2XCLA

Nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
421
structure length
421
Chain Sequence
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
publication title Nucleotide-Bound Structures of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase
rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 113
structure length 421
sequence length 421
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2xclA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2xclA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xclA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2xclA04
3SE7A 3BFPA 2YZMA 1EUDB 1OBGA 5LP6F 3U9TA 1EYZA 4IWYA 3K5HA 2XCLA 4J6EA 4Y8VB 5BPFA 2XD4A 1WR2A 3TQTA 4MAMA 4YB8B 1OBDA 4MA0A 2DLNA 3GIDA 3VA7A 2PN1A 3GLKA 1KEEA 3ORRA 2P0AA 4YBZB 5JQGF 1CQIB 1JKJB 3WNZA 3E5NA 1KJIA 5BMVF 2IP4A 2CQYA 4M9CA 2R7MA 2PBZA 3U55A 4TV8F 2W6ZA 3KALA 3DF7A 3WO0A 4TV9F 5HV6A 3BG5A 1KC7A 2YWVA 4M9UA 1EZ1A 1Z2PX 1KJJA 4YAJB 2V58A 2W6NA 5D8DA 5GONF 3AW8A 4O7WA 2VHEA 1I7LA 1SCUB 3BSYA 2I8CA 2QF7A 3N8DA 3AX6A 3LP8A 1CS0A 3VMMA 1I7NA 1GGOA 5DMXA 4HNVA 4C5AA 4WBNF 3UFXB 4E4TA 4IHJF 3QFFA 3MWDA 4O7TA 5JQWA 3RV3A 4O84A 2CNQA 2R7KA 4FFPA 3BSSA 3U54A 4XYMB 4FFNA 3KAJA 2DIKA 4FGRA 3OUUA 1GSHA 4O4IF 5CB4F 4O2BF 4YJ3F 4C5CA 3G8DA 3TINA 1C3OA 1T36A 2I87A 2YZGA 1JDBB 4NYEA 2ZDGA 5JVDF 1AUVA 3VPBA 3HBLA 2ZDHA 1M0WA 4EABA 1M6VA 4I55F 1DV1A 3V4ZA 4M98A 3R5FA 2YYAA 5J2UF 5LOVF 3VPDA 4O7YA 1GSAA 1PX2A 1AUXA 2NU7B 2J9GA 2CNVA 3TW6A 5JVLA 5CAEB 4MV3A 2YW2A 2VQDA 3R9RA 4EA9A 1Z2OX 1EHIA 3HO8A 2R85A 2VPQA 5KX5F 4FE2A 2C00A 5FNVF 2YZLA 4O7NA 4XYLB 4O4HF 4QSHA 3WO1A 2Z04A 4YAKB 1E4EA 4EGQA 3N6RA 5HBRB 5C8YF 2VR1A 4HNTA 2NPOA 4EA8A 2CNUA 5JH7F 2QK4A 2YS7A 4EA7A 2NUAB 2FPGB 4MV7A 1GLVA 2ZDQA 1C30A 3R23A 3ETJA 1GSOA 4O86A 5C1OA 1CQJB 4MV6A 4ZI7F 1KUTA 2PVPA 2R82A 2GPSA 4IWXA 2DWCA 2W70A 2R84A 3JRXA 1UC8A 5CA0F 1IOVA 4O7LA 5H80A 1KJQA 2YRXA 1JLLB 2Z02A 1VBGA 4ZQIA 3Q1KA 4MV9A 2HGSA 2GPWA 5LXTF 4M99A 4EAAA 4RZQA 3RFCA 4FFOA 4EGJA 2R87A 1KBLA 4FU0A 4WD3A 4O7ZA 4C5BA 4YJ2F 2FB9A 2GLTA 3HB9A 5CA1F 4O4JF 2R6FA 2GQSA 4DLKA 4DIMA 1IOWA 2WYOA 3TIIA 3ETHA 4IZOA 5EZYF 2GQRA 1KJ8A 3OUZA 4IIJF 2YRWA 4I4TF 1M0TA 3VOTA 3NUAA 4FFMA 3KREA 5K2MA 4MV1A 2NU6B 1Z2NX 2FP4B 3JZIA 2X0SA 1DIKA 1EUCB 2YZNA 1KJ9A 3R5XA 1DV2A 2R7NA 2I80A 5J2TF 4MV4A 1A48A 2NU8B 4HR7A 3RUPA 3U9SA 2W71A 4FFLA 3JRWA 3KAKA 4O4LF 5LA6F 1CE8A 4EG0A 4TUYF 1ULZA 3K3PA 4HNUA 2FPPB 4HQ6A 2W6PA 2FPIB 1E4EB 3LWBA 2YL2A 4GGMX 4XZ3B 1BNCA 2W6QA 4FFRA 2V5AA 1UC9A 4L1KA 3JZFA 4MV8A 4XX0B 1VKZA 4ZHQF 2OLSA 2W6OA 3I12A 2R7LA 4O81A 3TIGA 3Q2OA 3VPCA 4I50F 4O7VA 1B6RA 5LYJF 1JDEA 4ZOLF 4O82A 2NU9B 2CZGA 4ME6A 1PK8A 5I47A 1W96A 3ORQA 2HJWA 2W6MA 4O7RA 5IYZF 1W93A 2V59A 3MWEA 2YS6A 1BXRA 5C1PA 2DZDA 4MA5A 1A9XA 3G8CA 5KKNB 2SCUB 3MJFA 4O2AF 2R86A 3RV4A 4O83A 4O7SA 5BPHA 3BSWA 1VBHA 3R5HA 1B6SA 3V4SA 3K5IA
chains in the Genus database with same CATH superfamily
3NOVA 5FOTA 1E1YA 2ZS9A 1Y3BE 4IKEA 2BEWB 2VYFA 1NQXA 3KRTA 3MT8A 3KM0A 4XVQA 3C6ZA 1IMOA 1DKUA 3IMEA 1JWAB 3QVGB 2DBRA 5JNWA 4LTMA 3HCCA 1PGOA 1DFIA 4KWTA 5JSFA 5IAOA 1QYDA 1N9ZA 2V7VA 3TB6A 3SIPA 4O3QA 4F50A 5HPYB 4H60A 5BRJA 1RP1A 1EESA 1UWCA 1GP2A 1QTNA 4IEFB 4BY9E 1C9MA 1FDTA 1C14A 2R68A 2HN9A 6YASA 3H4BA 4UCSA 3WO0A 1HQDA 1MAHA 2ZSUA 4P54A 3RVJA 1L4FA 3AIKA 3JWIA 1HUQA 4MCAA 3M33A 2QYTA 2N0SA 3L8HA 1LD3A 3W05A 2VNSA 4M9UA 4IH9A 4JOCA 3N74A 6LDHA 2OAEA 4WFIA 5FD5A 2ZYAA 4XWGA 2V7QA 3GRKA 3PT9A 1S7GA 3FTCA 2IEDA 2O5RA 2XUJA 1S2DA 4J9NA 3MBOA 2PRJA 4EP1A 1U63A 5DM4A 3L4BA 1ZI8A 1DRUA 3FGZA 1NUPA 1PWXA 3UFXB 3AFMA 4O7TA 2ZJ3A 3BFXA 2A0XA 1TD1A 2W2MA 2HJVA 3DG9A 1X3LA 2IHNA 4QYWA 5A71A 2QUZA 3ZY2A 2QGZA 2FK8A 1KPGA 2YWFA 2AGQA 2OCGA 4PQEA 1HY3A 4JEHA 4G0ZA 1QXSA 4YRGA 3TXAA 1XMSA 1XZEA 1M0WA 3GMSA 2YYAA 2B0CA 1T5DX 3PDHA 4GOKA 4XLZA 4RVUA 5EZ6B 2PGDA 1OH5A 1EVEA 3LA8A 1G9SA 2X9QA 3BAFA 5ITVA 2ZBEA 2I71A 4RK0A 2FWPA 4X54A 3ANYB 4FOPA 4TZTA 4CR6A 1L7PA 3SHWA 1LW6E 4YACA 5BW6B 2W2NA 2O57A 1D6JA 5B2EA 2GBGA 4GRIA 3TEMA 3O82A 4G0QA 5D84A 2FCRA 2BL4A 5HS4A 4GLJA 1QG4A 3NAQA 2F4NA 2IHZA 2Y76A 4EVSA 1I24A 3MM4A 4G5SA 1DKNA 1X87A 3EXIB 2P79A 5EKSA 1PJ2A 4P0TA 2P77A 4NATA 4TTIA 2B5OA 3W6ZA 3R3WA 2GO7A 1YQWA 1JLLB 5K4GA 3RRXA 2J3JA 1O8BA 5K8LA 3BUSA 2B7LA 4DAOA 4Y9DA 4NULA 4TQUS 2RHDA 3P9IA 2QTWB 1U2DA 5LMUB 3A6FA 5JJ5A 3MTQA 4QYIB 2WVAA 3CJTA 5KMGA 3LY9A 1FDUA 3LA6A 4H0FA 3WAGA 4U7FA 3AG5A 5SV2A 5F35A 3N2YA 3NUAA 5ALNA 1JEJA 4AF7A 1B3BA 5C37A 1QVZA 4RKEA 3DMHA 7REQA 5K51A 1YQUA 4H15A 2QP3A 3QELB 3NTXA 1JDBC 1GTSA 1XSEA 3NP7A 1A9RA 3BF7A 3L4EA 3K3PA 3SYMA 3ZCXA 3PHJA 5LL6b 3LUFA 2I7VA 1I0LA 4M8SA 5CDFA 1NQOA 4IQGA 4ZCIA 1B8PA 4W5JA 4MYHA 1IULA 2OLSA 4XRGA 3PDUA 2PYZA 5EZYA 2NUAA 1M5TA 1PAUA 2CW5A 4QRDA 3IMFA 3OWOA 3WAJA 4IMPA 3LX6A 3TZBA 3T9DA 1AKRA 3D7SA 2WICA 5ERYA 1D9XA 4KJZA 1ZRSA 3A9SA 2FRVA 1OOEA 5FEUA 5G4LA 2ODWA 3QBVA 1JFLA 4GKJB 1A2OA 4S1OA 4I1UA 3AFOA 3NDPA 4Y7CA 2ZAOA 2NADA 4ZV4A 1LUAA 2CNOA 1WUIS 1LX6A 2MT9A 1GGEA 1RT9A 4GYJA 2JA8G 1LV8A 3IJPA 3GNQA 1V43A 4MIYA 1YS6A 5K0CA 5FD8A 2J0QA 2IYQA 4HVAA 3WV5A 4BVFA 1KO7A 5FNZA 4UCRA 5JSYA 1XCLA 2CYAA 2HK7A 2IF2A 3T1HB 1NAHA 2ZTHA 1VSQA 4LCJA 5AMXA 3SZOA 3EFBA 3HKDA 1FU7A 3MPUA 4GR5A 4IH4A 4MOWA 3ADBA 4C0HA 5IKEA 2XXJA 2XX3A 4NZ9A 9MHTA 3B3FA 4PFQA 5LKAA 3U6KA 5CLLA 4Q4JA 3VZDA 1VFPA 1R8XA 4RTMA 2HIVA 4ZYVA 3W3AD 5I5GA 2I7XA 2YUIA 5IG2A 1FPQA 4YUYA 4HDSA 4JX8A 3E0XA 4DY4A 1JR3A 3REOA 2VDOB 2ZYTX 5AHXA 2BFFB 1OKKA 5J5AA 3ULKA 1SUBA 5F73A 3OZAA 4C4YA 1Y1SA 5LU9A 4WUTA 3RC8A 4RYLA 3LVBA 2ZFUA 2WP0A 3IDSA 4LSWA 2Q3FA 1T3LA 4YGYA 1FDIA 2H1LA 4IFBA 3PUWA 1T1GA 1PZGA 2FKAA 3AU8A 1SQSA 4ZJZA 1UEXC 3CRRA 2I8LA 1HNZB 4FNMA 3C97A 3TCNA 1PTKA 4ZHQA 4ZAFA 3CYFA 2HBQA 5AVZA 2WHRA 1UKYA 3ZDDA 4NNPA 1W76A 4JUFA 1OIXA 2IPMA 3NP9A 1XP8A 4MWCA 1M7JA 4K5QA 4B48A 3L4SO 5DRYA 2J6UA 4OI0A 5L40A 5C5DA 2C4TA 4AROA 3PPYA 3R9RA 4XAQA 3JD0A 2RGEA 4WXHA 1YRHA 1I4WA 4XUCA 4RB3C 1IM2A 4CKCA 4H6XA 4L3OA 1R1DA 1MABB 1A8QA 2E89A 4H1HA 2RJNA 4Z4HA 2C82A 4QUIA 4FMPA 1QHGA 5KNCA 1CQJB 1EGHA 4U39A 1NXSA 3KXKA 3TQIA 2W4IA 2QD3A 5J9FA 4WWHA 4UCOA 1MC1A 1KORA 2VT3A 3WKBA 3OKFA 3QK7A 3ZS8A 2WIKA 2ZI5A 3IP9A 4O59O 1N32H 3AYZB 1Q2XA 2GA8A 3T3MB 1TWHA 1OI3A 1V5WA 2XKAA 3D1VA 4RQUA 3QMVA 2IHJA 1GZHB 3MB5A 3RS8A 2DAPA 4LYFA 1FSFA 5A1JA 4I4IA 2HRQA 2CCKA 2HF2A 4B4KA 1W0JA 4A2CA 3FOEC 2C61A 2CV1A 4Y2QA 1D9ZA 3DXXA 3N2IA 1R5NA 2BEUA 3WLRA 2E49A 3PXEA 4QOHA 4DUGD 3C1OA 2WAQE 5FAXA 2VDUE 1DX4A 3M1LA 5BSRA 1A5BB 3RUEA 2YQZA 4CQMA 1IVSA 3NIFB 4IMJB 1ZIXA 2PVCA 2QL9A 1NWCA 3HPRA 2W6PA 5I8WA 3NHBA 1YJCA 1Q3KA 1QE3A 1II8B 1EUQA 4AJLA 3D1LA 3PR3A 1JH8A 4MR7B 4YC7A 3QEKA 3ZTWA 4CNQA 2OXEA 4BY7G 3GN2A 2P1ZA 1EM8A 3I9V6 2ZSBA 1G0NA 4ENTA 2BFEA 4LY0A 2R8XA 4TQRA 4ZT7A 3THYB 4GC5A 1O94C 4KGZA 1GFIA 4HVTA 4O2AF 2VL7A 3RV4A 4O7SA 5IDYA 1BWPA 1MX9A 4CVNA 1F9EA 3TD6A 3K5IA 2PSFA 3L4BC 1CY4A 2ZRKA 3GFOA 2B92A 2QG6A 3WWIA 1TZ2A 1GAEO 3ENWA 3MTEA 3CS3A 3MGBA 1TAGA 4BLWA 2FSUA 4F86A 4J6EA 4N5DA 2VF2A 4Y8VB 1SC1A 2B7BA 1WR2A 3H6HA 2O3JA 3H1GA 2WWYA 1XT6A 3CEBA 4LXXA 3OIDA 3QQMA 1J25A 2JF0A 4EKYA 4WZBB 3FCYA 1NIJA 4EF5A 3PYXA 4YJGB 3ABSB 2C94A 2PX6A 5K4HA 4UUGA 5KNDD 3GGPA 2VHVA 3NJRA 3GJZA 4ZT3A 2P68A 1RWQA 4WCVA 5LP6B 1CBUA 1JZQA 4DBLC 2W8ZA 1KQNA 4G1EB 4REQB 5EUQB 2I4LA 1XMPA 3FDXA 4L8WB 5H02A 3BBLA 5EP1A 3UMFA 2GF9A 5GVSA 2HMSA 4TX1A 1V47A 2HAEA 3BA6A 3RYFB 3B5IA 1KMHB 1TJNA 1YVDA 3RD5A 421PA 4FGLA 1WMSA 1OXSC 3RNLA 1OXVA 2QV0A 1MFPA 2VYCA 4YUZA 4WRRA 4ZN6A 1BTOA 1LLCA 2WJGA 3PJDA 3GCXA 1EBFA 2ZRLA 4BEVA 4N6OA 2DERA 3ZYCA 3MXOA 3V42A 4GUAA 1FFDA 2XNKA 1A8HA 3IESA 1GZUA 1KY4A 5B1HA 5CT9A 2PV7A 4FILA 1WXGA 1N92A 4KIFA 4D5GA 3AF4A 4GE0A 3OBBA 4ARBA 3HGMA 4X3OA 4RVGA 2KYRA 2V97A 5T6MA 1N5DA 1EZ4A 3QWAA 2FEXA 1BX0A 2VSOA 1IYEA 2V54A 1H4SA 1P1BA 2YZLA 3GCZA 1QTIA 2AG8A 4FZ5A 4CCSA 4ABYA 2PUGA 2I4MA 2B6HA 5E0OA 2P9HA 4DV4H 1KI9A 1VLHA 1W85A 4Q4LA 3MOGA 2YNMA 4CMGA 2AW5A 4X45A 2FFBA 2WM2A 4QJ5A 1SBQA 4P92A 1T2DA 1OFTA 4FMDB 1AS3A 1QRSA 5KYUB 4ZA2A 2ZYUX 4NI5A 3ML1A 2DTXA 2C4KA 4AMGA 2G77B 3OF3A 4JJ4A 2Z9CA 1KF0A 3T38A 2O06A 4BBJA 3HWRA 4KGXA 2WY2D 3F8TA 1IBLB 4JROA 1VKHA 3JYPA 3CM0A 3JQAB 4W4TA 2YYZA 5C1IA 5IT5A 4YT8A 3Q9UA 3O1LA 1P31A 2ZB8A 2XMCA 3KPJA 1I4TD 5LM3A 2DKNA 3G68A 4X64H 1U2QA 4HWRA 4J1QA 4UUNA 3D59A 5CB6A 2P2SA 3IAXA 2EJVA 2QW0X 1E1QA 5K45A 4M1ZA 4C7VA 1GRNA 3OEYA 3IOCA 5EGNA 6REQA 3QF4A 4QKQA 2F43A 4J0HA 5HILA 3ZDZB 2O8FA 1WO8A 1XQVA 4HFMA 1KERA 3ZDCA 1OXMA 4EW6A 3BJIC 1ZZGA 3N2EA 4DJ5X 4P83A 4GPTA 3IIMA 2AYYA 1OJ7A 5TEWA 4DR7H 5CPFA 2OP0A 1RXIA 4PYKA 4FHEA 3H9CA 1N2HA 2N46A 4HB3A 2SBTA 2PX2A 3DPUA 2HKIA 2R6JA 3ETDA 1S3FA 3SS9X 1WSCA 3DMDA 4DDUA 5J4LA 3A32A 2UZ1A 4NBSA 5LMNH 3TOCA 2WFZA 1UQRA 3X1MA 1EX6A 3DZHA 3S44A 2P75A 2PMWB 2WSYB 1YKSA 1L5GB 4AK9A 1ULTA 5NULA 4JLMA 2ZU0C 1U9IA 1YQGA 2OFPA 1D03A 3AJEA 2WWRA 2VXBA 3ZJTA 3OZWA 1ET0A 2UKDA 3RT1A 2R92A 3AFIA 4DOMA 4PLYA 5JS7A 1N8NA 4L9RA 1R0RE 1RRFA 3BIXA 4DJDC 3FMPB 3U13A 1X2BA 2EP7A 4Z7QB 2FLPA 3TXXA 3UHPA 3V7FA 1L7QA 1S2IA 2JK1A 4QYMA 1O5TA 2QGFA 4F4XA 2IXAA 4YT2A 1SXJC 4IRXA 3QVMA 4RC9A 2O8EA 4HEA6 5DM70 2C3UA 2F55A 1M3SA 2H92A 3PFFA 1GA1A 4UHBA 2ZIGA 4FS8A 1XTVA 1RAAA 3SEQA 3CVWA 4YDRA 2C35B 3V2GA 2ZYVX 3O91A 2ZWAA 3SLKA 4YV1A 3GWGA 3AVPA 1W34A 3I2JA 5CJ2A 4F5ZA 1QM5A 1GYPA 1YJ8A 2GFQA 3HBAA 3A8TA 3EH2A 4YT5A 2EC5A 4HLNA 7MDHA 5K0LA 4CM7A 4JQCA 2PZLA 1CJBA 4CKEB 1TPYA 1GZ3A 3LJKA 2XW6A 3H0GA 1YZFA 2Y1DA 4BTVA 4DMMA 3UMBA 3X44A 1SCNE 1XDBA 1ZR2A 3HHPA 1JU9A 4R1UA 3K0CA 2F1KA 2G1KA 3FHTA 1KVSA 4UCTA 2ZBUA 3OIUA 2X1LA 2JA6G 1QHFA 5KEIA 3RAQA 4U2FA 4CLHA 1FQKA 2OFOA 4FR2A 3BXGA 4ZT5A 4PIPA 5KWVA 2DHQA 1L9XA 4Y1EA 2Y3IA 7MHTA 2JBAB 1L5RA 4P35A 2OG1A 3N3BC 3P2OA 1J6UA 5HKOA 1EFHA 4EPRA 5JLAA 1G5TA 3OUTA 4FQ8A 1KAHA 1DLIA 4V02A 2PJZA 1CT9A 3WFZA 3TQRA 2OORC 1BFDA 4AKIA 1IB6A 3MUNA 3E3MA 1NQAO 4Q3KA 1K83A 1YRYE 4L8LA 1ECJA 1AQLA 1VL2A 2DPMA 1Q12A 3V9PA 2FQWA 4FN4A 2YIMA 1TMGE 1MD9A 5IT9A 5EMNA 3Q7RA 2EZ9A 3VHXB 3FCOA 1PW5A 5HFNA 1SC6A 1O6GA 5KYVA 3OCVA 3ZHUA 2H9YA 4KKXB 5BWMA 1Q0HA 3FD8A 3UAXA 3E1GA 1ORTA 4I81A 3OQOA 2BMAA 1D2CA 2EOAA 5E9WA 1QIGA 2PBFA 3AHDA 2AJDA 4AY5A 3Q7SA 1P29A 4UQPA 3RSZA 2JGDB 4CMIA 4I5EA 3E7XA 4ACBA 4K46A 5J3JA 3MJHA 3KTDA 4ND8B 3HFGA 3T5MA 1W4BA 3PDJA 4HX9A 4KN9S 1KE1A 2J5RA 2PUBA 3TO5A 3IHTA 4O3FA 1TMOA 3VDMA 2FDXA 5BRAA 2H2IA 2X1HA 4TMYA 3D6NB 5JZ9A 3GW8A 2A92A 3W2FA 4OKNA 4B6SA 3Q7PA 3Q15C 4JP1A 5THKA 4ZU1X 1H65A 1IRXA 3EIQA 4U2CA 2FRXA 2G7ZA 3FWKA 4LSZA 1U3WA 1A98A 5FWAA 5B1IA 3GV7B 5CA1B 1XZGA 5ALEA 3SZMA 2H1CA 3Q7QA 4C0KA 1XNHA 4B73A 3DE7X 5JD5A 1CUXA 1IBKH 4LYEA 4H7DA 4G1VA 4OTZA 4LF8B 2AMFA 3R9WA 3FB4A 1YZUA 3VC2A 1PP4A 4XASA 4GZ5A 5DEIA 2Q5QA 1JPVA 2Z8ZA 1ZAUA 1OIVA 2H1WA 2IDZA 1JHXA 4GI5A 3FSEA 1XTQA 4MKHA 4WT7A 1TCAA 4PZAA 4BMOB 5BMVB 1CRZA 3A0UA 1YA4A 2OHFA 3DC2A 3HKBA 3AMVA 3TB4A 3E2MA 2VCEA 4O1HA 3U7HB 3U1TA 3LX8A 1U8CB 2XRYA 4LZZA 4F1WA 1A9YA 1SJ9A 1LLDA 3OQ1A 2GWRA 2F8LA 4M1YA 5E3HA 2CXTA 3H4DA 2J5BA 5CIYA 3F2IA 1R0ZA 2ZJ6A 5K8TA 3LLSA 2HRCA 3RBAA 2QRPA 4V0NA 3FR7A 2O4CA 4LBWA 4DSTA 4FYIA 3MXTA 1XB2A 1TF5A 5DQIA 1XRJA 5JQGF 2C2DA 1ZESA 2C07A 1JEQB 2HYDA 3K1JA 4EYQA 2CF5A 3Q2IA 2CFIA 3K0EA 3EFHA 3NNNA 3ZVMA 2WF8A 4MQ6A 4BZPA 5B30A 4UU7A 5ALMA 2HCRA 2WD7B 1ATZA 2NVXA 3U7EB 1Z4MA 5DNWA 2FMHA 4OP3A 2G9UA 1HT0A 2ZS7A 1VE7A 3ZK7A 1YTLA 2I8CA 5TIIA 3CCFA 2HGWA 2JNWA 4EMSA 4B17A 3VU9B 2WSBA 3GDHA 2V4RA 4HYEA 2QAGC 2P2DA 2DH6A 2NUPB 3SC4A 1QHHB 4P3PA 1HTWA 2Q9BA 3CBQA 4J9PA 2KHZA 4N49A 1QCDA 1CJCA 2J1LA 2FN3A 3N7UA 1L6IA 1NJ8A 1E0DA 3TLAA 4M1SA 1M1UA 3QI2A 4DYHA 1N6KA 1AX9A 3FTFA 5T57A 3U4MA 1UFRA 2QN2A 1GFSA 4EABA 3PX7A 4PCVA 4FDVA 2H11A 3NT4A 3DMTC 3ZXSA 3WWZA 4H1UA 2P8SA 4JX9A 3DPIA 1AA9A 3UAOA 1JMKC 4AZWA 3UB4A 1J9ZA 1VPDA 5B53A 4PGGA 4K88A 5JOQA 3NEPX 4R54A 4YCCA 4FZ3A 2R7ZA 2WKRA 2CBXA 3QU7A 1V9SA 4RESA 4J3JA 1CIJA 3GROA 2CKZB 3RVQA 3H11A 5DULA 3LK7A 4PCUA 3PBKA 3W2TA 2VP6A 1NW7A 3IVGA 3DL2A 5KSPA 2BH2A 1WZIA 1GTL1 2DCUA 4PLTA 1TOAA 4DJTA 4FONA 2YJZA 3F47A 3CEJA 4AWXA 3WWJA 2C0CA 4E7PA 3ONEA 4JQYA 3TM4A 3A14A 3IXQA 2OHXA 5B4VA 2HD4A 4DR6B 4KKVA 3BRCA 4XYMA 1YO6A 2AF3C 4DLUA 4P6VF 1GN9A 4JHXA 2NTJA 4RQAA 1P44A 5A5EA 2FN7A 5B3JC 4ZGWA 1NV8A 1NL3A 3SHVA 4E4RA 5AVQA 2XZLA 4BZXA 4TKUB 3CEHA 2Y99A 1Z2NX 3JZIA 3PR4A 4OUKX 3BZWA 1G42A 5DTQA 1DAMA 1U9IC 2ZWOA 1L7MA 2CFCA 4ZFNA 7AT1A 2RARA 1HEUA 3NVDA 3KVYA 3IMGA 1M66A 3GAFA 4ENWA 2YXBA 5TY0A 1V1JA 2V6BA 1PJBA 2ZUEA 2C7GA 2ATLA 2V0NA 2QRJA 2R1UA 3U7JA 4II2A 1OILA 4KBGA 1NXVA 2PNJA 3TY9A 2GFHA 4TZ0A 1G38A 2GZHA 1M2VB 4JIGA 3S68A 4J6FA 1FUUA 3FPKA 1JBKA 3D2CA 1CRQA 4B7UA 3A25A 3T4PA 1UMDA 1DBVO 4M0UA 1LB1B 5CFLA 4Z0PA 4EZBA 3TRKA 3HLYA 1T5HX 1XCBA 3BH7A 3GIQA 4D4LA 3TRJA 4ENRA 3PQ7A 4HZUA 4IRCA 3A31A 4MWZA 4R7GA 1NZJA 4JYAH 1X0XA 1Q1NA 4IV0A 2QI9F 4V2UA 3SHOA 3RIHA 2FG7C 1R4NA 4DPLA 3A3YA 1XNRH 3UK7A 5C18A 1G21E 4GPIB 5I3ZA 4JMPA 2UYYA 5HF9A 3WXBA 2NZVG 3ENQA 1MPXA 4LWOA 3GMTA 3LXRA 4N3BA 2FLKA 1YJAA 1OBOA 4G8JA 4BX9A 4A27A 4Z7NB 2PD3A 2WJWA 1XZLA 1PEKE 1QDEA 1CX9B 4Z1MA 4IKOA 4BN5A 5EUBA 1JP7A 1L5HA 2PT7A 4ZMBA 3GRZA 3RG2A 2PXHA 4DXAA 3DD1A 3QLEA 3DQPA 2YXDA 1ODJA 2EERA 2W8KA 4ZVUA 1SZDA 5KYWA 4PW0A 1W2GA 4O4JA 3OU2A 5JSQA 4GKVA 1FVFA 2QN8A 5BYAA 4RETA 1EVQA 2BLNA 1QJCA 3DJFA 1B74A 4I4TA 3MR5A 2WVGA 4OFWA 1TM7E 4UVIA 4Z86A 2B4QA 3GUCA 4BJHB 1F6BA 3G59A 3L5OA 1UWVA 3CEPB 2PGIA 3LO8A 1DRKA 1DB3A 3RANA 3DMPA 1PVOA 4HUQA 3WIEA 4NMHA 4A0SA 2AGPA 1HL7A 1W1WA 2AOTA 5ED4A 4D41A 2I2FA 3IAM1 1RBYA 2ODNA 3LVRE 1RJ9B 3GP5A 4KN8A 1ZH4A 1XMOB 2XE7A 3R8XA 5JCPA 1K66A 3O4HA 1WXEA 3OD5A 4EI9A 1VL8A 5JWRA 5LDGA 4UBJA 3AB7A 4MVJF 3KYCA 3C7KA 1GPUA 1NVUQ 4RCVA 1X7WB 5EINA 2K4MA 2BISA 3SSAA 2W6JD 5F1YA 2OGZA 5K0NA 5L3SA 2NUTB 3E27A 4RY0A 4XDGA 4IHKA 1B14A 1F5SA 1SIUA 5FNVF 1U2GC 3I5YA 3TZQA 4YROA 3GPIA 3HXTA 3OJ0A 2N42A 3TX6A 4U2KA 5H3HA 2ZBRA 1CQXA 3EZLA 3K16A 3AGPA 4UHDA 4XW2A 1DX6A 4PC6A 4X62B 1H4TA 5C1OA 4RKYA 2XYQA 1Z7BA 4OBXA 4J91A 4RD2A 2WSMA 3QVVA 3GEDA 4L4YA 4MXDA 5FLYA 4JLJA 3EUFA 2IBKA 1UMCA 4FOLA 5IDQA 2V6MA 1ADFA 4CHTA 4QU9A 2DOKA 4YMHA 1MAUA 3R9XB 1FZTA 1Z63A 2PIAA 4NS1A 5HZKA 1UBGA 1PJLA 4Z0HO 4UPDA 3H5TA 1G8HA 3HM9A 4N3NA 3H2ZA 4RPHA 3PFGA 1BD4A 3FYHA 3GLIE 5LQCA 3NW9A 4WZ6A 4MR9A 1JNYA 4ZZ0A 3GTQA 1Y3HA 3JQCA 1T2FA 3MAAC 3HJRA 3THOA 3PVCA 2V55B 3HRKA 1Z3IX 5T64A 1U0BB 4NH4A 3IAUA 1E5LA 3SM3A 3B9BA 4UUOA 4MITA 4OHYA 3DUFA 1ESDA 1SH7A 5BT9A 3B9RA 3DFFA 4QQFA 1OXTA 2O3RA 2H2GA 1N5JA 3EWIA 5DM0A 1PV2A 2PUVA 1FUYB 3VV3A 3KE9A 1XTPA 1OZFA 3AZOA 5LA6F 4RTJA 1CE8A 1E32A 4GXTA 3AG6A 1G41A 4HNUA 1N36H 1FUIA 3KKOA 2QLFA 3ZDQA 5IVPA 1CDDA 3Q40A 4ITVA 4I1SA 2FPGA 4OJYA 1OFUA 3EQ8A 3K2IA 4KI0A 2MINA 2I1LA 2KI5A 4Q44A 2WINI 1W96A 1RXVA 3LAWA 5KFLA 2Q29A 4GYWA 1XJQA 4OHFA 3KL4A 5BOSA 4PNPA 3C8HA 3BACA 4UVDA 1FFCA 1WCIA 4GXNA 4PIVA 5G0WA 2X5XA 4IX9A 2AN4A 1EUDB 2GPBA 3QTBA 1EXWA 3GDGA 2F1HA 3KKQA 2H59A 4X65B 1WCMG 3IVCA 2JLSA 5TDHA 1SURA 3KFVA 1ENOA 5KNLA 3NHSA 3ORHA 1PF7E 2NZ8A 3K9LA 1CIVA 4OHUA 2YIVX 4FSHA 1TQHA 1ZJ6A 1VL5A 2PN1A 4O2AB 1P0PA 2P0AA 1SCKA 1NTRA 3E82A 4TYYA 3DLAA 4HN4B 4UVHA 4QYSA 4DCMA 4IDOA 3VKHA 2GFIA 4IFEA 2R1TB 4EHHA 4F9TA 1T13A 3BCUA 5I5UA 1X7ZB 4GPBA 3NRBA 3WP0A 1E0JA 1NI4A 2HHFB 5G0SA 2PCLA 3OT5A 5EIBD 3IBFA 3RAPR 4XX0A 4M53A 1FF9A 3V8BA 1TTQB 4RJ2A 5FA8A 5GJVC 2QRGA 4WZZA 3QBEA 3BH6A 1XFDA 3BK7A 1TKBA 1T2NA 1DAPA 2ZJ5A 4ZAVA 2XVAA 5T4FA 4HAWA 1NXTA 2B4KA 1W4RA 1PJ4A 2H2FA 4XPZA 1C1HA 4LJ7A 1YDHA 2C2YA 1QBGA 2ONYA 3V3TA 4MQFB 3E8XA 3CTMA 4CETA 2IIBA 4K03A 1T36A 1JYFA 3AEQA 1FW6A 1TXGA 2QBYB 3NBZB 2BHTA 1UK8A 1JA1A 1OFUX 2RHRA 4G2TA 4N0PA 3VVBA 1UK7A 2A33A 4G1CA 5AQ1A 1W36D 4CLRA 2CFOA 2UUAB 3TOZA 1G5IA 1T0UA 1PEYA 1ZU5A 3ZVLA 2DCMA 3VNBA 4HQKA 1E3JA 2WWVD 4EA9A 1YS1X 2Q27A 1BWSA 2ACEA 5IN4A 1BN6A 1XIVA 3M81A 2ZRQA 1Z83A 2V0GA 4CMBA 3BMQA 2UXCB 3ZWXA 3JWPA 4IAJA 1NWHA 2MU1A 3O95A 3ZHZA 3K0SA 2O2IA 3TE7A 2AC4A 2QD5A 1ZIPA 2QVBA 3IJEB 1E9DA 1LRKA 4E1AA 2AJLI 4OQQA 4II3A 3OQJA 2NSYA 3HZRA 1UK9A 2L0XA 4AU1A 5FYDA 4A8JA 4K9PA 1K1EA 1DIHA 4WXMA 5KYYA 2IXGA 4WHMA 1SZPA 1XVTA 4FU0A 5D3ZA 4EYIB 2J4CA 2CYBA 3VNRA 3I8SA 2ZIXA 1BGXT 4RB0A 2Z1DA 1E64A 2ZB3A 1UZMA 2EZ4A 4DIDA 1ZOSA 3EVAA 5JJLA 2CLFB 5COAA 3CLRC 2PKCA 4DE5A 5KHAA 4KBYA 2IV7A 1IHUA 3BN3A 2WJZB 4PX9A 1C3EA 3ENZA 3BMNA 5BSFA 1UPTA 1XX6A 4UXHA 3EVEA 3WMXA 4KHPB 3QLTA 1R27A 5IJ9B 4XD7A 1LJUA 3ROXA 4TSFD 1CZHA 2X5OA 1G3MA 3PYMA 1O94A 1P4AA 3I12A 1XEFA 1O03A 2OECA 4O8CA 4XUDA 2OK7A 3DTVB 4MIEA 4FMBB 1GDDA 2PU7A 3W5UA 3WDSA 3DKRA 3F71A 3FIJA 4P7JA 4K05A 1K06A 2FFHA 4ZO9A 1SKQA 4U7GA 4OATA 1JFSA 5C1PA 4J9OA 1HYBA 1GXSA 4EY5A 2GPNA 1QFXA 1YHZA 1EHYA 4US0R 2K6GA 1BH6A 3DW1X 4BV8A 2BIFA 1ZWLA 1VOTA 1P7CA 4YQEA 5J59A 1I0ZA 1X0VA 3DFMA 3EXEA 1QGAA 1MX5A 5G1OA 1KMMA 2G0TA 3WMWA 1DQSA 1ISIA 3ER8A 2WAMA 2PMDA 4BWYA 5I4IA 3DWGA 3THRA 4DSZA 4MI9A 2Q5LA 5EUMA 1RAGA 3IDQA 2PYIA 2YXLA 5CXQA 5DLFA 4LV8B 3G49A 3QVKA 4AG5A 6ABPA 3PNVA 4QYTA 3RYHA 3INYA 2IP1A 4KLZA 4HWKA 4GVLA 1H6BA 5BW8A 4LYYA 4BNJA 4HGRA 5DISB 2EEZA 4DV3B 4EG4A 2VT2A 1FFXA 1S01A 4QNMA 1GT6A 2CFSA 1JJFA 3VO2A 1T91A 1I1HA 4R2WA 4ND3A 1RCTE 5EP4A 3OCZA 4FYJA 3WLJA 3OX1A 1RKBA 3T5PA 4IIXA 1V71A 3OPYB 3PZPA 1GGOA 1SK8A 1KP2A 1YULA 3FPBA 4W8GA 3WRXA 4A0RA 3B9QA 3RV3A 1C5KA 1CDZA 2VDWB 3NHZA 1C7IA 1VJDA 3GFVA 4CWAA 1E9AA 4BWSC 2A1UB 5ICFA 3U2QA 2LZ0A 2YC4C 5MDHA 3IPLA 1C9NA 3PXDA 1TMYA 3MLEA 2PFKA 2HG8A 1X1AA 5JXGA 2ZDGA 1EKVA 5E8RA 3F5FA 2VNKA 5K3SA 3E9DA 4G81A 2HSDA 5D85A 4OLJA 1Z6ZA 5FJJA 2VCYA 1T4DA 1U28C 2J9GA 3GT4A 3ZWCA 1BX1A 3V2HA 2P2ZA 2AUMA 2JEGA 4S1WA 2B4RO 621PA 4FCWA 2C8LA 4OYHA 2R65A 4RLQA 4LGMA 1K63A 2O0LA 3G6KA 5DTJA 2XCIA 2YH2A 2NXJA 1PR5A 2ZSIA 3R8CA 1CC1S 4LA4A 1FVHA 2HL6A 3G02A 3TOXA 2J3DA 1MB0A 2Y1GA 3EHEA 3SYRA 2IIQA 3WYBA 4DCSA 5CA0F 2W42A 2AMJA 4OP1A 3MIZA 3HLKA 1I1QB 4UD6A 3AI2A 2YBEA 4M0EA 3KKPA 2GYYA 1ZK0A 4ZCLA 1Q1AA 1T8RA 1F9AA 3B48A 1VCIA 1LBEA 5FJIA 3IEXA 2DP4E 4EFDA 2EW1A 3TBFA 1RWPA 1VGQA 2XNHA 1QU2A 2ZULA 4UNSA 4KRGA 4EJSB 1XZCA 2VG8A 2VT7A 4C6RA 4UTPA 1G5QA 2P62A 3MPOA 4ANFA 2IOQA 2O2EA 4ED8A 1O6FA 2RGUA 1YQTA 2R7NA 4IS3A 2VDMB 1EBBA 1GPJA 1W44A 2PUCA 4A15A 4YPOA 4BO3A 1T0IA 1DQRA 1JFFB 2VHUA 3SJBA 3HCWA 2A0WA 3DPSA 4FYWA 4U2GA 2V1XA 3N0WA 4AW9A 1KXJA 2C22A 1MT0A 3C3DA 1XTUA 3SZRA 2DBYA 4XYLA 2FW8A 4CMDA 4UU1A 4DUZH 3T5TA 1W5TA 4MV8A 3COYA 3D43A 4KQKA 4OL0A 3V6JA 1Q7RA 2BGIA 5I9LA 4EY3A 2EG5A 5GJWC 4B8WA 4HTFA 5FOVA 1VKRA 4MIOA 4HDMA 1UH5A 5FFMA 5IYCG 1WS6A 1OX5A 5I7VA 2NVYA 2CEKA 4AUNA 8OHMA 2RDMA 2AD5A 3GLGB 5KQPA 1AS2A 1YCDA 3N28A 2AUTA 2E4VA 2H1RA 3H5NA 4B09A 1R74A 5AVXA 1KPHA 1ODFA 1KDRA 1FJHA 2Z09A 1EFPA 1G20A 1OLUB 3EVFA 1JWLA 1SXJA 4DDKA 3V8VA 4B3TB 3SR0A 4ZVLA 4XWOA 3U9TA 4TTSA 1N7HA 2GXQA 4LBVA 4BX0A 4XARA 4U2BA 1YE3A 3GVHA 3AKYA 1NIPA 1UXKA 2IVZA 2GZSA 2CE2X 1E0AA 3LXUX 2QOEA 3SBDA 3K1AA 3V8NA 1RM4A 1COWD 1DJPA 3KSAC 4PO1A 3R6LA 2HMWA 4LHYA 4ARZB 2VH1A 2GM4A 4EGCB 2ZJ7A 3NAGA 1RYDA 4FUQA 3JYHA 5HMLA 2PG3A 4CV2A 1LNQA 4TV9F 1QF6A 2JVJA 1YE8A 1U2EA 2OBLA 4TPKA 1PJQA 2G07A 4K86A 3EZGA 3I04A 2MSWA 2HRRA 5HNKA 3H2YA 4MUFA 2DPYA 3NBKA 3RROA 1KDZA 2OZVA 1FFGA 2REBA 2BFCB 5JQGB 4A03A 1D2MA 3K2BA 3EGDB 4YLEA 2OHGA 4XRRA 1Z2EA 1EKPA 2P4HX 2O5EA 4IF6A 2MOKA 3AR7A 3E61A 5AICA 3UWKA 3QEMA 1IU9A 4JI6H 4FFNA 5BN5B 3ND5A 1KQ3A 5KT6A 4Q3OA 4N0EA 2J3HA 2PH5A 2ZUVA 1TFRA 5TJ9A 2XF2A 3OO1A 4J0KA 4J1SA 2DR0A 3LXMA 3L1JA 2OORA 4I55F 4A8JC 1RI3A 5REQB 1V5EA 2AFIA 2VQ6A 4M2LA 3UPUA 4V3CA 1J1UA 3ZY4A 1FJXA 1Z73A 3TLBA 3HYRA 3L1HA 3TRIA 4IMRA 4DB4A 4BYGA 4R2MA 1Z2OX 4DLVA 2HU8A 2ZBGA 1KYIA 1LSOA 2IBTA 2Y0SA 3IXMA 1BQEA 3LC7O 4IJ5A 3IQIX 4CQLA 4JL5A 3T0FA 2FSFA 5C5CA 4E08A 3B8EA 3UTCA 2COKA 2H4YA 4R51A 4D2IA 3R6TA 4C2UA 1NKVA 2MSDB 3PHBE 1NMQA 4GC7A 1OU4A 5BUSA 2ECKA 1LTKA 3P4UA 4RTOA 5L3QB 3E3AA 2R8JA 3OZUA 4W1QA 3KZMA 4G36A 4IYJA 1ZJWA 4DAAA 3JRXA 4GR9A 4EWLA 3FX2A 2PZKA 3C3YA 1KI7A 4BCDA 4H3SA 3TW8B 4M0CA 1GQRA 5E7IA 4QOIA 1NUUA 2OILA 2W0SA 3QLJA 4A1OA 2O7VA 2XNDD 3LECA 2IIPA 2IY7A 4DMCA 3R1IA 4Z51A 2GQSA 1EA7A 1WPXA 3ASUA 4I1PA 4WKNA 1GA6A 4ZEWA 2W58A 1USKA 2R4UA 1ZO8A 3EDOA 3T7IA 3QNWA 1YZ3A 1N57A 4LVOA 1G19A 4US1R 3M9MB 1GZ7A 3U4QA 3H20A 3NHJA 1FFAA 1K8YB 3Q3EA 3KVNA 1RWOA 4GZ3A 4CU5A 4EZEA 4GI7A 1Z5GA 4DA7A 1L1FA 1ORIA 1JEDA 4KIWA 2CXQA 4WN9A 2FZWA 4ZYYA 2OE2A 3HZHA 5IXYA 3PITA 4GX2A 1JG7A 1P0CA 1TZJA 1OHHD 4QARA 2FUCA 3TWOA 4QUBA 3B5EA 3UOAB 5K0FA 1K6MA 3RH0A 1Q0SA 3H1PA 2XMDA 3U6BA 1QH1B 2BTEA 1AS0A 1HF3A 4FHGA 1EJ0A 4YECA 5CM9C 4BFZA 5EIAA 2YXPX 1RBQA 4HAVA 5KX5A 4RKQA 4YWHA 4UOEA 3UUEA 3QYPA 3ECAA 3ASZA 5GY7A 4G07A 1W59A 4II7A 1G4AE 2IP2A 3AR5A 2DETA 3G5TA 1XGKA 3MFYA 3G6VA 3LSTA 4X6YA 3R5JA 3U0VA 5CUQA 5J40A 4C7MA 3OG9A 3WRXC 3LCRA 4P0PB 3OTOH 4JKOA 9GPBA 4EKIA 4Z8YA 3ZHRA 1UAGA 4BMNA 3OO0A 3BIFA 3I09A 3AT1A 1VL6A 4HQ0A 2XDWA 4LWQA 3PUXA 1YONA 4NX2A 5TPWB 3BGDA 3OZBA 1DGSA 3E5NA 1GZDA 3RC9A 5FFNA 1H2RS 4P3NA 4OIFA 3UJ8A 4GU5A 4YJ3B 4TWRA 4I3HA 4DA8A 3MD9A 2WPNA 5SYAA 1E3WB 3OT4A 5CBPA 3DDWA 4G0XA 2YWVA 1FJ2A 4B6EA 4A3DG 5K09A 2QAGA 1PDVA 2IELA 3RYIB 3DEKA 4H7PA 2AMLA 1ZY2A 4JSRA 3VNUA 1II9A 1JJIA 3CX6A 3IE2A 4W5OA 1MPTA 3HN7A 1G2IA 3OP4A 2F7SA 4C43A 3Q5EA 5HKKD 2P5TB 2P40A 1S1MA 2B98A 5CW2A 2APJA 5F12A 2YZ2A 2D3TA 1KNXA 1V41E 3WGTA 2CF6A 2JLYA 3KETA 2OCLA 1WXDA 5KWEA 3DMTA 1BU5A 3THWB 2REQA 1Q1QA 3SKXA 4LH6A 1OYWA 3QVOA 5K2OA 1QS0B 2GBPA 3AUJB 1GQSA 1D07A 3FMIA 3Q6NA 3RGXA 3GLHE 5KFMA 2A4KA 3LGXA 3D2AA 5LOVF 1WXFA 1VPLA 2HK9A 4FE4A 1PL7A 4RKRA 3TMAA 5I7UA 4JJAA 3KQTA 4QGFA 5KNCH 3NFYA 2QZ4A 1VJCA 3BBPA 5IU6A 2B37A 3LT0A 4RA9B 4YQYA 5KINB 4MYSA 1QGYA 1G8SA 5EIXA 1I4DD 4GBGA 2Y1WA 1XQYA 2IOFA 3GEHA 4KZKA 1Q6YA 3C98A 1ZCAA 4CLEA 4NJMA 1U1FA 3FVQA 4AC9A 3V46A 1IJFA 1K8XB 4QOJA 3C7DB 3NC0C 2FI1A 2I33A 2YICA 4FFVA 3ZZNA 3GPBA 4GEGA 1ZSVA 5LR6A 1THTA 1SB8A 3F5DA 1JI0A 3BD7A 2I0FA 2ZYHA 3QE2A 3PHIA 4J3FA 2GEDA 1YBFA 3IJ5A 1DELA 3O74A 1K98A 1ZJ4A 3B1WA 3BT7A 1DKRA 3RIZA 3B7PA 1CR0A 3DBOB 2VN8A 3CZMA 5B3JA 4YP9A 2CFMA 2PZFA 4BO9A 1MVOA 4Z0NA 1CUWA 5K0EA 5I01A 3CRVA 3FA2A 1NPDA 3LS2A 3VU0A 4ER3A 4YO7A 4FYKA 2F4VB 1HE3A 4EBBA 5IARA 2UXDH 1X1CA 1JQEA 2AFRA 4L22A 3WLIA 4YRBA 3MUEA 1FQJA 3Q3CA 4FS3A 1PYGA 3IV9A 3P2EA 1YDEA 4IM7A 3MB8A 3H5IA 2EBFX 4HPWA 3TYXA 1I3QA 5CVDA 1OBFO 4UUBA 1I51A 4KQIA 2CMKA 3CKYA 5IP5A 2OKGA 4DLNA 4YA6A 5CCBA 1ZKMA 4E2ZA 3O93A 1ZA2A 4FFBA 3T1QA 4I7EA 2VYNA 3DAOA 3GV0A 4E6NA 1DJLA 2ZRIA 4BAZA 4BP1A 1Q3HA 3WLLA 1DP4A 1M8FA 4QHYA 3EMVA 4JFRA 4N0QA 2A9VA 1Z7WA 1COZA 4WJLA 3DFZA 3EWSA 2EF0A 3QHAA 1V3QE 1Q5PA 1L3CA 3DZBA 4ME6A 1ID1A 3W6NA 2QP4A 3WMRA 5LA6B 3K9FC 4JV1A 3TZKA 2GNPA 2HHHH 3KBBA 5THXA 1LZLA 2RFLA 4AYTA 2OPBA 1EVIA 1T3TA 4MP6A 1SVOA 4HDRA 2ZUFA 3SFTA 3FKIA 3EZXA 4RPGA 1QNLA 3ZKWB 2O8CB 4O0MA 4DL6A 4M0LA 3QUQA 3AHCA 2Y1EA 4UM8B 1AQIA 1D1TA 2Q2QA 3I9KA 4BXOA 3K5HA 4NMMA 1CS4C 2Q4DA 2O1WA 5CEJA 2CCGA 3MN1A 3OP1A 2Q5JA 1OBDA 3BGIA 4BQQA 5KVCA 1NQUA 3KB6A 5FO0A 4XVRA 2AMVA 1MJNA 1MRNA 4EDFA 3WK4A 3VVCA 4WKGA 1OFVA 1FB5A 5HZMA 3KT6A 2R1VB 3P9RA 2HQSA 3PQDA 1BQ3A 5I7HA 4TVSA 4MWDA 3PWZA 1I7LA 1QTQA 3L7KA 4K6FA 3HA5A 1M6HA 1M1XB 4HP8A 1M74A 4ENQA 3VKGA 1E1CA 4WBNF 4E4TA 4PZ7A 3HU2A 4G24A 2XYHA 4OYLA 1I3MA 5HCNA 3KEMA 3U54A 1X15A 3DW3X 1JSCA 4WOPA 4XWWA 4E6EA 1NLFA 4JBXA 2EDAA 2A8YA 4LPSA 2DFVA 2YHAA 2YVQA 4MLCA 1B04A 1TC1A 1TUGA 1TIPA 3EYYA 2CHFA 2C4UA 3EMKA 2AW3A 4RHUA 1Y6RA 3OX2A 3GDFA 1AJEA 1DE0A 1YK1A 2YU9A 1JSRA 1U2GA 3A4MA 3U09A 3PXCX 2QM8A 3QNUA 2OGUA 5ER9A 4P36A 3E3OA 1K4YA 3C3MA 3U02A 1R8SA 1ACJA 4U7PB 4CKXA 3L6RA 4FC6A 2PGXA 2DVMA 2EEPA 1JB9A 3KG2A 3NJ8A 5JCZA 1BMDA 1HNWH 5TNXA 3D64A 2LW7A 2JIQA 4DEYA 2WWFA 2XDQA 1ZI6A 3HA2A 3M1YA 1YQQA 3C48A 4DBVO 3U31A 3WL4A 2A1IA 1N5MA 4R68A 4M0DA 4RNNA 1FP1D 1SUAA 4LRXA 4U7WA 1U99A 4FLEA 5EUCA 4BN0A 3BB3A 1KIMA 3L8CA 1LI4A 1ESNA 1PLJA 4UZFA 5F76A 3TFWA 2HCJB 2J08A 4YAFA 3MR2A 4Y9SA 3HBMA 2X2FA 1FMJA 5DI9A 3EOBI 3V33A 2ZJFA 4X41A 4MKZA 4RFVA 1E0SA 5EZSA 3LWZA 4CTKA 4M83A 1U3CA 5JECA 3ZZ1A 2WVJA 3CRW1 5E7JA 3JSAA 1E9BA 2HOQA 3GPDG 4B8ZA 3RWOA 2X7XA 3AVVA 2DBVO 4D3XA 1W0KD 4HDNA 4RFSB 2UYOA 4KBFA 2X0IA 1UDWA 4P82A 1SGWA 4M49A 4UU8A 1IEVA 1FFYA 4RPIA 4FR5A 5L51A 4ETNA 4UTVA 1H1LA 2A9FA 3CNBA 4C0LA 4ZQGA 5JEEA 2A2ZA 4PSDA 3HXMA 2JL1A 4HX5A 5DYWA 4C4OA 1Z12A 4YMSA 2GHQA 4QTZA 4ZV7A 4YX9A 1R6XA 4O81A 3IP8A 3CGWA 1CF4A 5E4YA 1MF7A 2DFPA 3OSZA 1XXHB 3RIGA 1S8NA 4C4TA 2C7VA 4IFTA 5IAJA 2R11A 5EDWA 1V16A 2I29A 3GVXA 4EBDA 3G5LA 1FLVA 4CG1A 2JLAA 1EH5A 1JXAA 5CH3A 3RUCA 3BE6A 4EO9A 4QDJA 4DC1A 2B6NA 3ZEAA 1DNPA 2INGX 4ZDJA 2FG5A 2G25A 4Y2VA 5HR5A 4M8KA 5FWXB 1IQUA 1GL7A 2QTFA 2XPCA 3T41A 2C28A 1CEXA 5EMMA 2OC9A 1QZXA 2VRWA 4Q5IA 5TVGA 2XD4A 2R2GA 1C0IA 4KK3A 3L9XA 3IP6A 2ZRNA 1LU9A 3YASA 2AZDA 3KSDO 2EFHB 3D4IA 5F2NA 2NZXA 1L5WA 5E0KB 4QJBA 4R2JA 1N7GA 1W9MA 5A0FA 1QRRA 4QXOA 2C78A 5B3KA 4CW7A 2EKBA 4RIFA 2QR5A 1K92A 3KPWA 2VXYA 5G3ZA 4JEUA 3MAGA 3MC1A 2R0QC 4JBNA 3E3NA 1V7PC 4HNGA 3NNSA 1LFAA 4EW3A 3LUAA 1WU8A 3N8GA 1DKOA 3HV0A 2XIJA 3G5AA 1URPA 1N2XA 4S1TA 1I7NA 3QJYA 4DR4H 4AXXA 4QNNA 4UMFA 4HJRA 3KOWA 4HNVA 4FGZA 1ULAA 3JQ8A 4EUKA 5EWLA 4IDCA 2O50A 1SOVA 3M2TA 4BCCA 2I2AA 5FOQA 1MGPA 1GQYA 1IXZA 2OHVA 3D0KA 3CX7A 2HUPA 3TL2A 2VUSA 1ZJZA 2FFRA 3G8DA 2VYQA 1TE2A 2PL9A 2AG6A 4KQGA 1RVV1 1PL6A 4CG0A 5A62A 4X8OA 4M7RA 5MF6A 2ZDHA 1JYSA 3VTFA 1IIBA 4Q21A 4ZVOA 3CNNA 3OX4A 4G8DA 3KYIB 1EKXA 2ZT8A 3BGSA 1E0KA 3AVXA 5C1DA 1UP4A 1YZQA 1TL7C 2G71A 1IUOA 2EFJA 3K35A 4FGJA 5AI6A 1F0KA 4WH0A 3MEQA 4DL9A 3BD6A 3CUWA 1D2RA 4K3VA 5AJZA 1BSVA 2RE8A 2D54A 3W5VA 2VDVE 1E8NA 1PD0A 3IVRA 4INZA 1JEOA 2YW2A 3FKSA 4HHEA 5K8JB 1WZNA 4HB0A 5F9LA 2O8NA 2FSGA 1YRAA 1YVRA 4CEIB 2B82A 5U9CA 3K8YA 3A1FA 3RGZA 3KB1A 1SHUX 2EW8A 1PWHA 4NARA 2II6A 4UW9A 3BRWA 1U3TA 3H4TA 4JLBA 5J1TB 3EC1A 3C70A 1RM0A 3KB2A 2V4MA 1T4CB 3ESYA 1J90A 3TQSA 2NYAA 1MV8A 1DIAA 3JS5A 121PA 4EO4A 5AD1A 1VL0A 1DC6A 3I9V1 3G5UA 4DLSA 4ZREA 4AZSA 1ECFA 1X80A 2QL5A 2HEGA 3P5BA 4YASA 1NW5A 3WBBA 2BUAA 4YCJA 5AI4A 2OZLB 2Y1OA 3HB9A 5JTTA 3EXFA 1FYDA 1TAUA 1LK0A 3WIVA 2JARA 4LN1A 5TPZA 4D02A 1R4AA 3E22A 3NBUA 4G5QA 3NEYA 4LCBA 4MS4A 5DNEA 4L7QA 1BJTA 2DRIA 4BOYA 5JRZA 2QG9A 3OZTA 4IQ8A 2XRZA 1N6PA 5FAKA 2FPWA 5G3YA 2H3HA 4OPMA 4FCTA 5DGXA 2X22A 1PZNA 4ARUA 2ZSHA 3EXAA 1V5GA 2JHPA 3EUAA 1F2TB 4N0DA 1L4HA 1ZINA 3K72B 1KFBB 4RAQA 1BEUB 2VJKA 3SDSA 5DN9A 4UDXX 2AHOA 4J43A 1TJYA 1EVKA 4Z1MD 1ZUNA 1M6YA 4MX8A 2ZRBA 4WI1A 2DLDA 3JYQA 3OOJA 4YY3B 1T94A 2E4ZA 4OSPA 3PIRA 3U7GA 5DH9A 2FK3A 3GG9A 1N5LA 4Q66C 5AIAA 5LSAA 1T9AA 3CG0A 1S3IA 1FFWA 1YOBA 1YB7A 2B25A 4HAIA 3W5HA 3F6CA 4KMMA 1HEYA 4GPZA 5KJ1A 1LI5A 3VXKA 1VHTA 2CUZA 3KSZO 2B9EA 1ZH2A 2J32A 4GOOD 2ZYIA 5BOVA 4ZDKA 1IHOA 2AK2A 3VPHA 1JEYB 4CL3A 1ZOOA 3QY9A 4FD3A 1B16A 4RK1A 2ZB4A 2H18A 4G3IA 3FOBA 5KWJA 3HB7A 4IIUA 2GI4A 3GMDA 1O96A 2DEUA 1HKUA 4C3VA 3OJEA 1UINA 4EVRA 1M9NA 5JSUA 1DXQA 1UZAA 2QYOA 4D45A 2OQIA 4YR3A 3OHBA 2IX9A 1M1YA 3OCYA 4ENPA 3ZBTA 2VA8A 4HFJA 5HHTA 5ELXA 1ZM2A 2RCYA 3C5HA 3UENA 4CF5A 1U3DA 5CXUA 4IOLA 3TBKA 4FCVA 2W6NA 3JD4A 4Y67A 4E5VA 4TSRA 1R6VA 3AP2A 2AG0A 3KNZA 3LHFA 1OVMA 5F4BA 3G3EA 2XB4A 5EWGA 3H86A 4Q7EA 5CR9A 2R5WA 5A5DA 4PX5A 4O84A 2OL4A 4MHTA 1YSCA 3G6WA 3ZW7A 4TV9B 1MOQA 2D2VA 3R5TA 4H1VA 2VDPB 4WIAA 4JEIA 1REQB 1YRWA 1U04A 5I9IA 1U28A 3CC8A 4DIBA 1YFLA 1EXNA 4KP7A 3SDZA 3HDYA 5A9SA 3MA0A 3Q9NA 4G1UC 4G63A 1GRQA 1QB8A 4GC6A 3E9CA 3VPAA 1T6XA 1EFRA 2R62A 4GLXA 5C7OO 3CPSA 3NHPA 4LDZA 5LDDC 1EWRA 5GADl 3M5DA 4MKXA 4UCWA 3C8UA 4REOA 2OUKA 4W82A 3S40A 3D3NA 1AGXA 2RMKA 2XWSA 5TS3A 1WXXA 2ZAIA 2VOBA 3M9WA 3GEMA 2OV6A 3DP9A 3GFFA 1SRRA 1CPYA 2BMJA 1DG9A 2OV2A 1FK8A 1G5HA 2PGNA 1SUIA 4RLHA 4ERXA 4L95C 2VXCA 1KMNA 3AP1A 3AW9A 3C5WP 1ETUA 1ADCA 2VEDA 1K0UA 4WGFA 3TOSA 4JT8A 2W22A 3GAZA 4X9XA 3R3YA 4D8UA 1CS0B 5F3DA 2TMYA 2PVPA 1UBTS 4QDXA 1TECE 4PC7A 1WIWA 4JI7B 5BRNA 3KXIA 2GZ2A 3FVVA 4NDZA 1PG0A 5FBWB 3LKZA 1E7WA 1GCGA 4PLZA 1C3XA 5A0VA 1CK4A 1TZCA 3I0ZA 4TV8A 5LXTF 4IL5A 4OQFA 1BXZA 3W7BA 4AQYB 3UUWA 1P91A 2G8NA 3OFNA 1ZISA 5CLFA 3A3OA 2WM9B 3QX7A 2PPVA 1SKYB 3CNOA 4NENB 4LJ4A 2OZKA 5JI2E 1S96A 2ZYGA 5EHZA 1RYSA 5FHQA 4TYNA 4ZAXA 1S02A 2D8MA 3HGQA 4F2HA 2WF7A 1A69A 4B75A 4LDPA 2OCAA 2F17A 4B4VA 1J5EH 4P4SB 3U80A 3PNKA 1K8ZB 3X0DA 2BKLA 2PEYA 5KAMA 4FKZA 2C2RA 5FI5A 4OHKA 5KG7A 5C7LO 2R47A 1I10A 4Z2YA 2LE0A 1K3UB 4KPGA 2I2WA 2M98A 3I8XA 1EWVA 4E5YA 5IJXA 5D3MA 3KSMA 4HEA1 4LZLA 2EGHA 1E58A 4ECSA 1V4VA 1P9OA 3REQB 3CZQA 1UIRA 1DKMA 3G0IA 3FZEA 4CEHA 1U1DA 1MZVA 4XEUA 1JHPA 3DE6X 3S24A 1QUFA 4KWCA 1IXSB 1N6LA 4EG1A 5LP1A 2NZWA 1WNTA 3DHYA 5JXHA 1NVXQ 4X1IB 3LYUA 1A4RA 1BXRA 4NZYA 4I4CA 3H8SA 5EJ4A 2DLCX 2J7PD 2IXTA 1JILA 2BEJA 3RFFA 4J76A 2FG6C 1VA5A 5I48A 2IOYA 1R5JA 2H52A 1SHJA 2Y4NA 3L6UA 1Y8QB 1J2JA 3PVSA 2WQZA 4DR2H 3G7SA 2H57A 13PKA 3A6DA 9LDBA 1QKKA 4ONEA 2OWDA 2M9MA 4U9HS 1D5WA 3OE1A 1D6NA 1DL5A 2JW5A 2HB6A 4NCJA 1NBWB 3WSVA 2CMFA 1XJ0A 2OY0A 4DQKA 1UKEA 4YCAA 4BE4A 3L7OA 3EN0A 1Q0PA 1KJZA 4NZPA 4BV3A 4EHAA 4LRTB 4PLFA 3VO1A 3WWOA 3KB8A 2RGGA 1RC1A 2COIA 4UAJA 1VLVA 3R09A 5CX1B 1IY2A 4B3RH 3WE7A 2ZTLA 3AB3A 3U81A 1UOQA 1CNEA 5BN3A 2V0CA 3OA2A 2PZ8A 4WLUA 5FHRA 1EEHA 2QX4A 3DAFA 1OTHA 1K5HA 4W9NC 3KR9A 2O0KA 4I1OA 4IDHA 5DM1A 2WAQA 3G2KA 2HNBA 4QECA 3MWEB 1R9GA 2GHRA 3KLOA 4LFAH 4P7FA 4KPFC 2QRVB 2GUWA 4Q9KA 4D9IA 3TDKA 2XLCA 5IJ0B 1N0VC 4GLOA 4E7OA 1FP4B 3JRNA 2J7KA 4KMRA 1JIUA 2YZGA 2G88A 3T3DA 4HV4A 4BGUA 4MQ4A 4CR8A 4MUMA 3V3KA 4FDAA 3NUQA 2WDTA 4RF5A 1QU3A 3D6TB 2GBFA 3DFIA 4M89A 2QLMA 2OXFA 1N78A 1LPOA 1Q20A 1EP2B 4G5XA 5IC5A 4EVQA 1A96A 3JQ9C 1RNLA 2YV4A 1KKMA 2RI0A 4ZQFA 3FTNA 4AB1A 2Y1FA 4P7BA 3ITNA 3LCVB 1TM5E 1KIFA 3NTRA 1Q0LA 3UNXA 5KOHB 4GKBA 4JXXA 1NFRA 1WCYA 1EG2A 4M60A 4AMZA 4P33A 4LKRA 1KTIA 4EX6A 4B4WA 4RVOA 4OBWA 3VSAA 5LOVB 1U0NA 2RHOA 3VBCA 4IGEA 3D3QA 4FC7A 4JVMA 3O2SB 2QUIA 4OK6A 1PT8A 3DBIA 3NWBA 5I9BA 4CEJA 2R84A 2GN9A 2XUGA 5I5TA 4WY8A 3RJ5A 3BE8A 1OZGA 3JPWA 3IT2A 4YLGA 3C4QA 2X6QA 4OX9B 2QA5A 4ZCMA 4XD7D 2PR2A 4ENUA 1L3IA 5F33A 5JNLA 1XDWA 2RBEA 4BN4A 3DHWC 1M2WA 3KKMA 3IERA 2JFGA 1O94D 4NCAA 1T1EA 4HMQA 3FBGA 3KHHA 2V7QD 3W8NA 3RE1A 5F3WB 3FOWA 5KNBA 4CTOA 2D5AA 1YR6A 2CJXA 3U48A 1A1SA 2UUCH 2O07A 3OZVA 2QRHA 2Y0BA 2QD2A 4WACA 2JDIA 4QXAA 3UB2A 1MTZA 2EV9A 3B2QA 4LDRA 3AU9A 1MT3A 1F20A 2WJ6A 3RUPA 2E4UA 3P0IA 2EFEB 3F6EX 1EVYA 4X1YA 1LEHA 4IIFA 4ZOBA 3ADPA 4NU5A 5DGHA 1KS9A 3RI3A 5E95A 2VC2B 4R8LA 4CV1A 4AY2A 2DB3A 3KXLA 4KO4S 3W5SA 5EY5B 1LPPA 2WAYA 4K6NA 3DKPA 3MYRA 4UBKA 3WQQA 5H3LA 3BL6A 1ORVA 3O4GA 3ZW9A 2OAGA 3M1AA 5EXDA 3JPYA 1AD2A 1DFHA 3TR5A 2VZ9A 3CT4A 1WMBA 2V6GA 1USGA 5J4VA 3H2GA 2Q5IA 3TCKA 5LBUA 1PNQA 3G8CA 5H16A 5ALZA 5EXEA 3IKTA 3N0VA 1H2XA 4E2WA 3MINA 3CMMA 3MCZA 5JH7A 1QFMA 2ONCA 1G2OA 1K6EA 2ZCVA 3L7BA 1CLEA 2WUWE 3RREA 4QOFA 2NZYA 2QROA 1MCZA 2O9JA 2ERCA 1DVRA 1CF2O 2IV2X 4L3VA 1F48A 4E1BA 1QOZA 2RD2A 2WUFA 2JAWA 2RF4A 3AILA 4HAOA 3S1LA 3UQYS 3R4VA 2BF4A 2PBZA 4GLBA 5E6SB 2HDNB 5M7EA 2XGOA 2EW2A 1DUIA 2FXIA 5JEDA 5NLLA 4B40A 1EE1A 4AJIA 4B3SB 5D00A 4A2BA 2C8JA 2VJMB 3WGGA 3RKRA 5I9NA 2R93A 4LECA 3TLXA 2AD1A 4NXMH 4HOYA 5KTPA 2O7SA 5FPSA 5F64A 3HUTA 4LHEA 1UXOA 1M7BA 4N3GA 1PSZA 2I6SA 2O48X 2FWNA 2G5CA 4H7KA 2OEPA 1A3GA 1JIJA 5EYPB 4FJ1A 5IEBA 3AKDA 2IXBA 3UKOA 2FN8A 2VSNA 2FMAA 3GGGA 2I62A 2O8BA 1MO6A 4DYDA 2ACVA 1E2UA 2EX4A 2V7XA 5DIFA 3IBGA 5DYGA 1CZKA 1BHQ1 4WBNB 1TO6A 1H1DA 4IFIA 3WQHA 3I9JA 3GRYA 4M1TA 5ECWA 5ITZA 3FFBA 2XZTA 2QTCA 4H08A 2NX2A 4RZSA 4FT4A 1R4ZA 4HBGA 1AKNA 1V11B 4WUVA 2VAWA 4QD3A 5LQJA 3QE4A 1X9HA 3RQIA 4LVCA 2R9VA 5EFZA 1J5XA 1YR1A 3MJCA 4AM8A 4E2FA 2GPTA 5J63A 5BV7A 2WA2A 2ZJ0A 4GFDA 2Q5CA 4Y2UA 3BERA 5DGIA 4WFJA 1EIWA 2ZRMA 3UC5A 4OHOA 3VNAA 5DZSA 4WESA 3CUTA 1V9PA 3PKIA 3W79A 4V0OA 1XD2B 3LWNA 4C04A 2QM7A 4BMZA 3R20A 4RJIA 2X77A 3LXXA 2QY6A 4QRHA 2QVCA 4HAZA 2IEIA 1E1LA 5AI5A 2X9NA 3F98A 2ILTA 1M1ZA 4DIEA 1KTAA 3OESA 4OHRA 4FP9A 3VVMA 3PW4A 4KMSA 1YU9A 1KI3A 3Q8SB 4FFOA 4NABA 2OPHA 1SUSA 5AHKA 1SBIA 2NXNA 4MULA 5IRCD 4MKFA 1FP2A 4D8XA 4PZDA 2QRQA 1JIVA 4H16A 2EYUA 4MUJA 4N1AA 5KT3A 3FMOB 3UATA 1JR3D 5HIAA 1VIMA 1MTOA 2I7CA 3M82A 1KP9A 2VJDA 2BR5A 1NUSA 2VKTA 2QLTA 1OKKD 1KFKB 2G82A 3GQBB 2FGJA 3BILA 2FP4B 3T15A 1II0A 2GKSA 4RXMA 4N6NA 4EBCA 2FZGA 2Q9AA 3WLKX 2QIPA 2PBRA 3PQ3A 4G5HA 4RLSA 4F3YA 3EF3A 2WF9A 5DK4A 5FO1A 5I7SA 3ROKA 1DRJA 4CFYA 2FPPB 4HQ6A 1B1AA 2BE9A 1LVUA 1XCPA 1PFQA 4YUWA 4QDTA 1Z4PX 4C4RA 4NEHB 2TS1A 4OBEA 1CUCA 2VLIA 5TR9A 1SCDA 2GK3A 1FTNA 5GWXA 1QPBA 5LFAA 2P5SA 3HJFA 4WPGA 1PBTA 3PR1A 2UVVA 3OZRA 3Q6IA 3PHGA 3PXBA 1Y3AA 3NIGB 4GBED 3FCEA 3UK6A 3VO8A 1SG0A 2NAPA 1P18A 3T1VA 3D0OA 1WBDA 3LY5A 1W581 5EPUA 4TLBA 3PQEA 2ZQ5A 1W19A 4FQ5A 1UOEA 3BDIA 4YMUA 4LSMA 3W3ZB 4Y2XA 1C7QA 2FZEA 4DV7H 3ESRA 1EFLA 1D8AA 1I94H 2QT9A 4EAQA 3ANTA 3TPFA 5KNCD 3SSNA 1OT3A 2UVQA 1GFZA 5MFPA 4PEVA 1AO0A 2CV0A 5BWCA 5ANRB 1IC6A 1W48A 1H2YA 5C80A 2VJNA 4BKRA 1K68A 3LQYA 5KYTA 4YBZB 4CT4B 3RTDA 3X2EA 3P2MA 3GUHA 1M1NA 3IN5A 4PFJA 1I36A 4F45A 4F4DA 3GTGA 3N0XA 2RAUA 4UPEA 1W0JD 4GLLA 5FDFA 2JH9A 1B42A 4HXGA 4YAJB 1CUUA 5KQGA 3H83A 4RHCA 1D5CA 1XD9A 1SCUB 2P9GA 2X4GA 4N18A 4FPXA 1G7CA 5CH8A 4WZBE 1Q14A 4CQMD 2CHQA 4E5KA 3EUWA 4PSUA 2IS2A 2OBXA 5PNTA 1AMUA 4A3KG 4QSMA 4GXQA 2J3KA 5IH7A 4YFYA 2JAQA 2XMGA 3MZ0A 3UUFA 5FPOA 3CVVA 3PKJA 4MRAA 5F1KA 1LF5A 2PWAA 5L9AA 4ND4A 2GKGA 3C3PA 3OJLA 2C9ZA 1ILWA 5I7EA 1Y1KE 1OXKB 2RGCA 4RCYA 2PWYA 1K8QA 4YP6A 1Z35A 3KE8A 1HBJA 4ZYWA 3H97A 2O1XA 1HDRA 2JGAA 3LIPA 3TW6A 1KZ1A 3CB2A 4MLZA 4YB8A 2ZI3A 4E3ZA 4GC9A 1PV1A 2EHDA 2I4TA 5E4FA 5AVTA 3IGFA 2XVMA 2R85A 3ETLA 3ZNPA 2VOEA 3KLMX 4HWOA 2WTNA 3CFYA 2W9BA 4AUKA 3NNDA 1H69A 3RVMA 3WNDA 1JHQA 1M5UA 1DIOB 4L3WA 1I13A 2ODQA 3ZJVA 5JW6A 2DUNA 2Y9PB 2O19A 2F3SA 3U3DA 4CV0A 1GLVA 3JAMW 4Y1RA 4KQWA 1ISMA 2RJ3A 5SZKB 1TYCA 3WYGA 2FMIA 3R7AA 4V1CA 4B46A 3WFJA 4YHHH 4FZRA 2C29D 3N8KA 1Z4JA 3WL7A 4ZCQA 3BQMB 2SKEA 2Q0HA 2A94A 4Y3UA 3JTMA 4V0KA 5I5YA 3H0EA 2H1VA 4JV5B 1BW9A 3KQVA 1P61B 5D1OA 2B8NA 3H9JA 3UAWA 1WU7A 3U44A 4LNUA 2GQRA 3DAAA 3VHRA 3L8GA 3VBEA 3U49A 1KAEA 5BNTA 3Q72A 3IT0A 1QHYA 4GOLD 3JATA 4KWEA 3EYAA 2C3YA 3H9UA 2FR0A 2CDBA 5TQJA 2ZJ4A 2Q50A 1D7OA 2OD2A 2X5JO 2GO1A 3UHOA 1F6WA 4OK5A 2HNKA 4TT3A 2IEZA 2UVWA 4H77A 3QSGA 2X4LA 2D5CA 2V5UA 3V1NA 4BATA 4JYBA 4ECYA 5JVDA 2PKYX 3WGKA 3IKLA 4D81A 4PYQA 1BDMA 1NNEA 1USUA 4D0SA 2GZAA 3JAWA 2P1RA 4TWBA 4KQMA 3WA7A 2GJ9A 1N2EA 1R15A 1ZN8A 5HSGA 4QLOA 4L6IA 2JA1A 3D3EA 3UYLA 2QNIA 4K9SA 4DRXB 1OV6A 2D1FA 3CLSC 4DXDA 5DWDA 2NP6A 4JJGA 1GV1A 4RTRA 4JGIA 1E7YA 2F2TA 2WWXA 2QVLA 4D9MA 4ER6A 4P9NA 4G84A 1CUDA 3VTAA 2WJ3A 2YNMD 4TLCA 4BLVA 4LOLA 2TMGA 3RUFA 5F4ZA 3S4YA 4LJKA 3VOSA 1SYXB 3DBLB 2O0JA 3DLCA 2HNAA 1VHJA 5AI0A 4TZKA 4RWEA 2YVLA 1OAKA 2GJSA 3KX2A 4KPUB 4CTJA 4LIPD 1IZZA 5DFAA 3SF8A 3I34X 4P08A 1XVAA 1Y9AA 1SA0A 1BVHA 4MUAA 1S5PA 4D56A 4DKXA 4PAWA 2VQFB 1D4OA 2V9CA 4YJ2A 3VJKA 3DV9A 1OASA 3CKMA 3WNBA 2ERYA 3Q4GA 1U9YA 4OO3A 2B0JA 4MA4A 3VR0A 4LNAA 1PN3A 3LL4A 3QVXA 3SC6A 5IUJC 1VPTA 1E1QD 5GJCA 4OHXA 4C87A 3ZV7A 2CSXA 4PZEA 1ZVQA 3COZA 4UHKA 1I2KA 1N25A 1USWA 3KJNA 2XBLA 1Z2DA 3DO8A 2GN1A 4TWAA 5BR7A 5FNVB 2GTIA 2AZMA 1ZUWA 2BHNA 2XB2A 3KQMA 3H9BA 3NHMA 5FEMA 3A4IA 2G76A 3R44A 3U61B 1C1DA 4IVNA 2J9YB 4F3RA 3C7CB 2XH8A 4NCBA 3V1YA 3OEEA 3AVYA 5IYZA 1KI2A 4YYZA 1EZZA 1WNFA 3B6ZA 2WTMA 5L1IA 3O4JA 3FAZA 2PA0A 4C4XA 4D8VA 3I2YX 3KDSE 4PLVA 4FE2A 3LT5A 3Q9LA 1P75A 1JDNA 2ZVPX 4AX4A 4N5IX 4JB8A 2C3OA 3GR6A 4G0OA 4D4HA 5K9ZA 4IVQA 4RD1A 4PLHA 3NT2A 3KYJB 3FHOA 4B3MB 1SQ6A 3E9RA 2VYVA 4OHPA 3IT3A 4PYOA 2A9JA 4XIIA 1MUUA 3HRIA 1P74A 3GL9A 4NU0A 2A0YA 4UKDA 5FCDA 1FYFA 3IV6A 3TJZA 1TU0A 2DWQA 3HR8A 5TGZA 2CLIB 4JLAA 4R3WA 2AV6A 2H31A 3O26A 4M99A 4DV0H 4BRSA 5ALLA 1KOJA 4E07A 1CTQA 1KR2A 1RHKA 1VJRA 3CH4B 2DABA 3GGOA 2HA3A 4PN3A 4I9HA 1IQPA 1WG8A 4DABA 2GJ4A 2XE6A 1XG5A 4RB2C 1TIBA 3GYBA 4R41A 3DHNA 4B9EA 3ND8A 5DQGA 3RIYA 3N6VA 1FP7A 1DAGA 4FI3F 3F5SA 4KI7A 1N0IA 2VTKA 4G1BA 1QGZA 2XTJA 4RD4A 2JK0A 2AN5A 5HQ3B 3JRWA 1KVRA 4KDCA 3S8YA 4FWTA 3GRPA 3ITEA 5CIQA 2CL7X 2E9SA 4HDCA 2JIRA 1KVUA 4WLVA 4UTRA 2Z4RA 3ZGNA 1JMVA 2WB4A 5TARA 4O3RA 4AYXA 1C9KA 4Z3OA 1MJHA 4FEAA 1HNNA 3GN1A 2Q2UA 3DEAA 2A1TR 2OKCA 2P2YA 1KGDA 2J9FA 6ADHA 3W8FA 4O7VA 1J2TA 1P1RA 2NTVA 1KQFA 2H8GA 2XNSA 3EC2A 4C2AA 1I2ZA 2O8DA 4KC0A 2XQGA 4JJEA 2COUA 1CG6A 1XKTA 3B2EA 2MCTA 2ZKLA 4XH9B 5BURA 1DCMA 4XQ9A 3QI7A 2R86A 4A26A 1C3OB 1MIOA 4NIMA 3I53A 1L5QA 5AW0A 2JJ1A 1G0OA 5K3DA 5FPYA 4HB2A 2WDZA 3BF8A 4JZYA 1ZOLA 2K7FA 1BEEA 1ZXXA 4Q1VA 4M76B 5CDGA 5CNKA 4BWFB 1M34A 4NZMA 3ZV3A 4V0SA 1LK7A 5AI9A 2XADA 3DAHA 1OH6A 2FEAA 2ZUUA 4J0FA 4POOA 1JV2B 3UKDA 1JHUA 4BNIA 2LGJA 4B7AA 1XEWX 2QMHA 3J80A 4JR2A 2R8YA 2C5HA 1KWKA 3DF7A 1PT6A 1HDXA 3IS3A 4E15A 3WSWA 3U7QB 5AW7A 3R3JA 4EB3A 2M6KA 2BFDA 2H0QA 2H2DA 4HJXA 3QWFA 3TN7A 4BAGA 2A78A 3P52A 5DXJA 4K2AA 1JPUA 4OUDA 3RIEA 5JAMA 2G4CA 2VSXA 4A3GG 3FWNA 5IZ4A 1YBMA 4EKDA 3Q5GA 1RI5A 3OMXA 4QJIA 2F3UA 4RTLA 5F1OA 4LJAA 2PH7A 5B5SA 3NCHA 4RF4A 1IPEA 4Q3BA 1CUSA 3LVFO 4LZJA 5ALQA 2QZPA 2XI4A 2W2PA 1VKJA 1RWNA 3F5MA 3V7WA 5EVCA 4Q6WA 2DIKA 4U7JA 1E7SA 1EFCA 3ESDA 3W9BA 2GXSA 1BE1A 4MJXA 4CMJA 3OPYI 3T5CA 2B63G 1U31A 4ZAYA 4NXNB 1B23P 4ZGGA 3O7WA 3WWEA 2DR2A 1MXHA 4AWBA 1Z22A 4HH0A 1YASA 3EG5A 2AOUA 5L3RA 1IBSA 1VE5A 3EDQA 2PY6A 2Q3HA 4RJJA 4Q7QA 3E53A 3LD9A 4ECQA 1QGUB 4CKBB 3A1EA 5IVDA 3V8PA 4BO5A 4ZAZA 3O8OB 4O4HF 2HJRA 2ABJA 3WC4A 3CUUA 2HZBA 3UWPA 4DR5B 3MGCA 1T2CA 1KEPA 5TEVA 1E89A 1NMEA 5C8YF 2ZANA 2CL6X 2A1TS 1RKQA 4TN1A 1FLNA 1W75A 2PV0A 4XLLA 1FTQA 3QKSB 2V7BA 5FL7A 2UDPA 5LB2A 2C57A 3GRAA 2R8HA 1XTSA 3CSSA 4MCJA 2DT8A 1SKUA 2CBZA 1DARA 1P17A 1S0OA 4MARA 1K97A 4HQFA 4NS4A 1E1RA 1ZK3A 3UJHA 4I36A 3FJOA 2Q6VA 3RPEA 1VIDA 1Z4KA 3USES 1OLXB 1NQTA 4KFSA 3QSYA 4JKYA 3WXMA 2BMEA 2PLAA 1K7FB 4IVRA 3M4IA 4ZVSA 3D4OA 4QGHA 4ZI2A 2WNSA 3N8NA 5EXTA 1KHHA 1RC0A 3C0FB 5ECDA 4LH7A 5K03A 3IDFA 1UBFA 3KLPX 4HDKA 3IUEA 1HOTA 2Q1YA 2JKVA 4W6QA 3OVMA 2HCFA 1RQPA 3VSBA 5L3ZA 1H0SA 1LWOA 1K7XB 1UPAA 4U6QA 2PZAA 4WNAA 4GEKA 4PZUA 3PXUA 1OXBB 3UV7A 2WFLB 3ZWNA 2XCSB 1S8FA 1MAAA 1FQOA 4J4TA 3V7NA 4X8LA 3IDZA 5A6SA 3KTAA 3SEFA 2BCJQ 4CT0A 1CIPA 1UDAA 3WK6A 4EQ6A 3RRFA 1BE8A 3T7SA 3WJ1A 4RV9A 4BVKA 1WEKA 4XWAA 3IUQA 3KT0A 4CE6A 3LPCA 2IYXA 2TMDA 2Z8XA 1AO3A 1BMTA 1FXWA 4UEWA 1RP7A 2X9GA 1GYFA 3HI4A 1P0MA 1VG8A 3VR4A 3EVGA 3KR0A 3OCXA 1H6AA 1JXQA 2DJIA 3HU5A 2VPIA 1AUQA 4BVGA 1ZETA 4JA2A 3NBAA 1MIHA 2AR0A 3LBAA 4MUHA 2YMQA 1SD2A 3FSJX 3UXHA 4IWYA 4OFXA 4EECA 4PHTA 4AS2A 4PFSA 4DMLA 2O2HA 5KWIA 1DPGA 2PR7A 3RW9A 1N75A 4QPZA 5KFKA 2ZJTA 1DTEA 2Y66A 3C16C 1EPUA 3QVSA 4ZVQA 5FWNA 2H5JA 3LKDA 5JDCC 1R5OA 1CETA 4TMWA 1EDDA 3OEHA 5B2ZA 4DLPA 1V95A 2VDNB 1P39A 4W9NA 2XA1A 1M0SA 2ZAYA 1UBSB 2PX0A 2HWXA 1PFKA 1EZ1A 1YJXA 2RDJA 3I1FA 4JI4B 4CIBA 4Q4AA 2OO5C 3USZA 4Z3KA 2ETVA 3AM4A 4X66B 1Q1GA 4FVTA 2JA6A 4IIGA 3FKSD 2XWJI 2QVZX 5J2TA 4R8UB 1E9SA 3MWDA 1FFBA 1APBA 2YTZA 4PYIA 2X1VA 2ZTSA 3MMNA 3AJ9A 1JAXA 2ODPA 2WKQA 2M1ZA 4B31A 3UCXA 3JQ9A 3SJCA 3IAS6 1Q1BA 3LYHA 2ORWA 3HR4A 1PZHA 1ZC4A 3TW7A 1B00A 4PG5A 5PGMA 2R66A 4WQMA 3B3JA 4ALJA 4QJ4A 5CA0B 1JXMA 1VSVA 1Z0KA 4JC5A 2CNVA 2ATXA 4NMLA 2IEAA 4UE6A 3HOVG 2FN9A 1ZJJA 4Y2SA 3RU7A 3CLRD 3KJZA 2AGVA 4Q3LA 1P7ZA 3DNMA 4RKWA 3G6XA 4XQGA 4RORA 2W2OA 3C0KA 3MQ2A 5AJVB 5C4IA 3OQPA 5LYYA 1V9CA 4YAKB 3GEGA 5KJFA 4BLRA 3H13A 4JELA 4PZ0A 5DXAA 5TPZD 3T61A 1VRWA 2VNAA 3KAPA 3DEHA 2BM0A 3FNFA 5G4KA 2PA3A 4E12A 2CNUA 3K2EA 5AK5A 4C7OB 1WZ2A 2C7RA 2NZUG 1C4KA 4ID3A 2H4XA 3UH1A 2GWHA 3M6IA 2XQVA 4RZ3A 1XMQB 3WFIA 4YGXB 1JXOA 4EMTA 1HZZC 2IZOA 1W94A 1LH0A 2DU8A 4C78A 3PPVA 1F8YA 4UD2A 2GPWA 2J6IA 4FYVA 1PJSA 4B85A 4FYYA 4RX1A 3W5IA 1UKAA 1F1JA 3RIXA 4UCUA 1C29B 3CVYA 1Q77A 1QV7A 5EOYA 1ABEA 3IAHA 4RMHA 3AWIA 4DT1A 2CHEA 5HBGA 2YHIA 3HJUA 4OH7A 4ED9A 3W7AA 3TZCA 3N70A 3NM5A 2XCOA 4INPA 5DHSA 3OD1A 4CFSA 1R6AA 3FNEA 4YIKA 3QXGA 4O2BA 1FY2A 2H9IA 3LWBA 2HO4A 4DIKA 3HP1A 3I9FA 4RTSA 4U7TB 3Q7TA 2BVNA 1X2EA 4RM2A 1TD9A 1BZYA 3QX8A 3KYDB 4X95A 1CRWG 3MD0A 1DXYA 4G4JA 1M2HA 3JZMA 4R16A 3W9UA 1RLUA 3ANMA 3PJGA 4JJFA 3PEEA 1VRCA 1DHRA 3BIWA 4KDFA 4U00A 4EFLA 1WUTA 2AI1A 2WTUA 3TY8A 4YYEA 3O38A 1Y8RB 1WHTA 4KXQA 1U0TA 2HRBA 3GZ4A 1WULS 3E1KA 4IJUA 2AEJA 3ETEA 4LHZA 1WSAA 5LLSA 3V8RA 3JX9A 3IL2A 3D0RA 3PVXA 3RF2A 3SI7A 5DGAA 2FZCA 4KTVE 1IZYA 3PRKE 4RZUA 3QBTA 3I72A 1XPRA 3BK1A 4UBLA 4CDNA 3VI3B 5KYKA 1N3YA 1DIBA 5EWMA 3CNQS 1CWUA 3DYVA 1P8AA 4C7JA 3VR4H 1XKXA 4RVCA 2XKKA 2QUHA 5CU7A 1EDEA 1B15A 1TEXA 4PHHA 4I55B 1P80A 1AXEA 1BOFA 3CX4A 4BNMA 3DL7A 2WM3A 3R7SA 3LWDA 5HKLA 2M6RA 4ZC1A 1J7KA 3PWSA 3UZBA 5FPHA 2BD0A 1DTSA 1OLSA 4AJHA 4MVJG 5HTOA 3VUEA 1DUVG 5AT1A 3IQWA 3SLGA 3I6YA 3NHRA 2ZIVB 1Z68A 2O6HA 4URWR 5AJHA 4YPVA 2D74A 1QONA 3C3BA 4KLNA 2Y0P<