2XCFA

Crystal structure of hcv ns3 protease with a boronate inhibitor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
180
structure length
180
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSAGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Evaluation of Novel Alpha-Amino Cyclic Boronates as Inhibitors of Hcv Ns3 Protease.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords NS3 PROTEASE
total genus 42
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xcfA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2xcfA01
4NIXA 1NPMA 3PWCA 4ISIH 3AW1A 3RXHA 3VGCC 2F9VA 3FP7E 2SNVA 4FUHA 2EA3A 1ZGIA 1Z8RA 3S9CA 2BZ6H 5DKMA 1EPTB 1SSXA 2CN0H 1NU7B 3RU4T 3SHCH 1D3DB 4ZH8A 4CH2B 2GCTB 1KLTA 3SN8A 1PQAA 3PLPA 5HGGA 1DLEA 4IGDA 1YPLH 3ZZ5A 3SQHE 1P9SA 2IJOB 4R0IA 4LOYH 2ZI2H 1BTPA 4Z6AH 3HPTB 1L0ZA 1ZGVA 3GY6A 4VGCC 1TA2A 2Z7FE 5TJXA 4LZ4B 1SFQB 1BIOA 1ELCA 1WTGH 3PTBA 4UE7H 1AB9C 1FAKH 1O3NA 3M5OA 2P95A 1IQJA 3MMGA 1P2QA 4KTUA 1G32B 1ZPZA 3ATLA 3STJA 1FIZA 1UK2A 1V2RT 1W7GH 5E0GA 5DP5A 3DD2H 2C4FH 4D7FA 4INLA 3F6UH 2PSXA 4NA8A 5GXPA 3CP7A 2P8OB 4AGJA 1WXRA 1YM0A 2AGIX 4SGBE 3PV2A 1OWJA 2GVFA 5HXFA 8GCHF 4LK4A 1FLEE 1XUHA 2G81E 4NZLA 2ZP0H 3C1KA 2Q6FA 3SO3A 1FXYA 3BEUA 4YT6H 1W11U 3E8LA 1C9PA 5GJ4B 1CBWC 2ZDLA 1TGSZ 2P8OC 4H4FA 3MI4A 1SGFG 3BTDE 5GNDA 1AIXH 2ZTYA 2P3UB 2GCHF 2A4GA 1KXAA 3OU0A 2ZKSA 4Y8YA 3KQCA 2FYQA 1F0SA 5A8XA 3T5FH 5FPSA 1XXFA 1BQYA 4JZ1A 1O2TA 3SZEA 3RMLH 1AWHB 1AB9B 2OD3B 3KN2A 2F91A 3MU1A 3UQOA 1UO6A 1O2OA 2FS9A 4X1PU 1ZMNA 1CO7E 1EAWA 1G3CA 2CV3A 4YTAA 3SZNA 1GMCF 3PO1C 2FIRH 1CSOE 1O2SA 1T8OA 1ZJKA 2F83A 4AOQA 1O3IA 3ZYDA 1F0UA 1GMHG 1DS2E 1D3QB 3LU9B 1OS8A 4BANB 3BTWE 3MNSA 1C5VA 4MG3A 1PPFE 1QA0A 1DM4B 5DO4H 3GCTF 1TGBA 2TBSA 2W3IA 3Q3KA 1TNHA 1JIMA 2V35A 1CVWH 4DURA 2OCVB 3RLYH 4BAKB 1SOZA 5FPYA 4YOGA 4I8KA 3TH4H 1DLKB 4CHAB 2ZIQH 1RS0A 3O8BA 4GAWA 1GJ5H 2TPIZ 1VGCC 3A8DA 8KME2 4I8GA 3S69A 2AFQB 3GICB 2ZPRA 4Y79A 1CGIE 4JYUH 1C5SA 2Z6BD 1SVPA 2ZO3H 1CA8B 2I6QA 2GMTB 2WUBA 4BXWA 1GG6C 3A83A 4OS7A 4GPGA 2JKHA 1SGNE 2ZF0H 1N8OC 4UFGH 2ZPQA 1UCYK 4NIWA 2ZDKA 4GUXA 1MCVA 2THFB 3ZZ4A 1GHYH 1SOTA 2EI8A 1O5DH 1TNGA 2AMPA 1GMCG 2FEQH 2ZGJA 1ESAA 1L2EA 3TGJE 1ABIH 1PJPA 7GCHF 1C1RA 1CE5A 3BG4C 2WV4A 4LZ1H 2A2XH 5BPEA 1C5MD 5FX5A 2PTCE 3LDXH 3SYJA 1TQ7B 2ZFFH 5DGJA 1GWAA 1C2JA 5EQRA 1L1NA 1ETRH 1HAYB 3MO3A 7LPRA 3P8NA 5JPMH 4OGYA 3Q3XA 3RXGA 5DK1A 3GDUA 2ZFSA 1UK3A 3HGPA 1DWBH 2AS9A 2SGDE 4MPVA 1RXPA 1RTFB 3BIVH 4OS6A 4MPXA 2AIPA 2QIQA 3F9GA 1NRNH 2IPHA 3SU0A 1ELGA 3F68H 2F9PA 4UEHH 3NCLA 3A88A 2QY0B 1O33A 4XOJA 3BF6H 1JRTA 3U1IB 1UTPA 1W13U 4OS1A 1ZSKA 4RKOB 1TPAE 2W7UA 2A5AA 1L4DA 2WV9A 4DCDA 2GGVB 3QDZB 1F5KU 2P93A 2VIPA 4ISOA 2BY7X 1O5CB 2ZDAH 3L33A 1PQ8A 1SGEE 2H9HA 5A2MH 5L30H 4ZKNU 7GCHG 1FPCH 2ANKH 4AZ2B 3M5NA 3U98H 3A7TA 4KKDA 5EPNA 1C1PA 3TLOA 3U8OH 1UTOA 4FXGH 2H9TH 1HXEH 1QL7A 5FBIA 2PKSB 3QTVH 1O5BB 4UD9H 4B6FA 5LPRA 3UIRA 2FOEA 4ABFA 1N6XA 1BITA 3GY7A 1YCPH 2V3HH 1NFXA 1J9CH 1Y3XA 5EQSA 2OLGA 3BTEE 1EAIA 2GZ8A 1SGPE 1O5FH 4XBCA 1DXWA 3LGUA 3SUDA 4YLQH 2YNBA 2SGPE 1J8AA 1HNEE 3B23B 3OSYA 4FUEA 2G5VA 3PMBB 4Y7BA 2GZ9A 2WYJA 1TBZH 3SV8A 1TQ0B 2G55A 3M3VA 3URDA 4ABBA 3O8CA 1BBRE 4FUFA 1D4PB 2STAE 1QBVH 4UFFH 4NGAH 1P0SH 4OS5A 1SGDE 2ZFQH 3ZZBA 2VWLA 2WPIS 4WWYA 3ATMA 1EP6A 2Q6GA 1TGCA 5ABWA 3SUFA 3EQ0H 1C5TA 1SGIB 2O8TA 5DG6A 1GI1A 4INKA 1HAIH 1ZTKA 4CRAA 1GDQA 3UNQA 3SNCA 4ZHMU 4DY7B 1Z8IB 1P11E 2Y7ZA 4X6OA 3MHWU 2ZU1A 1E34B 3E1XB 2GT7A 3GY3A 1G9IE 2I6SA 1NZQH 2BMGB 3SQEE 1S85A 5L2YH 1N1LA 2PUQH 3HK6B 3BG8A 1LHDH 1RRKA 4X1RU 1DWCH 3DHKH 3MNXA 4E7NA 2PHBA 3WY8A 4ZROA 1MAXA 2G51A 5DP4A 3UTUH 3TK5A 1TX8A 4X6NA 2A2QH 4KTCA 1YPKH 1S82A 1YLDA 1MKWK 2FP7B 1MKXH 4AB8A 1CA0B 1VZQH 4ABAA 4O97A 2FOGA 4FUBA 1OP0A 2VIQA 1QJ7B 1T8NA 4U32A 1SC8U 4JYVH 3D23A 3P92A 1DWEH 2W3KA 5A0BA 2AIQA 2CF9H 3TJVA 1ARCA 2PKAA 2OBQA 4RI0A 1FN8A 3A85A 1A7SA 3PWBA 3RXJA 1LVOA 1QQ4A 4A1XA 1ZRBA 2R2WU 1GHBF 1Z6JH 1O3DA 4ABGA 5E0HA 1AZ8A 3AASA 3OY6U 1ZSJA 1B5GH 1O2IA 1YKTA 2CGAA 2H5DA 1GI8B 3G01A 3ZZ9A 4X2XA 1YPEH 1SR5C 2HPQH 1P2IA 4F4OC 3GY4A 5PTPA 2VWOA 3I29A 2B9LA 4Y8XA 2DUCA 3M3TA 3PM3A 1WCZA 3ELAH 3PV4A 1TX7A 3NKKA 4TWWA 2ZZUH 5EOKA 1V2MT 2PTNA 2Z3DA 2BVXH 2FTMA 4TPYA 2Y7XA 2UUJB 1NRQH 1GBBA 1MD8A 1O3HA 1GG6B 5TCCA 1JMOH 1PQ5A 1QBNA 1C5RA 3NUMA 2QGRA 2GTBA 1X7AC 4GLYA 5T6DA 1ZPBA 5F8XA 2NWNA 2SNWA 4X2VA 1HAOH 1EB1H 1PPCE 3GYMA 1UVOA 3V0XA 1P09A 4ISNA 1Z1JA 4YOIA 5FBEA 3ZYEA 4ZUHA 4A5TS 1ZTJA 3JZ2B 6CHAC 2D1JA 2F9OA 1BRBE 1GCDA 1MKWH 4I31A 1UTNA 4B76A 4CBNA 1SHHB 4B75A 3TNTA 5LH8A 4IC5A 4BTTB 1QGFA 4CRDA 1LCYA 2BY5X 2BD2A 4AORA 1AKSA 1FMGA 4I7YH 5K0HA 2F9NA 1AVXA 3MNBA 3NZIA 1P2MA 1GJ9B 1YPGH 1IQHA 4B2BA 3UOUA 1VCPA 4I8LA 3ENSB 2AGGX 1HAVA 3TJUA 3MU5A 2Z3CA 1TONA 3DA9B 4ABJA 2FOFA 3LT3A 4E7RG 1TRMA 2P94A 3OYPA 2Z9KA 5JBBS 1TGTA 3TK9A 1BTHH 2P3FH 1ELAA 1TRYA 3A86A 1T4UH 4FU7A 3SU5A 1BMAA 1F2SE 2ZGBH 2PKSC 5DP7A 1SLXB 1W8BH 1CT4E 3TPIZ 3UUZA 2H1UA 2JETC 4WXVA 1FUJA 1P9UA 8LPRA 5T6GA 1V2JT 1O2MA 2ZU5A 4MPWA 2BOHB 1YPHC 5ETXA 3TK6A 1SQTA 1Z1IA 3RXBA 1SGQE 4AFUA 3FAOA 1L4ZA 1O38A 3RM2H 1HDTH 1OWEA 1W2KH 1K1JA 5T1VA 5FPTA 2QV1A 1JBUH 1EJNA 1C2FA 5AFYH 1IHTH 1HJAC 1BHXF 1ELFA 2H9EH 4X0WU 1C2LA 1NN6A 1PQ7A 1O2WA 3PMHB 1ZHRA 2ZHWH 1QJ6B 3TGIE 1O0DH 2ZHDA 1TA6A 3T2NA 1C1TA 1FZZA 1KIGH 1EPTA 1NTPA 5EQQA 3EA9A 4D7GA 2KAIB 2AH4X 3MU8A 3KEEA 3KGPA 4O3TA 1QL8A 1C4V2 1ETTH 1SL3A 5HM2A 1ETSH 1N8OB 2HGTH 2Y6TA 3T27A 3ZVEA 1V2OT 3MH7A 3E0PB 5C1XA 3MFJA 1IHSH 1QURH 3M5MA 1QA7A 4AYVB 1GMDF 2XRCA 3A7WA 3E3TA 1JIRA 1P3CA 4UDWH 3T29A 1QJ1B 2NU1E 1AWFH 1MCTA 3UNSA 3L3TA 1ANDA 1G3DA 3QN7A 3NWUA 3M61U 4IC6A 3VB4A 1J15A 1QCPA 2SGFE 1P2OA 1E38B 2TRMA 4XE4A 1ZOMA 3D49H 1FI8A 3Q77A 9ESTA 2BQ7B 1T32A 1GCTC 1GBJA 1CGJE 1TYNA 2XWAA 3SGBE 1C5XB 1SGYE 1K1OA 1QB6A 4Y7AA 1AFQB 1K21H 1WQSA 2VIDA 1F5RA 4D9QA 1EZUC 2RA0A 3QGJA 3IITA 6GCHF 1UTLM 5DJ7A 1V2PT 2QAAA 2UUKB 3Q00A 2BM2A 3KQEA 1G2MA 1D9IA 1S5SA 3SU3A 3SV2H 1XM1A 3VB3A 2LPRA 1O2UA 4IBLH 1LQDB 4A7IB 3H7OA 4A6LA 2VGCC 5G4BA 3R3GB 1DVAH 2TGTA 2OUAA 1KTTB 2OXSA 1HBTH 3E91A 3GY2A 1AFQC 2O8MA 3QWCH 1SLUB 1AD8H 3QTOH 1PPGE 3SV7A 3T62A 4TPIZ 2JH0D 2XW9A 2C93B 1FONA 1MUEB 1O2KA 1OSSA 1C1WH 3HGNA 2PFEA 1PYTC 1DICA 4O3UA 5GCHF 1C5PA 4XBDA 1C1NA 1GJCB 2ZA5A 3UREA 1TOMH 4CRFA 5LPEA 1K1NA 3RU4D 1IQFA 4UFDH 3D62A 4Q7ZA 1YCPM 1A0JA 1CBWB 4U30A 5T6FA 1ZZZA 1GHAG 4NFEA 1DANH 1SB1H 2GCHG 1Q2WA 3CS0A 4NA9H 3GCOA 4CBOA 2BQ6B 3RMOH 4HI3A 2H6MA 4Q2KA 4KGAA 1GHZA 4ZHAA 2SGAA 1P3EA 1WYKA 1TIOA 2GV7A 1TOCB 2GKVE 1A5HA 1AY6H 1LPGB 2AEIH 4ASHA 4CRCA 1A5GH 2BOKA 2QYIA 1V2QT 1YF4A 3K65B 6CHAB 2DE8A 2R9PA 5L2ZH 1P57B 3M36A 1UVPA 1XVMA 3PMAB 5C5NA 4AGKA 1E36B 1CHOG 1G36A 1UHBB 2BDCA 2KAIA 2Y80A 3RXQA 2Z3EA 5ESBA 1C5LH 1ANCA 1EPTC 4DT7B 4X1NU 1WTHD 1O3MA 3RC5A 1BMNH 1EX3A 2FPZA 1NFUA 3ZZ3A 1FAXA 2G4TA 1MH0A 1VCWA 2VH6A 1EXFA 3OY5U 1C1QA 1C1VH 1NT1A 1GBMA 1DT2A 3ATIA 1BA8B 1XVOA 1L1JA 2PGQB 1W3CA 2DE9A 3RLWH 1GHAF 4D76A 4HFPB 1SQAA 2TGDA 4NFFA 1QRXA 1FQ3A 2O9QA 5A8ZA 1GVKB 1D3PB 1O3AA 1ZTLA 1KLIH 1QQUA 2ODYB 1GBIA 2B8OH 1P12E 4NSVA 4GSOA 3NK8A 4JMYA 2R0KA 1OYTH 3FZDA 1A3EH 2Y5FA 5FXLA 1LKAA 1LO6A 2UWPA 3BTME 3C27B 4NIYA 1EAXA 2BVSH 1DDJA 7ESTE 5F03A 5DP9A 2WPHS 1VJ9U 1XMNB 3OTPA 2FX6A 3GISB 3ZVDA 3STIA 1A3BH 1IQLA 1ZSLA 4CR9A 1MQ6A 4K3JA 5IYTA 2A31A 4ESTE 3TNSA 2ZDNA 3MOCA 1C2HA 3SGQE 1J16A 3LOXA 1C2EA 2Z94A 4WXIA 2R3YA 1SGCA 2FTLE 1YBWA 1A0HB 1S0RA 5GWZA 1UTQA 3LC3A 2AMQA 1XX9A 2FX4A 2QXIA 3PLBA 2HNTC 2ZFRH 4MDSA 2ZPSA 1TRNA 2VVVA 1Q31A 3RXCA 2GZ7A 3I78A 1K1PA 1F7ZA 3BTHE 1O31A 5JB9S 1KXEA 1A1RA 1BRCE 4JZEH 1T7CA 5CMXH 1IQKA 2VIOA 1OWDA 1NRRH 1AMHA 1SBWA 3EA8A 1NFWA 2Z9GA 4H6TA 1CQQA 1F0TA 3RXUA 1O2XA 1THRH 2BD3A 1H8DH 1NO9H 3RP2A 1J17T 2XC5A 3EYDA 4WMEA 1GJBB 1YPJH 4PROA 3HK3B 3EE0B 4ABDA 1WAYB 1B7XB 1KXFA 2R2MB 1HXFH 2PR3A 1QRZA 2ZQ1A 1EUFA 1PPBH 2TGAA 1GBCA 2ZGCA 3PROA 1O5GH 3UFAA 2Z9IA 2F4LA 1GBKA 4JZFH 4Y6DA 4D8NA 4FUJA 2Y81A 5JYIA 3ZZDA 1IQNA 1V2KT 1G3BA 2XXLA 2SGQE 5EXMA 2NU2E 1E37B 4YZUA 2WPJS 1LVYA 1IQGA 1OWIA 1UTKA 1V3XA 5TCAA 2GP9B 4ZMAH 1MTSA 1GJAB 1NRSH 3GCHC 1AQ7A 1N6YA 5AFZH 2ZGHA 1GMHF 5FCRA 1VCQA 3UOPA 2BY6X 1XUFA 2TGPZ 1O35A 1XUGA 1W0YH 4GCHG 4AFSA 4B73A 3OX7U 3QK1A 1MD7A 2QF0A 3TVJB 1ID5H 1H8IH 3SUGA 1GJ6A 2ESTE 5E0JA 3ZVFA 3I77A 2BX4A 1O3PB 1A2CH 3QO6A 1F5LA 1CA0C 4CRGA 1GI9B 1LHFH 2BYAX 2PSYA 4DOQA 2P59A 1WQVH 1JXPA 3QUMP 4BXSA 4WH8A 5A09A 1QR3E 1VITG 3RC6A 1OWHA 2D26C 4DIHH 1C5UA 4ZXYH 4J1YA 3RXPA 1BMLA 1S81A 2QC2A 2VIVA 1NRPH 1TGNA 2FLRH 1ELDE 2XNIA 1GJ7B 1O3KA 2F3CE 4IN2A 1KXBA 3TH2H 1W7XH 3RXIA 3QGNB 5FCKA 4B6EA 1OKXA 5EPYA 2WPLS 3SV9A 4UFEH 3AW0A 1P04A 5EXLA 1ORFA 3LH1A 1QIXB 2ASUB 3A7VA 1Y59T 2C8WB 2A5IA 4XFQA 1SLWB 4MNXA 4JZIA 1C5OH 2BD5A 1V2NT 1NFYA 2PLXA 2GX4A 2UUYA 3MU0A 1W10U 4GCHF 3RDZA 4KELA 1GHBG 1EB2A 3GCHB 3PLKA 3BV9B 2ALVA 1GI2A 2EI6A 3W94A 1LTOA 4JK6A 1HV7A 2ZFPH 4AB9A 2FOBA 1H1BA 3SU4A 1IQEA 1SI5H 2GD4B 5E2OA 4RN6A 4ZKOU 1CU1A 4AN7A 1XUKA 1ELVA 3BG4B 1QB9A 1GHVH 5EGMA 1DSTA 3S0NA 1Y3VA 5EW2H 1JRSA 1BZXE 1QB1A 2PWXA 3FP8E 3LC5A 1KXDA 2PGBB 2VNTA 3RUOA 3VXFH 1RGQA 3A7YA 2BQWB 4UONA 1FNIA 3D65E 4U2WA 2OQ5A 3LGYA 1BJVA 3SNEA 3K2UA 1QNJA 4WMDA 3RU4E 4FU9A 1UCYH 1P2NA 1K1LA 1Z8JB 3RXDA 1TLDA 3TIUA 1RD3B 2FM2A 1IOEA 3BEIB 3SJKA 1THSH 3DFLA 5C20A 1GBAA 3AAVA 2C8ZB 4YOJA 2XC4A 4Y0ZE 2FOAA 3A87A 4ZXXH 5JBCS 3E16B 1HAPH 2IN2A 4Y0YE 2P3TB 1V2ST 2G8TA 4FUCA 2O8LA 3LGWA 1MU8B 3MU4A 1HJ8A 2CHAC 2B0FA 2FDAA 5BRRE 1UK4A 3LJOA 1YC0A 1O2GH 1O2ZA 1MKXK 6ESTA 1TMUH 3SNDA 3A8AA 2ZEBA 1KXCA 1KDQA 4A1TA 1MTNB 1GBFA 2C3SA 2G4UA 1SQOA 2ANWA 4BOHA 2VGCB 4BTUB 4ZKSU 3ESTA 1O2NA 2RA3A 1O2QA 2ZHQH 3ZVAA 1CHGA 1TNJA 2HWLB 1OWKA 2J94A 3FP6E 1O34A 1O5AB 2ZG0H 1NY22 3LH3A 2ZHFH 1GGDC 2QF3A 4MQAA 1BTYA 5H4IB 2HLCA 5DP6A 4B2CA 4U01A 2ZFTA 2RDLA 3Q3YA 5K7RA 4BAQB 1MQ5A 2FS8A 3AK5A 1VR1H 3U8RH 3RM0H 1GBHA 1HJ9A 1LDTT 4DGJA 2FXRA 3P8FA 3A7XA 5F8TA 1HAHH 4MNVA 4K5ZA 4YM9A 1TWXB 1RJXB 2UWOA 2H2ZA 4DG4A 2ZU2A 8GCHG 5AVDA 3KQBA 3ZV8A 1YP9A 4MLFB 2OP9A 1MBQA 4FUIA 3M7QA 1KTSB 1BTUA 1HLTH 3RXKA 1BRAA 3EDXB 4X6PA 1EOJA 1TMBH 1MU6B 3L6PA 1C2GA 1ESBA 1HJAB 2ZTZA 4CRBA 3HKIB 1KSNA 2IJD1 2JH6D 1OP2A 3MH4A 4I32A 1HRTH 1P01A 2ZWLH 1LKBA 1HAXB 1C2MA 1UHBA 2C90B 2W7SA 4OS2A 1C1OA 1FPHH 1A5IA 1W12U 2ZC9H 2RCEA 4JK5A 2K1QA 3MO9A 5C3NA 1P05A 4MNWA 1Y3WA 3SJ9A 2ANYA 2NU0E 4SGAE 1P2KA 2SFAA 3VB6A 3FFGA 4IW4E 4X8TH 4GHTA 4BAHB 3DFJA 3E6PH 4HTCH 1O2PA 2OINA 4OS4A 2HVXA 1GMDG 1V6DA 1JOUB 2AERH 3SHAH 2V0BA 1TNKA 3NXPA 4INHA 2FI4E 3P8GA 1HAZB 4AFQA 4MNYA 4WF8A 3P95A 3DT0H 3HATH 2A32A 3U1JB 4BAMB 1LHEH 3EGKH 1AUJA 5A0AE 3AVZA 4XSKU 4MTBA 3S7HB 1WUNH 3RXVA 4NCYA 2EI7A 2ALPA 1H9LB 5C67A 3MTYA 1FIWA 1ZLRA 4O03A 3SGAE 5A0CA 1MZDA 3SW2B 4JZDH 1QY6A 2BLOA 1TMTH 4FU8A 5FX6A 1BHXB 3FVFB 4X8VH 4DVAU 1G37A 1HAVB 2G00A 1S0QA 3M37A 2FODA 2QXHA 1O5EH 4WY3A 3GDSA 2BDGA 4TYDA 4X1SU 3ODFA 3O8RA 2BXTH 1A61H 1NROH 4DIIH 3F9FA 1O36A 1YLCA 4GHQA 3BTFE 1MTNC 1AKSB 2FO9A 1C5ZB 3QLPH 2ZTXA 1EQ9A 2M5TA 1K2I1 1OOKB 4DJZB 2BY9X 1NM6A 3SU1A 1O37A 4GVUA 1YPMH 3KCGH 3ATKA 3VB7A 3M7UA 2VINA 2VWNA 2FOMB 1XUJA 1GI3A 2NU4E 1G2LA 1AE8H 1RTKA 2OBOA 2ZCKP 2HPPH 5CE1A 1DE7H 3V12A 1QFKH 4NA7A 5GCHG 1BB0B 1ZJDA 3VGCB 3TH3H 1GI7B 3A84A 1NESE 1GI0A 1S83A 1WOFA 1F92A 2BXUH 3PV5A 3GY5A 1CGHA 2WPKS 2W5EA 1HIAB 1K1MA 2BDYA 2NU3E 3RC4A 2BDAA 3RMMH 2AGEX 2BDHA 1ZMLA 2PUXB 1FY3A 3KL6A 3IWMA 4O9VA 5CHAB 1BCUH 2Y82A 2GMTC 2WUCA 3ZVBA 1EJAA 1M9UA 7KMEH 2CJIA 1CT2E 4WMFA 3T25A 3LONA 4IMQA 4X2YA 3SV6A 1ELEE 1BOQA 5EU8A 1INCA 1GJ4H 1ZMJA 2UUFB 4K60A 1HB0B 3SBKA 3BTQE 1DSUA 5LPFA 3NPSA 1Q3XA 2BD9A 3ZZCA 5F6MA 5DP8A 1P8VC 3DUXH 5CHAC 4FUDA 3CS7A 4X8SH 3BTTE 2Q1JA 5HMAA 5JB8S 2J34A 2BX3A 2CMYA 4K1TA 1HAGE 4I33A 3HKJB 3MH5A 3P17H 3UWJH 1A0LA 1YGCH 4AG1A 1K9OE 1UMAH 1P03A 2OK5A 1EJMA 1DWDH 3V3MA 3MH6A 1O3FA 1O2VA 3ZVGA 2XBYA 1UTJA 1FJSA 1G30B 5GIBA 1SG8B 3PO1B 2Y5GA 5E2PA 3QX5H 4NG9H 2WINI 3RXRA 1QHRB 1XXDA 1ABJH 3SJIA 2J4IA 4AYYB 3MWIU 3LIWA 1SMFE 2XTTB 4IMZA 5EODA 3U9AH 1C2IA 3M5LA 2JETB 2SGEE 1VITH 5A8YA 1ZYOA 1O39A 3VFEA 5JDUB 5JBAS 2Z9JA 4MVNA 2CHAB 4OM9A 1UTMA 3ZVCA 1MZAA 3SNBA 3A82A 1LPKB 1O3CA 1QL9A 1DY8A 1O2HA 1ZPCA 2GT8A 4WVPE 1PPEE 3GCNA 1W14U 2FOCA 4K8YA 1TALA 4D9RA 1KLJH 1VJAU 1Y8TA 3GOVB 4TY7A 2J38A 3GDVA 1BRUP 1O3JA 1XKAC 3FANA 4ABIA 1UVTH 5C5OA 3SORA 2BY8X 2BDIA 4K1EA 4CR5A 3R0FA 2FESH 2XYAA 3K9XB 1FN6A 1O2LA 1O3GA 4KP0A 4JCNA 1O32A 1XUIA 2PW8H 2HRVA 6GCHG 4CH8B 2GDDA 1HCGA 1EOLA 2J92A 2A7HA 1GDNA 1V2VT 2P16A 1QTFA 4I8HA 1SGRE 1SHYA 2V3OH 3KIDU 1CT0E 4Y11E 1V2WT 1AN1E 5F8ZA 1LVBA 4H42U 4ZHLU 1W0ZU 1P06A 2OC7A 4Y10E 3SU6A 2A4QA 4NSYA 2A0QB 2VVUA 1ACBE 3A8BA 4IN1A 5I46H 1BT7A 3ZZAA 1IQIA 1EKBB 1WV7H 2J2UA 3UNRA 2WHXA 2HNTE 2OC8A 4ISHH 3GCTG 1C9TA 2BVRH 3SI4H 5L6NH 2F9UA 4KTSA 1GBDA 1AGJA 1AVGH 2FI3E 2XBXA 2XBWA 1V2LT 4XDEA 2ZCHP 3PB1E 1JWTA 4YO9A 2J9NA 1K22H 2VBCA 1H4WA 1MMJN 1RIWC 2V6NA 1BTWA 1DITH 1MTVA 2BD8A 4X8UH 1NC6A 3H7TA 1B0FA 4Q7XA 1HYLA 1ELBA 4BNRA 1BJUA 5HM9A 3VEQB 1DUEA 2A4RA 5DPAA 6LPRA 2BLWA 4F49A 3RXEA 4A1VA 1LQEA 4FVBA 4CREA 2A4OA 2ILNA 2QXGA 1XKBC 1DOJA 1EP5A 2BLQA 4I8JA 1WSSH 3KNXA 1B0EA 3GY8A 5J4QA 1CHOF 1Y5BT 2STBE 4RSPA 2HOBA 1GBLA 3KQDA 1O30A 2C8YB 5C1UA 1PFXC 4QT8C 3RXOA 1TABE 1DXPA 4AX9H 3V7TA 1GBTA 2XBVA 3U8TH 1QBOA 2PKAB 1O2YA 1YPHE 3SJ8A 1NS3A 4WJG2 1BMMH 4B2AA 4BTIB 3M7TA 2ZQ2A 3RXTA 1YCPK 1RTLA 2FLBH 1MAYA 1UVSH 4X6MA 1Y3UA 2ODPA 2QXJA 1PYTD 1MTUA 2LNCA 2QN5T 4NWLA 1TE0A 3RXAA 2FZZA 2BDBA 2ODQA 1AFEH 3LPRA 3RXLA 5C2ZA 1FDPA 2FYRA 3UR9A 4FUGA 2BD4A 3SU2A 1OP8A 2ZGXH 4BAOB 3MO6A 3LGIA 1GPZA 2CXVA 1A4WH 2OC1A 2VJ1A 3BSQA 3ZZ7A 2A45B 2OTVA 3EAJA 2G52A 4AFZA 3E90B 1HIAA 1TBQH 1NU9A 1AZZA 5T3HA 1S6FA 3BTGE 1D3TB 1J14A 1AUTC 1VGCB 5B6OA 3P6ZB 3VB5A 1RIWB 1DUAA 2ZECA 1C5QA 1H9HE 2C8XB 2VB0A 3H09A 1TPSA 3W95A 1UJ1A 1DX5M 2D2DA 2ZHEH 1ANBA 1EZQA 1SGFA 2ANMH 2B7DH 1ANEA 2J95A 2A7JA 5FHTA 3TITA 3T26A 1THPB 2XCNA 3PYHA 4MPUA 5DP3A 1GL0E 2R0LA 4E06H 3RMNH 1BBRK 1C4U2 4TWYA 1GHXH 5HYOA 1T4VH 1KY9A 1Z71A 1FY5A 2ULLA 4B71A 1Y3YA 1KYNA 1TB6H 1SLVB 1O2RA 2JH5D 3QZQA 4XBBA 3UPEA 4FVDA 4ABEA 5IDKA 1T31A 1WBGB 4ISLA 3V13A 5B6LA 2O8WA 3ZV9A 1GI4A 4X1QU 1UVUH 3ITIA 1G3EA 1QRWA 1GVZA 3M3SA 2UWLA 3FZZA 1EASA 2Q6DA 5AHGH 3Q76A 1P10A 3M35A 3TGKE 1BTXA 3S7KB 1BUIA 3A89A 3SJOA 2WYGA 1V2UT 3GYLB 2G5NA 1S84A 2EEKA 2GDEH 3B9FH 1Y5AT 3IG6B 5AF9H 1DPOA 1GI6A 1GBEA 1DY9A 3CENA 3BIUH 2A7CA 2XWBI 4NIVA 1K1IA 1IQMA 1Z8GA 3ATWA 1P02A 2AYWA 1GDUA 1AVWA 1T8LA 2HALA 3TU7H 4HGCA 3UQVA 4R8TB 2OC0A 1TFXA 3QZRA 3S9AA 3UY9A 4Y8ZA 2B5TB 4VGCB 1O3LA 4K69A 1AI8H 4OGXA 1OYQA 1FY4A 1BBRH 5LGOA 4H6SB 3RXMA 1FV9A 1LMWB 3E0NB 3KHVA 4J2YB 3LKWA 4ZAEA 4NWKA 1EZXC 2W26A 2ZCLP 5EG4A 2XCFA 1T8MA 1LHCH 1TPPA 2BTCE 3LGVA 1AHTH 1EZSC 2VWMA 3H5CB 4JYTA 3SOSA 2ZDMA 3PMJA 4THNH 1E35B 2WPMS 3N7OA 3SNAA 1K28D 1AO5A 2BD7A 1L1GA 3RXFA 1O3BA 3VPKA 4K8BA 2BHGA 1HFDA 5GDSH 1YYY1 1TX6A 3A8CA 1H9IE 1SGTA 1LVMA 4AG2A 1GCTB 1ESTA 2GCTC 2EC9H 4YLUA 1RFNA 1ZHPA 3PTNA 3F1SB 1GHWH 3A81A 1C5YB 2FI5E 2Y5HA 9LPRA 3F9EA 1A46H 1C5NH 1O2JA 3P8OA 2VVCA 1Y5UT 4Q80A 4DW2U 2R3UA 3A7ZA 4M9FA 3AAUA 2GV6A 3VXEH 1HGTH 1GJ8B 2BB4A 1MBMA 4E05H 2FMJA 1VITF 1Z6EA 4Q7YA 1ZHMA 4NZQA 3JZ1B 5SGAE 1S6HA 3ZZ8A 4Y76A 3BTKE 1TPOA 3B8JA 1ELTA 1U6QA 8ESTE 1Z7KA 1HUTH 2ZU3A 4Z0KA 5ESTE 1PPHE 2OQUA 3KF2A 1FY8E 3U69H 3TJNA 1MTWA 3K6ZA 3UWIA 2XC0A 1ZRKA 5JBTA 1D6RA 1GL1A 2QCYA 4YESB 1C5WB 1GGDB 1DFPA 4CHAC 2VH0A 3F9HA 2WZQA 1F0RA 4B74A 1GVLA 2QA9E 3URCA 1D6WA 1TNIA 3LGTA 1O3EA 3LJJA 5I25A 2HNTF 2VU8E 3ZZ6A 4YT7H 3SI3H 2F9BH 2BZAA 1SFIA 3MNCA 1C1UH 3O8DA 4Y71A 1IAUA 1SPJA 1C1SA 2BLVA 2ZU4A 1KDQB 1E0FD 3A80A 4A92A 5GPIB 4X2WA 4K2YA 1FY1A 2CF8H 2VIWA 4TY6A 1OXGA 1C2KA 2FOHA 1UCYE 1AE5A 1ARBA 3MYWA 1EAUA 4RKJB 1TAWA 2AMDA 2H5CA 2ZDVH 2Z9LA 3T28A 1LHGH 5FAHA 4K1SA 1LPZB 3BN9A 2D8WA 1C2DA 2RG3A 4ZKRU 2PV9B 1P2JA 2TIOA 4B1TA 1O3OA 4IS5A 2IOTA 1AU8A 3P70B 4WH6A 3ODDA 1OX1A 1BDAA 3EA7A 4LXBH 3K6YA 5EW1H 1TBRH 4ABHA 1WU1A 5E8EH 5C1YA 2YOLA 4HZHA 1C4Y2 1EATA 1ZR0A 1C1MA 2O8UA 5J4SA 2A1DB 2ZNKH 3RXSA 2A5KA 2WV5A 1V2TT 4M7GA 3UR6A 1BTZA 2FWWA 1PPZA 1HPGA 2YNAA 3SUEA 1OPHB 3BEFB 5EXNA 3OTJE 3TJOA 3S9BA 1TNLA 1GI5A 1GJDB
chains in the Genus database with same CATH superfamily
4NIXA 1NPMA 3PWCA 4ISIH 3AW1A 3RXHA 3VGCC 2F9VA 3FP7E 1E79D 2JJ1D 2SNVA 4FUHA 2EA3A 1ZGIA 1Z8RA 3S9CA 2BZ6H 5DKMA 1EPTB 1SSXA 2CN0H 1NU7B 3RU4T 3SHCH 1D3DB 3FN8A 4ZH8A 4CH2B 2GCTB 1KLTA 3SN8A 1PQAA 3PLPA 5HGGA 1DLEA 4IGDA 1YPLH 3ZZ5A 3SQHE 1P9SA 2IJOB 4R0IA 4LOYH 2ZI2H 1BTPA 4Z6AH 3HPTB 1L0ZA 1ZGVA 3GY6A 4VGCC 1TA2A 3U28C 2Z7FE 5TJXA 4LZ4B 1SFQB 1BIOA 1ELCA 1WTGH 3PTBA 4UE7H 1AB9C 1FAKH 1O3NA 3M5OA 2P95A 1IQJA 3MMGA 1P2QA 4KTUA 1G32B 1ZPZA 3ATLA 3STJA 1FIZA 1UK2A 1V2RT 1W7GH 5E0GA 5DP5A 3DD2H 2C4FH 4D7FA 4INLA 3F6UH 2PSXA 4NA8A 5GXPA 3CP7A 2P8OB 4AGJA 5DSFA 1WXRA 1YM0A 2AGIX 4SGBE 3PV2A 1OWJA 2GVFA 5HXFA 3F3BA 8GCHF 4LK4A 1FLEE 1XUHA 2G81E 4NZLA 2ZP0H 3C1KA 1W0JD 2Q6FA 3SO3A 1FXYA 3BEUA 4YT6H 1W11U 3E8LA 1C9PA 5GJ4B 1CBWC 2ZDLA 1TGSZ 2P8OC 4H4FA 3MI4A 1SGFG 3BTDE 5GNDA 1AIXH 2ZTYA 2P3UB 2GCHF 2A4GA 1KXAA 3OU0A 2ZKSA 2QF5A 4Y8YA 3KQCA 2FYQA 1F0SA 5A8XA 3T5FH 5FPSA 1XXFA 1BQYA 4JZ1A 1O2TA 3SZEA 3RMLH 1AWHB 1AB9B 2OD3B 3KN2A 2F91A 3MU1A 3UQOA 3FKSD 1UO6A 1O2OA 2FS9A 4X1PU 1ZMNA 1CO7E 1EAWA 1G3CA 2CV3A 4YTAA 3SZNA 1GMCF 3PO1C 2FIRH 1CSOE 1O2SA 1T8OA 1ZJKA 2F83A 4AOQA 1O3IA 3ZYDA 1F0UA 1GMHG 1DS2E 1COWD 1D3QB 3LU9B 1OS8A 4BANB 3BTWE 3MNSA 1C5VA 4MG3A 1OHHD 1PPFE 1QA0A 1DM4B 5DO4H 3GCTF 1TGBA 2TBSA 2W3IA 3Q3KA 1TNHA 1JIMA 2V35A 1CVWH 4DURA 2OCVB 3RLYH 4BAKB 1SOZA 5FPYA 4YOGA 4I8KA 3TH4H 1DLKB 4CHAB 2ZIQH 1RS0A 3O8BA 4GAWA 1GJ5H 2TPIZ 1VGCC 3A8DA 3F2HA 8KME2 5EJLA 4I8GA 3S69A 2AFQB 3GICB 2ZPRA 4Y79A 1CGIE 4JYUH 1C5SA 2Z6BD 1SVPA 2ZO3H 1CA8B 2I6QA 2GMTB 2WUBA 4BXWA 1GG6C 3A83A 4OS7A 4GPGA 2JKHA 1SGNE 2ZF0H 1BMFD 1N8OC 4UFGH 2ZPQA 1UCYK 4NIWA 2ZDKA 4GUXA 1MCVA 2THFB 3ZZ4A 1GHYH 1SOTA 2EI8A 1O5DH 1TNGA 2AMPA 3KQ5A 4HG6A 1GMCG 2FEQH 2ZGJA 1ESAA 1L2EA 3TGJE 1ABIH 1PJPA 7GCHF 1C1RA 4I86A 1CE5A 3BG4C 2WV4A 4LZ1H 2A2XH 5BPEA 1C5MD 5FX5A 2PTCE 3LDXH 3SYJA 1TQ7B 2ZFFH 5DGJA 1GWAA 1C2JA 5EQRA 1L1NA 1ETRH 1HAYB 3MO3A 7LPRA 3P8NA 5JPMH 4OGYA 3PRBA 3Q3XA 2HVYB 3RXGA 5DK1A 3GDUA 2ZFSA 1UK3A 3HGPA 1DWBH 2AS9A 2SGDE 4MPVA 1RXPA 1RTFB 3BIVH 4OS6A 4MPXA 2AIPA 2QIQA 3F9GA 1NRNH 2IPHA 3SU0A 1ELGA 2GJGA 3F68H 2F9PA 4UEHH 3NCLA 3A88A 2QY0B 1O33A 4XOJA 3BF6H 1JRTA 3U1IB 1UTPA 1W13U 4OS1A 2XNDD 1ZSKA 2RDEA 2JJ2D 1TPAE 2W7UA 2A5AA 1L4DA 2WV9A 4RKOB 4DCDA 2GGVB 3QDZB 1F5KU 2P93A 2VIPA 3FO8D 4ISOA 2BY7X 1O5CB 2ZDAH 3L33A 1PQ8A 1SGEE 2H9HA 5A2MH 5L30H 4ZKNU 7GCHG 1FPCH 2ANKH 4AZ2B 3M5NA 3U98H 3A7TA 4KKDA 5EPNA 1C1PA 3TLOA 3U8OH 5C0TA 1UTOA 4FXGH 2H9TH 1HXEH 1QL7A 5FBIA 4P00A 2PKSB 2QE7D 3QTVH 1O5BB 4UD9H 4B6FA 5LPRA 1SQRA 3UIRA 4RT0A 2FOEA 4ABFA 1N6XA 1BITA 3GY7A 1YCPH 2V3HH 1NFXA 1J9CH 1Y3XA 5EQSA 2OLGA 3BTEE 1EAIA 2GZ8A 1SGPE 1O5FH 4XBCA 1DXWA 3LGUA 3SUDA 4YLQH 2YNBA 2SGPE 1J8AA 1HNEE 3B23B 2J98A 3OSYA 4FUEA 2G5VA 3PMBB 4Y7BA 2GZ9A 2WYJA 1TBZH 3SV8A 1TQ0B 2G55A 3M3VA 3URDA 4ABBA 3O8CA 1BBRE 4FUFA 1D4PB 2STAE 1QBVH 4UFFH 4NGAH 1P0SH 1NBME 4OS5A 1SGDE 2ZFQH 3ZZBA 2VWLA 2WPIS 4WWYA 3ATMA 1EP6A 2Q6GA 3WWBA 1TGCA 5ABWA 3SUFA 3EQ0H 1C5TA 2O8TA 1SGIB 5DG6A 1GI1A 4INKA 1HAIH 1ZTKA 4CRAA 1GDQA 3UNQA 3SNCA 4ZHMU 4DY7B 1Z8IB 1P11E 2Y7ZA 4X6OA 3MHWU 2ZU1A 1E34B 3E1XB 2GT7A 3GY3A 1G9IE 2I6SA 1NZQH 2BMGB 3SQEE 1S85A 5L2YH 1N1LA 2PUQH 3HK6B 3BG8A 1LHDH 1RRKA 4X1RU 1DWCH 3DHKH 3MNXA 4E7NA 2PHBA 3WY8A 4ZROA 1MAXA 2G51A 5DP4A 3UTUH 3TK5A 1TX8A 4X6NA 2A2QH 4KTCA 1YPKH 1S82A 1YLDA 1MKWK 2FP7B 1MKXH 4AB8A 1CA0B 1VZQH 4ABAA 4O97A 2FOGA 4FUBA 1OP0A 2VIQA 1QJ7B 1T8NA 4U32A 1SC8U 1E1RD 4JYVH 3D23A 3P92A 1DWEH 2W3KA 5A0BA 2AIQA 2CF9H 3TJVA 1ARCA 2PKAA 1E1QD 2OBQA 4RI0A 2LP6A 1FN8A 3A85A 1A7SA 3PWBA 3RXJA 1LVOA 1QQ4A 4A1XA 1ZRBA 2R2WU 1GHBF 1Z6JH 1O3DA 4ABGA 5E0HA 1AZ8A 3AASA 3OY6U 5HIZA 1ZSJA 1B5GH 1O2IA 1YKTA 2CGAA 2H5DA 1GI8B 3G01A 3ZZ9A 4X2XA 1YPEH 3UAIC 1SR5C 2HPQH 1P2IA 4F4OC 3GY4A 5PTPA 2VWOA 3I29A 2B9LA 4Y8XA 2DUCA 3M3TA 3PM3A 1WCZA 3ELAH 3PV4A 1TX7A 3NKKA 4TWWA 2ZZUH 5EOKA 1V2MT 2PTNA 2Z3DA 2BVXH 2FTMA 4TPYA 2Y7XA 2UUJB 1NRQH 1GBBA 1MD8A 1O3HA 2WPDD 1GG6B 5TCCA 1JMOH 1FX0B 1PQ5A 1QBNA 1C5RA 3NUMA 2QGRA 2GTBA 1X7AC 4GLYA 5T6DA 1ZPBA 5F8XA 2NWNA 2SNWA 4X2VA 1HAOH 1EB1H 1PPCE 3GYMA 1UVOA 3V0XA 1P09A 4ISNA 1Z1JA 4YOIA 5FBEA 3ZYEA 4ZUHA 4A5TS 1ZTJA 3JZ2B 5HKKD 6CHAC 2D1JA 2F9OA 1BRBE 1GCDA 1MKWH 4I31A 1UTNA 4B76A 4CBNA 1SHHB 4B75A 3TNTA 5LH8A 4IC5A 4BTTB 1QGFA 4CRDA 1LCYA 2BY5X 2BD2A 4AORA 1AKSA 1FMGA 2WSSD 4I7YH 2W6ID 3KYGA 5K0HA 2F9NA 1AVXA 3MNBA 3NZIA 1P2MA 1GJ9B 1YPGH 1IQHA 4B2BA 3UOUA 1VCPA 4I8LA 3ENSB 2AGGX 1HAVA 3TJUA 3MU5A 2Z3CA 3UB0A 1TONA 3DA9B 4ABJA 2FOFA 3LT3A 4E7RG 1TRMA 2P94A 3OYPA 2Z9KA 5JBBS 1TGTA 3TK9A 1BTHH 2P3FH 1ELAA 4TT3D 1TRYA 3A86A 1T4UH 4FU7A 3SU5A 1BMAA 1F2SE 2ZGBH 2PKSC 5DP7A 1SLXB 3DSGA 1W8BH 1VKYA 1CT4E 3TPIZ 3UUZA 2H1UA 2JETC 4WXVA 1FUJA 1P9UA 8LPRA 5T6GA 1V2JT 1O2MA 2ZU5A 4MPWA 2BOHB 1YPHC 5ETXA 3TK6A 1SQTA 1Z1IA 3RXBA 1SGQE 4AFUA 3FAOA 1L4ZA 3F2FA 1O38A 3RM2H 1HDTH 1OWEA 1W2KH 1K1JA 3VG8A 5T1VA 5FPTA 2QV1A 1JBUH 1EJNA 1C2FA 5AFYH 1IHTH 1HJAC 1BHXF 1ELFA 2H9EH 4X0WU 1C2LA 1NN6A 1PQ7A 1O2WA 3PMHB 1ZHRA 2ZHWH 1QJ6B 3TGIE 1O0DH 2ZHDA 1TA6A 3T2NA 1C1TA 1FZZA 1KIGH 1EPTA 1NTPA 5EQQA 3EA9A 4D7GA 2KAIB 2AH4X 3MU8A 3F0OA 3KEEA 3KGPA 4O3TA 1QL8A 1C4V2 1ETTH 1SL3A 5HM2A 1ETSH 1N8OB 2HGTH 2Y6TA 3T27A 3ZVEA 1V2OT 3MH7A 3E0PB 5C1XA 3MFJA 1IHSH 1QURH 3M5MA 1QA7A 4AYVB 1GMDF 2XRCA 3A7WA 3E3TA 1JIRA 1P3CA 4UDWH 5DN6D 3T29A 1QJ1B 2NU1E 1AWFH 1MCTA 3UNSA 3L3TA 1ANDA 1G3DA 3QN7A 3NWUA 3M61U 4IC6A 3VB4A 1J15A 1QCPA 2SGFE 2V7QD 1P2OA 1E38B 2TRMA 1MABB 4XE4A 1ZOMA 3D49H 1FI8A 3Q77A 9ESTA 2BQ7B 1T32A 1GCTC 1GBJA 1CGJE 1TYNA 2XWAA 3SGBE 1C5XB 2W6JD 3OAAD 1SGYE 1K1OA 1QB6A 4Y7AA 1AFQB 1K21H 1WQSA 2VIDA 1F5RA 4D9QA 1EZUC 2RA0A 3OEED 3QGJA 3IITA 6GCHF 1UTLM 5DJ7A 1V2PT 2QAAA 2UUKB 3Q00A 2BM2A 3KQEA 1G2MA 1D9IA 1S5SA 3SU3A 3SV2H 1XM1A 3VB3A 2LPRA 1O2UA 4IBLH 1LQDB 4A7IB 3H7OA 4A6LA 2VGCC 5G4BA 3R3GB 1DVAH 2TGTA 2OUAA 5CDFE 1KTTB 2OXSA 1HBTH 3E91A 3GY2A 1AFQC 2O8MA 3QWCH 1SLUB 2KR7A 1AD8H 3QTOH 1PPGE 3SV7A 3T62A 4TPIZ 2JH0D 2XW9A 2C93B 1FONA 1MUEB 1O2KA 1OSSA 1C1WH 3HGNA 2PFEA 1PYTC 1DICA 4O3UA 5GCHF 1C5PA 4XBDA 1C1NA 1GJCB 5IK2D 2ZA5A 3UREA 1TOMH 4CRFA 5LPEA 1K1NA 3RU4D 1IQFA 4UFDH 3D62A 4Q7ZA 1YCPM 4Q63A 1A0JA 1CBWB 4U30A 5T6FA 1ZZZA 1GHAG 4NFEA 1DANH 1SB1H 2GCHG 1Q2WA 3CS0A 4NA9H 3GCOA 4CBOA 2BQ6B 3RMOH 4HI3A 2H6MA 4Q2KA 3DSOA 4KGAA 1GHZA 4ZHAA 2SGAA 1P3EA 1WYKA 1TIOA 2GV7A 1TOCB 2GKVE 3KYFA 1A5HA 1AY6H 1LPGB 2AEIH 4ASHA 4CRCA 1A5GH 2BOKA 2QYIA 1V2QT 1YF4A 3K65B 6CHAB 2DE8A 2R9PA 5L2ZH 1P57B 3M36A 1UVPA 2KX4A 1XVMA 3OFND 3PMAB 5C5NA 4AGKA 1E36B 1CHOG 1G36A 1UHBB 2BDCA 2KAIA 4FETA 2Y80A 3RXQA 2Z3EA 5ESBA 1C5LH 1ANCA 1EPTC 4DT7B 4X1NU 1WTHD 1O3MA 3RC5A 1BMNH 4DT4A 1EX3A 2FPZA 1NFUA 1NBMD 3ZZ3A 1FAXA 2G4TA 1MH0A 1VCWA 2VH6A 1EXFA 3OY5U 1C1QA 1C1VH 1NT1A 1GBMA 5F53A 3PRDA 1DT2A 3ATIA 1BA8B 1XVOA 1L1JA 2PGQB 1W3CA 2DE9A 3RLWH 1GHAF 4D76A 4HFPB 3DSPA 1SQAA 2TGDA 4NFFA 1QRXA 1FQ3A 2O9QA 5A8ZA 1GVKB 1D3PB 1O3AA 1ZTLA 1KLIH 1QQUA 2ODYB 1GBIA 2B8OH 1P12E 4NSVA 4GSOA 3NK8A 4JMYA 2R0KA 1OYTH 5EJ1A 3FZDA 1A3EH 2Y5FA 5FXLA 1LKAA 1LO6A 2UWPA 3BTME 3C27B 4NIYA 1EAXA 2BVSH 1DDJA 7ESTE 5F03A 5DP9A 2WPHS 1VJ9U 1XMNB 3OTPA 2FX6A 3GISB 5C17A 3FOAA 3ZVDA 3STIA 1A3BH 1IQLA 1ZSLA 4CR9A 1MQ6A 4K3JA 5HIYA 5IYTA 2A31A 4ESTE 3TNSA 2ZDNA 3MOCA 1C2HA 3SGQE 1J16A 3LOXA 1C2EA 2Z94A 4WXIA 2R3YA 1SGCA 2FTLE 1YBWA 1A0HB 1S0RA 5GWZA 1UTQA 3LC3A 2AMQA 1XX9A 2FX4A 2QXIA 3PLBA 2HNTC 2ZFRH 4MDSA 2ZPSA 1TRNA 2VVVA 1Q31A 3RXCA 2GZ7A 3I78A 1KMHB 1K1PA 1F7ZA 3BTHE 1O31A 5JB9S 1KXEA 1A1RA 1BRCE 4JZEH 1T7CA 5CMXH 1IQKA 2VIOA 1YLNA 1OWDA 1NRRH 1AMHA 1SBWA 3EA8A 1NFWA 2Z9GA 4H6TA 1CQQA 1F0TA 3RXUA 1O2XA 1THRH 2BD3A 1H8DH 1NO9H 3RP2A 1J17T 2XC5A 3EYDA 4WMEA 1GJBB 1YPJH 4PROA 3HK3B 3EE0B 4ABDA 1WAYB 1B7XB 1KXFA 2R2MB 1HXFH 2PR3A 1QRZA 2ZQ1A 1EUFA 1PPBH 2TGAA 1GBCA 2ZGCA 3PROA 1O5GH 3UFAA 2Z9IA 2F4LA 1GBKA 4JZFH 4Y6DA 4D8NA 4FUJA 2Y81A 5JYIA 3ZZDA 1IQNA 1V2KT 1G3BA 2XXLA 2SGQE 5EXMA 2NU2E 1E37B 4YZUA 2WPJS 1LVYA 1IQGA 1OWIA 1UTKA 1V3XA 5TCAA 2GP9B 1S6LA 4ZMAH 1MTSA 1GJAB 1NRSH 3GCHC 1AQ7A 1N6YA 5AFZH 2ZGHA 1GMHF 5FCRA 1VCQA 3OE7D 3UOPA 2BY6X 1XUFA 2TGPZ 1O35A 5KGOA 1K0HA 2KCYA 1XUGA 1W0YH 4GCHG 4AFSA 4B73A 3OX7U 3QK1A 1MD7A 1EFRD 2QF0A 3TVJB 1ID5H 1H8IH 3SUGA 1GJ6A 2ESTE 5E0JA 3ZVFA 3I77A 2BX4A 2KCPA 1O3PB 1A2CH 3QO6A 1F5LA 1CA0C 4CRGA 1GI9B 4RT1A 1LHFH 2BYAX 2PSYA 4DOQA 2P59A 1WQVH 1JXPA 3QUMP 4BXSA 4WH8A 5A09A 1QR3E 1VITG 3RC6A 1OWHA 2D26C 4DIHH 1C5UA 4ZXYH 4J1YA 2LELA 3RXPA 1BMLA 1S81A 2QC2A 2VIVA 1NRPH 1TGNA 2FLRH 1ELDE 2XNIA 1GJ7B 3N7EA 1O3KA 2F3CE 4IN2A 1KXBA 3TH2H 1W7XH 3RXIA 3QGNB 5FCKA 4B6EA 1OKXA 5EPYA 2J5UA 2WPLS 3SV9A 4UFEH 3AW0A 1P04A 5EXLA 1ORFA 3LH1A 1QIXB 2ASUB 3A7VA 1Y59T 2C8WB 2A5IA 4XFQA 1SLWB 4MNXA 4JZIA 1C5OH 2BD5A 1V2NT 1NFYA 2PLXA 2GX4A 2UUYA 3MU0A 1W10U 4GCHF 3RDZA 4KELA 1GHBG 1EB2A 3GCHB 3PLKA 3BV9B 2ALVA 1GI2A 2EI6A 3W94A 1LTOA 4JK6A 1HV7A 2ZFPH 4AB9A 2FOBA 1H1BA 3SU4A 2KFWA 1IQEA 2CK3D 1SI5H 2GD4B 5E2OA 4RN6A 4ZKOU 1CU1A 4AN7A 1XUKA 3GS9A 1ELVA 3BG4B 1QB9A 1GHVH 5KEDA 5EGMA 1DSTA 3S0NA 1Y3VA 5EW2H 1JRSA 1BZXE 1QB1A 2PWXA 3FP8E 2J98B 3LC5A 1KXDA 2PGBB 2VNTA 3RUOA 3VXFH 1RGQA 3A7YA 2BQWB 2EY4C 4UONA 1FNIA 3D65E 2XOKD 4U2WA 2OQ5A 3NRLA 3LGYA 1BJVA 3SNEA 3K2UA 1QNJA 1SKYE 4WMDA 3RU4E 4FU9A 1UCYH 4ZCNA 1P2NA 1K1LA 1Z8JB 3RXDA 1TLDA 3TIUA 1RD3B 2FM2A 1IOEA 3BEIB 4ASUD 3SJKA 1THSH 3DFLA 5C20A 2RFKC 1GBAA 3AAVA 2C8ZB 4YOJA 2KCAA 2XC4A 2FOAA 3A87A 4Y0ZE 4ZXXH 5JBCS 3E16B 1HAPH 2IN2A 1YWUA 4Y0YE 2P3TB 1V2ST 2G8TA 2YMSC 2O8LA 3LGWA 4FUCA 1MU8B 3MU4A 1HJ8A 2CHAC 2B0FA 2FDAA 5BRRE 1UK4A 3LJOA 1YC0A 1O2GH 1O2ZA 4F55A 1MKXK 6ESTA 1TMUH 3SNDA 3A8AA 2ZEBA 1KXCA 1KDQA 4A1TA 1MTNB 1GBFA 2C3SA 2G4UA 1SQOA 2ANWA 4BOHA 2VGCB 4BTUB 4ZKSU 3ESTA 1O2NA 2RA3A 1O2QA 2ZHQH 3ZVAA 1CHGA 1TNJA 2HWLB 1OWKA 2J94A 3FP6E 1O34A 1O5AB 1H8ED 2ZG0H 1NY22 2M2AA 3LH3A 2ZHFH 1GGDC 2QF3A 4MQAA 1BTYA 5H4IB 2HLCA 5DP6A 4B2CA 2KM0A 2J97A 4U01A 2ZFTA 2RDLA 3Q3YA 5K7RA 3W1EA 4BAQB 1MQ5A 2FS8A 3AK5A 1VR1H 3U8RH 3RM0H 1GBHA 1HJ9A 1LDTT 4DGJA 2FXRA 3P8FA 3A7XA 2PP6A 5F8TA 1HAHH 4MNVA 4K5ZA 4YM9A 1TWXB 1RJXB 2UWOA 2H2ZA 4DG4A 2ZU2A 8GCHG 5AVDA 3KQBA 3ZV8A 1YP9A 4MLFB 2OP9A 1MBQA 4FUIA 3M7QA 1KTSB 1BTUA 1HLTH 3RXKA 1BRAA 3EDXB 4X6PA 1QZ8A 1EOJA 1TMBH 1MU6B 3L6PA 1C2GA 1ESBA 1HJAB 2ZTZA 4CRBA 4AC9A 3HKIB 1KSNA 2IJD1 2JH6D 1OP2A 3MH4A 4I32A 1HRTH 1P01A 2ZWLH 1LKBA 1HAXB 1C2MA 1UHBA 2C90B 2W7SA 4OS2A 1C1OA 1FPHH 1A5IA 1W12U 2ZC9H 2RCEA 4JK5A 2K1QA 3MO9A 5C3NA 1P05A 4MNWA 1Y3WA 3SJ9A 2ANYA 2NU0E 4SGAE 1P2KA 2SFAA 3VB6A 3FFGA 4P02A 2V3MA 4IW4E 4X8TH 4GHTA 4BAHB 3DFJA 3E6PH 4HTCH 1O2PA 2OINA 4OS4A 2HVXA 1GMDG 1V6DA 1JOUB 2AERH 3SHAH 2V0BA 1TNKA 3NXPA 4INHA 2FI4E 3P8GA 1HAZB 4AFQA 4MNYA 4WF8A 3P95A 3DT0H 3HATH 2A32A 3U1JB 4BAMB 1LHEH 3EGKH 1AUJA 5A0AE 3AVZA 4XSKU 4MTBA 3S7HB 1WUNH 3RXVA 4NCYA 2EI7A 2ALPA 1H9LB 5C67A 3MTYA 1FIWA 1ZLRA 4O03A 3SGAE 5A0CA 1MZDA 3SW2B 4JZDH 1QY6A 2BLOA 1TMTH 4FU8A 5FX6A 1BHXB 3FVFB 4X8VH 4DVAU 1G37A 2EQNA 1HAVB 2G00A 1S0QA 3M37A 2FODA 2QXHA 3F0PA 1O5EH 4WY3A 4Q4LA 3GDSA 2BDGA 4TYDA 4X1SU 3ODFA 3O8RA 2BXTH 1A61H 1NROH 4DIIH 3F9FA 2KZ4A 3N7DA 1O36A 1YLCA 4GHQA 3BTFE 1MTNC 1AKSB 2FO9A 1C5ZB 3QLPH 2ZTXA 1EQ9A 2M5TA 1K2I1 1OOKB 4DJZB 2BY9X 1NM6A 3SU1A 1O37A 4GVUA 1YPMH 3KCGH 3ATKA 3VB7A 3M7UA 2VINA 2VWNA 2FOMB 1XUJA 1GI3A 2NU4E 1G2LA 1AE8H 1RTKA 2OBOA 2ZCKP 2HPPH 5CE1A 5C0UA 1DE7H 3V12A 1QFKH 4NA7A 5GCHG 1BB0B 1ZJDA 3VGCB 3TH3H 1GI7B 3A84A 1NESE 1GI0A 1S83A 2KCOA 1WOFA 1F92A 2BXUH 3OEHD 3PV5A 3GY5A 2JIZD 1CGHA 1HIAB 2W5EA 1K1MA 2WPKS 2BDYA 2NU3E 3RC4A 2BDAA 3RMMH 2AGEX 2BDHA 1ZMLA 2PUXB 3F2GA 1FY3A 3KL6A 3IWMA 4O9VA 5CHAB 1BCUH 2Y82A 2GMTC 2WUCA 3ZVBA 1EJAA 4ACBA 1M9UA 7KMEH 2CJIA 1CT2E 4WMFA 3T25A 3LONA 4IMQA 4X2YA 3SV6A 1ELEE 1BOQA 5EU8A 1INCA 1GJ4H 1ZMJA 2UUFB 4K60A 1HB0B 3SBKA 3BTQE 1DSUA 5LPFA 3NPSA 1Q3XA 2BD9A 3ZZCA 5F6MA 5DP8A 1P8VC 3DUXH 5CHAC 4FUDA 3CS7A 4X8SH 3BTTE 2Q1JA 5HMAA 5JB8S 2J34A 2BX3A 2CMYA 4K1TA 1HAGE 4I33A 3HKJB 3MH5A 3P17H 3UWJH 1A0LA 4Z1MD 1YGCH 4AG1A 3ZIAD 1K9OE 1UMAH 1P03A 2OK5A 1EJMA 1DWDH 3V3MA 3MH6A 1O3FA 1O2VA 3ZVGA 2YMSD 2XBYA 1UTJA 1FJSA 1G30B 5GIBA 1SG8B 3PO1B 2Y5GA 5E2PA 1YY3A 3QX5H 4NG9H 2WINI 3RXRA 1QHRB 2JDID 1XXDA 1ABJH 2K8IA 3SJIA 2J4IA 4AYYB 3MWIU 3LIWA 1SMFE 2XTTB 4IMZA 5EODA 3U9AH 1C2IA 3M5LA 2JETB 2SGEE 1VITH 5A8YA 1ZYOA 1O39A 3VFEA 4TSFD 5JDUB 5JBAS 2Z9JA 4MVNA 2CHAB 4OM9A 1UTMA 2YMSB 3ZVCA 1MZAA 3SNBA 3A82A 1LPKB 1O3CA 1QL9A 1DY8A 1O2HA 1ZPCA 2GT8A 4WVPE 1PPEE 3GCNA 1W14U 2FOCA 4K8YA 1TALA 4D9RA 1KLJH 1VJAU 1Y8TA 3GOVB 4TY7A 2J38A 3GDVA 1BRUP 1O3JA 1XKAC 3FANA 4ABIA 1UVTH 5C5OA 3SORA 2BY8X 2BDIA 4K1EA 4CR5A 3R0FA 2FESH 2XYAA 3K9XB 1FN6A 1O2LA 1O3GA 4KP0A 4JCNA 1O32A 1XUIA 2PW8H 2HRVA 6GCHG 4CH8B 2GDDA 1HCGA 1EOLA 2J92A 2A7HA 1GDNA 1V2VT 2P16A 1QTFA 4I8HA 3WWFA 1SGRE 1SHYA 2V3OH 3KIDU 1CT0E 3CNRA 1V2WT 4Y11E 1AN1E 5F8ZA 1LVBA 4H42U 4ZHLU 1W0ZU 1P06A 2L6OA 2OC7A 4Y10E 3WW7A 5CHBA 2A4QA 3SU6A 4NSYA 2A0QB 2VVUA 1ACBE 3A8BA 4IN1A 5I46H 1BT7A 3ZZAA 1IQIA 1EKBB 1WV7H 2J2UA 3UNRA 2WHXA 2HNTE 2OC8A 4ISHH 3GCTG 1C9TA 2BVRH 3SI4H 5L6NH 2F9UA 4KTSA 1GBDA 1AGJA 1AVGH 2FI3E 2XBXA 2XBWA 1V2LT 4XDEA 2ZCHP 3PB1E 4XD7D 1JWTA 4YO9A 2J9NA 1K22H 2VBCA 1H4WA 1MMJN 1RIWC 2V6NA 1BTWA 1DITH 1MTVA 2BD8A 4X8UH 1NC6A 3H7TA 1B0FA 4FOUC 4Q7XA 1HYLA 1ELBA 4BNRA 1BJUA 5HM9A 3VEQB 1DUEA 2A4RA 5DPAA 6LPRA 2BLWA 4F49A 3RXEA 4A1VA 1LQEA 4FVBA 4CREA 1WDIA 2A4OA 2ILNA 2QXGA 1XKBC 1DOJA 1EP5A 2BLQA 4I8JA 1WSSH 3KNXA 1B0EA 3GY8A 5J4QA 1CHOF 1Y5BT 2STBE 4RSPA 2HOBA 1GBLA 3KQDA 1O30A 2C8YB 5C1UA 1PFXC 4QT8C 3RXOA 1TABE 2K0QA 1DXPA 4AX9H 3V7TA 1GBTA 2XBVA 3U8TH 1QBOA 2PKAB 1O2YA 1YPHE 3SJ8A 1NS3A 4WJG2 1BMMH 4B2AA 4BTIB 3M7TA 2ZQ2A 3RXTA 1YCPK 1RTLA 2FLBH 5EIYA 2HLDD 1MAYA 1UVSH 4X6MA 1Y3UA 2ODPA 2QXJA 1PYTD 1MTUA 2LNCA 2QN5T 4NWLA 1TE0A 3RXAA 2FZZA 2BDBA 2ODQA 1AFEH 3LPRA 3RXLA 5C2ZA 1FDPA 4ACAA 2FYRA 3UR9A 4FUGA 2BD4A 3N99A 3SU2A 1OP8A 2ZGXH 4BAOB 3MO6A 3LGIA 1GPZA 2CXVA 1A4WH 2OC1A 2VJ1A 3BSQA 3ZZ7A 2A45B 2OTVA 3EAJA 2G52A 4AFZA 3E90B 1HIAA 1TBQH 1NU9A 1AZZA 5T3HA 1S6FA 3BTGE 1D3TB 1J14A 1AUTC 1VGCB 5B6OA 3P6ZB 3VB5A 1RIWB 1DUAA 2ZECA 1C5QA 1H9HE 2C8XB 2VB0A 3H09A 1TPSA 3W95A 1UJ1A 3DCLA 1DX5M 2D2DA 2ZHEH 1ANBA 1EZQA 1SGFA 2ANMH 2B7DH 1ANEA 2J95A 2A7JA 5FHTA 3TITA 3T26A 1THPB 2XCNA 3PYHA 4MPUA 5DP3A 1GL0E 2R0LA 4E06H 3RMNH 1BBRK 1C4U2 4TWYA 1GHXH 5HYOA 1T4VH 1KY9A 1Z71A 1FY5A 2ULLA 4B71A 1Y3YA 1KYNA 1TB6H 1SLVB 1O2RA 2JH5D 3QZQA 4XBBA 3UPEA 4FVDA 4ABEA 5IDKA 1T31A 1WBGB 4ISLA 3V13A 5B6LA 2O8WA 3ZV9A 5KECA 2IPQX 1GI4A 4X1QU 1UVUH 3ITIA 1G3EA 1QRWA 1GVZA 3M3SA 2UWLA 3FZZA 1EASA 2Q6DA 5AHGH 3Q76A 1P10A 3M35A 3TGKE 1BTXA 3S7KB 5C94A 1BUIA 3A89A 3SJOA 2WYGA 1V2UT 3GYLB 2G5NA 1S84A 2EEKA 2GDEH 3B9FH 1Y5AT 3IG6B 5AF9H 1DPOA 1GI6A 1GBEA 1H8HD 1DY9A 3CENA 3BIUH 2A7CA 2XWBI 4NIVA 1K1IA 1IQMA 1Z8GA 3ATWA 1P02A 2AYWA 1GDUA 1AVWA 1T8LA 2HALA 3TU7H 4HGCA 3UQVA 4R8TB 2OC0A 1TFXA 3QZRA 3S9AA 3UY9A 4Y8ZA 2B5TB 4VGCB 1O3LA 4K69A 1AI8H 4OGXA 1OYQA 1FY4A 1BBRH 5LGOA 4H6SB 3RXMA 1FV9A 1LMWB 3E0NB 3KHVA 2QF4A 4J2YB 3LKWA 4ZAEA 4NWKA 1EZXC 2W26A 2ZCLP 5EG4A 2XCFA 1T8MA 1LHCH 1TPPA 2BTCE 3LGVA 1AHTH 1EZSC 2VWMA 3H5CB 4JYTA 3SOSA 2ZDMA 4XRNA 3PMJA 4THNH 1E35B 2WPMS 3N7OA 3SNAA 1K28D 1AO5A 2BD7A 1L1GA 3RXFA 1O3BA 3VPKA 4K8BA 2BHGA 1HFDA 5GDSH 1YYY1 1TX6A 3A8CA 1H9IE 1SGTA 1LVMA 4AG2A 1GCTB 1ESTA 2GCTC 2EC9H 4YLUA 1RFNA 1ZHPA 3PTNA 3F1SB 1GHWH 3A81A 1C5YB 2FI5E 2Y5HA 9LPRA 3F9EA 1A46H 1C5NH 1O2JA 3P8OA 2VVCA 1Y5UT 4Q80A 4M9FA 2R3UA 3A7ZA 4DW2U 3AAUA 2GV6A 3VXEH 1HGTH 1GJ8B 2BB4A 1MBMA 4E05H 2FMJA 1VITF 1Z6EA 4Q7YA 1ZHMA 4NZQA 3JZ1B 5SGAE 5EJZA 1S6HA 3ZZ8A 4Y76A 3BTKE 1TPOA 3B8JA 1ELTA 5FL7D 1U6QA 8ESTE 1Z7KA 1HUTH 2ZU3A 4Z0KA 5ESTE 1PPHE 2OQUA 3KF2A 1FY8E 3U69H 3TJNA 1MTWA 3K6ZA 3UWIA 1ZRKA 2XC0A 5JBTA 1D6RA 1GL1A 2QCYA 4YESB 1C5WB 1GGDB 1DFPA 2WZQA 2VH0A 3F9HA 1UW7A 4CHAC 1F0RA 4YXWD 4B74A 1GVLA 2QA9E 3URCA 1D6WA 1TNIA 3LGTA 1O3EA 3LJJA 5I25A 2HNTF 2VU8E 3ZZ6A 4YT7H 3SI3H 2F9BH 2BZAA 1SFIA 3MNCA 1C1UH 3O8DA 3EE7A 4Y71A 1IAUA 1SPJA 1C1SA 2BLVA 2ZU4A 1KDQB 1E0FD 3A80A 4A92A 5GPIB 4X2WA 4K2YA 1FY1A 2CF8H 2VIWA 4TY6A 1OXGA 1C2KA 2FOHA 1UCYE 1AE5A 1ARBA 1W0KD 3MYWA 1EAUA 4RKJB 1TAWA 2AMDA 2H5CA 2ZDVH 2Z9LA 3T28A 1LHGH 5FAHA 4K1SA 1LPZB 3BN9A 2D8WA 1C2DA 2RG3A 4ZKRU 2PV9B 2F43B 1P2JA 2TIOA 4B1TA 1O3OA 2AHME 2IOTA 4IS5A 3MQKC 1AU8A 3P70B 4WH6A 3ODDA 1OX1A 1BDAA 3EA7A 4LXBH 3K6YA 5EW1H 1TBRH 4ABHA 1WU1A 5E8EH 2L74A 5C1YA 2YOLA 4HZHA 1C4Y2 1EATA 1ZR0A 1C1MA 4F48B 2O8UA 5J4SA 2A1DB 2ZNKH 3RXSA 2A5KA 2WV5A 1V2TT 4M7GA 3UR6A 1BTZA 2FWWA 1PPZA 1HPGA 2YNAA 3SUEA 1OPHB 3BEFB 5EXNA 3OTJE 3TJOA 3S9BA 1TNLA 1GI5A 1GJDB
chains in the Genus database with same CATH topology
4NIXA 1NPMA 3PWCA 4ISIH 3AW1A 3RXHA 3VGCC 2F9VA 3FP7E 1E79D 2SNVA 4FUHA 2JJ1D 2EA3A 1ZGIA 1Z8RA 3S9CA 2BZ6H 5DKMA 1EPTB 1SSXA 2CN0H 1NU7B 3RU4T 3SHCH 1D3DB 4ZH8A 4CH2B 3FN8A 2GCTB 1KLTA 3SN8A 1PQAA 3PLPA 5HGGA 1DLEA 4IGDA 1YPLH 3ZZ5A 3SQHE 1P9SA 2IJOB 4R0IA 4LOYH 2ZI2H 1BTPA 4Z6AH 3HPTB 1L0ZA 1ZGVA 3GY6A 4VGCC 1TA2A 2Z7FE 5TJXA 4LZ4B 1SFQB 1BIOA 1ELCA 1WTGH 3PTBA 4UE7H 1AB9C 1FAKH 1O3NA 3M5OA 2P95A 1IQJA 3MMGA 1P2QA 4KTUA 1G32B 1ZPZA 3ATLA 3STJA 1FIZA 1UK2A 1V2RT 1W7GH 5E0GA 5DP5A 3DD2H 2C4FH 4D7FA 4INLA 3F6UH 2PSXA 4NA8A 5GXPA 3CP7A 2P8OB 4AGJA 5DSFA 1WXRA 1YM0A 2AGIX 4SGBE 3PV2A 1OWJA 2GVFA 5HXFA 3F3BA 8GCHF 4LK4A 1FLEE 1XUHA 2G81E 4NZLA 2ZP0H 3C1KA 1W0JD 2Q6FA 3SO3A 1FXYA 3BEUA 4YT6H 1W11U 3E8LA 1C9PA 5GJ4B 1CBWC 2ZDLA 1TGSZ 2P8OC 4H4FA 3MI4A 1SGFG 3BTDE 5GNDA 1AIXH 2ZTYA 2P3UB 2GCHF 2A4GA 1KXAA 3OU0A 2ZKSA 4Y8YA 2QF5A 3KQCA 2FYQA 1F0SA 5A8XA 3T5FH 5FPSA 1XXFA 1BQYA 4JZ1A 1O2TA 3SZEA 3RMLH 1AWHB 1AB9B 2OD3B 3KN2A 2F91A 3MU1A 3UQOA 3FKSD 1UO6A 1O2OA 2FS9A 4X1PU 1ZMNA 1CO7E 1EAWA 1G3CA 2CV3A 4YTAA 3SZNA 1GMCF 3PO1C 2FIRH 1CSOE 1O2SA 1T8OA 1ZJKA 2F83A 4AOQA 1O3IA 3ZYDA 1F0UA 1GMHG 1DS2E 1COWD 1D3QB 3LU9B 1OS8A 4BANB 3BTWE 3MNSA 1C5VA 4MG3A 1OHHD 1PPFE 1QA0A 1DM4B 5DO4H 3GCTF 1TGBA 2TBSA 2W3IA 3Q3KA 1TNHA 1JIMA 2V35A 1CVWH 4DURA 2OCVB 3RLYH 4BAKB 1SOZA 5FPYA 4YOGA 4I8KA 3TH4H 1DLKB 4CHAB 2ZIQH 1RS0A 3O8BA 4GAWA 1GJ5H 2TPIZ 1VGCC 3A8DA 3F2HA 8KME2 4I8GA 3S69A 2AFQB 3GICB 2ZPRA 4Y79A 1CGIE 4JYUH 1C5SA 2Z6BD 1SVPA 2ZO3H 1CA8B 2I6QA 2GMTB 2WUBA 4BXWA 1GG6C 3A83A 4OS7A 4GPGA 2JKHA 1SGNE 2ZF0H 1BMFD 1N8OC 4UFGH 2ZPQA 1UCYK 4NIWA 2ZDKA 4GUXA 1MCVA 2THFB 3ZZ4A 1GHYH 1SOTA 2EI8A 1O5DH 1TNGA 2AMPA 1GMCG 2FEQH 2ZGJA 1ESAA 1L2EA 3TGJE 1ABIH 1PJPA 7GCHF 1C1RA 1CE5A 3BG4C 2WV4A 4LZ1H 2A2XH 5BPEA 1C5MD 5FX5A 2PTCE 3LDXH 3SYJA 1TQ7B 2ZFFH 5DGJA 1GWAA 1C2JA 5EQRA 1L1NA 1ETRH 1HAYB 3MO3A 7LPRA 3P8NA 5JPMH 4OGYA 3PRBA 3Q3XA 3RXGA 5DK1A 3GDUA 2ZFSA 1UK3A 3HGPA 1DWBH 2AS9A 2SGDE 4MPVA 1RXPA 1RTFB 3BIVH 4OS6A 4MPXA 2AIPA 2QIQA 3F9GA 1NRNH 2IPHA 3SU0A 1ELGA 3F68H 2F9PA 4UEHH 3NCLA 3A88A 2QY0B 1O33A 4XOJA 3BF6H 1JRTA 3U1IB 1UTPA 1W13U 4OS1A 2XNDD 1ZSKA 4RKOB 1TPAE 2W7UA 2A5AA 1L4DA 2JJ2D 2WV9A 4DCDA 2GGVB 3QDZB 1F5KU 2P93A 2VIPA 4ISOA 3FO8D 2BY7X 1O5CB 2ZDAH 3L33A 1PQ8A 1SGEE 2H9HA 5A2MH 5L30H 4ZKNU 7GCHG 1FPCH 2ANKH 4AZ2B 3M5NA 3U98H 3A7TA 4KKDA 5EPNA 1C1PA 3TLOA 3U8OH 5C0TA 1UTOA 4FXGH 2H9TH 1HXEH 1QL7A 5FBIA 2PKSB 3QTVH 2QE7D 1O5BB 4UD9H 4B6FA 5LPRA 3UIRA 2FOEA 4ABFA 1N6XA 1BITA 3GY7A 1YCPH 2V3HH 1NFXA 1J9CH 1Y3XA 5EQSA 2OLGA 3BTEE 1EAIA 2GZ8A 1SGPE 1O5FH 4XBCA 1DXWA 3LGUA 3SUDA 4YLQH 2YNBA 2SGPE 1J8AA 1HNEE 3B23B 3OSYA 4FUEA 2G5VA 3PMBB 4Y7BA 2GZ9A 2WYJA 1TBZH 3SV8A 1TQ0B 2G55A 3M3VA 3URDA 4ABBA 3O8CA 1BBRE 4FUFA 1D4PB 2STAE 1QBVH 4UFFH 4NGAH 1P0SH 4OS5A 1NBME 1SGDE 2ZFQH 3ZZBA 2VWLA 2WPIS 4WWYA 3ATMA 1EP6A 2Q6GA 3WWBA 1TGCA 5ABWA 3SUFA 3EQ0H 1C5TA 1SGIB 2O8TA 5DG6A 1GI1A 4INKA 1HAIH 1ZTKA 4CRAA 1GDQA 3UNQA 3SNCA 4ZHMU 4DY7B 1Z8IB 1P11E 2Y7ZA 4X6OA 3MHWU 2ZU1A 1E34B 3E1XB 2GT7A 3GY3A 1G9IE 2I6SA 1NZQH 2BMGB 3SQEE 1S85A 5L2YH 1N1LA 2PUQH 3HK6B 3BG8A 1LHDH 1RRKA 4X1RU 1DWCH 3DHKH 3MNXA 4E7NA 2PHBA 3WY8A 4ZROA 1MAXA 2G51A 5DP4A 3UTUH 3TK5A 1TX8A 4X6NA 2A2QH 4KTCA 1YPKH 1S82A 1YLDA 1MKWK 2FP7B 1MKXH 4AB8A 1CA0B 1VZQH 4ABAA 4O97A 2FOGA 4FUBA 1OP0A 2VIQA 1QJ7B 1T8NA 4U32A 1SC8U 1E1RD 4JYVH 3D23A 3P92A 1DWEH 2W3KA 5A0BA 2AIQA 2CF9H 3TJVA 1ARCA 2PKAA 1E1QD 2OBQA 4RI0A 1FN8A 3A85A 1A7SA 3PWBA 3RXJA 1LVOA 1QQ4A 4A1XA 1ZRBA 2R2WU 1GHBF 1Z6JH 1O3DA 4ABGA 5E0HA 1AZ8A 3AASA 3OY6U 1ZSJA 1B5GH 1O2IA 1YKTA 2CGAA 2H5DA 1GI8B 3G01A 3ZZ9A 4X2XA 1YPEH 1SR5C 2HPQH 1P2IA 4F4OC 3GY4A 5PTPA 2VWOA 3I29A 2B9LA 4Y8XA 2DUCA 3M3TA 3PM3A 1WCZA 3ELAH 3PV4A 1TX7A 3NKKA 4TWWA 2ZZUH 5EOKA 1V2MT 2PTNA 2Z3DA 2BVXH 2FTMA 4TPYA 2Y7XA 2UUJB 1NRQH 1GBBA 1MD8A 1O3HA 2WPDD 1GG6B 5TCCA 1JMOH 1FX0B 1PQ5A 1QBNA 1C5RA 3NUMA 2QGRA 2GTBA 1X7AC 4GLYA 5T6DA 1ZPBA 5F8XA 2NWNA 2SNWA 4X2VA 1HAOH 1EB1H 1PPCE 3GYMA 1UVOA 3V0XA 1P09A 4ISNA 1Z1JA 4YOIA 5FBEA 3ZYEA 4ZUHA 4A5TS 1ZTJA 3JZ2B 5HKKD 6CHAC 2D1JA 2F9OA 1BRBE 1GCDA 1MKWH 4I31A 1UTNA 4B76A 4CBNA 1SHHB 4B75A 3TNTA 5LH8A 4IC5A 4BTTB 1QGFA 4CRDA 1LCYA 2BY5X 2BD2A 4AORA 1AKSA 1FMGA 4I7YH 2WSSD 2W6ID 5K0HA 2F9NA 1AVXA 3MNBA 3NZIA 1P2MA 1GJ9B 1YPGH 1IQHA 4B2BA 3UOUA 1VCPA 4I8LA 3ENSB 2AGGX 1HAVA 3TJUA 3MU5A 2Z3CA 3UB0A 1TONA 3DA9B 4ABJA 2FOFA 3LT3A 4E7RG 1TRMA 2P94A 3OYPA 2Z9KA 5JBBS 1TGTA 3TK9A 1BTHH 2P3FH 1ELAA 4TT3D 1TRYA 3A86A 1T4UH 4FU7A 3SU5A 1BMAA 1F2SE 2ZGBH 2PKSC 5DP7A 1SLXB 1W8BH 1CT4E 3TPIZ 3UUZA 2H1UA 2JETC 4WXVA 1FUJA 1P9UA 8LPRA 5T6GA 1V2JT 1O2MA 2ZU5A 4MPWA 2BOHB 1YPHC 5ETXA 3TK6A 1SQTA 1Z1IA 3RXBA 1SGQE 4AFUA 3FAOA 1L4ZA 3F2FA 1O38A 3RM2H 1HDTH 1OWEA 1W2KH 1K1JA 3VG8A 5T1VA 5FPTA 2QV1A 1JBUH 1EJNA 1C2FA 5AFYH 1IHTH 1HJAC 1BHXF 1ELFA 2H9EH 4X0WU 1C2LA 1NN6A 1PQ7A 1O2WA 3PMHB 1ZHRA 2ZHWH 1QJ6B 3TGIE 1O0DH 2ZHDA 1TA6A 3T2NA 1C1TA 1FZZA 1KIGH 1EPTA 1NTPA 5EQQA 3EA9A 4D7GA 2KAIB 2AH4X 3MU8A 3KEEA 3KGPA 3F0OA 4O3TA 1QL8A 1C4V2 1ETTH 1SL3A 5HM2A 1ETSH 1N8OB 2HGTH 2Y6TA 3T27A 3ZVEA 1V2OT 3MH7A 3E0PB 5C1XA 3MFJA 1IHSH 1QURH 3M5MA 1QA7A 4AYVB 1GMDF 2XRCA 3A7WA 3E3TA 1JIRA 1P3CA 4UDWH 5DN6D 3T29A 1QJ1B 2NU1E 1AWFH 1MCTA 3UNSA 3L3TA 1ANDA 1G3DA 3QN7A 3NWUA 3M61U 4IC6A 3VB4A 1J15A 1QCPA 2SGFE 2V7QD 1P2OA 1E38B 2TRMA 1MABB 4XE4A 1ZOMA 3D49H 1FI8A 3Q77A 9ESTA 2BQ7B 1T32A 1GCTC 1GBJA 1CGJE 1TYNA 2XWAA 3SGBE 1C5XB 2W6JD 3OAAD 1SGYE 1K1OA 1QB6A 4Y7AA 1AFQB 1K21H 1WQSA 2VIDA 1F5RA 4D9QA 1EZUC 2RA0A 3QGJA 3OEED 3IITA 6GCHF 1UTLM 5DJ7A 1V2PT 2QAAA 2UUKB 3Q00A 2BM2A 3KQEA 1G2MA 1D9IA 1S5SA 3SU3A 3SV2H 1XM1A 3VB3A 2LPRA 1O2UA 4IBLH 1LQDB 4A7IB 3H7OA 4A6LA 2VGCC 5G4BA 3R3GB 1DVAH 2TGTA 2OUAA 5CDFE 1KTTB 2OXSA 1HBTH 3E91A 3GY2A 1AFQC 2O8MA 3QWCH 1SLUB 2KR7A 1AD8H 3QTOH 1PPGE 3SV7A 3T62A 4TPIZ 2JH0D 2XW9A 2C93B 1FONA 1MUEB 1O2KA 1OSSA 1C1WH 3HGNA 2PFEA 1PYTC 1DICA 4O3UA 5GCHF 1C5PA 4XBDA 1C1NA 1GJCB 5IK2D 2ZA5A 3UREA 1TOMH 4CRFA 5LPEA 1K1NA 3RU4D 1IQFA 4UFDH 3D62A 4Q7ZA 1YCPM 4Q63A 1A0JA 1CBWB 4U30A 5T6FA 1ZZZA 1GHAG 4NFEA 1DANH 1SB1H 2GCHG 1Q2WA 3CS0A 4NA9H 3GCOA 4CBOA 2BQ6B 3RMOH 4HI3A 2H6MA 4Q2KA 3DSOA 4KGAA 1GHZA 4ZHAA 2SGAA 1P3EA 1WYKA 1TIOA 2GV7A 1TOCB 2GKVE 1A5HA 1AY6H 1LPGB 2AEIH 4ASHA 4CRCA 1A5GH 2BOKA 2QYIA 1V2QT 1YF4A 3K65B 6CHAB 2DE8A 2R9PA 5L2ZH 1P57B 3M36A 1UVPA 3OFND 1XVMA 3PMAB 5C5NA 4AGKA 1E36B 1CHOG 1G36A 1UHBB 2BDCA 2KAIA 4FETA 2Y80A 3RXQA 2Z3EA 5ESBA 1C5LH 1ANCA 1EPTC 4DT7B 4X1NU 1WTHD 1O3MA 3RC5A 1BMNH 4DT4A 1EX3A 2FPZA 1NFUA 1NBMD 3ZZ3A 1FAXA 2G4TA 1MH0A 1VCWA 2VH6A 1EXFA 3OY5U 1C1QA 1C1VH 1NT1A 1GBMA 5F53A 3PRDA 1DT2A 3ATIA 1BA8B 1XVOA 1L1JA 2PGQB 1W3CA 2DE9A 3RLWH 1GHAF 4D76A 4HFPB 3DSPA 1SQAA 2TGDA 4NFFA 1QRXA 1FQ3A 2O9QA 5A8ZA 1GVKB 1D3PB 1O3AA 1ZTLA 1KLIH 1QQUA 2ODYB 1GBIA 2B8OH 1P12E 4NSVA 4GSOA 3NK8A 4JMYA 2R0KA 1OYTH 3FZDA 1A3EH 2Y5FA 5FXLA 1LKAA 1LO6A 2UWPA 3BTME 3C27B 4NIYA 1EAXA 2BVSH 1DDJA 7ESTE 5F03A 5DP9A 2WPHS 1VJ9U 1XMNB 3OTPA 2FX6A 3GISB 5C17A 3FOAA 3ZVDA 3STIA 1A3BH 1IQLA 1ZSLA 4CR9A 1MQ6A 4K3JA 5IYTA 2A31A 4ESTE 3TNSA 2ZDNA 3MOCA 1C2HA 3SGQE 1J16A 3LOXA 1C2EA 2Z94A 4WXIA 2R3YA 1SGCA 2FTLE 1YBWA 1A0HB 1S0RA 5GWZA 1UTQA 3LC3A 2AMQA 1XX9A 2FX4A 2QXIA 3PLBA 2HNTC 2ZFRH 4MDSA 2ZPSA 1TRNA 2VVVA 1Q31A 3RXCA 2GZ7A 3I78A 1KMHB 1K1PA 1F7ZA 3BTHE 1O31A 5JB9S 1KXEA 1A1RA 1BRCE 4JZEH 1T7CA 5CMXH 1IQKA 2VIOA 1OWDA 1NRRH 1AMHA 1SBWA 3EA8A 1NFWA 2Z9GA 4H6TA 1CQQA 1F0TA 3RXUA 1O2XA 1THRH 2BD3A 1H8DH 1NO9H 3RP2A 1J17T 2XC5A 3EYDA 4WMEA 1GJBB 1YPJH 4PROA 3HK3B 3EE0B 4ABDA 1WAYB 1B7XB 1KXFA 2R2MB 1HXFH 2PR3A 1QRZA 2ZQ1A 1EUFA 1PPBH 2TGAA 1GBCA 2ZGCA 3PROA 1O5GH 3UFAA 2Z9IA 2F4LA 1GBKA 4JZFH 4Y6DA 4D8NA 4FUJA 2Y81A 5JYIA 3ZZDA