2XCJA

Crystal structure of p2 c, the immunity repressor of temperate e. coli phage p2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
84
structure length
84
Chain Sequence
SNTISEKIVLMRKSEYLSRQQLADLTGVPYGTLSYYESGRSTPPTDVMMNILQTPQFTKYTLWFMTNQIAPESGQIAPALAHFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the P2 C-Repressor: A Binder of Non-Palindromic Direct DNA Repeats.
pubmed doi rcsb
source organism Enterobacteria phage p2
molecule tags Viral protein
molecule keywords C PROTEIN
total genus 30
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2xcjA00
2LYRA 1JFTA 4Z5DA 2KEIA 1HF0A 1ZZBA 2R1JL 2LCVA 1UTXA 3B7HA 1DW9A 3F51A 2L49A 1GT0C 3F6WA 3PXPA 2OR1L 3BDNA 2HINA 1ZZCA 2IVBA 3FYAA 4X4IA 1PRUA 4YARA 3ZHIA 1XWRA 2IU7A 3JXBC 2O4AA 4YBAA 3HZIB 3ZKCA 3SCHA 1POUA 4Y42A 3S8QA 2EF8A 1LMB3 1Y7YA 1WIZA 1ZVVA 1X57A 2CROA 1DWKA 2PUFA 2PUEA 2XJ3A 4X4GA 2AXZA 1WETA 2L8NA 4JCYA 2AXVA 4IVZA 1QP4A 1PRAA 2B5AA 2GRMA 3G5GA 3KXAA 5K98B 1NERA 3TRBA 1LCCA 3CROL 3FYMA 3VK0A 2MQKA 3QYXA 4GHJA 3KZ3A 4X4DA 4IA8A 3GBFA 1RZRD 3BD1A 2BNMA 1LQCA 4GQMA 4IWRA 1JWLA 4X4CA 1ZAYA 1R69A 4Z59A 1PRVA 2XCJA 3LISA 2O49A 1UXCA 4MCXA 2ICTA 3RZZA 2KZ8A 1PERL 1ADRA 1UXDA 1BDHA 2IV1A 1OCTC 4YG4A 3CECA 3H5TA 4Z58A 2PUBA 3ZHMA 1QP7A 1O4XA 3OQOA 2WUSR 1ZZ6A 1ZUGA 1WH6A 2IVQA 2BNNA 4Z5CA 1RZRA 1EFAA 1LCDA 2JVLA 2AUWA 2LYLA 3EUSA 3G7DA 2MEZA 3DNVB 4I6UA 1ZS4A 2JCGA 1QQAA 1YSEA 2PUGA 4YG1A 2H8RA 1OSLA 2EWTA 2IVGA 1QPZA 1QQBA 3BS3A 3SCFA 3OQNA 2HSGA 4PU8A 2O38A 2PPXA 2PIJA 3FMYA 4O8BA 3JXCL 2A6CA 1CJGA 4MCTA 4PU7A 2LYPA 1X2LA 1ZPQA 4FBIA 1S7EA 1BDIA 1PNRA 1WH8A 1ZZ8A 4OB4A 2IUOA 2KPJA 2R63A 2XSDC 4X4FA 3OP9A 3QWGA 1B0NA 4J1XA 3QQ6A 2XIUA 1AU7A 2AXUA 2EBYA 3R1FA 2XI8A 4X4EA 1RIOA 2KEKA 2AWIA 1NEQA 2AW6A 2LYQA 2PUDA 2ICPA 4PU4C 4NDWA 3GN5B 1Y9QA 4X4BA 1JH9A 1VPWA 2GZUA 1JFSA 2D5VA 1IC8A 4I6RA 4J1WA 1RZSA 4JCXA 1CQTA 3O9XA 3L1PA 3U3WA 4Z5HA 2LYJA 2CSFA 3GN5A 3MLFA 2KEJA 1LLIA 2WIUB 3F52A 1L1MA 2BJCA 3OMTA 3SCGA 3D1NI 4F8DA 3CLCA 4I6TA 2PE5A 3KJXA 2PUAA 3LFPA 3OQMA 1ZZ9A 1E3OC 5A7LA 2PUCA 2BNOA 4X4HA 1QP0A 2OFYA 1RPEL 4FN3A 3IVPA 4YG7B 3UFDA 1R63A 4PU3C 4JQDA 2LYSA 2LYKA 1SQ8A 1ZZ7A 3JXDL 4I8TA 3QF3A 2GRLA 2FJRA
chains in the Genus database with same CATH superfamily
2R1JL 4EKIA 3QFIA 3F6WA 3PE5A 3BDNA 2HINA 2IVBA 4YARA 3SR4A 3LQXA 4HRAA 1X57A 2CROA 3VWSA 3NZLA 2XJ3A 2AXZA 4JCYA 2L8NA 1QP4A 1PRAA 4EK9A 3TRBA 2MQKA 3M9LA 4X4DA 4IA8A 4DE9A 3A9ZA 1JWLA 2O49A 1R69A 1PRVA 3LISA 1UXCA 4MCXA 3RZZA 2KZ8A 1OCTC 2V3CC 2ODRD 1QP7A 1RZRA 2D5VA 1ZUGA 4Z5CA 2AUWA 4ER6A 2JCGA 2LLWA 1YSEA 3GZCA 2PPXA 3FMYA 3JXCL 1X2LA 1ZPQA 1BDIA 3ME5A 4OB4A 2IUOA 4X4FA 3OP9A 1B0NA 2PXLA 1AU7A 2AXUA 2EBYA 3R1FA 2XI8A 2AW6A 4X4BA 1JH9A 1VPWA 4ER7A 3KL4A 4JCXA 3O9XA 2PXTA 3SCGA 3D1NI 3G0TA 2PE5A 3KJXA 2PUAA 2PXVA 4YG7B 3UFDA 5DRTA 2LYSA 3QF3A 3NXHA 2FFHA 2GRLA 2FJRA 2LYRA 2OR1L 1HF0A 2LCVA 1DULA 3GUUA 3SX0A 3PXPA 4EQZA 3FYAA 1PRUA 3JXBC 3ZHIA 2O4AA 4YBAA 3ZKCA 3S8QA 1ZVVA 1Y7YA 2PUEA 2J7UA 4ER3A 4IVZA 2GRMA 1NERA 3CROL 3A9YA 4GHJA 3GBFA 1RZRD 2BNMA 2YBDA 4X4CA 4Z59A 2XCJA 1PERL 1UXDA 2IV1A 1HQ1A 2PXPA 2WUSR 3ZPXA 1ZS4A 3EUSA 2PUGA 4I6UA 3TEPA 4YG1A 2EWTA 3OQNA 5GAHi 4MCTA 2XXQA 3QQ6A 2XXAA 4ER5A 2MXDA 2PXDA 4X4EA 1NEQA 5DRYA 3R09A 3OWQA 2LYJA 1LLIA 2WIUB 3F52A 1L1MA 2XXPA 2M4HA 1E3OC 5A7LA 2LLVA 4I8TA 1JFTA 2KEIA 1ZZBA 1UTXA 1NW3A 1DW9A 3B7HA 2L49A 4X4IA 5DTQA 3HZIB 3SCHA 1POUA 4Y42A 2J7WA 2EF8A 1WIZA 2PXBA 1QZXA 2B5AA 3G5GA 5K98B 3QOXA 1LCCA 5DTRA 3VK0A 3QYXA 1LQCA 4GQMA 4EKGA 2ICTA 1QB2A 1BDHA 4YG4A 3CECA 3H5TA 3ZHMA 3OQOA 1WH6A 2PXEA 2LYLA 1QQAA 2H8RA 1OSLA 2VEOA 1QPZA 1QQBA 4PU8A 2JQEA 2A6CA 3GZDA 2LYPA 3TFLA 1S7EA 1WH8A 1ZZ8A 2KPJA 2L1PA 4J1XA 4WVLA 2XIUA 3NROA 2KEKA 2AWIA 2PUDA 3GN5B 1Y9QA 2GZUA 4I6RA 4J1WA 4ER0A 1CQTA 3L1PA 3U3WA 4Z5HA 3GN5A 3MLFA 2KEJA 2BJCA 3OMTA 3CLCA 4I6TA 3LFPA 3OQMA 2BNOA 1QP0A 4FN3A 3IVPA 4PU3C 4JQDA 1SQ8A 1ZZ7A 1U2ZA 3JXDL 2LNMA 4Z5DA 3F51A 1GT0C 1ZZCA 1XWRA 2IU7A 3OKZA 2HCNA 1LMB3 4Q2JA 1DWKA 2PUFA 4X4GA 1WETA 2AXVA 3QOWA 3KXAA 2PXQA 3FYMA 5DT2A 3NDBB 3KZ3A 3BD1A 5DSXA 4IWRA 1ZAYA 5GAGi 5DTMA 1ADRA 2PXUA 2PUBA 4Z58A 3A9XA 2PXKA 2PXFA 1O4XA 1ZZ6A 4OBMA 2IVQA 4EZIA 2BNNA 1EFAA 1LCDA 2JVLA 3G7DA 3DNVB 4DE8A 2MEZA 5JUWA 2IVGA 2HCSA 3BS3A 3SCFA 2HSGA 2O38A 2PIJA 4O8BA 1CJGA 4PU7A 4FBIA 1PNRA 3MEJA 2R63A 2XSDC 3QWGA 1RIOA 2LYQA 2ICPA 4PU4C 4NDWA 1JFSA 3UWPA 1IC8A 1RZSA 2HFZA 2CSFA 3TELA 4F8DA 1ZZ9A 2PUCA 1MFQC 4X4HA 2OFYA 1RPEL 1R63A 3GZDC 2LYKA 3DM5A
chains in the Genus database with same CATH topology
2LYRA 1JFTA 4Z5DA 2KEIA 1HF0A 1ZZBA 2R1JL 2LCVA 1UTXA 3B7HA 1DW9A 3F51A 2L49A 1GT0C 3F6WA 3PXPA 2OR1L 3BDNA 2HINA 1ZZCA 2IVBA 3FYAA 4X4IA 1PRUA 4YARA 3ZHIA 1XWRA 2IU7A 3JXBC 2O4AA 4YBAA 3HZIB 3ZKCA 3SCHA 1POUA 4Y42A 3S8QA 2EF8A 1LMB3 1Y7YA 1WIZA 1ZVVA 1X57A 2CROA 1DWKA 2PUFA 2PUEA 2XJ3A 4X4GA 2AXZA 1WETA 2L8NA 4JCYA 2AXVA 4IVZA 1QP4A 1PRAA 2B5AA 2GRMA 3G5GA 3KXAA 5K98B 1NERA 3TRBA 1LCCA 3CROL 3FYMA 3VK0A 2MQKA 3QYXA 4GHJA 3KZ3A 4X4DA 4IA8A 3GBFA 1RZRD 3BD1A 2BNMA 1LQCA 4GQMA 4IWRA 1JWLA 4X4CA 1ZAYA 1R69A 4Z59A 1PRVA 2XCJA 3LISA 2O49A 1UXCA 4MCXA 2ICTA 3RZZA 2KZ8A 1PERL 1ADRA 1UXDA 1BDHA 2IV1A 1OCTC 4YG4A 3CECA 3H5TA 4Z58A 2PUBA 3ZHMA 1QP7A 1O4XA 3OQOA 2WUSR 1ZZ6A 1ZUGA 1WH6A 2IVQA 2BNNA 4Z5CA 1RZRA 1EFAA 1LCDA 2JVLA 2AUWA 2LYLA 3EUSA 3G7DA 2MEZA 3DNVB 4I6UA 1ZS4A 2JCGA 1QQAA 1YSEA 2PUGA 4YG1A 2H8RA 1OSLA 2EWTA 2IVGA 1QPZA 1QQBA 3BS3A 3SCFA 3OQNA 2HSGA 4PU8A 2O38A 2PPXA 2PIJA 3FMYA 4O8BA 3JXCL 2A6CA 1CJGA 4MCTA 4PU7A 2LYPA 1X2LA 1ZPQA 4FBIA 1S7EA 1BDIA 1PNRA 1WH8A 1ZZ8A 4OB4A 2IUOA 2KPJA 2R63A 2XSDC 4X4FA 3OP9A 3QWGA 1B0NA 4J1XA 3QQ6A 2XIUA 1AU7A 2AXUA 2EBYA 3R1FA 2XI8A 4X4EA 1RIOA 2KEKA 2AWIA 1NEQA 2AW6A 2LYQA 2PUDA 2ICPA 4PU4C 4NDWA 3GN5B 1Y9QA 4X4BA 1JH9A 1VPWA 2GZUA 1JFSA 2D5VA 1IC8A 4I6RA 4J1WA 1RZSA 4JCXA 1CQTA 3O9XA 3L1PA 3U3WA 4Z5HA 2LYJA 2CSFA 3GN5A 3MLFA 2KEJA 1LLIA 2WIUB 3F52A 1L1MA 2BJCA 3OMTA 3SCGA 3D1NI 4F8DA 3CLCA 4I6TA 2PE5A 3KJXA 2PUAA 3LFPA 3OQMA 1ZZ9A 1E3OC 5A7LA 2PUCA 2BNOA 4X4HA 1QP0A 2OFYA 1RPEL 4FN3A 3IVPA 4YG7B 3UFDA 1R63A 4PU3C 4JQDA 2LYSA 2LYKA 1SQ8A 1ZZ7A 3JXDL 4I8TA 3QF3A 2GRLA 2FJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYR A;  1JFT A;  4Z5D A;  2KEI A;  1HF0 A;  1ZZB A;  2R1J L;  2LCV A;  1UTX A;  3B7H A;  1DW9 A;  3F51 A;  2L49 A;  1GT0 C;  3F6W A;  3PXP A;  2OR1 L;  3BDN A;  2HIN A;  1ZZC A;  2IVB A;  3FYA A;  4X4I A;  1PRU A;  4YAR A;  3ZHI A;  1XWR A;  2IU7 A;  3JXB C;  2O4A A;  4YBA A;  3HZI B;  3ZKC A;  3SCH A;  1POU A;  4Y42 A;  3S8Q A;  2EF8 A;  1LMB 3;  1Y7Y A;  1WIZ A;  1ZVV A;  1X57 A;  2CRO A;  1DWK A;  2PUF A;  2PUE A;  2XJ3 A;  4X4G A;  2AXZ A;  1WET A;  2L8N A;  4JCY A;  2AXV A;  4IVZ A;  1QP4 A;  1PRA A;  2B5A A;  2GRM A;  3G5G A;  3KXA A;  5K98 B;  1NER A;  3TRB A;  1LCC A;  3CRO L;  3FYM A;  3VK0 A;  2MQK A;  3QYX A;  4GHJ A;  3KZ3 A;  4X4D A;  4IA8 A;  3GBF A;  1RZR D;  3BD1 A;  2BNM A;  1LQC A;  4GQM A;  4IWR A;  1JWL A;  4X4C A;  1ZAY A;  1R69 A;  4Z59 A;  1PRV A;  2XCJ A;  3LIS A;  2O49 A;  1UXC A;  4MCX A;  2ICT A;  3RZZ A;  2KZ8 A;  1PER L;  1ADR A;  1UXD A;  1BDH A;  2IV1 A;  1OCT C;  4YG4 A;  3CEC A;  3H5T A;  4Z58 A;  2PUB A;  3ZHM A;  1QP7 A;  1O4X A;  3OQO A;  2WUS R;  1ZZ6 A;  1ZUG A;  1WH6 A;  2IVQ A;  2BNN A;  4Z5C A;  1RZR A;  1EFA A;  1LCD A;  2JVL A;  2AUW A;  2LYL A;  3EUS A;  3G7D A;  2MEZ A;  3DNV B;  4I6U A;  1ZS4 A;  2JCG A;  1QQA A;  1YSE A;  2PUG A;  4YG1 A;  2H8R A;  1OSL A;  2EWT A;  2IVG A;  1QPZ A;  1QQB A;  3BS3 A;  3SCF A;  3OQN A;  2HSG A;  4PU8 A;  2O38 A;  2PPX A;  2PIJ A;  3FMY A;  4O8B A;  3JXC L;  2A6C A;  1CJG A;  4MCT A;  4PU7 A;  2LYP A;  1X2L A;  1ZPQ A;  4FBI A;  1S7E A;  1BDI A;  1PNR A;  1WH8 A;  1ZZ8 A;  4OB4 A;  2IUO A;  2KPJ A;  2R63 A;  2XSD C;  4X4F A;  3OP9 A;  3QWG A;  1B0N A;  4J1X A;  3QQ6 A;  2XIU A;  1AU7 A;  2AXU A;  2EBY A;  3R1F A;  2XI8 A;  4X4E A;  1RIO A;  2KEK A;  2AWI A;  1NEQ A;  2AW6 A;  2LYQ A;  2PUD A;  2ICP A;  4PU4 C;  4NDW A;  3GN5 B;  1Y9Q A;  4X4B A;  1JH9 A;  1VPW A;  2GZU A;  1JFS A;  2D5V A;  1IC8 A;  4I6R A;  4J1W A;  1RZS A;  4JCX A;  1CQT A;  3O9X A;  3L1P A;  3U3W A;  4Z5H A;  2LYJ A;  2CSF A;  3GN5 A;  3MLF A;  2KEJ A;  1LLI A;  2WIU B;  3F52 A;  1L1M A;  2BJC A;  3OMT A;  3SCG A;  3D1N I;  4F8D A;  3CLC A;  4I6T A;  2PE5 A;  3KJX A;  2PUA A;  3LFP A;  3OQM A;  1ZZ9 A;  1E3O C;  5A7L A;  2PUC A;  2BNO A;  4X4H A;  1QP0 A;  2OFY A;  1RPE L;  4FN3 A;  3IVP A;  4YG7 B;  3UFD A;  1R63 A;  4PU3 C;  4JQD A;  2LYS A;  2LYK A;  1SQ8 A;  1ZZ7 A;  3JXD L;  4I8T A;  3QF3 A;  2GRL A;  2FJR A; 
#chains in the Genus database with same CATH topology
 2R1J L;  4EKI A;  3QFI A;  3F6W A;  3PE5 A;  3BDN A;  2HIN A;  2IVB A;  4YAR A;  3SR4 A;  3LQX A;  4HRA A;  1X57 A;  2CRO A;  3VWS A;  3NZL A;  2XJ3 A;  2AXZ A;  4JCY A;  2L8N A;  1QP4 A;  1PRA A;  4EK9 A;  3TRB A;  2MQK A;  3M9L A;  4X4D A;  4IA8 A;  4DE9 A;  3A9Z A;  1JWL A;  2O49 A;  1R69 A;  1PRV A;  3LIS A;  1UXC A;  4MCX A;  3RZZ A;  2KZ8 A;  1OCT C;  2V3C C;  2ODR D;  1QP7 A;  1RZR A;  2D5V A;  1ZUG A;  4Z5C A;  2AUW A;  4ER6 A;  2JCG A;  2LLW A;  1YSE A;  3GZC A;  2PPX A;  3FMY A;  3JXC L;  1X2L A;  1ZPQ A;  1BDI A;  3ME5 A;  4OB4 A;  2IUO A;  4X4F A;  3OP9 A;  1B0N A;  2PXL A;  1AU7 A;  2AXU A;  2EBY A;  3R1F A;  2XI8 A;  2AW6 A;  4X4B A;  1JH9 A;  1VPW A;  4ER7 A;  3KL4 A;  4JCX A;  3O9X A;  2PXT A;  3SCG A;  3D1N I;  3G0T A;  2PE5 A;  3KJX A;  2PUA A;  2PXV A;  4YG7 B;  3UFD A;  5DRT A;  2LYS A;  3QF3 A;  3NXH A;  2FFH A;  2GRL A;  2FJR A;  2LYR A;  2OR1 L;  1HF0 A;  2LCV A;  1DUL A;  3GUU A;  3SX0 A;  3PXP A;  4EQZ A;  3FYA A;  1PRU A;  3JXB C;  3ZHI A;  2O4A A;  4YBA A;  3ZKC A;  3S8Q A;  1ZVV A;  1Y7Y A;  2PUE A;  2J7U A;  4ER3 A;  4IVZ A;  2GRM A;  1NER A;  3CRO L;  3A9Y A;  4GHJ A;  3GBF A;  1RZR D;  2BNM A;  2YBD A;  4X4C A;  4Z59 A;  2XCJ A;  1PER L;  1UXD A;  2IV1 A;  1HQ1 A;  2PXP A;  2WUS R;  3ZPX A;  1ZS4 A;  3EUS A;  2PUG A;  4I6U A;  3TEP A;  4YG1 A;  2EWT A;  3OQN A;  5GAH i;  4MCT A;  2XXQ A;  3QQ6 A;  2XXA A;  4ER5 A;  2MXD A;  2PXD A;  4X4E A;  1NEQ A;  5DRY A;  3R09 A;  3OWQ A;  2LYJ A;  1LLI A;  2WIU B;  3F52 A;  1L1M A;  2XXP A;  2M4H A;  1E3O C;  5A7L A;  2LLV A;  4I8T A;  1JFT A;  2KEI A;  1ZZB A;  1UTX A;  1NW3 A;  1DW9 A;  3B7H A;  2L49 A;  4X4I A;  5DTQ A;  3HZI B;  3SCH A;  1POU A;  4Y42 A;  2J7W A;  2EF8 A;  1WIZ A;  2PXB A;  1QZX A;  2B5A A;  3G5G A;  5K98 B;  3QOX A;  1LCC A;  5DTR A;  3VK0 A;  3QYX A;  1LQC A;  4GQM A;  4EKG A;  2ICT A;  1QB2 A;  1BDH A;  4YG4 A;  3CEC A;  3H5T A;  3ZHM A;  3OQO A;  1WH6 A;  2PXE A;  2LYL A;  1QQA A;  2H8R A;  1OSL A;  2VEO A;  1QPZ A;  1QQB A;  4PU8 A;  2JQE A;  2A6C A;  3GZD A;  2LYP A;  3TFL A;  1S7E A;  1WH8 A;  1ZZ8 A;  2KPJ A;  2L1P A;  4J1X A;  4WVL A;  2XIU A;  3NRO A;  2KEK A;  2AWI A;  2PUD A;  3GN5 B;  1Y9Q A;  2GZU A;  4I6R A;  4J1W A;  4ER0 A;  1CQT A;  3L1P A;  3U3W A;  4Z5H A;  3GN5 A;  3MLF A;  2KEJ A;  2BJC A;  3OMT A;  3CLC A;  4I6T A;  3LFP A;  3OQM A;  2BNO A;  1QP0 A;  4FN3 A;  3IVP A;  4PU3 C;  4JQD A;  1SQ8 A;  1ZZ7 A;  1U2Z A;  3JXD L;  2LNM A;  4Z5D A;  3F51 A;  1GT0 C;  1ZZC A;  1XWR A;  2IU7 A;  3OKZ A;  2HCN A;  1LMB 3;  4Q2J A;  1DWK A;  2PUF A;  4X4G A;  1WET A;  2AXV A;  3QOW A;  3KXA A;  2PXQ A;  3FYM A;  5DT2 A;  3NDB B;  3KZ3 A;  3BD1 A;  5DSX A;  4IWR A;  1ZAY A;  5GAG i;  5DTM A;  1ADR A;  2PXU A;  2PUB A;  4Z58 A;  3A9X A;  2PXK A;  2PXF A;  1O4X A;  1ZZ6 A;  4OBM A;  2IVQ A;  4EZI A;  2BNN A;  1EFA A;  1LCD A;  2JVL A;  3G7D A;  3DNV B;  4DE8 A;  2MEZ A;  5JUW A;  2IVG A;  2HCS A;  3BS3 A;  3SCF A;  2HSG A;  2O38 A;  2PIJ A;  4O8B A;  1CJG A;  4PU7 A;  4FBI A;  1PNR A;  3MEJ A;  2R63 A;  2XSD C;  3QWG A;  1RIO A;  2LYQ A;  2ICP A;  4PU4 C;  4NDW A;  1JFS A;  3UWP A;  1IC8 A;  1RZS A;  2HFZ A;  2CSF A;  3TEL A;  4F8D A;  1ZZ9 A;  2PUC A;  1MFQ C;  4X4H A;  2OFY A;  1RPE L;  1R63 A;  3GZD C;  2LYK A;  3DM5 A; 
#chains in the Genus database with same CATH homology
 2LYR A;  1JFT A;  4Z5D A;  2KEI A;  1HF0 A;  1ZZB A;  2R1J L;  2LCV A;  1UTX A;  3B7H A;  1DW9 A;  3F51 A;  2L49 A;  1GT0 C;  3F6W A;  3PXP A;  2OR1 L;  3BDN A;  2HIN A;  1ZZC A;  2IVB A;  3FYA A;  4X4I A;  1PRU A;  4YAR A;  3ZHI A;  1XWR A;  2IU7 A;  3JXB C;  2O4A A;  4YBA A;  3HZI B;  3ZKC A;  3SCH A;  1POU A;  4Y42 A;  3S8Q A;  2EF8 A;  1LMB 3;  1Y7Y A;  1WIZ A;  1ZVV A;  1X57 A;  2CRO A;  1DWK A;  2PUF A;  2PUE A;  2XJ3 A;  4X4G A;  2AXZ A;  1WET A;  2L8N A;  4JCY A;  2AXV A;  4IVZ A;  1QP4 A;  1PRA A;  2B5A A;  2GRM A;  3G5G A;  3KXA A;  5K98 B;  1NER A;  3TRB A;  1LCC A;  3CRO L;  3FYM A;  3VK0 A;  2MQK A;  3QYX A;  4GHJ A;  3KZ3 A;  4X4D A;  4IA8 A;  3GBF A;  1RZR D;  3BD1 A;  2BNM A;  1LQC A;  4GQM A;  4IWR A;  1JWL A;  4X4C A;  1ZAY A;  1R69 A;  4Z59 A;  1PRV A;  2XCJ A;  3LIS A;  2O49 A;  1UXC A;  4MCX A;  2ICT A;  3RZZ A;  2KZ8 A;  1PER L;  1ADR A;  1UXD A;  1BDH A;  2IV1 A;  1OCT C;  4YG4 A;  3CEC A;  3H5T A;  4Z58 A;  2PUB A;  3ZHM A;  1QP7 A;  1O4X A;  3OQO A;  2WUS R;  1ZZ6 A;  1ZUG A;  1WH6 A;  2IVQ A;  2BNN A;  4Z5C A;  1RZR A;  1EFA A;  1LCD A;  2JVL A;  2AUW A;  2LYL A;  3EUS A;  3G7D A;  2MEZ A;  3DNV B;  4I6U A;  1ZS4 A;  2JCG A;  1QQA A;  1YSE A;  2PUG A;  4YG1 A;  2H8R A;  1OSL A;  2EWT A;  2IVG A;  1QPZ A;  1QQB A;  3BS3 A;  3SCF A;  3OQN A;  2HSG A;  4PU8 A;  2O38 A;  2PPX A;  2PIJ A;  3FMY A;  4O8B A;  3JXC L;  2A6C A;  1CJG A;  4MCT A;  4PU7 A;  2LYP A;  1X2L A;  1ZPQ A;  4FBI A;  1S7E A;  1BDI A;  1PNR A;  1WH8 A;  1ZZ8 A;  4OB4 A;  2IUO A;  2KPJ A;  2R63 A;  2XSD C;  4X4F A;  3OP9 A;  3QWG A;  1B0N A;  4J1X A;  3QQ6 A;  2XIU A;  1AU7 A;  2AXU A;  2EBY A;  3R1F A;  2XI8 A;  4X4E A;  1RIO A;  2KEK A;  2AWI A;  1NEQ A;  2AW6 A;  2LYQ A;  2PUD A;  2ICP A;  4PU4 C;  4NDW A;  3GN5 B;  1Y9Q A;  4X4B A;  1JH9 A;  1VPW A;  2GZU A;  1JFS A;  2D5V A;  1IC8 A;  4I6R A;  4J1W A;  1RZS A;  4JCX A;  1CQT A;  3O9X A;  3L1P A;  3U3W A;  4Z5H A;  2LYJ A;  2CSF A;  3GN5 A;  3MLF A;  2KEJ A;  1LLI A;  2WIU B;  3F52 A;  1L1M A;  2BJC A;  3OMT A;  3SCG A;  3D1N I;  4F8D A;  3CLC A;  4I6T A;  2PE5 A;  3KJX A;  2PUA A;  3LFP A;  3OQM A;  1ZZ9 A;  1E3O C;  5A7L A;  2PUC A;  2BNO A;  4X4H A;  1QP0 A;  2OFY A;  1RPE L;  4FN3 A;  3IVP A;  4YG7 B;  3UFD A;  1R63 A;  4PU3 C;  4JQD A;  2LYS A;  2LYK A;  1SQ8 A;  1ZZ7 A;  3JXD L;  4I8T A;  3QF3 A;  2GRL A;  2FJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...