0A 4LF8J 5I3QA 1S1XB 4USMA 4P10A 4ZVQB 2QL9B 4MIAA 4ZITA 5KFTA 4OI1A 1NDKA 2ZBQA 3RG6A 3I31A 3I0RB 3BYPA 5E2QA 2AHOB 3TWZA 1HNZF 5GAEU 5L9XA 2QMXA 1RBLA 4UUXA 3LF0A 5D8HB 3ILLA 1UJ5A 4EGLA 1KQSR 1VIXA 1D09B 1ZYQA 3CCUS 2V2ZA 3LA0A 1LK7A 2XMAA 4WE1A 4B9SA 4YS2A 1RHJB 3FMBA 4HTIA 3LP0B 3T6BA 2HHQA 3ZZOA 1N36F 1R7IA 1FRHA 1S6OA 2HAIA 1T9UA 2HFUA 4F4YA 1EQ0A 2RIJA 5DLFA 3KFWX 4WFYA 1RT3B 2OEMA 3HULA 4A8WA 1XNQJ 4FN5A 1R8PA 1Y3KA 2H1YA 4CH1A 3NGRA 5CYQA 2YKQA 3EXCX 5K14B 4P52A 1HD1A 1RHQB 3O3LA 4NLRA 4F26A 2YKPA 3TW0A 2XGQA 4PWWA 3UW1A 2I6WA 4JI8F 1UZHA 4X2BA 4Y6IA 5KG1A 2U2FA 1BMQB 4B3OA 4OI2A 3BSCA 3U27A 2HQDA 3IBFB 1PO6A 3BV8A 4TXSA 5FDLA 2IFXA 1RWWB 4V19X 3D67A 5KFYA 4X64J 5K20B 1QSYA 3LALA 3TEGA 5HBMB 2LDYA 2G2YA 3MHYA 1U1RA 2RRAA 3OVBA 2HBRB 2BUNA 4IG0B 1S72S 1X31C 4XO0A 2HFNA 2Z56B 2VA3A 2BM1A 2AGQA 2F63A 2JRSA 2UVUA 3OD2A 3G96A 2G4BA 3EXYA 2DKOB 4IFVB 1VQKS 2VG6B 3F73A 3VZIA 4DL2A 2ADCA 2V8DA 1N5YA 3MWBA 2W9BB 3W66A 1YIJS 4PCQA 1O51A 3M8SA 1H72C 2X1AA 3DGPA 2YKMB 4WCEQ 5HVFA 1VC5A 2QMWA 1DLOA 1PG5B 3X1LB 4YQWA 1IKVB 3T1YF 1EKRA 2ROPA 1RA6A 1Q81T 3K0JA 1M5OC 3KLFA 3FQLA 4TQRA 4G3IA 1R3NA 2JH3A 1XK8A 2IPOB 1H98A 2CVIA 3Q8VA 2A10A 2B6AA 3A13A 2Q3PA 3W3SA 2P6TA 1JLAA 2B3TB 2CPFA 2GS8A 4U8YA 4C11A 2OGUA 1AROP 4IR1A 2HVIA 2IM0A 3TA0A 3HZEA 3BGRA 1T8EA 4QU6A 1S12A 2D7SA 1CEZA 3KK2B 1AFJA 5KFNA 3EWGA 1BC6A 2RDJA 1JXVA 4KPCA 5C2CA 3C6TB 3DGVA 5B0BA 2HEKA 5J2NB 3M1VB 5DGBA 2FY1A 3A8JA 5GVQA 1S1XA 4OYBA 3BBCA 3KUGA 1NRKA 1M5PC 5LJ5Y 3QATA 4Y00A 1RAJA 2PIIA 3DU6A 3I0RA 2QL7B 4DR7F 4F0KA 1NK4A 2XB2D 3OTEA 4DG1B 2HQIA 4PG8A 2FDNA 4Z37A 2YX4A 2XI3A 4J5OA 3QZ7A 2E5LF 1S0NA 2VQEJ 2CQPA 3HM9A 2WW8A 5GADU 1ZTWA 1RISA 3JAMU 1TR0A 3LP0A 1T03B 2VC1A 1MWYA 2UVVA 3UR0A 2KH9A 1UAWA 4ZCKA 2PMZD 2NREA 1NB7A 2CPJA 4DFJA 3RB0A 1RT3A 4B9VA 4ICLB 5K8NA 1F1BB 1YKWA 2EFVA 2MKIA 1EP4B 4TYAA 5IV3A 2FTRA 1HARA 4AUKA 5HVGA 1DJ0A 3RGIA 3GYXB 2EPIA 5K14A 2BM0A 3ITHB 4GKJJ 4CO1A 3IWXA 3PRVA 1ZAVA 4WFXA 4ELTA 4A8FA 1SJQA 1WI8A 1WHYA 3V5RA 2AJ1A 3PM9A 5ETVA 1NB2A 2CKWA 3M8PB 3QZ8A 2DNYA 2MYFA 1RA7A 2XS5A 2KYXA 2RE1A 3AODA 3PHEA 2ZITA 3I5BA 4YY3J 4XPCA 5HMZA 4LSLB 5CD4H 4Y34A 4DR2F 2R9LA 4DFMA 3MURP 3K2YA 4OLOA 1U2FA 2BZ2A 3VV2B 1VISA 2K7JA 2J76E 3RRHA 4LF9J 3Q86A 2Y3YA 3MFHA 1Y4ZB 1FXDA 2LKZA 2UXBF 2N82B 2WSFC 5HBMA 3HPOA 5DG9A 2VFTA 3T1HF 4L3KA 4NLGA 1U24A 4DX5A 2DT9A 4IG0A 1I6JA 3GTYX 4DR4J 2Z2LA 5B0DA 1WOOA 4IFYB 2IRUA 3BSAA 5GMEA 1FESA 3ELHA 1B7YB 2OAUA 1HHQA 2W2NP 4K50A 4HDGA 2WOMB 4IFVA 4OV1A 2VG6A 1WC5A 1AT1B 1WTFA 3HJFA 2W9BA 3LUYA 4M94A 3GPAA 2BE9B 2N7CA 3UCGA 2YKMA 1VBZA 3IWLA 1KEKA 1NNDA 2O67A 2XY5A 1VBYA 4ED7A 2RB7A 3KNAA 3L95X 3VQTA 3NGSA 1IKVA 5IT4A 4LF5F 1S0VA 3W63A 2LA4A 4P74A 1RT1B 4KGKA 2HGMA 5KG5A 1PGZA 3LGMA 4IKAA 1PC4A 3CD6S 4KPYA 1IKWB 3MPUB 2ASYA 2HK3A 4DJBA 3AOCA 2OELA 1PC5A 4OI4A 3QSIA 4FXVA 3DN9A 3WDOA 4K4TA 3FBFA 3RAMA 1R8BA 1YDLA 4G1QB 3I5CA 2XM3A 1WSRA 1M5HA 3A4TA 4F3MA 3KK2A 1OSCA 4NYZA 4EBCA 3CC4S 1LKZA 2HSEB 3C6TA 1T9XA 3PW5A 2UVRA 5J2NA 1YBUA 1W25A 3M1VA 1UL3A 4W98A 2CPDA 3C14B 1Y7PA 3JTNA 2HURA 1MN7A 2CA9A 3AB4B 3SCLE 4ALZA 1NPKA 5KFMA 3FBCA 2G0JA 2AX0A 1XNRF 2EG1A 3VAGA 2Y1RI 2WB1D 4NX9A 3K5LA 4RNHA 3D0HE 2FLNA 2XC9A 4NLOA 2F3JA 3W9IA 3ENVA 2DGOA 3AOAA 3SSSA 5J1NA 4ED2A 4M5GA 1RGVA 4DG1A 4DPXA 1NMEB 4ELUA 1HQUB 4TY8B 3ZZZA 1TK5A 2XEXA 4FBTA 3PKYA 2MY7A 1TMJA 4GKKJ 4NLTA 3CDUA 3MECB 3BR8A 2RDDA 1T03A 4IOCQ 1RZMA 1YBAA 1TL1B 2PEBA 4JI4J 1CSJA 1PSDA 3D1HA 1BWVA 2FGOA 3BBBA 4LF8F 4L75A 3G6YA 1SKSA 4KTQA 4ICLA 4LFBJ 2H54B 1XMBA 2V69A 1L3TA 1EP4A 4F8RA 4WF9Q 1RBOB 2EFGA 1ELOA 3PR5B 1H3DA 2CUYA 3ITHA 4AQYJ 2C3UA 5ETOA 2ZJPQ 4DV2F 1N6QB 1QSLA 1B0PA 3BF4A 5KFKA 1WG4A 1RYRA 3UDVA
chains in the Genus database with same CATH topology
3KLEA 5EWGA 3MFIA 4RBVA 1FKAF 1D1UA 1Q16B 3B8HA 4DLEA 2G0CA 2EK6A 3M8PA 2P9CA 5F41A 1Y5LB 3TAMB 2IRXA 3SZ2A 2UUCF 3N4WA 2K7KA 4FYDA 4PUOA 4PWDA 3LWMA 3OR2A 1T3NA 4URSA 4X84A 3HVAA 4O3PA 5IWAF 1YJUA 2QLWA 4NCGB 3PW4A 4KGMA 3OPKA 1ZAXA 1C2PA 4Q2MA 4ILLA 4C8KA 4LSLA 4QWDA 2ZJRQ 4QR0A 3MEKA 3DCAA 1YHQS 1KOOA 2GO9A 1RT4A 4M1KA 4UQTA 1Q53A 4O0IA 2HNDB 3ENQA 3GR0A 4OZJA 3LWLA 1NZAA 5DM7Q 3K5MA 3KHRA 2OPPA 3ETOA 3HHKA 1FKPB 1G3OA 4FF2A 3HT3A 2OMOA 4ZS6A 5K8OA 4XDCA 2XS7A 4MAKA 1LW0A 1FD2A 1YSJA 3KG4A 2RJZA 4OQJA 3H5XA 4K4ZA 3JSMB 3QPIA 3DLKB 1UVJA 1UFLA 5DQHA 3CCTA 1X4GA 4NLSA 4U6PA 1YG0A 2VKZG 5IT0A 1JNZB 5LMUF 1T95A 3US5A 2FJVA 4Q8FA 1QM9A 3TP2A 2OSQA 1P8GA 2GIRA 2XCAA 5CH7B 3DM2B 1XNQF 2F40A 1BQMB 2D41A 5GAEI 4DQIA 1VK8A 3LO3A 3DLLQ 3I6PA 4HHJA 5A8RB 2QIFA 3H98A 3MMAB 1KNZA 2XWYA 3HO1A 4WJBA 3HX9A 1U45A 1FE0A 3IXQA 4K59A 4IFYA 1C1BA 4RW9A 2MSTA 4DR6F 1JJHA 3UE2A 3PXGa 1RI7A 1YRUA 4UY8T 1BQNB 1WG5A 3MOJB 3AJ1A 4QYZJ 1WF0A 4IH6A 4QBUA 2QYCA 4ZPTR 3RBDA 2WOMA 3V4IA 4FNHA 2DIVA 2OD4A 4URGA 2VQFF 1RYSA 3FNNA 3OXGA 4OJGA 4YB1P 4JV1A 4D3HA 2WRMA 2DIUA 4BBYA 3OFGA 4GO5X 2ZH4A 3MM5A 1NJZA 3MMBB 2J0XA 1F9FA 2XG8A 3ISZA 3OL7A 3BO3A 5HROB 4DFKA 4F4WA 1MROB 3L7PA 5IZHA 3SV3A 2R8KA 3BEGB 2PE8A 3X3UA 2KT2A 2MHEA 4ECSA 3U1NA 2KTQA 2FLPA 2ZBIA 2C3YA 4A8XA 1VFJA 5LL6d 3OTOF 2LEBA 1FHTA 3OFEA 3OV7A 1HBNB 2XNQA 1NK7A 3MR2A 2VONA 2XI2A 3JSRA 1ULRA 3U7JA 4X64F 1HI8A 4NRTA 3FFIA 2CZ4A 1VOMA 5KFGA 2KFYA 2HHPA 2XMMA 4ERDA 2MKKA 3OUYB 4E8UA 3N5BA 4OFZA 2YQ3A 4QZVB 2DR9A 3Q8PB 4DL6A 3MPVA 3VCDA 4YB7A 1ZM9A 1RT7B 3CIMA 1X4DA 2CQ1A 1GX6A 3H8YA 3H20A 3TO8A 4C8MA 3MD3A 5KFDA 2M52A 2C2RA 4C7QA 4QJVA 4BCAA 1RT1A 2RQ4A 4TNOA 3UI3A 5D3GA 1UA0A 2R7VA 4WU3A 3N6LA 4ZMMA 4K4WA 2DGXA 2Z2MA 1SIWB 2HMIB 1A9NB 1C4AA 2HGNA 5C24A 2XO7A 3M32A 4ES2A 1HYSB 3CCWA 3E51A 1IKWA 5KOWA 2ASDA 3DRPA 4KT0C 2NZ4A 1R0AB 1DARA 3I96A 3E01A 1M90T 2M5YA 4Q8EA 3CF5Q 2J8AA 4UW2A 3TUZC 1VQNS 4OHVA 4X4VA 4KQZA 4RX6A 3I0SB 3OW2R 1LWFB 2J9CA 4I1TA 2E5GA 4TU9A 2AGOA 1IBLF 3BQ2A 1HQEB 2HG4A 1AUDA 2VA2A 1BLUA 2DK2A 1U2RA 3C46A 3PKMA 3QIDA 3TRGA 4F4XA 2FJBB 1HNVA 3N6NA 4CO2A 3L7OA 4H4MB 3FDSA 4J9NA 1UVIA 2EG2A 1HI1A 2A2DA 3KLIB 4ZVHA 3FVYA 3DOLB 2HHVA 1HR0F 1N5QA 2GFFA 4F67A 4YDDB 4RUCA 2C3PA 3NBPA 4JI6F 5A0YB 3UDCA 1X9WA 2ZKTA 4RW7A 5IFMA 4DX8H 1X5TA 4I6WA 4PG6A 4G1QA 4DHVA 4Y2AA 4X65F 4Q0BA 2LA6A 3RAXA 2ZHBA 3CCQS 2LXUA 3MEEB 1LXJA 2AF6A 4O3SA 4TY9A 4RNMA 4N5SA 1RTHB 3GIMA 2Z4PA 1HPZB 3DFEA 3GYNA 4NA2A 4KV8B 5DJBA 4B08A 2MZQA 1R8CA 2FPHX 1OQ3A 5D4OA 5AJ3F 4FXDA 4NL5A 1VQ9S 2F9JA 2CQHA 2VL1A 2LQJA 2VG7B 3MEGB 2YKNB 4J9MA 3ZZTA 3H5UA 2W7PA 1QJHA 1H7WA 3HFKA 5AE1A 1TV6B 2VODA 1RTIB 2NUUG 3K5OA 2K3KA 1X4FA 5CYJA 1RQ0A 2ZC3A 3DXSX 3HVWA 3KKFA 4C97A 1S1UA 2DBBA 1YVFA 3EUNA 2HS4A 1FD8A 3ICLA 2BDPA 3KHLA 2BE2A 4FPRA 5HL7Q 4FS1A 2R7TA 2XULA 2CZVC 2IVFB 4LQ9A 2I0XA 4MMOA 4ZPAA 5LJ3Y 3T3FA 2PI5A 2MZTA 3DRRA 2GQ2A 4MK9A 5FIIA 2DISA 1BD6A 3MEDB 1E6VA 5F3ZA 3C2PA 1MNEA 3SCJE 1S0OA 1HWIA 2I38A 4MYUA 4ID5A 4W92B 4ED1A 3VR1A 2ZHOA 1FA0A 2ZFHA 2LCWA 2R2UA 3ZZPA 4RWXA 3PIPQ 2XMJA 2AYBA 1U1OA 2LU1A 5CZXA 3KLHB 2YWGA 3MTKA 2CJAA 2EWHA 2FVCA 2BANA 3AQOA 2KRBA 3PEJA 5A2QY 1XMOF 1M1KT 4HI2A 4MYTA 5KFAA 3VZHA 5F9LA 2FVRA 1YQHA 1S49A 4IQXA 2QZ8A 2E1AA 3NNAA 4Y28C 2CJQA 3AAWB 5I42A 3M05A 1TL3A 3AHPA 1HQUA 1KD1T 4TY8A 1X4EA 3LP1B 2KI2A 4QWBA 3PRDA 4EO6A 1WHWA 3M30B 3V6DA 3SMZA 2UU9F 2NUHA 2RQMA 1CQNA 2ZD1A 4MK8A 4ECTA 2AU0A 3THTA 4CTAA 2J5AA 3HKWA 5BJRA 2JEGA 5ITHA 4JV0A 1YRTA 2KVIA 2PA8D 3C6UB 3KG1A 4NLYA 3J7Z5 2GJIA 3SQGA 2FVPA 4YMEA 3G8SA 3MECA 2APOA 2ZNYA 5GAHU 2VOOA 1D8ZA 3CCMS 3I87A 3EGNA 4PUOB 1DAXA 3I82A 4PRFA 3BN7A 2DO4A 4M8LA 4OJ3A 3E8OA 2KKHA 2YNIA 3TNVA 2GIQA 2XBPA 2HLTA 1TL1A 2FHJD 2GV1A 2NS1B 1VQ7S 4FF4A 4OHYA 5KT4A 1NK9A 1K0VA 1U48A 4B9UA 1DRZA 3NMAA 2DR5A 2OPPB 5JXSA 1VQPS 4ES3A 3HDSA 4DL0C 2RU3A 4QU7A 5IQQA 4WK3A 2R7QA 2Q6BA 1JLBB 5AXMA 5DO2A 2CQGA 3KK3B 2F9DA 2W8KA 2C2DA 1P9QC 5L1KA 2N4DA 1Q8LA 2AJFE 1NJYA 4O44A 3G6ES 1LW2A 2MJNA 3KLGB 2W8LA 3MAQA 4PXDA 5B08A 5CZVA 4B9MA 5H9FJ 2P9EA 4EU0A 4U7CA 2ZNZA 3QAUA 4A48A 1DTTB 1H2VZ 1LFWA 2EFPA 4IG3B 2DNHA 3PR4A 1KLNA 2MZRA 4Y2CA 1XR7A 5DM6Q 4JI1F 2EI5A 2B51A 2MDAA 2IYGA 3NRBA 4P7TA 3CJKA 4B3RF 3HVTB 2DNNA 5J1PA 2RF2A 5L1IA 5AE3A 2CQ0A 1JLQA 4BS2A 4IOAQ 4NXNF 2V9KA 4KE5A 4ECYA 2PC6A 3R1LA 1K9MT 2WCXA 4FF3A 1N6QA 1S9EB 1HW9A 2QA4S 2OIHA 3N9UC 4O3RA 1KLMB 4K5SA 2KG1A 3I56S 1JXLA 1Z4UA 2B43A 2DGVA 2F8MA 1KR4A 2CQCA 3MOZA 2R4FA 1YJTA 3DU5A 3OXLA 1S6UA 1M5VC 4PXCA 2CQDA 5CHCB 3VTIA 5AXNA 2HHHF 3DRXA 2L9WA 1VRUB 3TAMA 2AYGA 3GIKA 3QGGA 5E3PA 2NR0A 1QLNA 3KTQA 2XMTA 3CJ2A 1SKWA 4N41A 3IAM9 5HO4A 2YKOA