2XB2D

Crystal structure of the core mago-y14-eif4aiii-barentsz-upf3b assembly shows how the ejc is bridged to the nmd machinery
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
89
structure length
89
Chain Sequence
PQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EUKARYOTIC INITIATION FACTOR 4A-III
publication title Insights Into the Recruitment of the Nmd Machinery from the Crystal Structure of a Core Ejc-Upf3B Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 89
sequence length 89
chains with identical sequence Z
ec nomenclature
pdb deposition date 2010-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xb2D00
2LECA 1L3KA 1VQ5S 4ZKAA 2YWKA 4Y0FA 4PR6A 2DGXA 2DNQA 4A8XA 4EGLA 1SJRA 4CH0S 3R27A 2OSQA 1VQNS 3G9CA 2ZJPQ 1M5KC 3VAJA 2N7CA 2N3LA 3JB9k 1QVGR 3CC4S 4YB1P 1NJIT 5DETA 2RVJA 2U1AA 2B0GA 1P27B 2MHNA 1X4BA 3CMAS 4TU8A 3CC7S 3OW2R 1YJWS 3SXLA 2CPYA 5DDPC 1HD1A 4WFNQ 5EN1A 2KM8B 2DIUA 1JJHA 2DHXA 4J5OA 1M5OC 1AUDA 2XS5A 1M5PC 1WHYA 1N52B 2OSRA 2ZJQQ 1FJCA 2K8GA 4LIRA 1X5OA 3MOJB 2BZ2A 2KFYA 4WF9Q 2D3OR 2RRAA 3LQVA 1WHXA 2DNPA 3RW7A 3BEGB 1FJEB 2YTCA 1VC5A 2FC8A 1K73T 1QVFR 2LCWA 4F25A 2CPZA 1FHTA 3UCGA 1DBDA 2KU7A 3G6ES 4V19X 2LKZA 1WI8A 1S79A 1G2EA 4ED5A 1W2BR 1OWXA 3CCQS 1M5VC 3S6EA 2MY8A 2PE8A 2NLWA 3US5A 2RQCA 3S8SA 1WG4A 2LEAA 1BY9A 2MKHA 3P3DA 4PKDB 3SDEB 3D2WA 2VOOA 3TP2A 1D9AA 2XNRA 3NS6A 2JRSA 2LEBA 3CCES 2DGWA 2KVIA 2UP1A 1URNA 3VAMA 3CCVS 2KH9A 1WWHA 1PO6A 2DNLA 1OO0B 1YTYA 4WCEQ 2DHAA 3UE2A 1VQPS 3G8SA 4IUFA 4OZ0A 2CJKA 2VODA 2OIHA 2O3DA 1H6KX 1YI2S 1OPIA 3CF5Q 2LYVA 1WF0A 2M88A 5ITHA 1S72S 2N3OA 2J0SD 2MZJA 3J7YU 3BO3A 1DRZA 1UW4A 2DNHA 1SJFA 5CYJA 2LXIA 2WBRA 4BS2A 5LJ3Y 1VBYA 4QU7A 1VQ9S 2M8HA 2MKJA 1A7GE 1UP1A 3SMZA 5BJRA 3VAGA 2ADCA 1X4CA 2XS2A 4C4WA 5DM6Q 1KOOA 2J8AA 2D9OA 2EVZA 1X4HA 1NO8A 2XB2D 2MXYA 3V4MA 2HYIB 1VQMS 5LJ5Y 3MUTP 1WI6A 2LA6A 1IQTA 2CPXA 2MZ1A 1X4EA 1ZH5A 1VC6A 2KN4A 2MYFA 3U1MA 2AYMA 5D78A 4C0OC 2G0CA 2E5IA 2HZCA 3NNCA 4CQ1A 3UD4P 2QEXS 4WFBQ 2ADBA 3TYTA 3UWTA 5GAEU 1WTBA 2AYBA 2DNMA 2U2FA 1X4AA 2X1AA 3SDEA 3BS9A 1U6FA 2F9DA 3H2VE 1FT8A 4IO9Q 1OIAA 1WF1A 1HD0A 2FY1A 2DK2A 5DM7Q 1Q86T 1U6BA 3G8TA 2MKSA 3CULA 4IOAQ 2AYEA 5IM0B 2SXLA 1YWXA 2CQDA 5CXTA 1U1MA 1WG5A 1RKJA 2M7SA 2DNOA 3U1LA 2QA4S 1ZZFA 3VAFA 2I2YA 3CCMS 2M52A 4QQBA 3G96A 2GO9A 2CQ2A 2FHOB 2DH9A 1FO1A 4M5DB 5DDRC 1KD1T 1X5SA 3R1HA 1F9FA 2V94A 1YIJS 2YKAA 3FEXB 2MMYA 5LXYA 1VQKS 3IWNC 5LXRA 1FNXH 2E5GA 4U67Q 3RW6A 1VC0A 2D9PA 1SJQA 1UAWA 2X1BA 1VBZA 2DB1A 5LSLA 4YUDA 1R8PA 1B7FA 1Q82T 2HGNA 1SXLA 1P1TA 2CPHA 2CQIA 2CPIA 2XSFA 2LQ5A 4LJMA 2DHGA 2PEHA 1QM9A 2DNRA 5GAGU 3Q2TC 3CPWR 2CPEA 3ZZYA 1YITS 2HGMA 3G4SS 2AYGA 3UCZP 3MDFA 3NNHA 2DO4A 5CA5A 4C7QA 1WEYA 2DNYA 2RT3A 4UY8T 2X1FA 3MXHP 4YOEA 2F9JA 2DH7A 1VQLS 3DLLQ 3NS5A 2MSTA 3MD3A 2BOPA 2MSSA 2MQPA 1PGZA 2KHCA 2F3JA 3I55S 4UQTA 2CQGA 1FJ7A 3L3CA 3ULHA 2DNNA 1KC8T 3N9UC 2OTJS 1HA1A 2CPFA 2YH0A 1YJ9S 3EGNA 2MZRA 3HHNB 3B4MA 1Q81T 2MB0B 1X4GA 3NMRA 2KXFA 1R8HA 2G4BA 5GMKa 3THTA 3P6YC 1WF2A 2DGUA 2MY7A 3I56S 2E44A 2ERRA 3MI7X 2CQ1A 2LMIA 3CCUS 1Q7YT 4LMZA 2RNEA 1WELA 2M8DB 2DNGA 1D8ZA 2M4MA 2KXNB 1FXLA 2DGQA 1VQ4S 3TO8A 5HL7Q 2M2BA 3CCJS 2RUGA 2DISA 3G71S 2E5JA 4CH1A 3P5TL 4TU9A 1K8AT 2N82B 3VALA 1X5TA 2MJNA 2FPHX 2MPUA 2FC9A 3CMES 2J0QD 3CXCR 2G1DA 1H2UX 1U2FA 2L41A 3EX7B 3S7RA 2LA4A 3PIPQ 2LXUA 4IOCQ 2MGZB 2HGLA 1WHVA 2DGTA 3NNAA 2DNKA 4F02A 2VOPA 1DZ5A 2CPDA 1U1NA 2K3KA 1WHWA 2MQNA 1U1PA 1DHMA 2KT5A 3FEYB 1U1RA 3LPYA 2EK6A 1X5PA 3CCRS 4Y00A 2MKCA 1RK8A 2RRBA 3DXBA 1M1KT 2DH8A 2X1GA 3MUVP 1U1KA 2KXHA 2CPJA 3CCLS 1K9MT 4ERDA 1YJNS 1WEZA 4FXVA 2J76E 2CQ0A 2CQ3A 5DDOC 2MJUA 3CD6S 2MQLA 5IQQA 4CIOA 3CC2S 1H2TZ 3EGZA 2MZSA 5JVGQ 3UD3P 1X4DA 3HI9A 2MKKA 2XS7A 2RS8A 2RU3A 3BO2A 1JJ4A 4QPTA 1U1OA 2Q79A 2DIVA 2JX2A 2KM8C 1UFWA 1XN9A 2JWNA 5JVHQ 3S01A 1O0PA 3IRWP 3MURP 2DGOA 2KI2A 2MKIA 1CVJA 2DGVA 3B4DA 2AD9A 3H2UB 1N54B 3VF0B 1KQSR 4PRFA 5HO4A 1WEXA 2I38A 3ZZZA 2MGZA 1WG1A 2DHSA 1U1LA 3J7ZT 3K0JA 2GHPA 4P6QA 5H1SV 2DNZA 2CQPA 1YHQS 2NZ4A 4TLQA 2RS2A 2CQ4A 5IM0A 2MZTA 5GAHU 2CQBA 2M0GB 4WIIA 1N88A 2RQ4A 2DO0A 5DDQC 3CUNA 2OJ3A 3CCSS 5MLCV 2KRRA 2DITA 3Q2SC 2XNQA 2ZJRQ 3MD1A 3VAHA 1VQOS 1JJ2R 4RU2A 4OZ1A 1A9NB 2KRBA 1KOHA 1N8RT 2JVRA 1ZZNA 2VONA 1VQ6S 2MQQA 4TU7A 2CQCA 1U1QA 1VQ8S 2KYXA 2M9KA 2HVZA 2L08A 1VBXA 2JVOA 2MQOA 2EK1A 4WFAQ 2CQHA 1M90T 1X4FA 2MZQA 3VAIA 1NU4A 1HL6A 5D77A 1SJ4P 2KG1A 3VAKA 3PIOQ 1JMTA 3R1LA 2OTLS 2M70A 5GVQA 4F26A 3THPA 5LSOA 2L9WA 4Z2XA 2DGSA 3P49B 1SJ3P 4WKRA 1VQ7S 3UCUP 3CTRA 1X0FA 2MQMA 4W90B 1H2VZ 3MUMP 2YH1A 4FXWA 5FJ4A 4QU6A 2QFJA 3BO4A 5IFMA 2A3JA 2E5HA 5GADU 2KG0A 4W92B
chains in the Genus database with same CATH superfamily
3OQ2A 1BGXT 2VZ9A 4BHQA 3NGRA 5E0OA 2UXDJ 4HHJA 3OLBA 3TAMA 4LBHA 4LREA 3G9CA 2HHXA 3BH7B 4FF3A 4B9LA 3BPDA 1TP7A 3BB5A 2V4RA 1IBCB 1NM2A 4PWUA 1UZDA 1XK8A 4J9SA 2CRLA 2AJ2A 2O1PA 3DLGB 1XBWA 2HRYA 5KT6A 1N52B 5GMEA 1L5UA 1HNXJ 3DRRB 3ZTPA 1KLMB 3H25A 4CZCA 1X8DA 1RTHA 2YTCA 2NUHA 1VC5A 4WZMA 1RT7B 3LWLA 1HNZJ 4H4OB 2K1RB 2OHDA 3LH2S 2NLWA 2FJEB 1A0OB 4GC6A 2GIRA 3PV8A 2MKHA 3ILOA 3G87A 3IBCB 1TVRB 3W7BA 1D9AA 3FNNA 2LEBA 3OL8A 4WYLA 2C3OA 3PYGA 1FRXA 2F40A 2HQ3A 3G8SA 3IS9B 1LEOA 1HR0F 3JAMY 3CF5Q 4GKKJ 5BXIA 2XZWA 3KMSA 2HRTA 4DSKA 1DRZA 3DRRA 1KLMA 3M9MB 4DUTA 1R43A 1RTZA 1NJWA 3NGKA 2J0WA 4ZMMA 2AYMA 1R31A 2HZCA 4RUBA 4CQ1A 1U24A 5AXKA 3RRGA 1SPBP 1UVLA 1ZOTA 4LIWA 2A2CA 2P8IA 1IBLJ 4JV1A 3NG8A 1HKAA 1NJYA 3IS9A 4QWEA 1Y0HA 2V34A 2R4FA 3PR5B 3ITHB 5LXRA 1PC5A 4TQSA 1TR0A 1PG5B 3KUGA 4X4OA 2X1BA 3IGVA 5A6PA 1XIQA 2XSFA 1H74A 2LQ5A 2Y1JA 2Y0SD 2DNRA 2UU9J 2G9OA 5D0HA 4HI1A 3PJ9A 2KJVA 3QIDA 4M5MA 5E3QA 1IBKJ 2JJ4D 2KTQA 4ZCLA 5CZXA 1S1VA 2ZDPA 5GAGI 2Q6CA 4F4XA 1KC8T 4RUHA 4DQPA 3DDNA 3AOAA 2E7VA 4PQUA 3I6PA 1VRQC 3NGTA 4RO0A 2BV3A 3ITHA 1N6QB 4EZ9A 3LANA 3KKFA 4UUWA 3MM5B 2C28A 4X66F 1L3TA 1IVZA 3CIZA 2CA9A 5KG0A 2EBEA 4DR4J 4WPAA 4DQIA 2R7VA 2OEMA 2FB0A 1G3OA 3CD7A 3VALA 3RAXA 1M0SA 3I9V9 3WZ0A 3MMBB 4DR7J 4M5KA 1DY3A 1GT8A 2DR6A 5D4NA 2QSWA 4A8MP 2H1YA 2FD2A 2Z4PA 1FEHA 4ECQA 2X1GA 3U7JA 3GV5B 3F44A 3KYLA 3T19A 4LSZB 4ZVRB 2CQ3A 1SKRA 3AJDA 3JQJA 2BKPA 1H2TZ 1U6ZA 2GQCA 1RUSA 4KGVB 1RTIB 2RU3A 2DCUB 4CO0A 1VISA 2ZVSA 1XN9A 3MCMA 2QIFA 3S01A 1O0PA 5H9EK 4PG7A 4WXOA 2RU9A 2JHEA 5ETMA 2QMWA 4CP5A 4DV3F 2B7CB 7FD1A 1FJGJ 2VG5B 1FDDA 1QSSA 1VIXA 1DFDA 1VMBA 4F0HA 3PKYA 1NB2A 3N6NA 2OJ3A 3JTNA 5A2QU 2ILZA 3AQOA 2ZH8A 4JI7F 4J9OA 2F4FA 2MQQA 5J2PB 4J9QA 1VQ8S 2F4VJ 2IBOA 5K8OA 2MQOA 3GYNA 3GFYA 1RTIA 2MZQA 4NZ6A 3MHYA 2KG1A 2ASDA 6FD1A 3OTBA 2ZBIA 2ZD1B 1UPPA 3IRXB 3MR5A 5FJ4A 2E1AA 4NLSA 2E1MC 3HSZA 2J6TA 5D4LA 1JLGB 4DV4F 1HHTP 2B8PA 4DR5J 4FYVB 4CI0B 3QWUA 4OV1A 4TVAB 3D9BA 3ZC4A 1MWZA 4ZPCA 1SC3B 2BKNA 1S0VA 4P72A 2VKRA 4OIXA 4URQU 3UN2A 4RKUC 2Q66A 1T05A 2X3GA 1KN6A 5J2PA 2F63A 4J9LA 2FVCA 4NLUA 2EEYA 1GEHA 1N5VA 3R5DA 1YVFA 2XCPA 5KG3A 3T41A 3D66A 2Y8WA 3HT3A 4F25A 4A8QA 2ZD1A 3PM9A 1OY6A 1S1XB 1DLOB 3IRXA 3RBDA 3DOMB 2CIMA 3HMJG 1GNKA 2JFKA 4CLZA 1DURA 4U7UK 1RWVB 2ROEA 2R7SA 2UP1A 2P9CA 3EXCX 3CDUA 4YY3J 1OJ4A 2VFSA 2FHJA 1VQPS 4IUFA 4OZ0A 1DQ8A 4X4TA 1YI2S 2R3VA 3WX4A 3KLIB 4NLQA 3J7YU 4DLEA 1B99A 2W7PA 1NK0A 4JI8J 1GTEA 3KLHA 2EKYA 3AB2B 1QTMA 2OAUA 5D4OA 5DM6Q 1F9HA 3AB4B 1KDNA 3JSRA 3KTQA 1TTHB 4N8OA 3ILIA 1S1XA 3SV3A 4HLBA 1DLOA 1WI6A 4WXWA 2C3YA 1VC6A 3BM7A 2G0CA 3D67A 4KT0C 1DTTA 4DR6F 3FBCA 3HD1A 1U02A 1NKEA 5L1LA 2JEJA 2JOQA 2XHCA 1RHMB 1UWBB 2AYEA 2DNOA 5EX3A 3K2YA 5D3GB 4QQBA 1ZAVA 1QAJA 2CJBA 2C22A 1X5SA 3POTA 4CO1A 2E5GA 1N5YB 2VFVA 4B3RF 1ZAWA 1LFPA 5BR8J 2H4YB 3L95X 3QJLA 3MM9B 4CT8A 2EFGA 1WC4A 3Q8UA 1LWCB 1XMOJ 2HSEB 5M2RA 4IFYB 4ZPWR 1QJHA 2VBZA 2JZ5A 3LP1B 2UV8A 4OHWA 2BRKA 3Q83A 3OV7A 3HVAA 3MCNA 3UCZP 1SKSA 2BVZA 4DV7J 4YFUA 2DNYA 4UY8T 4LF4F 2C1EB 1VQLS 3HPOA 3QIPA 1XWLA 1G6BA 1HI8A 2MSSA 1JLEA 3GP9A 3QGPA 4B3MF 4D3GA 4PWDB 2AJ1A 2ILYA 1TQLA 1H3DA 2WVEA 4ZN1A 5L1JA 4QZVB 1ELOA 2YY3A 4ATNA 3UI3A 1G7CB 4ZA1A 3MAAB 1C0TA 2XLKA 1Q7YT 4LMZA 2QLBB 2G1HA 3HT0A 5THWA 2EBGA 3PW7A 4RW7B 3HKWA 3MPVA 1LWCA 2VG6B 3DGVA 1X9WA 4U8VA 2R8HA 3LP1A 4E8UA 2MPUA 4KRWA 3A8KA 4ZIVA 1U2FA 1LWFB 3QRRA 4GO5X 5KFWA 1IJEB 2N4CA 2CPDA 2V2VA 4LFBJ 3BR8A 4J7CA 2KT5A 3OFGA 3BSOA 1HNIA 1S6QB 3DXBA 5F8JA 4PWDA 2YWWA 2XMWA 4FXVA 3EM1A 2MQLA 3PYFA 3PW5A 3OTDA 2MZSA 2A18A 3LO3A 3UD3P 5K14B 2MKKA 3H8YA 2HWHA 1JJ4A 1MWYA 5DJBA 4RW7A 4D3HA 4B3SJ 2W4DA 1NJXA 2LQ8A 3KJVB 2HK2A 2RQKA 1MSWD 1N54B 4O44B 5HO4A 1PC4A 2I5JB 3I82A 1OQ3A 3T1YJ 3J7ZT 4OX9F 1Q1KA 4C0BA 2NYIA 1RDRA 3M32B 1S6QA 1N0UA 3M2RB 4OI0A 2KFNA 5MAOA 2DBBA 4RLEA 1RAIB 1VQ6S 1RLCL 2XGQA 2JVOA 1OY9A 3QSIA 2BQRA 4OZ3A 4DWIA 1S9FA 2PN6A 2KHDA 1EKRA 3H5UA 1ZS6A 3EXYA 2B4VA 1KWMA 4P75A 4DX8H 4NWBA 4RBTA 4O44A 5G0RA 2PI5A 4URGA 3BO4A 2D3UA 1Q79A 3OHBA 1DQAA 3G6YA 1RWUA 3TUPA 4DR3F 5ETKA 2OSQA 2IVYA 3C16B 2IDEA 4R25A 1SVDA 3HVRA 1VQYA 4OLOA 1SL0A 2YQ1A 5E3RA 4DN0A 4IOBA 3LGMA 1VI7A 4DLGA 1IWGA 1FE0A 1RBAA 1OY8A 1K44A 4AE5A 3C15B 3PRVA 1S9GB 3CCWA 4OZLA 1SL2A 3RW7A 1KBRA 2L3MA 4FVCA 1FHTA 4HACB 4R8UA 1IKXB 4XPCA 1OWXA 2JC0A 3R7NB 4FZVA 2I6WA 3FK4A 3MMAB 1RT1A 3H5XA 3P3DA 2VOOA 4P7VA 3KLEB 3C16A 3NOCA 2HG4A 4NA2A 4KAIA 2B9EA 2NS1B 4MT1A 4WP9A 2ZH6A 2DNLA 4WCEQ 2VODA 3J7AN 4JUZA 2L9NA 2YBVA 1X7VA 4ALZA 2XEXA 2DNHA 2ZZTA 1JLQB 5LJ3Y 3C15A 4OZNA 1MLAA 1S9GA 2J8AA 2EVZA 4OYIA 3QT7A 4DPXA 2ZH9A 4HACA 4NXMJ 3MUTP 1IKXA 3IP0A 2R7WA 1X4EA 5I42A 5IQ6A 2FY8A 4ED4A 3PW4A 4JBCA 5SUHA 5GAEU 3MMAA 4L72B 2ZH1A 1JX4A 3KLEA 1HR0J 4LF8F 4C8YA 3TEGA 3MR2A 3ZZUA 2AV5A 2FVRA 4ZP6A 4FYWB 5G4DA 4WBFA 4USKA 1HQEA 5K8NA 1RKJA 5HBMA 4DS4A 1CJTB 3VAFA 1Q8KA 2CQ2A 1D0EA 3ETMA 1ZM9A 1RT6A 4KY3A 1JLQA 4RW9B 3CJ4A 3CCTA 2JL9A 2IMWP 3ZTQA 3TI0A 9RUBA 2D7SA 1B7FA 1P1TA 4PG5A 1C1CA 5D15A 3V2UC 2CPEA 4CWBA 2HGMA 1Y7PA 2IJNA 4C8ZA 1X60A 1NDLA 1TZ0A 3M30A 3KOAA 3P5BP 3LGHA 1YRUA 3TW0A 1FNMA 2YKMB 3T1HF 4W98A 3UVJB 5JUMA 4NLOA 2CVIA 3VHQA 2HQCA 3C2PA 3GJQB 2EFVA 3G82B 3CCUS 2WTFA 4WFZA 2V8VA 3RB6A 3H7HB 1D8ZA 4DU8A 2KXNB 5DG7A 1VQ4S 5HL7Q 1WKKA 4OYXA 3QGHA 3PX0A 1DTQB 2OD6A 1FWKA 1PYTA 1WHVA 1JXVA 2KB2A 3Q86A 1SKUB 1XNRF 3DNCA 4YB6A 2CYYA 1P9YA 2IVFB 5KG1A 4BDPA 4X66J 3P96A 4MMOA 2VFTA 1TL1B 2B3TB 3PJWA 3BBFA 1JIHA 4C6AA 1D9FA 2UVVA 1CJKB 3MOZA 3G82A 2VIHA 2WK4A 1GH8A 3K58A 2LDYA 3GYXB 3KK3B 4K4XA 1UFWA 4K4YA 1CVJA 2YWFA 1HWLA 1DTQA 2C42A 4P71A 4ZVOB 3EGVA 1YJ7A 2XMAA 3K0JA 3JTPA 4C3MA 5KFDA 2NZ4A 4KV8A 5IM0A 4UW2A 2I1RA 3Q8VA 2M0GB 1S49A 2DRDA 3NL0A 2P5VA 4B9TA 5MLCV 2Y1IA 2XNQA 4K4WA 1NB7A 3CWJA 2YWEA 1TL1A 1MROB 1AA1B 1A6LA 1RWWB 1RT4B 1CJKA 2AZ3A 3GJTB 1R27B 2FLNA 2AEFA 3RB4A 2R9LA 4YHHF 4JYAJ 5CAAA 3KK3A 2IM3A 2HRUA 4XDCA 1RT3B 3THPA 1BQNA 1KSPA 3CTRA 1KQGB 1RGVA 4DQQA 4ED0A 2KZMA 2QFJA 1W25A 5DZ7A 2VFUA 4XO0A 3OUYB 4UOHA 4ZKAA 2NXNA 4JI7J 4DV2J 1TK0A 2FQQB 2HNZB 3HJVA 4DSJA 1N5TA 5L9XA 3IAS9 5EUHA 2CDRB 3DHXA 3W2WA 2BX6A 1DAXA 4K4TA 1MROA 5EWFA 3ENVA 5CZVA 1NK5A 1M5OC 1RT4A 4A46A 5EHHA 1WHYA 4DOZA 4JI4F 1O5JA 1RT3A 3BEGB 4DV4J 4FNIA 3TA1A 4I67A 5K20B 3R6GB 1NBEB 4DI6A 3Q23A 3GIJA 5CYQB 4KBIA 4Y2IA 2MY8A 3OUYA 3HO1A 3AH6A 1S1WB 4QIFA 3UDLA 2EKNA 2OI2A 2A6OA 4WE1A 4LR7A 3OL9A 1T3NA 2HNZA 3LF0A 3PCOB 3I96A 3IR6B 2H4WB 1WWHA 1PO6A 4DDFA 2QMUB 1TK5A 4RWXA 4IYQA 3I87A 3QLHB 4NEZA 1S72S 2J0SD 3WDOA 4EU0A 5A8RA 2D9OA 3KG1A 5LMNJ 3DOLA 2MXYA 3OXLA 5CYQA 3BJYA 4HTJA 5KFNA 1PBUA 5D78A 2A2DA 3M4XA 1S1WA 1PJ5A 4USHA 4EO6A 4F4AA 3W8PA 4IO9Q 1EQ0A 2ZE2A 4FKXA 1H7XA 2VICA 3KLFA 5HJXA 4JV5F 5DM7Q 1S0OA 3O1LA 4RZRA 4TYBA 3CJ2A 3UN5A 2MKSA 2XBPA 1RU1A 4Q8FA 3SQOP 3K57A 1J5EF 5BYQA 3QLHA 4X4NA 4IDKB 3PO4A 2E66A 2WRMA 3C19A 2YKAA 1QE1B 4ITSA 4LFCF 3IWNC 4WK1A 1FNXH 3SCLE 3BBCA 2WAQD 4OHVA 2DB1A 4YUDA 1R8PA 1ZM4A 4EUVA 1Y4ZB 3CDBA 1GAOA 3X1LB 4R0JA 2IFXA 1REGX 4X4QA 3N5FA 2FJDB 1Q16B 4C3LA 2HLTA 3CE8A 2XY6A 2VL1A 2YNHB 4NLVA 3BGRB 3HZEA 1LWEB 4NLRA 1EX8A 1KR4A 4DXLA 5F8GA 3T5LA 2G13A 3ICLA 2E1CA 3FVYA 4B3RJ 2OLWA 1T11A 4IDKA 3A3NB 3EVWA 2M5YA 1N0VC 2XTJP 2A1BA 3THVA 2QA2A 5F3TA 2J9DA 3HSDA 3B54A 1SIWB 5ETQA 2DRAA 3VQTA 1UEKA 3CJTA 1UETA 2R8IA 4CO3A 2ASLA 2GZOA 4QIWD 3L7PA 4LF4J 3BYRA 3TAPA 3G71S 2DTJA 3QWPA 2FTRA 4NRUA 2L41A 4B3MJ 2YNHA 2Z2ZA 1VR6A 1LWEA 3GYGA 1FWPA 4AD6A 4LF5F 3FEYB 5L1KA 4HDGA 3CCLS 3M8PA 5KFVA 2YKQA 2JEFA 5JVGQ 3RBEA 3HHKA 4M94A 4H54A 2FVPA 2Q79A 3MCOA 2YX4A 2XG8A 3FBEA 2DGOA 4Y65A 2AD9A 3OHAA 1SI9A 1IR0A 4JI0F 2RDJA 3HHLC 1HQ2A 4B9NA 2DO0A 5HN0A 3IWXA 4LR9A 3Q2SC 3W2VB 3AXKA 2O66A 2VDIA 4RU2A 1IXKA 2H5IB 2VONA 3ONQA 2CZ9A 1U1QA 1PYOB 1OS5A 2UXBF 3H42A 3GLJA 4Z7CA 1JK9B 3DRPB 3W9JA 5D77A 4QIVA 5LOQA 4HHUA 2Y9HA 4ZP7A 4RNNA 2DR5A 3GE9A 4OX9J 1FKOA 2F8HA 2GHWA 4C48A 3MM7B 1WOOA 3QBCA 1V6HA 2W8LA 2BJ9A 1SC1B 2C2RA 2UUAF 3GG1A 4MKYA 2YWKA 3EDQB 4DR2J 2NXCA 4QWAA 4XPEA 2MHEA 4OZJA 2BDPA 2WONB 1M5KC 4K59A 1X4BA 1VHFA 2GQ2A 3W2VA 3I9ZA 4QWBA 3GONA 5FDLA 1BQMB 3C8YA 3HD2A 3DRPA 3RG6A 4WF9Q 3RTVA 1P8GA 5A2QY 3AFGA 1FJEB 2YNGB 1CULB 2CPZA 3MM7A 1KVJA 1RP5A 2X51A 4JI3F 4I2QA 1FK9B 5LSRA 2HHHF 5KG7A 4ES2A 4M1KA 3NKYA 2YKOA 2HHQA 4PXEA 2WONA 4ANDA 2CUYA 3MMJA 3C46A 3UD5A 2AEMA 1URNA 3CCVS 3RAQA 2GAHC 1GK8A 2AMCB 4WZQA 4RR5A 3I5CA 2I0XA 2C2ZB 2HKEA 3BO3A 4OHYA 4BS2A 5CYJA 4ER8A 1A7GE 1L3UA 4NXNF 1X4HA 2YNGA 1CULA 1YSJA 3E8OA 3NCRA 1DQ9A 1ZPWX 2HQDA 4Q0BA 1CLFA 2DCLA 2A6MA 3TYTA 1Q5VA 2BA9A 4CO2A 4X4RA 1T7PA 4DV6F 2XMTA 5GMDA 2AGPA 1ZAXA 2DK2A 3KUHA 5D0RA 2W9BB 1RTJA 2BJ3A 4DV0F 4IOAQ 4C11A 2HMIA 4C8OA 4G6VB 2W2QP 2ZBCA 1RBLA 4ZJQA 2V4QA 5DDRC 2V50A 4F0KA 5CCLA 5L1IA 1HBNB 1QDUB 4KGMA 1Q78A 4Q2MA 2VBYA 4FS2A 4EEYA 4F4WA 3GU0A 3R2DJ 1LWXA 4DSEA 5LMUJ 4AFFA 2CQIA 1UL3A 4OFZA 3D5MA 4FN5A 3IA0A 1QM9A 3NWGA 4B9UA 1X0PA 3R2CJ 2VF3A 3HXMA 4K4VA 4YN3B 2RF2B 2WVFA 4C98A 2RT3A 1FVQA 4RW4B 3MEKA 2NSCA 3T3FA 2W9BA 2MLXA 2VH7A 4Z7YA 2BOPA 3R5AA 3L7UA 4PAAA 4X84A 2D3O1 2CPFA 4B9MA 2MZRA 2RE1A 1HBNA 1QAIA 5HVHA 2MB0B 1R8HA 1U0HB 2J7WA 1WDTA 2E44A 1WELA 3ISND 2M8DB 3IFEA 3BKTA 4GVLA 3IAM9 5KT7A 4OL8A 2PIIA 5EGYA 3I0RB 1UMJA 2FHKA 1TL7B 2Y8YA 2DD8S 4PUOA 3CXCR 3VZIA 2RF2A 1NDCA 3W5XA 2BR0A 4ZPBA 2YX7A 2HBRB 3OLAA 3L7OA 4OYOA 2ZFHA 2KKHA 1HNZF 2VFRA 4RW6B 5K8MA 1X5PA 1RK8A 3A3PB 4DUYF 1NSPA 2BXJA 3MUVP 3PRBA 1U1KA 4YDDB 4KHMA 3NY0A 5HSPA 1NLKL 2CQ0A 3NEKA 1U0HA 4CIOA 2IVMA 2D41A 4IQXA 2RUSA 1AYEA 2PO4A 4CNYA 2KVQE 4QPTA 4Y3CA 3I0RA 3DGPB 4LUBA 4H4MA 4CCHA 3IRWP 1TL7A 1IKVB 4MIBA 1XNRJ 3BGFA 4DFMA 4PRFA 1RA7A 4TQRA 1S10A 1TUWA 2B5JA 3A8JA 4L76A 5GAHU 4USJC 2CZVC 2MEWA 4RW6A 2XMVA 3QNWB 2BE2B 3VVTA 3EDRB 4HT7A 4M5DA 3M8WA 4F67A 3NBPA 1Q4RA 5DG8A 1RAJA 3PHTA 4ECYA 4FBTA 1RZMA 1KP6A 1TAQA 3GQCA 4J9VA 3HHDA 4GVBB 4LBPA 1IBLF 3VV2B 3TRGA 2HEKA 3DGPA 2GW8A 4YR2A 1IKVA 4I69A 3KHLA 2NQPA 2C2NA 4BBYA 2RJZA 3E01B 1VQSA 2RQMA 5GADU 3DRXA 4HKQA 4Y0FA 2Z2MA 4QIGA 4DHVA 4N5SA 2DGXA 4A8XA 4TNOA 4RU9A 3AOCA 4F50A 2CG4A 1TL3B 1I51B 1QSLA 4ZVQB 1KQFB 1NJIT 5IC6B 2J9CA 2MHNA 3CMAS 5KFLA 2UU9F 4NLGA 3NAIA 5DQGA 2G2OA 2YNFA 4YHHJ 1HD1A 2F8EX 4ED2A 4UOCA 3TQEA 1IN0A 5EDWA 1U47A 1AUDA 2XS5A 3KNAA 4GVBA 1JLBB 3MOJB 5AE1A 1T9UA 1TU0B 4CLWA 2ZKUA 1F2HA 3G6ES 4V19X 3MR6A 3QRQA 4ZP8A 4RNHA 2K2PA 4RJVA 3EGWB 2JSXA 2RQCA 4MTPA 1S57A 5F8IA 1MWQA 4YEAA 4DR4F 1TL3A 5FD1A 3VAMA 4JI6F 2VC0A 5HQ8A 1J2VA 4JI4J 2WB4A 3AD9C 3OSNA 2XYHB 2CJXB 3AJ1A 4DR7F 2EXUA 4PG8A 2ABYA 1SJFA 3WIUA 4FKYA 1KOOA 1GMVA 3PG9A 2HYIB 3ETOA 2QL7B 4Q43A 1IQTA 3EYZA 2MZ1A 5SZTA 4ELVA 4OZ2A 1HBOA 1WTBA 2U2FA 1B4SA 4YS2A 1WKLA 3UDEA 3O3LA 1PAEX 1M5SA 1UEUA 1P6TA 2VPXB 3W65A 4MK9A 1ZBTA 2Q6BA 5C25A 3CCMS 1FJGF 1JKHA 4Y28C 3R1HA 2G0IA 4X2BA 4DL5A 3HP6A 3GTYX 3EMTA 3KUEA 3R6LB 1LXJA 1JLCA 1V3ZA 3M6WA 4WU3A 2J7KA 1WSVA 4UT4A 3B8HA 3IWLA 2VC1A 3CPWR 2CJQA 3Q8QB 4P10A 2HW3A 4DL6A 2X1FA 1J5EJ 3DLLQ 3NS5A 2NXUA 4IQMA 4LFCJ 1F2GA 1WD6A 5L46A 3QMQA 1Q8IA 1NXIA 1S76D 4MYTA 2Y1RI 4IH7A 2ZBQA 4TYAA 1SC4B 3MMCA 3QRPA 2ERRA 3MI7X 1SBRA 5B09A 4PXCA 3GCWP 3TEHB 2M2BA 1FFWB 1DARA 2HS0A 4FPRA 4DS5A 2V0NA 1R6YA 4P73A 4J90A 1RE1B 4NYPA 4UF4A 1U1RA 1CSJA 4KC5A 4ZVSB 4NLXA 3KG0A 3WX8A 3SCIE 2KXHA 5I3UB 3TA0A 3SV4A 3FDSA 1Q7LB 1VDHA 2MQ8A 1D3WA 1FNOA 4I2PB 5JJBA 3MPYA 4B3TJ 2CWKA 3PW2A 3DFEA 1SUQB 2C3MA 4NX9A 2Z8QA 3PFEA 2VV5A 1ITPA 2HNYB 2KI2A 2DGVA 4L74A 2EG1A 4K2JA 4JI8F 5A8KB 4MH8A 1W7WA 2R8GA 3N4WA 3PEJA 2ASJA 3VWSA 2Z2YB 2UVRA 3A1YG 5JXSA 3HJFA 1YLXA 3T9ZA 4F8RA 2KRRA 4L3KA 3ILLA 5KT5A 2B9WA 2ZJRQ 4NMLA 4OI2A 4M5IA 1RWKB 1V5IB 1U8WA 4I2PA 1FVSA 3IG1A 4JB8B 3W60A 5AJ3F 1J5OB 1SUQA 2AIRB 3ET6B 4FYXB 2EFNA 4XIUA 3EPIA 4JI0J 5C24A 4EYIB 1RAFB 3ZNJ1 2LEPA 2VG7B 3BR9A 2HFOA 4MK8A 5A8KA 2ALYB 2E5HA 2PFDA 3C14B 3QO9A 4K0KF 2RH3A 4N7TA 3TNVA 2DNQA 3GB0A 4ZK7M 1BE4A 1RA6A 4V19J 2BRLA 2AJ4A 2N3LA 2UXBJ 5E7OB 1S1UA 4TU8A 3CCZA 3QFWA 1FX4A 3GILA 2EFPA 2ZNYA 3E3XA 4RW8B 5H9FK 3QSYB 4DV7F 1ZM2A 2DHXA 4ZLJA 5KFUA 3KJNB 2Q3PA 1M5PC 1J5OA 3TANA 3T5KA 2MLYA 3W8GA 2KFYA 4ANCA 5KFRA 2UUAJ 2GJIA 4DSIA 1QVFR 3Q8PB 3K8WA 2VG7A 2ZUAA 3WIVA 1NSKL 1KVIA 3JYTB 4KQZA 3CCQS 6FDRA 3S6EA 3C14A 2DR9A 3S8SA 2QA1A 3D2WA 2AEJA 4L73A 4JI2F 1NPKA 2XNRA 2NCKL 2HS4A 5KG6A 4DZDA 1YBTA 2V9KA 3AHPA 2E7XA 2KH9A 3VGVA 1YJVA 4ILLA 3FCHA 1OO0B 1BHNA 2DHAA 3OTOJ 1NK6A 2HNDB 4O23A 1S97A 2LYVA 1WF0A 4AQYJ 1QLNA 2PMZD 3J80U 2B4UA 3V5RA 4JI3J 4O3NA 2XS2A 2C2OB 2KT3A 3QATA 3DLKB 1KFDA 4LF6F 2KN4A 2DEIA 3UWTA 1UWAA 1RWNB 3BSNA 4HEA9 4B3SF 4NZ0A 4TLRA 1Q86T 3JXOA 1U6BA 3CULA 1YK9A 1FXRA 2NREA 4P9SA 4NLPA 1YWXA 2FJVA 1U1MA 5GAEI 4OI6A 4RBUA 3U1LA 5KAKA 5BYRA 3LOUA 1TL4A 3QFHA 1ZTTA 2VPWB 3OVSA 1F9FA 3W9IA 3DLKA 4M5NA 2YKNB 1VBZA 4EFAC 3V6JA 4DV6J 4R5PB 3KXDA 3R3TA 1JNZB 2PC6A 4DV5J 1R3NA 2W2NP 2WZ1A 3FQLA 4UOFA 3Q2TC 1KQKA 5IT9U 3BREA 2GIQA 4JP8A 4N56A 1FRLA 3A12A 3OR2B 3MXHP 1HYSA 1QAYA 3BSAA 3D1OA 2OMOA 4F0MA 3SIPB 2KHCA 4M5HA 3UN3A 2F3JA 1CEZA 4UQTA 2RDDA 2OTJS 5T14A 1S0NA 5KT4A 1Q81T 1X4GA 3W66A 5DLGA 3BZQA 4ZVHA 2V2KA 5KFQA 1HBUB 3CJRA 3U02A 1FXLA 2DGQA 4USVA 3M05A 3DKDA 1N4LA 5KT3A 1MMDA 2CADA 3RR8A 4NL5A 2FC9A 5HMYA 1ULRA 5F41A 2GS8A 5HROB 3P8BB 3OL6A 2COLA 5T41A 4CNZA 2K3KA 1WHWA 2NUUG 7AT1B 3LPYA 3PDNA 3KHGA 2MKCA 2ZITA 2UVWA 1U26A 2Z0GA 4IRDA 3H98A 3HX9A 1VK8A 4Y2CA 3FZBA 3CC2S 3DRSB 5B0DA 1HBUA 4HH0A 3T9NA 1IQZA 1HPZB 4ZP9A 4NA3A 3VGUA 1VRTB 2FLLA 3DOKB 4CO5A 6AT1B 2V67A 5HROA 4ZS6A 4W4MA 4DUYJ 1SL1A 3LW5C 3F41A 2NR0A 4G65A 1SB6A 1TL5A 2HPUA 2MZTA 4NXMF 2RQ4A 1BD6A 3MPDA 3AY0A 1R0AA 1FCAA 3MEGB 5A76A 3BV8A 3Q8SB 2QE5A 3K5OA 4ZCMA 1RAAB 3DRSA 4N47A 1D9DA 3R97A 1I3OB 5EWGA 2EK1A 4WFAQ 2OPSB 2HVEA 1M90T 2KFZA 1HPZA 2OKQA 1JMTA 1OSDA 1TUGB 5HP1A 2G0JA 5C2CA 1SJ3P 3UCUP 4P2FA 1VRTA 2MQMA 3OVBA 3DOKA 5M2PA 2CJ9A 3UO0A 4W92B 1XEZA 4FYDA 3CC4S 4EWTA 3QT6A 4ECZA 5DETA 3MEGA 1S1VB 3UFCX 1YKWA 5ETLA 5T7LB 1Q8BA 1CC8A 3I4HX 5HANA 2DIUA 2K7KA 2CXEA 1JJHA 4CRJA 1PSDA 1M1GA 3BKFA 4PQUB 2OPSA 1FJCA 2N7YA 2IC3B 4MK7A 4ZIWA 3TJAA 2E1RA 3IC1A 1HMVA 1N34F 1CC7A 3H40A 4NA1A 2KU7A 3PX6A 3ZZTA 1W2BR 5HQLA 3MTJA 5KFMA 2ATCB 4PPDA 5KFTA 3PJXA 1WG4A 1O6XA 2YQ0A 3BF4A 1T3OA 4QCLA 3TR5A 4ECVA 5F8HA 1YBAA 1IR1A 2AGQA 4I6YA 2V69A 3CDWA 2QT7A 4FYYB 2HFSA 5T7LA 1JB0C 2IHR1 2M88A 3ZTOA 3MECA 1R8CA 4LBIA 1UW4A 3FBFA 2GIFA 2XGPA 2HHVA 2IC3A 4Y2AA 2MKJA 4ZLNA 3EVOA 3GJRB 2CJAA 3O8WA 3R5GA 1FRMA 4OHZA 4YQWA 2CPXA 3V4IB 4EBDA 1ZH5A 1WC5A 4GKJF 4JI6J 5DRKA 2QTWA 4NYOA 3HHEA 1P1LA 2XWYA 1SCJB 2HHWA 2BJ8A 4KGXB 1B64A 2WHOA 5IS2A 3F0NA 1HHSA 2RB7A 1WG5A 4KH0B 1LQ9A 5KFGA 3UR0A 5KFFA 1ZZFA 4PZVA 3T1AA 2FHOB 3W9HA 1KD1T 1YIJS 2GJFA 4LQ3A 4P52A 4YR3A 2IAJA 3LP0A 2GMLA 2RHQB 4M5LA 3M8QB 3DCAA 3V4IA 1RT2B 5I4MA 4K50A 3LA0A 4PYAA 4ZLPA 1FX2A 2AYGA 3GR1A 3NGUA 2WOMB 5KFBA 1HFEL 4C7QA 3TUZC 4JYAF 3UW1A 4LFAJ 1SQEA 2Y0BB 1Y5LB 3NCPA 3FSIA 1AZSB 2P6TA 2RAQA 3FCVA 1KNZA 5D8HB 2E7WA 3L3CA 3ULHA 3N9UC 4IH5A 2DPIA 2RSQA 2C3PA 3KK1B 1YJ9S 4EO8A 4DV2F 1HLWA 3AXMA 3UNGC 1T05B 1WF2A 2H5JB 2ZZNA 2MY7A 3RBXA 2RRNA 4KB7A 3M8QA 2OMLA 4X4PA 3PRDA 2DNGA 2M4MA 3SQGB 2HQIA 1T9XA 3HHLA 1RT2A 3CCJS 2RUGA 4X4SA 2D1CA 4TU9A 3HK2A 2N82B 4ECXA 2M3DA 3R8YA 3FJ2A 4O4RA 2WOMA 3UDCA 3GIRA 2NZCA 1Q95G 2AT1B 3CJ5A 3PXGa 2HQFA 3M2VB 4ED6A 4FBUA 1AZSA 3KJFB 3KWMA 2MQNA 1LW0A 2L9DA 2FZCB 2EK6A 1MU2A 2RRBA 1AXQA 1UCNA 3KK1A 3K7RA 4KHRA 1K9MT 2A0FB 3EZUA 1Y5IB 2W1BA 3W63A 1R0BG 4B08A 2MLZA 3EZOA 3CD6S 1ZETA 2FIUA 2LU1A 4EZ6A 3D6FB 1S77D 2XZTB 1RWPB 3SQGA 4LT6A 3D7SB 3KLHB 1NDPA 5DLFA 3I0SB 3KDOA 3M8YA 4B9VA 2MKIA 3FZ2A 3D6TB 5EWEA 3H2UB 3W64A 1WEXA 4A48A 2QRRA 1IJFB 2HZAA 3M2VA 5LMNF 1DTTB 2IJRA 1SJ1A 2RIJA 4MFBA 2QMXA 2K06A 3CCSS 2ZDOA 5KFZA 5A0YA 1VQOS 3NAHA 4LF9F 3D68A 3ZFVA 2GJ2A 1KOHA 3TJ8A 2C2DA 3W5ZA 5ETSA 2XM3A 4USUA 4OZ5A 1RWMB 3TZXA 1VBXA 2JDJA 1Z2ZA 1NU4A 3POTB 3MFHA 3I0SA 4KKOB 5L8RC 4R0EA 4KO0A 4WK3A 4OYWA 2XO6A 2BKOA 2FDNA 4DZ6A 3GFHA 3ENWA 4DG1B 2WSEC 4QYZJ 3DLJA 2GX8A 3H4DA 1CQNA 1SJRA 4J37A 4CH0S 3QPIA 1HHQA 5F8NA 3G6VA 1FA0A 2VQFF 5AJ3J 3TA2A 1KHWA 3N6MA 3NGSA 3QIPB 1YJWS 1R8AA 4C0HA 4N76A 1JLEB 1TK8A 2K7JA 4I56A 1MG7A 5EN1A 2DY1A 2GVDB 3CT9A 2ZJQQ 3KFWX 5IWAF 4CYUB 3L09A 2VBXA 3LQVA 1FKAF 2CVEA 4I7FB 1WHXA 4KKOA 4K0KJ 1FDAA 4G3IA 2PMHA 1F1BB 1C0TB 3MF5A 3UCGA 3AQPA 4GMKA 1T9TA 5KFOA 2PE8A 3TWZA 5I3QA 4DG1A 2B9YA 1OYEA 1U2CA 4C8KA 4QWCA 4X65F 4DSLA 2EFQA 1V5VA 1U48A 3OT9A 4AUKA 2HZVA 1T9WA 2D69A 3R9LA 3SBMA 3UE2A 2H51B 2PT0A 1HNIB 2GVDA 1RJJA 2QA4G 3M9OB 2ZNZA 4CYUA 3TZWA 2ADCA 4I7FA 2P2CB 2XB2D 2GVZB 3WHIA 2DVIA 1UEVA 4JI2J 1MMLA 2IY5B 1N56A 5FLXU 3SSQA 2QEXS 3UD4P 3OR1A 5FIIA 2DNMA 1X4AA 3KK2A 3BS9A 4UZCA 5I3PA 4ES3A 2XO7A 3RRHA 4WJBA 4LRBA 5K9FA 2RD5C 2ZC4A 4MKVA 1GX6A 3FRYA 3TJ9A 4LSLB 1PIEA 5AE3A 1OPZA 1D1UA 4LF6J 3WC0A 2EC2A 1WDDA 3SZ2A 3W5YA 2YNIA 3HZGA 3RW6A 4NCAA 4J9PA 1UAWA 1M5HA 4G1IA 2GVZA 3JQMA 1GQEA 4Y2MA 1E6YB 1JQGA 2CPHA 2CPIA 3L9ZA 2DHGA 1S5ZA 4B9SA 2GCFA 3MWBA 3U27A 5KFPA 1FTCA 1QY7A 4U7UD 1FRHA 3GIKA 3BDEA 3DM2B 4PYDA 5G0RB 2WW4A 2LDIA 3C6TB 2IIHA 2F1FA 1S7HA 3EE3A 3ENQA 1N32J 1PGZA 2D3ZA 2MTLA 2XMMA 4KSEB 2LXFA 1FJ7A 4DL2A 2DNNA 4LSLA 2B8QA 2YH0A 1B7YB 3CJKB 4IG0A 3EGNA 2BM0A 4DR2F 5GMKa 4ED1A 3ISNC 3M1VB 3PYDA 3FSXA 4J9NA 4ICLA 1E6YA 2B51A 4WP8A 3V6HA 1U2RA 3AD7C 2LU2A 4F7VA 3HVTB 1K8AT 5KFHA 1X5TA 2FPHX 1FF2A 2BACA 4R8UB 2HIYA 3V6DA 3DM2A 3BH6B 4AL6A 3E51A 1ZYQA 2MGZB 3C6TA 4O3RA 2DNKA 1RT1B 1U1NA 1LV5A 2ZOMA 1FD8A 1VFJA 4IRKA 3CCRS 4U9RA 3Q0AA 4ELTA 3CJKA 3GJSB 4XK8C 1SQFA 1UJ6A 4KPCA 3BDPA 2FZKB 4M5JA 1TKZB 2R7OA 5DDOC 3M1VA 1X4DA 2F65A 2DR8A 1V9OA 2JX2A 5IT4A 2RMLA 2JWNA 2HVHA 3HVTA 4KHPF 4J9MA 4LRDA 5A6WA 4HH1A 1N5SA 3BGLA 3AD8C 1HW9A 1KQSR 2AGOA 3CGIA 5I42B 3QQCD 1CS4A 2MGZA 1WG1A 4NASA 4LRAA 4BC9A 3N5BA 5H1SV 5ETRA 2FVQA 2POKA 3SCKE 5HVFA 2B6AB 3DDIA 5IT0A 4WIIA 2IM2A 1YX2A 2GHVC 3B6BA 3GIIA 2YPYA 4YDXA 1HQEB 3EWGA 1TKZA 5HBMB 4USTA 4GRSA 4QYZK 4WIQA 4UY85 3VAIA 1RT6B 4K5RA 1S7IA 2YVSA 2FHMA 3MCSA 2ZWOA 4WKRA 3KLGA 3BGOP 2AU0A 1C1CB 4QOTA 1UPMB 4H4KA 2LECA 4HI2A 3C66A 1SV5B 2VHGA 1XQIA 2J6SA 2B6AA 3NGDA 4NE9C 5LMUF 3MTKA 1PKUA 3I32A 4OMFG 2VA2A 1D8YA 1KVKA 2G2YA 1GFWB 1D09B 2OEJA 3M30B 2OGUA 5DDPC 1L3VA 4EI2A 1REVA 1KTVA 4ED8A 2KM8B 3D0GE 3HF5A 5AXLA 1U8SA 2VJVA 3SEOA 3MEDB 2XYGB 4F3MA 2RRAA 1LK7A 4ZHRB 1IKWB 1UVJA 5HMXA 2QC3A 1DBDA 1WI8A 4IR1A 2HK3A 4HYKA 1G2EA 1H0HB 4K8RA 2BANB 5E41A 4ECWA 2ASYA 1SV5A 1Y3KA 2GO8A 2LQ9A 2KVIA 3PACA 2UUWA 4HDHA 4NI2B 3ZXWA 2J6UA 2JH3A 2HAFA 3LP2B 4RUAA 1BLUA 2GMHA 3DYAA 5KFKA 1L3SA 1N34J 3X3UA 2XY7A 4DUZJ 4F04B 3J7Z5 2PD1A 3MEDA 4ZHRA 1X4CA 1S9EB 2CNLB 1XTZA 1IKWA 3RGIA 2ZH5A 3CD5A 5C42B 3N6LA 1VQMS 3ELHA 5E3AA 2I8EA 3QT5A 1F5BA 3CW2C 3NNCA 2ADBA 2BANA 2JC1A 2AYBA 3H4BA 5B7WA 4EYHB 1VJQA 1FT8A 4NI2A 4CO4A 3CMQA 3CJ8A 2BE9B 1S12A 2JEGA 3LP2A 3R5JB 4KV8B 3RB0A 5IM0B 3P4UB 2AJQA 5CABA 4C8LA 1FDNA 2R7QA 4OJHA 1Q0NA 3BBBA 2ZBRA 1WC0A 2V94A 2W25A 2EPIA 3NCQA 4MKBA 1S9EA 2D9PA 4GKJJ 3PFOA 5C42A 1NDKA 1ACMB 1SXLA 4ECUA 3D6HB 1WOSA 3J80Y 1BQNB 4EMDA 2FHJD 1N5QA 3FBBA 3I5BA 3CVKA 3CDAA 5J2NB 2F9JA 1GTHA 1Q5YA 2QX0A 4QJVA 2QN6B 4AXIA 3WBZA 1KEKA 4PG4A 1K47A 1RB0A 3DLGA 3W2WB 3NOGA 2QGFB 3PYEA 2ZHBA 1EARA 2FJXA 5E2QA 2WCXA 4OI1A 2DGUA 4YR0A 1NHVA 2V8HA 1RHKB 2CQ1A 1RT7A 4H4OA 2K1RA 1ICEB 3M6XA 3PY8A 3R5BA 1K0TA 1HI0P 1TVRA 1R89A 2XWXA 5J2NA 3BGUA 1JNRB 2P6SA 3MAHA 4JI1J 4F02A 3GPAA 2HBQB 4KGKA 4WE1B 3K8VA 1LW2B 4NCGB 5IT9Y 2AX0A 2DH8A 1AFJA 4ZVGA 1RAEB 1YJNS 2ATLA 2BM1A 5IQQA 1T94A 3D4JA 2K3IA 3N79A 3D0IE 2PSZA 3R5CA 3D3BJ 4Q8EA 2ZEJA 4YB5A 4I1TA 5J1EB 3OXFA 2HFNA 5A8RB 4DL7A 3RR7A 3DOLB 2GC8A 4RBVA 2VBWA 2R7RA 2APOA 1VS3A 4FPIA 1VLYA 2CJYB 1JJCB 3M8ZA 2CQPA 2Z58B 2H54B 1LW2A 2CQBA 1T95A 3GWCA 4PCQA 5DDQC 2ZE2B 4NCGA 2XMKA 3KLFB 4Y6IA 3IR5B 3VAHA 5DQHA 2HHSA 1ZZNA 1VBKA 8AT1B 2N4DA 4ZN3A 1K1SA 2M9KA 3MZIA 1XERA 3V6KA 5IV4A 5J1EA 1QD1A 5LSOA 2DGSA 1FERA 3ZTRA 1WC3A 3ZZPA 2C2KB 1VHIA 2A3JA 1UFKA 1XR6A 1FI4A 1O51A 4LF9J 2NYHA 1VQNS 2ZJPQ 4ELUA 2U1AA 5K5MA 3SSSA 1I6JA 3SXLA 3RUBL 1N6QA 4WTOB 3H20A 4DV1F 3MM5A 4ZCIA 5J1PA 2Z30B 3J7A1 4Q5VA 2HBZB 4OJGA 2K8GA 3UPFA 4HR2A 2VB6A 3AA8A 4O3SA 3H2LA 5KFIA 2DNPA 2W24A 4CLLA 3AT1B 3VCDA 3HFKA 1YJUA 3MMBA 1MN7A 2VQFJ 4PKDB 3DLHA 1KRPA 1XMBA 3GR0A 3G8QA 3FKBA 3NS6A 2X7IA 4S0MA 5IWAJ 3HCXA 1NPPA 4F3OA 3OBIA 1MN9A 1OPIA 1G1XA 3VVUA 2IM0A 2O67A 2MZJA 2HBYB 4DF8A 2OPPB 2M8HA 4V1Ak 5BJRA 4C4WA 3M8PB 1NMEB 2X3DA 4KH1B 5KOWA 2J7UA 2CWXA 2W9AA 2H5EA 4RNFA 4M8LA 1W26A 2VG5A 4X65J 3EUNA 3D0HE 1HWKA 2C2EA 4B3TF 3VR1A 3JSMB 4MKAA 2F9DA 1HW8A 2XLJA 2FY1A 3DLBA 4X64J 3ENAA 3CO0P 2I9SA 3M8SA 2BABA 3G8TA 2NPIA 3LAKA 1ROFA 2CQDA 4OJ1A 2I2YA 1CBKA 2M52A 3CO9A 2GGPB 1FFSB 4DPTA 1VQKS 2OPPA 1CG2A 3FGVA 1PJ7A 3C3LA 2ROGA 2AF6A 4XTTA 5HATA 4O0IA 3QT8A 4UOGA 3BN7A 1JLGA 3K5NA 1FKOB 4ETZA 3KNGA 3JSMA 1YITS 2IJFA 4N41A 3TUIC 3NNHA 1YQHA 3CJ0A 2ZUGA 3BQ1A 4F2SA 3T6BA 1RABB 4FXDA 4DPUA 2V8DA 2MQPA 3RZAA 2DXDA 1PILA 1T03B 4CLSA 4RL1A 1CQMA 3QGIA 3LUYA 3SI8A 1HNWJ 4LSNB 4RNMA 2E1PA 2GGPA 4QBUA 4DCPB 3TVZA 5FDLB 1X9SA 4NCBA 1XNQF 3PNIA 1S4EA 2ZBPA 2WVBA 3I56S 2GA7A 4KPYA 2RKIB 4FDFA 3DOMA 5KFYA 2KZZA 3TO8A 1LFWA 2DISA 5RUBA 2E29A 3LPEA 3P5TL 1VRUB 4LVOP 3A13A 4NRTA 3A3OB 1C4CA 3PIPQ 4I2QB 4IOCQ 1U09A 4Q45A 2PI4A 1T0TV 1NNDA 3IBFB 1MMNA 2VOPA 3RRKA 2KT2A 4OQJA 3LTOA 1DHMA 2H3EB 2CKWA 3N28A 1T03A 1H73A 3KLIA 2ZWPA 2FZGB 2VQEF 1KTQA 4LSNA 1FESA 2J76E 2QLWA 2RKIA 4X62F 2XS7A 2HAIA 1B0VA 1TELA 4B02A 3OTOF 1EHWA 2LQJA 1EQMA 4ZPTR 1VRUA 4AQYF 4G1QB 4FNHA 4RNOA 4KGZB 1J27A 4K7QA 3TUJC 4HHHA 4Q0BB 4B3OB 3MM6B 1UWBA 3J81U 1K0VA 2QL9B 2YPZA 2DRBA 3W61A 1RAGB 5D3GA 4TY9A 3MD1A 1RTJB 1VLOA 4ANEA 4C11B 2IDLA 3PTWA 2HMIB 1N5YA 4KHPJ 3MM9A 1X4FA 2EG2A 1QSYA 3VAKA 2A10A 2M70A 1I94J 4IFYA 2J9DE 3A4TA 5B0GA 4G1QA 1RHJB 1NAQA 3IXQA 4CDIA 2HHUA 3HULA 4W90B 1HIYA 2HQGA 3OXGA 4FXWA 4QU6A 3QJPA 1OMSA 4B3OA 3MM6A 1N36J 3MPWA 4EGLA 2VD3A 2ZH7A 3MR3A 3K5MA 4X4VA 3CD0A 3JB9k 3OTEA 5CD4A 2OELA 4DV5F 3C6UB 4DR1J 2HFUA 1PAUB 2CPYA 2F5GA 3I4PA 3MM8B 3MFIA 3ZZ0A 4UTGA 3MAAA 3DHWC 5J1NA 2VPZB 4J9RA 4PXBA 4LIRA 4USWA 1XR5A 2VG6A 4AL5A 1GXUA 3IMQJ 1LWFA 2DXFA 5DO2A 1M5VC 3IR7B 4USIA 2HFVA 3M6UA 1NK4A 3US5A 2PA3A 2B56A 3SDEB 4PUOB 2C2MB 1FE4A 2AJFE 1O8BA 2V4JB 2ZM6F 5JMNA 3C6UA 1F60B 1QTNB 1RKIA 2W4PA 2ACYA 4NLTA 1IBMF 1RXOB 1FEEA 3TVKA 2EW9A 2O3DA 3MM8A 5L9NA 5ITHA 3IN5A 1UVMA 2R8KA 5K14A 2LXIA 1VBYA 2GMJA 1VQ9S 4A47A 1NSQA 3H59A 1NO8A 3KJVA 2LQBA 3D1QA 2OUGA 2I5JA 1RU2A 2MYFA 3M6VA 3K5LA 1RYRA 1S6PB 4H4MB 3TAQA 2R7TA 5CCMA 3SDEA 3GMGA 3M32A 2V4JA 1HD0A 1IUJA 3M2RA 1YDLA 2B5JB 1RTDB 2ALZA 1NZAA 1C1BB 4C9DA 2YWHA 2GO9A 4RX6A 2DH9A 4M5DB 3HSJA 3NBPB 3CJ3A 2E5LJ 3Q8RB 1RT5B 1FRIA 4GO7X 1SJQA 1Y11A 2WVDA 3AA9A 4Y34A 4N77A 2HGNA 2QL5B 2BE7D 1F3FA 2V68A 3CDEA 1P9QC 1S6PA 4EBEA 4QPXA 4ES1A 4CH7A 3ZZYA 1TKTB 2DO4A 1F0XA 5CA5A 4IKAA 1WEYA 1S99A 4K4SA 1RTDA 5IC4B 2OFGX 3NRBA 4CLKA 5FLXY 4U95A 4P2SA 1C1BA 1OSCA 5A8WB 1HA1A 3SFGA 2BW2A 1LNQA 2IRYA 2YNFB 2B4OA 2NXJA 3P6YC 1WC1A 3VGTA 3EZ5A 1RT5A 4PXDA 2YX1A 2B7BB 2VPYB 3GV7B 4LF7F 4OYBA 2AQ4A 2Q43A 4ZJOA 4C8NA 3RB3A 2G1DA 1TKTA 1I5OB 3OL7A 4XDDA 3VGSA 1HBMB 2ZH3A 1EKSA 1F5CA 2CNKB 3NNAA 4UUXA 2JNJA 3A8EA 1KS2A 4DQSA 2R2RA 1U1PA 3T5HA 1B3TA 3JSBA 5A8WA 4Y00A 1M1KT 2CPJA 2E9RX 2MDAA 4ERDA 2B43A 1WEZA 1C2PA 1NJZA 4KTQA 2CNNB 4IG3B 5ETNA 1BWEA 5F0WA 1S48A 1LK5A 3FCWA 3ZTSA 3GG0A 3EGZA 1FD2A 3KHHA 2XZDB 3P45B 3TZYA 2VUGA 4P2MA 4LVNP 1HWJA 3DLEB 2FJWA 4ID5B 1H72C 4NLWA 4YP3A 3ZZZA 1HBMA 5H9FJ 2DHSA 1FWLA 2NXEA 4DBQA 2ZZMA 4DPYA 1HBOB 5C5JA 3DI6B 1CJTA 2PA8D 4WFXA 1KFSA 3TX8A 4OI3A 4FF2A 4DFJA 1W2IA 1FFGB 4RW9A 4OZ1A 2KRBA 4WTYA 1N8RT 4IG3A 2JVRA 2WB1D 2KL8A 3PO5A 5C25B 4MIWA 4GC7A 2V5HG 2L08A 1VCTA 5KG4A 1JKHB 3PEHA 1SKWA 1SIZA 3TOQA 3TARA 2V9WA 2PEBA 3DLEA 4BC7A 4Z2XA 3OFEA 2XYPB 1JXEA 1R7IA 4ID5A 1JLCB 5IFMA 4FF1A 3J7YI 3BKUA 3JS9A 2J8SA 3HDSA 2HIQA 1HWIA 4ZVEA 3R27A 4J9UE 3DI6A 2J5AA 3D6MB 2YKMA 4CLFA 4MIAA 1HWUA 3CC7S 2HS3A 2FJBB 3UVJA 5D4PA 3K17A 5L38A 3CJSA 1Y3JA 4ZPDA 2IMOA 3GZ7A 4LFAF 4ETXA 3O2IA 1IWAA 1KKHA 2OSRA 1HNVB 2D3OR 2YQ3A 3MMCB 3PW0A 1TFWA 3EICA 2DR7A 1Q53A 1S79A 1C4AA 2CAJA 4KJIA 2VA3A 1RYSA 2LEAA 1Y9OA 3JTOA 1WNEA 2ZOGA 3FEZA 4DV1J 2H9ZA 3MR7A 4DL4A 2P9EA 4LRFA 2R2SA 1H6KX 3GSDA 4IRCA 4DV3J 1NK7A 3SMZA 1HNVA 3VAGA 1SQGA 2FGOA 4YB7A 4Z37A 1GMWA 3HLUA 4MJKA 1PYSB 3A8IA 3RJMB 2LA6A 3AAWB 4A8YA 3U1MA 3AOBA 2RHSB 2BEFA 4C8MA 2AJ0A 2X1AA 2DKOB 4NPOA 4NZ7A 3D3CJ 4CLPA 1OIAA 2F7VA 4NYZA 3ILJA 4F36A 2G2ZA 1FRKA 5ETPA 1YZ7A 3MGJA 4XAKA 3BQ2A 3IG1B 2WW8A 4OYAA 5LM7E 1UKUA 1R8BA 5GAGU 5C24B 2UUTA 2R7UA 1TKDA 2IRXA 3HM9A 4PQAA 4Q2LA 3G2XA 3O44A 1H7WA 3QO9B 1HQUB 4UZBA 2MSTA 1VGYA 3RAMA 4JI5F 1WUUA 2HLUA 4KFBB 2GAGC 3IM8A 2CQGA 1BUXA 3AODA 2P9GA 1S1UB 3GFZA 1VIOA 1EP4B 3W1YC 4EK2A 3HHNB 5BYSA 1UJ4A 3FRZA 2OPRB 2KXFA 2G4BA 1NHKL 3NS7B 2LMIA 4QWDA 4A4JA 1EETB 4F4KA 5DQIA 2J0QD 4C2MA 1H2UX 3NWRA 2Y3YA 4ZPAA 2KJWA 4O3QA 1HQUA 2OO4A 5KOXA 2ZHAA 2W2OP 2GV1A 3FQKA 1NH7A 3ZZRA 4KFBA 5AT1B 1XNQJ 2XULA 4DX6A 1NSAA 1EP4A 4RPFA 2OPRA 1UVKA 2UUCF 1WORA 4DR6J 2DHHA 4YMEA 3NMAA 4CTAB 2E9TA 3BO2A 2YKPA 4C97A 4QW9A 1EETA 5L39A 1MNEA 5JVHQ 4Q44A 1RHUB 3VF0B 1XMQF 1Z2LA 4M5GA 3B78A 3OSPA 4U96A 2GHPA 4P6QA 5ETTA 2VQEJ 2D74B 4TLQA 1BXNA 1QUPA 2DITA 5HMZA 3Q89A 4X62J 2WSFC 1QE1A 1Y5NB 4I6WA 1ZPVA 4C3KA 1T9YA 2KYXA 1NRKA 4K4ZA 1TFYA 3Q8YA 4CTAA 2GNKA 3K89A 3K5PA 5GVQA 2XC9A 3KHRA 2UXCF 3K59A 1G4CA 1VQ7S 2GFFA 2ZH4A 1TKXB 4I68A 4J9KA 2IBKA 1L3KA 1VQ5S 3JAMU 3BGRA 3OJUA 4O3OA 2BMBA 1N33F 1YJTA 5KFSA 2N7CA 2QO3A 4DFKA 3QAEA 1HYSB 2RVJA 2B0GA 2NSBA 1P27B 4I0WA 5U47A 3HVWA 5B0EA 2UUBF 4ED3A 2C3UA 2XCAA 3G86A 2V6AA 4WFNQ 1URRA 3GSIA 2F8MA 3PKMA 1N32F 1X5OA 1NCLA 2BZ2A 4OV6A 2FC8A 1K73T 2LCWA 3WC2A 2LKZA 3MPUB 1TKXA 1S1TB 4DJBA 2CZ4A 1JLFB 2DT9A 2HVDA 3D1HA 4PEOA 1NZ8A 1F6TA 2V8PA 2PGCA 2Q1LA 1RHQB 2JRSA 3CCES 1VYAA 1CPZA 4DN9A 4L3NA 4NMXA 5KG5A 2XQCA 1SC6A 2AWZA 3DMJB 3EJMA 4BLGA 5HK4A 2WBRA 4HVZA 4QU7A 1APSA 4K2XA 1U4BA 1UP1A 2CDQA 1KONA 2QYCA 1IKYB 1MW7A 1YZ6A 3KG4A 1X9MA 3H5SA 2H65B 1S1TA 2XMUA 5F0UA 1I1GA 1YGYA 2ZM6J 2OEKA 4WKYA 4C0OC 2E5IA 2EWHA 3LGNA 1JLFA 2OP5A 4WFBQ 1UVIA 4J91A 1ZA2B 1AB8A 1IBMJ 4LF2A 4ILRA 4ECTA 3PX4A 5F8LA 3IO1A 1WF1A 5CD4H 1BC6A 2FVSA 4A8SA 4TKTA 4QR2A 4HT5A 1AFIA 5CXTA 1UW9A 3BYPA 1R0AB 3DMJA 4PWWA 2MMYA 1N48A 2BBEA 1VC0A 1IKYA 2JEIA 1WACA 5DGBA 4DR3J 4FP9A 5D0GA 2B4PA 3PHEA 2FGCA 2VKZG 2PEHA 3BN4A 3SYZA 3M7VA 5HP1B 3HKZD 2XI3A 2Z57B 2PMWA 4DPWA 3MD3A 4X4UA 4CLYA 2DPJA 3I55S 1BQMA 3NXZA 5DGAA 3DRYA 1FRJA 3DC2A 2BQUA 2OFHX 5J2MB 1TAUA 4U6PA 3THTA 3BPSP 1UJ5A 1NKCA 1M1HA 2DYAA 4DX5A 5HQMA 2HWTA 2QLXA 2FUG9 4A8WA 1FK9A 2IA0A 1YRTA 5KFAA 1EB0A 2XHWA 4QR1A 1HMVB 2IPOB 2MJNA 1CJUB 2BOAA 3EX7B 3U1NA 3FUYA 2LA4A 4AXJA 4NLYA 4OI4A 2HFZA 1YRXA 2DGTA 2ROPA 5IXUA 3M8RA 4RWWA 2QLFB 3FC9A 2W7OA 2Z2LA 3FSYA 2FLPA 1S6OA 4CM0A 5J2MA 4LF7J 2VDHA 4JV0A 3PR4A 5HAOA 1RWXB 4O3PA 3MECB 1AW0A 5CHCB 4LF8J 3V81B 1U49A 3JSYA 2HHTA 4P7TA 2W2MP 4DMZA 3O6QA 4HTIA 1CJUA 4G1PA 4DUZF 1ZTWA 3TVYA 1U7LA 3M2UB 1U1LA 4IR9A 2R8JA 2OPQB 2DNZA 3FMBA 2ZH2A 3B82A 1YHQS 4IFVB 1GMWD 3CJQA 1HI1A 5B0AA 2R2TA 1V3RA 2VASA 2UXDF 1JJ2R 2CFXA 4OHXA 2IYIA 4ECRA 4TU7A 1IM4A 2J9EA 1NHUA 1RLDA 2HVZA 2MKYA 3W62A 5CYMB 3J81j 2KDOA 1RBOB 2W2PP 3UNYA 1TUVA 5J2QB 1PJ6A 2UV8G 3V81A 2IAJB 1SJ4P 1NK8A 3R1LA 3LP0B 5D0EA 3H90A 2JFDA 1XC9A 3N0VA 3P49B 2UVUA 4DL0C 3BSCA 4RUCA 4OX6A 1H2VZ 1R0CB 1HNXF 2FLOA 4RW4A 3IM9A 3T1HJ 3M2UA 3HSGA 3G6XA 1GXLA 4PR6A 2OPQA 1YBUA 2ZHOA 1HARA 3CNQP 4IFVA 2CG8A 3VAJA 4DF4A 1NEEA 1QVGR 4YB1P 2ZC3A 1WKJA 1WOPA 3RYLA 1JXLA 4CLTA 4J5OA 3KDNA 3M9NB 3J81Y 5C2GA 5CYMA 2FYXA 1LOUA 5J2QA 1H98A 2RDIA 2QLJB 5KG2A 3AJ2A 3SCJE 4E98A 8ATCB 4GKKF 1TV6B 3QZ8A 2ZKTA 2RILA 4KYZA 1OQ6A 3ISZA 4HL9A 3OJSA 1OYDA 3HHLB 4WU2A 5F3ZA 1S0MA 3JQKA 2BUNA 3MAQA 3O5TB 3DDKA 2QYGA 1UA1A 3TP2A 3OPKA 3QYYA 2DGWA 2ZOFA 2OH2A 3EPGA 4DSFA 2V8GA 2PDAA 1YTYA 2IM1A 1LW0B 5IOLA 3S1TA 3WQPA 2CJKA 2OIHA 1MU2B 3UQSA 2XMJA 3KJQB 4JI1F 5KFXA 2V2QA 5IV3A 2AZ1A 1QUVA 2UZAA 4L6V3 3F56A 3T6JA 3UDVA 3TX0A 3VTIA 3SFUA 1FDBA 2JLFA 1R6VA 1TV6A 4N8NA 3V4MA 5LJ5Y 1ZA1B 1WJ9A 2Y1LB 4JOUA 5LT5A 3ZZOA 5E3PA 4AYBD 2J0XA 2KYZA 1BMQB 1U6FA 3H2VE 2BE2A 5ETVA 3UR3C 4UQGA 2BYCA 4I4BA 2IA6A 3DN9A 4ZVPB 4A8OA 3FMWA 5KFEA 1IBKF 4MYUA 1UA0A 3NP5A 2M7SA 4MFBB 3KLVA 3G96A 1FO1A 1V3SA 4DL3A 5A0YB 3FEXB 5LXYA 3GV8B 3F73A 2XSJB 4M63A 4U67Q 2OD4A 1Q8LA 8RUCA 5F8MA 5LSLA 2W8KA 1Q82T 1T02A 2PFFB 3E01A 4WWSA 4ZVFA 1RAHB 3OVAA 1QAXA 4KO0B 4NEYA 3IBWA 3RU0A 4YOEA 2BW7A 4KE5A 2DH7A 1LKZA 5B0CA 2LVWA 4TY8B 5E5NA 4H4KC 4AL7A 4F2RA 2EI5A 3OD2A 3CB4A 4DCOB 1JLBA 3B4MA 3NMRA 2XSJA 3GFXA 3IGNA 5KFCA 2BJDA 1WC6A 4CH1A 1LXNA 1RWOB 4ILMA 3CMES 4JI5J 4DCJB 3S7RA 3E2EA 2AW0A 4TY8A 2H48B 2LLZA 2BQ3A 1B0PA 1BQXA 3R7BB 1GXTA 3HFVA 4OLPA 4PG6A 3Q22A 3D28A 3VZHA 4ZJLA 4F4ZA 4E0DA 2MJUA 5CH7B 4BWJA 2B9XA 1T8EA 2AP6A 1BWVA 4Y2KA 3HI9A 1RCXB 4FF4A 2DY9A 5ADZA 3SSRA 4QR0A 2KM8C 4JV5J 2BJ7A 4AT1B 2W4CA 5KFJA 2F4VF 1JLAB 3B4DA 2HURA 3LAMA 4OYZA 2R2UA 1Z1ZA 5HMWA 2W7AA 3QGGA 4OYMA 4I6AA 3H5YA 2O01C 4WP3A 3OR1B 3BQ0A 2CQ4A 3KK2B 2IYGA 1K1QA 3PVXA 1N88A 4I64A 1PBAA 2QFIA 4U8YA 2UUCJ 4ZLLA 1S4FA 3MEEB 3EVMA 2BJEA 4ZITA 4DR5F 1XR7A 2ACMA 1A9NB 2QZ8A 3D54A 4NLDA 2CQCA 5DG9A 1RCOB 2HHPA 1FKPB 4X64F 4BWMA 2CQHA 1XMQJ 1NK9A 2LP4A 1NPRA 5C7PA 1U0SA 5M2UA 2YNIB 4ED7A 7FDRA 2OTLS 4WYWA 1JLAA 4ZVTB 3MUMP 5IZHA 1CJVB 1XJWB 2VU5A 2HVIA 3PIOQ 3CEDA 2AKWB 3OTCA 1RSCA 4L75A 1UTAA 4LR8A 2V63A 1ZM3A 2DEJA 2YWGA 3MEEA 4DX7A 4FVMA 1RQ0A 2R42A 3PZPA 4ID8A 1GX5A 3OW2R 4KR0B 4QW8A 3LWMA 4OJ3A 3TQ1A 2AX1A 4F4YA 2UXCJ 4LQ9A 1FKPA 2W9CB 4YY3F 4KIAA 4IG0B 1S59A 3OFHA 1SH2A 4QYRA 1F9EB 2XLIA 1Y10A 4USMA 4IO1A 1N33J 1HNWF 2QG9B 3GCXP 4ICLB 1PCAA 1JWWA 1TMMA 4LF5J 1CJVA 1T9VA 4ED5A 2L48A 1UZHA 5DS7A 1BY9A 1B70B 2DJWA 4QIEA 2UUBJ 3V6DB 5D6GA 1F3VA 4CLUA 5I3UA 4K5SA 3DXSX 1WSRA 2NPFA 4MAKA 1UVNA 1AROP 9ATCB 1IR2A 4IH6A 3LALA 2W9CA 2N3OA 1FXDA 1B0TA 1YG0A 5E33A 1SH0A 5HI7A 2FJAB 2R7XA 3OFFA 4EBCA 2E9ZA 5EX0A 2HNYA 3TZZA 4DU7A 4ECSA 2QJ3A 1C0UB 4E2FB 1RHRB 5BR8F 5LL6d 2QSFA 5HJYA 5AXMA 2WBMA 1S6UA 1XMOF 3VQSA 4WFYA 1CS4B 4CM2A 2QV6A 5B0FA 2SXLA 4ZDNA 2QA4S 4OX8A 4O4GB 2AHOB 2V2ZA 1RACB 3ET6A 2EC0A 2JLGA 2XY5A 4LF1A 1NUEA 3RBZA 1RISA 3QZ7A 3T5JA 1C0UA 2ZVIA 1YJRA 4U7CA 4LJMA 2HWIA 5HVGA 1VK3A 3KLGB 3G4SS 4DQRA 3MDFA 4OYPA 3I31A 3KMQA 5ETOA 1IM6A 1I94F 4URSA 4RW8A 1E6VB 3CIMA 1EJ7L 1RAOA 4O4GA 1NH8A 3N01A 1U45A 1N36F 2CNOB 2W01A 4LFBF 2HHHJ 2LFVA 3ZNUA 4DPOA 5KTQA 1REVB 3L4BC 5GAHI 3NLCA 4DR1F 2YXLA 1H38A 1KHVA 2RNEA 2XI2A 4F3QA 4JV2A 5AE2A 3JYTA 3H0PA 2E5JA 5AXNA 1FTRA 1F5AA 1RI7A 2LXUA 2HGLA 3R7SB 3FFIB 4ZVUB 5DZ6A 1DZ5A 1U25A 2KO1A 5K8PA 4FS1A 1GMUA 2HNDA 4PABA 4NXNJ 1E6VA 2JLEA 3T1YF 5F9NA 1AUSL 1SH3A 5GADI 5B0BA 3W3SA 3DYAB 4P2XA 2O5DA 4DEZA 4M95A 2RS8A 1Y00A 1U1OA 2VJUA 2DIVA 3ADAC 1EIYB 4Q7AA 2GQQA 3ZO7A 4P74A 3MURP 4TN2A 2Z56B 3QAUA 4DV0J 3HFZB 3Q24A 1DJ0A 2WSCC 2EFOA 1KLNA 5F9LA 1VJWA 1X31C 4OX7A 2I38A 5HLFB 4A8FA 4K4UA 3QJJA 5E3CA 4B17A 3FFIA 3TAMB 2RS2A 5CQGA 1UFLA 3DU5A 1NKBA 4O0NA 3CSKA 3GIMA 3CUNA 5H9EJ 1VOMA 1TMJA 3HHLD 1EAYC 4ZOSA 1WTFA 4DFPA 1AT1B 5KT2A 1RADB 4PPZA 2YKNA 4BCAA 3I5AA 2IRUA 4ZPVR 4R5PA 5B08A 1HL6A 2WVCA 2DXEA 4NOHA 4ENOA 4F26A 3DU6A 1RTHB 2L9WA 1EZZB 4CT9A 4LRCA 2BJ1A 4TXSA 1X0FA 4ZCKA 2YH1A 3OR2A 1Z4UA 4A8KA 2E5LF 5HLFA 2KG0A
chains in the Genus database with same CATH topology
4DG1B 2WSEC 3GG1A 3OQ2A 4MKYA 4QYZJ 3DLJA 2YWKA 2GX8A 1BGXT 2VZ9A 3HDSA 4BHQA 3H4DA 5E0OA 4HHJA 2HIQA 1CQNA 1HWIA 4ZVEA 3OLBA 1SJRA 4J37A 3TAMA 4CH0S 3QPIA 3R27A 4QWAA 4XPEA 2MHEA 4OZJA 3G9CA 2HHXA 4FF3A 3DI6A 2BDPA 2WONB 2J5AA 4B9LA 1M5KC 1TP7A 3BB5A 3G6VA 4K59A 5F8NA 2YKMA 1FA0A 2V4RA 4MIAA 2VQFF 1HWUA 3TA2A 1X4BA 3CC7S 1KHWA 1VHFA 2GQ2A 2HS3A 3N6MA 3W2VA 3QIPB 2FJBB 1YJWS 1R8AA 3I9ZA 5D4PA 4C0HA 5L38A 4N76A 4QWBA 1JLEB 1TK8A 4PWUA 5FDLA 1BQMB 1Y3JA 2K7JA 4I56A 4ZPDA 5EN1A 1XK8A 2IMOA 4J9SA 2CRLA 3GZ7A 2O1PA 4LFAF 3DLGB 1XBWA 2HRYA 3C8YA 4ETXA 5KT6A 3O2IA 3CT9A 1N52B 2OSRA 3KFWX 5IWAF 2ZJQQ 3DRPA 1L5UA 4WF9Q 3RTVA 1HNVB 3DRRB 2D3OR 1KLMB 1P8GA 2VBXA 2YQ3A 3L09A 3LQVA 4CZCA 2CVEA 4I7FB 5A2QY 3H25A 1FKAF 1WHXA 1X8DA 3MMCB 1RTHA 4KKOA 1FJEB 1FDAA 2NUHA 2YTCA 1VC5A 4G3IA 4WZMA 2YNGB 2CPZA 2PMHA 3MM7A 3PW0A 1TFWA 3MF5A 1C0TB 3UCGA 1KVJA 1RT7B 1RP5A 3AQPA 2X51A 3LWLA 2DR7A 1Q53A 4H4OB 4GMKA 1S79A 2K1RB 4JI3F 1C4AA 4I2QA 1FK9B 5LSRA 2HHHF 5KG7A 5KFOA 2PE8A 5I3QA 3LH2S 2NLWA 4KJIA 2FJEB 4DG1A 2B9YA 2VA3A 4GC6A 4ES2A 2GIRA 1RYSA 2LEAA 4M1KA 2MKHA 3PV8A 3NKYA 1Y9OA 2YKOA 1TVRB 4C8KA 3JTOA 3W7BA 1WNEA 2HHQA 1D9AA 3FNNA 4PXEA 2LEBA 2WONA 2ZOGA 3OL8A 3MMJA 3C46A 4QWCA 3FEZA 4X65F 2EFQA 2H9ZA 4DSLA 1U48A 1URNA 4WYLA 3CCVS 3RAQA 2C3OA 4AUKA 4DL4A 2P9EA 1FRXA 2F40A 2HQ3A 4WZQA 3UE2A 2R2SA 3G8SA 3IS9B 1HR0F 1H6KX 3JAMY 3I5CA 3CF5Q 2I0XA 2PT0A 1HNIB 3GSDA 2XZWA 4IRCA 3KMSA 1RJJA 2QA4G 3M9OB 3BO3A 4DSKA 4OHYA 1DRZA 2ZNZA 4BS2A 5CYJA 1NK7A 1A7GE 1HNVA 3DRRA 3SMZA 3VAGA 1KLMA 2ADCA 1L3UA 4I7FA 3M9MB 2FGOA 4NXNF 4YB7A 1X4HA 4Z37A 1R43A 2XB2D 3HLUA 2YNGA 1YSJA 3E8OA 4MJKA 3NCRA 1DQ9A 2DVIA 1UEVA 1ZPWX 2LA6A 1NJWA 3AAWB 3NGKA 4A8YA 1MMLA 2J0WA 4ZMMA 1N56A 4Q0BA 3U1MA 2AYMA 1R31A 3SSQA 2HZCA 1CLFA 2DCLA 4CQ1A 3UD4P 2QEXS 1U24A 3TYTA 4C8MA 3OR1A 2AJ0A 2BA9A 5FIIA 4CO2A 2DNMA 1X4AA 5AXKA 4X4RA 2X1AA 3KK2A 1T7PA 3BS9A 4DV6F 4NPOA 3RRGA 2XMTA 2AGPA 4NZ7A 1UVLA 1OIAA 1ZOTA 4LIWA 5I3PA 1ZAXA 2A2CA 2F7VA 4NYZA 2DK2A 4ES3A 2XO7A 3RRHA 2W9BB 4WJBA 5K9FA 1RTJA 2RD5C 4JV1A 2ZC4A 3NG8A 4DV0F 4IOAQ 4C11A 1FRKA 2HMIA 4C8OA 1NJYA 4G6VB 1GX6A 3FRYA 3IS9A 2ZBCA 4LSLB 4QWEA 1Y0HA 2V4QA 5DDRC 5AE3A 2R4FA 1OPZA 5CCLA 5L1IA 3PR5B 3MGJA 1D1UA 1HBNB 4KGMA 3WC0A 3ITHB 3SZ2A 1Q78A 5LXRA 2YNIA 3HZGA 1PC5A 4Q2MA 4XAKA 3BQ2A 3RW6A 4TQSA 1TR0A 2VBYA 4FS2A 4EEYA 4NCAA 4X4OA 4F4WA 4J9PA 3IG1B 1UAWA 2X1BA 2WW8A 1M5HA 4G1IA 3IGVA 1GQEA 5A6PA 4Y2MA 4DSEA 1E6YB 2CPHA 4AFFA 2XSFA 2CPIA 2CQIA 1UKUA 1UL3A 4OFZA 2LQ5A 3D5MA 4FN5A 3IA0A 2Y1JA 2DHGA 2Y0SD 1QM9A 1R8BA 2DNRA 3NWGA 5GAGU 4B9UA 4B9SA 5C24B 2G9OA 2GCFA 2UUTA 3MWBA 4HI1A 3U27A 2R7UA 5KFPA 1FTCA 2KJVA 3QIDA 1QY7A 1X0PA 1TKDA 3HXMA 2IRXA 1FRHA 3GIKA 3BDEA 5E3QA 3DM2B 3HM9A 4K4VA 2JJ4D 5G0RB 2RF2B 4PQAA 2KTQA 4Q2LA 2LDIA 4C98A 2RT3A 1FVQA 4RW4B 4ZCLA 3C6TB 3MEKA 2NSCA 3O44A 1H7WA 2F1FA 3QO9B 3T3FA 1S7HA 1HQUB 5CZXA 1S1VA 3ENQA 2W9BA 2MSTA 1VGYA 2VH7A 3RAMA 2BOPA 2ZDPA 4JI5F 5GAGI 1PGZA 2Q6CA 2D3ZA 2HLUA 3R5AA 4KFBB 2XMMA 4KSEB 4F4XA 2LXFA 2CQGA 1FJ7A 4DL2A 1KC8T 2DNNA 4LSLA 4RUHA 4X84A 4DQPA 2P9GA 3DDNA 2CPFA 4B9MA 2YH0A 1S1UB 3GFZA 3CJKB 1VIOA 4IG0A 4PQUA 1EP4B 3EGNA 2MZRA 2RE1A 3I6PA 2BM0A 3HHNB 1HBNA 1QAIA 5BYSA 4DR2F 1UJ4A 2BV3A 3FRZA 2MB0B 2OPRB 2KXFA 1R8HA 2G4BA 5GMKa 3ITHA 1N6QB 4ED1A 4EZ9A 3LANA 3ISNC 3M1VB 2J7WA 3KKFA 4UUWA 2E44A 3FSXA 3MM5B 2C28A 4X66F 2LMIA 1L3TA 4J9NA 4ICLA 3CIZA 1WELA 3ISND 2EBEA 5KG0A 2M8DB 3IFEA 1E6YA 4DQIA 2B51A 2R7VA 3IAM9 5KT7A 3V6HA 4QWDA 1U2RA 4A4JA 2PIIA 5EGYA 4OL8A 2FB0A 1EETB 2LU2A 3I0RB 1G3OA 3CD7A 4F4KA 1UMJA 2FHKA 3HVTB 1K8AT 5KFHA 3VALA 1X5TA 3RAXA 1M0SA 2DD8S 2FPHX 3I9V9 3WZ0A 5DQIA 4PUOA 1FF2A 2BACA 2J0QD 3CXCR 4R8UB 3V6DA 4C2MA 1H2UX 3DM2A 3VZIA 4AL6A 2RF2A 3E51A 2BR0A 1ZYQA 4ZPAA 3MMBB 4ZPBA 2MGZB 3C6TA 4O3RA 2KJWA 4O3QA 2YX7A 1HQUA 3OLAA 2OO4A 2DNKA 5KOXA 3L7OA 1RT1B 1GT8A 2ZHAA 1U1NA 2GV1A 2ZFHA 1LV5A 3FQKA 2ZOMA 2KKHA 1HNZF 1FD8A 1NH7A 2VFRA 5D4NA 4KFBA 3ZZRA 4RW6B 1VFJA 2QSWA 2XULA 4IRKA 5K8MA 4A8MP 1X5PA 3CCRS 4U9RA 3Q0AA 4ELTA 2FD2A 1RK8A 2Z4PA 4DUYF 1FEHA 2BXJA 4ECQA 2X1GA 3U7JA 3MUVP 3PRBA 3CJKA 1U1KA 4YDDB 1EP4A 4KHMA 4XK8C 1UJ6A 3F44A 3GV5B 3BDPA 3KYLA 3T19A 2OPRA 2CQ0A 1UVKA 1TKZB 2CQ3A 2R7OA 5DDOC 2UUCF 1SKRA 4CIOA 2IVMA 3M1VA 1H2TZ 2D41A 1U6ZA 4IQXA 4YMEA 3NMAA 1X4DA 2GQCA 1RTIB 4CTAB 2DR8A 2PO4A 1V9OA 2E9TA 2RU3A 2YKPA 4C97A 3BO2A 2DCUB 4CNYA 4QPTA 4QW9A 4CO0A 2JX2A 5IT4A 2ZVSA 1EETA 2RMLA 5L39A 4Y3CA 1MNEA 1XN9A 2JWNA 3I0RA 4LUBA 5JVHQ 2QIFA 4H4MA 1O0PA 3S01A 4CCHA 3IRWP 4MIBA 1IKVB 3HVTA 4Q44A 4KHPF 4PG7A 4J9MA 2HVHA 4WXOA 2RU9A 5A6WA 2JHEA 4HH1A 1N5SA 3BGLA 3VF0B 3BGFA 4DFMA 2QMWA 1HW9A 1XMQF