2XCLA

Nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
421
structure length
421
Chain Sequence
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
publication title Nucleotide-Bound Structures of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase
rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 113
structure length 421
sequence length 421
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2xclA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2xclA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xclA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2xclA04
2IP4A 3K3PA 3U9SA 1DIKA 4E4TA 1B6RA 1VBGA 1VKZA 2VR1A 1M6VA 4Y8VB 1KJJA 1JKJB 2I87A 2V59A 4HNTA 1DV1A 4MAMA 2GQSA 2YS6A 2YW2A 2YRWA 5JVLA 1EYZA 2YRXA 4FFRA 4O4HF 1KJQA 3ETJA 3TIGA 3R5HA 3LP8A 3U54A 2W6NA 3BSSA 4HNUA 2YYAA 1WR2A 4O82A 2C00A 3K5IA 3TW6A 3VPDA 5BPFA 2R7MA 3HBLA 4O7ZA 4MV3A 2SCUB 2R84A 4EA7A 3RV3A 2ZDHA 1SCUB 5J2TF 2YWVA 2GPSA 2ZDGA 1JLLB 5C1OA 4I55F 5C1PA 2R82A 4O4LF 5I47A 3ORQA 4IZOA 5CB4F 1KJ9A 2XCLA 1Z2OX 5LA6F 3LWBA 2PBZA 2W6OA 2CNQA 4O2BF 2HGSA 2YZLA 4O7RA 3HB9A 1CS0A 2FP4B 1A9XA 4O7TA 1E4EB 4HQ6A 3JZFA 1B6SA 5BPHA 3TQTA 4MA5A 4O7YA 2Z02A 3MJFA 3VMMA 3RUPA 4YJ2F 3R5FA 3VOTA 1EZ1A 1C3OA 4O4IF 5FNVF 3KREA 1I7NA 1Z2NX 2CZGA 3K5HA 1CQIB 3MWEA 3HO8A 2W70A 3OUUA 5GONF 5KX5F 1PX2A 3AW8A 4EGQA 4MA0A 1ULZA 1AUVA 1KUTA 4FFNA 4IHJF 2W71A 2NU9B 2YZMA 3VPCA 2V5AA 4O7VA 4I50F 3Q2OA 4YBZB 2NUAB 1JDBB 3NUAA 5CA1F 4O7LA 4EAAA 5K2MA 2W6QA 2R85A 3N8DA 5CAEB 4EG0A 1OBGA 1M0WA 3R5XA 2W6PA 5JH7F 4MV4A 2NU7B 4EABA 3KALA 4MV6A 1E4EA 4YJ3F 1EUCB 1VBHA 3E5NA 4ZI7F 2YL2A 2V58A 3QFFA 5D8DA 1CQJB 4O2AF 4TV9F 4IWYA 4WBNF 3AX6A 4O7WA 2I8CA 1GSAA 2NU6B 2FB9A 2PN1A 4M9UA 3KAKA 4EA9A 2DZDA 5LYJF 2Z04A 4TV8F 4O7NA 3I12A 3BSYA 1CE8A 4J6EA 1KEEA 4M9CA 5KKNB 4FFPA 3VPBA 4MV7A 3V4ZA 2FPIB 3KAJA 4C5CA 5C8YF 2YZGA 4O86A 1UC9A 3VA7A 1M0TA 3OUZA 5LXTF 2YZNA 2DWCA 1GSHA 3WO1A 5H80A 2R7LA 2WYOA 3N6RA 1EHIA 4HR7A 1JDEA 5HV6A 1GGOA 5BMVF 5J2UF 4EGJA 4YB8B 4O84A 3ORRA 4MV9A 3G8DA 1KBLA 5HBRB 3ETHA 4YAKB 2R87A 2CNUA 2R6FA 3U55A 4TUYF 2NU8B 2PVPA 3JRWA 2DIKA 3U9TA 5DMXA 5CA0F 4DLKA 3TIIA 4IWXA 3BG5A 2QK4A 5EZYF 3GIDA 3WNZA 1IOWA 2R7NA 4O81A 2W6ZA 2VPQA 4ZHQF 1EUDB 2FPPB 1GLVA 3G8CA 4YAJB 2R86A 4C5AA 4FFMA 4L1KA 1Z2PX 3GLKA 2XD4A 2YS7A 1AUXA 1KJ8A 3BFPA 3RV4A 4QSHA 1IOVA 4M98A 2X0SA 3DF7A 3R9RA 2CQYA 2GQRA 2GLTA 1OBDA 4FFOA 2NPOA 2J9GA 1C30A 2VQDA 5LOVF 2GPWA 2QF7A 5LP6F 1BXRA 4FGRA 4XYLB 3JRXA 2DLNA 4MV1A 2R7KA 2ZDQA 4ME6A 5JQGF 4M99A 4C5BA 3UFXB 2VHEA 4MV8A 5JVDF 5JQWA 1A48A 1UC8A 4WD3A 4O83A 1W93A 3SE7A 3V4SA 4O4JF 1PK8A 4ZOLF 4O7SA 3R23A 1BNCA 4EA8A 4NYEA 2FPGB 1KJIA 4RZQA 2P0AA 4DIMA 2CNVA 4XX0B 4GGMX 3BSWA 4IIJF 5IYZF 3JZIA 4XYMB 1I7LA 4I4TF 1GSOA 4FE2A 3MWDA 2W6MA 4FFLA 4FU0A 1T36A 2I80A 4XZ3B 3WO0A 3Q1KA 1KC7A 2OLSA 1DV2A 4HNVA 4ZQIA 3RFCA 3TINA 1W96A 2HJWA
chains in the Genus database with same CATH superfamily
4DR6H 2D5LA 2JD1A 1CS0B 2QM3A 1DEKA 3NYWA 4GPD1 5DX1A 1PQPA 2DAPA 3DMRA 3SX4A 4GKJB 4BJ5A 2EU8A 3M5DA 4YRPA 3M3DA 2IY9A 5IBQA 3NBMA 3ZS8A 1OLUA 3T9AA 4Q03A 3SQDA 1F3OA 3GJ7A 2JZNA 3SZLA 1DEOA 5TGZA 4B3GA 4YWJA 2J3EA 1LVGA 3FM9A 2NPFA 3HLTA 1XMJA 1T3TA 1T0PA 5GTDA 4HDMB 1L5HA 4KGXA 1TQ8A 3RIXA 3BD6A 4XYMA 1D1SA 4E6NA 3MWJA 3IXQA 3K2BA 2JVIA 3W6PA 4Q02A 4HATA 4O4LF 3K1JA 4HBZA 1R6VA 4ZOAA 3LUHA 1MIOA 5FJ8G 2ZT8A 1T5SA 5I8WA 5LUAA 4GYYA 2FFJA 3AFIA 1UM8A 3VH1A 3U1BA 5F9LA 3IELA 3ZZTA 3L07A 2GETA 3JQ7A 1ULSA 5HCIA 4DNQA 4RJJA 2VBIA 2JBAB 1D4ZA 3H5AA 2W9XA 3D3KA 5IDWA 3FOZA 5JO9A 2QBYB 1PGJA 4U6PA 1XF9A 2IDJA 2QQ0A 1JEDA 4MYRA 3W8EA 3DLPX 1KC1A 4GZ3A 3J80A 2QMZA 2H2AA 4XUGB 2EBWA 3CQ9A 2XKBA 3CLSC 2E4UA 2WAAA 1N9GA 3ZY3A 1LI5A 2D6FA 2D59A 3TLAA 2H48A 3TEMA 3N7UA 3DZBA 3DJFA 2VP9A 4RDXA 4B4OA 4FFVA 2PSHA 4BLPA 2KS6A 3TOCA 4LJ4A 5BR8B 4UHFA 1ZM2A 2Z8YM 4DS3A 3NHBA 1PFQA 2PXCA 3QUSA 4B43A 5TMPA 5L40A 1OZAA 2XNJA 1GU7A 1I9GA 5JJBA 4NBVA 1JIUA 4GR9A 1ZIPA 1NQXA 4OHMA 5H16A 3ZLVA 1EIZA 2OUKA 4MARA 3WWIA 1VIVA 3NHAA 4HDSA 1VYVA 3B48A 1I3QA 5EUBA 2ZB7A 4DIBA 5ABPA 3RVKA 4H27A 3JATB 2WILA 3FPSA 1UWCA 3I42A 4CMIB 4WCFA 1KZHA 4BHTA 4B3TB 2XYHA 1WOMA 2Y6VA 1JIVA 3BCSA 3JARA 4J6FA 4LRYA 2VXYA 3AKCA 1J8FA 5B2EA 1G7TA 3JYPA 1XP5A 1IBLH 2BGGA 3TTVA 4ZRNA 2XYRA 1YRWA 3WNDA 1GYFA 1KO5A 4ZTZB 2VBCA 4PSCA 3SDSA 4JBGA 1SR8A 3F6CA 1EFAA 1XVAA 4MRMB 1Y1TA 4N18A 1IBRA 4X64H 4MUAA 2Z9CA 3GZTB 2Z6AA 4GLJA 3V2HA 1M75A 4AG5A 2NV0A 2QNIA 3LC2O 1QG2A 4DV4B 2VT3A 2IXTA 3O2SB 4RKEA 1JA0A 4XEHA 2XEDA 5K8TA 1HDXA 2D4HA 4UAUA 3E7WA 3R9WA 3SJZA 1KZYC 1E7SA 1R6BX 2AFIB 9LDTA 3FFAA 5EKTA 2WVJA 3QNWA 2CNVA 2XMZA 2Q27A 3N8KA 1PUXA 3AL0C 3DT9A 2UUAB 3K5WA 1IZ9A 2F3PA 2I80A 2VC2B 4M49A 2WKRA 4FWBA 1P0QA 1ADJA 4KQKA 4RHTA 2WNHA 1GNVA 5PGMA 5DLEA 1AF7A 5F35A 4P4NA 4EVSA 3KDSE 3AUUA 1K7CA 2ST1A 4IM7A 3PQCA 4O1IA 1KO7A 1PFYA 1DIKA 2A1TR 1FEZA 2ONZA 4ZMSA 4R40A 1NFRA 1HKHA 5AESA 1KSHA 1S89A 2R6GA 5DN6A 2Q4OA 4DCJA 2QRLA 1R5OA 3AG5A 1NULA 3PHIA 4EB3A 3G17A 3TDNA 1IDOA 1Z4PX 4HGRA 2ZYGA 1HE1C 4JC5A 3G9TA 2P5SA 3VV2A 2XUDA 1UJ5A 3KR2A 2JFVA 3LJKA 2CYAA 4KXYA 5GIPE 2A1IA 3EQ2A 3NUQA 3WKAA 1U3VA 2WM3A 4DAOA 3ESZA 5JDIA 1PT6A 1W49A 1IQUA 2D74A 4LGMA 2D4AA 4BPRA 5C4IA 2C2YA 4A27A 4PHTA 1DIBA 2I4OA 3I9LA 3CKMA 4IDPA 1FDIA 3I8OA 2RG1A 3MJEA 5FWNA 2EF1A 3A1DA 2C58A 2FP4B 2PGJA 1G9TA 1C3XA 1G98A 4LCBA 5KQLA 5EG5A 1J23A 4JV1A 3IDZA 1AB6A 1OI2A 3A1NA 4NU0A 1ORDA 2RDIA 3GG2A 1Z6ZA 2DWOA 4IRXA 4OBBA 3PICA 5GV8A 3A1SA 1Z0DA 1ZH0A 3WE7A 5BNZA 2FLNA 3R3XA 4C4YA 5AKKA 4EPWA 4F3CA 1JALA 2OV2A 1OH6A 4R2IA 5LL6P 4TROA 3E3AA 2CUNA 3HJGA 1P74A 1DC5A 3W0LB 1MORA 1SXJD 3EGXA 2UYYA 4X9XA 4C01A 1E1MA 1U81A 2QN8A 2OXIA 4UTXA 1R1DA 3LGAA 4KIWA 3FYUB 5KYVA 3HE3A 3ZCTA 4XSVA 2EEZA 4DXAA 2VRBA 1G0OA 2A5FA 2YFKA 4P7GA 2JI8A 2ZE8A 5KUTA 4DL4A 1H1LB 4AN0A 1G8JA 2ISSD 2GCOA 4HTFA 3N8NA 4F3TA 3E5NA 2PU7A 1AC5A 3HUUA 3SVLA 3ZWWA 4I1SA 4C1NA 1GSAA 1Z5GA 2MINA 3OLQA 4NTZA 5KFOA 5DSZA 1DUSA 1VLVA 3Q3EA 4TV8F 4GAEA 3NWEA 4YT2A 1Y80A 4KAJA 4UZSA 4LE1A 3UWPA 1D6MA 1QU2A 3G2QA 3K70C 3FKQA 3IOEA 3MUEA 3P9PA 1O5IA 2Y1XA 4ZAFA 4ZEMA 3IBSA 1I94H 1FYVA 4EVRA 2V45A 3B3AA 5BO5A 4A15A 5K3OA 1RJPA 3RYIA 2BGNA 5H80A 3QEAZ 2Q0SA 3C87A 1ZL2A 3H2KA 2QQGA 3A4LA 3LHSA 3BVPA 1CJUC 1S9FA 2JD2A 4KJXA 1T29A 4B4WA 3DBOB 2Q3HA 4D9GA 1BXGB 4YCAA 3SP1A 4CF4A 2PVPA 1XT6A 3WNVA 2GD0A 3KJXA 2NZ8A 3INNA 2B3DA 2XWPA 2VLIA 4Q7EA 5DM70 1LI4A 2JJQA 4U7CA 2HR1A 1KY3A 2I6UA 4PHFA 5FLMG 4LGVA 1KMIY 4NLGA 4FFMA 1SMKA 4CIDA 1XAIA 2EW1A 4DANA 3AB7A 5ICEA 3ESBA 3QFHA 1GZ5A 2OHJA 1KYTA 1NG9A 3KKOA 1OBDA 1CR2A 4BWSC 2LIPA 1SH7A 3DH0A 1VRCA 3RSFA 4HLUC 4R8KA 5KMGA 3LUKA 1BXRA 1TM1E 1A8UA 2Z2KA 3RF7A 2JIOA 4AJ1A 3A31A 5AK0A 2VWHA 3D59A 2B7BA 1QHSA 1P3DA 4KE8A 1U31A 1U0RA 2ZYWX 3QBTA 5TQ0B 5JCJA 1CLEA 1SPXA 4O7SA 1BNCA 5KFCA 4GMKA 4ZJUA 4Q4JB 1M6EX 4DNXA 3U09A 1SUPA 5DULA 3ZQ4A 2LKCA 1T0IA 1GNRA 1R4MB 2V6MA 3QLUC 1ZNZA 2VAXA 1V7QA 1TD1A 4RIGA 3GGPA 4AIRA 3BRWA 4YAFA 1CF9A 3I6YA 4U9UA 4GT1A 2A59A 4K0KB 3RVDA 3HL0A 4HCJA 3O4GA 4D5EA 3X1DA 4K8OA 2J32A 4LXQA 3RRJA 1RXVA 4NECA 4JI5H 5G02A 3A11A 3QMVA 1LA2A 3GT4A 1N92A 4EB8A 1VHDA 3IBTA 2CV0A 1P9WA 1N3LA 1D2CA 3WGUA 1CDEA 3L1KA 4JJFA 3JWGA 5KT3A 4LVUA 4YQWA 2XTNA 1WUTA 2WDZA 5ICFA 2D7JA 4S3MA 1W0KA 5TS2A 2EZ9A 2X1LA 4DR2H 2R4QA 3CXUA 3CZAA 4HNAB 4OHYA 4Q0MA 4OHCA 1YVRA 1CUAA 1RQNA 5EIHA 1SXIA 1BU8A 1CK4A 1XGKA 4UZEA 3AKZA 4L3VA 3TLKA 2OHIA 3ZQUA 2QG4A 3EVEA 1WCMA 3HKCA 4NBLA 3E5MA 3JQ6A 4MVWA 3WIUA 3BN3A 4F4JA 4O2BF 1BS2A 3B6MA 3SZGA 5ENDA 1KYZA 2PZJA 1ESCA 2JAUA 1DQZA 2EIXA 3ZC3A 1D2AA 4U02A 4U6NA 4YDQA 2HF9A 5F76A 3LUGA 4U0KA 1X3SA 3NM6B 2BZ1A 4RLQA 4BDSA 2SCUA 1ZMXA 3ITKA 4L3WA 2O7RA 1E9VA 1KUTA 5B1SA 1MJ5A 5EKXA 1KP2A 3ROMA 2OOSA 3OZCA 3EEIA 2WYWA 5EMHA 1JLLA 5CDTA 1V7CA 1R5NA 5ELLA 3IEMA 3F3KA 4HRAA 1OAOA 5DASA 3HEAA 2OZKA 3BBLA 1BOFA 1L7MA 2J9RA 4L6CA 3BWYA 1E4EA 3F67A 2I71A 1WD5A 5C3EG 4MW7A 5CVTA 2Q9AA 1VL8A 2ZUTA 1B1CA 4FLEA 2J9XB 3ZR4B 4O33A 4M0LA 3U44B 1KQPA 1T9GR 2YJGA 1DAHA 4ETIA 1JFLA 5COAA 4BO3A 5LYJF 4OL9A 4YP6A 1JIHA 5J2UA 4TPKA 1P75A 3FVVA 3WGJA 2FN4A 1UBRS 2YCLA 4MYSA 3EZ6A 4AC9A 2GVNA 2GZRA 2VDMB 5EHNA 2FPUA 1SB8A 2I2WA 1WR8A 2J7PD 2ZIGA 4B76A 4B2IA 1XEAA 2DLDA 1AK9A 3ENQA 2ZVPX 3EH2A 7MHTA 5ALQA 4ZHQA 1GGOA 1LLCA 2ZJOA 3I01A 1KDTA 4YB8B 4EK9A 5TX7A 3MMPA 4LV6A 3KHUA 4B9AA 3WHKA 2EAUA 1Q16A 3KOUA 3VTKA 3FUTA 4QTYA 4RD0A 4IUCS 6GPBA 4QGSA 1WMDA 1TT5B 3BK7A 1PQWA 3U7IA 3V8VA 1JAYA 1XB2A 3T35A 4WK4B 3CF6R 2LUOA 3QUTA 1WPRA 3I53A 4L9AA 1NIJA 3T7EA 1YK1A 4DZTA 1UMKA 3ACDA 4IZIA 4MWTA 1K5PA 3LO8A 3NW9A 4FMCB 1R9JA 2XD9A 4JR1A 2CXQA 2HU5A 3B78A 2ZSJA 4CN9A 4EYHB 5KT2A 2QXYA 1E99A 5B4TA 3TY5A 3NRCA 3SZ3A 3U3XA 1X6VA 1J0XO 4XYLB 1DJNA 1TZCA 1VE9A 4BBJA 2ZDQA 1UINA 3OO0A 1P2VA 1KKLA 3K0FA 4PO1A 3U4IA 1FS6A 2JGRA 1U0LA 4IV8A 4BMCA 1GPMA 2B1JA 5CXUA 2YXDA 1L5QA 3TSCA 2UVVA 5FBKA 1N36B 1TFRA 2XCPA 5KFLA 4ND8B 1AO0A 2NZXA 1AO3A 3IUQA 5DEIA 3I61A 4KSYA 2Q1WA 3TQSA 5E25A 4FMBB 2Y0EA 5HTKA 1GKLA 2GEVA 4MS3B 3FVWA 4K9NA 1YDMA 2HU8A 3H7AA 3RB6A 3NC0B 2X4LA 2RE8A 3O2JA 3RS2A 3ZE7A 3G6XA 1HT2E 2J48A 1VC2A 2E87A 3IFSA 1SBTA 1R5JA 2VNKA 1M2FA 1CDZA 4HB4A 4GG1A 2WJ3A 5TPZD 3ONVA 1PWEA 1ZK4A 2NM0A 4QWCA 1V4VA 4PWZA 4PGGA 2FK8A 4MEBA 4YJHA 2G82A 4EA6A 4S35A 1D7AA 1FTYA 3H0EA 3NHUA 4PZAA 3UMJA 4AWBA 3HGTA 4OGWA 5DGAA 4IDNA 1GVNB 2WTMA 1C0LA 4W9NA 3TE6A 4BO9A 3LWBA 3C3BA 2DETA 3GEHA 5LCXA 5KCZA 3T7JA 5LNK6 2Y77A 4BMDA 2OFOA 3D8TA 1EH5A 1S2MA 2OK8A 4L4SA 3H4IA 3DBLA 3JZFA 2D1SA 3IT2A 1A4IA 1TMYA 3EXFA 1ZUHA 2OBXA 4OI4A 4LBYA 2UUPA 3R40A 2C2OA 2IBTA 1CU1A 2O50A 1Q7RA 3OSZA 3DSRA 5K0ZA 1HUQA 3L8MA 2QTNA 4P1ZA 4E5VA 1C3LA 1IWPB 3KM0A 1VIAA 2NO9A 1ZK0A 1CBUA 3FNHA 4KV7A 3N1UA 1P29A 3B20A 3L2OB 3OE1A 3S28A 1YQ9A 5EJ8A 1IXKA 2IHUA 3MMSA 3Q41A 2GA8A 1O9HA 1PTJC 4AP6A 4MROA 2ZWVA 3V5NA 4QYWA 4CLRA 3RWBA 4BNTA 2R85A 3TGLA 1Y6ZA 5A71A 4YROA 1BROA 5I7AA 4BQPA 1QORA 5DBEX 5EN4A 1KPIA 3FVRA 1Y9AA 4FFBB 1UDCA 1OX6A 4QGBA 3SQXA 3QYJA 1YBVA 4DXHA 1BWSA 1NNLA 2H1FA 4TV9F 3BGWA 4ZEWA 3PXAA 2OXCA 3B5EA 5BYBA 2C28A 5IYZA 1WCIB 3I9FA 1Q0UA 5DYYA 4NBUA 1N75A 4L16A 1FVXA 3KJZA 3AJEA 2H54A 2X14A 5FXMA 1O9GA 4BCCA 1NW5A 3SI7A 2RGAA 3ZZMA 2Q3EA 4AI6A 5HZMA 2AGVA 1B23P 1V8PA 2XDQB 5KFIA 3EZYA 1LF0A 3DFZA 1ET0A 2DQKA 1C30B 2GQ0A 3M1IA 2BFFB 5AKHA 5A4FS 2YNMD 4H3KB 5JJLA 2OH2A 4QOHA 2E4XA 1BE0A 1VYHA 1G7RA 3MR5A 3AGQA 5D1NA 3BE5A 5KFKA 3G8DA 3DE5X 3I45A 1AQIA 3CEBA 4MGHA 2CCKA 1PL7A 1BG6A 2NU8B 5K9ZA 3RBXA 2CNBA 3MUOA 4S04A 2G08A 2CD7A 5T4BA 4N40A 1K8QA 1OY1A 4AKIA 1QNLA 4O29A 5ALRA 3W3ZB 1G9SA 1JH8A 4M0MA 1FRZA 1FDSA 4WNAB 4FZ5A 5DGBA 5DCWA 3GR6A 1GCUA 4CG2A 2BGKA 1BKYA 4IHKA 2EDAA 1RM3A 1MFPA 4BMZA 3OKFA 3ZE8A 4KKVA 4KLAA 4XGIA 3OSPA 3BFKA 5KYUA 1LBQA 1KERA 2UVPB 4RVFA 1SC1A 2EYUA 4EUEA 2CC2A 4FGJA 4H2DA 1QKIA 2JLQA 3TR0A 4JASB 4PG6A 1E8DA 2AE2A 2XYGA 3Q87B 3C6YA 4R8LA 3UB4A 4Q1BA 3BJIC 3HN2A 1J4AA 2C22A 3S7ZA 1R0WA 1A48A 2ZUDA 1DAPA 2HJVA 5AIBA 3VU1A 2CKZB 4DREA 3OY7A 5GJCA 4D9MA 4HJRA 4F4UA 2A0FA 1C2TA 1B8VA 3E9QA 5LZ7A 3JALA 3ABOB 3E15A 3HOXG 4HFRA 5ECYA 3E3NA 1RC1A 2DX7A 3V4LA 1I1NA 2AJBA 1IATA 3DPIA 5B1EA 4JXXA 3SY8A 1DJOA 2BM0A 1W19A 2GAFA 1P73A 3N0WA 3WRXC 2YUIA 5JZMA 2BSQA 5BWWA 3OZEA 4HDAA 2E85A 5KWEA 4Y2JA 3CH5A 5JCJD 1A8QA 4JS0A 3VPHA 1XU9A 3UEOA 1P31A 4CEJB 3UB3A 3DCIA 1O5TA 4CKWB 3A9WA 2H9IA 3RHTA 2H6EA 1NBHA 2P4QA 3KXLA 2N46A 3A6HA 4HH3C 1YJ5A 2ODAA 5C7IO 4XKJA 1JUDA 2ZCVA 3VSAA 1SCUB 4QRDA 1EK6A 3PDWA 3HCFA 4ALIA 3LPLA 3F1LA 2IYQA 5F2KA 3BRWD 2JK0A 1Q15A 1V0JA 5JCZA 8ATCA 3MXOA 4EFKA 4IW3B 5TQ2A 5KT4A 5GGYA 3G5MA 4E0BA 1MB4A 4O7TA 5IWAH 3WKBA 3ZDFA 5C1BA 1H85A 3IALA 5JSFA 3A1VA 4H31A 2H7XA 4K9KA 1C14A 3N9IA 3BDVA 4YALA 1PS0A 5I45A 5CM8B 1EGAA 3JQ8A 2GCGA 3LCUA 3WKEA 1XPUA 2ZM5A 2CDAA 2CMFA 2PFKA 3VZCA 4DAAA 2BFBB 3UAXA 4NV1A 1N0UA 1RKXA 1ODCA 4GRAA 1KSFX 3U9LA 3VVBA 3CLKA 5DTQA 4HX2A 5BV2P 3I4LA 3AEUB 1XEWX 2PX0A 3HNOA 5CEFA 5JC8A 2C95A 5D1PA 3PPIA 5HUHA 4JB2A 4PEVA 4NMXB 1DO8A 2PQMA 1JDTA 2OGWA 1KVRA 1JFFA 1TOAA 2AXNA 1RWPA 1XFDA 4URUR 3ICEA 2VTEA 4AUKA 3OZUA 3QITA 4D02A 1ZP6A 1M6VB 1Z36A 3A0UA 1L4KA 3LD9A 1C1HA 4CV1A 2A5YB 5DHFA 4XB2A 2Q45A 1JDSA 2ERYA 1ZD4A 3NYRA 4BAUA 5D7NA 1VHLA 3IAUA 1IY1A 5FOQA 4LNHA 3FOBA 4I9HA 2YZGA 1Q7EA 4PC3A 2ZR7A 2Q1YA 2FNAA 5JTUA 3H2JA 3SEQA 2Z2IA 2ZGVA 3GEGA 1B8PA 1ZRSA 3FLMA 4J7XA 1X7DA 821PA 1QQ5A 3EBLA 5A3SA 1IYZA 3GLSA 5CVEA 4YAUA 1G7CA 3V7FA 1HYBA 4YFVA 2QGZA 2EGHA 4RKYA 2H7VA 5IN5A 1DBVO 4EB6A 2PXHA 3J7TA 1TJPB 3GB9A 1OR8A 2CUZA 2O8CA 1Y42X 2XAAA 2CXXA 3BA8A 2G4LA 1P6QA 5I8PA 1ODTC 3GMDA 3DAHA 2VAPA 1GSIA 4YREA 1X86B 2PMFA 4PCVA 2D5CA 5FR2A 1UIMA 1LV7A 4REQB 2WAQA 2YN2A 3EIUA 3O2NA 1U8ZA 1TWHA 5CX4A 5H59A 1C4XA 4JCOA 3C16C 1AUQA 1WXHA 5IDXA 1MG0A 3SLRA 2C9YA 2DUUA 3GIQA 4OV6B 1D07A 2FUG6 4HNSA 4WZ6A 1UBUS 3QELB 3C4VA 2HVQA 1SC4A 2M2IA 2ZTMA 1VI6A 1AZLA 4M3NA 3VAAA 4DQKA 1AGPA 4MEJA 1KOJA 1YJAA 2GEJA 3PDIB 4ECYA 2W8BB 3EK2A 2ZPUA 1Q11A 4RSGA 3QNMA 3JZIA 4LQ4A 3ONNA 4N5DA 2B63A 4WNIA 1NOKA 2O14A 1ZIXA 1P1KA 3WISA 1PZXA 1Z2AA 3UUFA 3WK7A 2YJ3A 3F6BX 4BOYA 3EWAA 5EC8A 1KWGA 5JNTA 5KFTA 4DUZH 4LMPA 1ZHQA 2LNDA 1LPOA 1HNXB 5HKBA 4N01A 1X1BA 1V71A 3O38A 3TQRA 2CF6A 1E2EA 3X1WA 1C7EA 2E18A 4XWAA 1L1EA 3AEXA 1M1XB 4ZVKA 4FWTA 2P9ZA 4X60A 1RVV1 2PMEA 3NHFA 3VHQA 3V6HA 4DDWA 3I6QA 2ZBFA 4YAWA 4EA7A 1G4UR 3MTQA 4YLGA 3TD6A 3KU1A 1OPXA 3L6OO 3WKCA 1RYMA 4YJFB 2KMLA 1KBOA 1G1AA 3I2JA 3QWBA 1VPDA 5KPDA 3DVSX 3KVYA 1NRIA 3HWWA 3L8EA 2YMPA 1E0JA 4DIKA 3I34X 2QW0X 2JFQA 3WGTA 1VJ5A 2NNWB 1MHPA 4WECA 3R7WA 3P9KA 1ZC4A 4RTOA 4YY3B 2IU0A 1CJMA 4ARIA 3GQBB 1Z0IA 2J0SA 4QBHA 5L7TA 2HLPA 5EJMA 4D9IA 1VJTA 3JZ6A 5C0OE 2C2GA 4TKUA 3Q6MA 5TXGA 4CCWA 3EBOA 5C4GB 2PKQO 4AS3A 2TMGA 2WU8A 3B3FA 4M8IA 2FK1A 3AW8A 1CE8B 4JJ6A 5DTIA 4L95C 1KEEB 5IC4A 3L6EA 3IC5A 3DTNA 1UXHA 3DT6A 1JPVA 1LDMA 1R3DA 4FLMA 2HADA 1JG4A 4LAFA 4HDNB 2G9QA 3PUZA 3DOOA 3DNFA 1CW2B 4TV8A 4JLBA 4ETMA 1A9OA 2NU7B 2VP3A 4IJWA 3KALA 5EOYA 4RTPA 4GR5A 1U8CB 3H8VA 4EATA 4FB5A 4PQFA 1W36B 1FP4B 3P0IA 1MKYA 1RIIA 1E7RA 1IEXA 2FDRA 3FUWA 5AVVA 5E6RB 1ZGAA 3P0RA 1IY2A 3HVUA 3L8FA 4I4TA 4L2IA 1SHKA 4GR4A 3CR7A 4RQAA 1YE3A 3GJQA 1OH5A 5IM4F 1JU9A 3MT7A 2W7PA 2ZZKA 1YQQA 2M98A 3BZUA 4QXQA 5AMXA 2VF5X 1U4OA 1CP3A 3LCMA 3FPAA 5AI5A 4LHVA 2ASJA 2AN9A 3ND8A 4NYJR 4DJJA 3ILXA 2B2XA 1VKRA 5LVAA 1ZICA 1DX9A 2Q07A 2AUNA 4S1TA 3B9BA 4QFBA 5FA8A 3HOYG 3DVAB 1IBSA 1VG9B 3DCNA 1PEYA 4EIWA 4Y6PA 5GVRA 4P58A 5DMXA 3C7CB 3QXHA 3CUVA 2WHXA 3WLAA 2F7SA 4BYGA 3WMWA 2I2CA 4DIFA 5IH3A 4TM8A 3PNQA 5GM2A 3BABA 3HY3A 1WMFA 3FW1A 2OLJA 2BUAA 3F46A 3AQ4A 3IVAA 4FNAA 3L8DA 5AW4A 3F74A 4F7WA 4OK6A 2V0GA 3PS9A 1NLZA 4PYNA 4TXHA 5IAAA 4HH1A 1O95D 5LLSA 1S3SA 1OSNA 2VUUA 1SXJA 5CUQA 3RLFA 4YJ2A 5F1KA 4CHTA 4YASA 1LSOA 3O4FA 1HMPA 4IGEA 1DQSA 5FOUA 1TYEB 3I2HA 4C0KA 5AUPB 2ASVA 1M7HA 4RZQA 5KC8A 3SR4A 3ZZ0A 1C80A 1DKUA 3GBVA 4I8XA 1N8NA 1AKYA 3WICA 2V9CA 3FAZA 1DXOA 4OHRA 5JARA 1OI7A 4Z1MA 2EKDA 4CKEB 1WV0A 4YAJA 3LAWA 2ZS7A 4RLHA 4Z6KA 5AM1A 3P97A 2DFTA 4PXSA 4FWIB 5JMPA 1V9SA 4FCTA 1E2FA 1TIBA 1RBYA 3F9IA 4PDBA 2I6FA 2H5LA 3WGVA 5A3JA 2ILVA 1EDBA 5B55A 3CS3A 1JIKA 4Q3LA 3SXJA 2IF2A 1NXSA 2MU1A 5TIIA 2OKCA 3GFQA 3WGGA 3UQ8A 2IIBA 1TMKA 2R6HA 1O75A 2VNJA 1IAQA 4BE9A 3FPKA 5KG1A 4O2BA 3V8QA 5L6MB 3S2SA 4TMZA 4ZCSA 2ZW9A 4XJTA 5EE5B 4U4AA 3GYGA 4JAVC 1E5TA 8AT1A 4LHXA 3HRHA 4V39A 2G9UA 2Y1FA 1DZ3A 3IB6A 5BSRA 2EWMA 2GXQA 1OGJA 1WV1A 5GJWC 2C8LA 3R5TA 1OLSB 4I5FA 4TVSA 1FLDA 2PUVA 1M9NA 4HLUA 2YVLA 2N1BA 3G7UA 3OU6A 1OJ7A 1CULC 4QPCA 1CZNA 1CJBA 2P65A 4I6EA 1T43A 1T9ZA 4N7BA 1PJCA 5FOSA 1PS9A 4RIEA 4HGYA 1MDBA 2VH5R 1C3EA 3MJFA 2JFZA 2I9PA 3R5FA 1L6RA 3PDJA 4KIUA 2X5JO 1WB9A 3DLTA 3NASA 4OQLA 1EGMB 2HO4A 1UZMA 5KWVA 5BV8A 5SZJA 3ECAA 3ISJA 2XH8A 4FK8A 1RTTA 4PZCA 3MJ4A 2EVWX 4KN6A 4KO4S 3QLUA 1GHTA 1FNNA 3SF0A 4U7TB 3KNZA 4OUDB 4K9QA 3L0SA 1OBCA 2GZHA 4XM1A 1WUHS 2FSVC 4PHCA 1NHWA 2VCEA 3KT8A 1VA4A 4Y98A 3VPFA 5J4YA 2NXNA 4U2FA 5FLXW 2WVGA 3TY9A 2I4NA 4ZEXA 9ATCA 4MW2A 3G1TA 4Y1RA 1HMYA 2I2BA 2X2PA 4Z3DA 4P7KA 5LYJA 1T6XA 4IJMA 3ZGVA 3R5XA 3NJRA 4UHBA 4RHEA 3MQ4A 4NF2A 4EABA 4B47A 5HUJA 3T1VA 3FHLA 1P9NA 4Y9UA 5ER9A 1ADBA 3P9NA 4D9EA 2WI8A 2VRNA 5JMWA 3AEQA 1V5FA 3G9QA 1LK7A 4CM4B 1XXHA 3UATA 2R8JA 4RB1A 1JYSA 2OCLA 4FOLA 3WTCA 1U0TA 3GCGA 5T6BA 5JQGB 3JAMA 1KYXA 3WLNA 1T9CA 3GJ6A 3DXXA 4JJIA 1IBMH 3RNOA 4DQ0A 4B6GA 1EP1B 1DMRA 2HBRA 1F8FA 4KYVA 1J25A 5KC9A 4QRHA 1NQUA 2FOLA 2WYOA 1P6UA 2JCGA 4KQGA 4BLRA 3GA0A 1T0JB 4X0EA 1QMPA 3PKJA 4LZJA 3PP8A 2QTMA 1GZ4A 2FRDC 3OF2A 4TUYF 2A5GA 4ZQHA 3MTJA 3O8OA 1ESNA 1YFZA 3C74A 5DISB 1LPMA 5J63A 4RVGA 2B8TA 2KHZA 3SHTA 2BMJA 3NIGB 1OX4A 1KFCB 2I34A 5HR5A 3P5BA 2PDAA 3KVRA 5FORA 2NU6A 2IITA 4RZUA 5FULA 1U7TA 3K9WA 2HW8A 1I14A 4J0QA 1L7NA 5CFZA 5D51S 3SIRA 4HEHA 4MK4A 4U00A 3VDXA 1DBPA 5I4KA 4FT2A 2K7FA 2CN1A 4Q24A 1BMDA 5ERYA 3TQFA 5F23A 4DYDA 3A6KA 2A9OA 5K8CA 1IZ8A 4B6FA 3GJSA 1HKUA 4AT1A 3D5EA 2GF9A 3VJMA 2NSDA 2DF8A 3K4HA 3UT5A 3OPYA 4URHA 4EZBA 1UC8A 1SOAA 4XGRA 1G55A 2BLLA 5EFZA 1UDWA 3JD0A 3IR5A 4GMXA 3KZXA 4WFQA 4W5NA 3CLSD 4URXR 3AUKA 3UPUA 1YDEA 4QA9A 1WXEA 1ONSA 3L8HA 3RWOA 2QL9A 2O3UA 3DBVO 4S24A 3GK3A 1GKYA 5HZGA 2VZ9A 4CU5A 4R2JA 4ENRA 1HWYA 4I1YA 1RXIA 2IP4A 3DZJA 1EKFA 3O0DA 4I4LA 3NBYC 3REQA 1T3ZA 4YV1A 4BS9A 2YKGA 1CTQA 2AN3A 1QDUA 2QYTA 2YFYA 3O95A 3HBNA 1GEGA 4ZVSA 4UEWA 4ZZ1A 3A06A 1FFXB 3BAZA 2ESRA 1BSVA 4EFMA 2J7PA 5TR9A 2B6HA 2C2BA 4RFSA 2P4HX 4D4KA 1XQ6A 1C3VA 2B21A 3HFGA 5EZ6B 4ENTA 3V97A 1EK5A 1DEAA 4A6EA 1F7VA 4P7JA 2PT6A 4QTUB 3RK1A 2DM6A 2NXWA 4J4HA 5ETJA 4CM7A 4EHFA 2P27A 4C2TA 2VWQA 1N5DA 4FB4A 2EFCB 2SKCA 1YS6A 5BQPA 3ASVA 4MB0A 3J81W 1EAYA 1J20A 5HTOA 1QIHA 4ED1A 2QZZA 3ETNA 4X7BA 4EL0A 4G1UC 3KQNA 4NATA 3R3JA 1T5IA 3GAMA 3HTXA 1M2OA 2IDMA 2Q7XA 1Q1QA 1BOOA 5T7BA 3DWIA 2VQ3A 2WWTA 3OCXA 2HHJA 3OX4A 2AOUB 1DCTA 1J07A 2Q9BA 4GM0A 3K5HA 1BCSB 1T9HA 4X65H 3HO8A 2I7DA 2YZ2A 1OXMA 1NFQA 3HMKA 2PL1A 5JNRA 3I72A 3PRJA 2A9JA 3N2NA 3S2IA 2YOHA 4DJEC 3FWKA 1EVEA 2QMUA 2PZ8A 4TV9A 1ZMTA 4NYJQ 5EZQA 1Q1GA 5HIAA 4MKFA 4MR8B 3Q72A 4W82A 4KBYA 4Z4EA 4G4IA 3MGKA 2R60A 3OEYA 1KAHA 1WETA 3QXJA 4UREA 1J5PA 3I28A 1DT3A 4R8RA 1CRWG 4YUZA 3F9CA 4UTVA 1L5NA 4N1AA 1IUKA 1L8XA 2V7TA 4UATA 1UBMS 2FW1A 2B4QA 4ZU1X 3EXHA 3DZFA 2CK3D 2E3JA 2RGCA 4LOAA 2PO7A 5KSPA 5I5VA 2G8LA 3IG0A 5H3HA 4DWWA 2FW6A 1E32A 3EXEA 1R88A 2CDCA 5CLGA 3AEYA 1T2AA 4PNHA 1MO4A 3AW9A 3U19A 3HSKA 4QIWA 1XEWY 1N34H 4LRUA 4Z9XA 3EWSA 4JEMA 3IJRA 5TPZA 1YCHA 2ILTA 1Y4UA 2AN4A 3BWDD 1H5UA 4I46A 3QEMB 1J21A 5EIBC 4QULA 5IG2A 4CEHB 1MRZA 4PSAA 1CG6A 3DL4A 3U4AA 5I5XA 3EVNA 3H04A 3LVFO 2HJRA 5HXAA 2QTZA 4D3ZA 2ZTUA 2XNCA 4V3CA 4K46A 3TMYA 5CYOA 4LFAB 3DO8A 5A2GA 3C0KA 2X0FA 1EDEA 1EFPB 4HEA1 3USZA 3N43B 4Q5IA 1Z0JA 4K9MA 5KZMB 2VPQA 1D9XA 4ECTA 1G21A 4R9NA 1PTJA 3ND7A 1G5RA 2QJOA 2XZTA 3A32A 4HX9A 5E7MA 4BTLA 3GRVA 1WABA 2XGQA 1L4EA 1JWAB 2CJWB 4IGAA 5AXBA 2ECFA 5CR5A 1JSRA 5ALFA 5DHQA 4YO7A 4I81A 4LWPA 1R0LA 1R74A 3RS3A 1UJNA 3FPHA 4DR1B 4JT8A 1JHOA 4Q21A 3L04A 1G8KA 3TL3A 3Q3GE 3RC9A 4KFUA 5JXIA 2D7CA 3COZA 5GJBA 5EPOA 1MB2A 1YV9A 2J3LA 3EH1A 3LKDA 3P9IA 2O54A 1SY7A 2G3YA 2JHPA 2P2ZA 1R18A 3RR5A 5K0CA 1ZHSA 2ZUSA 1SCQA 2C0QA 5EPEA 3DMYA 1E3JA 4W5RA 3LT1A 2RI1A 5CITA 4YMGA 3ZV4A 1URPA 1JXMA 3LNTA 4O0LA 4YHHB 4TKVB 1U5BA 1XDNA 3H8WA 4PZLA 1I4OA 4UEQA 2YJ6A 3PQ3A 3SLKA 4I1UA 4YI5A 4D82A 1F9EA 2ANBA 2BFDB 2VRWA 1HR0H 3DZKA 3F7OA 3S40A 1E1NA 1JX6A 1F6BA 4RVHA 2J0QA 2QTLA 3GEMA 1V2HE 3GC6A 3K5IA 1KI6A 3HBLA 1X9GA 2YNMA 2QSZA 3K70D 4XIFA 2EFJA 3VDQA 2XNHA 3QVGB 2AMJA 3UT6A 1T9AA 4IEFB 4CCSA 1WCV1 5LD2B 4Z1MD 5LLTA 2TSYB 3FOCA 3B1FA 5DGIA 1TAHA 1Y1WG 2X3FA 4ECZA 2ZM6B 1S2DA 4QC2A 1Z16A 2HT1A 3G0CA 2IWHA 2WEKA 4OHXA 5CM9C 1JKJA 2Y1EA 1TCAA 4JJ4A 1ZRNA 5BSHA 4GUAA 2L0XA 3I05A 1W1IA 4A6DA 4EPVA 4UCOA 2FW0A 3HKDA 4YRKA 4D3XA 2CYBA 2B83A 2VL7A 4M7PA 1T10A 4Q93A 4J1TC 2DECA 3UCFA 1ZJ5A 4WKNA 3GEEA 2UU9H 3PA8A 3S6JA 3X1MA 3DNPA 4BLQA 4PX3A 5KSWB 4S12A 3Q8QB 4Y7DA 5EJ5A 2M6LA 2QVLA 5C34B 1SHUX 1DCMA 1S7GA 1YE8A 4FI3C 5COBA 3M49A 4ZDWA 5TT0A 1DO2A 2WJHA 4LV5B 4ZAGA 2LCIA 3GAFA 1NYLA 5KREA 4X71A 1TKCA 3BA1A 3K7EA 2BI7A 4RPKA 2YWFA 3KOZA 3AY6A 4G09A 2A58A 4ENQA 2G5CA 2FB9A 4OCZA 4M54A 4A23A 3BH6A 4UM8B 2DB3A 4XWYA 4HWTA 4LF8H 1DFHA 1DKQA 1BO6A 3AVXA 3NCTA 4N0EA 3U4CA 2VQEB 3H84A 4BZXA 2CCGA 3IILA 4TL7A 5LMZA 2EG9A 2ZKLA 1XKXA 4X20B 2I7XA 3K6SA 2GBFA 3JVUA 4O1HA 2GBIA 5G0SA 2Z6VA 3B3GA 2FSIA 4XWKA 1P4JA 4LV8B 2LR0A 4PHHA 3SJ7A 3T54A 1CKMA 2AC4A 2XY4A 1EU1A 1NJSA 1SCKA 5JY1A 3PVSA 2C4HA 2Z8YA 4IQFA 1XTBA 5EIFA 3T5MA 3BA6A 2YQZA 2HBYA 3ILYA 3EGEA 2W58A 1VMKA 5LBTA 4HGQA 1EG7A 3WFJA 3TAUA 1N8SA 5A0FA 4ZVUA 5BYJA 4LTMA 1NLFA 4FYVA 3U56A 3MT0A 3S5JA 3ZV6A 5JADA 4LF5B 3DS8A 4ZMBA 3ONWA 1SEPA 2E82A 1YZGA 3A6GA 3LIPA 3OZAA 3RF2A 2FUEA 3CVUA 4EELA 1PZHA 3UXMA 4UHDA 1ZMRA 4CN8A 2W6CX 3L7AA 4LSXA 3WWHA 5JAUA 4V02A 1T25A 2Z5FA 1U0OC 4WD3A 3D31A 1CQWA 1EA7A 4FI3F 3H86A 1K86A 5J5VA 4M7WA 4RABA 4XARA 1CY6A 4F9TA 3O1LA 1FDOA 2KW5A 3GFOA 5LQSA 1LZKA 3MA0A 4DZZA 2AN1A 3UWKA 3N2KA 4M6WA 3U7QB 1MNAA 2O0LA 3BMQA 2J5KA 3GVIA 1CQJA 2NUTB 3RFUA 3KIPA 4XIJA 2QN1A 2X0KA 3V4OA 2GPAA 4FT4A 4CG1A 3CIOA 3VH4A 1E0AA 4UU1A 3UMYA 2DFNA 2EWWA 4JYAH 1SUIA 2X8LA 4XSHA 1Z22A 4UM7A 1M54A 2DVMA 3MXTA 2R1VA 2PX6A 4V0KA 4TMXA 4F0JA 3X1YA 2CUTA 5DNVA 3K0AB 2ZIXB 2P3QA 3FZQA 4BRZA 2VDQB 3L6RA 4KMOA 3QKWA 2G17A 1D7OA 3OY2A 2UXDH 1X2BA 4L8LA 4F11A 1AZSC 4QJ4A 4LJ8A 1B6SA 3P27A 3U81A 4PGFA 3V8NA 1F2TB 4EPRA 4ZQFA 2F9MA 3B12A 2HZ7A 4XIGS 3CLTC 1ZX1A 3AILA 3I3SR 4FQ7A 4BGVA 4IRCA 3MAGA 1K6XA 1G5FA 2BFPA 5ALHA 3FTQA 1SURA 1B7GO 3RGXA 4JUZA 2W71A 4NE9A 1YS7A 1KEUA 1GILA 3QJ5A 2FZ5A 1XWFA 2LP4Y 1BD4A 2DERA 1U4SA 2UZ1B 4F6CA 1D9ZA 3PNMA 1YMUA 3EMBA 2QENA 2WIDA 3NKFA 1O89A 2P9GA 2BBTA 2ZRNA 5C44G 4PTZA 5IM4A 1RDFA 4XIIA 4OY3A 3K92A 1Z63A 2LCFA 2B63G 4QQ8A 1E7MA 4DAEA 3RB3A 4OH1A 1I6UA 3HXKA 4MPRA 2IYTA 1H4TA 3L7MA 3PGLA 4K1LA 2H8GA 2EQ5A 1DRKA 4M2LA 3UMRA 3JY6A 4BIIA 2FSSA 5CEEA 3AH8A 4INOA 4HEQA 2HPZA 2AK2A 2DT8A 5I7UA 1ZI6A 5TMBA 3WBFA 4LZPA 4JXJA 4XB6B 1WL8A 1XZFA 3DG9A 4DMLA 1Z73A 5JVDB 4EP1A 1E2NA 4KB5A 1QOQB 2JEOA 4O4JB 4TYYA 2GASA 3N8IA 1GTMA 3IE0A 4DRXB 5KFEA 4KDRA 2PGOA 4N48A 4RL4A 3U6KA 5KDDA 4UPVA 3IPYA 1FFEA 1BRTA 3GZNA 2HDWA 1DSSG 4DPMA 1PNVA 3MUFA 1QRUA 1ADCA 3OO1A 5CH8A 2QP9X 3FKJA 4AUNA 1Z34A 4OI2A 5JJKA 4MVJH 2M32A 4L02A 2ZRHA 2W8LA 4EY5A 3AR6A 3HJUA 3V8BA 1HE2A 1GRVA 4MQFB 4MRVA 2C04A 4DV5B 2CBXA 2NZUG 5AD1A 2C8KA 3WJ1A 1RBQA 3IQIX 4IJUA 2XMSA 4GBED 1FNDA 3G79A 2RGVA 4BE7B 5K0NA 2O7NA 4AQ7A 3DYVA 4XM0A 2ENWA 4YAOA 4CIVA 1JFSA 2JJ1A 1J2YA 2QD5A 3LQ1A 1WUYA 2FZLA 1M3SA 2HU2A 2WAOA 4HZUB 4HAWA 3S2YA 4WN9B 3CY6A 4M88A 2FOIA 4GD3Q 4HNRA 1J90A 5CP8A 2JIQA 2X6QA 4Y6QA 4AKTA 5KFGA 5GOZA 1FDRA 2YWGA 3I32A 3CPHA 3DWGA 5TRTA 3EEFA 2XCRB 2NW6A 3SZOA 4OL0A 2I3AA 3TTXA 1KXJA 1A4XA 2PLNA 1L5FA 4BNYA 3RYCA 5ALJA 4CM8B 1S0UA 1TVEA 2XA1A 1GT91 4XUEA 4DV6H 3FGOA 4X3CA 1OQAA 3IMGA 4EDFA 4Z86A 3L1VA 1E2PA 3LVRE 1E1CB 4O5AA 1WCYA 5CA1A 2JZCA 4X44A 1WOYA 3L7YA 2O57A 5EQTA 3O1IC 4HXYA 5G0TA 4XH9B 4CCYA 4A8JC 3HKBB 2FSHA 4X62H 2VSFA 2H5IA 4UASA 3C3AA 3LTEA 4HNTA 4KXVA 1GP2A 1PSZA 4TL6A 2I8LA 4QAJA 4G25A 1F6DA 3WIVA 1NASA 3U4QA 3A9CA 2XDWA 3BSSA 1GAEO 5B58T 1Y5IA 5KFNA 1EFCA 4F2PA 4C0HA 4P98A 2ZIVB 3AHEA 1E4FT 5D86A 3RRFA 4EI7A 3H5WA 3NS7A 4AJOA 3G2NA 1SBHA 2GHTA 1T8WA 3S2EA 1H6BA 4A92A 2WUDA 4ZKEA 4I55F 1FMFA 4X1OA 1NJ6A 5GIOE 1XMXA 4URWR 3LSTA 3BQ2A 3DUWA 2P77A 1T26A 5B7GA 4X24A 3C8HA 3TI7A 5DT2A 4M60A 2P40A 1Z45A 3LDHA 3F3MA 1QWOA 3OCVA 4HBGA 3ZLBA 3C70A 4MPJA 3RJZA 1OVMA 4EUFA 4YT5A 3OICA 2AG6A 4EG4A 1V6CA 2X9VA 1O95A 1GUFA 4QXPA 4K88A 1VSVA 1JT2A 1ZU4A 4ANFA 2IEDA 5IS2A 2PNJA 4HAUA 1TWCA 1MVNA 4QYXA 2HRQA 2INGX 2C7QA 3W34A 1GYPA 2HIXA 3FWPA 3IPRA 1KY2A 1TM2A 5L51A 3AP1A 1ILWA 3HCBA 5JMTA 4RF4A 2XVZA 1N33B 1CWUA 3ANSA 1HE8B 5KTRA 5KFJA 2HMYB 5K20A 3TBHA 5KSOA 5KAMA 1M1NB 3CE6A 2J6UA 1WB6A 3ESDA 3AR3A 2WKWA 5D5QA 3F7TA 1SIBE 1OLXB 2NVUB 2V58A 3E9DA 2P35A 4KO3S 1GGEA 1XWWA 4S1WA 3UMCA 1IH8A 2FG5A 4JP1A 2I22A 4XB1A 1ZCJA 1GO3E 3AI2A 2PZMA 5AM4A 4OKSA 1V1MB 1PDWA 2H59A 1P5FA 5E9AA 5BXYA 4Y2VA 2C99A 3GGGA 4TUYA 1XZIA 1K2WA 2A1UA 1U0JA 3V4ZA 1PUIA 2PTGA 5FLYA 1KYYA 4UZFA 3A1UA 1FUIA 2ZRIA 1SIOA 1RKUA 4MWZA 1UDBA 4M8SA 4AY2A 4I3FA 2AK3A 2VSQA 4AKSA 4AG6A 2QRVA 3PD1A 1UQTA 1KH1A 4GMHA 2GJ8A 3NP9A 1GKIA 3AEKA 4MULA 1FPMA 4N7JA 4MJ3A 3M3PA 1T5OA 3I2IA 1J2UA 3DMTC 3F7MA 5KAPA 2ZOSA 3TNJA 1TU4A 4BVKA 3V4VB 1KP9A 2BTEA 2FSVA 3RYHB 1Y7PA 4NDZA 3R8XA 1XZ8A 5KQRA 3V6LA 1T3SA 5DGTA 4O4LA 2AF3C 2ONYA 1Z06A 2ZWIA 4G67A 1EXNA 2IYFA 2HQSA 1SELA 1VECA 5EJ2A 4TMKA 3ZNOA 3WGOA 3LFHA 2PA3A 4G56A 1TA8A 4J0DA 4A2WA 3F2VA 3H11A 3ZGZA 1NRJB 2WWGA 4MUHA 2VHUA 1N57A 5BOSA 5HG0A 1HETA 3A28A 1XBTA 3K4PA 3IUJA 1GUYA 2V6FA 2HIMA 1VIYA 2RJOA 5DG8A 3TUIC 1RRPA 2H1LA 4RL6A 4DG9A 3GW8A 3BIOA 3EVCA 4W1PA 2ABWA 5C4XG 1WBJB 4UTOA 2ZWMA 4IOMA 1BDJA 3BD9A 4B7CA 4B3FX 1TF5A 2OESA 3FCUB 3I73A 4LJLA 4ECWA 5IM5A 2P1ZA 4JJEA 2DXIA 3EZGA 2WJVA 1AN0A 4GOKA 3DOEA 1T24A 2V5UA 1EWVA 1V1RB 5E6SA 2J45A 3EMKA 4QM6A 1DIOB 3CR8A 3R7BA 1PZEA 1C3OB 1JJVA 3EUFA 3GHYA 3FNRA 2ZJZA 2FVYA 2QZPA 5TQVA 2HI0A 2AFHB 3D4PA 1TL7C 1AGYA 1K3TA 2XODA 3VR3A 3MLEA 5AVRA 5B53A 3RJMA 1O3YA 1GY8A 3M9MB 3BQ1A 4KFRA 5DBFA 3AZPA 3AF1A 1VG0B 5E2IA 3PA6A 4C2AA 3W5VA 1ZA1A 3QP9A 3HSSA 3STXA 3VSCA 5BUSA 3GNTA 1Q0SA 4LWOA 3VXKA 3GIPA 1WVGA 1A4UA 1U1FA 1Z26A 3MHTA 4C0XA 2BR5A 2H4HA 4IKOA 5DNYB 1RBZA 1Y3FE 3PV0A 2BP7B 2AYZA 3GVCA 1MTZA 1YXMA 5JMOA 2C88A 4ZCQA 3QLJA 4O4IF 2MOKA 2O8EA 2HREA 1KI7A 4JDUA 2QJWA 1Z2NX 5JATA 3A1CA 2Y93A 2BRUC 3G2KA 2GVZC 2FDCA 1K97A 1HE4A 1RYBA 3NTRA 1O8BA 4TTIA 4DMHA 4AJHA 3AM5A 2H29A 1GFSA 4OQDA 4DDHA 2BL4A 1Q91A 3AESA 5L1JA 4TQSA 1US8A 2BBSA 3T38A 3P7MA 2Z3VA 3ICWA 4JL8A 4CDMA 2A33A 1RSZA 5DBHX 4JWTA 2LW7A 3UJCA 5A7FA 2TMDA 5F3RA 2VO1A 3T4PA 5K0SA 3QVTA 5ICCA 4B8WA 2OBYA 5D8DA 4YHBA 4OU4A 4CTKA 3O31A 1MPTA 1L5ZA 1U0NA 3MWMA 1Z29A 4PF1A 3CVZA 4RPHA 2DRIA 2VQFB 5HJ7A 2ZG6A 2BCJQ 1SA0A 1IMOA 3UJ9A 4R69A 4J6EA 5KT6A 3CG4A 2R65A 4YUAA 2J4DA 1GPKA 2QV7A 4HDQB 1P1HA 1GTZA 5KNCH 3F4LA 1EX6A 3TUJC 5FO1A 3TOZA 1V4NA 5JZ9A 2IX9A 4U7GA 4IUDS 2BFEA 4G9EA 5JS1A 3IA7A 3UN1A 1DB3A 5CFMA 2I3GA 2KPOA 5DGXA 4GC5A 1YZYA 2H1VA 3M1LA 2GWHA 3QVSA 1C2YA 2CMDA 3HXTA 1KK1A 3NEYA 1QFZA 2IU6A 4PX2A 1RFGE 2X9NA 3LIIA 3A2NA 2RARA 1Y48E 3I2KA 4EY4A 1VHQA 5K5EA 2A9KA 4FOTA 2RIRA 3L49A 4QOSA 3CNQS 2BBOA 1RHRA 1W29A 4RTLA 4BVAA 5E8RA 1E6EA 3MS7A 2CJYA 3RVBA 1P77A 1NZFA 5FAXA 1YA6A 1IWOA 4ZDJA 4ZHSA 4DG5A 3M4YA 5DH9A 5IHPA 3AI1A 3DOFA 1N8TA 4NU6A 4NJMB 4BNNA 1CDDA 3AK4A 4PPFA 4NMHA 1V3UA 5FADA 1WXQA 3EGWA 4NFYA 2WQZA 4QELA 1N8KA 1DXHA 1UPCA 4RKWA 1E9DA 3F71A 3MR3A 4CQMD 1JH9A 3K31A 4FBMA 2W8ZA 1ECBA 2JH8A 1NOIA 1TZMA 3G5LA 2P7HA 4PYJA 1A2BA 1G2IA 3PWTA 3TINA 4B6RA 1I7DA 2CK3A 2IIQA 4FC6A 2JJ1D 4DA8A 2QTVA 1X80B 3PXDA 2QZ4A 1XZNA 1AKWA 5T64A 4IHJB 2O48X 3MT9A 1S0NA 1R9TA 2AWNA 3PFNA 1R4NA 4D3DA 4QSMA 4MIEA 4EW3A 4PY2A 1SCJA 3Q3VA 4TVKA 4LS3A 2FQYA 3VTFA 1DTSA 4NPAA 2H1OA 1YL7A 2O0MA 2C00A 1CV2A 1T1GA 4LK3A 3NXSA 2XCUA 5THXA 4F12A 5IKEA 2D1RA 1TGYA 1JEJA 5JALA 2PL3A 1IYDA 2I2FA 3CX8A 1ORTA 5C1OA 3NTUA 5ITZB 1N5MA 2XXAA 4ABTA 1TEZA 2EYQA 4UTPA 2P11A 3Q9NA 3R7NA 5MFZA 3HBFA 3P96A 1U8XX 1XCLA 1ZBQA 4OAOA 4QYTA 2BMWA 4ARZA 3LYUA 2ABJA 4HQ6A 5BVHB 3CF4A 4BFZA 1LPSA 3IRVA 4NBTA 3AGPA 2HDOA 2WAQE 5E1BA 1UFQA 2VJNA 1EZ1A 2OA0A 2ZJTA 1SCDA 3M6UA 1P81A 2JLAA 3ZWBA 3F49S 1XNHA 4EHDA 2X8WA 1QG6A 3CW9A 3P9QA 4LQCA 3O83A 3O7WA 2G4VA 2JIMA 1CZRA 1OPRA 4D96A 2E4AA 4C14A 1DBIA 5COQA 4YRZA 2D5BA 1J2EA 3C6XA 2AG1A 2XOKA 4WVFA 4F56A 3W9YA 3D1JA 5LQMA 2J3QA 2ZJ1A 1E1DA 5EYPA 5AIAA 2IGBA 3TJZA 4LRSB 3HYLA 5FPHA 3PLAE 3JASA 4OSOA 2WMDA 3ZY6A 2QOEA 3W3AH 3K2EA 3JWPA 4DL9A 1FSPA 3UJPA 5KIAA 2ADMA 4HUQA 2TYSB 4HGZA 3KG2A 2CFSA 3VO1A 1YGPA 3MQ2A 2DSTA 3W1EA 2H1IA 4G8JA 4F72A 5F7XA 4W8HA 4KN9S 4Q3DA 1KDOA 3ED1A 4H7FA 2HGXA 4WJLA 1VBNA 1EWTA 2ODEA 5K0TA 1R0RE 1C7ZA 3BMNB 2CDNA 3QYFA 2XWQA 3HCNA 1TTTA 4OX9H 2PUFA 4J0HA 2P78A 4M0JA 1HOTA 5DG9A 4R5HA 4Y9SA 3PUWA 3WL3A 3QXSA 3C2QA 2AC7A 1KNXA 5FI0B 2NSLA 2YMMA 5JHGB 1YGYA 1BDMA 1J97A 1QQ6A 4K1XA 1VRVA 2QL6A 3BK2A 3LV8A 4ZIRA 4J1TA 5JAHA 1W47A 4X3OA 4B44A 2QTBA 3U62A 4KE6A 1BYIA 5AW3A 4XUCA 4D56A 2ZI7A 1RS0A 1P9RA 5I5GA 3T94A 3ZHZA 4MPDA 3DEFA 1PGPA 1GYQA 3E9EA 3EFHA 1YU6A 2JLVA 1BMTA 1TMOA 1XDGA 5KFMA 3OH8A 3K1AB 2OCAA 2HGWA 2WFLB 1WHTA 1ZZEA 1N5KA 1IN5A 3D81A 1JSLA 3P26A 2YYZA 2W9CA 3D0RA 4ME6A 2IEZA 1JZSA 1KZGB 3GV0A 2K4MA 2RGBA 2AOWA 2VG8A 4H4CA 1A8PA 5FPOA 3CO0S 4MW6A 3FGZA 2C5LA 1LRKA 2GN0A 4KXFB 3BGVA 3DTVB 5I7FA 3K96A 1H66A 1YZUA 2HZBA 3WGQA 3CMCO 1HDOA 4B4UA 3V4RA 3E6AA 3C5CA 4E13A 5LQNA 4ZYZA 5D6OA 3TNLA 1W96A 2CHFA 3IOYA 4U39A 3FSRA 4EEXA 2JKYA 3IUEA 1IULA 1QC5A 1CRPA 1KF0A 4EJ0A 4XI9A 1VBGA 4TS9A 1MFZA 4BP9A 2I87A 3QHAA 1C1DB 4JYBA 5TGDA 2YRWA 2BGIA 3AO0B 1EYZA 4UE2A 2O3SA 1U65A 2IFTA 1QVVA 4ZVOA 3IPLA 5DM60 3GMSA 4ZC8A 3RADC 3B36A 2UZAA 1M10A 1TF2A 2CLOB 2XX3A 2QYZA 1JNXX 5KOJB 3EXG2 1N0IA 1LF5A 4PG5A 4G9GA 5H8WA 4UUBA 2ZCJA 4GPEA 5K3FB 1QH8B 4HS4A 4JI6B 1N4DA 1L5YA 3A58B 1NLYA 3IMCA 3A25A 2UVRA 1C41A 2H92A 4JKYA 4G0WA 2P3LA 3UV7A 4MVXA 4L0DA 3FPFA 4GP9A 4E2WA 3KPWA 4J7CA 1A1SA 3D54D 4WXRA 1ZY2A 1YQEA 1S8AA 5EEHA 2JIRA 4EDHA 4L3OA 1RHKA 4A1OA 4XQGA 4RAQA 4E21A 2O06A 4PXYA 2OYSA 5FLEX 4GLXA 2ZUUA 2VZEA 4EYEA 5FNVF 4J1NA 2HK6A 4KXUA 1O08A 2XWBF 4XM2A 4ZO4A 3I23A 3VR3D 1NPDA 5B3AA 3HXMA 5U4XA 1SXJE 1PK9A 1NBEA 2FWJA 4QWMA 2CE7A 1Y8QA 1FX1A 3Q2OA 2NUAB 1WCMG 3IJPA 4W6ZA 3LBYA 2YVUA 3ETEA 3OQIA 4MP3A 4TL8A 1OKKA 1N0VC 1PV4A 2CMHA 3R44A 5CAEB 3DLAA 3MBOA 3R2JA 2FV8A 1NR7A 1NQVA 1Z4MA 2O2EA 1OXSC 1LDGA 2O2IA 3BXFA 4CLXA 5EWLA 1FYDA 2PXAA 3OLZA 4RO0A 4O2AF 5JECA 3PLNA 4D25A 2WFAA 1EAMA 4PAWA 4MVJM 2VYQA 1YHZA 1Y1LA 2XGSA 3UG6A 3O4IA 3W5UA 2HC9A 1VS0A 4LTNA 2GAAA 1PJ8A 4CF3A 1YR2A 1YR6A 3KX2A 3MCUA 4M0PA 3NH9A 3LPCA 1ZNQO 4KR7A 3DDNA 1MB9A 2LZ0A 4JX9A 3PU6A 1DC7A 3GUCA 2OHXA 3VOAA 1HURA 2IJGX 3NBZB 2H7CA 1UXJA 1J0BA 1AQJA 1G6Q1 1J9ZA 2EJUA 4JLUA 3UAVA 5AI9A 4UVIA 2XYVA 3AVQA 3MJVA 2GARA 2C94A 3IT1A 4RELA 3K0BA 3ROGA 1NVMB 3EEOA 5KI6A 3JZMA 4FCVA 1UT5A 2BOVA 3AB8A 3TCXB 621PA 3UY4A 3SHWA 3A05A 1N2IA 3ZG6A 2H06A 3RBZA 3PRYA 3THSA 5HQ3A 2XZOA 3ZI0A 3UPDA 3HKZA 4IXWA 1Q20A 5IXJA 3SM3A 5CLFA 4L1KA 2BIFA 2CFCA 3K0CC 3WMXA 4FW9A 3D43A 4J0IA 3G59A 3ZEAA 2JH9A 4EG6A 4RWZA 2W11A 4H0NA 2WM9B 2XDAA 2V4UA 2Q7DA 2R1TA 1W6UA 2ORVA 2IPMA 2XZLA 1P1IA 2QV0A 3VBEA 4NOJA 1O6BA 5LBUA 1RWXA 1WDLA 3CLHA 1ORHA 4U6SA 3H4TA 4NAVA 1SUDA 2PEZA 1L8QA 2R7ZA 4QDUA 1JZTA 1MZBA 5FFMA 2RSLA 4WKOA 5BNIA 2OCKA 3LA6A 1GXSB 4DIMA 2QQ5A 4Q1CA 3TM4A 2DHEA 4LECA 2JHGA 4RJLA 1AMOA 2ZRDA 5HWSA 2BEWA 3CNOA 3UPTA 1HLGA 3ZBTA 2ISQA 2ETVA 1JP7A 3HXLA 1S97A 4HYEA 4CHIA 5DX0A 3CX4A 1K3UB 2V7EA 1XXHE 2PD6A 4BE4A 1OFTA 1ZSNA 5DP1A 2RB5A 4I14A 3F78A 3ZZUA 1X1DA 2C35B 3PC7A 4ENUA 3SKYA 3LFTA 4MI6A 4I55A 3WQHA 1S5PA 3RC8A 1N7GA 4FLFA 3IEXA 3HUDA 4ZC1A 2J31A 4M36A 1M7JA 3N7TA 3IBFA 4IBOA 5FOWA 3FCSB 1NXOA 4X93A 3U7GA 5A4DA 1EDZA 3PXUA 5IXSA 3KYJB 2VTDA 3LBNA 4WZAE 2CV1A 1X1TA 1KO8A 5EIBD 4K2AA 2PS0A 4G97A 5FWXB 3I1FA 1I4TD 4MITA 1JJ7A 1KXZA 4K5QA 3AT1A 1JG2A 1NW6A 2WT9A 2PV7A 1A9XA 5AVXA 2RGUA 1W5TA 2BQRA 1CZKA 1DBSA 3BWXA 1DKLA 3G6WA 4C06A 2IVZA 4KZPA 2AX4A 2DP4E 2OB1A 3OQ6A 4A3JG 1Z4OA 2QTCA 3MN1A 4KGZA 1RMTA 4AS1A 1ACLA 4MJ7A 3QF7A 1ZGGA 1QQBA 1REQA 4OHVA 1N4AA 1O5OA 1YULA 4PO9A 4UXJA 1QHNA 1OB2A 1JF8A 2BHLA 3EVDA 2ASEA 1T4CA 3IV7A 3SC2A 1H3FA 3VJRA 1QP4A 2OQ2A 2KM1A 2QU8A 2PMDA 5EMJA 5EXXA 4WFIA 2R8XA 3ZHQA 2M6RA 2OZVA 2UZIR 3GJ8A 1KI9A 3NOXA 3CEAA 1NVDA 2Y9PB 3S44A 5GVSA 5AKJA 3EC2A 5NLLA 2QYHA 1Z28A 5KFPA 5J3JA 2BYTA 4FMPA 2XJ9A 4CV2A 2O03A 2E89A 3WNBA 3L7IA 5M7EA 2IV3A 5AQ1A 1L7DA 2A0WA 5HIJA 3ZHOA 3CVJA 3RGZA 4EYKA 1A7UA 2XOKD 4BUJA 6REQB 4WCVA 3TRDA 2JC3A 3I9MA 2EKLA 3A26A 5ED0A 4MI3A 2BH2A 3D5QA 4R1LA 4AJ9A 4G89A 3IVGA 1EHIA 3LKZA 2B25A 1DKNA 2Q0QA 3OAAD 3W2TA 3LK6A 4TWAA 4Q01A 1K1SA 4H7DA 2R6FA 2AUTA 2JEGA 2ZJ0A 1FBNA 3KU4A 4Q7MB 1U4NA 5LP1A 4Q7LA 3IOMA 2RK6A 1RPAA 3AV3A 5F9NA 5BWXA 3LX5A 2EBUA 1XNQB 4QGFA 1ZGJA 2EX4A 1AKNA 4FIDA 4OA5A 5AVYA 4O3RA 1E2LA 3DOJA 1WW3A 4E22A 3CU5A 4OIFA 1I3OA 3G0DA 2CXSA 4UBNA 1KOFA 4M7RA 2W6JD 3ZCXA 3AP2A 1MH1A 1V95A 5BN4A 2HLNA 1GG2A 4PLCA 1PV2A 1U7DA 4UUNA 1E9BA 2XRZA 3FCCA 3M6XA 4RKFA 2PZAA 3FTEA 1Q22A 4BEJA 1VRWA 4E3ZA 5HBRA 4RTRA 1ZXBA 3THWB 3ORSA 5A3VA 1YI1A 2QTAA 2VYNA 2VNHA 3IUYA 1FPQA 2UUBB 2P0AA 3KZVA 1E6KA 4CUJA 4IY1A 3NBXX 1OA0A 2HB6A 2PBFA 4MSUA 4AD8A 2GJ4A 1TLTA 4B3SB 2CLLB 4N9WA 3V9AA 3C3MA 1P4GA 2IEAA 5JCXA 4RXTA 1OGIA 1DV2A 4PX5A 1M2JA 1KTVA 1NYTA 4PC7A 2IYOA 3CYFA 4ZYWA 4KQWA 4QUDA 2ZRAA 5JS6A 1K7EB 3H5LA 2OYRA 2OB2A 4QIWE 2WJYA 3DMTA 4A3BG 3WRXA 1YQUA 4NENA 1ZONA 4ZO6A 1RTKA 2A9QA 2V4ZA 9MHTA 1JQ5A 3RUFA 2FG6C 1TA0A 4B3JA 1C9YA 3BXXA 3BJZA 5BNFA 4H17A 4QNNA 3LOUA 1STOA 2F43B 3W8NA 2C78A 1AKVA 2BTOA 1RADA 2VP4A 4O4IA 4XZ3A 3SC6A 3JQFC 5JT1A 3KETA 1HO3A 5AW5A 4W6QA 2HSEA 2YV2A 4ON9A 2IWRA 2DHRA 5IUKC 3SXPA 4JHLA 4R1UA 4AZ3A 4ZPXA 3Q85A 5TB5A 1ECPA 2LDBA 5E8JA 2ZJFA 3AR4A 1F0KA 2ZTHA 4B1FA 1G21E 2ODNA 1YZLA 1RQ7A 4Y67A 2X2FA 1K1EA 3SICE 2Q1UA 3RTXA 1ATZA 5DEOA 3QG5A 4FDTA 3QQ5A 3U80A 2HRBA 2AXPA 4A2BA 4S0ZA 3FR8A 2F1HA 3TSWA 1BW9B 1F5SA 4PBTA 2HBZA 3EUEA 1ZM4A 3ENWA 3EVFA 1PNTA 1I2BA 2JD0A 3JAKB 2X6RA 4IS3A 4IRMA 3RIHA 1E2MA 2P90A 3ICQB 1W88A 3MTIA 4QTTB 1JHAA 4EMBA 2HHFA 4TMVA 1QBGA 3L77A 2WKSA 3DE2X 3NNNA 3D8NA 2FY8A 3EXAA 1AKUA 2CW5A 1T5TA 1PBNA 4G36A 1Z62A 4UAVA 3NHWA 3CWCA 4JELA 3DTFA 4RA6A 1SVSA 5DHTA 4HWPA 2DWQA 3D6VA 4BX2A 1ND6A 2OXEA 3L7CA 4RJIA 3FDZA 4WBNF 3QPUA 2ACKA 7ABPA 2DY0A 4XJVA 1E9FA 3BJEA 4WZBA 2Q5LA 1G5QA 1E3SA 3MWGA 5F1PA 1EWKA 4WNCA 1ISGA 3PXBA 4U3JB 1WUJS 4LF6H 1H22A 4BNHA 4AXXA 2DHDA 4JXZA 2Q99A 1E5VA 1JE0A 3GT7A 4R31A 2ECQA 4J0EA 1I4WA 5D1OB 4DB4A 2ZBUA 3P19A 4H0FA 1Z0KA 5JS2A 4Q6WA 1OKKD 1GG8A 3EPHA 1POXA 4JOSA 5KG3A 3VZSA 3SGIA 1H0SA 3TTYA 4O84A 4P3XA 4NCJA 4MUMA 1E9CA 4G65A 4L76A 1OROA 4UU7A 5A06A 1EUCA 5HMLA 1QTRA 2I5PO 1Q0PA 4OJQA 3SVTA 3FCEA 1B0UA 4V0NA 1ZBDA 1QLHA 4P33A 5KQGA 4DSZA 2W6ZA 5DSTA 3V1UA 1WQ3A 4MR9A 1UMBB 4QWEA 1DXQA 2GFIA 3H0CA 4BX3A 2LCQA 4AB1A 1QNFA 2J08A 3JQCA 1J42A 1AUXA 5K6RA 5KQMA 5ECGC 4LBWA 2X2OA 3W5IA 1XK5A 1T9KA 2ZAGA 2E6KA 4GEKA 4CNBA 4KLZA 3FDFA 3FZGA 1LQUA 3ZBPA 4KQ2A 1PW5A 1E2BA 2CFOA 4B79A 2CL6X 4WLOA 1AMNA 1DEXA 3CLTD 3AM3A 1JV2B 1WRVA 1UPFA 1CJKC 1UT8A 1R5BA 1WCXA 4P82A 2ZSDA 3PR3A 4L8FA 221PA 3WWPA 2IZ1A 2WD8A 3RVOA 3CB4A 3GDOA 4DV7B 4CI0B 4LTDA 4FZRA 2GYWA 1EINA 3T1TA 1JLKA 2X2EA 1FUUA 1ZJ6A 2QDKA 2IZ0A 5TNXA 4JJ8A 5IDQA 3CJTA 1S2IA 2I99A 1BFKA 1UP7A 3GLTA 5FV4A 4WK6A 4E5PA 1NY5A 4P7FA 2V55B 3RRMA 4PWQA 3NAZA 1R37A 3WYBA 3HXOA 521PA 2ZRQA 5ALSA 5ECDA 3EOBI 1QO7A 1J9EA 5EJGA 1EUYA 5F5LA 2UYOA 5AHKA 2I33A 4OB7A 2V4QA 4K9DA 3DZHA 1XZDA 5BXQC 1T2VA 2O7VA 4TVOA 5JAZA 4CEIA 1PVOA 1P7ZA 3RSSA 4EX6A 4QDTA 3PGKA 2BEKA 3EZ9A 3F96A 2XE7A 1E8NA 2FX3A 2RC5A 3STVA 5J23A 1ZJWA 3RBDA 4NRDA 4WH0A 4DJ5X 4IXDA 1A7AA 4RU1A 2FP3A 4G1CA 4Q3EA 4Z0NA 3U0VA 4RU9A 3KVVA 4S1OA 3HUTA 3W5CA 1I24A 1ZD2P 1UM9B 4F84A 5BWRA 4JX8A 3GWGA 4NJEB 1ULUA 2PM8A 3PW2A 3IURA 2IIPA 4ZOLB 5JJ5A 2QRMA 4DGSA 5IJ9B 2WTAA 3H3XA 4JLMA 4KOAA 3M34A 5LXTB 3SM9A 1VQ1A 4AQYH 1KE2A 5B2ZA 1JGTA 1AGNA 2Z3ZA 5A4KA 4WI1A 1G66A 3HYCA 5CR9A 4TVBA 4PLWA 4LBZA 5JIBA 3C5HA 4LYFA 1AXEA 1QV6A 3OZTA 4ZREA 2A1TS 1UBSB 1CEYA 3QY9A 4OI1A 1M5TA 3B51X 3KXDA 5LP6C 3LY8A 2JIPA 3VYRB 2PD4A 4RZHA 1EJ6A 1L5MA 5L4SA 2V8OA 1QPGA 2AHRA 5CBKA 5K2MA 3QUBA 2JAQA 1BMQA 2YDXA 4CQMA 4J0KA 1OBHA 1QGYA 1QHHB 4CWAA 4G0PA 1M76A 3ZN2A 5HFAA 4A2AA 4JBWA 2VF2A 4G3XA 1RKBA 1CS4C 4ETWA 1XKLA 2O5RA 1JEQB 1E5XA 1B04A 4RWEA 1NUAA 1GG5A 3HA3A 1KR2A 2PUJA 1P0IA 4PICA 1BXZA 3L8GA 1Y3CE 3K6KA 3PGA1 4Q3OA 3K32A 5FRDA 1Q7CA 1E4OA 4GOLD 3FF1A 3KWFA 4EGCB 3HADA 3FCAA 3RI3A 3ROTA 2ZFUA 1VP3A 1JDBC 5EXDA 2E2IA 4IJVA 3IV6A 1SQ6A 3WLQA 2C8VA 3KR9A 1GL9B 5AXAA 4Z49A 1DU4A 2XNDA 3K9GA 4LDNA 5HV6A 1TB4A 1NKSA 5JFGA 4YAKB 4HSGA 5ALLA 1WSBA 1EFVA 4U7PB 2VTBB 4G5OA 4D81A 1ESZA 1HDYA 4CPDA 4CIBA 3UHJA 2Y27A 2ZBQA 1KOGA 1WP4A 3O9MA 4JI3B 4LI3X 4Z7NB 3BUSA 5BWBA 3FA2A 4I50B 2XMCA 1YHNA 2F62A 1TLLA 1NOJA 2I2AA 4PX9A 1RI1A 2PS9A 4MO2A 2DHQA 4R98A 4CW7A 4CMCA 2BZSA 1X87A 4F6LA 3ITDA 4P3KA 4Z9AA 3D1VA 5FFFA 1S02A 4C7JA 2Y0SA 1VPWA 2QF7A 5LP6F 5FR1A 3G2HA 4OFZA 4YAEA 1WHSA 5KFVA 3SEFA 3HL4A 2A92A 4XGKA 2HMTA 1TM4E 4KEAA 4IMIB 1P0PA 3M5WA 4LNUB 2OQRA 1H0RA 2AVNA 3R9KA 4EG1A 2EIYA 1ENPA 1I7LA 3I9V6 1RJQA 5E4YA 5FEMA 3ZY2A 1NR5A 1VDMA 3DBHB 4Z4HA 2FN7A 1F06A 3BSFA 2H57A 4JQYA 3EFOB 4EY7A 5EHZA 1FRVA 4CR7A 4Q1EA 4IQ0A 5AJYA 1T13A 2F8SA 4HLNA 2JKVA 4BVGA 3WLIA 1P19A 4Z4CA 4BU0A 1VG1A 2HG8A 2YRXA 1V2GA 1OXTA 4KQ6A 2QX4A 2FMTA 3PKZA 1G6KA 4NOKA 1FFHA 2VUMA 4JI0H 1B43A 3DDZX 3I30X 2FPLA 2VYND 3TW6A 1EIWA 2JW5A 1E4YA 2BUCA 3D3EA 4DHWA 3D0QA 1U8YA 1WCWA 5AK4A 4JR0A 4J8PA 3QXXA 2DT5A 3ZDRA 4I1VA 3S1AB 2VS1A 1I7QB 1D2HA 3AFOA 2RH9B 5BSGA 4D8XA 3BE6A 1I3CA 4LY3A 5FNVA 2GH1A 5BRJA 4AJPA 5DWDA 4Q9KA 2GRUA 5GZ1A 4DR7H 5FYQA 1XCMA 3D4NA 4KBFA 4JI8H 1BYUA 1QJCA 4PPQA 2JAHA 1N5IA 4B2PA 3F6EX 3ZWQA 3W8FA 1Q1ZA 8LDHA 3FNFA 4L4UA 3MAAC 3PUYA 3U1VA 5B3KA 1IDN1 1IU9A 4DBLE 3HXQA 1ONOA 1DLJA 4MUFA 2CNLA 1N3IA 3LCJA 4RV5A 2NXEA 1OBOA 1UMCA 5LNK1 3EYWA 4BVFA 2YZMA 2JPDA 3L1UA 1GTL1 1NU8A 4O2AA 3QX9A 4JJGA 2OCDA 5GGXA 3GNLA 4IOJA 5GOTA 1HY3A 2GFHA 3KV3O 5ESDA 4HVTA 1E3DA 3O3MB 4CQJA 5FI1B 1PJ2A 5JH7F 4DV3H 3OT1A 4JIMA 2QW1A 1MABB 2JATA 4NQRA 2XCQA 2EWVA 2EJCA 1J1ZA 3EB9A 3KOXA 3UK6A 3VOSA 3IIKA 3O2QB 4MCIA 1QP8A 4HB0A 1JIIA 4P83A 4EX7A 3IE1A 3L01A 4MCJA 2HEIA 3UO8B 1RRGA 1QGAA 4L6IA 5CX1B 3VHXB 5IWCA 5D5PA 1K89A 4XDYA 1XZHA 2GFQA 1UBTS 4DLXA 5FJIA 1I5RA 1I2AA 3CNHA 2VKQA 1PD1A 3EBPA 1G19A 3JAMW 3G49A 1U9JA 2FPIB 4HWRA 3L0DA 1HDZA 3OOJA 4N49A 3GGJA 4JQOA 2Z9BA 2FTKE 3WLJA 4CT4B 1AQNA 4GNRA 4IR1A 4DHEA 3V33A 3ES9A 4D9NA 1QDLB 2AEEA 2RHOA 3UAZA 4DC0A 4WW0A 3H4MA 4KO8A 4BO7A 1RWQA 4C4RA 2VQSA 3FHOA 5C8DA 4D46A 5K8LA 4IFBA 3RVPA 2DG2A 2FRDA 4YCJA 3MWDB 2JLBA 4IVRA 5IN4A 4XR9A 4AF6A 5B2FA 4GP7A 1QO9A 1X7WB 2XCOA 2G7ZA 1CUBA 1FRFS 4NCAA 4KQ1A 4RQUA 4ZTBA 1EM8A 4Q05A 2HFJA 4F4IA 4RK7A 2HMSA 3P2OA 3IKLA 4E5NA 4S1NA 2AQKA 4X84A 1SRQA 2A9VA 5G2OA 1JQDA 3KTMA 2O07A 3TX2A 4L74A 4MVJF 4TN5A 3OQHA 4U63A 4IUBS 2BI8A 3M6FA 1BGXT 3QM1A 1II0A 4NS4A 1T9GS 4MQ6A 4BNDB 3W4KA 2CLMB 1FP2A 3BTUA 4JC4A 5BWCA 4FGUA 4FGWA 4DM3A 2V0NA 1RJ9B 1VE5A 2WE7A 5LA6B 2ZE6A 3ZDYB 3HU5A 1UWKA 4Y1GA 2H17A 4WV3A 1PT5A 1IHXA 1KY5A 4WOPA 4B4KA 4G4GA 1ZJ4A 2ZT5A 1Y6FA 1QGZA 1GPBA 1HA3A 3D02A 1GZDA 3VC7A 3T52A 2QX9A 4JVMA 4R2WA 3M89A 1Z07A 5KOYA 1SUEA 3QPBA 3TQIA 3LBAA 2GCNA 3BT7A 1VTKA 3K8ZA 4EBEA 1JHYA 2C9CA 3RHZA 4XVUA 3R41A 1QYWA 3C98A 4B5KA 4AJJA 2VR1A 3PGVA 1KEKA 4G0OA 1WU8A 3I9JA 1D6SA 3J80W 1RNLA 1Y1RA 4D4JA 3LP8A 1V16B 4V0OA 3B1JA 3GELA 3Q40A 5FWYB 4EZEA 1KRXA 4ZCIA 4FEYA 5FOVA 4RD1A 1PFVA 4ER7A 3QK7A 2OL4A 4E3WA 3PDCA 4NCHA 2ZUVA 5TF0A 3K0CA 2Q1XA 3E9ZA 4WY5A 5A9RA 4OBXA 2JVKA 1NDHA 2J6SA 4C1BA 1KTAA 3NRBA 4ZRDA 5FUXA 5C4MA 2HRZA 1BJTA 4MO9A 4LIPD 1CVRA 1TZBA 2AF4C 1EXVA 1JQ3A 5CB4F 3KSDO 1OXKB 4ZPJA 3P45A 5BV1A 1T8PA 1ICIA 2VUIB 1K6EA 1MO2A 4RK5A 1L8AA 2XIGA 4NNPA 4WNYA 1UQRA 3A27A 4EYIB 4M1WA 5TPWB 3UA4A 2EOAA 4RB2C 3JSAA 4N3GA 2CFMA 1IEWA 2C03A 3GTPA 3KUCA 4OQPA 1DIHA 5K51A 3DPUA 2Z5LA 1X7ZA 3W90A 2OZLA 3OJCA 1FUKA 3ND5A 1MA0A 2CNKA 3T9FA 2XUQA 3BEOA 4MGEA 1JB1A 3QKUA 2FPSA 4GX5A 1M2WA 1PL6A 5F78A 4W5JA 2V5AA 3COPA 1K0UA 2ATXA 1ZN7A 5CA0B 4P4SA 4FKMA 2CKDA 4PQYA 5H02A 4Y0NA 2J5QA 4PYQA 1X1SA 3EQ9A 3Q7IA 1IBKH 2SKEA 4LVOA 5EWMA 1NKTA 3ZI4A 2P9EA 3QA3E 2V7QD 1PTKA 4DSNA 3FTPA 4DR5B 1MZPA 3QFFA 4NU8X 2G04A 5AR1A 1XVIA 1WDWB 1OV6A 2XVAA 3RJ9A 4OF4A 2IUTA 5C8ZA 3CV3A 1RWVA 4QHYA 1FFBA 2BEUB 3DB2A 3NRJA 3M9XA 3W4JA 4F97A 4WTOA 3FCXA 3PJRA 3PWSA 2NYVA 4RAYA 2A0KA 3NH6A 1DS6A 1SC9A 5EMLA 1JILA 3PHLA 2PSEA 3TSAA 3ZHCA 4CCAA 1XUOA 5EDWA 1ZN9A 4L6AA 1TE2A 4CG3A 1RW4A 1PG0A 5DI3A 3TQQA 4D4HA 3Q7QA 4RPIA 4KIJA 5A5EA 1T5DX 2PRKA 5FBVB 1U2PA 5TARA 1C4OA 1H5QA 4X63A 3UMGA 2F3QA 2GSWA 3AHHA 1N3YA 2X4DA 3MOSA 1G59A 4X00A 3RHSA 1NT2A 4KG7A 1ZVMA 3I4CA 3MCWA 5G3YA 4JA0A 3W2GA 1EGHA 3ZV7A 4R7TA 4IGKA 3L7JA 2I2XB 4F5DA 1F8UA 1OXBB 4URVR 2PRIA 3GZ4A 4EKYA 2PV0A 3VVMA 2B99A 5JU6A 1WUIS 4QLBA 1P7WA 4WLUA 2FF7A 4BU1A 5CCEA 3T5GA 3M1AA 3ZVRA 4A0QA 3JW8A 1RYRA 2B1GA 2XNDD 3DKVA 4OHOA 1LK5A 5C5JA 2XIJA 4LRWA 1EKPA 2YHIB 2B36A 1T1SA 3NOVA 1ADYA 4NCNA 4YV0A 3EQ8A 2DFKB 3HCAA 1LQTA 4MWCA 1PGNA 1QDEA 2BHSA 1XXLA 3F8TA 1IM2A 3BEDA 3COYA 1OLOA 3Q98A 5A2QA 4MS1B 1GQQA 1E94E 3KUXA 4FIZA 3WWCA 1CNFA 2MSKA 5ALGA 2I1VB 4IEEA 3TAXA 3G7NA 2FUG1 1D3AA 2OPBA 4GUDA 2XMPA 3OQJA 3L7L<