2XCLA

Nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
421
structure length
421
Chain Sequence
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide-Bound Structures of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase
rcsb
source organism Bacillus subtilis
molecule tags Ligase
molecule keywords PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
total genus 113
structure length 421
sequence length 421
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2xclA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2xclA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xclA01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2xclA04
3ORRA 1KJ8A 4ZOLF 5LYJF 4ME6A 4O82A 3V4SA 2HJWA 2GQRA 3MWEA 2NU9B 2GPWA 2NU7B 3ETJA 1EZ1A 2FPPB 2V59A 1KEEA 3U9TA 2V5AA 3R5FA 2ZDHA 3N6RA 2W6NA 4O7TA 3RFCA 4FFPA 4J6EA 3BFPA 5KKNB 4O7SA 3VMMA 2NU6B 2YZLA 1Z2NX 2R82A 5J2TF 1Z2OX 4IIJF 5I47A 1M0TA 1KBLA 2R84A 1EUCB 4EGJA 4Y8VB 3AW8A 3RV3A 4MV3A 3JZFA 2CNQA 4FFLA 2CQYA 2J9GA 5C1OA 2CZGA 1UC9A 2R7KA 1GSHA 4EG0A 4YAKB 1EUDB 3R5XA 5JQGF 3NUAA 4FFMA 2OLSA 2W71A 2R6FA 5K2MA 5BPFA 5C1PA 4FU0A 1JDBB 2W70A 3LP8A 5EZYF 4FFNA 1VBHA 2ZDQA 1JLLB 5HBRB 3KAKA 3HBLA 2FB9A 4O83A 5KX5F 4O84A 3DF7A 2FPIB 5DMXA 1M6VA 4ZQIA 3RUPA 5IYZF 5JVDF 1WR2A 2R7LA 1AUVA 2YS6A 1W93A 2DLNA 2R86A 2C00A 3UFXB 2R7NA 4XYMB 4O7ZA 1C3OA 3GIDA 5C8YF 4XX0B 4IWXA 2GQSA 4WD3A 4O4LF 5H80A 4EA7A 4MV1A 1UC8A 3HO8A 5BPHA 3U55A 1I7NA 4MV6A 2VR1A 2V58A 4MV9A 4IWYA 5HV6A 2YS7A 3QFFA 4RZQA 1Z2PX 2YZNA 4FFRA 3TINA 1JDEA 3VPCA 3R5HA 1KUTA 2X0SA 2PVPA 3K5IA 4YB8B 4MV4A 4FE2A 3WO1A 1KJIA 2IP4A 1KJJA 1KJQA 4O7LA 4EAAA 1B6SA 1KJ9A 4DLKA 2Z02A 4TV9F 4XYLB 2DZDA 3I12A 2W6ZA 5JH7F 3LWBA 1I7LA 1IOVA 4MAMA 2GLTA 4ZHQF 2W6OA 1T36A 2I8CA 2SCUB 4O86A 4I4TF 1BNCA 4XZ3B 3VPDA 2I87A 5JQWA 4YAJB 1W96A 2VHEA 4MV7A 4HNUA 2R7MA 1CQJB 5LOVF 1KC7A 2HGSA 4I55F 4O7YA 4MV8A 3KALA 4QSHA 4E4TA 1B6RA 3WNZA 4O81A 3TIGA 5LXTF 2Z04A 3VPBA 5CA0F 3E5NA 3JRWA 2YZGA 3GLKA 5FNVF 2XD4A 4YBZB 3R9RA 4M99A 4MA0A 3KAJA 3MJFA 1E4EA 2FPGB 2GPSA 2W6MA 1EYZA 2PBZA 3Q2OA 2YRXA 3HB9A 4GGMX 4HQ6A 1EHIA 3BSSA 2VQDA 4C5BA 1IOWA 3K3PA 3ETHA 4HNTA 2NPOA 5LP6F 4NYEA 2QK4A 2YWVA 4HNVA 2W6PA 3MWDA 1PX2A 5CB4F 3R23A 4O4JF 5CA1F 2P0AA 4MA5A 5J2UF 3U9SA 2W6QA 1DV1A 1GGOA 4O4IF 1ULZA 2DWCA 1CE8A 3JRXA 3AX6A 3V4ZA 4WBNF 4O2BF 4O7RA 2ZDGA 2QF7A 4O7NA 1OBGA 2PN1A 4FGRA 4C5AA 3KREA 3OUUA 3VA7A 4EA9A 1JKJB 1AUXA 1CQIB 2I80A 4L1KA 4TUYF 3RV4A 3OUZA 4IHJF 3N8DA 3K5HA 3TW6A 4ZI7F 1DIKA 3BSYA 4C5CA 2CNVA 1A48A 2VPQA 1SCUB 5GONF 3BSWA 5LA6F 3BG5A 4TV8F 4M98A 2R87A 1M0WA 2FP4B 4IZOA 4O7VA 1A9XA 1GSAA 3G8DA 4HR7A 1C30A 3G8CA 5D8DA 1GLVA 1GSOA 2NU8B 3U54A 1E4EB 2WYOA 4FFOA 2YW2A 3ORQA 2YZMA 1OBDA 2YYAA 2YRWA 4O2AF 3SE7A 2R85A 4EGQA 3VOTA 2DIKA 4O4HF 1VKZA 3TQTA 4O7WA 4EA8A 2CNUA 1VBGA 5CAEB 4I50F 4M9CA 2NUAB 1DV2A 1PK8A 1BXRA 1CS0A 5JVLA 3JZIA 4YJ3F 4YJ2F 3Q1KA 3WO0A 4M9UA 2XCLA 2YL2A 5BMVF 4EABA 4DIMA 3TIIA
chains in the Genus database with same CATH superfamily
2G7MC 4DCNA 4KIWA 1EKVA 4NCXA 3EGEA 3RARA 4BRUA 4DS3A 5IAJA 4I4NA 3PPYA 4BKUA 2WAAA 4TMFA 1A4IA 4EGFA 4LH7A 4Q7JB 1U2EA 5EXXA 4DBLC 4RZIA 1JZTA 2FEMA 4MVCA 2ZM5A 3T1TA 3AILA 3BX1A 2RHDA 1K7EB 4MO9A 4OYHA 1Y4AE 5DQIA 3L0PA 1K89A 3FZYA 4P3NA 4ZEVA 1TZKA 1ECPA 1TF2A 2WJ3A 5KIAA 2F1RA 3MBKA 1JILA 5CYPA 4FUTA 2NPFA 2JLYA 3T7RA 1PU2A 4INOA 2A5DA 3NI2A 4BKPA 4KAAA 2EBFX 4F3KA 1BQ4A 5B4TA 3VX3A 3V6HA 1QCZA 3MMSA 2GJKA 3EUWA 5IP5A 4DARA 4G67A 1HYEA 5KJFA 4JT2A 1GCOA 1GU0A 3WWOA 1A0GA 4TYWA 4Z3DA 3SQWA 1X38A 3RHZA 4A6DA 4OJYA 3WKBA 4EYKA 1CKNA 3Q2IA 4MGEA 3VC3A 4UBKA 5KWIA 2PUCA 3G5LA 4F86A 3K53A 4MQEB 4G0UA 2IS2A 4HNSA 3CKYA 3BKWA 4W5HA 2P7HA 5F77A 3OCZA 1L4UA 1XU7A 1VKJA 1QZUA 1BXGB 2JF0A 4M9QA 2X5NA 4DRFA 1KQNA 1DXQA 3M1AA 3ZCUA 2PMZA 3C5HA 3L43A 2ODQA 4CMFA 2QT9A 4IHAA 4PYNA 5AR1A 3NTLA 1OIWA 4UQPA 4WKPA 3H99A 4NARA 4R1LA 1H3EA 1MQ9A 4H1UA 2BMDA 4ALJA 2CWDA 3HB7A 5DQGA 3I9NA 1W0JA 3E84A 1JDVA 2H4JA 4NH0A 2AG0A 1XN1A 1KOLA 3FAZA 1U2GC 2F4NA 3PYLA 3WYGA 3L5OA 4OHWA 3Q8MA 3F3KA 5EP2A 3W4IA 3DBLB 3AHHA 1WKCA 4GPAA 4R9RA 5AI0A 5FFMA 3SEAA 4ETNA 3MR3A 2V74B 2Q6VA 2Y27A 3RRBA 4AB1A 3RRFA 5CD9A 4E2XA 4AY4A 2CW5A 3RV3A 1HK7A 3EIUA 4PGHA 1NASA 2EWMA 2H1LA 1I14A 3CTPA 2RHMA 3QWAA 3P0HA 4NDNE 4PHFA 3I64A 4R2IA 4D0NA 4G0WA 2XWBF 3OUTA 4ECTA 1K0UA 2QMQA 5K99A 4UU8A 3VTAA 1T5HX 3A11A 2GXUA 4M36A 4MV5A 1KP2A 4XPZA 1E3JA 1E9DA 2BVNA 2A9RA 4U7HA 4OFXA 1II8A 4YJFA 5J2UB 4EJSC 1IOZA 2P68A 3RU2A 4EEXA 3W1GA 1JPJA 4HLUC 3ZXIA 3E22A 2P8JA 2X2OA 2HUPA 3NBFA 4L5AA 1HNWB 2ZWVA 3K6SA 2I3AA 2HIAA 2V6GA 2COEA 3P4XA 3RHSA 4RY8A 1LF0A 4RHCA 1XLWA 4E7OA 1XNRB 2V0NA 1YB2A 3P9ZA 4D0LB 1QKKA 1E1YA 3HCCA 5ALDA 5DP2A 3O3MB 4GMGA 5D3ZA 4D9KA 1HNXB 1B8OA 2Q4BA 3CRQA 4C4ZA 1E5DA 5EHIA 4DV2B 2JIBA 2WSSA 3W3AH 5AW4A 1PR3A 3D3NA 3GJXC 4IJWA 2ALJA 2Y1WA 1EM8A 3ZTWA 4DIUA 1V7ZA 3ZK7A 1UBNA 1X7YA 5IAGA 4PHCA 4R7GA 3ZZ1A 1E1CA 3M5PA 3SR0A 2ZATA 2XQIA 4LEIA 5G1PA 3MWFA 3GAAA 5BSRA 2F8LA 5ESDA 4RUAA 3L1VA 4P4GA 2FXVA 3OPYB 5BUCA 4I55B 2DFLA 4A3MG 4ZEWA 2E48A 4G4SO 4XW2A 4JMLA 3JAKA 3L79A 4LNUA 1FUIA 2VJMA 4MCAA 3D7RA 2P1DA 2VP2A 3OPXA 5FXMA 3T34A 1BXKA 1WY5A 1E5QA 1GFSA 1Z6YA 2OVFA 3O2NA 4JJ7A 4K6MA 4PC1A 4QNMA 1HEIA 1E2EA 4FVTA 4P3XA 4CMHA 5CDUA 1KIAA 3KB6A 5J4LA 4KQFA 4C7OA 1ETHA 2BDUA 4OP3A 3O8OB 4L0MA 2I4RA 2NVOA 1G8PA 1WU7A 4JLKA 4M1SA 1OU0A 1DG1G 3WGTA 4C4AA 3W2IA 3KJEA 3M1YA 5IVIA 1YXMA 1SWVA 2VWPA 5HUJA 3AUYA 3DWFA 3UFXB 2R7NA 3TTYA 3LRPA 3TW4A 1NA5A 1XVLA 1VAJA 3AVYA 3OE4A 4DLXA 3GT4A 1LTHR 1TB4A 1RNLA 4GYWA 5I9IA 2ABWA 2AZDA 5DHPA 4F5DA 1GVHA 2Q1SA 3AR5A 2XCOA 3O9MA 3H2YA 4KQWA 4Q44A 2XKAA 2X4IA 2Y76A 5EIAA 5ALXA 2FMTA 2GKGA 1DG3A 4NE7A 1AG9A 4DAAA 1KNXA 2A59A 2Z3VA 1ORVA 4B5LA 5ITVA 5BMOA 1L5OA 2XRFA 3L6EA 1KK0A 5BRJA 1XT6A 5C37A 3IYLW 2X1MA 1XTSA 3EGWA 1UZUA 3QEKA 1B3RA 4ZOLB 5T8KA 3H87A 4H35A 1LVUA 1ISIA 2BN4A 5I4CA 1V9PA 2WTMA 4KE8A 1FDOA 1ODKA 2CHEA 2ZGIA 4PBTA 3A6DA 4HRXA 5CK4A 3GB9A 2ZAGA 2V7XA 4H27A 3VU1A 4AFNA 3AVXA 4RK4A 3IERA 2BOVA 3RSSA 3T3DA 4YO7A 4TTRA 4YT2A 1BJKA 1V5FA 1GNPA 2JA6G 1SHUX 1QDUA 1T5DX 2O2XA 3KELA 1L8LA 1RQGA 3ZGYA 2O5EA 3ED1A 1ZSVA 3EGXB 3NT5A 2BP7B 4OXNA 3DE3X 4E0BA 4YCCA 1MGOA 2FCAA 2B1GA 3UKDA 2FW7A 3FB4A 3ZVKA 3JD2A 1XA0A 3QLEA 5KYWB 3ZQUA 2DQKA 4NP6A 1MHPA 5CHEA 4O7LA 3LC7O 3KSDO 3VOBA 5KX5A 4LSXA 3K6RA 3CRZA 2GKOA 4G5SA 2GN4A 3VAYA 3CQ9A 5A4FS 5EKTA 5DEOA 1N6RA 1PL7A 4IHJB 4GLXA 1ESCA 4QQRA 5AW8A 1C3EA 3M89A 2PT5A 4L78A 3SVLA 2ZK7A 3W9YA 1D2NA 3A58B 3TQSA 4JODA 1KZHA 2FCRA 5I5UA 2YKGA 1FTGA 1LK5A 2JANA 3GTJA 1A5BB 3SJZA 4ZZ1A 3E9RA 4TQSA 3L1KA 3NM4A 3LWBA 1JHXA 2J48A 4AKGA 3WWZA 4MAMA 4HWKA 5LZ7A 3WTBA 2NACA 3MTQA 3ZIAA 4JUFA 4WDQA 5JRDS 3F71A 1PS9A 1U90A 4YJ3B 5IKPA 5C0OE 1K4MA 2B2CA 4C03A 4M1ZA 4DR7H 1S4MA 4I9FA 3T61A 3W6UA 3LUBA 4OJMX 4A3JG 4YJGA 4K81B 4LJRA 3DXFA 1YC5A 4LY3A 5AJTA 1E9EA 4HNUA 3MXOA 5ECDA 5AWFC 3WZMA 1MOSA 1M0EA 3RDPA 4BRSA 2CDRA 1U0SY 3M83A 3HCWA 2G9ZA 1U8ZA 3MR5A 3GILA 1YT5A 2DU8A 3C3AA 2V98A 3LQ2A 5HG0A 4Q6BA 3V6JA 4N48A 2CJYA 1TPZA 2FQQA 3NYRA 1UPBA 4MV8A 1THMA 1GZUA 2PGAA 3AKDA 3TIFA 4X63A 3RS0A 4YAKA 1XF1A 1N48A 2MU1A 1QMGA 3KALA 4LJ5A 4UD6A 5BWBA 3BZWA 1P31A 3HXKA 3NAMA 3BPSA 3CXUA 1I7DA 4QFDA 2JBWA 4OHFA 4HFRA 4UEJA 2H2HA 4MKGA 4LJ6A 4M0DA 4HDOB 5KTTA 2ZCJA 3HLYA 4E03A 1VCHA 3SLKA 2XBLA 4RF2A 5AXCA 4ZCTA 2QHXA 1BHO1 4FE4A 3TIGA 4LBVA 3VPBA 2J7PA 2DFNA 2V8OA 2GT1A 1N2BA 3GAFA 5E8JA 1QV9A 3EXFB 3E4CA 1FFXA 4J16C 4E5NA 2GM3A 1T9GR 2NADA 5LNK6 1TCUA 3GROA 3QVSA 5EE3A 1P77A 3SZOA 3BGSA 4RY0A 1PAUA 4C0QC 3NNNA 1JJVA 2BR3A 3TSYA 5K2OA 3T52A 1RHUA 2B4TO 5IAKA 2DT8A 3W1EA 4M0JA 4CC5A 2C9CA 5IG2A 1J5PA 1RKQA 3AUKA 4FYKA 4O1IA 1ODCA 4ADSG 4BJHB 5FI5A 4DWWA 2A3RA 4RIEA 2EJTA 2A9KA 3GCDA 5L40A 3UJDA 4F4IA 1SOMA 2IODA 3ICCA 4MGZR 3WMWA 1QU2A 3D6UA 4M8KA 3L0CA 2ZYGA 4M8SA 3K3PA 1RWXA 1Q1ZA 4X45A 3A2NA 2QYZA 1FX1A 3IVRA 2QN6A 3PJGA 3FYHA 2AOUA 4KHZA 3X1KA 3KV1A 1VDMA 7GPBA 2P9QA 4KPYA 2NXWA 4K9QA 1Z4PX 1J9GA 1O4VA 1ZC3A 3B52X 2O8CB 5LP6F 1FMFA 3U40A 1GTL1 2F59A 3G88A 3I73A 1A8HA 4F50A 3A1NA 3A9CA 4B31A 3U7HB 5JCOA 3BMNB 1UEXC 4R98A 1M1UA 1ZRSA 1I8TA 4R84A 4AN0A 4UBJA 5B1YA 4YAGA 3Q3IA 3RSQA 1NKTA 3TLGA 3DOUA 2GZSA 4E1BA 3TY8A 2CL6X 1U6IA 3DFMA 3EMVA 1IXKA 4RD3A 4DVGA 4B6SA 2EWWA 3FDSA 4AJOA 1AS0A 3JALA 1RACA 2IXEA 2PT6A 2X5JO 2XR1A 3B8EA 5AESA 1E9RA 4B3DA 2AFIA 2Q3EA 4EPVA 3BE6A 3PW0A 2GM5A 2MSLA 3KXLA 4UM9D 3DO5A 4GR4A 2ODAA 1NLMA 2VF7A 4UFOA 1IHPA 4YRPA 2JFQA 1NX6A 5CMLA 5D5HA 3PHBE 5EEGA 3LQSA 4IBOA 1QGZA 3OQPA 4K03A 1EVIA 4ILEA 2ISSD 4RJIA 4Z0NA 5JJKA 3CFYA 3SDSA 1RPTA 4ITUA 4Q3AA 4O2BF 3GLHA 4CDGA 1DXYA 3FOZA 2JJMA 3HHEA 3NTOA 4BXXG 2HK6A 2XYGA 2M2IA 1PGOA 3FZQA 1TE2A 2ZR9A 3P9QA 2Q1UA 4JLPA 3R7NA 5ICGA 3NNSA 5EP3A 2VXCA 2SKDA 3WK7A 1ZL0A 1Y5IA 3B3AA 4RELA 1EFVA 3AJ9A 3A6GA 3H42B 1NYLA 3OETA 4JYBA 5IC6A 4OBEA 2ZRFA 4GMHA 1YK1A 4I1YA 4TLMB 3ZHZA 3L8MA 1LVHA 2NV0A 2OB2A 1SUAA 2YX1A 3GRZA 3AVQA 3PTZA 1KT8A 3KHTA 3IV6A 5HE8A 3ZW7A 1IL0A 2TS1A 3P4UA 3S0JA 4BMZA 4ND2A 2EZ8A 3GG2A 3DTVB 3K9GA 1GGNA 1R4NA 4ETWA 2BQ3A 2ATXA 3AR8A 3U02A 1JLKA 4N12A 3AF6A 4JT9A 1VMIA 4N54A 2I7VA 4LF6H 5F9LA 4YAIA 1AU9A 1ISJA 1DIKA 1VMEA 2D5CA 2ZRCA 2D4HA 2ZTSA 3JQBC 1E0KA 2GYVA 3RIMA 1K6MA 1F3LA 1TDJA 2QI9C 1OYYA 4WIAA 1YI8A 2GYWA 3QPAA 5TVKA 4WY8A 3ZU3A 4B3GA 3LA6A 3ZG6A 4BX3A 3J81A 1Z7YA 4PLFA 4RH0A 1KI9A 1RQXA 4RSHA 2AVDA 4EA6A 4TV8F 4MVJD 4Y1EA 5JQGA 2ZBGA 2VDVE 2DPHA 3RANA 1EJ0A 1FVXA 1ZIYA 5LMNH 2V96A 4O7VA 1EINA 1QYVA 2Q3FA 3GLRA 3HACA 1C8KA 2EFHB 4Q3CA 1FTYA 2VF5X 3UMFA 3W5UA 5JJBA 1JEYB 2VF2A 1QHYA 3ETGA 4RKWA 2J3HA 2X9LA 1Q0LA 1NBMD 3O8BA 5IZCA 5CCXA 1SY7A 4JDPA 2ZB8A 1ZG3A 4MDFA 2BISA 5D8DA 3CGWA 1MABB 3ZDYB 3QEAZ 3DBLA 4P6VF 3GLIB 3OZCA 4TLLB 3KJNA 5E4FA 1G1AA 5GV7A 4KX3A 5K4AA 1ZOOA 2WD7B 5A0TA 3R5KA 3U54A 2ADMA 2FEAA 1VG8A 3MTDA 3Q8RB 2W2LA 3HYRA 1E4EB 3OE1A 1EWKA 4M7WA 4WZ6A 1SZJG 5TVGA 3ZV7A 4BASA 5BN5A 5C8ZA 2G17A 2RIPA 4AJJA 4M0UA 2EJ0A 2YW2A 3F0TA 3OP4A 4P08A 2R8KA 5AJWA 3TLZA 4E12A 1JIHA 3JQDA 4D41A 5F2EA 2YYAA 3I53A 5FPTA 5FNVA 1RC0A 5DAAA 2H4XA 2O57A 3HJGA 3RD5A 3WQQA 4RTRA 5DM1A 1NXQA 1SVUA 2JEGA 3T06B 3SX2A 2C4TA 5JRJA 4TXMA 1PWXA 1T3TA 2XBUA 5AK0A 2AZXA 4EHIA 4CIVA 5KNCH 3AINA 5D6OA 1NXSA 1TQ8A 4IFBA 1VECA 5AJXA 5F52A 1MNAA 2JVKA 3UHJA 3UJPA 2XC9A 2FR8C 2CNUA 2P11A 2O5RA 3ZGXA 1VBGA 3W6NA 1ZNZA 2YUTA 1TKBA 1ST3A 2BHLA 3LF1A 5HA5A 3ENZA 3UGTA 1R5BA 1L2TA 4BBRG 1ZUWA 2DUMA 3QKSA 1FP1D 4KQJA 2BRUC 4HEA1 2NUAB 3FRHA 2WZQA 4ZTUB 3JRNA 2A30A 4KRFA 1VYVA 1TVMA 2NVUA 4KE6A 3N76A 3NBYC 4C2AA 1D2EA 1R4MA 2QJOA 1ZOSA 1BGXT 3T9DA 4P31A 1LNQA 4PC6A 3L9WA 4BMNA 2UVDA 1WW8A 1YVPA 2CNWD 1AKYA 2C28A 4IIJA 1GPJA 1FC0A 1B73A 3B20A 4L7QA 1C0KA 5HUHA 3SMQA 1EFRA 2FX5A 3PXXA 4DBVO 4EEKA 4EO7A 3I05A 3H19A 3LKVA 1H0SA 3VZDA 3AHGA 1T0IA 1DSSG 2W6IA 3NWOA 3LBHA 4NS1A 4RXTA 1Q11A 2HMUA 3KDPA 5E7MA 5FOVA 4F9TA 3NXKA 4V0ME 3DCIA 2E85A 2PXXA 2RJOA 4FYVA 2FQXA 4Q34A 3RTDA 4QWMA 2AQ4A 3GVXA 3T54A 3TB6A 3MELA 4IQGA 4WLOA 3UB2A 5AM2A 5JZVA 2JK0A 4P80A 4D2IA 1LZLA 3ZGZA 4UNQA 1PJAA 3LQQA 2X76A 4XQEA 1M34A 1CUGA 1Y5MA 1XZMA 1YBVA 1QG2A 1P3JA 4I4CA 4Y2VA 3F6EX 3T7JA 4AW9A 4KYUA 4IDOA 4AC9A 2C59A 3QG5A 2PYDA 2FTKE 2YV3A 5AJYA 3WL8A 5CBPA 5HXAA 2Q9UA 3P9CA 1EVKA 1FS5A 4RSMA 2DFDA 3RUFA 5IJXA 3O1IC 1C5KA 1GAJA 4LC0A 4U7TB 2AFIE 6YASA 4OLJA 4A3CG 1JHZA 1OE0A 3DDSA 5CM8B 3NDBB 4CQLA 1XPJA 3P94A 4OLHA 5H81A 3AM3A 3EZ9A 1O6ZA 4CKCB 1NV9A 3VZPA 2C9OA 3HA7A 3IUSA 4HRAA 5E2AA 1P18A 3NRJA 1FE8A 2GF9A 2QVYX 1FDTA 2UXBH 1G5RA 1NW8A 1DHRA 2E5WA 3GEHA 2MIIA 1ODTC 1QIGA 5BRAA 1D6MA 1CRPA 3ES9A 4NDZA 4E2WA 4EVRA 5I3CA 1JXAA 4B3CA 4BQRA 2FR0A 1U0BB 4NBNA 4EBCA 1T0HB 2NTEA 4NCNA 5A9SB 3AUJB 3BA6A 1FXWA 4MUBA 2EX0A 3LECA 2JASA 5ABPA 2QLBA 4KNWA 3NYWA 4YO8A 1DQZA 1GQSA 4PBRA 1EEXB 2I78A 3WV4A 2GUWA 2HNAA 4AL4A 4OU5A 3QJYA 4BPBA 2XOKD 2AFIB 2GAIA 1TZCA 3SZGA 1JXMA 1OYOA 1Q21A 3OF2A 4RGVA 1L0BA 3PEFA 3PGA1 3NEYA 4JYPA 2GPBA 5KVQA 2OXCA 4H7FA 1CZHA 1Q3KA 1NXOA 5HJ2A 1SOVA 2V4ZA 3CB4A 3K16A 4Z49A 1O3YA 3AQ4A 1OHHA 3PVCA 1Z2OX 5EUBA 4UCOA 3HWX1 1Z5GA 1AGYA 1UL1X 5I47A 4U63A 2YHSA 2R3SA 3KJFA 1U9YA 3KFXA 3AW8A 4Q7QA 3VKHA 1R5JA 3PQEA 4XYEA 1LW7A 1FMTA 4OSPA 4A0QA 5IXJA 2MT9A 4UBOA 1N0VC 4AG6A 2XVYA 3VNNA 2P4SA 3OJCA 3KE9A 1QPGA 1RAHA 2VDNB 1O9BA 1SRQA 1SUSA 1BS2A 1P1CA 3A3PA 1RFLA 4G0QA 1A9TA 4Y1RA 3WB2A 2ZJ1A 3RTBA 3TBHA 1TTPB 2FRDA 2DMRA 2FW6A 3GJ0A 3EJWA 3L7AA 1QAOA 1MX1A 3NVDA 2RHWA 2QUAA 4QASA 1TZ2A 4X65H 4IG4A 1XC7A 5IH3A 4DYDA 3NV9A 4D81A 4A5SA 5ADUS 1W5SA 5CDFA 4B3MB 1NZDA 2BD0A 4W8HA 5ALLA 3R3UA 2F8MA 3KKEA 4I8IA 3WK6A 5JQGF 1WDWB 2UVPB 2JA2A 4FFMA 2OLSA 2HHFB 1UM9A 3HPQA 3I8XA 2R6FA 4CMAA 3JQCA 1A2QA 2LRHA 3AKEA 4L3OA 3GO4A 2HAEA 1IYEA 1DUSA 1KKUA 2P9ZA 3LQYA 3QPVA 4P9NA 2PWBA 1N2EA 3U3ZA 2G1KA 3GPLA 2CXHA 4HQFA 3AFGA 4PO3X 1P1HA 3BXGA 5C9ZA 3A4MA 3TXAA 1N34B 2IVZA 4A8JB 4G1EB 3OTOB 4ABTA 3I3SR 3WGVA 5CP8A 4WK4B 2VHXA 3ONNA 4ZANA 2BEVA 4E1VA 1XSEA 4GICA 3WL3A 4B45A 4BO1A 1Z26A 1Z6ZA 3BGOS 4H7EA 3O94A 2KLHA 5EJGA 3ZV5A 3FGNA 1WF6A 2Q49A 4MO2A 2IFTA 2IPOA 5DMXA 1JI3A 5ADHA 4LZJA 3HY4A 1XAIA 4BLTA 3NBQA 3OEED 4RF3A 3ADKA 5HBRA 3Q8QB 3AB7A 4JI4B 2CDBA 3MAGA 2GN6A 3KWLA 4RANA 1TTHA 5AUNB 3ZKAA 2QBYA 3RS4A 4LF4B 2CSXA 4Q4HB 3UCEA 3MWJA 1B00A 1E92A 3WJ7A 1P9WA 4RZRA 1W93A 1Y4SA 3RVMA 1A76A 4MI6A 2QG4A 5DW0A 4BBSG 3M6LA 3MVEA 4IZHA 3WWYA 1LPOA 2WWHA 3FYSA 5EZYA 4D5EA 5JYDA 1HMYA 2I33A 2R6CA 1N6HA 2C3YA 3VNSA 1S0OA 3AR9A 2A7XA 3GJQA 3MM4A 1F8FA 3HZHA 3UK1A 3SHFA 3D6JA 3ZK9A 2IEBA 1CEYA 1NMYA 3GP5A 1T8PA 1P9OA 1IN6A 2DJ5A 4TV8B 3TD9A 4R1PA 3VTKA 4QO7A 3D6VA 3WK9A 3ICOA 1GNLA 4KQCA 5HOEA 3DDZX 1AN0A 3LT1A 4MI3A 2B9VA 2QU7A 1G6KA 4WADA 3U4QA 1MNQA 3DR5A 3HB0A 4P84A 2H48A 3H1FA 4M38A 3VDXA 2J6IA 4CV2A 2EKQA 2PH5A 2X9NA 2XTJA 1ZH4A 4N65A 5DYGA 4OATA 1GZ7A 5JUMA 5IT9A 3CT6A 2H8KA 3U55A 5CPFA 2FK1A 2DEUA 1KEPA 5THXA 2B7CA 3A1EA 2ODTX 3MTJA 4LMYA 1XZEA 3OECA 5IDYA 1CJKC 3B12A 3HCDA 4PAWA 1L5HB 1TWFA 1QRSA 1CU1A 3MMPA 5E3JA 1FDUA 3BC1A 3NTXA 5HV6A 5JY1A 3K1YA 3V7NA 1NOKA 2VBIA 2YS7A 2VPYA 2AKYA 3SI7A 1Z2PX 1X92A 3WYAA 3EVAA 5CXSA 3LT0A 4FFRA 1O5TA 3WLMA 1XRJA 5JNUA 1WCYA 4N82A 2XDYA 4QUJA 1RJWA 1MG5A 3C3DA 3IXMA 4FHCA 2X3YA 2ZI9A 4M0MA 2DUNA 4YB8B 4YJHA 5FI1B 3N0TA 1Y1QA 4KVGA 2IYUA 2WTAA 3KR2A 4M8LA 3NHLA 2BKXA 3O47A 5DWVA 3P9NA 1L5GB 5H7XA 7MHTA 2IP4A 3JY6A 5ALNA 2VZ8A 5HF9A 2I91A 1KJQA 3DKIA 5H3LA 5JASA 1U28C 3WXBA 1QP8A 1B6SA 2VUHB 5AI8A 1LW6E 1SVWA 3EFBA 4JVMA 4CDNA 1D6JA 2ABJA 3U4CA 3WYFA 1A7AA 5I48A 1XU9A 1IAVA 3F6YA 1X9NA 5DK6A 3JQ8A 1R66A 4DMFA 1GGFA 5TQ2B 4Z3OA 4DV5B 1W4RA 1EQAA 4TTTS 3AHJA 3ILHA 3I5MA 1I24A 3P0JA 1E9FA 1EESA 1H94A 3IPLA 2GBLA 4AZTA 2BKEA 4DV0H 4Z53A 1TJNA 4F56A 2XGQA 3CVVA 3CR8A 1I4WA 4EX6A 2AX4A 2PL5A 4WVFA 4GPEA 3KQWA 4F3NA 4PAGA 3VYSB 2X6TA 3TNLA 3V4OA 2OO5C 3OOWA 4ENUA 1L7DA 4O86A 3DVAB 4V38A 1H3NA 1L4MA 2D0IA 4AZSA 1BWPA 4QDKA 3RR5A 1JLRA 1NI4B 4BE9A 4UCTA 1TCVA 3L0DA 3BQ2A 5DEIA 5A4AA 4BMCA 2CVQA 1APBA 2I6TA 3K4PA 2Q3CA 4EFDA 2JIOA 2CV0A 4DHEA 3MD0A 3QK7A 1GEGA 1V47A 2BTQA 3BK1A 3EH2A 2NZVG 3AOEC 1I4EB 3M6XA 2IBTA 3FNRA 3DNMA 4A8JC 2DERA 3HXMA 4Y9TA 4ZWNA 2H1VA 4KPFC 5EE5B 2FFHA 5AHRA 1FDVA 4KO2S 4NS4A 4NV0A 5T4FA 3ABSB 3IBFA 1CB0A 1SKQA 1MQSA 2WIFA 1YQTA 1CQWA 1QGAA 1HL3A 2PIAA 4QEDA 2C22A 1DU4A 1OT5A 1RTTA 1X6VA 5JTTA 2JFOA 2OBMA 5IH7A 4NZOA 3JD4A 3CLSC 2QLTA 2CKZB 2Q6LA 4JSRA 1PT7A 3DAPA 3LX4A 3TX2A 2Z04A 5CA0F 1YNSA 3CT4A 4BAUA 4C43A 4QPDA 3KKQA 1HPLA 2YZGA 3WLOA 2R1TB 3MRVA 5BWOA 3DVQX 1N2SA 1Y5RA 2I4IA 1KE2A 3DCJA 3OHPA 1LSJA 1A95A 2XD4A 3L1UA 1KJNA 5E6SA 5IKOA 5CFOA 1SBZA 2JATA 3R1IA 2V5VA 1SD2A 2IKSA 2IE0A 2XGOA 3TN7A 5BMVB 1N77A 2Z57A 5FLKA 3W5OA 3H4VA 3DV0A 5CA1A 1EYZA 4X85A 5EWEA 4BVHA 3U5TA 2IY8A 1XEFA 1DB3A 4NV1A 3PFIA 5HYVA 4MUGA 3IKTA 4NPHA 1EHIA 3NJRA 3P26A 4BQFA 2MDTA 5JIBA 2ZWAA 2XLBA 4AKTA 4GKBA 4EUHA 1XZCA 4LCEA 1IZYA 1ZMBA 3LW8A 4JKYA 5JVDB 1OTHA 4RKYA 4DWJA 1YS4A 4NF2A 3AYXB 3RFUA 3PUVA 5ILGA 3WADA 5JZSA 3RF6A 4YYEA 2CXRA 4QEKA 2XT9A 1Z4IA 3H86A 1S03G 5EA2A 4NCHA 4JZYA 3WICA 2D7DA 2ZJ2A 3K9LA 1Z39A 2A9OA 3UHAA 4DMHA 4L8VA 4OQEA 5JUWA 3PVSA 3GQBB 5U1PA 2GZDA 1DXOA 1TJ3A 1P16A 4P54A 3ROMA 1PZGA 3HKCB 1QYRA 1R0WA 4WXMA 4V0RA 1E1CB 4OG2A 1P4GA 2BGLA 4QL3A 4S35A 1P2TA 2DQSA 4XSVA 4AUNA 5F73A 3WLPA 3ZBQA 1H2YA 3GY0A 4YWJA 3S2UA 3RKRA 2O05A 3R23A 3H84A 5HDQA 2V3CC 2YN2A 3C15C 1DAKA 5AKXA 3PW4A 1NMEA 2SKEA 2VHYA 4XM0A 3V8VA 3JQEA 5ES4B 3GJ5A 1OXBB 4EQZA 3SLRA 1X7WA 1XJWA 1H93A 2FG7C 3B78A 3F1LA 4E2YA 3E1SA 3UJBA 2PSFA 2VA2A 1KMNA 1RZVA 2P41A 3OEHA 4YLGA 5LP6C 3T1HB 4PX2A 2HU7A 3C1OA 3HGQA 2P9FA 4RABA 2MSCB 4GOMD 1TD1A 4DIBA 2JKZA 4U7DA 5TMDA 1E8MA 3HCBA 1V7QA 1ZW6A 2O07A 3QELB 1HQCA 1R6XA 1XAGA 1B42A 1E1QD 1M2WA 3WLEA 4XVRA 4A1OA 4F6LA 4QRHA 5DBOA 1LX6A 1SXQA 1O96B 3SS9X 2JEJA 4L8WB 5FD6A 4EY7A 5FTWA 4D4JA 3IPXA 5EGSA 5C32A 2Q5JA 2EBHX 2X1VA 3DP7A 3E9ZA 4H60A 5AW9A 2AYZA 1FMLA 4ONEA 4YI3A 2WJJA 3ER9A 1L3BA 4R8UA 3CA8A 3NS7A 4RESA 2WG1A 1T9DA 3WKCA 4ID3A 2WIJA 3PT5A 4WFJA 5L3ZA 2DOKA 3WYDA 3N74A 4AJEA 5B3LA 1JHPA 3D54D 2W0SA 4KXXA 3LUGA 4QJIA 5GVRA 3ZX4A 3FOEC 1JU3A 2MSNA 3M9LA 4A93G 3C3KA 3DEFA 1H05A 1YZKA 2V97A 4OI1A 2IYZA 2PGJA 1YQXA 1K83A 1MFPA 1DFHA 3D3JA 4KJZA 3UK2A 3JSAA 5KTKA 4FNAA 4CM3A 2ZJYA 2XA9A 2K4MA 1JIXA 3FZNA 4DKJA 3IGFA 1XK5A 3SC2A 5JS8A 3F4LA 1IM5A 1VHTA 1BEEA 1UF9A 3AWDA 3WB9A 2B99A 2COIA 2VJKA 5CDYA 1M6HA 3LSYA 5K0FA 2WQ7A 3AVUA 4KFUA 3AZOA 2WLTA 4BN4A 5DNYB 4FJ0A 4FB5A 3E8SA 1ZPDA 2PH7A 5BQPA 2J3QA 3GJYA 3OQBA 1E6MA 3I72A 2CVHA 5A7HA 2R60A 3ZTTA 4XGRA 1F3OA 2OO7A 4KGVA 1OLXA 4IH4A 5DM0A 3IUJA 4M7OA 1VJCA 1FVHA 2ZB2A 4M49A 1FEZA 1L5LA 4F4JA 1GKLA 3MILA 4S2EA 4UEOA 4FYMA 3B9RA 3BH6A 3M82A 4ESOA 3UY4A 4GOJA 1G16A 4GSLA 4RFVA 1M2NA 2FI1A 3QVJA 4M37A 1W2HA 3DUWA 3ON5A 3S29A 3NDIA 4WCFC 2Y9PB 1CF9A 4FEGA 3WBJA 4HRVA 2HF8A 4BLRA 4Z9XA 1LUAA 2ZS9A 4II7A 5JJ5A 4CMDA 3C8HA 2FK8A 3GFPA 1FJXA 5DISB 2CMHA 2VRCD 3I52A 2Q9BA 2CLSA 1U2DC 5CU7A 2NO5A 4ALMA 3OOHA 2G5PA 1EJBA 2HR1A 4EFMA 2GN1A 3E3LA 4JX8A 2HREA 1E9SA 4OO3A 2FMHA 1J0CA 3QI7A 3M34A 1EI9A 2C2DA 4B83A 1KSHA 3R5SA 4EHDA 1E62A 1EK5A 4YMSA 3HZOA 1G7SA 1OILA 1ZK0A 2V7BA 3VKWA 1IXSB 4N03A 1U02A 2DLDA 1RRVA 4HDKA 1GADO 2QTRA 1WUKS 4OQFA 2WKPA 1G8GA 2IOQA 2C07A 4RVHA 1TA8A 4LNUB 3BQ1A 4QVIA 3IV9A 4EY3A 1MN6A 4HY3A 2ZE7A 3EIOA 3GVHA 3MMXA 3W3AA 3KYJB 2OP0A 4ARBA 3A4TA 3CLHA 4MP3A 1IPHA 3X1JA 4V0OA 3ZHRA 2VXYA 3FYCA 4PZUA 4MW2A 3D9QX 1KZ1A 3ZUGA 3ERCA 3MCZA 4EMUA 3QUQA 5AVJA 1O77A 4LYJA 2IWRA 3WNBA 2DFKB 2NO9A 3WLTA 5I5TA 4CGYA 1DWQA 1OC2A 2XNHA 3H11B 3V48A 1E77A 3PPWA 1CY1A 4GQIA 4Z8YA 4HZIA 5I8WA 2ERCA 3R20A 3OLYA 3O4GA 3W8EA 4FGWA 4C7JA 4F4WA 1A77A 2N0SA 2O3QA 4Q3DA 2X0RA 3L4JA 3TLBA 2VO1A 3AV3A 4DEYA 1WZIA 4FWTA 1W36C 2YZKA 1UZAA 4QQ8A 1MBZA 4JI0H 1CQZA 3BVPA 2ZQYA 4D4IA 3FDIA 3SFTA 5FPKA 5KX5B 1IBSA 3GRUA 5FP0A 3RG2A 3N6XA 3HVIA 3GZ4A 3V1NA 1BW9B 3TTWA 3H8JA 1XCBA 4YP5A 4LRTB 3V8QA 2ZR0A 2H7CA 4XQ0A 5CTAA 5FNZA 2IU3A 4WXEA 3LKZA 4S1VA 4DABA 2ZAOA 1RBZA 4XQGA 4QJ5A 3LLCA 5EE0A 3D0OA 2V7QA 5KTOA 1E3EA 3LIPA 4F4XA 3BMCA 1PR4A 4MWGA 5EOVA 2IU0A 1I4LD 2B25A 3DP9A 1M1XB 3EWAA 4GC9A 3FCUB 5JXIA 2NU9B 1BE0A 3A9TA 3DZJA 4M1EA 2GPWA 1P8LA 2WV9A 3INNA 2ZIUB 1JE1A 4YQFA 4MARA 2NU7B 2OP1A 2WV7A 4YQZA 3GLSA 1TD9A 2FPPB 5I8PA 1II9A 1JAIA 3CEJA 4EG7A 2NUTB 3BMOA 2CWWA 3D8TA 1J2UA 1C1XA 3ROGA 2MSWA 2REXB 3ESAA 4BVBA 4YUWA 3FZGA 4LE0A 1IQUA 3AL0C 2QPLA 3UCFA 3QM1A 4F96A 4Q4LA 3ZZNA 4CG2A 1Q91A 3IEXA 3ZU4A 2O2CA 1R3DA 4BO5A 4ER7A 2A78A 1PT6A 2BFFB 1EWVA 2BEWA 4JYMA 3M9MB 2BCGY 3SIXA 2QL5A 1JQJC 1P7WA 3BICA 4Q37A 4F4FA 4H4CA 2FJPA 4INAA 1GCIA 1Y8AA 2R4QA 1UXIA 2D5IA 4CC6A 2NU6B 1PDOA 2JJ2D 1FS6A 1Q7BA 1D6SA 3OPNA 4QBKA 3WHPA 3ZWAA 4B74A 5LUAA 1WY7A 4AZ0B 1XXLA 1QZXA 1DVRA 1TA9A 5JCOC 3MCTA 1I6LA 1T3NA 1NE2A 4KFTA 4PHHA 4UZEA 3LPAA 2PL3A 4GXRA 5TMBA 3K70C 3R9IA 3LGSA 3FNEA 3K96A 4JI2B 2FK7A 2SHKA 3TMYA 5CFPA 5KOYA 1GYFA 1HXHA 4FFLA 1Z0JA 4TXNA 3BB4A 4EHBA 2Y0EA 1L3IA 1JI0A 4KHPH 1GEEA 3ZWOA 3B70A 2EJCA 2OQVA 1WCWA 2CYBA 1QZTA 2P3OA 2OWEA 4CHIA 1Y0BA 2C97A 1IU9A 2N1MA 3Q3GE 4NATA 4BV8A 1EK0A 1PW5A 2OFFA 5L4LA 4NOKA 4WXHA 1YOVB 1XTVA 1OA1A 3ORSA 3RPEA 2ATEA 5AVWA 1EUDB 1TW2A 1ISRA 2ZRNA 4FBLA 1LDNA 4GUAA 4RSGA 1E58A 4DA7A 3FPKA 5K0TA 4A2QA 1FSZA 1P1KA 2FOIA 1J20A 4I5DA 3I39X 3HKDB 2W71A 1DUIA 3TW8B 1TKRA 3OLZA 1J39A 3A27A 4Z54A 1X14A 4RPGA 3H04A 2YWBA 3JWJA 3HKEB 4H15A 4QYMA 2ZRBA 1UXJA 2V4RA 4PGMA 1E7RA 2C7RA 3LP5A 2NZUG 3AGPA 4LJLA 3GFSA 4BWSC 1VBHA 2CUKA 3ZCXA 4XDGA 3HJAA 3MQ2A 1KFBB 1ZRMA 2VZ0A 2WAYA 3H8VA 4GD3Q 5D1OB 3W5DA 2Z95A 4W5OA 3PFCA 4HUQA 4NL4H 3H97A 2BHSA 4JKIA 4M0KA 4D9GA 2YDXA 2OK7A 2B5VA 3C8DA 3GNSA 4DZTA 1US8A 1G19A 4QU0A 5JI2E 1FVIA 3E6AA 1TM1E 2G09A 1IB0A 2EBUA 2RGWA 2JAPA 1PG2A 2HBQA 3RHFA 4EJ2A 3ISVA 4KRGA 2Q5OA 1O6BA 4UHEA 1M6NA 4BO9A 5I3ZA 3PU6A 1KQ3A 3E9YA 1I50A 1QK3A 2B3DA 3GCGA 4KC0A 2K6GA 4PSUA 3OZFA 4CCWA 3I9V1 1Z6XA 2EGUA 2HA6A 2Y0CA 4G56A 3WLRA 5M04A 3X2SA 1XTBA 3H2HA 4RETA 4NY1A 1RABA 2FPIA 4NECA 4WRRA 3GFFA 3ZVRA 3EDOA 1EGHA 2J67A 3EPPA 3GLHB 2M6SA 1T91A 1ZITA 5P21A 5L7WA 5MF6A 3EZLA 4XYMB 4EKYA 5CVVA 1O54A 3PE6A 3OZRA 3VNVA 1NLUA 3BMCB 2E9SA 3F4KA 3O4FA 1HRDA 1TM4E 4RD0A 1ZCBA 5ARDA 1ADBA 1I2DA 2J0VA 1KYWA 1MAAA 1Q0RA 1Q0PA 4I7HA 2GNPA 2QN7A 3DT9A 3F49S 4EKIA 1IXZA 3FXAA 5KFUA 2LBPA 3QOFA 1A9ZA 2H08A 2VZLA 3OTGA 4XX0B 1RHMA 3I9V6 4HAXA 1YDMA 1G41A 5G0WA 1PTJA 1DLIA 3HVHA 1ODIA 1L5ZA 5GVSA 2PKYX 3IAHA 4O4LF 4XD7D 2OG2A 5JRZA 1TYEB 2IHKA 2WZCA 4C0WA 4ER5A 2F7SA 5EGNA 3EODA 5PGMA 4UUGA 2BMFA 4J0EA 5CEJA 4ZXPA 4BCCA 4HGRA 5EWMB 3UBMA 2BKUA 2IW1A 2QYHA 4H6PA 1ADFA 3LO5A 4K28A 3AEYA 4QHTA 1OXUA 2F43A 4HDSA 2A0KA 1I1MA 4RUKA 5DSXA 4YP7A 4HX9A 4YMGA 4DV3H 3VR0A 2EC5A 1KAOA 1QHFA 5A4KA 3OY7A 1ZUNA 5CDTA 2LD4A 2HQRA 4JWKA 1U5AA 4ZEMA 4QWEA 1PLLA 1RS0A 5NLLA 3WWDA 1YB4A 1JEQA 5AVZA 1P61B 3BRCA 5CB8A 4MV4A 1R00A 4UBIA 3MTEA 4NYMR 1JN0A 5GZ1A 3HY3A 3LC2O 4AY3A 1L7MA 2A0UA 2JI7A 3OESA 4ND8B 1AN9A 1L4NA 1PHRA 1TFUA 4IEIA 3I2KA 4HGNA 3VR5D 2KB0A 2C4MA 1HT3A 1ZBQA 2D2EA 1U9ZA 2R25B 2V4UA 1BN7A 4DYVA 2CEKA 4EJSA 1SOUA 2CXUA 2YIDA 4HG2A 4Q9IA 4XE5A 2GEBA 4JSYA 5EJMA 4HLUA 3JSNA 4PO1A 3ZWVA 2EW2A 4IV5A 5HIAA 3RRXA 2QA5A 1W36D 5DHFA 1I2ZA 5L9AA 4RE5A 5EZSA 1WULS 1L9XA 4IW3B 1N33H 1N3BA 3CISA 4ML3A 1KIFA 2CXOA 2I03A 4OHCA 4U2EA 2C2ZA 5FBRB 4LWPA 4FFSA 5FUBA 1UOEA 2I1QA 4PGAA 3T7KA 2OQRA 1SVIA 3RJZA 2J59A 1LBSA 3SC6A 5KQSA 2NG1A 1XN4A 1XV5A 3N8KA 1ZK4A 2ISCA 3FLBA 4RHXA 4XUCA 4LSAA 2EYQA 2OECA 1Z56C 1RBQA 4O2AB 4TRNA 3UK0A 4EZEA 3U26A 2PJUA 1WRVA 4ZN6A 1CZKA 2IC5A 5BN4B 1QKIA 1I33A 1FQWA 3HE3A 2AJ8A 4ZAGA 3T1OA 3N43B 1S9DA 2VPWA 3V9AA 2NUPA 4INJA 4ECZA 1E9BA 2YQ5A 1GGEA 3OPQA 4IKPA 3NHWA 3OWOA 5DJ5A 2WINI 4Y6OA 1KC3A 1MU0A 4MEBA 4TWRA 4AMUA 3FG9A 4HNGA 3SLGA 3ZY2A 2WHPA 4PYJA 2EZ9A 4DCVA 3DHVA 5CB6A 5IXYA 3KAQA 1VBMA 3MRXA 2PMWB 1F8XA 1U80A 3CC8A 4RHTA 1SUPA 1H8ED 4G0VA 2WYWA 1COZA 2WD9A 3HU5A 2WQZA 5CR9A 5JNLA 5KZMB 4A3GG 2F64A 3OJXA 4DMLA 1QQ6A 4O81A 1U1IA 2OY0A 3G59A 4HEQA 4JS0A 3OE7A 1CLEA 4L7VA 1U7UA 4AJ9A 5I7UA 2Y0SA 4R9UC 3VKUA 1Z34A 4FFDA 1VBNA 1SHZA 1C14A 1SH7A 2RH4A 4D4LA 5JC8A 3VFDA 3VSEA 2WABA 1TAUA 3F2VA 3DWIA 3QPUA 3ILYA 4XIFA 1IBKB 1UBCA 3UYYA 1N3LA 5ECGC 1Z7EA 2F90A 4RIGA 5F7XA 3H83A 4PVDA 1J21A 1SFOA 3OLVA 1WSWA 1CFZA 3PQ5A 4MQLA 4TS9A 5T64A 4MA0A 3ETEA 3SR4A 1OLUA 5FX2A 5LOVA 2PEZA 3Q5GA 1DARA 1L7PA 1D8AA 3I2IA 3FCCA 4WL0A 4EMBA 3WA7A 3ONFA 1G2QA 4UTPA 1CVRA 2YJ4A 2GH1A 4KWTA 4TLCA 5IT0A 4AZWA 1GL7A 2IHBA 2C92A 2NUAA 1QX3A 1U8EA 2BFOA 4D0SA 5IT9W 1WAMA 3IKJA 3WAJA 2HV9A 2V7GA 4NOLA 4LFCH 2UZAA 4PGFA 3LSTA 1IOWA 3WZLA 5L3VA 2H0AA 3CVUA 2XMGA 3KT6A 2G04A 4OYLA 3EVGA 3GN1A 4TVIA 3SEZA 4X62H 3GLFE 3N05A 1O97D 1KP3A 1RAIA 2ZUWA 1SZDA 5KYXB 1XVUA 4P93A 4HVLA 2AN1A 4TQAA 2RGBA 3C1TA 3C3MA 1FTWA 2DUJA 2FEPA 1FTSA 2WM9B 4KH1A 1DBRA 3LCRA 3V00A 3PRJA 3V7UA 2XECA 4QGAA 5EE1A 5JY6A 2JK1A 3T3OA 4HNVA 2PM8A 2P9GA 2DT5A 3FGZA 4B17A 1BDHA 3TYXA 2RHOA 3I30X 5JU6A 1I4DD 1E7YA 4O3PA 2Z4SA 4G0ZA 1MA0A 4JI8B 2OWOA 3RSOA 1BJTA 2V65A 2IPAB 2QE6A 4YFYA 5HQ3A 1H1LB 2O2EA 2HMVA 3KSZO 3NUZA 4L6AA 4F5YA 1CF4A 5EXSA 5A3VA 1LLUA 1XTTA 5KJ6A 3AL3A 4ZAVA 1AQUA 1BG6A 1G3IA 4KACA 1BYIA 1JA9A 1ZH8A 1ISSA 2QVXX 5LMUB 2HEGA 1XD2A 2O2DA 1P1RA 3AZQA 2ZYWX 4AYBE 3OU6A 4JH0A 5E9JA 4JI3H 3R0XA 1PIWA 3DHNA 4EGSA 3HS3A 2B8WA 3RVKA 3HY6A 1H6CA 1L7BA 4W7SA 5TPWB 1L7AA 5K8TA 4RTKA 2AG5A 2WJ6A 3ELBA 1ECGA 4D8UA 4K26A 2XCRB 4DR3B 4ARAA 1F12A 3TOZA 2HJ9A 1G8SA 3CEHA 3EYWA 1W9MA 4CTOA 4YY3H 4N5HX 4NBUA 4MPTA 5BW8A 3VISA 3ZGLA 2P69A 2QW0X 2I2WA 4G84A 3L6CA 1YCFA 4CLRA 1QZZA 1RP7A 5EZ6B 2PMEA 4I8DA 2WWTA 2ZJBA 4I6EA 3WHLA 2JFPA 2QD3A 3KUCA 1DCKA 5DLEA 1Q0SA 3JWHA 1JKJB 3PO2G 4TYQA 2WKSA 1YHZA 2DVMA 2JEZA 1PZNA 5C51B 2ZBDA 3LQFA 4KIFA 2VTBA 5C8VA 2FDRA 5ALQA 2H5IA 2JI9A 3OUZA 3OVMA 3G2OA 3G13A 4JOSA 5DKFA 3PXGA 3FPLA 3TZBA 1M8KA 4RL4A 3K5HA 1N6PA 2OESA 2FY8A 4RQTA 2D0DA 3G82C 3LL7A 1RQRA 1CKNB 4KSBA 3RS9A 4AUKA 1F2UB 1YKSA 3DT6A 3O4HA 5CVJA 3IEPA 2MINA 2OORA 5FJ8G 2XIGA 1LDMA 3V1MA 2BJWA 4N41A 2VT7A 1N2CB 2IYQA 1PX0A 3ZIDA 2Y05A 4MA4A 1WO8A 1LSSA 1WF3A 2CD9A 3AJDA 4X1YA 3S2FA 5FOTA 1IHYA 3CWZA 1M8FA 2PQ2A 3O8LA 3Q6IA 4EHLA 4JI7H 4YRBA 3IE1A 4GL2A 1S01A 3SXUB 2C31A 3A26A 3WAKA 4JD5A 4AMZA 4J3NA 4BDSA 4Q7KA 3M5WA 3T3HA 3TGPA 3K15A 1Z8DA 3L2OB 3WGUA 3PQ6A 2EIYA 1SCAA 3IAXA 3G8DA 3MA0A 4D1YA 3DZCA 1EFDN 1UFOA 5G4LA 2ILVA 1G3QA 1UJ2A 1ZO8A 2JJ8A 1YA4A 4H7PA 4REQB 5JEDA 1TGVA 2VDLB 4FWBA 4QYTA 4YBZA 5DK4A 3NW9A 5KTPA 2UVRA 1U11A 5FD5A 4COOA 3W1VA 2C0QA 1IVYA 4RTQA 1YS6A 3EULA 1P3DA 4IV0A 2FWJA 1MO4A 4KDEA 1W5AA 1VLVA 1OAOC 4AROA 3RT1A 1P72A 2YZMA 1T0UA 1U2PA 2E49A 4GRDA 1YL5A 1IZ0A 3UFXA 4LFBH 1UEIA 1ZJ4A 1YCGA 1SELA 2PV0A 3EISA 3R8CA 3H1AA 3SE7A 4Q24A 3SNKA 4XCQA 3HV0A 3EZYA 5B58C 4MMYB 3PJEA 2EZUA 2KWIA 4WGGA 2ZZNA 4OVKA 1A5SB 1J7KA 4FBMA 3EJ6A 4GFDA 1E7MA 2HHCA 2PCJA 4LNAA 4DIKA 1PT8A 3MNFA 4OXKA 3MCWA 1U28A 2XWQA 4KKVA 2HO4A 2LDBA 1TMYA 5D7NA 1IG3A 4BB6A 2QW8A 2I67A 3ACBA 4P34A 5KQLA 4PTLA 3SGIA 3HDQA 1S2NA 1MRZA 3KYIB 4LYDA 2HB6A 4WE3A 3RROA 3IMEA 4GBMA 4F1JA 5F9HA 4GC5A 4JBNA 4DA9A 1CJBA 2E6UX 5DW3A 4EX7A 4CKYA 2OG1A 3I6IA 3U1BA 2JC3A 3LHDA 2HSZA 4D5GA 4DJAA 3QQMA 3SEFA 1DC7A 4DILA 3RODA 3X2EA 1SZCA 2EOAA 1GUBA 5FUXA 1JYSA 2GILA 4HDNB 4JENA 4Q9HA 4KXVA 5B7QA 2JHAA 3ESCA 2WSLA 4IO1A 4JJKA 1KO7A 4BLVA 5KC8A 3GLIE 2QTCA 3G2MA 4RD1A 4CMEA 2J45A 4JR0A 3HA3A 3QPDA 4JU8A 3K0AB 2B0JA 2XCLA 4NBLA 4ENVA 4M1KA 4MVXA 2ZSFA 4ZQHA 4DQNA 5K6AC 5KBYA 5J1SB 1T3GA 1U6KA 4PG5A 4BVEA 1FYXA 4L15A 3QU9A 3BORA 3V8PA 1U0NA 3WI7A 3F7NA 5IM4F 5CFLA 2EEPA 3KFLA 2WT8A 4DLUA 4N9WA 2O8VA 3GRYA 3IUPA 2JDIA 1GLNA 1YQQA 2HPVA 4EJ6A 3WGKA 2AJBA 2GBIA 4ME6A 3CW8X 4EYIB 4L5JA 5DM60 4EJMA 4ENSA 5J4YA 3HVRA 3NWPA 3QY9A 1RRKA 4MINA 3ZWMA 3NMUF 3JQBA 4BVFA 2PX5A 5HCIA 2LGJA 4X1KB 4BZQA 3CB2A 5DHSA 1IWPB 3BXHA 3H18A 1V3UA 2AMFA 2VQSA 4IH9A 1QNLA 1SIOA 5JYEA 3HL4A 2ENUA 1U04A 2W58A 2QI9F 3HA5A 2P40A 1JDBC 3CUEF 3PQ3A 1LPPA 5G41A 1QAMA 4AO6A 4FHGA 4EUSA 3UCXA 5EIXA 3DSRA 1X70A 1QYCA 1XXHB 4YNBA 2ZUFA 1EVQA 2PRYA 3GMSA 1FLNA 1UJNA 2YU9A 2AFVA 3KXIA 5ESWA 1F8GA 1DWOA 2JIZA 4MP6A 4XKJA 5DX1A 5KJ1A 2QAGA 3NCHA 4JYAB 1TK9A 1J1UA 1Q15A 2Q28A 4BNFA 1TIBA 2QT0A 3HBNA 3N8HA 1N0HA 1U65A 4FILA 4TWBA 5E2BA 1KE1A 1HYGA 1X74A 3D6FA 2W6JA 2ZDHA 4AXBA 1OXSC 2JD2A 4CYMA 1A7UA 3B1XA 4PLCA 1NSYA 4DSNA 5LDDC 5AXBA 1ELOA 1JE0A 1JPNA 3DF9A 5KDOA 4Q0MA 1JHRA 1W47A 3HLKA 4O3NA 2QLFA 2ZIZA 4S24A 4LHWA 3CVYA 4KMSA 4S1NA 2QRVA 1IEVA 2PQ0A 1WVGA 2BI4A 2CYCA 3FBGA 4TTJA 3SYRA 3WDLA 1MORA 2O8NA 2V7UA 3EIXA 1NUSA 2RHTA 2Z2KA 4DLYA 2YN4A 3KWMA 1Z08A 2QRPA 3IUEA 3ND8A 2WM3A 2VJQA 2XADA 4WLNA 4XM2A 4V24A 2ANBA 2CV1A 221PA 3FGPA 1Z6AA 2HCTA 5K3CA 5IAOA 1KBLA 2FHSA 1WSDA 3KR9A 2R84A 4AU1A 1PF7E 1S7GA 3ZYCA 4UMVA 5E1BA 5I01A 4R0MA 4HEHA 4EG6A 2Y9MB 1ZXLA 3HDTA 3UMBA 4HYKA 3KZCA 4W9MC 1A7KA 3T3NA 1DJNA 1S2DA 2VTDA 3QYFA 1LBEA 4RPCA 2XB9A 1N5IA 4INPA 1FX0B 3EA0A 3KEMA 2QD2A 1JBEA 2VP9A 3VBCA 1T4BA 3ZTYA 1LBTA 3C16C 2NZWA 2Q41A 2VHTA 2O1WA 3HZRA 2I3GA 1TO1E 1QUEA 1Z25A 2P9EA 3OEEA 4IVPA 4OOEA 4EG0A 5DWDA 2UVUA 1E2QA 2PSHA 3KZKA 2J9XB 1TVKB 4FNGA 4FQ8A 3E53A 3EY9A 1E2DA 1Y1TA 1M34E 1KJZA 2JKYA 4UDYX 4X0EA 3BERA 1QO9A 2JZOA 1CQPA 1QS0A 3GUCA 1O94D 2X19A 4UCQA 4ZVMA 3I8OA 1JNYA 4RLFA 2EZ4A 3RBEA 2ZRAA 4WKCA 4CEJA 4O02B 1SBYA 5LMUH 1AS3A 1CVIA 4HWRA 4XASA 5I9SA 4JNKA 1W4LA 3R6WA 2JW5A 2R65A 4GWGA 5B6IA 3LP8A 2YHUA 1NQ5A 1JAZA 2JIMA 2FSVC 4CEIB 2O3TA 2H1WA 5JSFA 1P7PA 4OAOA 1VGVA 2XOEA 2ZVQX 2GA9A 3HYLA 2V9CA 4UHDA 1G8HA 1QH1A 1D8TA 3QYAA 2ZTLA 3A6LA 3GGSA 5KFNA 3BK7A 3HBLA 1P7CA 3O03A 4G5QA 2H1CA 2BV3A 4DL3A 1XDSA 2QN9A 2HF7A 4Q00A 5DU2A 4MKZA 3ZQ4A 2P35A 2BC9A 4X93A 2JA6A 2GNOA 3H75A 1ZN2A 4Q3LA 1OA0A 4MR9B 4FE7A 1KSGA 4KYVA 5IJAA 3RUPA 3PUWA 2B5OA 1SBTA 3VAAA 3A4LA 4DADA 3EXEA 4MR7B 1YBAA 4EG3A 3QPCA 4H2DA 3BULA 2WA1A 4XTCS 1KFKB 3O91A 1JG3A 2RK4A 4E3WA 4F45A 3D8RA 2C9DA 4RACA 3GHHA 1C1DA 3Q7QA 3ANSA 4URFA 3K0SA 3L7LA 3MT8A 2PKXA 3A2LA 4XIJA 1DC5A 1AGNA 1T9HA 2VQEH 3E3OA 3RVJA 1XFDA 3EXHA 1U4OA 2P7IA 4EYEA 5GM1A 1N5OX 2IF2A 1NBOA 2D5AA 3WG9A 3S2EA 3X1DA 4AN1A 3HRKA 3FLAA 3KJZA 3N2KA 4NAUA 3AHCA 1J9ZA 4ARZA 5CXQA 4ZQCB 4JP2A 6Q21A 4TTAA 1SVMA 4PZ7A 5C4GB 4HV4A 3BE5A 4XEHA 2X22A 2ZM6B 5TB5A 2MWMA 1R9JA 1A82A 3IVAA 3JYNA 2AHOA 3T1YB 1USWA 3KZ1E 2TMGA 4O8ZA 5H80A 1GDHA 3LL4A 1XE3A 3E0XA 4R69A 4WCFB 4MVJG 3JAWA 2C5GA 5AHWA 4YMWA 3UG6A 5CCEA 4F4YA 2VR1A 2FAXA 2RHRA 4PZPA 4Q9LA 3TEJA 3MJEA 1GQYA 2VNJA 2AOTA 2W2NA 3ZDRA 5C8DA 1M7JA 4Y9UA 3NP7A 5KG4A 2HBYA 2NWQA 3T1HH 1DRVA 1L4GA 5FLEX 4ZA2A 4DY6A 3PFNA 3QE3A 3KB8A 1VI5A 1AT1A 2F3RA 3TK1A 1F4LA 3EPLA 2WJPA 2X7HA 2OM2A 4MVJM 3X3HA 4DFDA 3EK2A 4RCYA 5JSUA 1Y7PA 3OTHA 4AURA 3NGDA 1Q3TA 1AGPA 4ALLA 2G40A 3CPSA 4K6OA 4O2BA 4QGHA 1YFJA 3IJRA 4U7WA 3FMAA 2DCMA 2QSJA 2FN8A 1TGYA 4ED8A 2JA5A 2Q0XA 1X19A 1QB7A 3GWZA 1GITA 2OENG 2VP6A 4X7MA 1V4YA 3VH4A 1PE0A 1T34A 4OA5A 3WYCA 2XMZA 3OWXA 1TYCA 1VXRA 3G89A 5ULLA 3U0VA 3VR6A 4BWVA 3TLEA 4EAAA 1V7CA 1XI2A 3MQ4A 2VDKB 1LWOA 5AOVA 2RGNC 4R6XA 4EOGA 1P8AA 3W3ZB 1L5WA 3DMDA 2R1VB 3LUCA 4AP5A 4MW0A 1IH8A 4YYZA 4IIHA 4F1KA 1TKAA 2J0UB 3AR4A 3H2BA 2FDXA 5JH7F 4L2IB 2I54A 5T41A 4EUNA 4NPCA 1RLJA 5CVTA 1QR2A 3AT1A 4DQKA 3W5CA 5F3RA 4BATA 5E25A 4DR6H 3QTLA 2Q4TA 3ESZA 5LM3A 4CLRB 2C2XA 2EFCB 2OXFA 1Z4LA 3KRTA 5JR3A 1CRZA 1Y81A 2W11A 1MEJA 2YHAA 1LVGA 2I2AA 3R0VA 3MB8A 1RM0A 4LF4H 2ZROA 2PMKA 3RUDA 3KB1A 2CHFA 4GM0A 4WJZA 3KXYT 3ASUA 1WV1A 2IDKA 5E9AA 1NRWA 5KTNA 3GLGE 4NCBA 1QG0A 2Z5FA 2IF0A 1COWA 5A03A 5EEHA 5ED4A 2IYOA 2RDMA 2DKFA 1HTBA 1JQ3A 2Z2JA 1E18A 1YZTA 5F76A 3OD5A 1RWWA 3UJ6A 4C4YA 1E1MA 5F2NA 4KIGA 4UBLA 3HBMA 4XWWA 2CNWA 1QYDA 4IILA 2VLBA 3SWWA 5D5QA 5B6PA 1EVJA 1VL5A 3GUUA 1OFHA 2PLRA 2VA8A 8AT1A 4DLTA 2OE2A 3CLSD 4RZXA 1L7RA 2RKWA 1EIWA 1L5FA 4ZJZA 3AP3A 3R9XB 1FFBA 3GMIA 3OZWA 1X7HA 5COAA 1OV4A 3QLUC 4MIYA 3ICPA 3AIOA 5FWAA 3LXUX 1GQ2A 3ZDFA 2ZW9A 1WLYA 5A5DA 1MB2A 3COSA 3DE5X 4UCVA 3NJ4A 1VYTA 2OZLB 4PHGA 2ZIAA 2H1SA 1BEUB 5DCYA 4AP6A 2AYXA 3VTFA 2D62A 3TTXA 3UAOA 1DPGA 5F12A 3CSSA 5CM9C 2QTHA 1E3QA 1JX4A 3VDRA 1OAKA 2FKNA 3REQB 2VF4X 3ZE7A 3QBTA 4N7BA 1J0AA 4N5DA 2VP4A 3GTMA 4KW7A 3WP0A 1M34B 3UZBA 5B4VA 3G8BA 3O0DA 5F21A 2C9MA 4EITA 1SCKA 3EZGA 1XTJA 3PD7A 1VSQA 3PN1A 2JFVA 4IUYA 3QX7A 2XUPA 4IXNA 4K88A 4O5OA 4OFBA 2ZBRA 5IBQA 2GJSA 4C4XA 1SU7A 2YY5A 2YWHA 3DBIA 4OHBA 5AKEA 1QBKC 5FR2A 5K3BA 1DT5A 3ZGNA 1SK8A 5K0BA 2VQDA 1CY2A 1F5NA 1VIAA 1Z0DA 1L1QA 2PXHA 2QM3A 2W2LD 1AE1A 3MN1A 8LDHA 2XA2A 1BYUA 1EP1B 4CIBA 1KMCA 3C97A 2BGKA 3KT8A 1KORA 3ILXA 3L8GA 1RHQA 1VCOA 3MLEA 1DFGA 3DAHA 3CNOA 3KQQA 4OQQA 5A1JA 1GWNA 1SUBA 4O3SA 1JRLA 3WMEA 2JIPA 1KH2A 1I4TD 1DI0A 3BA8A 1GAWA 4F4CA 1IQRA 5JI3E 3W4JA 4DMKA 3ZI0A 4IJVA 1V6AA 3T1NA 4XUGB 5CURA 4C08A 1VG1A 1AJEA 1NLZA 2RB4A 1RYMA 1M1NA 3A31A 2R8YA 3EGXA 3NDJA 4LAFA 3DHEA 4J1QA 4QJFA 2Q3HA 1IXYA 2PX8A 1KL7A 4UE6A 4U3JB 3PR2B 2WOOA 3CTMA 2VUIB 2ODWA 4QXPA 4BNYA 3DFZA 4P58A 5EJ5A 1CUCA 4YRRA 2FPWA 1GGOA 3IUQA 4RYLA 4O4IF 3O8RA 1SUIA 3GJ4A 3TNDA 3P0IA 4JT4A 3AX6A 3I6YA 5C5CA 1M2JA 1HY3A 5IYBG 3E1KA 1JDTA 2C29D 2WPDA 4LTMA 4UEKA 2P62A 4LSZA 3DBHA 3P32A 1RAAA 3HWRA 2DY0A 1AZLA 4AUEA 2XGMA 2FE3A 1PNQA 3DMTC 1OXMA 1TM2A 2JS7A 1V1MB 1FSFA 3LA8A 1P1IA 4PN3A 2WE7A 3S5UA 5EJ8A 1WCMG 4E14A 3N2EA 4C5AA 3GEMA 4NYJR 5AP9A 1N5LA 3KR0A 5FEUA 4UARA 2X8WA 1M5RA 1N9KA 1TTQB 2AN9A 2EHJA 4DR1H 4E6EA 4C4PA 3SOZA 3ZNOA 1XEAA 2OZKA 3FHOA 2AGQA 1G98A 4K3VA 1V35A 2RAVA 1F60A 1PVOA 4ZT2A 3BBPA 4FM9A 2O5VA 4O25A 2VSFA 2A14A 4B7XA 3D8UA 5EVCA 5HFAA 3C2QA 4C2UA 3H5IA 4AKIA 4HXFB 3WMGA 1YOVA 1Z82A 3KB2A 4LKOA 5IM4A 4BO7A 4CDMA 3PIIA 4IHJF 2FF7A 4P7JA 2NXCA 3B3JA 3DEJA 3RWMB 2F43B 5C4XG 2ANCA 4HDSB 2WB2A 1HF3A 3RK1A 3WLKX 5CE8A 2WJVA 4WBNA 4DTIA 1UM9B 3F3MA 2C84A 3S7ZA 4JR2A 3U80A 2Z2YA 1KH3A 5C35A 5LU9A 1DDGA 3A25A 1I2LA 2R6AA 1W48A 2XB4A 2A5GA 2J5QA 3CZCA 4NYIR 3FUCA 1VG9B 3IAS1 4PEVA 1JIIA 1ESNA 4FE3A 2CN1A 3HU1A 1S3FA 2HYDA 4OHRA 1HZZA 2ZITA 4Q03A 3BG5A 2ETXA 4HF7A 3IAEA 4XWYA 5CLJA 5FH9A 2Z09A 1RC1A 2LW7A 1GR0A 3I01M 1RYBA 4WHMA 2FP4B 4WOCA 4PE5B 2EYUA 1ISMA 4MIOA 1MV5A 4L27A 4S3MA 1TFRA 3R3SA 1DBPA 2HQ1A 1I2AA 3FDFA 5FR9A 2OHGA 4FJ1A 5D1HA 4ER0A 4XVUA 3TG8A 3GTOA 1W7AA 2GUGA 1U8AA 2XVXA 1O87A 3T5PA 4B75A 1K27A 5LNK1 1MZVA 1U0HC 3KJXA 3R3JA 4HYQA 3V1LA 1GL6A 3UT0A 3W5AA 2PK3A 1LZKA 3BXFA 1F38A 3RAFC 1EDDA 5BVGB 3CRMA 3GRKA 3GP8A 1RI4A 1G64A 1RM3A 2YY7A 3AW9A 4I1IA 4J07A 4K5QA 4ZVVA 4X94A 4E4RA 2HNKA 5JMPA 4FW9A 2BBWA 1LRKA 3OSZA 2GGSA 3IDFA 1Y8ZA 1J1IA 1E1NA 1TF5A 4K9MA 1CF2O 4F2PA 1X0XA 1J8YF 1FOEB 1JIVA 1X7ZB 1HETA 1K08A 2LE0A 3FPJA 3KTOA 1LPMA 2FN3A 1EX6A 4UTRA 4NCAA 5LJIA 3GLVA 3N87A 2WHXA 2YIJA 1EDBA 1PVVA 1V6CA 4K0KH 3JYHA 4BQEA 5LZ8A 5FBKA 1KO5A 2A4KA 2YASA 1QHEA 2B8EA 3ANYB 3PL5A 2YNMC 4QBFA 2XQJA 4Y6PA 5HK8A 1QE5A 3WB1A 3I2FA 1XJ0A 4XWGA 4EYSA 1PZFA 1FUKA 4H3KB 3PGMA 3F98A 3D0RA 3LCVB 4F8YA 5BYAA 1WXQA 4XVQA 3GLTA 3TDNA 3FRJA 3LBFA 2DB3A 2QR2A 5IYZB 1JT9A 3R44A 2VHQA 4WCVA 4TKZA 4WQMA 2GA8A 4XUDA 2V0GA 4UCRA 1JR3A 1O6CA 1ETUA 2A1TR 3EW9A 1AXGA 2GN0A 4LDPA 4MNTA 5LB4A 3SSNA 3EPHA 2WSYB 3O2SB 4LZWA 4RGBA 2HFKA 2HZ7A 4RA6B 3IJ5A 3OZUA 4S2UA 4LXXA 5IJ0A 3PHCA 5TY0A 1XMPA 2W6CX 3V6LA 1QIMA 2GZ2A 4FSHA 2HW8A 1X7GA 4BJ3A 1E79D 3GT0A 3RVDA 2EFDB 3TTTA 3WIVA 1U2RA 5EHXA 4PQEA 3MWGA 3NQ41 4Q3NA 1P73A 2YJ3A 1TZJA 1IQ0A 4JJ6A 1WDLA 1NF3A 4MKIA 1UMBA 2P9YA 2P9CA 5LP6B 2QTVB 1JFFA 3NBXX 3R0ZA 5CFRA 3CF4A 3TD2A 1XQ1A 4B3TB 2XXAA 5EAIA 4AP9A 4QXAA 4BNJA 1S1MA 3LPLA 5EL0A 4DPKA 1OLUB 2R9VA 2PZ8A 3SZRA 3KHUA 2JLQA 4UTZA 1KBQA 1ORTA 3NASA 4LGMA 3HO6A 5KDDA 3KYBA 1QX4A 3LUFA 3MUOA 2QL7A 2XQKA 4C07A 1T4DA 3SC4A 4LSGA 4I5FA 3ZX5A 1OKKA 2DE0X 1E2LA 5SYAA 4FB4A 1G20E 1UAYA 1Z5OA 2EJ2A 2SKCA 3VR3D 1HEUA 1NAIA 3I6MA 1Q0TA 2H7XA 2VT2A 4PRYA 4RNOA 4Z9FA 1LD3A 1AD2A 1ABEA 1BOOA 4DGQA 2WZBA 1VB3A 5JAOA 5JHHB 1AA9A 3PLRA 6AT1A 4IGAA 4ZVTA 3LDAA 4L9AA 5EZQA 4BZXA 2DC1A 1Y1RA 1RSZA 1JQBA 1SIBE 1X1AA 3IH5A 2YN0A 1O5IA 1GCGA 1NJ1A 1XL1A 4XFJA 2Q0SA 2HM7A 4ZV9A 1P45A 4LJSA 2UUBH 4EF6A 1MAHA 4TQGA 3FI9A 1Z16A 4NBKA 4OX9B 3LJKA 2BYTA 5FEMA 1G60A 4PW0A 1P0MA 2XE8A 1O2DA 5F2KA 5HS4A 5ICEA 1SVLA 2O8BB 4LQLA 2Y8EA 3DVLA 4KHPB 3BDAA 5K0ZA 3RFCA 4CNQA 5C1DA 1RJRA 2OV3A 2WU1A 5JSKA 3N3BC 1HI9A 5CG1A 1TIKA 3AFNA 4CM6A 3ZK8A 3E35A 2KW5A 3DTGA 1T1GA 1FU4A 4JASB 3SG0A 5IRCD 2O8FA 2C7BA 2RGGA 4DQ0A 1ORWA 4MGIR 3QXSA 2R82A 5D3KA 2BFFA 2W2QA 3PNQA 1N36B 1WVMA 4EBBA 4V3CA 1VJDA 2CYAA 3D7NA 3FDZA 2FPKA 2ZPAA 2X2PA 1QH0A 2PG3A 3BE4A 3C4QA 3T9EA 2UVVA 1PT5A 2ODBA 3E03A 4Y8VB 1H2XA 1RYHA 2RONA 3RH0A 3U3KA 2O6HA 1ICIA 1W30A 2RJNA 2V1XA 2YYYA 3RTAA 3T3EA 4CVNA 1F48A 4DMCA 1G0OA 2M6KA 1SHJA 4MQFA 4YHHB 2FDCA 4BNDB 1CJTC 2ENWA 2XA1A 4BPRA 3A1WA 2J3DA 2ZRJA 3M3HA 2J9GA 3LLVA 3VO2A 1XP5A 2PMDA 5FNVB 3C3CA 4IGIA 1OWNA 1GRCA 1VS0A 1P80A 2FLWA 3QUSA 4PONA 4TUYB 4UKDA 2HLDA 4PG4A 3UG7A 4DA0A 5IEJA 1R9GA 3QKRA 2CMFA 2HK7A 3G2IA 4KMRA 1R6AA 4WZAB 4C89A 4XPIB 3EF3A 4P82A 4Y1GA 5DHAA 3UMYA 3R4CA 4ZZIA 3IPAA 1NQTA 2P0YA 1PI3A 4RDIA 1YQEA 2O7SA 4M1YA 4L4RA 3PHJA 4ARIA 3IV7A 2QRUA 3Q3EA 4N5IX 4BEBA 2O2HA 1C9JA 3QRWA 1Y4DE 2JGDA 1DJPA 3KSUA 4I1VA 2ECKA 5C7OO 1RC8A 4QM7A 2A0YA 3QQ5A 3AY0A 4FOOA 3U31A 4BYGA 3CMMA 2B3TA 3SX0A 3BTUA 1PJLA 4KOEC 2PQMA 3FTNA 3L8YA 3JCZA 2A5JA 1ULTA 3AHIA 3GRFA 3DEKA 3HPRA 2PXCA 3QWIA 3E2PA 4KTTE 1H5QA 2JAOA 2GTHA 1TNDA 5I7WA 3DQZA 1VL6A 3ZLUA 1JWLA 3AF4A 1UINA 4ED9A 1PZEA 1YI0A 1KZGB 1NJ8A 4QWAA 3Q87B 4LTNA 4X7PA 1TUGA 4HDQB 1XJ5A 5D2CA 1ODLA 3EQ2A 4JC4A 2SNIE 1ZD5A 1I6WA 4R01A 2O4CA 5DV9A 4CXMA 1IBCA 1M6VA 2GJ8A 3R09A 1QOPB 4DL2A 1BX3A 2CFSA 1HT2E 2VKTA 3HRIA 4QPNA 3QU4A 4LWQA 5E95A 3U4HA 4AJPA 2PNJA 3UFBA 1US8B 4B8YA 3PNKA 2AMYA 1P1BA 1K86A 1TJYA 4IXMA 1SIWA 4KEAA 1HTTA 4C22A 3EWIA 5D3MA 1WR2A 4IM7A 4TMYA 1ZESA 1S68A 1F9AA 4EL0A 4OPMA 5LC1A 5L3QB 4AZVA 2JLUA 3GIQA 1V16B 1U8XX 4UCSA 2E55A 2HXGA 2VSOA 2YMQA 3AUFA 4O33A 1JWBB 4U6NA 5CRIA 3W5VA 3ZHCA 1VYHA 3KQKA 1IONA 1CJSA 3AI7A 3KTMA 4E09A 5C5IA 5KT4A 2DBYA 3PICA 3PDWA 4GZMA 2V6MA 2PKQP 3O3NB 2XSZA 1M2FA 3FCSB 1BH6A 4NG4A 1HLPA 3CV3A 1O0SA 1P4AA 5AI6A 4DBLE 1DQRA 1DEKA 2D1FA 1LC3A 2HJGA 4Q7MB 3CO5A 3K72B 4Z86A 3TMKA 1VI2A 3B9QA 4CT0A 5JMWA 2YWEA 1GP2A 5AK5A 3A4NA 5DBIA 2FZ4A 4UM8B 5H0IA 1BHJA 5DX8A 2GCIA 5DULA 1UC8A 1CP2A 3OG9A 4BN5A 5CAEA 2YCLA 4O4IB 3T4UA 1QTQA 2VDRB 1NNUA 3PFWO 4R7RA 1Z5UA 2AT1A 3QXJA 5BOVA 4N0MA 1D1PA 3RKUA 3W2EA 1AA6A 2V58A 1DNPA 2C78A 4NHOA 1NLFA 4IWYA 1Y7LA 3UPTA 4KXMA 1M7BA 4ND6A 3H1GA 4E08A 4F9FA 1OH7A 1QP7A 1OAOA 2TMDA 2H7VA 5ENVA 2YHBA 4WXPA 4RZQA 1TZBA 4TXLA 4BECA 1ORRA 5CH5A 3COPA 4ASUD 4UHBA 3VMFA 2HFJA 4TQRA 3B3QA 2AZMA 4JI1H 1WCIA 3F7MA 3Q40A 4KXUA 4NQRA 3I58A 5KT6A 2WI8A 1M5TA 1NBIA 2YFKA 2X0SA 2QYOA 1NE7A 4FE2A 2PIDA 1DEAA 3W9SA 1SEPA 1R0YA 2PJDA 3QPWA 4K3UA 4YDSA 2BE9A 4A3SA 1XLTA 1UNNC 2DYKA 2ODEA 1KJIA 2C9BA 4LGVA 1Y1SA 5AM4A 5T8KC 1GUDA 1D4FA 1S1CA 1ZEMA 1HZJA 4Q1BA 2GKSA 4YRCA 3L46A 3L84A 4TV9A 4Q8FA 3FOBA 4LZLA 1L4LA 3GDFA 4PX3A 3NH6A 4M9XA 2W9BA 5JDIA 3WGJA 1MPTA 2YVAA 4L6CA 2WNHA 2PY6A 2XB6A 4JYZA 3K8ZA 4ZI3A 3UUEA 5C3MA 4RTJA 2IEDA 1UKCA 2DPJA 3IQGX 4XYLB 3QW2A 1NXPA 2DR3A 4EM6A 1Y9JA 3F5MA 3V97A 4LDAA 4Q4DA 2A86A 2HRBA 2WU3A 3A10A 3DL0A 3ADBA 2G88A 4W99A 1C7JA 1X7XA 2OC9A 5EJFA 4ED3A 2BM1A 1E2KA 5JDCA 3ZNQA 1LX7A 1AGXA 4M46A 3QKUA 4ZHQF 3INRA 3PUXA 5CA0A 2O19A 1QO7A 1LB1B 3HM2A 1G8YA 3A06A 5LVAA 1GRRA 1CBUA 4X62B 1FFDA 2FRDC 4K2HA 1GG2A 4XD2A 3FKIG 4YAJB 1ZVVA 3LY5A 5JS2A 1XEXB 2ECQA 1A5ZA 3VR5H 4KN5A 1I6UA 2H7YA 5JCXA 1WXDA 3ZDQA 3D3WA 5JBIA 1ZD3A 2VDPB 4DLRA 5GINE 4H77A 2R7MA 1XQWA 4QG3A 3OEWA 4KOAA 4ZK2A 1BXGA 3QI2A 1ZKMA 1OI2A 3LWDA 4I55F 1HNZH 3K30A 4LK2A 4TKMA 1R64A 2ZBPA 2P79A 4LZNA 5KQMA 2VL7A 3NHPA 5FTKA 3IRVA 1TEXA 1UBTS 2DPMA 4QD3A 2A4MA 4R68A 1EB8A 4EO9A 4BUZA 4TRMA 2PL9A 2DAAA 3UV7A 3ZEAA 3T5MA 4R31A 4RJ2A 5C31A 4RTLA 4I4LA 2Z8YA 3MGAA 4MWBA 3RVPA 3MFYA 2VQ3A 1ZDMA 1K2VN 2W83A 2HVRA 3AR2A 3HUFA 3KTFA 4GPBA 1GYRA 3N5KA 4ISCA 4BVLA 3EHEA 4U00A 3NHRA 1F20A 2DETA 4DLNA 4ECVA 3NJ8A 1CT9A 2WU0A 5BQFA 4BEWA 2XRYA 1JR2A 4NU5A 1T4CA 4RD4A 2OGTA 1M0SA 5EPUA 4B6OA 4C04A 1P0PA 2FW8A 3EEYA 4E46A 2FU5C 2VJCA 1ZAKA 5KFLA 4H1WA 3LCUA 3AI2A 4O08A 5HQJA 1OIVA 1PP4A 3PZRA 4WZAE 1FX0A 2QVGA 5ILOA 3TGLA 5CX1A 2GETA 5DNDA 3F8WA 5EPEA 1EJ2A 4KXWA 2P5SA 3DOIA 3WWHA 2CD7A 2ZJOA 4EMTA 3QF4A 3KHKA 3SM9A 1Y8QA 4P98A 3BXZA 2ATVA 4N40A 5F3WB 2H31A 4DV5H 4QDJA 4B3RB 2VUMG 4YBRA 3LXRA 5AHKA 2VJMB 3HB9A 3N2ZB 4IIUA 3I6QA 2OGZA 4R16A 5DPMA 1PG5A 2WFLB 4ZCPA 3HCPA 2WWGA 2ZPUA 3O0TA 4F85A 1G3MA 2RI1A 3UAVA 3SYLA 1LEHA 4RNNA 1T2FA 5F5NA 1QS0B 3B3GA 4D8VA 1ZD8A 2A5YB 2CXSA 2UVPA 3H8WA 2ZG6A 4LK3A 2VK1A 3LVRE 2DTEA 3FPAA 1W1UA 4CJXA 4C76A 2R6ZA 3VI4B 1C80A 2UYGA 1E1RD 5DLDA 3WGZA 2D5LA 4DNOA 3TLAA 4L57A 3OX1A 1O03A 3KQPA 5AJVB 1K8ZB 1RRMA 1UMDB 1U3TA 1WZEA 1NIJA 1YONA 3VJRA 2NTJA 1O58A 1PV2A 1URPA 2QUHA 3FOWA 3LYHA 3R77A 4KLCA 4U3JA 5ALHA 3T0GA 2BEVB 1D09A 2NQ2C 3PGXA 1LRJA 2D7CA 3C8MA 4JUCA 4DLPA 2P9HA 3BXOA 4RAQA 3IIIA 1FDSA 5GIPE 2IOYA 2VTEA 2NOAA 3L4BA 3KOMA 4NCJA 3ZE2B 2ZSIA 4II2A 1Q7TA 2ZOSA 1AMUA 2IYEA 5JWRA 4L4UA 1C81A 3DT8A 3DXYA 4E88A 4FSDA 1Y1KE 1ECBA 5LL6b 2DWOA 1MVLA 2W6QA 1QTNA 2FJ0A 3OCXA 3OQ1A 4MRRA 3T9AA 1QYIA 3ISJA 1KO8A 5BN3B 3WMXA 1N32B 1GPAA 1D0IA 4J6FA 5JE8A 1JHDA 1IVSA 4B3TH 5C1BA 4JC8A 4OQZA 4PZLA 2AB0A 4GGOA 3TZHA 1FFWA 3TG2A 1B23P 4EJFA 2EATA 4B7CA 1DELA 5L3RA 3P2JA 4IJ6A 2A6PA 5DGAA 1JJAA 4TROA 1AH2A 5HHTA 3L7YA 3TLMA 1S7CA 4FGUA 5GWXA 1B93A 2QPAA 5CEEA 1ONBA 3DMYA 4JP3A 3CRRA 4R0VA 1W29A 2H2GA 3IT2A 5JNWA 4UPEA 5BNZA 2D1RA 3MYYA 2JCXA 3KPVA 3PT9A 4WK6A 4YDHB 3VVLA 4DL9A 2IGTA 3DDWA 3NRCA 2IY9A 1RZ3A 1UP4A 1XYYA 1H3FA 3TXXA 1VLJA 2H4ZA 2NU9A 3L8CA 3OZSA 1UDXA 2B63A 2KSWA 1CKMA 3RV4A 1VPLA 2HBRA 2O0HA 1TM3E 3PTLA 3H0GG 3LT4A 4TLAA 4YROA