2XCLA

Nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
421
structure length
421
Chain Sequence
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide-Bound Structures of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase
rcsb
molecule keywords PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
molecule tags Ligase
source organism Bacillus subtilis
total genus 113
structure length 421
sequence length 421
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2xclA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2xclA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xclA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2xclA04
3K3PA 5FNVF 4MA0A 1BNCA 5IYZF 3KAKA 3ORRA 3VA7A 1CS0A 4O4IF 1A48A 4FFRA 4FU0A 4M9UA 1I7NA 1KJIA 4HNUA 5J2TF 2YS6A 2DWCA 4MV1A 4O82A 4EA9A 1B6SA 2R7LA 2VQDA 1EYZA 3OUZA 3E5NA 2SCUB 3VPCA 3WO1A 1KJJA 4I55F 1KBLA 5CA1F 3HB9A 1JDEA 5LA6F 3GIDA 1M0WA 4ZI7F 2ZDGA 1GSOA 3RV4A 1KJQA 2YZNA 2CNVA 2I87A 4MV6A 4DLKA 2W6NA 1VKZA 3I12A 2W70A 2ZDHA 2OLSA 2YL2A 3VMMA 4C5AA 4EGJA 1BXRA 2YZMA 5C1PA 3ETJA 5KKNB 4YB8B 2ZDQA 1E4EA 3JRXA 1Z2OX 4MA5A 5I47A 2YWVA 1GSAA 2I8CA 4IHJF 4EG0A 2YZGA 2P0AA 2GPSA 5JVLA 4FFPA 4J6EA 4O2AF 4XX0B 2YYAA 1M0TA 5HBRB 2PN1A 3TINA 4O7VA 4MV9A 2V59A 1B6RA 2FPIB 5LXTF 1M6VA 2DLNA 3DF7A 3U55A 4TUYF 3R9RA 1KUTA 5CA0F 1JLLB 3LP8A 3JZIA 1OBDA 1EUCB 3WO0A 2W6QA 3HBLA 4MV4A 1GGOA 5JVDF 1VBGA 4QSHA 4O83A 2PVPA 4MV7A 5D8DA 2GQSA 3RV3A 1PK8A 3VPBA 3LWBA 4I4TF 3ETHA 2NUAB 3RFCA 2GPWA 1WR2A 4L1KA 2W6OA 5H80A 5EZYF 3GLKA 1IOVA 4IIJF 2XD4A 5CAEB 4WBNF 3TIGA 4YBZB 4O86A 4M98A 5LOVF 3BSYA 4WD3A 4HQ6A 2CZGA 3MWDA 2YRWA 2IP4A 4XZ3B 3TIIA 1KC7A 4FFOA 4XYLB 3TW6A 3JZFA 3KREA 4HNVA 1CQIB 4HR7A 3NUAA 4ME6A 3AW8A 4ZQIA 4C5BA 5LP6F 5JH7F 4DIMA 4O7TA 1C3OA 1DV2A 3QFFA 2W71A 5GONF 5BMVF 3N8DA 2Z02A 2NU8B 3BSSA 4YAKB 4C5CA 3RUPA 4E4TA 2VHEA 4IWXA 2VR1A 1IOWA 3K5HA 2QK4A 1ULZA 4EGQA 2YRXA 2R87A 2I80A 2PBZA 3UFXB 2YZLA 5JQWA 4YJ2F 2NPOA 3AX6A 3R5FA 2DIKA 4FFLA 1Z2PX 2HJWA 2VPQA 3R5HA 1GSHA 1CE8A 2W6PA 2FPPB 1W93A 4FE2A 4EA7A 3Q1KA 3MJFA 3TQTA 3VPDA 4MV8A 1AUVA 4EA8A 2R7NA 3R5XA 3BSWA 4O7WA 1EZ1A 4ZOLF 4Y8VB 2Z04A 2NU7B 3Q2OA 4FFNA 3G8CA 2FB9A 2YW2A 4MAMA 5J2UF 3OUUA 4M9CA 4TV8F 2NU9B 1T36A 1AUXA 1SCUB 5HV6A 2YS7A 5BPHA 2W6ZA 2W6MA 3JRWA 2GLTA 2FPGB 4YAJB 1VBHA 3R23A 1W96A 5K2MA 4HNTA 3BG5A 2CNUA 4O4JF 4MV3A 1KEEA 3U9TA 1KJ8A 5KX5F 1DIKA 1EUDB 2R86A 3U54A 2R6FA 3U9SA 2R84A 2C00A 1OBGA 3KAJA 3HO8A 3V4SA 2CNQA 4I50F 3ORQA 3WNZA 4EABA 4ZHQF 2X0SA 2GQRA 4O84A 4EAAA 3MWEA 2CQYA 1PX2A 1C30A 1EHIA 4FGRA 1GLVA 4GGMX 2XCLA 4FFMA 1A9XA 5CB4F 4O7YA 4XYMB 4NYEA 3KALA 1KJ9A 4O7RA 4O7LA 5C8YF 3SE7A 2NU6B 1JKJB 4O2BF 2R82A 4O7NA 3VOTA 5JQGF 1CQJB 5LYJF 2DZDA 4O4LF 2QF7A 1Z2NX 2HGSA 3N6RA 1UC9A 2V5AA 4O4HF 4RZQA 1UC8A 1I7LA 3BFPA 1E4EB 4O7SA 4O7ZA 4IZOA 1DV1A 2FP4B 4TV9F 3V4ZA 4M99A 3K5IA 5DMXA 4IWYA 2J9GA 3G8DA 2R7MA 4YJ3F 2R85A 2V58A 5BPFA 4O81A 2WYOA 2R7KA 5C1OA 1JDBB
chains in the Genus database with same CATH superfamily
1L5ZA 4UDOA 1KQ3A 3DT8A 5ECWA 3UZOA 4EO7A 4IX9A 2XB4A 2GILA 4D41A 1C7JA 2QZSA 4QLBA 2Q4OA 4QUEA 3A6LA 4N8SA 4QWMA 1FQKA 1PSZA 3BDAA 1X1CA 3I8OA 5JRZA 1VCOA 1ML4A 2GQ0A 5JU6A 2HJHA 2YFQA 3HNOA 4JVLA 4UU1A 2NYRA 2IITA 1M0WA 2D59A 3QUCA 4KCGA 5AJVB 2NXCA 3Q8KA 4DLKA 3OF5A 3DWGA 4UHHA 3LPLA 3SKVA 2PMEA 4EGJA 4OH7A 1Z73A 1CHDA 2AE2A 2ZRFA 3IAXA 5DHPA 2WAQE 2IUSA 2CHVA 4WKPA 4ZVMA 2DBZA 1DKQA 2KPOA 3WZ2A 5FTJA 2NO5A 2A9KA 4CIVA 2O0KA 3S68A 1L0BA 3KOZA 2VHYA 3UTDA 5D5PA 5EZYB 5FORA 2OECA 2IEYA 4EO4A 3STUA 2NM0A 3B9RA 3HACA 4E15A 3WO0A 4LJ7A 1U6JA 1NA5A 2VF2A 2ZJAA 4FNOA 4RY9A 4A10A 1SUDA 4I4TF 3UZBA 3ICCA 2GJ9A 1N32B 3BPSA 3RGWS 4FNAA 1JGTA 2GETA 4IRXA 2QMZA 3RIMA 1S97A 5J4YA 1I32A 4BB6A 2GCOB 5EWJA 3LRXA 1WB9A 4JBIA 1QGUB 2NYVA 1PFVA 2JHFA 5EUBA 3EC7A 4KO8A 2VJPA 5EP4A 5CDYA 3WIUA 1Z0IA 4HYKA 2JRLA 5EZQA 2YY7A 4IV8A 4DG9A 2WAXA 1Z74A 2A7QA 4FYMA 2IXEA 1WDMA 1UBKS 4PN7A 2FN8A 2R2AA 1C3OA 3LY9A 1TWFA 3IG0A 4PGMA 1N36B 3ND9A 1SEVA 4EUKA 5JHHB 4UMVA 2FPIA 3VOBA 4QFMA 1Z7GA 2DUMA 3IEUA 1P1CA 4DUPA 3DTGA 2FJZA 1GJRA 2WNSA 3PXAA 1QWSA 3QU2A 4JX9A 4RKEA 2R8KA 1XN4A 3LBHA 2H1IA 3SEAA 3HGQA 1GTRA 3A2MA 3L7CA 4QATA 2ZBVA 3O2NA 4TZ0A 1PJTA 1RIIA 2HK8A 3K9CA 5T3YA 1CZRA 3F71A 3PICA 4AJ9A 2OK7A 3OTQA 4XD2A 1K5HA 1DWOA 1XG5A 5CXQA 5AKYA 3VYUB 1UZAA 2WTFA 1YL5A 1CIVA 2PMBA 1QANA 2BMDA 2QRNA 4GR5A 2YIMA 4E1BA 1CQIA 3SJBA 4AU1A 2YXLA 3THWA 1UMDA 1G4HA 4RHUA 1CFZA 1J8DA 3FMIA 3TTVA 5BNTA 3DOUA 4D8YA 3V8BA 3J81W 4Q4HA 3F8SA 2BKEA 1YJCA 5KJCA 3TOVA 2HR1A 3COZA 4LOLA 4NMMA 1QJ4A 3GUZA 4PLTA 2LCQA 3B6JA 2ZIFA 1U1IA 1RWVA 1PR3A 3LBIA 1RR6A 1XPOA 2V4ZA 4PZYA 4AKIA 1KQGA 3UNXA 4GGMX 4L2IB 1EXWA 1ZESA 4RSRA 3QX7A 3T7AA 5K0FA 2RJNA 4LPSA 1O1YA 3CO0S 1UFQA 4JI7B 2EL9A 2G72A 3A7EA 3ECSA 5TPZD 1U5CA 5ISMA 4YP9A 4M8LA 3ZWCA 1WG8A 4A1FA 4TLCA 5LD2C 2UZIR 4QOFA 5JOQA 5D85A 5JD5A 5CCXA 3QENA 1W4LA 2RAVA 2OCLA 4IOJA 1MR3F 5F12A 2F3PA 2PDAA 1VYHA 1FU7A 3HZZA 4J2TA 2X7JA 4HH4A 9LDTA 5CG2A 4NJOA 4LF8B 4PWZA 4TS4A 3QZ8A 1B6SA 1NU6A 3OUZA 2JJMA 4AJEA 3CLUC 4CG3A 1KEKA 4G2NA 2HHFA 3BD8A 1F48A 4M0MA 3ROMA 1P0QA 1S68A 3ET4A 3T94A 4RTOA 4BKQA 3UN1A 4C0LA 2EJBA 5FFMA 3SC2A 4Y2SA 1S4MA 4R0VA 3AGQA 5F51A 4RZUA 3EF3A 3UMJA 1UEJA 1LEHA 1Y9DA 4ZAFA 2BMVA 1DAOA 4OQMA 3PLRA 2EX4A 1JMVA 4Y1RB 4UDNA 2GPSA 3WBBA 1KC1A 4DZRA 3Q12A 4RMNA 3PRYA 1WETA 4FJ2A 4J75A 4ZTUB 4K9SA 4H1TA 2UXBB 3TNLA 4LRSB 1W4CA 1RRPA 1GPYA 1DMSA 4QARA 3JATB 3F1KA 3HBLA 3KS9A 3GY0A 3SDBA 3R6DA 4ND6A 4TQSA 2IQ5A 1R12A 4I19A 2VWPA 5AXCA 1C9MA 2QY6A 3PIDA 3OHSX 4C05A 7MDHA 2JCYA 4ZREA 4MMXB 3GEBA 3RJZA 4I1UA 1V9LA 5C3UA 2QYOA 1KAGA 3B3QA 4QGSA 4O3MA 4TTRA 1CG6A 1FUYB 2RHDA 2Z3VA 1EQ2A 1ISJA 4HZIA 2ZM5A 4KJXA 3L07A 2Z1DA 2A1HA 3UMVA 4LC9A 5KJFA 4Q3EA 1N56A 4MQUA 1SKQA 5AKGA 1J09A 4AS2A 1DEOA 2VZLA 3WLFA 5AM1A 5A3VA 1GG8A 2V3WA 1LC3A 4EWLA 3WIDA 4GI7A 5A3SA 3OFVA 3LLCA 5IDYA 4WK4B 1GPWB 5DLFA 2ZS7A 3D31A 2PUCA 4ITVA 3H11A 3W6NA 1YZUA 5INTA 4P35A 4ALKA 3GGCA 3R5HA 4MCHA 4NBWA 4JC0A 3FTEA 2X58A 5ALVA 1U0BB 3D8RA 2OE2A 5IKEA 5LP6A 3TL6A 2C2XA 1LI7A 2XQKA 2ZAIA 1F7UA 4BO7A 4J0JA 3CFYA 3BCUA 5GPBA 4ROSA 2VQEH 4E7PA 1Z7EA 1JFLA 4C0XA 1PZEA 4EI2A 3W9BA 3OM9A 3CUSA 1BG6A 3HU3A 3GVXA 3IVRA 4JI6B 2HUPA 4ND1A 1NVTA 1AQIA 1MORA 4L3WA 1GUZA 1LDNA 3FGOA 2AMJA 3V5NA 2IV3A 1IVNA 4LC1A 5LZ5A 3GJTA 2VJQA 5FTNA 2WHEA 3ZWYA 3GXBA 5F35A 3DHNA 3E48A 4UVHA 2KX7A 1LH0A 2HHHB 4BV3A 3IS3A 3AIIA 5CPFA 2JAUA 3ZVMA 3ABRB 4EGFA 4XYMB 3H1AA 3OCXA 3I3OA 2JI9A 3BHIA 3BA6A 3AETB 2R82A 3G2JA 1RHRA 2AOTB 5G40A 5B2FA 4QGBA 3JYQA 1S9HA 1M2EA 1DQYA 1MB2A 4NMXB 4G3XA 5HKOA 5TJ9A 4PR0A 1ODJA 3UA4A 3ZVLA 5DGCA 3QIVA 4M60A 4TLMB 4C7OB 4ZIRB 1VKJA 2DCMA 2ZUUA 3V9AA 3TRKA 3HB4X 3PXXA 5FOVA 4GRDA 4MLPA 2C4WA 3JARA 4L78A 1JHDA 2C1ZA 2BFBA 2R00C 3OJOA 1IUNA 5K3OA 5KG3A 3VTKA 3DXXA 5KQSA 5AP9A 1ZCZA 1LJUA 2CUTA 5I5SA 3BHMA 2ODQA 3AVQA 4QGHA 4JQOA 3B12A 1E2PA 4NAUA 2VP2A 2WM3A 4LY6A 2C4KA 3MWFA 2CKZB 3ULKA 3BE5A 3U4IA 1I2BA 3M89A 1POWA 4JBHA 4GVXA 4QOGA 3REOA 3IOYA 2B83A 2OB1A 3PNBA 1L4HA 3A36A 5IEJA 2Y27A 2P75A 1GV1A 1P9OA 1UQRA 4IVPA 2QRQA 4JGGA 5ADHA 2TSYB 2ALZA 3WFJA 1O54A 1U3WA 5B12A 1T0BA 1D03A 3I0ZA 5F5NA 3ZGZA 2PK3A 3JVUA 3K0KA 3KEOA 4YAGA 1A04A 1ZLYA 2GBCA 1E9CA 1MW8X 1R9GA 2BZSA 1VSTA 3TGWA 1C4KA 2J41A 2YHIB 1GTSA 4YDRA 5FL7A 5JZ9A 2CWWA 2QNIA 5TEVA 2HDHA 5AJHA 2N42A 3MMZA 4DR2B 4EJ0A 2PTHA 3EPKA 3UK2A 2BEWB 3EZGA 4P53A 5G0TA 3MTQA 3OOSA 2ZSJA 5FD5A 4PPQA 1U5AA 1NXOA 3D4BA 2VTKA 4UXIA 2AMLA 1UBTS 3WR5A 2FN4A 4IDBA 3G9QA 2ZZKA 4COOA 2P6NA 4GKKH 4MKHA 5HJEA 3PT5A 1FS5A 2OQIA 4BQPA 4FW8A 4F4DA 4AZTA 4HY3A 3HDYA 4FFOA 4MGYR 4XYLB 5D01A 1BFUA 3ZS8A 1QYXA 3KREA 2ZRBA 2HLDD 5FB3A 5C3EG 4QO8A 2H59A 3O7MA 2PKCA 1NZDA 3EIUA 4WLVA 1KEZA 1UL1X 1ONOA 4U6QA 5TRTA 1BS1A 2BH2A 3T3MB 4BO4A 4ZZ3A 1B7GO 4GGOA 4IWXA 4ZARA 4ECQA 1AKTA 4LYFA 1T0IA 1Z34A 4U5XA 5AI0A 3B53X 3H97A 1JFRA 3L7MA 5E9AA 4NVRA 3VR2A 3KWMA 4NOJA 3WBKA 4P33A 1P7VA 4ZICA 3TM5A 4B9EA 1YUMA 3EAQA 3HO6A 2FEMA 3MMSA 4BO0A 6CHYA 2EZ8A 1SHZA 2C0CA 5HCUA 3OLXA 5KVVA 3D6MA 1H6AA 5F7JA 3L0YA 1ZSNA 3F5DA 2MCTA 3TECE 3RS4A 4BMOB 1TTQB 4MWBA 5H0IA 5FI3A 1SC3A 4MB2A 1FP6A 3UPDA 4CM4A 2F1HA 2XEXA 4JA2A 4L51A 3HV0A 4PIVA 5M04A 4G4JA 3W2GA 2H16A 5FOUA 3RS3A 1Y8QB 5I5GA 3WRWA 1DIKA 4G5HA 1FSFA 3A0RB 4PGAA 3U9SA 1VYVA 4M1KA 1RAGA 3K6KA 3AYHB 1SIBE 4S1PA 3Q3GE 2FFBA 5DNAA 3P9SA 4G0MA 1UFVA 3CZ4A 3MW8A 1VRCA 4CMFA 1B43A 2CVPA 2QVCA 5KFPA 3H1EA 3S8YA 3R5KA 4WUTA 3BKWA 3G17A 5HOQA 2GGSA 4U6SA 3KE9A 1RYMA 1QHNA 4C4RA 5AW7A 2AGQA 5AVTA 4CVNA 3HOUG 3GDHA 4IH4A 1RPNA 2JEYA 1CKEA 3GJRA 3Q98A 2HGSA 3ZDZB 1JQ5A 4K6NA 1FLVA 1WX1A 4BAZA 4CTKA 1G2WA 3RKUA 3H2GA 4ZMSA 2PRSA 3GOQA 4G1UC 1C7ZA 4RGYA 2JJQA 3PTLA 2Y68A 2D74A 3PENA 1LI5A 3CLRC 4YCAA 5C1OA 3ADOA 3LF1A 1TECE 1Y81A 1WE2A 3STWA 2EFYA 2NQTA 5ICSA 4H15A 3NIFB 1XA0A 4CDGA 2XR1A 5EVCA 3K05A 3R6LA 4OM7A 1DJQA 2DFNA 2Y71A 4FX5A 1T2NA 2YWCA 4RTJA 1YVUA 4JYCA 4ZJUA 1JU3A 1K66A 3DUFA 4I6GA 2BFEB 5WRFA 3OZCA 4R9UC 3NYWA 2GPYA 2P4UA 3JD4A 3KYJB 3IQDB 4BN0A 4RQBA 3MFQA 1NQXA 1KKUA 1RCFA 1BE1A 1RQPA 3L8HA 1WW8A 1XC7A 4M0DA 5LXTB 3C1AA 1EP3B 1C5KA 2PLWA 4C7BA 1KK3A 5HQ3B 3V9PA 5L51A 3H9JA 5BSUA 5BUSA 2ZBGA 4EI8A 4U02A 2JNWA 3RF6A 3NIDB 1J1ZA 5AESA 4IDNA 1WMBA 1E79A 2OG1A 3TINA 4C0BA 5DI3A 4O3OA 4DA6A 2C98A 4BX3A 3WYGA 3W5JA 3WGHA 3CISA 5D87A 1WB6A 4YCJA 4A3FG 1IN5A 2FJ0A 5PGMA 3WKEA 1D0SA 2WMYA 4ZQBA 1EJ0A 4NU6A 2Q8QA 2EYQA 2IXAA 2RK6A 2NLOA 1Z4OA 1T2AA 2ZXFA 2Y1WA 1D1SA 2WIBA 4EJFA 4HVAA 5IAAA 5E7QA 4TN1A 3JAMA 3C3DA 4UPDA 3UUWA 3AHCA 3I6ZA 1DQNA 3QI2A 1CULC 1IYZA 3MWDA 1SVLA 1D1QA 4Y6RA 5K8JB 3AR7A 5AVQA 1GO3E 2COGA 4G5OA 2I1QA 2IS1A 2IDMA 4Q4JA 4WXMA 4DL4A 3I8XA 5DDIP 2IZ5A 4F86A 4IDPA 7GPBA 3ZE1B 1P4JA 2PX3A 3SSMA 5MN4A 1EM8B 3LC2O 2O3QA 1PS9A 1XQ6A 1YJXA 1UFKA 3SC6A 1IN4A 3ABSB 3T1YH 2D5BA 1QRTA 1I5EA 4NMWA 2LXNA 3NC0C 5JANA 3DDZX 4RW0A 1T5IA 4L16A 1E5QA 3OZDA 4MW1A 5FUVA 4ARBA 4MO9A 1CERA 3ZJYA 4GT1A 1OVMA 2HIHA 2CNLA 3DAGA 2BSQA 3C7DB 4ASUD 4CMIA 1QPBA 4ZOLF 1N6HA 1YQQA 2XUFA 4XCQA 3C16C 1UDAA 4ZMRA 1YHNA 4DDUA 5HP4A 2DPXA 4MLCA 1NPTO 2PX0A 4BO5A 3AZOA 4HKTA 1OXBB 5EMNA 2RAFA 4BFYA 3D64A 5DISC 4J2OA 1OLSB 4JA0A 2P69A 4RVDA 4U7HA 1BGWA 3HCAA 5KG7A 3T3PB 3B3FA 1V6CA 1QPZA 3NGXA 5C9ZA 4TSRA 1RXIA 3OPNA 3TTXA 2KBEA 3SBXA 3HJFA 4D0LB 5JR3A 4MJ3A 1SHKA 1T6NA 4I9FA 5E4JA 2D6FA 3ZQKA 5K0SA 3FUXA 2VVTA 2QRVB 2HF9A 2Z9CA 1XMJA 4PX3A 4QT4A 1ILEA 5IMSA 1AU9A 4B7XA 2GM5A 4NMLA 3DLIA 3OPYB 4O4HB 2XGOA 1EKXA 4W9MC 5A2QW 2FN9A 2QROA 4CLOB 1T34A 4IIUA 3SJ7A 4IV5A 3RH0A 1ZUNB 5JDIC 1BA3A 4XDZA 2VXCA 3WDSA 2I65A 3OZXA 4EECA 1NW9B 3KQNA 4HFJA 4JASB 3BRQA 4Q9NA 3BFPA 1ZPDA 2FP4B 2O8CA 1IWOA 1D1TA 4WXYB 1Z5WA 1K0FA 4NKRA 1TU0A 3ZDBA 4NU5A 3KAQA 1GT6A 3EQ8A 4AWBA 1VE5A 2FMAA 3CJTA 3PHBE 4MS4A 3IV9A 5FPTA 1SUWA 3KNZA 4EYGA 5A0FA 4MRNA 1NR1A 3JQQA 1FMJA 5A3JA 5FQNA 4PZLA 1P2VA 1JTEA 4WX2B 1YMUA 1U2DA 4ILEA 2VUMG 1TGVA 2XYQA 3GFRA 2CKMA 3O3MB 2KLHA 5A9RA 3NMUF 2OFFA 1OWOA 4QOSA 1MC8A 2NQ8A 2IXBA 5KFGA 3INNA 5DCYA 4B31A 1S9DA 4KXNA 2BONA 1E1QA 3ZLBA 2W6NA 5KDOA 1IZZA 2NO9A 2NIPA 4EHHA 3RVSA 4BC0A 2FXIA 5C34B 1HFJA 3WICA 4OQPA 1TKCA 2YFKA 1EB9A 1X70A 3C5VA 3KB1A 1E9RA 1BEUB 4AJOA 4ZXFA 3W5IA 1K06A 4CT5A 1TU3A 5HF5A 1FYXA 1WD5A 1PV4A 2YQ5A 3FUWA 2EHDA 2P30A 4D97A 4M1ZA 4IIVA 4DMRA 3OE4A 4NONA 1T3SA 4HXEB 2B4YA 5EHXA 2JEJA 3WNCA 2GDZA 1Z4KA 1MX5A 5I4BA 3HFRA 2QL7A 3UJNA 2E2IA 3KDSE 2OGZA 4I3GA 3UJPA 3CC8A 2RKOA 4M0CA 4Q9DA 1HV8A 2DC1A 3RLIA 2JLRA 5REQB 1XNJA 4DCVA 4WXEA 2BCJQ 1NVXQ 2GX6A 4EPWA 3BXFA 2YASA 4BUZA 3H0EA 2I4OA 4EPTA 3CCCA 4GPTA 3EK2A 4HYTA 3QF4A 3PGA1 4YRGA 4IJ6A 2JGMA 1PG0A 1K7CA 4EYKA 5TX7A 3GD7A 3NORA 1JI0A 4X9XA 2XWSA 1W0CA 1GDDA 3OFND 3W04A 2FWPA 3N9IA 3BWEA 3V1UA 2N9UA 1YR6A 4HXGA 1R6DA 1X1QA 4DVJA 3WMEA 3KKKA 2VO1A 1BDIA 3SR0A 2O05A 1ZSVA 4BFWA 1XL0A 4JZKA 1JEOA 4GE0A 2REXB 4CC6A 2R8IA 3QPDA 1JDBC 3HRIA 1U3VA 2WB1A 3CRRA 2Q3BA 4S0XA 3Q8MA 3Q8WA 2WKPA 2HVRA 2HQRA 1NNEA 4JI3B 4MS1A 2PVSA 2YY6A 4O63O 3KPUA 1ULHA 3PX3A 3TCXB 3R9XA 1GPKA 4U8HA 4IOMA 3B1VA 1M34B 5JALA 1LK7A 2P5YA 1YWGO 1L7OA 2JGEA 3KQLA 1UPUA 4D9NA 1XD2B 4MR7A 3P4YA 5L3RA 4JI4B 3G5MA 4R9SA 3H16A 2QN3A 3SDSA 2RH5A 4YCDA 4PFJA 3H2BA 1E62A 4BTEA 4HBZA 3TR6A 4F97A 4KHPH 4YFYA 3CONA 1BD4A 3E23A 3GRFA 3ESDA 3UJDA 1GO2A 4OJTA 4MX8A 4O0MA 4ZZ0A 1EX6A 3GEGA 3OESA 4OHRA 2X9NA 1W0KD 4WACA 3QLJA 2CL5A 5DE3A 3KTDA 1HYHA 1XCJA 3SP1A 4CV0A 5JCOC 3GGDA 3D5EA 1FFGA 3LCUA 1DZ3A 3UCXA 2PBFA 2P9FA 4HH3C 4KR2A 3MR2A 1D4AA 1JPJA 3PIIA 3DWFA 3ADBA 2C7PA 1M73E 1W25A 4Y6QA 2C5FA 3ZXYA 2Z9DA 3G5AA 2HMTA 2PVCA 3HDJA 3GIKA 4PG5A 1RMYA 3F5QA 3TLAA 2F3SA 3IB6A 1AKVA 3RF7A 4J0QA 4JODA 3ILHA 4YASA 1Y3FE 1NKTA 4HOYA 3NOQA 1D4FA 4RF2A 3UGJA 4AW9A 2FRDA 4INJA 3KQQA 3EHEA 2OO5C 1LVGA 4RTQA 4G01B 4PX5A 3ETNA 1NNUA 2FUKA 4BVGA 4UUQA 3F4BA 5FLKA 3LXRA 4G84A 4H08A 2DWCA 4Q1FA 2C5EA 2R7LA 1EFPA 1YDHA 1O75A 4IEIA 2B4KA 2ZBEA 3GWZA 1N9ZA 1YF3A 5CA1F 2Y76A 1FNMA 5HJ2A 3AF4A 3CLRD 4EJMA 3F7TA 5FI0B 4ZD6A 1JKJA 3HA2A 3DKRA 4KFCA 3VX4A 1WM1A 3DMNA 1WWKA 1QIHA 3E7XA 2ZQ5A 4QQKA 4LWPA 5FNVA 1GM5A 3PKZA 3V2IA 3S29A 3X1YA 1DJLA 3PPWA 1PVOA 1NVDA 4QAQA 5BYKA 1JW9B 1MA0A 5IX8A 2FWMX 2ACWA 1O58A 3DLAA 2VN8A 4J9PA 2BM9A 1GWNA 1HG0A 1T91A 4MV9A 4HL6A 1ABFA 2Z58A 1SBTA 1E58A 2CMGA 5H3HA 2PYZA 2GKGA 1P31A 3OWOA 5BSVA 1FFXA 2OOSA 4HD8A 1JH9A 4N7RA 3M6FA 4ECYA 1JNYA 1DEXA 3OT5A 3SS8A 3TBKA 3LCVB 5HGXA 1JNXX 2ZRCA 5EJIA 1CE8B 2E4XA 4MGHA 4OJQA 3Q6IA 3NH9A 4CHTA 3ICWA 3N87A 3ZXUB 1N5LA 3MIZA 4U7TB 1AF4A 5SZIA 1MDBA 3D3WB 5EA2A 2XF2A 5FPQA 2ZPTX 3T9FA 1F1JA 3VYRB 3U4MA 4DRXB 1UJ5A 3I1YA 4DR4B 4XB1A 1QIIA 3QE3A 4JLMA 4I08A 2ZITA 4PLYA 1UWKA 3JXEA 4CIAA 4QBHA 3DJYA 4ZQIA 4NE2A 2Z1MA 1JG3A 1FYWA 1HUQA 2BBOA 2BISA 1H1LA 2JFGA 2XXBA 3TSCA 4QW8A 2GM3A 2DU8A 3OE7D 1YB4A 2D0IA 3GLUA 3PC6A 2Q4TA 2AEEA 2DJIA 2VHUA 2QRPA 1MJ5A 3NPMA 3PFGA 3ZPXA 2H2IA 4KPEC 4XUCA 1KZ4A 1NAHA 1GPMA 1XMIA 3E3LA 5ARDA 1HX7A 2YUTA 4RA6B 3FAZA 2GD1O 2QMOA 3TX2A 3TXAA 5KOJB 4NX2A 2O2SA 2MIIA 1IXKA 3RS2A 4B6EA 4LJSA 2HOQA 4ENWA 3LKDA 3R9WA 1T3GA 3PC4A 3EDYA 3SOZA 3QYAA 5HKKD 3I5XA 3SY8A 3O03A 1PU2A 4HRAA 2HA6A 3QKUA 4YQWA 4WL0A 5FUWA 3DBRB 4DIBA 1S8NA 5F4BA 4H0CA 3QQPA 5ITSA 3AV3A 1JXOA 1XRQA 4RK5A 3T61A 4D4KA 3SHOA 1YL7A 3NLLA 4PHGA 2P4QA 1ID1A 1NWCA 4EHBA 1BW9A 2CVOA 1G3IA 4OMDA 4HYQA 1Z22A 1RLOA 1E2EA 4TZ6A 4IYJA 5EKSA 1N0WA 2W2LD 1Y1PA 3WXMA 3MSCA 1OJLA 3ZZUA 2H08A 2O2HA 4LOIA 4IDEA 3VU3A 5THXA 2GHIA 4V2UA 2P11A 2DZDA 3HYTA 2Y92A 1D0VA 1R6BX 5SV2A 3IJ5A 1RJRA 2FZ4A 1NVBA 4UASA 2FLLA 4RC9A 4J9LA 4IL5A 3G8DA 2WNHA 1H3NA 1QYDA 1JA1A 1E0DA 2R92G 3CN9A 3E81A 2MOKA 3AHFA 5I9IA 4DFDA 3RRJA 4QBTA 1X42A 4I55B 4GBED 3WRYA 2GPJA 4L8VA 5A3RA 1A7UA 3I2GA 5KT7A 4AULA 1E2FA 2JJ2A 2C8LA 4B7AA 5AKEA 5CFZA 3E7DA 4Y9SA 2VDMB 1A0GA 2IOYA 1GAWA 5JPIA 121PA 2WHPB 4WHMA 3L4BC 4ECWA 1ULTA 3GGGA 4F85A 5DBGA 5CXUA 5FCDA 4DA0A 5LA6F 2PJUA 2R8OA 2WJAA 4L73A 5AK6A 2PQMA 5FTKA 1TRKA 3NWEA 2EKZA 4MARA 1HRDA 3RAGA 1W1IA 1RCTE 3FOCA 4JJ6A 5DHAA 3KXDA 3ZY5A 5I5TA 3A6FA 4IJUA 5DFAA 4KXYA 1UEIA 3RWMB 4XSHA 4RAZA 4MKXA 2GZHA 1GPJA 2Q62A 3C41J 4KR6A 3ZD9A 4OX9Y 3ZGYA 3MJ4A 3IDSA 3JD1A 1QTRA 4J3NA 2Z2XA 3KSDO 3CUUA 1HT1E 2NNWB 4F2HA 2WD9A 5AXBA 4CMAA 1C41A 3NC1C 2G88A 1IY8A 3FOEC 4U1RA 2CZCA 4I2VA 4AP6A 1MHPA 3T9AA 3L5OA 1P9NA 2GPWA 2NYUA 1OROA 2HF2A 4A8HA 1C7IA 1JR4A 2O7VA 4R1TA 5F3WB 2CSXA 1XK6A 5JH7B 4WBNF 1R4AA 1MNQA 2B1RA 2FEPA 4YB8A 5CRIA 1JZTA 3RVNA 1P5ZB 4MB0A 4BB5A 1PTJC 2W8BA 2H1FA 1Y9ZA 1M34E 2XDQA 4EENA 3JW8A 4D9HA 5BSRA 1YQTA 4BBZA 3Q72A 2GB4A 5IK2D 2L0XA 4A3GG 1MJGM 1WDWB 5TIIA 3KHRA 2AOWA 5KU1A 4YRTA 1NVKA 1CB0A 3V6KA 4ID9A 2C2KA 4RAYA 3IAM6 4M0FA 3F8TA 4IOLA 4DDWA 1TKAA 2WSLA 4R1UA 5CP8A 1K7YA 4R2IA 2HJWA 4AJ1A 2VYCA 3K6JA 2O1SA 3WDMA 4CCYA 4YRAA 2D13A 1YA6A 3L1IA 2JGRA 4MVJH 4WFJA 3NTUA 1KMQA 2JCVA 4Q0MA 3MPUA 1JX4A 4X6LA 2WVJA 1B04A 4QUIA 3H18A 1XEFA 3P9PA 3G0OA 4IILA 1EPUA 2PRJA 3HCFA 4A3BG 3JQAA 1MAUA 2AI2A 3DLPX 5EWMA 4M1EA 3O4HA 4J9MA 4ZN6A 1PUIA 2I0FA 1TZ2A 2NQ2C 2QRJA 3H5LA 3COSA 2Q99A 1G5HA 5BV1A 4N41A 1CS4C 2DQYA 2R6HA 4GW3A 4BJ5A 2O8EB 3FGNA 4FD3A 1PDVA 1EUDB 4DJFC 3QFSA 1QH1A 1R6AA 1QPGA 2C03A 1Z13A 3PNMA 3ASUA 3WJAA 3V4RA 4PRYA 4I6EA 2WHRA 4O2BB 1G9SA 4Y6OA 3ZJ4A 2MT9A 5JADA 1E2GA 3L2OB 2C9CA 3JWHA 2FVYA 4FGRA 3ZHCA 3IQFA 5DASA 4GYWA 3WGMA 1G6Q1 2XGGA 3U37A 3OT1A 1PZXA 1I80A 2IRWA 3W4KA 4ALLA 2PMFA 1R9TA 4IIFA 1Z2NX 1HF3A 4PYIA 1DKRA 4R1OA 1OXTA 5JT1A 1FNBA 5IYZB 3CB2A 5KNDA 1YASA 3GN1A 2Q9BA 4UTVA 5DM70 2Q1XA 1GG5A 4AY6A 5DXFA 1ESDA 4PQYA 5KINB 5KYTA 4CG1A 4X95A 5BSEA 4QL3A 5ITWA 3JR3A 3GDEA 3TCKA 1NFRA 4QXAA 3HR4A 3A9CA 4QRDA 4U00A 2OBNA 1CLEA 1RP1A 3TLJA 2YCHA 3L6CA 1TTPB 4QXQA 3LCJA 4AXXA 2RAPA 1ZEMA 5J2TF 3SCZA 1V6AA 1JHPA 4MVJF 3C3KA 4CJXA 4LYEA 1A4UA 4I4NA 2SCUB 3GFGA 1W49A 2LZ0A 3CT6A 4KSYA 2C94A 4AX8A 1W9MA 4INOA 4ETIA 1INLA 3L92A 5ADUS 4CMEC 1B15A 2W70A 5EKDA 4UM5A 4D9MA 2R4UA 3U81A 1IBKH 5C32A 3EXFA 3D3KA 2OWDA 2XNKA 2P8SA 2EJUA 2NX2A 3SN6A 2NZXA 1EDDA 3VR4A 4IG9A 2J48A 1JXQA 1R3DA 1YZKA 2DHQA 1AZWA 1ISHA 3DFIA 1LV7A 3IP1A 4KWTA 3INRA 2D5LA 2JIMA 5HF6A 3C3AA 3FKQA 1AKMA 3MCUA 3RVOA 1Q77A 2PGDA 2DWOA 4BZXA 1JHRA 3LQ2A 4P4LA 4HVLA 2FOLA 1PJZA 4G0VA 4A3JG 4RWEA 2N1MA 4LJ5A 1E8MA 2WJ6A 5CCBA 5I8PA 4JLJA 3VPBA 4JENA 3J7AC 3LPAA 1YTUA 4AP5A 2PT7A 3EIEA 4B3XA 4DYDA 5K45A 2E89A 1FC0A 2JFQA 2GM4A 1VSUA 3KB2A 4C3VA 4HB0A 4ODIA 3AFNA 1RXEA 3DE4X 2R8JA 1IQRA 2ERCA 1A9PA 4AUEA 2OEPA 3H5TA 4XIYA 4BX0A 2PT9A 5GY7A 2EATA 2X8WA 1JHUA 3MGKA 3ZE2B 1LDEA 3PNQA 2EWVA 2O50A 3TOZA 5CVVA 3IPXA 2QNBA 2YOHA 2GASA 1GG2A 4TOIA 3IQWA 2LW7A 2A1TS 2WOOA 3AESA 5FNZA 1YKFA 5IH7A 1WEKA 4BDTA 2G0NA 4J1TA 5BWVA 3BSSA 2BGRA 5IDXA 5KTPA 1OBCA 4CL3A 2VDNB 1BMFA 4IIJA 4PW0A 2N3ZA 1TO6A 2VXOA 1CKOA 1MJFA 3EC2A 4UXJA 2B94A 1TM7E 5AI4A 1RNLA 3EZ6A 3GJ7A 2YJ4A 3CX8A 5IYBG 2PUDA 1JG4A 1T9AA 2V54A 4YI3A 4R5MA 3S7ZA 1JR2A 1AGNA 3OPYI 3K71B 3WHIA 4J1NA 2Z43A 5JRJA 3OA0A 4PVCA 4C2BA 1I3LA 5FOXA 3T3GA 4E2XA 5KNDH 3GLTA 5KSYA 2XVMA 5JUMA 3AUUA 2BZGA 4HNGA 1KKMA 5L7YA 3RK0A 2YHUA 2XIJA 2W6MA 1SKAA 4IVQA 1O77A 1TM2A 2IOFA 5CFOA 1ZGAA 4OHVA 1WCXA 4KYIB 3AVVA 3SIRA 1TA9A 1SELA 4WSOA 1CY0A 1AS2A 1YHZA 3QLEA 4RD6A 3L8MA 4H7JA 4O29A 4JBYA 3B89A 1J33A 1LB1B 4AUKA 1RI2A 3MD0A 4LYHA 3LYHA 4G26A 3LWDA 1IXZA 1DAHA 5K7SA 4JI5B 6NULA 2DYKA 2W48A 2TYSB 2YDYA 4BNTA 1HDOA 2H7VA 3KLMX 3FOWA 3TDMA 2VSXA 5AOAA 4O7RA 2AUNA 4N3AA 1P1JA 2RGDA 3RYTC 1UK6A 2EZTA 3TAUA 5KTKA 2O0MA 3IE0A 4U7WA 5G53C 4GOXA 2XE8A 4OGLA 4FN5A 2B21A 1QCDA 1W36B 4XAQA 1IY0A 1T25A 1DV1A 3VR4H 1DPFA 1LTHR 1M9NA 5B4VA 1R50A 2PS1A 4XOUA 4OKSA 2VSFA 2UAGA 1G98A 1ZQ9A 1TQ6A 4J3JA 3WDLA 1MXFA 4NY1A 1GQQA 3KZVA 5FH9A 2NWQA 1HO3A 2DH6A 3E35A 2D1SA 5CB4A 3FWHA 5LB2A 1KWGA 4LFBH 3WWEA 1Z12A 5J59A 1F20A 3VC7A 1L4LA 3K9QO 3ML1A 4LRXA 4ECTA 2DOKA 4OQNA 3ZDRA 4RV9A 3IAS6 3I9JA 3O4GA 1UMCA 4PONA 4JEUA 5IASA 2QR3A 4HLUC 4OL9A 1XNGA 3BJRA 2PEYA 1B42A 1T6ZA 4RDHA 2X40A 3SZUA 2PX8A 3W6ZA 1TL7C 3W7BA 2Z3ZA 2I4IA 1H65A 3PJRA 4WQMA 1CUDA 4I8XA 3K1TA 4C89A 4DNQA 4KDRA 2JJ8A 4J94A 5JCPA 5GV7A 1BVRA 1DO2A 1JFSA 1I6UA 2JPDA 3LYAA 1GSAA 2C42A 5D00A 2W9XA 5TNXA 2P2YA 4RCYA 2XODA 2VPTA 5F33A 4BBRG 1ORRA 4F6LA 3FGPA 2COJA 4DLRA 1GTMA 3HJCA 3AR2A 3ZHTA 2PXXA 2VT3A 4RA9B 5A4IS 1XCPA 2F4VB 1YACA 1XZPA 3KJGA 1LXCA 1J2UA 1U1DA 3GYBA 3Q7IA 5IT0A 1F0KA 2YZ2A 1VE3A 3V6MA 1MD9A 3MELA 3W79A 2EWWA 4I1RA 3Q87B 3ZYZA 2W6IA 4PG4A 3UQYS 5CM8B 3SQWA 3A10A 3H8SA 3CV3A 4A2AA 4GYJA 3AEXA 3JWIA 2BFFB 3HE3A 1PL7A 1N75A 4ZV9A 3DMDA 4Y2HA 2Q27A 4OQ4A 2OV1A 2JIBA 2JFPA 5G2OA 5CDSA 2QBYB 4HQ6A 6PFKA 4KYTA 4KODA 2AJCA 3V1MA 2PO5A 4O3SA 1EWRA 3RKRA 2V3VA 2UVPA 2B4RO 3RT7A 5KOHB 1HBJA 3ZLTA 4R81A 5FADA 3FZGA 1WXEA 2A0UA 1WV0A 4NIMA 2VF8A 2G67A 3FG9A 4JKOA 1HR0H 1P6UA 4IQ8A 4MQFB 5JFTA 3DZHA 5FTWA 1XMOB 1HZZC 1UM9B 1YSCA 4WADA 5LBIA 2RCNA 4CQJA 3KB8A 3HNRA 1D2EA 4H7PA 1RC8A 1UPCA 2J09A 5CIQA 4TKUA 1ZICA 2ZVPX 3W5CA 1WF3A 3WNQA 4I5IA 1VI6A 3N6XA 4YXFA 2FPPB 4V38A 3F9CA 3X0DA 4R7TA 2OZLB 3WGGA 5FEMA 3CW8X 1WSAA 3ZV7A 4PFQA 5FR1A 4DA4A 1BCSA 2E6UX 3E1GA 3B2NA 1DC4A 2Y2VA 1NNLA 2CCKA 2IDZA 3B36A 3S3TA 2EBHX 1HQYE 4QU8A 3SNKA 4TLLB 1HMYA 5ILQA 1TW2A 3E5HA 1RLUA 3AVYA 2QQ0A 3SF8A 3LQRA 4D3DA 5FLYA 1FFHA 1NMEA 4K26A 1I9CA 1NG9A 1Z5UA 1VPDA 1YC2A 1QCZA 4PAOA 3VAAA 4H6VA 1HSZA 2GSWA 5DIZA 2OYRA 4G65A 2JS7A 4WT7A 3TRDA 2IHUA 3HZOA 3ROPA 3A1VA 3MJCA 3URMA 2HDWA 1WD7A 2J6HA 1GA4A 1TQ2A 2HCJB 1TKBA 3ZU6A 5FWYB 1CWUA 4FN4A 1BS2A 2R0QC 4O7YA 3UHFA 1OIXA 3OQPA 4URXR 3SZMA 3SE7A 5J4LA 3ED1A 3I37X 3I9V1 2WT9A 2C3OA 3Q3CA 2Z57A 3CB4A 3N2YA 1UC9A 2Q6OA 4UBIA 2V5AA 1ZMXA 1N3BA 2Y0DA 5CFQA 1E7MA 5KFOA 3PCXA 3K6SB 3OCJA 1AO3A 1OB5A 3WV4A 1XLUA 4FMCB 4Y7DA 3K5IA 3KXIA 5KYXA 3H3JA 3AP3A 4J4TA 5CFNA 3B52X 1R0BA 3GMIA 3W0LB 3WL3A 3O8BA 2V0GA 3LC0A 1CUIA 2G7MC 3DB1A 3FMPB 3OE5A 4GKJH 3PR5B 3U3OA 3TTSA 5JXIA 1BNCA 4C14A 3TQFA 1UXJA 1M8FA 4PLZA 4B45A 4NU0A 1JUDA 1PR1A 4B3TB 2PFSA 1GZSA 4W8HA 5KFDA 4QBGB 1WZCA 1W8DA 1EYZA 2EFCB 3RPEA 3ZNOA 1ZYUA 1CUWA 1RJEA 4E70A 3ZXIA 2CF5A 2Z56A 1TD9A 5IAKA 2G9VA 3LUCA 1CZLA 2A9RA 2EL7A 2H0QA 3PXCX 2ZREA 1DE0A 4A8JA 4L6IA 1R4NA 4KPGA 2FZ5A 1E99A 3NP9A 4BWGA 5EUMA 1GKIA 3HBFA 4AP9A 2J67A 2Y9MB 4Z0TA 3DA8A 2OGUA 3VNUA 4OUDA 2G6BA 1E77A 3S2GA 4HH1A 1CDZA 2BP7A 2CEAA 5KNBA 5DVZA 4DUGD 4AZ0B 4EW1A 2E5FA 2M6LA 4DSUA 4N0QA 1G20A 3HCBA 4I4CA 3V6JA 1B16A 3LGAA 4Z54A 1YZFA 1P1FA 3ZBQA 2C2MA 4LF6B 3DZGA 5E3HA 3ZHZA 3H5VA 5FI1B 4G1VA 3KVVA 2V5VA 4HWSA 2JA6A 1JXLA 4HYEA 1RKVA 5GMOA 3P32A 3RRBA 4RACA 5KSOA 4R31A 4Y0VA 2Q5CA 3IDAA 2EJ0A 4X66H 1F9EA 3IAFA 2GARA 4K05A 3W7AA 3PZPA 5T57A 1LFDB 2MU1A 1RKBA 3CZAA 3OJEA 4P3YA 4BE9A 3IMKA 4LBWA 5LP6F 3ZHYA 4GM4A 2IBTA 1UMKA 4R41A 1FDUA 5FAKA 4G0ZA 1NI3A 5BVHA 1PO7A 4QOEA 2I2XB 4TPKA 3OD5A 3H40A 3TNYA 2CHGA 3OQNA 3LUJA 2O8NA 4YRJA 5BQ5A 3MSXA 4JVNA 4I8DA 1QGAA 3S2ZA 1ZLXA 1P3JA 1OAOA 4A1OA 4Q18A 5BN3B 4JNCA 3EB9A 3K0SA 1E9EA 4IX1A 3SXPA 2LDXA 2RGVA 5J40A 1G8AA 3OM8A 4RAQA 5EEHA 1IPFA 3R5XA 4Q93A 3PZBA 5HZMA 2O3TA 2O6HA 1TA8A 1YR9A 3BDVA 3ZJTA 3NZEA 4MUYA 3Q5EA 1YJQA 1GZ3A 4E2YA 1GNSA 1DGSA 3P26A 3PC8A 1RYFA 5I60A 2EQ5A 1T8RA 4N3BA 4BNXA 4ARVA 3DPIA 1BXZA 2VJBA 1Y7IA 2HK6A 2OYSA 4TMTA 1JIUA 3A6KA 3JSLA 3JD0A 4CDNA 3S1AA 3U54A 2KI5A 1ZNQO 3JALA 2GLUA 4WTOA 4ALMA 4J9VA 4Y1FA 1TKRA 4ZYUA 4GXNA 3PR3A 3NUQA 1PQ4A 1B14A 1E6EA 1JSXA 3RS0A 1TJ5A 2ZJBA 1VL1A 1NQUA 3LG2A 2WFMA 1L4MA 1U2PA 3F1LA 3GG9A 3JQ8B 4RD1A 4BO3A 1TUGA 2NTNA 1SOUA 5TQJA 4FBLA 4FD2A 4W5OA 1PT6A 2GKSA 4HS9A 1F2DA 3R1IA 2W2KA 3T0GA 3CLUD 4EJSA 4H1UA 4JI2H 2OCPA 3EASA 4DR7B 2QR5A 4L5CA 1QCYA 3EMDA 4LVOA 3BSFA 1GNLA 1SU7A 1CQXA 4WZZA 4DSNA 2YJNA 2QTNA 2R85A 1GNPA 1NAIA 5M5BA 5KNBH 3KV3O 2I2BA 4PLVA 5BORA 1VHQA 4DG5A 5LC1A 3HCRA 4DARA 1IRIA 2D5CA 3T1HB 1YB7A 1G60A 5JATA 4U7FA 3BBLA 1O9GA 3R7DA 2D0OB 3NTLA 1Z37A 2LGJA 1VMIA 4K46A 1RQLA 2ZYGA 5JSQA 5B1IA 2P6PA 4WMLA 5EUQB 5KQGA 2QOEA 1NOIA 1SRQA 1BQ4A 4MQ5A 1B3BA 3EYWA 5THKA 2GERA 5F2NA 5L8VA 1VQ1A 3ZDQA 3GRUA 2DQ4A 1N2CA 2DVMA 3BC1A 2JGDB 1I51A 2P9JA 3VC2A 4CE5A 3RR5A 1X14A 4C4SA 1NBOA 2AE1A 1PUXA 4CM1A 4N47A 1EUCA 2YYAA 4JSRA 1LV8A 1QX4A 1I7SB 2QS9A 1C9KA 3C97A 3UGKA 4RVCA 1BDHA 1YRQA 4MI9A 3RVBA 3P0HA 2W2PA 1A4IA 1GL3A 1SUEA 4RY0A 4KNWA 1RBQA 5CXXA 1PKXA 4Z4HA 1R5OA 4BO8A 1ODIA 3HWX1 1VA5A 1HC7A 4DV0B 4JT4A 4ZQHA 3UXEA 3TL2A 1HTBA 3QXHA 3VR6D 4EY6A 3QYFA 1WKBA 3EWSA 4G4SO 3C5WP 1PRYA 2FEWB 3WI7A 4PX2A 4OGWA 4AMBA 1VLLA 2Q5IA 4HUQA 1Y3BE 4E5PA 4DZTA 3RAFC 1X7YB 3QELA 1R0CA 4KRFA 2NTVA 4UNNA 4YJ2B 1H2FA 3QY9A 4V0SA 4LJ8A 1DV2A 3PQ2A 3OZWA 2JKVA 2B30A 3LS2A 3ZY4A 2ZRGA 1LNZA 4TX1A 3FOBA 2H18A 2VYVD 4NI5A 3PFIA 4Q3DA 3NV9A 4OQQA 2J9RA 2EJWA 1OWTA 2XUIA 1KH3A 3ORHA 2EU8A 3G9ZA 4X93A 2VP0A 3FYUB 1GGFA 3ER8A 2WF7A 1E3LA 1MEOA 3UY4A 5K3AA 4XZ3A 1ZX1A 3PRKE 4BNVA 3GX1A 2RHCA 1NMXA 1IM8A 4DUZB 2OV3A 4FKBA 4MWZA 3UJ6A 1XZKA 2JFVA 3E84A 4KVZA 3RIXA 4I36A 2ZGIA 2UYQA 4E30A 1V3TA 2M98A 2VYQA 1A88A 5EXEA 4EY8A 3GJSA 4LZLA 4IYRA 2A1UB 2NZJA 5EKXA 4PV7A 2V7WA 4S35A 3FNFA 5JDCA 4RKYA 5K9ZA 1XTSA 5I7HA 4LSAA 3R3SA 4OHUA 3DAAA 3R7LA 5I6DA 1SWWA 3IH5A 3OQIA 1Y0BA 4N0DA 4UBLA 4TV8A 3RUHA 4M1SA 3INGA 3NYIA 3OETA 2AJLI 3ZV5A 3TIVA 1E5TA 2WPDD 1Z29A 5EXTA 2WIGA 1CVIA 1MRSA 2QAJA 4ZEWA 3M6UA 1S4QA 2HMYB 2C4HA 1Z63A 1SRRA 2VJDA 2VHCA 5CG1A 1PSWA 1YB1A 3SF0A 2LUOA 3W1EA 3V4PB 2VTVA 3RB8A 1NP6A 3WJ7A 3UKDA 5BP7A 4CEIB 4FZ3A 4MHSA 5CX1A 1EXNA 4DV4H 1KRWA 3JQBA 4CKBB 3INTA 2FZLA 2PSFA 3QPAA 3ACDA 3AY7A 5L7TA 4L08A 4TM7A 1M6VB 1BKSB 2ZYWX 3B5JA 1SVUA 2OHIA 4FT4A 4XKJA 4L4SA 3CBQA 2Z08A 5FTMA 3JWGA 3LY8A 3OIWA 3QQ5A 3CKYA 2P9QA 4YQFA 3RRFA 3S55A 3S1LA 2CXRA 1A8HA 2BFNA 3KUCA 3U4QB 5A62A 4HT3B 4DCJA 1UKYA 1TF5A 1CZUA 3FLBA 4J4BA 2HRDA 1L5QA 3GFFA 4CF7A 4IPTA 4C2AA 1JR3A 1WDLA 2A58A 3W3AA 1EWQA 2REQB 4MDEA 2GNOA 3MRXA 2OHHA 3CVOA 1JSLA 5FJJA 1A76A 4R8UB 4LAFA 2E5LB 4O2RA 2WE6A 3WB1A 2JZNA 1TFRA 2EZUA 4L02A 4HDCA 1SK8A 1E3QA 2B8WA 2GEDA 2IEIA 3DZBA 4LHSA 2YWDA 2F3RA 3H4BA 1U80A 4YTEA 3UC9A 4RXTA 1YU9A 2FEAA 2W2MA 3N2GB 5C35A 4TKLA 1X7HA 2VPWA 4BQRA 5HIMA 4EI9A 2W6QA 4ABTA 4UZFA 1ZMTA 1FQWA 1VPWA 4BPBA 5C1DA 4Q4AB 3KT8A 2GPBA 1Y1VG 5ABPA 2V03A 2CLHB 5FUXA 2GBPA 4UVEA 4AWAA 3W8NA 4EYOA 4ZV7A 4O2AA 1JEJA 2B1QA 4NCHA 3SD7A 3ROXA 4OBEA 4Y67A 2PKQO 1X7XB 2B9EA 2VF7A 1WXXA 3BRSA 2HLHA 2H31A 1M2VA 2IKSA 2FSFA 4BU0A 1LF5A 3P7MA 2GJAA 4OJMX 4RGQA 1E3JA 4X85A 1PQYA 1E92A 1OOEA 3LHIA 4CMDA 5KJEA 1N4AA 2IH2A 4F4UA 3VKHA 1PGQA 3AP1A 4BGDA 4M9QA 4LDRA 4POOA 1KGSA 3T1TA 3RUAA 2ASJA 1U0TA 1LVUA 5J5CA 2QG4A 3R7NA 4NNOA 5HTOA 2I22A 4X8HA 2HF8A 5B37A 3LTNC 3BABA 3EXG2 3O4IA 3HR8A 521PA 4H7FA 4MI1A 3R5FA 1HT3A 1R16A 2VBCA 1S3SA 1BVYF 4ZU3A 4OHPA 5BN4B 2PX6A 1PL0A 3MJFA 2DTXA 3ASZA 4WZBA 1N9KA 1ADFA 2Y99A 2FR8C 5DO9A 1P9WA 1MENA 3IA2A 3IUBA 3SYMA 5FV4A 1WCMG 4A93G 1E0SA 4XWAA 2ZIWB 4W1SA 5HW0A 1U1EA 4G9EA 4XVUA 2AOVA 3R77A 4M9CA 1PGNA 1Y5MA 2EHJA 4XW2A 4XGRA 2H0AA 3U7JA 4UHCA 1TE2A 3L41A 3SGIA 4TROA 3PXBA 2VATA 4L22A 3C3YA 3BG5A 3O2JA 4CMKA 5DLEA 4TKMA 4AMVA 4AVYA 4OFWA 4TT3A 4CI0B 2W7PA 4LKRA 4HB4A 2W8KA 3TUZC 4DLXA 3VNVA 4M46A 5IT9A 1J24A 4WZAA 4UCSA 1YS9A 3WGLA 2XDAA 2VAVA 5F21A 1AV7A 3COWA 1PNOA 2RIPA 1ODCA 1T0JB 4S12A 3GTGA 2YJGA 2UUCH 3OUTA 1CRWG 2JAWA 4G1BA 1RW4A 3AEQA 5K6AA 3O8OA 1DQPA 3LSTA 4RZQA 1FNNA 5KWIA 1GNRA 1SVOA 1BX0A 1SMKA 4Q1DA 4O7SA 5FLMG 4YT2A 2DSNA 2HO4A 1I6KA 4EYSA 1LU9A 3L6UA 4XRRA 4B6FA 3TQQA 4DTCA 1J99A 4EUFA 1NZJA 4QU9A 3T4EA 1PIWA 4XGKA 4YGXB 1Y7TA 1JJ7A 3K3PA 1K1EA 4PWYA 2C9ZA 4AO8A 4CKCB 4EATA 4M1TA 3KZNA 5KFNA 1BYUA 2I7CA 5HNKA 3DCIA 3PIRA 1OTXA 3G2LA 2CY0A 5K3SA 2C7BA 4MS3B 3ESBA 1R8QA 5JLAA 3ICOA 2ZIZA 1U2EA 2OH2A 1T35A 2YVAA 2JFBA 2P3QA 2JJ1A 3N0RA 5IPFA 5EWFA 5DPMA 4IQ4A 4OD0A 2VKQA 2NU6A 4QGAA 2ICAA 4ZYLA 5HK9A 1KDPA 3O93A 4P32A 4C03A 3VXKA 4N8DA 1UC4B 4ED2A 3K9HA 3A9WA 1JWAB 2B25A 3S44A 4HUTA 1VL2A 2W9CA 2IYZA 5BMOA 4OJKA 1ORIA 1J97A 3L0ZA 2P6OA 4RJJA 4G1EB 3PNLA 1MB4A 2CN1A 1TT5A 2V4RA 4NS1A 3HUUA 4J6EA 4MROA 2XT9A 3BMXA 3BL6A 3NM5A 3LZ6A 4G0PA 1U9ZA 1DAGA 2WA2A 1IQUA 3TIXB 2E18A 4TMKA 3ZY3A 1BKYA 1EH5A 3SMQA 3U7RA 2ZYRA 4A2BA 1S0NA 4HQLA 3AB8A 3T1NA 4URWR 3P19A 3UWPA 1P0PA 3KQOA 1KY5A 4J76A 2ZI9A 3GCGA 5CDUA 1C7QA 5AUNB 2PRZA 4WFIA 3K4HA 4RUKA 2ZR8A 3EQ6A 3GLKA 1WS6A 5MFPA 4F4HA 4BNZA 2IUEA 3CG0A 3FRIA 1IBRA 1ZWLA 4UU8A 3M70A 3TIGA 1GR0A 2QLTA 4L95C 1RFLA 3NCHA 1M1XB 4LHEA 1I1QB 3O38A 1S2OA 2RBKA 3FZNA 1K2WA 1ZKMA 3ZQJA 3K0EA 4NJEB 3JAMW 4QGFA 3R3ZA 3IXLA 2DABA 2O1XA 4ND7A 4ZVNA 4C6TA 4K0KB 4OQFA 4N8EA 1S2LA 1Y1LA 1XDGA 2WD7B 1LRJA 2WK1A 1U0EA 2HXSA 1TF7A 3SVLA 3VR5D 1LS6A 3LDAA 1HT2E 2WA1A 2JDID 5DX8A 2QY9A 3HYRA 5I8ZA 3IEMA 2EQBA 5L3SB 3U49A 4P36A 3K4QA 4JCCA 2A14A 3BORA 1C30B 2J6CA 3V8NA 5K20A 3Q1KA 3W8DA 4GOLD 4IJKA 4WKOA 2VPYA 2QORA 2PWPA 1CDDA 4FLEA 2CK3D 4FZRA 3VH1A 4NHOA 1EZ1A 4EHJA 2XMDA 4FIDA 1T4DA 3S2SA 4G5YA 4MAMA 1XAIA 5ANRB 2AFHA 4TXMA 4KNYA 3DOIA 4MAAA 2AFIA 2QMHA 4F04A 1KQPA 1TGYA 2PSHA 1XGKA 1Z8DA 2JRCA 3RBXA 3A0UA 3LY7A 1XZEA 1K6MA 2NV6A 4YAKA 3TIFA 1DLJA 2C2ZA 2HMAA 1OBGA 3AJEA 3KQTA 4BQFA 3MT7A 3OLCX 4O33A 3BWVA 1RJFA 2YW9A 1SUPA 2FJUA 3LSYA 1FU8A 5JQGB 4F4YA 1BJRE 2XNCA 1YOVA 4CUZA 1HRKA 3RVDA 2HSWA 4GIBA 1ORHA 1T9CA 2I3ZA 2CDCA 1GZHB 1DI0A 4BVAA 4HXFB 3V32A 3PO3G 1U7HA 4DAOA 2W5UA 1P4GA 2PR2A 5AM3A 2F64A 2OKCA 2NUTA 1NWHA 1LSUA 3HKZA 2Q2WA 3NBZB 4MKGA 1U99A 1US8A 4DQKA 2BH9A 2SECE 2XTAA 1EFVA 1VDZA 3ZE7A 5GIOE 1A9SA 1R5JA 4CZ2A 4P7FA 1Q1BA 3ZNPA 4EBDA 2IEAA 1QUEA 5AKXA 2QTHA 3T41A 5FNVF 4G5FA 5DM0A 1YOBA 1MVOA 4K81B 5LDGA 2XCAA 2V96A 5HKLA 4YHHH 2X6RA 1GUBA 3GNSA 1TYDE 2YS6A 2AXEA 3FNGA 3BMNB 3RWBA 1JAZA 1DKOA 1PGOA 1R0SA 1C2TA 5AOVA 1IG3A 4J0FA 2P90A 4AQYB 3MD9A 4YR0A 4IHJB 1KOFA 4JVSB 2C7GA 1L7XA 1MMFB 3TYXA 2X3FA 3OPVA 1V8PA 3BIOA 1E4EA 1K3FA 3USCS 1TX4B 16PKA 1R88A 4IDDA 1LI4A 1UBMS 3RSZA 1Q95A 2ZCUA 3HSKA 4P5PA 4KO4S 4DVGA 5BQ3A 1IHDA 3MXOA 3K92A 4MB6A 2R96A 4K6GA 3RNOA 3RSOA 3WLTA 2AJDA 1NI5A 2VWQA 3M0EA 3I0NA 1IBMH 4RXUA 5IHXA 4FZJA 2VJYA 4QUJA 5BOSA 1QHYA 2RFLA 2GEVA 5D8DA 5BT9A 2BHTA 2GDJA 1CQZA 1NBHA 2GF9A 2J6IA 4BWYA 4BWVA 5E9JA 1KI6A 4UCTA 1OZFA 4KPUA 5CVCA 3PO2G 5TT0A 3NRBA 4DQUA 2IFTA 2FA9A 2HHJA 2BLLA 1U0HC 4DA9A 1P2UA 2PRKA 2A35A 2UYHA 4GOMD 5DYWA 2XNSA 2GLXA 4OKNA 5FOWA 2HNAA 2H8GA 1KMIY 1KC7A 2NVBA 2VCEA 1LLFA 3LVQE 1CVLA 3KHTA 4HDSB 3TLGB 5HIKA 5DULA 2PBLA 4XQGA 4UULA 2EJCA 4B33A 5KQPA 1SURA 4DIMA 3RS8A 1LWNA 3QBDA 4RFSB 2WABA 4XFJA 3PQCA 1FS6A 1GNVA 4XGNA 2XVAA 1QP7A 1NMQA 1RZVA 4RANA 4TSKA 1OGYA 3ZHBA 2ZE6A 1U5BB 3MIIA 2XY4A 2VOBA 1M2WA 1DUVG 2F1IA 4IP0A 4YQYA 1SIWA 2PM8A 4Z1MD 2ZAOA 1Z8NA 1HOXA 3B9PA 2CXHA 3KV1A 3BWBA 5DQGA 3R3XA 5FOTA 3HWWA 2F90A 3SIWA 4MQLA 1X9IA 3LNCA 4RK1A 3MOGA 4J2HA 4GWGA 3EHDA 2Q45A 3W90A 2QUJA 2ZUTA 1SC9A 1AZLA 2GNPA 2H29A 3N0XA 1TYEB 5CM2Z 4P3OA 1H8EA 4JB8A 3PVZA 2QYHA 5JXWA 5BSFA 4V24A 4ZVQA 1AA6A 1F0PA 1JSRA 4QYSA 3K9BA 3QPCA 4MDFA 1JKFA 5BQXA 3GPCA 1IEWA 1XTIA 4DADA 2VHQA 1CUCA 2HCTA 3A9RA 1KFEB 5AVSA 2GCIA 4JJKA 4IF4A 1IN7A 2I4RA 2XUJA 3ANNA 2I1VB 1OB2A 2JA7A 4G8JA 1U02A 2P0YA 3TZLA 4YUXA 5EE3A 2L2QA 4LBYA 1JEDA 2HZ7A 2JFZA 2DBYA 3IUNA 3ESYA 2C2WA 1XTZA 3USES 3F0TA 5JS6A 1UAGA 1WSCA 4J9SA 3G8BA 5JSFA 1G7RA 4I0WB 1ZK1A 5AHXA 2CW8A 3A7DA 2GN9A 5KDDA 4ITUA 1A2OA 4BKRA 1EFTA 2J4DA 1IPEA 3Q4GA 3QKRB 3KHLA 2MSEB 4NG5A 1DTWA 1ORDA 4JSTA 3W5AA 3HQ4O 2DPMA 1I3MA 4QQ8A 5K99A 4M1QA 4ZCIA 5EKTA 2J9GA 4YRZA 3V33A 2I2WA 5K3BA 4ISBA 3DLTA 4I1YA 3WGJA 2YIJA 2ZTMA 1JG2A 2IU6A 4RGBA 3IKJA 2ZVDA 3UMRA 1U2GA 4ARSA 1X39A 1RZRA 5IC5A 1ENZA 1QFXA 5ITVA 2I2CA 3J81k 1M0EA 1GGVA 1DELA 1I6WA 4DNXA 3KOWA 4BIIA 4N6GA 4EFMA 1W0JA 1DWUA 2HQ1A 2I99A 4TWRA 3EA5A 3H2YA 4KGXA 3TLXA 2I9PA 2EJTA 1DB3A 1BMDA 5A4MS 3ZCPA 2JATA 3G8YA 3KYDB 1UWCA 4ZPJA 1CHNA 2ZSDA 2V7UA 4G2TA 1RLJA 3KZMA 1OA1A 3TEJA 2GT1A 5I7UA 2FFRA 4RM3A 1YIDA 5HCNA 4Z1OA 2H1HA 5F2OA 4ECEA 4OPMA 5CA0B 5HM6A 4FWIB 1FJGH 1Y6JA 4RTKA 2W4IA 2H54A 5AW6A 2RGEA 3DAYA 1NW8A 3VI3B 3A05A 4U5QA 1BVHA 4LVUA 4Z7NB 3OTIA 1QC5B 3U2QA 3TJMA 5ALHA 4B7CA 4BXOA 1O5OA 1KF0A 2VQFB 3NYQA 4GU5A 4EUHA 3COJA 2VWGA 4YALA 3HCPA 3PPYA 5JI2E 1Z18A 2G3YA 5LQRA 5JBQA 3FCUB 1RAAA 1T15A 4DOMA 3L43A 3U0VA 4YLYA 2R5WA 3T9BA 1BJTA 3BAAA 2JCBA 5EFOA 5CAEB 4TTJA 3NJRA 4C4PA 5AJYA 3C2QA 2BFOA 1KYWA 5KUTA 4M7WA 2A59A 1TWAA 3IO5A 5CVEA 1M8JA 4B3JA 3I1FA 3HYSA 4HR7A 1U3UA 4XWOA 1VG9B 4NCXA 2PQ0A 3K2BA 1WLYA 3A6HA 2QMQA 4JI1H 4GO1A 3FHCB 5BWLA 1K8QA 4GQBA 4Y9RA 3DEHA 1UOEA 3BHNA 1G8PA 5B5SA 4KR3A 4BS9A 2QN2A 1KKLA 1NF2A 3D3QA 4A36A 4KLRA 5IXJA 3GUCA 1HNNA 2A5YB 1OC4A 3TSZA 4S2UA 4U9HS 4JLPA 1T5OA 1RXVA 3FPFA 2FE4A 2BCEA 4L4RA 4M89A 4MVJP 3K2EA 1E63A 3PKJA 3UHOA 1XJWA 2EG9A 1DP4A 1OWLA 4RAOA 2B2XA 1C9DB 3EPJA 3V42A 2IYEA 5K4AA 4FDUA 2H0RA 3EGXA 2XMPA 4OB6A 2PRIA 2FR0A 1EP2B 4KVGA 3RYCA 1EBBA 2W37A 4YI5A 4DWVA 4BRZA 3AHDA 2M32A 3DMTC 5LZ2A 2HYIC 4UFOA 2EJVA 3JWPA 3RJ9A 3VV3A 3AG5A 5LQDA 3FIUA 3CUWA 3MTIA 3MTGA 1M54A 4YREA 3CH7A 1M2GA 4Z7OB 4PSAA 4QVIA 2G06A 3WWPA 3BIWA 3X2FA 2CNUA 4ZQEA 5EKUA 2C35B 4MRMB 1ICEA 2OUKA 4LW8A 3EVGA 2E4AA 4NZYA 3WHLA 2E21A 4QIWA 3OZ7A 2Z6UA 4CEJB 4JUFA 5KQLA 2HJSA 2R1TB 1JJIA 1ZCJA 2JEIA 2ZJ3A 2DTDA 1J90A 2XGMA 2QA5A 1P8LA 3TF5A 3HKCB 5L3ZA 4M49A 4YP0A 1YBHA 4URHA 3UJ9A 3HDVA 2R2GA 1MIOB 2FEXA 4YY3B 4YYEA 4HGPA 4PIPA 3ZX5A 2G4LA 1ZVMA 5JYEA 2B63G 2ASLA 1NKSA 3TOSA 1FRFS 2WIDA 2JBAB 1Q6YA 1X92A 2IC5A 3MNFA 5LP6C 1QGZA 2XBLA 4CM9A 1R4MA 3A1DA 4K9LA 3GNLA 1EFLA 5EWLB 2W7TA 4XM2A 1Y1RA 2PG3A 2YNMC 5BR1A 2GKOA 4W5QA 4BEBA 1S0UA 4QDTA 1AS3A 5JFGA 4IKOA 1R6TA 1YS1X 3SQMA 3EY4A 2JI4A 2EFDB 1D9ZA 5E6SA 4H7IA 3WGKA 5FPHA 4GD3Q 1E8DA 3EIWA 3DXYA 2IYRA 4PO9A 3C1TA 4JR2A 3KAPA 1NJ6A 2D0PB 5IJXA 3GTQA 2NVUA 4DNOA 4B3HA 4KO2S 4M87A 4CWAA 1ZINA 3QW4B 1BE0A 3KKPA 4Q48A 2P40A 1QF9A 2GWRA 2ZAMA 2X42A 3PFHA 1YS4A 3MTBA 1EFAA 4P54A 2VZ8A 2TRSB 5C1PA 5BYBA 2ISSD 3GPIA 2FPRA 1XP5A 3GQBB 5FFNA 4Q1EA 1UMBA 2F4NA 2NG1A 2IYNA 3FLEA 1AURA 4PQFA 2H9YA 3QU5A 3H20A 1OIVA 3HLTA 3L4JA 3PR4A 1MX1A 4F4JA 4WESA 4L8GA 4BLRA 1MABA 4G8DA 4IO1A 4IR9A 1J8FA 4JBNA 1DTSA 4BNKA 1E3DA 3QNUA 2WUGA 5KYKA 2ZJTA 3TTTA 2AOUA 4YXWD 3H6HA 1EVKA 1ILWA 1E9DA 3PHGA 1G1MA 3EXIB 1QGYA 1T6XA 2XUQA 1BCRB 4F71A 4M0JA 5CLHA 1H2RS 2M6KA 2ET6A 4Q03A 2HBQA 4OMFG 5AFSA 3Q85A 4IIJF 3FNBA 4DCNA 2RB4A 1JE1A 1I01A 4NXMB 4EUNA 2VAXA 1NQAO 1J8QA 1LPSA 1HNWH 3MZ0A 1YE8A 3DT9A 2IP4A 3PI6A 3TLEA 2Y1DA 2HN9A 5JO0A 1HDGO 1V16A 4GMDA 2WR8A 2W2XA 2A5LA 3D9QX 2XQGA 1AV6A 1WNFA 2IEGA 4IXTA 5F64A 2WSSD 1A8IA 1J4AA 2C04A 3DBHA 3G9XA 3T5TA 5LZ8A 1K0UA 4FR2A 5D3ZA 2WMNB 3H2JA 5K8TA 7AT1A 1ZIYA 1JIIA 1L5HB 3H9GA 2OCYC 3G6WA 2ZS9A 4PTZA 3QVGB 3MEQA 1G6KA 2I80A 2X6TA 3UAYA 1V51A 3T7TA 3MWEB 2ECQA 2VZEA 4V1CB 3OKCA 5J47A 3H2HA 3L46A 2BWJA 3IBFA 4OQDA 2X2PA 1X7ZB 3Q9LA 2RGYA 3O8NA 4N0MA 2MMCA 1UPBA 2R8XA 2RG7A 4I3HA 2UZ1B 2YXEA 3BK7A 1SVMA 2X1VA 4XFDA 4KQIA 2NTJA 1Q15A 3RYHB 1XAHA 4YR9A 3ZUGA 4ZVKA 4DR6H 1ZC3A 3LT1A 1FSZA 1PFKA 3GQCA 3S6JA 4A0GA 5BN5A 1SAYA 3LC1O 4MZDA 1V5WA 3CNHA 2XQVA 1LTQA 4WOKA 3MM4A 1SGWA 1USKA 5H1YA 1DADA 1GYPA 2W93A 3QY0A 3K0CA 1SVSA 2AQIA 4LDAA 4TKZA 3FZEA 4QC2A 4E07A 2ORVA 4ZO4A 4BZWA 3OF3A 2Q28A 2KMLA 1CQJA 5EMLA 3RFTA 5K0GA 4TQGA 2B8NA 2BJHA 5CB4F 2VUTA 5KSPA 4F21A 3GEMA 1V4BA 4LSZA 4PQEA 4H7KA 4KC0A 4LFCH 2NSHA 2FQQA 1KU0A 3H1TA 5LQNA 1M6HA 5CDFA 5CCDA 1NQ5A 3NBUA 1UXIA 1PJLA 2COUA 4IJVA 1SXPA 1ZN7A 2QGFA 4RE6A 4JWTA 3WBJA 2PD3A 4P3XA 3WTCA 3H5WA 5J4HA 5A5DA 4BC1A 1W52X 2WYIA 3NBYB 4PYOA 3KWFA 1I8TA 4LWZA 3M5PA 4LTDA 4YV2A 4KXQA 1DX4A 3I53A 4NBNA 4WFKA 2P9YA 1ISRA 1A96A 4XVRA 1HKUA 2BGMA 1RWQA 4M0UA 1S8AA 2HUNA 4F3TA 4AX4A 2BV3A 2B36A 3V2UA 1O0CA 2YHBA 2WFAA 1WB5A 4M1OA 2QN6A 4QWDA 4CCSA 3DV9A 1U7UA 3UCEA 2FLWA 3Q11A 1FDIA 3I3SR 3C6YA 5CDHA 4Y6SA 1DAFA 5CVUA 1WMEA 4DEVA 3I83A 4OYHA 5K3WA 3V34A 2QE6A 2BM8A 3W5UA 4JQSA 4NQZA 3JASB 3ZWDA 2FVXA 1E2IA 5HZGA 4G5QA 2X8JB 1K88A 5KJ1A 3PGJA 4R1NA 1OZHA 2R6ZA 2CDNA 3CMCO 4WNIA 1YDEA 2AZXA 1L4EA 1UFOA 4P0QB 3AEKB 3WXBA 1JLLB 5JAHA 3EG9B 1LX6A 3N86A 5B3JA 2H52A 5DSTA 3RBEA 2Q0XA 4HWTA 1D5WA 4R3WA 1BRMA 2WP8J 2Z2ZA 3OHMA 4CI9A 1UBGA 4E51A 1U4OA 3EVBA 5A7FA 1WR2A 4ESVA 1BIFA 2X9LA 4RNDB 4P2GA 4C88A 1QQAA 5L1JA 1N5MA 5THQA 1YC5A 3U6KA 4INAA 1TJNA 3NDPA 4W5HA 2QVXX 2WU8A 5SYNA 3R0ZA 5KYNA 1S03G 5BSMA 1KDRA 2H85A 5BOVA 5EIHA 3MYRA 3V3TA 3BB1A 2FG5A 3B82A 2FK7A 1II9A 1RWPA 1OREA 4B3BA 1L7PA 2AIRA 3LAWA 1U2SA 3KJZA 1LPPA 4KQ2A 4YJHB 2VAWA 2QK4A 1VJ0A 3DF9A 2XEDA 1E0JA 2HVSA 2HWWA 2JLSA 1B00A 1QQBA 3T99A 2AX3A 2O5CA 2X7HA 1GZDA 2B35A 3OAAA 2ODWA 2ERYA 1AHPA 4UVGA 3WAGA 2X0DA 4CR6A 2GUWA 5AJXA 2J5XA 2VSNA 4NAVA 2ZYIA 1ECBA 3R6GA 3TJRA 3I6MA 3ABQB 2WAQA 2C4MA 1SVNA 1N2IA 1O6ZA 4C4TA 1OLXA 1EFUA 3QUTA 3VGJA 4Z7QB 1DKNA 4ETMA 3E18A 2QD4A 1M7BA 3AILA 3E9EA 3P94A 3GFPA 3RVQA 3MMNA 2C3YA 3DVAA 4A0SA 4FTWA 3TFQA 4NBLA 3D3EA 3SXUB 5JSZB 3ACCA 2E9SA 4W5RA 2IYVA 2YOGA 5ALQA 5CTJA 1C1DA 1G2QA 4B40A 3WGZA 2B5WA 3TNDA 1N7IA 2VK1A 2P9TA 4J07A 4JYAB 1PR0A 4BEVA 1T4CB 3PD1A 1UBSB 4HYYA 2R5NA 1E4FT 2J3DA 3KKZA 5JI3E 1NONA 3CZRA 3C3MA 4CG0A 2B37A 4J9OA 4PC6A 2WIJA 1P4AA 2ZUFA 3PD0A 3E9CA 3B1JA 1RZ3A 4HK4A 2OCGA 3IQIX 2ONKA 3GT7A 1CY2A 4JI8H 2O0LA 1WKCA 5ERXA 4EF5A 3KYIB 3T7CA 4RH0A 5BWNA 3P71T 4N03A 1BXRB 3AG6A 3IP8A 2CNNA 1CP2A 2QVZX 1T0PA 2FR1A 4NHEA 1SCNE 3E9DA 2H65A 2G83A 2HCFA 3AFHA 3ZQ4A 5KPJA 2WNIA 1GRCA 1R1DA 1E2HA 2G71A 3BWYA 3I2FA 5JECA 4AIIA 4II3A 4X91A 5DP1A 5IVDA 3UXMA 1N48A 2H4JA 2POCA 1BKDR 2WYHA 5EPUA 2QRUA 3D0KA 1R8YA 2CDAA 4LDQA 1A5TA 1QZTA 1T8SA 4OJYA 4KQGA 3NBQA 1JRLA 3E22B 2PKYX 2TMKA 2NXWA 4FC6A 1JLMA 1KMHB 4U0KA 1S9FA 1JEYA 2YNMD 2ZIGA 3UAOA 1YO6A 3N05A 1XRLA 2H00A 3CH6A 4GUDA 1VLJA 4R05A 4B87A 2OMKA 3ENQA 4NYJQ 3TLMA 2KS6A 1CUJA 1VL6A 5KKNB 4CIYA 1TVEA 3RTCA 1RQRA 1I2DA 1TC1A 1UXGA 3ROZA 4WEOA 4AZSA 4GZLA 4ERNA 1DRJA 1GCGA 2J6SA 4ECRA 4FHCA 1ZJWA 4EOGA 2C5BA 5C5IA 2XZDA 3IEXA 3NUZA 3BOSA 5F98A 4W63A 3HJTA 4WLOA 5M7EA 4FMDF 3W5DA 3KUXA 3U6BA 4BMXA 3EOBI 2ZSKA 2GVNA 4MV7A 3UAGA 4PR3A 4Q7EA 4EW6A 5JAMA 3JQ9A 3MINB 5DLQC 3ETHA 2L69A 1WCIB 3KKEA 1B2RA 3O47A 5JIBA 1G291 1YK0A 1JTFA 6YASA 1KYYA 1U2DC 2VOJA 4YRDA 1L8AA 3C6MA 4CM7A 3OZUA 3OM0A 4F8JA 1B0PA 2ZM6H 1Z28A 2FPKA 2CLOB 3TK1A 4E46A 2W6JA 3AFMA 4BE4A 5BSHA 4XCVA 3G7NA 2Q5LA 3EXEA 3ZHQA 4ECXA 1EKFA 2XUOA 1ZIDA 3EAFA 4TT8A 1ZH0A 2HX1A 3R9KA 3HCNA 3OHPA 2H4XA 2D2EA 2FETA 1Q1GA 1L7VC 3QU4A 4OB7A 2BM0A 5FBKA 3D6TB 3K1AA 3U60B 5LOVA 4IFEA 4RFLA 1B1AA 1WL8A 1T3ZA 3O4VA 4AB1A 1KE2A 3UFBA 1A8PA 4WNYA 3CBGA 4PNHA 2I7TA 1SQSA 5LQSA 4Z4GA 5KYYB 4X7MA 1I1MA 2NVWA 1KE1A 2OOKA 4YCBA 1KP2A 1PFGA 3DDHA 4LSGA 4GQAA 4YACA 1I4EB 5BW4A 2Q1WA 5DYGA 4RJTA 5F9MA 3CSUA 4L50A 3OC6A 4JYPA 1Y4SA 3OY7A 3P4XA 2FWBA 1O96A 2VTDA 1C7RA 2A5GA 3G6XA 2QG9A 3IBYA 5BY2A 2OVFA 2P3OA 1N7HA 2RH4A 3CNEA 3ZZ0A 4OYRA 2IYUA 3R4VA 1H2BA 4DUYH 2G7ZA 3BTOA 4OHFA 1PJSA 3DAFA 1XCGB 4E5MA 3EWIA 4ZOCA 2CNQA 2AXPA 3EFBA 4OFZA 3SIPA 3B6EA 1KO8A 3K0BA 2FDRA 4LSXA 4YRLA 1HE8B 4I8IA 3FA2A 3A6PC 4FHEA 5IHPA 3H83A 2CJXA 3EZFA 4IH9A 1XA3A 1ZN9A 2FK3A 4IRCA 1XNRB 3TB4A 3FNEA 3QVKA 2VH1A 5AKHA 1Q0TA 1FVFA 1T1IA 2E37A 3NH6A 4UEJA 4TLDA 1X87A 2PQ2A 5DNWA 3O8RA 2WLTA 3UV6A 5C4MA 1DAMA 4BIMA 3L0IB 1LPOA 2DPYA 1UF9A 4YAJA 5LKRA 3MCAA 2IH4A 1ZJYA 2WJWA 4R40A 3GU3A 1IAVA 3B3GA 3GGSA 4R2KA 1AMNA 3GZNB 1XLVA 3PQ7A 4DL2A 1LBIA 1Y4UA 4U39A 4XXHA 4NYJR 1SKMA 1U9YA 1UK9A 2MTBA 5C8YA 1M1YB 1XEWY 1PNTA 3GLQA 3ROQA 2OCDA 2CGEA 4AYXA 3QV1A 2IQIA 5IJ9A 5KREA 1ZH4A 2VZ9A 4GNKA 2R1ZA 3LX4A 4DLTA 2Q2QA 3KKLA 5K3FA 5FFFA 3DEYX 3PDWA 1UOPA 3QPBA 3WQHA 2QN7A 4KQ1A 5KFQA 3N42B 1YBVA 4NULA 2INGX 1H6DA 3OCVA 4TTVA 1VPLA 2NXEA 2VCHA 4PC2A 3OSNA 3VAZA 4BLUA 1UH5A 4BCBA 2YV4A 1B93A 4OUKX 1I36A 3KQYA 1RJ9B 5CW2A 4WAUA 3EN0A 2OR3A 1DAPA 3NV7A 4Y0NA 1K3TA 3ESCA 1HXHA 3PSHA 1JHVA 3G2KA 4YMUA 3FMOB 5TGDA 1C4OA 3NHFA 1AKEA 3DZIA 3NALA 2WUVA 1KEUA 3DPSA 3NWPA 4F12A 4PPNA 2NV2B 2OSBA 1DDOA 5KYWB 3D6JA 1L8OA 1SCBA 3LE8A 3PWKA 4EKEA 4JXUA 3G2HA 4I81A 3TPZA 1OX4B 4EH1A 4KAFA 3UHPA 4ZK2A 1AN9A 2V6MA 1T94A 3T5LA 1NI4B 3R3UA 3S81A 4U7DA 4WJLA 1EK1A 5C4IA 2BDEA 1OBDA 1NJSA 1KZHA 2QN8A 2ZXUA 3QPVA 4WCFA 2WYVA 2X0FA 1P75A 3RRXA 3DFFA 4Q02A 2ZJ4A 4ARIA 2CNWD 2PNFA 2FRDC 1Z0DA 2NUAB 1D2HA 1KYVA 1JPVA 4L7QA 4JLOA 4US1R 1XMSA 3H42B 3VSBA 1YDGA 1CY7A 1EIZA 2CW5A 3QWFA 2E7ZA 1NVEA 1R64A 1YRYE 3GPLA 1XDWA 4B6RA 3LRPA 2HIMA 3GFTA 3JY6A 3SEQA 1HYGA 4NK4A 1QKIA 4QWBA 1B33N 3BJYA 4II2A 2BJVA 4V03A 1JKXA 3IKTA 3PDIB 3RYFB 1V11B 2C2OA 1V95A 5EZYA 3CM0A 5EJFA 3HU2A 4MVXA 4L3OA 1Z08A 1JLSA 1YZQA 2DR2A 3SDZA 3ADDA 3IXQA 2BI7A 3GUVA 4JMPA 3W3AH 4JS0A 3DVLA 1M6YA 3OSZA 2IYFA 1QSGA 4J16A 3IMGA 4OI0A 3OIYA 2XWPA 3OKPA 3Q0EA 1WY5A 2QLLA 2G4CA 4OI2A 1OFUX 3W8FA 3MWLA 2QAIA 5LZ4A 3MFIA 3MR6A 2GCOA 1M8KA 5AK0A 1QGUA 1CUZA 3W1WA 5IULC 2BGGA 4UCFA 1WOYA 5KT6A 2QV0A 3NHAA 4P7GA 4PLFA 3SBEA 1E79D 3O1IC 4L5JA 4TV8F 1Q21A 1WF6A 3DTVB 2C2BA 1EGHA 1FP2A 3LO5A 4N5DA 3AKCA 1FUIA 1MCZA 4L9WA 1GTVA 2ZJ8A 3WNDA 4JGIA 4MWTA 1VB5A 2Y66A 1H0SA 3CF4A 4FW9A 5JYBA 4JH0A 2QXYA 3M82A 4XD7A 2XNDA 4NE7A 4BNYA 1V41E 1KYZA 1Z2AA 1Z83A 2DUWA 4Q7LA 1JWLA 1NSYA 3OTOB 3IMEA 4K88A 5A5EA 2DBVO 2OP0A 4IGEA 1O9HA 3ITDA 3DXZA 4GL4A 5EZ5A 2YVUA 1MJHA 2O7NA 1X94A 4UUOA 1JG1A 4ZCMA 3QJYA 3I8SA 8ATCA 4EYHB 1OWNA 2V7VA 2PX4A 2FV8A 3F47A 3QMVA 3WYFA 4MUHA 2C58A 4O3FA 1TYBE 4FP9A 4DEXA 2ZPUA 1XEAA 1ZHFA 4GSLA 4PXAA 1VIAA 1X7DA 2C0PA 2AYXA 3F96A 3CEBA 4CIBA 2O2ZA 1X74A 3H65A 3GAMA 3S8EA 3D4PA 1IBLH 3ZWNA 4LF5B 1CUYA 2SNIE 4ZHSA 1V37A 4X24A 2WTXA 5AM4A 4YLGA 1XQVA 4MA0A 1XRJA 4OM8A 1HZJA 3EISA 3N7TA 2EXXA 4BX9A 4KAJA 3RK4A 4XJSA 1WPGA 2YQZA 2KWIA 4EG7A 1OV4A 3GPBA 5A4DA 2H6EA 2J0QA 3E5NA 5KCMA 3PEYA 5IWAB 3KYHC 1Z8FA 3F5FA 5DP2A 2QSZA 3EQ9A 4L2IA 1E1KA 3N58A 2Q2TA 3O3CA 2PUTA 1KIAA 2F43B 2PUHA 5HQJA 3CZMA 2EGHA 2D7JA 3O90A 1I7DA 3M6IA 4C87A 5GJVC 2F1RA 2XUGA 3RTDA 3D1VA 2DULA 3DLBA 4F2PA 4TUYB 4DMGA