2XBVL

Factor xa in complex with a pyrrolidine-3,4-dicarboxylic acid inhibitor
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
43
Chain Sequence
CSDNGDCDQFCVVCSCARGYTLADNGKACIPTGPYPCGKQTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a Factor Xa Inhibitor (3R,4R)-1-(2,2-Difluoro-Ethyl)-Pyrrolidine-3,4-Dicarboxylic Acid 3-[(5-Chloro-Pyridin-2-Yl)-Amide] 4-{[2-Fluoro-4-(2-Oxo-2H-Pyridin-1-Yl)-Phenyl]-Amide} as a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords ACTIVATED FACTOR XA HEAVY CHAIN
total genus 7
structure length 43
sequence length 50
ec nomenclature ec 3.4.21.6: Coagulation factor Xa.
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2xbvL00
5JB9E 3HS5A 3KQEL 1PFXL 5JBAE 3SOVA 4Y7BB 5EGMB 1FAKL 1IQML 2VWOL 1O5DL 2Y7XB 2G00L 1FAXL 2EI8B 4Y79B 3NJPC 2FD6A 2FLRL 1TOZA 4ZXXL 5COXA 3KQCL 2P3UA 1XFEA 1JV2B 2YGPA 1IOEL 2ADXA 4Y76B 3HO3A 1IQEL 4O1ZA 2XBXL 1KLJL 3SW2A 4RRWA 1LPGA 2J4IB 4X8TL 1G2LB 4CUDA 4JZDL 2WPHE 1OB1C 4A7IA 1NT0A 1P0SL 1PRHA 3LC5B 1G2MB 3ZYIB 3HPTA 2WFTA 1Z6EL 4JZEL 4CUFA 1P9JA 1Z6CA 3KRKA 5CKMA 1HX2A 1V3XB 2Q1JB 3KQBL 3N8YB 1DDXA 3C9AC 4MMYB 1ATDA 2KB9A 1XKBA 2BQ6A 4TGFA 5L2YL 1WU1B 3P5BL 2EI7B 4COXA 1NFYB 2P95L 3F1SB 2P28B 2YGOA 4JZFL 4RRXA 1COUA 1NFWB 1IQLL 1YUFA 2Y80B 2OYUP 3HS7A 2VWLL 2WFXB 5FDQA 1HZ8A 1HT8A 2F9BL 1L3YA 2OYEP 1IVOC 3OLTA 4RRYA 2BMGA 2RNLA 1IQNL 1I0UA 1F0RB 2DDUA 1IJQA 2VWNL 1KLOA 5JB8E 4XL1A 4BDXA 2VVVL 1EZQB 1N1IA 4Z6AL 2WPLE 3CA7A 4NG9L 1F7MA 1KIGL 2M74A 4X8VL 3LTFB 2P93L 3LC3B 1NQLB 4Y71B 2WYGB 3KQDL 1LPZA 3SOQA 5IKVA 1K36A 4D0EA 2WG3C 2FLGA 3BPSE 1EQGA 1ATBA 4OTYA 3EGFA 1LQDA 3V64C 4C16A 1EPGA 1FFMA 1A3PA 2UWLB 1F0SB 1NFXB 4NA9L 3QCWA 3ASIA 4Y7AB 4JYUL 2UWOB 2W86A 2WG4B 2AYLA 2XC5L 3TH3L 1UZQA 1WHFA 2H9EL 3KK6A 3RR3A 5CKQA 2K2TA 1EBVA 1EGFA 1DX5I 4JYVL 4ZH8B 3ENSA 4CSYA 2BOKL 1U67A 2VVCK 1LMJA 2W2NE 5JBBE 1TLEA 1G1RA 2PR3B 3KCGL 3V65B 1HRFA 1EMNA 1HT5A 5JVZA 1EPIA 1NPEB 1YUKB 1JL9A 4E1GA 2W2QE 2I9BA 3N8ZA 3NTGA 3HO4A 4Z0KB 2RHPA 1X7AL 3GCWE 4BTIA 1FSBA 1CCFA 4RS0A 2WPKE 3TBDA 5E8DA 1LPKA 1IGXA 2BOHA 1XKAL 4Z0LA 3QH0A 3HS6A 1CVUA 1TPGA 2KV4A 3FFGL 1IQFL 1JBUL 2W3IB 5JVYA 2VJ3A 4ZAEB 4X8UL 4XLWA 2PHBB 4PH9A 4LORA 1F7EA 3ELAL 1IQJL 5L30L 3GISX 2VH6B 4AQTA 2P16L 2XBWL 1MQ5L 3IJEB 1BF9A 2XC4L 1KLIL 2JKHL 4YT6L 2J94B 1N7DA 3IITB 1EPJA 3BT1A 4ZXYL 3FBYA 3TZIA 1HAEA 3N8WB 3HO5A 4YT7L 1G1TA 3MQEA 1HREA 3FCSB 4G1MB 1G1QA 3N8WA 2FLBL 1CQEA 3LAQA 1FE2A 1ZAQA 5CISA 5JBCE 2P3FL 2I9AA 1K37A 2Y5HL 2P3TA 1SZBA 2P94L 1UZKA 4O02B 2P3FN 1UZPA 3GCXE 1HJ7A 3TK5B 4BTTA 2VVUL 2WYJB 1URKA 2TGFA 3M36L 1RFNB 2BZ6L 4RUTA 2MGRA 2W26B 3K9XA 2VH0B 4OTJA 3CFWA 3LTGD 2Y5GL 1FF7A 3BT2A 2BQ7A 1PXXA 3NT1A 3N8VA 4BTUA 4CUEA 2UWPB 1DIYA 1YO8A 1CX2A 1Q4GA 1HCGB 1YGCL 2XC0L 1EQHA 3SOBB 1CVWL 1W7XL 3U73A 1MOXC 2WPIE 3QMOA 2NPRA 1EMOA 1EAIC 3MDLA 4D90A 5I46L 2BOXA 2Y38A 1IQHL 3U7UG 3LN0A 3POYA 2J34B 2RA0L 3CS7L 5KIRA 6COXA 3LIWB 1WHEA 5F1AA 2EI6B 1G1SA 2GD4A 1ATEA 2XBYL 4M10A 5IKTA 1PTHA 2MHPA 4BXWA 2FZZL 2J2UB 2WPJE 5IKQA 1IP0A 2MGPA 2W2OE 1APOA 5KN5C 2P26A 4M11A 4MMZB 1AUTL 1IQGL 1PGEA 1B9WA 4Y6DB 1ADXA 4ZHAB 1KSNB 1CEJA 2CJIB 1FJSL 2D1JB 2XBVL 1M1XB 3ZYJB 4BXSA 1C5MF 1IQKL 1XDTR 1UZJA 1J9CL 1GK5A 2Y82B 3NTBA 3ZYGA 5CKNA 2Y7ZB 3LN1A 4BDWA 1DQBA 1HAFA 1APQA 3M37L 5K0HB 3OLUA 3PGHA 4FM5A 2BOUA 4YZUB 2B7DL 4RRZA 2W2ME 2KL7A 4LMFA 1CCVA 2Y81B 4X8SL 3R05A 1IGZA 2W3KB 2BO2A 3Q7DA 5F19A 5L2ZL 4MMXB 3H5CB 1ATAA 3TK6B 3N8XA 5IKRA 2PUQL 1W8BL 1U8CB 4ISIL 3CENL 1NFUB 3F6UL 2K2SB 1YUGA 3DEMA 3KL6B 1IOXA 2WPME 2BQWA 2J38B 1IQIL 2J95B 3N8YA 3Q3KB 2W2PE 5JW1A 3TGFA 1DVAL 4ISHL 1NZIA 2VWMK 4D0FA 1QFKL 4NGAL 2Y5FL 4XBMA 1L5GB 1MQ6L 1EPHA
chains in the Genus database with same CATH superfamily
5JB9E 3HS5A 3KQEL 1PFXL 5JBAE 3SOVA 4Y7BB 5EGMB 1FAKL 1IQML 2VWOL 1O5DL 2Y7XB 2G00L 1FAXL 2EI8B 4Y79B 3NJPC 2FD6A 2FLRL 1LMMA 1TOZA 4ZXXL 5COXA 3KQCL 2P3UA 1XFEA 1JV2B 2YGPA 1IOEL 2ADXA 4Y76B 3HO3A 1IQEL 4O1ZA 2XBXL 1KLJL 3SW2A 4RRWA 1LPGA 2J4IB 4X8TL 1G2LB 4CUDA 4JZDL 2WPHE 1OB1C 4A7IA 1NT0A 1P0SL 1PRHA 3LC5B 1G2MB 3ZYIB 2WZPP 3HPTA 2WFTA 1Z6EL 4JZEL 4CUFA 1P9JA 1Z6CA 3KRKA 5CKMA 1HX2A 1V3XB 2Q1JB 3KQBL 3N8YB 1DDXA 3C9AC 4MMYB 1ATDA 2JJLA 2KB9A 1XKBA 2BQ6A 4TGFA 5L2YL 1WU1B 3P5BL 2EI7B 4COXA 1NFYB 2P95L 4GU4A 3F1SB 2P28B 2YGOA 4JZFL 4RRXA 1COUA 1NFWB 1IQLL 1YUFA 2Y80B 2OYUP 3HS7A 2VWLL 2WFXB 5FDQA 1HZ8A 1HT8A 2F9BL 1L3YA 2OYEP 1IVOC 3OLTA 1V1HA 4RRYA 2BMGA 2RNLA 1IQNL 1I0UA 1F0RB 2DDUA 1IJQA 2VWNL 1KLOA 5JB8E 4XL1A 4BDXA 2VVVL 1EZQB 1N1IA 4Z6AL 2WPLE 3CA7A 4NG9L 1F7MA 1KIGL 2M74A 4X8VL 3LTFB 2P93L 3LC3B 1NQLB 4Y71B 2WYGB 3KQDL 1LPZA 3SOQA 5IKVA 1K36A 4D0EA 2WG3C 2FLGA 3BPSE 1EQGA 1LK9A 1ATBA 4OTYA 3EGFA 1LQDA 3V64C 4C16A 1EPGA 1FFMA 1A3PA 2UWLB 1F0SB 1NFXB 4NA9L 3QCWA 3ASIA 4Y7AB 4JYUL 2UWOB 2W86A 2WG4B 2AYLA 2XC5L 3TH3L 1UZQA 1WHFA 2H9EL 3KK6A 3RR3A 5CKQA 2K2TA 1EBVA 1EGFA 1DX5I 4JYVL 4ZH8B 3ENSA 4CSYA 2BOKL 1U67A 2VVCK 1LMJA 2W2NE 5JBBE 1TLEA 1G1RA 2PR3B 3KCGL 3V65B 1HRFA 1EMNA 1HT5A 5JVZA 1EPIA 1NPEB 1YUKB 1JL9A 4E1GA 2W2QE 2I9BA 3N8ZA 3NTGA 3HO4A 4Z0KB 2RHPA 1X7AL 3GCWE 4BTIA 1FSBA 1CCFA 4RS0A 2WPKE 3TBDA 5E8DA 1LPKA 1IGXA 2BOHA 1XKAL 4Z0LA 3QH0A 3HS6A 1CVUA 1TPGA 2KV4A 3FFGL 1IQFL 1JBUL 2W3IB 5JVYA 2VJ3A 4ZAEB 4X8UL 4XLWA 2PHBB 4PH9A 4LORA 1F7EA 3ELAL 1IQJL 5L30L 3GISX 2VH6B 4AQTA 2P16L 2XBWL 1MQ5L 3IJEB 2KNIA 1BF9A 2XC4L 1KLIL 2JKHL 4YT6L 2J94B 1N7DA 3IITB 1EPJA 3BT1A 4ZXYL 3FBYA 3TZIA 1HAEA 3N8WB 3HO5A 4YT7L 1G1TA 3MQEA 1HREA 3FCSB 4G1MB 1G1QA 3N8WA 2FLBL 1CQEA 3LAQA 2HOXA 1FE2A 1ZAQA 5CISA 5JBCE 2P3FL 2I9AA 1K37A 2Y5HL 2P3TA 1SZBA 2P94L 1UZKA 4O02B 2P3FN 1UZPA 3GCXE 1HJ7A 2H9EC 3TK5B 4BTTA 2VVUL 2WYJB 1URKA 2TGFA 3M36L 1RFNB 2BZ6L 4RUTA 2MGRA 2W26B 3K9XA 2VH0B 4OTJA 3CFWA 3LTGD 2Y5GL 4GU3A 1FF7A 2VRSA 3BT2A 2BQ7A 1PXXA 3NT1A 3N8VA 4BTUA 4CUEA 2UWPB 1DIYA 1YO8A 1CX2A 1Q4GA 1HCGB 1YGCL 2XC0L 1EQHA 3SOBB 1CVWL 1W7XL 3U73A 1MOXC 2WPIE 3QMOA 2NPRA 1EMOA 2HORA 1EAIC 3MDLA 4D90A 5I46L 2BOXA 2Y38A 1IQHL 3U7UG 3LN0A 3POYA 2J34B 2RA0L 3CS7L 5KIRA 6COXA 3LIWB 4A94C 1WHEA 1QIUA 5F1AA 2EI6B 1G1SA 2GD4A 1ATEA 2XBYL 4M10A 5IKTA 1PTHA 2MHPA 4BXWA 2FZZL 2J2UB 2WPJE 5IKQA 1IP0A 2MGPA 2W2OE 1APOA 5KN5C 2P26A 4M11A 4MMZB 1AUTL 1IQGL 1PGEA 1B9WA 4Y6DB 1ADXA 4ZHAB 1KSNB 1CEJA 2CJIB 1FJSL 2D1JB 2XBVL 1M1XB 3ZYJB 1KKEA 1C5MF 1IQKL 4BXSA 1XDTR 1UZJA 1J9CL 1GK5A 2Y82B 3NTBA 3ZYGA 5CKNA 2Y7ZB 3LN1A 4BDWA 1DQBA 1HAFA 1APQA 3M37L 5K0HB 3OLUA 3PGHA 4FM5A 2BOUA 4YZUB 2B7DL 4RRZA 2W2ME 2KL7A 4LMFA 2BSFA 1CCVA 2Y81B 4X8SL 3R05A 1IGZA 2W3KB 3S6XA 2BO2A 3Q7DA 5F19A 5L2ZL 4MMXB 3H5CB 1ATAA 3TK6B 3N8XA 5IKRA 2PUQL 1W8BL 1U8CB 4ISIL 3CENL 1NFUB 3F6UL 2K2SB 1YUGA 3DEMA 3KL6B 1IOXA 2WPME 2BQWA 2J38B 1V1IA 1IQIL 2YGQA 2J95B 3N8YA 3Q3KB 2W2PE 5JW1A 3TGFA 1DVAL 2BT8A 4ISHL 1NZIA 2VWMK 2BT7A 4D0FA 1QFKL 4NGAL 2Y5FL 4XBMA 1L5GB 1MQ6L 1EPHA
chains in the Genus database with same CATH topology
5JB9E 3HS5A 3KQEL 1PFXL 5JBAE 3SOVA 4Y7BB 5EGMB 1FAKL 1IQML 2VWOL 1O5DL 2Y7XB 2G00L 1FAXL 2EI8B 4Y79B 3NJPC 2FD6A 2FLRL 1LMMA 1TOZA 4ZXXL 5COXA 3KQCL 2P3UA 1XFEA 1JV2B 2YGPA 1IOEL 2ADXA 4Y76B 3HO3A 1IQEL 4O1ZA 2XBXL 1KLJL 3SW2A 4RRWA 1LPGA 2J4IB 4X8TL 1G2LB 4CUDA 4JZDL 2WPHE 1OB1C 4A7IA 1NT0A 1P0SL 1PRHA 3LC5B 1G2MB 3ZYIB 2WZPP 3HPTA 2WFTA 1Z6EL 4JZEL 4CUFA 1P9JA 1Z6CA 3KRKA 5CKMA 1HX2A 1V3XB 2Q1JB 3KQBL 3N8YB 1DDXA 3C9AC 4MMYB 1ATDA 2KB9A 1XKBA 2BQ6A 4TGFA 5L2YL 1WU1B 3P5BL 2EI7B 4COXA 1NFYB 2P95L 3F1SB 2P28B 2YGOA 4JZFL 4RRXA 1COUA 1NFWB 1IQLL 1YUFA 2Y80B 2OYUP 3HS7A 2VWLL 2WFXB 5FDQA 1HZ8A 1HT8A 2F9BL 1L3YA 2OYEP 1IVOC 3OLTA 4RRYA 2BMGA 2RNLA 1IQNL 1I0UA 1F0RB 2DDUA 1IJQA 2VWNL 1KLOA 5JB8E 4XL1A 4BDXA 2VVVL 1EZQB 1N1IA 4Z6AL 2WPLE 3CA7A 4NG9L 1F7MA 1KIGL 2M74A 4X8VL 3LTFB 2P93L 3LC3B 1NQLB 4Y71B 2WYGB 3KQDL 1LPZA 3SOQA 5IKVA 1K36A 4D0EA 2WG3C 2FLGA 3BPSE 1EQGA 1ATBA 4OTYA 3EGFA 1LQDA 3V64C 4C16A 1EPGA 1FFMA 1A3PA 2UWLB 1F0SB 1NFXB 4NA9L 3QCWA 3ASIA 4Y7AB 4JYUL 2UWOB 2W86A 2WG4B 2AYLA 2XC5L 3TH3L 1UZQA 1WHFA 2H9EL 3KK6A 3RR3A 5CKQA 2K2TA 1EBVA 1EGFA 1DX5I 4JYVL 4ZH8B 3ENSA 4CSYA 2BOKL 1U67A 2VVCK 1LMJA 2W2NE 5JBBE 1TLEA 1G1RA 2PR3B 3KCGL 3V65B 1HRFA 1EMNA 1HT5A 5JVZA 1EPIA 1NPEB 1YUKB 1JL9A 4E1GA 2W2QE 2I9BA 3N8ZA 3NTGA 3HO4A 4Z0KB 2RHPA 1X7AL 3GCWE 4BTIA 1FSBA 1CCFA 4RS0A 2WPKE 3TBDA 5E8DA 1LPKA 1IGXA 2BOHA 1XKAL 4Z0LA 3QH0A 3HS6A 1CVUA 1TPGA 2KV4A 3FFGL 1IQFL 1JBUL 2W3IB 5JVYA 2VJ3A 4ZAEB 4X8UL 4XLWA 2PHBB 4PH9A 4LORA 1F7EA 3ELAL 1IQJL 5L30L 3GISX 2VH6B 4AQTA 2P16L 2XBWL 1MQ5L 3IJEB 2KNIA 1BF9A 2XC4L 1KLIL 2JKHL 4YT6L 2J94B 1N7DA 3IITB 1EPJA 3BT1A 4ZXYL 3FBYA 3TZIA 1HAEA 3N8WB 3HO5A 4YT7L 1G1TA 3MQEA 1HREA 3FCSB 4G1MB 1G1QA 3N8WA 2FLBL 1CQEA 3LAQA 1FE2A 1ZAQA 5CISA 5JBCE 2P3FL 2I9AA 1K37A 2Y5HL 2P3TA 1SZBA 2P94L 1UZKA 4O02B 2P3FN 1UZPA 3GCXE 1HJ7A 2H9EC 3TK5B 4BTTA 2VVUL 2WYJB 1URKA 2TGFA 3M36L 1RFNB 2BZ6L 4RUTA 2MGRA 2W26B 3K9XA 2VH0B 4OTJA 3CFWA 3LTGD 2Y5GL 1FF7A 3BT2A 2BQ7A 1PXXA 3NT1A 3N8VA 4BTUA 4CUEA 2UWPB 1DIYA 1YO8A 1CX2A 1Q4GA 1HCGB 1YGCL 2XC0L 1EQHA 3SOBB 1CVWL 1W7XL 3U73A 1MOXC 2WPIE 3QMOA 2NPRA 1EMOA 1EAIC 3MDLA 4D90A 5I46L 2BOXA 2Y38A 1IQHL 3U7UG 3LN0A 3POYA 2J34B 2RA0L 3CS7L 5KIRA 6COXA 3LIWB 4A94C 1WHEA 5F1AA 2EI6B 1G1SA 2GD4A 1ATEA 2XBYL 4M10A 5IKTA 1PTHA 2MHPA 4BXWA 2FZZL 2J2UB 2WPJE 5IKQA 1IP0A 2MGPA 2W2OE 1APOA 5KN5C 2P26A 4M11A 4MMZB 1AUTL 1IQGL 1PGEA 1B9WA 4Y6DB 1ADXA 4ZHAB 1KSNB 1CEJA 2CJIB 1FJSL 2D1JB 2XBVL 1M1XB 3ZYJB 4BXSA 1C5MF 1IQKL 1XDTR 1UZJA 1J9CL 1GK5A 2Y82B 3NTBA 3ZYGA 5CKNA 2Y7ZB 3LN1A 4BDWA 1DQBA 1HAFA 1APQA 3M37L 5K0HB 3OLUA 3PGHA 4FM5A 2BOUA 4YZUB 2B7DL 4RRZA 2W2ME 2KL7A 4LMFA 1CCVA 2Y81B 4X8SL 3R05A 1IGZA 2W3KB 3S6XA 2BO2A 3Q7DA 5F19A 5L2ZL 4MMXB 3H5CB 1ATAA 3TK6B 3N8XA 5IKRA 2PUQL 1W8BL 1U8CB 4ISIL 3CENL 1NFUB 3F6UL 2K2SB 1YUGA 3DEMA 3KL6B 1IOXA 2WPME 2BQWA 2J38B 1IQIL 2YGQA 2J95B 3N8YA 3Q3KB 2W2PE 5JW1A 3TGFA 1DVAL 4ISHL 1NZIA 2VWMK 4D0FA 1QFKL 4NGAL 2Y5FL 4XBMA 1L5GB 1MQ6L 1EPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JB9 E;  3HS5 A;  3KQE L;  1PFX L;  5JBA E;  3SOV A;  4Y7B B;  5EGM B;  1FAK L;  1IQM L;  2VWO L;  1O5D L;  2Y7X B;  2G00 L;  1FAX L;  2EI8 B;  4Y79 B;  3NJP C;  2FD6 A;  2FLR L;  1TOZ A;  4ZXX L;  5COX A;  3KQC L;  2P3U A;  1XFE A;  1JV2 B;  2YGP A;  1IOE L;  2ADX A;  4Y76 B;  3HO3 A;  1IQE L;  4O1Z A;  2XBX L;  1KLJ L;  3SW2 A;  4RRW A;  1LPG A;  2J4I B;  4X8T L;  1G2L B;  4CUD A;  4JZD L;  2WPH E;  1OB1 C;  4A7I A;  1NT0 A;  1P0S L;  1PRH A;  3LC5 B;  1G2M B;  3ZYI B;  3HPT A;  2WFT A;  1Z6E L;  4JZE L;  4CUF A;  1P9J A;  1Z6C A;  3KRK A;  5CKM A;  1HX2 A;  1V3X B;  2Q1J B;  3KQB L;  3N8Y B;  1DDX A;  3C9A C;  4MMY B;  1ATD A;  2KB9 A;  1XKB A;  2BQ6 A;  4TGF A;  5L2Y L;  1WU1 B;  3P5B L;  2EI7 B;  4COX A;  1NFY B;  2P95 L;  3F1S B;  2P28 B;  2YGO A;  4JZF L;  4RRX A;  1COU A;  1NFW B;  1IQL L;  1YUF A;  2Y80 B;  2OYU P;  3HS7 A;  2VWL L;  2WFX B;  5FDQ A;  1HZ8 A;  1HT8 A;  2F9B L;  1L3Y A;  2OYE P;  1IVO C;  3OLT A;  4RRY A;  2BMG A;  2RNL A;  1IQN L;  1I0U A;  1F0R B;  2DDU A;  1IJQ A;  2VWN L;  1KLO A;  5JB8 E;  4XL1 A;  4BDX A;  2VVV L;  1EZQ B;  1N1I A;  4Z6A L;  2WPL E;  3CA7 A;  4NG9 L;  1F7M A;  1KIG L;  2M74 A;  4X8V L;  3LTF B;  2P93 L;  3LC3 B;  1NQL B;  4Y71 B;  2WYG B;  3KQD L;  1LPZ A;  3SOQ A;  5IKV A;  1K36 A;  4D0E A;  2WG3 C;  2FLG A;  3BPS E;  1EQG A;  1ATB A;  4OTY A;  3EGF A;  1LQD A;  3V64 C;  4C16 A;  1EPG A;  1FFM A;  1A3P A;  2UWL B;  1F0S B;  1NFX B;  4NA9 L;  3QCW A;  3ASI A;  4Y7A B;  4JYU L;  2UWO B;  2W86 A;  2WG4 B;  2AYL A;  2XC5 L;  3TH3 L;  1UZQ A;  1WHF A;  2H9E L;  3KK6 A;  3RR3 A;  5CKQ A;  2K2T A;  1EBV A;  1EGF A;  1DX5 I;  4JYV L;  4ZH8 B;  3ENS A;  4CSY A;  2BOK L;  1U67 A;  2VVC K;  1LMJ A;  2W2N E;  5JBB E;  1TLE A;  1G1R A;  2PR3 B;  3KCG L;  3V65 B;  1HRF A;  1EMN A;  1HT5 A;  5JVZ A;  1EPI A;  1NPE B;  1YUK B;  1JL9 A;  4E1G A;  2W2Q E;  2I9B A;  3N8Z A;  3NTG A;  3HO4 A;  4Z0K B;  2RHP A;  1X7A L;  3GCW E;  4BTI A;  1FSB A;  1CCF A;  4RS0 A;  2WPK E;  3TBD A;  5E8D A;  1LPK A;  1IGX A;  2BOH A;  1XKA L;  4Z0L A;  3QH0 A;  3HS6 A;  1CVU A;  1TPG A;  2KV4 A;  3FFG L;  1IQF L;  1JBU L;  2W3I B;  5JVY A;  2VJ3 A;  4ZAE B;  4X8U L;  4XLW A;  2PHB B;  4PH9 A;  4LOR A;  1F7E A;  3ELA L;  1IQJ L;  5L30 L;  3GIS X;  2VH6 B;  4AQT A;  2P16 L;  2XBW L;  1MQ5 L;  3IJE B;  1BF9 A;  2XC4 L;  1KLI L;  2JKH L;  4YT6 L;  2J94 B;  1N7D A;  3IIT B;  1EPJ A;  3BT1 A;  4ZXY L;  3FBY A;  3TZI A;  1HAE A;  3N8W B;  3HO5 A;  4YT7 L;  1G1T A;  3MQE A;  1HRE A;  3FCS B;  4G1M B;  1G1Q A;  3N8W A;  2FLB L;  1CQE A;  3LAQ A;  1FE2 A;  1ZAQ A;  5CIS A;  5JBC E;  2P3F L;  2I9A A;  1K37 A;  2Y5H L;  2P3T A;  1SZB A;  2P94 L;  1UZK A;  4O02 B;  2P3F N;  1UZP A;  3GCX E;  1HJ7 A;  3TK5 B;  4BTT A;  2VVU L;  2WYJ B;  1URK A;  2TGF A;  3M36 L;  1RFN B;  2BZ6 L;  4RUT A;  2MGR A;  2W26 B;  3K9X A;  2VH0 B;  4OTJ A;  3CFW A;  3LTG D;  2Y5G L;  1FF7 A;  3BT2 A;  2BQ7 A;  1PXX A;  3NT1 A;  3N8V A;  4BTU A;  4CUE A;  2UWP B;  1DIY A;  1YO8 A;  1CX2 A;  1Q4G A;  1HCG B;  1YGC L;  2XC0 L;  1EQH A;  3SOB B;  1CVW L;  1W7X L;  3U73 A;  1MOX C;  2WPI E;  3QMO A;  2NPR A;  1EMO A;  1EAI C;  3MDL A;  4D90 A;  5I46 L;  2BOX A;  2Y38 A;  1IQH L;  3U7U G;  3LN0 A;  3POY A;  2J34 B;  2RA0 L;  3CS7 L;  5KIR A;  6COX A;  3LIW B;  1WHE A;  5F1A A;  2EI6 B;  1G1S A;  2GD4 A;  1ATE A;  2XBY L;  4M10 A;  5IKT A;  1PTH A;  2MHP A;  4BXW A;  2FZZ L;  2J2U B;  2WPJ E;  5IKQ A;  1IP0 A;  2MGP A;  2W2O E;  1APO A;  5KN5 C;  2P26 A;  4M11 A;  4MMZ B;  1AUT L;  1IQG L;  1PGE A;  1B9W A;  4Y6D B;  1ADX A;  4ZHA B;  1KSN B;  1CEJ A;  2CJI B;  1FJS L;  2D1J B;  2XBV L;  1M1X B;  3ZYJ B;  4BXS A;  1C5M F;  1IQK L;  1XDT R;  1UZJ A;  1J9C L;  1GK5 A;  2Y82 B;  3NTB A;  3ZYG A;  5CKN A;  2Y7Z B;  3LN1 A;  4BDW A;  1DQB A;  1HAF A;  1APQ A;  3M37 L;  5K0H B;  3OLU A;  3PGH A;  4FM5 A;  2BOU A;  4YZU B;  2B7D L;  4RRZ A;  2W2M E;  2KL7 A;  4LMF A;  1CCV A;  2Y81 B;  4X8S L;  3R05 A;  1IGZ A;  2W3K B;  2BO2 A;  3Q7D A;  5F19 A;  5L2Z L;  4MMX B;  3H5C B;  1ATA A;  3TK6 B;  3N8X A;  5IKR A;  2PUQ L;  1W8B L;  1U8C B;  4ISI L;  3CEN L;  1NFU B;  3F6U L;  2K2S B;  1YUG A;  3DEM A;  3KL6 B;  1IOX A;  2WPM E;  2BQW A;  2J38 B;  1IQI L;  2J95 B;  3N8Y A;  3Q3K B;  2W2P E;  5JW1 A;  3TGF A;  1DVA L;  4ISH L;  1NZI A;  2VWM K;  4D0F A;  1QFK L;  4NGA L;  2Y5F L;  4XBM A;  1L5G B;  1MQ6 L;  1EPH A; 
#chains in the Genus database with same CATH topology
 5JB9 E;  3HS5 A;  3KQE L;  1PFX L;  5JBA E;  3SOV A;  4Y7B B;  5EGM B;  1FAK L;  1IQM L;  2VWO L;  1O5D L;  2Y7X B;  2G00 L;  1FAX L;  2EI8 B;  4Y79 B;  3NJP C;  2FD6 A;  2FLR L;  1LMM A;  1TOZ A;  4ZXX L;  5COX A;  3KQC L;  2P3U A;  1XFE A;  1JV2 B;  2YGP A;  1IOE L;  2ADX A;  4Y76 B;  3HO3 A;  1IQE L;  4O1Z A;  2XBX L;  1KLJ L;  3SW2 A;  4RRW A;  1LPG A;  2J4I B;  4X8T L;  1G2L B;  4CUD A;  4JZD L;  2WPH E;  1OB1 C;  4A7I A;  1NT0 A;  1P0S L;  1PRH A;  3LC5 B;  1G2M B;  3ZYI B;  2WZP P;  3HPT A;  2WFT A;  1Z6E L;  4JZE L;  4CUF A;  1P9J A;  1Z6C A;  3KRK A;  5CKM A;  1HX2 A;  1V3X B;  2Q1J B;  3KQB L;  3N8Y B;  1DDX A;  3C9A C;  4MMY B;  1ATD A;  2JJL A;  2KB9 A;  1XKB A;  2BQ6 A;  4TGF A;  5L2Y L;  1WU1 B;  3P5B L;  2EI7 B;  4COX A;  1NFY B;  2P95 L;  4GU4 A;  3F1S B;  2P28 B;  2YGO A;  4JZF L;  4RRX A;  1COU A;  1NFW B;  1IQL L;  1YUF A;  2Y80 B;  2OYU P;  3HS7 A;  2VWL L;  2WFX B;  5FDQ A;  1HZ8 A;  1HT8 A;  2F9B L;  1L3Y A;  2OYE P;  1IVO C;  3OLT A;  1V1H A;  4RRY A;  2BMG A;  2RNL A;  1IQN L;  1I0U A;  1F0R B;  2DDU A;  1IJQ A;  2VWN L;  1KLO A;  5JB8 E;  4XL1 A;  4BDX A;  2VVV L;  1EZQ B;  1N1I A;  4Z6A L;  2WPL E;  3CA7 A;  4NG9 L;  1F7M A;  1KIG L;  2M74 A;  4X8V L;  3LTF B;  2P93 L;  3LC3 B;  1NQL B;  4Y71 B;  2WYG B;  3KQD L;  1LPZ A;  3SOQ A;  5IKV A;  1K36 A;  4D0E A;  2WG3 C;  2FLG A;  3BPS E;  1EQG A;  1LK9 A;  1ATB A;  4OTY A;  3EGF A;  1LQD A;  3V64 C;  4C16 A;  1EPG A;  1FFM A;  1A3P A;  2UWL B;  1F0S B;  1NFX B;  4NA9 L;  3QCW A;  3ASI A;  4Y7A B;  4JYU L;  2UWO B;  2W86 A;  2WG4 B;  2AYL A;  2XC5 L;  3TH3 L;  1UZQ A;  1WHF A;  2H9E L;  3KK6 A;  3RR3 A;  5CKQ A;  2K2T A;  1EBV A;  1EGF A;  1DX5 I;  4JYV L;  4ZH8 B;  3ENS A;  4CSY A;  2BOK L;  1U67 A;  2VVC K;  1LMJ A;  2W2N E;  5JBB E;  1TLE A;  1G1R A;  2PR3 B;  3KCG L;  3V65 B;  1HRF A;  1EMN A;  1HT5 A;  5JVZ A;  1EPI A;  1NPE B;  1YUK B;  1JL9 A;  4E1G A;  2W2Q E;  2I9B A;  3N8Z A;  3NTG A;  3HO4 A;  4Z0K B;  2RHP A;  1X7A L;  3GCW E;  4BTI A;  1FSB A;  1CCF A;  4RS0 A;  2WPK E;  3TBD A;  5E8D A;  1LPK A;  1IGX A;  2BOH A;  1XKA L;  4Z0L A;  3QH0 A;  3HS6 A;  1CVU A;  1TPG A;  2KV4 A;  3FFG L;  1IQF L;  1JBU L;  2W3I B;  5JVY A;  2VJ3 A;  4ZAE B;  4X8U L;  4XLW A;  2PHB B;  4PH9 A;  4LOR A;  1F7E A;  3ELA L;  1IQJ L;  5L30 L;  3GIS X;  2VH6 B;  4AQT A;  2P16 L;  2XBW L;  1MQ5 L;  3IJE B;  2KNI A;  1BF9 A;  2XC4 L;  1KLI L;  2JKH L;  4YT6 L;  2J94 B;  1N7D A;  3IIT B;  1EPJ A;  3BT1 A;  4ZXY L;  3FBY A;  3TZI A;  1HAE A;  3N8W B;  3HO5 A;  4YT7 L;  1G1T A;  3MQE A;  1HRE A;  3FCS B;  4G1M B;  1G1Q A;  3N8W A;  2FLB L;  1CQE A;  3LAQ A;  2HOX A;  1FE2 A;  1ZAQ A;  5CIS A;  5JBC E;  2P3F L;  2I9A A;  1K37 A;  2Y5H L;  2P3T A;  1SZB A;  2P94 L;  1UZK A;  4O02 B;  2P3F N;  1UZP A;  3GCX E;  1HJ7 A;  2H9E C;  3TK5 B;  4BTT A;  2VVU L;  2WYJ B;  1URK A;  2TGF A;  3M36 L;  1RFN B;  2BZ6 L;  4RUT A;  2MGR A;  2W26 B;  3K9X A;  2VH0 B;  4OTJ A;  3CFW A;  3LTG D;  2Y5G L;  4GU3 A;  1FF7 A;  2VRS A;  3BT2 A;  2BQ7 A;  1PXX A;  3NT1 A;  3N8V A;  4BTU A;  4CUE A;  2UWP B;  1DIY A;  1YO8 A;  1CX2 A;  1Q4G A;  1HCG B;  1YGC L;  2XC0 L;  1EQH A;  3SOB B;  1CVW L;  1W7X L;  3U73 A;  1MOX C;  2WPI E;  3QMO A;  2NPR A;  1EMO A;  2HOR A;  1EAI C;  3MDL A;  4D90 A;  5I46 L;  2BOX A;  2Y38 A;  1IQH L;  3U7U G;  3LN0 A;  3POY A;  2J34 B;  2RA0 L;  3CS7 L;  5KIR A;  6COX A;  3LIW B;  4A94 C;  1WHE A;  1QIU A;  5F1A A;  2EI6 B;  1G1S A;  2GD4 A;  1ATE A;  2XBY L;  4M10 A;  5IKT A;  1PTH A;  2MHP A;  4BXW A;  2FZZ L;  2J2U B;  2WPJ E;  5IKQ A;  1IP0 A;  2MGP A;  2W2O E;  1APO A;  5KN5 C;  2P26 A;  4M11 A;  4MMZ B;  1AUT L;  1IQG L;  1PGE A;  1B9W A;  4Y6D B;  1ADX A;  4ZHA B;  1KSN B;  1CEJ A;  2CJI B;  1FJS L;  2D1J B;  2XBV L;  1M1X B;  3ZYJ B;  1KKE A;  1C5M F;  1IQK L;  4BXS A;  1XDT R;  1UZJ A;  1J9C L;  1GK5 A;  2Y82 B;  3NTB A;  3ZYG A;  5CKN A;  2Y7Z B;  3LN1 A;  4BDW A;  1DQB A;  1HAF A;  1APQ A;  3M37 L;  5K0H B;  3OLU A;  3PGH A;  4FM5 A;  2BOU A;  4YZU B;  2B7D L;  4RRZ A;  2W2M E;  2KL7 A;  4LMF A;  2BSF A;  1CCV A;  2Y81 B;  4X8S L;  3R05 A;  1IGZ A;  2W3K B;  3S6X A;  2BO2 A;  3Q7D A;  5F19 A;  5L2Z L;  4MMX B;  3H5C B;  1ATA A;  3TK6 B;  3N8X A;  5IKR A;  2PUQ L;  1W8B L;  1U8C B;  4ISI L;  3CEN L;  1NFU B;  3F6U L;  2K2S B;  1YUG A;  3DEM A;  3KL6 B;  1IOX A;  2WPM E;  2BQW A;  2J38 B;  1V1I A;  1IQI L;  2YGQ A;  2J95 B;  3N8Y A;  3Q3K B;  2W2P E;  5JW1 A;  3TGF A;  1DVA L;  2BT8 A;  4ISH L;  1NZI A;  2VWM K;  2BT7 A;  4D0F A;  1QFK L;  4NGA L;  2Y5F L;  4XBM A;  1L5G B;  1MQ6 L;  1EPH A; 
#chains in the Genus database with same CATH homology
 5JB9 E;  3HS5 A;  3KQE L;  1PFX L;  5JBA E;  3SOV A;  4Y7B B;  5EGM B;  1FAK L;  1IQM L;  2VWO L;  1O5D L;  2Y7X B;  2G00 L;  1FAX L;  2EI8 B;  4Y79 B;  3NJP C;  2FD6 A;  2FLR L;  1LMM A;  1TOZ A;  4ZXX L;  5COX A;  3KQC L;  2P3U A;  1XFE A;  1JV2 B;  2YGP A;  1IOE L;  2ADX A;  4Y76 B;  3HO3 A;  1IQE L;  4O1Z A;  2XBX L;  1KLJ L;  3SW2 A;  4RRW A;  1LPG A;  2J4I B;  4X8T L;  1G2L B;  4CUD A;  4JZD L;  2WPH E;  1OB1 C;  4A7I A;  1NT0 A;  1P0S L;  1PRH A;  3LC5 B;  1G2M B;  3ZYI B;  2WZP P;  3HPT A;  2WFT A;  1Z6E L;  4JZE L;  4CUF A;  1P9J A;  1Z6C A;  3KRK A;  5CKM A;  1HX2 A;  1V3X B;  2Q1J B;  3KQB L;  3N8Y B;  1DDX A;  3C9A C;  4MMY B;  1ATD A;  2KB9 A;  1XKB A;  2BQ6 A;  4TGF A;  5L2Y L;  1WU1 B;  3P5B L;  2EI7 B;  4COX A;  1NFY B;  2P95 L;  3F1S B;  2P28 B;  2YGO A;  4JZF L;  4RRX A;  1COU A;  1NFW B;  1IQL L;  1YUF A;  2Y80 B;  2OYU P;  3HS7 A;  2VWL L;  2WFX B;  5FDQ A;  1HZ8 A;  1HT8 A;  2F9B L;  1L3Y A;  2OYE P;  1IVO C;  3OLT A;  4RRY A;  2BMG A;  2RNL A;  1IQN L;  1I0U A;  1F0R B;  2DDU A;  1IJQ A;  2VWN L;  1KLO A;  5JB8 E;  4XL1 A;  4BDX A;  2VVV L;  1EZQ B;  1N1I A;  4Z6A L;  2WPL E;  3CA7 A;  4NG9 L;  1F7M A;  1KIG L;  2M74 A;  4X8V L;  3LTF B;  2P93 L;  3LC3 B;  1NQL B;  4Y71 B;  2WYG B;  3KQD L;  1LPZ A;  3SOQ A;  5IKV A;  1K36 A;  4D0E A;  2WG3 C;  2FLG A;  3BPS E;  1EQG A;  1ATB A;  4OTY A;  3EGF A;  1LQD A;  3V64 C;  4C16 A;  1EPG A;  1FFM A;  1A3P A;  2UWL B;  1F0S B;  1NFX B;  4NA9 L;  3QCW A;  3ASI A;  4Y7A B;  4JYU L;  2UWO B;  2W86 A;  2WG4 B;  2AYL A;  2XC5 L;  3TH3 L;  1UZQ A;  1WHF A;  2H9E L;  3KK6 A;  3RR3 A;  5CKQ A;  2K2T A;  1EBV A;  1EGF A;  1DX5 I;  4JYV L;  4ZH8 B;  3ENS A;  4CSY A;  2BOK L;  1U67 A;  2VVC K;  1LMJ A;  2W2N E;  5JBB E;  1TLE A;  1G1R A;  2PR3 B;  3KCG L;  3V65 B;  1HRF A;  1EMN A;  1HT5 A;  5JVZ A;  1EPI A;  1NPE B;  1YUK B;  1JL9 A;  4E1G A;  2W2Q E;  2I9B A;  3N8Z A;  3NTG A;  3HO4 A;  4Z0K B;  2RHP A;  1X7A L;  3GCW E;  4BTI A;  1FSB A;  1CCF A;  4RS0 A;  2WPK E;  3TBD A;  5E8D A;  1LPK A;  1IGX A;  2BOH A;  1XKA L;  4Z0L A;  3QH0 A;  3HS6 A;  1CVU A;  1TPG A;  2KV4 A;  3FFG L;  1IQF L;  1JBU L;  2W3I B;  5JVY A;  2VJ3 A;  4ZAE B;  4X8U L;  4XLW A;  2PHB B;  4PH9 A;  4LOR A;  1F7E A;  3ELA L;  1IQJ L;  5L30 L;  3GIS X;  2VH6 B;  4AQT A;  2P16 L;  2XBW L;  1MQ5 L;  3IJE B;  2KNI A;  1BF9 A;  2XC4 L;  1KLI L;  2JKH L;  4YT6 L;  2J94 B;  1N7D A;  3IIT B;  1EPJ A;  3BT1 A;  4ZXY L;  3FBY A;  3TZI A;  1HAE A;  3N8W B;  3HO5 A;  4YT7 L;  1G1T A;  3MQE A;  1HRE A;  3FCS B;  4G1M B;  1G1Q A;  3N8W A;  2FLB L;  1CQE A;  3LAQ A;  1FE2 A;  1ZAQ A;  5CIS A;  5JBC E;  2P3F L;  2I9A A;  1K37 A;  2Y5H L;  2P3T A;  1SZB A;  2P94 L;  1UZK A;  4O02 B;  2P3F N;  1UZP A;  3GCX E;  1HJ7 A;  2H9E C;  3TK5 B;  4BTT A;  2VVU L;  2WYJ B;  1URK A;  2TGF A;  3M36 L;  1RFN B;  2BZ6 L;  4RUT A;  2MGR A;  2W26 B;  3K9X A;  2VH0 B;  4OTJ A;  3CFW A;  3LTG D;  2Y5G L;  1FF7 A;  3BT2 A;  2BQ7 A;  1PXX A;  3NT1 A;  3N8V A;  4BTU A;  4CUE A;  2UWP B;  1DIY A;  1YO8 A;  1CX2 A;  1Q4G A;  1HCG B;  1YGC L;  2XC0 L;  1EQH A;  3SOB B;  1CVW L;  1W7X L;  3U73 A;  1MOX C;  2WPI E;  3QMO A;  2NPR A;  1EMO A;  1EAI C;  3MDL A;  4D90 A;  5I46 L;  2BOX A;  2Y38 A;  1IQH L;  3U7U G;  3LN0 A;  3POY A;  2J34 B;  2RA0 L;  3CS7 L;  5KIR A;  6COX A;  3LIW B;  4A94 C;  1WHE A;  5F1A A;  2EI6 B;  1G1S A;  2GD4 A;  1ATE A;  2XBY L;  4M10 A;  5IKT A;  1PTH A;  2MHP A;  4BXW A;  2FZZ L;  2J2U B;  2WPJ E;  5IKQ A;  1IP0 A;  2MGP A;  2W2O E;  1APO A;  5KN5 C;  2P26 A;  4M11 A;  4MMZ B;  1AUT L;  1IQG L;  1PGE A;  1B9W A;  4Y6D B;  1ADX A;  4ZHA B;  1KSN B;  1CEJ A;  2CJI B;  1FJS L;  2D1J B;  2XBV L;  1M1X B;  3ZYJ B;  4BXS A;  1C5M F;  1IQK L;  1XDT R;  1UZJ A;  1J9C L;  1GK5 A;  2Y82 B;  3NTB A;  3ZYG A;  5CKN A;  2Y7Z B;  3LN1 A;  4BDW A;  1DQB A;  1HAF A;  1APQ A;  3M37 L;  5K0H B;  3OLU A;  3PGH A;  4FM5 A;  2BOU A;  4YZU B;  2B7D L;  4RRZ A;  2W2M E;  2KL7 A;  4LMF A;  1CCV A;  2Y81 B;  4X8S L;  3R05 A;  1IGZ A;  2W3K B;  3S6X A;  2BO2 A;  3Q7D A;  5F19 A;  5L2Z L;  4MMX B;  3H5C B;  1ATA A;  3TK6 B;  3N8X A;  5IKR A;  2PUQ L;  1W8B L;  1U8C B;  4ISI L;  3CEN L;  1NFU B;  3F6U L;  2K2S B;  1YUG A;  3DEM A;  3KL6 B;  1IOX A;  2WPM E;  2BQW A;  2J38 B;  1IQI L;  2YGQ A;  2J95 B;  3N8Y A;  3Q3K B;  2W2P E;  5JW1 A;  3TGF A;  1DVA L;  4ISH L;  1NZI A;  2VWM K;  4D0F A;  1QFK L;  4NGA L;  2Y5F L;  4XBM A;  1L5G B;  1MQ6 L;  1EPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...