2XD0A

A processed non-coding rna regulates a bacterial antiviral system
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAPLTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLLDLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNFSLLEEKYRDFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXN
publication title A processed noncoding RNA regulates an altruistic bacterial antiviral system.
pubmed doi rcsb
source organism Pectobacterium atrosepticum
molecule tags Toxin/rna
total genus 47
structure length 162
sequence length 162
chains with identical sequence B, E, X, Y, Z
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xd0A00
4ATOA 2XD0A 4GLKA 2XDBA 2XDDA 4RMOA
chains in the Genus database with same CATH superfamily
2GFUA 3QHSA 2Z0WA 4X1VA 2LNHB 1YIJA 4HKEA 1JU5C 2Y4YA 4M77D 1IHWA 2I2LA 1M3BA 1MHNA 5I11A 1NPPA 4EMKA 2YLCA 3E9GA 1WHJA 4RTTA 2MOXA 1NLPC 2FL7A 3P8BB 3NHNA 5GAMf 2JZ2A 1SKUB 1KQ1A 3L2VA 1Q81C 2QI2A 1SRMA 4J9IA 1MUZA 2DK3A 3MEAA 2KXDA 3VS6A 1QLYA 4X34A 1E6HA 2BZXA 1ZSZB 1WHLA 4AFQC 1I0CA 2IPOB 2CSQA 2JN0A 4RKUE 2L2PA 1X2KA 4EPCA 3JCMP 3RKWA 1M90R 2LRQA 3VS4A 3SDZA 2Y4XA 3WXMB 4FIBA 2RHYA 2RF0A 4C0ZA 4C0DC 1K9MC 3A8GB 1OU8A 1NEGA 1WJSA 3M0PA 3V7RA 3VS7A 2VGNA 3JCMW 5FROA 3OS0A 4E7SA 4RTUA 4OB0B 4RG2A 2JJ9A 2HMAA 1ZLMA 5IN1A 1TWBA 5HCKA 4CRIA 3HRUA 3QG1A 4OMNA 2MWPA 4DEYA 3OW2P 4JRPA 2YHTA 2ZPFB 1OX8A 3R6OA 1U3OA 2V26A 4QQDA 1WQWA 2YSQA 2PTKA 3CCSQ 2O2OA 2MAMA 1N27A 1QWFA 3MPUB 3NPFA 4IUPA 1OYXA 1NYGA 3JAME 2Y90A 1TH7A 2F5KA 1ZBXA 2AIRB 5LJ3g 2HL5C 1YJWA 1QCFA 1J3TA 2H8HA 3MEUA 1OULA 3CCST 1I1JA 4HA8A 2HD0A 5GANf 5FLXE 3O5ZA 3OB9A 2ESWA 2RI3A 2RHIA 1OPLA 3OYHA 1YI2Q 1WNLA 3T9NA 3M57A 4XK8E 2QA4A 1BBZA 1JO8A 4PNOA 2YT6A 1YIJQ 2JXBA 4ZGEB 3INZA 4KGZB 1AOJA 2K57A 3SFMA 1RACB 3EAEA 4JPBW 2DIGA 3OYMA 4C5IA 4LDYA 5C6SA 3LW5E 4F14A 4KGVB 3JCMf 3JCMc 2QQ9A 3PFSA 4F7UE 2DYBA 3EH2A 1YI2T 5FU6B 2XK0A 2P4TA 2BZ8A 2LQ8A 2KROA 4C92D 5GAOm 1YIJT 2KRSA 3REBB 3CCVQ 3EHRA 1Y96A 2RHUA 2FRWA 5CK9A 3CQTA 1QP2A 2ZCFB 3CC7A 2O31A 2NYSA 3JCMb 2DL5A 1OZ2A 4DEXA 3V7CA 2RJCA 1A0NB 3S3NA 3A1PA 3FEOA 3X28B 3CCMA 4HT9A 3VYGA 5CKHA 3HTRA 2YUPA 2HBWA 2EVRA 1D3BA 3SWNB 1WDXA 3N5BB 4JJNK 5KYWA 3QYHB 1O9SA 2D8JA 3LGLA 1WHHA 4PJOE 3CMAA 2FPDA 3TCJA 4NS5A 2RPNA 4XTVA 2VKNA 1RLPC 4M75G 3OYEA 1DJ7B 4RCBA 1K8AU 5GAN7 1B7TA 1JBMA 2X3XD 2EKOA 3KUFA 1MGQA 1GCQA 2GQIA 1YCSB 3CCJA 3OYKA 2EQKA 3A98A 2K3XA 3PE0A 2RJFA 4OGCA 3CMEA 1PSEA 4FW1A 4N0AA 2DTOA 2PVOB 3OMGA 4ELYC 4KULA 1O75A 2I0NA 3JCMJ 1Y7XA 2KQWA 3RUXA 3MP1A 3V8JA 2DERA 4FYWB 1QQJA 4BE0A 2DIQA 3UT1A 1WFWA 5I2SA 1K4US 1AT1B 3LYIA 2A28A 5GAOq 2YUNA 4E47A 3FJPA 3V8LA 4M7AE 1D1AA 1GCPA 1ZUYA 2VVKA 1NJIR 4E6RA 2B8AA 2RHZA 1YITQ 4Y92A 2VGMA 1YJWT 2L3SA 1AEYA 1Y57A 2DF6A 2ZZDA 2OTJA 2E6ZA 1C1AA 3MEVA 4XTZA 4C5GA 1BI3A 2W10A 2DE0X 1Q82R 5GAN2 4OP0A 3QSUA 3EGDA 4J6WA 1NPRA 1XOVA 3VS0A 1I5OB 4CC4B 4AG2C 1CSKA 4RMOA 2XD0A 2DRKA 3VS1A 3UDCA 6AT1B 4HCCA 2FG0A 4HVWA 2RM4A 5KYYA 2DL4A 1QVGP 4M7DB 1G5VA 4E7IA 2HBPA 3OS1A 3VKIA 1RAEB 4QVCA 4M78A 5LJ5e 4C0GA 1KQ2A 4D6WA 1QVGA 2K2MA 2WSFE 4DA4A 4C8QE 1EFNA 2HAXA 3L2QA 3M55A 3VS3A 2FHDA 3G4SQ 4IKFA 3CC2Q 4BB7A 1NE8A 1XNIA 8ATCB 1K73C 1PKSA 1SHGA 1D0ZA 1OV3A 1I07A 2X51A 3VS2A 4JRIA 4CC2A 3CC7T 4BI8B 1OI1A 2K3YA 4LD6A 4M77B 3E1SA 3CCMT 2CP6A 1K8AR 2VXFA 2KMTA 1ABOA 5KYXA 4C92A 1BB9A 4PFOA 5GAN6 4J5YA 4N4HA 2CSIA 3G4ST 1WJQA 2EKHA 4IUUA 3UATA 1X27A 1G3YA 1M30A 4F7UF 2QK0A 3OSSC 4XQ3A 3CCJQ 4M75D 2KT1A 3LGFA 2EPDA 2CGHA 2H3EB 1R0CB 1I4K1 2PVDB 2K5FA 3H6ZA 5CAIA 2AZVA 2O9VA 2ECZA 5DLOA 2K5IA 5GAMe 1K0SA 3PVQA 4MDXA 1UE9A 4YTLA 1GL5A 2JVVA 1ZBJA 2CP5A 1E6GA 3CCJT 3QJ6A 1ZSZA 3AHUA 1JXMA 5D6XA 1U1TA 1UFFA 3E9FA 3BY7A 4J9FA 1GCQC 4F16A 3QYGB 5ECAA 4RTZA 4LXCA 3VV0A 1RAHB 3SB2A 2PVGB 3U23A 4PJJA 2IIMA 4PK4A 4N0AC 2P0KA 1SPKA 4J9EA 4A4FA 2OTJQ 1UECA 4AT1B 4Q5WA 5CR2A 2DMOA 3FJ5A 4XAXB 1BU1A 3J7AF 2LCCA 4ORZA 4F7UG 2QQSA 3CCUA 3EGXB 3X25B 2DBMA 3H9NA 3TQ7P 4V2SA 1W6XA 1EX4A 1OX9A 2JNGA 4B6MA 1W2BP 1FYNA 1YJ9Q 4J7FA 4PFPA 5LJ3f 3J81E 4E7LA 3JB9D 1ZA1B 2OTJT 1K0XA 4C0FA 4M78F 3ZL7C 1Y71A 3C4SA 2DO3A 1W2BA 1NEBA 2JM9A 5KYUB 4C5EA 1AZEA 3LWIA 4J6XA 1VQ7Q 2OI3A 2K3BA 4PJMA 2EWNA 4HT8A 5J26A 3QPHA 2XICA 3VJPA 5CQYA 3M59A 1YJ9T 1UB4A 4PJOG 2X9HA 3OQ5A 2DETA 3GPLA 1H3ZA 2CDTA 4M7AF 1IZ6A 3CCSA 1QVGS 3I5SA 1HSQA 2DJZA 2L3RA 2RB6A 3EHQA 5EC7A 2FPEA 4KH0B 4IUTA 1Q7YC 4OB2B 1YHQQ 4MZPA 1QVFP 3MP6A 1VQ8Q 4M7DD 3D7SB 5GANe 2DM1A 1UGVA 4M78C 2P84A 3G6EQ 1KQSP 2RQUA 1WHGA 1IO6A 2KAFA 4HVUA 4N4IA 4LDUA 1QVFA 4EMHA 1RAGB 4VUBA 2KGTA 2F5TX 4XU2A 3GIBA 1LJOA 1PNJA 1YHQT 1KQSA 3CCLQ 3UWNA 3KXTA 1VQ8T 1YNZA 2DXUA 3C12A 1G3WA 4KUIA 4M7AC 1U8RA 1PM3A 3JV3A 5EG2A 3LWHA 1X2QA 2BKDN 3JCMe 2LDMA 1ZUUA 4C8QF 1M27C 1WGSA 5IXFA 2VV5A 2KYMA 1W4SA 1M2VB 4M7AG 3FC3A 1M1KC 1N8RR 3F70A 2YWWA 1AHJB 3THKA 1U5SA 2FZGB 5I21A 2HKNA 3RR6A 5CKFA 2CP2A 1VQKQ 3PT9A 4KUDK 2LQKA 3A5ZB 2D1XA 4FSSA 3CCVA 2A08A 4D8DA 3SWNA 2ZPGB 2MWOA 4OMQA 4R55A 3QZ9B 2DBKA 2CS7A 4Z88A 4GLKA 2LP5A 2M0OA 5CIUA 2CUBA 3HRSA 1KSWA 3L2WA 1PKTA 4PLLA 4XTXA 3A8MB 4E2FB 1WXTA 5LL6S 3CCUQ 1VQKT 4NL2A 1VQ6Q 4C8QC 1RI0A 4ME7A 4E7KA 3HSBA 2DL3A 1M90C 5DY9A 3VS5A 3JSCA 1V29B 2FO0A 4C8QG 3CCUT 1JEGA 1VQ6T 2JM8A 5GMKe 2L3PA 1W2BS 2ROTA 2E1HA 4DBRA 4ZGDB 1WXUA 1T3SA 2LNVA 4N4GA 2OAUA 4BD3A 1D1BA 1U1SA 4HCKA 2DPPB 4P5NA 2CH4A 2WSEE 3CXCP 1WYXA 3M0SA 4JDSA 4AMCA 1UHCA 1YJNQ 1M1FA 2M02A 2A36A 2JTMA 3RMQA 2KVQG 2KBTA 4ESRA 4PJOD 3CXCA 2C0OA 4A54A 1V76A 4DBQA 1MMAA 4K11A 5KE3A 3TREA 1HK9A 1XTDA 5I2MA 2ZPIB 2NWMA 2FRYA 3X20B 3VU3C 1YJNT 3ZBDA 1RAAB 3I56Q 2L3QA 3JCMX 1QVFS 3V7SA 2LT4A 2DA9A 2MK5A 1TS9A 2AZSA 4JRKA 2ZPEB 1I81A 2K9GA 4O6JA 2FPFA 2HL3A 1YITA 3VRYA 5KCOA 2RA2A 1X6OA 1NJIU 1KQSS 2ROLA 4BI3A 1JJ2A 4FYVB 3CC4Q 1IREB 2FB7A 2RQTA 1UUEA 1PC0A 2WACA 3HFOA 3I55Q 3EFSA 2E5KA 2AT1B 4DOWA 1X69A 4M7DA 2YUQA 2MMPA 5CCAA 1Q82U 4BACA 1RLQC 5CKEA 1Y0MA 4MZTA 4FYXB 3ZEHA 1PRMC 1BYMA 3JRZA 1KIKA 1JQQA 2CP7A 4GY5A 4BE1A 3C0CA 3VUZA 1Q86U 3I55T 2QEXA 4F17A 2SRCA 4DBHA 1M9SA 2JS2A 2EJGA 3PMTA 4FSXA 3OYBA 4RTWA 2LX9A 5IHNA 4EMKC 1M3CA 2V1QA 1QP3A 4M75B 3DB3A 3G4SA 4JUVA 3CC2A 1PWTA 4M77A 3HP9A 1F1BB 1N6AA 1WLPB 4OMMA 3CCVT 1UGSB 1WPYA 3UPUA 4XU1A 4CI0C 2EW3A 2VC8A 1IRXA 3GNGA 2QYZA 3M53A 3EG3A 2X4XA 2SEMA 2M0YA 4NOYA 3WVDB 3VUBA 4J9DA 2CYZB 2DVJA 2XHCA 4J9HA 3QIIA 1VYTA 1YN8A 2RQVA 2EQUA 3V8KA 1AZGB 4LN2A 1VQ4A 2E12A 3GLXA 2KXCA 4E7ZA 1SEMA 5D6WA 4X9CA 2IG0A 4GLMA 3RKXA 3HKSA 3H0HA 8AT1B 1QWEA 1KD1R 5A2QE 1FX7A 1X75C 5KYNA 4M78E 4L6V5 2FZKB 5FRMA 4LDWA 2KSSA 4LNPA 5IXBA 1IGUA 3G7ZA 3UF4A 2HDAA 3BW1A 3CXCS 4XTUA 3GBQA 1TUCA 5FU7C 2HCKA 2YLBA 4LUEA 2VB6A 1ZHIA 4R56A 2KRNA 2CZ6B 1NG2A 1G3TA 3EFOB 1RAFB 1YFNA 3EGXA 4FT4A 2GTOA 3LH0A 1MV0B 3DB4A 2COYA 2RK2A 1X6BA 4C92E 3I9QA 5D6YA 3ASKA 1S72Q 2DTIA 5HKCA 5LJ3e 1U06A 2QGFB 3LLRA 1JRIA 1KK7A 1SG5A 1CKAA 7AT1B 2NUZA 5LJ5j 1R0BG 1JJ2S 3OA6A 5GAN4 1NJIC 4EDUA 5KYUA 1YJ9A 2DL8A 2J05A 2KY9A 3EG9B 3FRNA 1UHFA 1Z9ZA 1YITT 1Q86R 2FVUA 3JB9J 1XQHA 2LZ6B 3HRTA 2KR3A 1S72T 1WHKA 2C06A 1Q82C 2V1RA 4UC4A 2KE9A 2QEXQ 2RI2A 3NTKA 2BUDA 2VXEA 2R57A 2FYKA 2ZPHB 2DNUA 1VQ7A 1GBRA 3EG0A 2PU9B 1ABQA 4M77F 2AKKA 2KRMA 2DVEA 2LT1A 2JW4A 2DZ9A 1N5ZA 5GAOl 1BIBA 2E65A 3HFNA 4A4HA 5GAN3 3QDRB 2CT3A 1VQ9Q 3BE3A 2QEXT 3PGGA 3E2UA 2HEQA 1VQNQ 2L8DA 4CC7A 2EQIA 3AT1B 2G6FX 2RI5A 3RIRA 3X26B 1YHQA 1M8MA 2CUDA 2RH2A 2YRVA 1VQ8A 2CP0A 4HVVA 4E7HA 3CEYA 2KEAA 1BIAA 3M0TA 2QDLA 4IUVA 3RDVA 3G6EA 2DFUA 5GAMj 3CC2T 3A8OB 4IIMA 2BIVA 1VQ9T 3OBYA 2K6DA 1VQNT 4J83A 1VQ4Q 4A63B 2HQXA 4M77C 1K8AC 3CCLA 1VIEA 2E5QA 5L8RE 4GBQA 4AFZC 4IIOA 2ENMA 5CKBA 2ZPBB 1M2VA 2DKGA 4J9CA 4BDZA 2K2VA 2MYSA 2KT8A 5GJWB 1UGQB 4M77G 2J7IA 4RTYA 2MIOA 1QCOA 2EYZA 1WIEA 5C0MA 1N9RA 1VQ4T 1RUWA 3QDFA 3NTHA 2KDSA 1ACMB 2XU8A 2XDDA 5GAMd 1YWOA 2MPXC 2P0QA 2LJ3A 3L42A 2K5LA 3ME9A 4J9GA 1N8RU 3H0FA 2CZ1B 1VQKA 1QMCA 1SSFA 2X4WA 2CZ7B 4F7UB 2RO0A 3QJYA 3M0QA 3WVEB 1Q81U 1WA7A 2CKKA 4J6YA 1VQ5Q 1VQLQ 2J6FA 2HNIA 3OSVA 3TSWA 3UA7A 2L89A 4BY6B 4PJLA 2QTXA 4ANJA 2R5AA 3LH5A 3H41A 2CREA 1R8OB 3I35A 3P8HA 1VQ6A 2DTHA 1RADB 3M5AA 1Y07A 1YBYA 2AHJB 2EYYA 1VQ5T 2L0AA 1W70A 3H0IA 4AFSC 2BE9B 1UG1A 3BDLA 4QVDA 5HK3A 4KH1B 2D8HA 4PJOB 2XDBA 2JTFA 4MDWA 1VA7A 2LJ0A 3META 1AWXA 1LNXA 3QO3A 1T0HA 2B86A 1QKXA 4J8OA 1KC8R 3CD6Q 1M1GA 4PJNA 4L5GA 3JB9H 2MCNA 5GANj 5GAOr 5HK0A 1GFDA 3M4YA 4FYYB 1GXIE 2XI9A 1X6GA 1OOTA 1SSHA 2R5MA 1YJNA 4A4KA 1RAIB 2ZAEA 2DILA 3TEEA 3FIFA 2KK4A 2E64A 4MMKA 3PNWC 1VQ7T 3CD6T 4C92F 3A8HB 2A0FB 3EGUA 2KI7A 2J06A 1TSFA 3DLMA 1B07A 3FLGA 4B9XA 5L23A 2XKOC 2XG8D 4JJDA 3X24B 2NUPB 1QW1A 4WCIA 3P8DA 1T0JA 3OYGA 2MI6A 4FT2A 4JRQA 1LPLA 1OEBA 1UDLA 2AK5A 4JZ3A 1YCYA 3CCEQ 4HCZA 2QQBA 2EJ9A 4PFZA 1I8FA 2DLPA 2E41A 5LJ5h 1MMGA 3I56A 1AWWA 1HXDA 1S1NA 3CCRQ 2NLUA 1NBEB 2O9SA 4ATOA 5A0LA 1VQPQ 4M78G 3QZ5B 1ZQ1A 1PRLC 1X43A 4M7AB 3JB9I 3ZFJA 2DXBA 3G6ET 2PNIA 5IHIA 3CC4A 2RQWA 1D1CA 3I55A 5CQXA 4RTVA 1UJ0A 4C92C 3CCET 3OMCA 3QWXX 1Q95G 1VYVA 4BDYA 5DLQE 1VQOQ 1SRLA 3CCLT 3MEWA 1MNDA 3JCMd 1P92A 1VQPT 3M9QA 3LX7A 2DEUA 2L5QA 2EQJA 3M58A 3TSZA 3GP8A 2YXYA 4E7JA 1D0XA 1TTHB 1G3SA 2XMFA 4D8KA 1Q81R 4C92G 1FMWA 1PCXA 2E3HA 3KBGA 2DAQA 4M75A 4OB1B 2A7YA 1HD3A 2ZGWA 1N8RC 2CZ0B 1VQOT 1IHVA 3PMIA 3RNJA 3G1JA 1WX6A 2VYTA 1SHFA 2O01E 1WQ7A 2CT4A 9ATCB 1ZSZC 1UGRB 1PD0A 2QAZA 5GMKj 2X4JA 3SHWA 4C8QB 4C0DB 5GAMh 1QCNA 1AD5A 2WSCE 5GAN8 2EAYA 2RK1A 3OYCA 1K9MR 2D9TA 2F2WA 2COWA 2A3LA 2X35A 1AWOA 4L59A 3OYNA 2GF7A 2LCSA 2RJEA 2GTJA 3HHTB 2IVWA 2JOYA 2DJQA 2ATCB 1WJRA 4RUGA 2GBQA 2RMOA 1UGPB 3J80E 2K79A 1B34B 1W1FA 1VOMA 3QKJA 2LMJA 4M7DE 2YUOA 5IHKA 4LUDA 3EG2A 4XTYA 2HZYA 5AT1B 2NUTB 1I5LA 1H3HA 3OBWA 1QKWA 1YWPA 2EYXA 2OTLA 2CH4W 1JB0E 4IUQA 2PUOB 4NL3A 1EIFA 3QUIA 1AVZC 1KD1U 1H641 1N9SA 1FWZA 1K1ZA 3CBOA 2QQAA 3OW2A 5GMKi 2X3WD 3EFOA 4TVRA 2F69A 5J3BA 4M77E 5I22A 4ZTJA 4RG8A 1C6VX 4AG1C 4QQ6A 1BCOA 4Z02A 4O5VA 5FWBA 1JJ2P 1M3AA 4FW2A 1EZZB 4XU0A 3REAB 4J9BA 3MP8A 2H3JA 3A8LB 1S72A 1C0MA 3DLLA 2O4XB 3ULRB 1KFZA 3EG9A 5CKDA 1UJYA 2DL7A 3S3MA 4OF1A 2GGRA 4M78D 3I56T 3OYIA 4Z89A 2G3RA 5KH6A 5GANh 2J6KA 3GF5A 1PG5B 3M0UA 2LVMA 5LJ5g 4KGXB 2R58A 3RBBB 4JS5A 2RHXA 2DXTA 4M75F 2BE7D 2OAWA 1IB8A 3CC4T 3QBYA 2HKQB 2LC4A 4HCBA 2EJFA 4M7AD 3MJXA 3GNFB 3MKDA 5FU6C 2E70A 4FCYA 1G83A 4EMKB 4FU6A 4IURA 4PL6A 3JCMh 4DOVA 2EYQA 4FL6A 1K9AA 2EGAA 1VQ9A 5KE2A 5GAN5 1MV3A 5DM7R 2F1LA 2DZCA 2QG9B 1VQNA 2F2VA 1K73U 4PLIA 1TUGB 3OS5A 4JJBA 1HYOA 1OU9A 2DD5A 2BZYA 1H92A 2DYIA 3SD4A 1XJWB 1UEBA 3SWNC 4KBMB 2EGCA 4M75C 4BI4A 4JLGA 2E6NA 4R0KA 3JCMQ 1BKBA 3CPWP 3MCAB 3MO8A 3NMZC 3PIOA 1KHCA 2K4YA 4LDVA 2DD4A 1D0YA 4ELZC 4ZNXA 2M51A 4WTOB 5GMKm 4F04B 5GAMg 2LTOA 3CPWA 3RESA 2E4HA 4C8QD 3HPWA 2EYWA 3NFCA 5CO7A 4ZN3A 2OTLQ 1BI1A 4HXJA 3JB9F 3BDUA 2DXCA 1BI0A 1CKBA 4CC3A 3L2ZA 1TU0B 3EG1A 2JS0A 2F2XA 4JZ4A 2KNBB 3C94A 4OMOA 3HL8A 1NZ9A 1ZX6A 4F7UA 5LJ3j 3L2RA 2DEQA 2HSPA 1WHMA 5FU7B 2HQEA 1KD1C 4PKCC 1WZOA 3OW2S 2OTLT 1OQKA 3C95A 5GMKh 4XTWA 3H8ZA 1YJWQ 3UA6A 2VWFA 2LQWA 1VQ5A 1VQLA 1LOJA 2ED0A 4BE2A 3PIPA 2LX7A 4EIKA 3ER0A 1T3LA 1AWJA 1VUBA 4M7DF 3EH1A 3L1AA 2K7AA 3OYDA 4A4GA 2JUFA 1KHIA 4DBFA 2GFAA 3CCQA 2M1HA 4PJOA 5KCHA 2V8KA 2DRMA 5LJ3d 2QDYB 3FB9A 4A53A 2E3IA 2QA4Q 1FXXA 1V1CA 5FRNA 3GOXA 3VYHB 3JB9G 4MZMA 1TOVA 1QVPA 3QXEB 2VASA 2ED1A 5IH2A 3DKMA 2MF2A 2EIFA 5A0DA 2YRDA 3VRZA 1R77A 3CD6A 1KC8U 1TG0A 2EFIA 1Q86C 3R6NA 3S6WA 1GFCA 1LCKA 3Q1JA 2QA4T 1TXQA 2KYBA 4M7DC 2JT4A 2ABLA 3URGA 5LJ5d 4M4ZA 2OX7A 5GANg 1K73R 1IGQA 2FZCB 4XU3A 3G71A 4OB3B 1HJDA 2XDPA 2QTVA 3CC7Q 5GAOp 2NUPA 1PD1A 1ZSGA 3CCMQ 2GCXA 3CBPA 3OYFA 2EBPA 1Q7YU 1Y96B 4RTXA 3TU4K 4M7DG 1RABB 1PHTA 3OYLA 4J7IA 5J39A 3RMSA 3I5RA 1OPKA 4KT0E 1TUDA 4DQ2A 1GBQA 3E19A 1RI9A 1H8KA 1GRIA 4QVZA 3CMAQ 2JMCA 5HY6A 4M7AA 2AKLA 4WF2A 1VQMA 2GNCA 5AYFA 1D3BB 4AFUC 3CCEA 3NTIA 3MHXA 3JCMg 3KFVA 5KYWB 3CCRA 2D6FA 4BUGA 4JJCA 2FEIA 1VQPA 5IAYA 4QKUA 3IQLA 2XIDA 1MNEA 2A37A 5FW9A 3CPWS 2PQWA 3CMAT 1OZ3A 4Y28E 1D09B 5M9OA 2GQVA 2HQHA 1M5Q1 2RN8A 4QQGA 1KJWA 5GMKl 1VQOA 2QASA 3CMEQ 1FMKA 4OMLA 2QQRA 2LJ1A 3PVLA 3NGPA 2QGGA 5D7UA 1M1KU 1NLOC 2YDLA 2RQRA 1VYUA 3L2UA 4LD9K 2LCLA 1YP5A 1MMDA 5A0GA 1ZA2B 4B9WA 2LQNA 4C8QA 2J6OA 4ZN1A 2RD1A 1RL2A 5FWCA 4PJOF 3CMET 3M0RA 2COZA 2EGEA 2V8IA 2X4YA 4X9DA 2P4RA 5GAOn 2HSEB 3CCQQ 1FMVA 4C5HA 3TVTA 2EQMA 4OVAA 1X01A 3RERA 3M56A 1BK2A 2D0NA 3OS2A 4BY6C 1ARKA 1VQLT 3OYAA 1K9MU 1B34A 1G2BA 4A4EA 4JLIA 3M54A 2V8JA 1NM7A 4LDXA 1MMNA 1M90U 2DX1A 2C0TA 1M8VA 3OYJA 1BI2A 2JMAA 2NUTA 1BCMA 1K76A 3CBMA 3O8VA 4MMLA 3CCQT 2YRCA 4FM4B 4QT7A 2QXFA 4PJOC 1VIFA 3S3OA 2RNAA 4OMFB 1WI7A 2PUKB 1UTIA 4EMGA 3EGDB 3SEMA 2E10A 3OY9A 5LJ3h 4RCCA 1KC8C 3G71Q 2OJ2A 2P0PA 1M2OA 1Q7YR 4M75E 3FDRA 5KYYB 2PZ1A 3QWYA 1LVKA 2W0ZA 3BFMA 3EFRA 4QW2A 2JTEA 4M78B 5CVIA 4ZTFA 5LJ5f 1B3QA 1WXBA 1M4ZA 2D0QB 3G71T 1PSFA 1VQMQ 5GANd 2VUBA 5IT9E 4KRTA 2O4XA 1E7OA 4OMPA 4ZGJB 1IXDA 1G8XA 2M16A 3JCMV 2CP3A 1JXOA 3OYYA 2RJDA 4II1A 1Z9QA 4Y91A 5GJVB 3PTAA 4LE9A 3CPFA 3M4GA 2O88A 2BTTA 3RKYA 4JS4A 1KG1A 1NYFA 2M9UA 5KYXB 4C92B 1VQMT 4Z8AA 3CCRT 1ZUKA 1SF9A 1YI2A 2C0IA 4OGEA 1M1KR
chains in the Genus database with same CATH topology
2GFUA 2CZ6B 3QHSA 5CKDA 3CCJT 3QJ6A 3AHUA 1YIJA 4HKEA 5D6XA 1G3TA 1U1TA 2Y4YA 3S3MA 4FT4A 3E9FA 3LH0A 4OF1A 3DB4A 4M77D 4M78D 3I56T 3BY7A 3OYIA 2I2LA 2RK2A 1MHNA 2G3RA 4C92E 5KH6A 1NPPA 3QYGB 2YLCA 4EMKA 3E9GA 5GANh 5D6YA 3ASKA 3GF5A 2DTIA 5HKCA 5LJ3e 3VV0A 3LLRA 2FL7A 2LVMA 1JRIA 5LJ5g 2R58A 3SB2A 3P8BB 2PVGB 4JS5A 2RHXA 2DXTA 4M75F 5GAMf 5LJ5j 2JZ2A 1JJ2S 3OA6A 1KQ1A 4N0AC 2P0KA 5GAN4 3L2VA 3QBYA 2QI2A 2LC4A 3CC4T 1Q81C 4A4FA 4HCBA 4EDUA 3MEAA 2DK3A 1YJ9A 2EJFA 4Q5WA 4X34A 5CR2A 2KY9A 4M7AD 3FRNA 4XAXB 3J7AF 1YITT 2LCCA 4F7UG 2FVUA 2QQSA 3JB9J 3CCUA 1XQHA 3X25B 2JN0A 4RKUE 3HRTA 3GNFB 4V2SA 5FU6C 1S72T 2E70A 4EPCA 3JCMP 2JNGA 1Q82C 3RKWA 2C06A 4UC4A 2LRQA 2RI2A 3NTKA 4FU6A 2BUDA 4EMKB 4IURA 2VXEA 4J7FA 2R57A 2FYKA 2ZPHB 3SDZA 4PL6A 2Y4XA 5LJ3f 3JCMh 3WXMB 3J81E 4FIBA 4E7LA 1VQ7A 4DOVA 2EYQA 4FL6A 3JB9D 2RHYA 1VQ9A 5KE2A 5GAN5 2PU9B 5DM7R 2OTJT 2DZCA 4C0ZA 4M7DF 4M77F 4C0FA 4M78F 4C0DC 1K9MC 1Y71A 1VQNA 1K73U 3C4SA 2DO3A 4PLIA 1W2BA 3OS5A 3A8GB 2DVEA 2LT1A 4C5EA 2DD5A 1WJSA 3LWIA 4J6XA 2DZ9A 3V7RA 3SD4A 5GAOl 1BIBA 2E65A 2EWNA 1UEBA 2VGNA 3HFNA 3SWNC 3QDRB 4KBMB 5J26A 5FROA 5GAN3 3QPHA 2XICA 3OS0A 4M75C 3VJPA 5CQYA 2QEXT 3PGGA 4BI4A 3M59A 4JLGA 2E6NA 3JCMQ 1YJ9T 2L8DA 4OB0B 1UB4A 1BKBA 4PJOG 3OQ5A 3MCAB 4RG2A 2RI5A 3RIRA 3X26B 3MO8A 1YHQA 3PIOA 5IN1A 3GPLA 1H3ZA 2RH2A 1KHCA 1IZ6A 2YRVA 3HRUA 2K4YA 3QG1A 4CRIA 4LDVA 3CCSA 1QVGS 2DD4A 2MWPA 4E7HA 4JRPA 3CEYA 4ELZC 2YHTA 2DJZA 1BIAA 4IUVA 5GMKm 2ZPFB 2L3RA 2RB6A 3G6EA 5GAMg 2LTOA 3R6OA 3CPWA 1Q7YC 4IUTA 3RESA 4C8QD 4OB2B 5GAMj 3HPWA 3CC2T 3A8OB 2BIVA 1WQWA 4QQDA 4MZPA 3NFCA 3MP6A 1VQ9T 5CO7A 4M7DD 4ZN3A 1BI1A 5GANe 2MAMA 3JB9F 1N27A 3BDUA 2DXCA 3OBYA 1VQNT 4J83A 2HQXA 1BI0A 4M77C 4IUPA 4M78C 3L2ZA 1K8AC 4A4HA 3CCLA 1OYXA 3JAME 2KAFA 2Y90A 1VIEA 2E5QA 1TH7A 4N4IA 4LDUA 5L8RE 1QVFA 3C94A 2F5KA 4EMHA 4VUBA 1ZBXA 3HL8A 1NZ9A 5CKBA 4F7UA 2ZPBB 2F5TX 5LJ3g 4XU2A 1YJWA 2DKGA 4BDZA 3GIBA 2K2VA 5LJ3j 3L2RA 2DEQA 1LJOA 1YHQT 5FU7B 1KQSA 3UWNA 1UGQB 2HQEA 3KXTA 1KD1C 3MEUA 4PKCC 4M77G 1VQ8T 3CCST 3OW2S 2OTLT 2DXUA 3C12A 1G3WA 4KUIA 5C0MA 4M7AC 3C95A 1U8RA 5GMKh 1N9RA 4HA8A 4XTWA 1VQ4T 5EG2A 2HD0A 3LWHA 1JJ2A 5GANf 3H8ZA 5FLXE 3NTHA 2KDSA 2BKDN 3OB9A 3JCMe 2XU8A 2XDDA 1VQ5A 1VQLA 5GAMd 2LDMA 1LOJA 2RI3A 2P0QA 2RHIA 3L42A 1N8RU 2K5LA 3ME9A 4BE2A 4C8QF 3OYHA 2CZ1B 3PIPA 1VQKA 1WGSA 3ER0A 1SSFA 1WNLA 2X4WA 3T9NA 2CZ7B 2VV5A 1VUBA 1W4SA 2RO0A 3M57A 3QJYA 3L1AA 4XK8E 3WVEB 4F7UB 4PNOA 3OYDA 3FC3A 2QA4A 1Q81U 3F70A 1M1KC 4M7AG 2CKKA 4J6YA 4A4GA 2JUFA 1AHJB 1KHIA 3CCQA 2GFAA 5I21A 2M1HA 2HNIA 3INZA 4ZGEB 4PJOA 3OSVA 2K57A 2L89A 3SFMA 4BY6B 5KCHA 5CKFA 3PT9A 2V8KA 2QTXA 3EAEA 2DIGA 4KUDK 2R5AA 3OYMA 4C5IA 5LJ3d 2LQKA 3A5ZB 4LDYA 2QDYB 3FB9A 5C6SA 4A53A 3LW5E 3CCVA 1FXXA 5FRNA 3SWNA 3GOXA 3VYHB 2ZPGB 2MWOA 3JCMf 3JB9G 1R8OB 2QQ9A 3PFSA 3JCMc 4MZMA 4F7UE 3P8HA 4R55A 1YI2T 3QZ9B 1QVPA 2CS7A 3QXEB 1VQ6A 4GLKA 5FU6B 2XK0A 2P4TA 2DTHA 3DKMA 2LQ8A 2M0OA 2MF2A 1Y07A 3HRSA 3M5AA 1YBYA 2AHJB 2EIFA 5CIUA 4C92D 5GAOm 3L2WA 5A0DA 4PLLA 1YIJT 4XTXA 3A8MB 1VQ5T 1VQ8A 3CD6A 1Y96A 2RHUA 5CK9A 5LL6S 3BDLA 4QVDA 5HK3A 1QP2A 1KC8U 1VQKT 4NL2A 2ZCFB 2EFIA 3CC7A 1Q86C 2JTFA 2XDBA 4PJOB 4MDWA 4C8QC 3JCMb 3S6WA 1RI0A 3META 1OZ2A 1LNXA 2RJCA 3QO3A 4ME7A 3V7CA 3FEOA 4E7KA 3S3NA 2QA4T 3Q1JA 3X28B 3CCMA 3HSBA 4HT9A 3VYGA 4J8OA 5CKHA 1M90C 4M7DC 5DY9A 3URGA 1M1GA 5LJ5d 1D3BA 3SWNB 5GANg 3N5BB 4L5GA 4XU3A 3G71A 3JB9H 4JJNK 4OB3B 3QYHB 3JSCA 1V29B 2XDPA 5HK0A 1O9SA 5GAOr 5GAOp 5GANj 3LGLA 3M4YA 4C8QG 1GXIE 4PJOE 3CMAA 2XI9A 3TCJA 2GCXA 3CBPA 3OYFA 3CCUT 4NS5A 1Q7YU 1Y96B 4XTVA 3TU4K 1VQ6T 4M7DG 5GMKe 3OYLA 1W2BS 2R5MA 4J7IA 5J39A 1YJNA 3RMSA 4A4KA 2E1HA 4KT0E 4M75G 3TEEA 4ZGDB 3FIFA 2KK4A 2E64A 4DQ2A 2LNVA 3E19A 4MMKA 4N4GA 3PNWC 1VQ7T 3CD6T 2OAUA 4BD3A 4QVZA 3OYEA 1U1SA 4C92F 2DPPB 4P5NA 5HY6A 1DJ7B 2WSEE 4RCBA 1K8AU 4M7AA 4WF2A 3A8HB 4JDSA 1VQMA 5AYFA 1D3BB 5GAN7 3CCEA 3NTIA 3MHXA 4B9XA 3DLMA 3FLGA 1JBMA 3JCMg 1M1FA 2XKOC 3CCRA 2XG8D 3X24B 2EKOA 2D6FA 1QW1A 3KUFA 1MGQA 4BUGA 3P8DA 1VQPA 5IAYA 2JTMA 3RMQA 3OYGA 3OYKA 3CCJA 2KVQG 2MI6A 4FT2A 4PJOD 4JRQA 3CXCA 2XIDA 2EQKA 2K3XA 1YCYA 2RJFA 4HCZA 2QQBA 2EJ9A 4OGCA 3CMEA 1I8FA 2E41A 3I56A 5LJ5h 3CPWS 1HXDA 4A54A 1PSEA 2NLUA 5KE3A 2PQWA 3CMAT 4ATOA 5A0LA 3TREA 1OZ3A 4N0AA 4Y28E 5M9OA 1HK9A 4M78G 2GQVA 3QZ5B 1M5Q1 1ZQ1A 1XTDA 5I2MA 2ZPIB 2DTOA 4QQGA 2PVOB 3X20B 3OMGA 4M7AB 4ELYC 3VU3C 4KULA 3JB9I 1YJNT 5GMKl 1O75A 1VQOA 3ZFJA 3ZBDA 3JCMJ 1Y7XA 2DXBA 3G6ET 2KQWA 3CC4A 3JCMX 3I55A 5CQXA 1QVFS 3RUXA 3V7SA 2QQRA 3MP1A 3V8JA 2LT4A 1M1KU 4BE0A 2DIQA 4JRKA 4C92C 2ZPEB 3L2UA 1I81A 3UT1A 4LD9K 4O6JA 3OMCA 1YITA 5I2SA 3CCET 2LCLA 5KCOA 3LYIA 4BDYA 5DLQE 2RA2A 1X6OA 5GAOq 1NJIU 1KQSS 4BI3A 3CCLT 3MEWA 3JCMd 1P92A 4E47A 3FJPA 3V8LA 1IREB 2FB7A 3LX7A 2L5QA 3M9QA 5A0GA 2EQJA 2WACA 3HFOA 4M7AE 4B9WA 3EFSA 3M58A 3GP8A 4C8QA 4E7JA 1G3SA 4DOWA 4ZN1A 2RD1A 1RL2A 2B8AA 2RHZA 1YJWT 2VGMA 4PJOF 3CMET 4C92G 2V8IA 4M7DA 2MMPA 5CCAA 2X4YA 2ZZDA 4X9DA 2OTJA 5GAOn 1Q82U 2E6ZA 4BACA 3KBGA 2DAQA 4M75A 4OB1B 2A7YA 2ZGWA 3MEVA 4MZTA 4XTZA 5CKEA 4C5HA 4C5GA 1N8RC 4HT8A 2EQMA 4OVAA 1X01A 3ZEHA 1BYMA 3RERA 1BI3A 3JRZA 1VQPT 3M56A 2CZ0B 1VQOT 5GAN2 3PMIA 4GY5A 4BE1A 1NJIC 4OP0A 3VUZA 3QSUA 3OS2A 4BY6C 4J6WA 1Q86U 1VQLT 3OYAA 1NPRA 1XOVA 3I55T 2QEXA 1K9MU 1B34A 4A4EA 2VYTA 4JLIA 3M54A 2O01E 2V8JA 1WQ7A 4LDXA 4RMOA 1M90U 2XD0A 1M9SA 5GMKj 1UGRB 2EJGA 1M8VA 2X4JA 4C8QB 5GAMh 4C0DB 3UDCA 4HCCA 4M7AF 2WSCE 5GAN8 3OYCA 1BI2A 2EAYA 2RK1A 3OYJA 2RM4A 3PMTA 2D9TA 3CBMA 3O8VA 4FSXA 3OYBA 4MMLA 2A3LA 4M7DB 2X35A 1G5VA 4L59A 2LX9A 3CCQT 4E7IA 3OYNA 2HBPA 2GF7A 4EMKC 2RJEA 3OS1A 1QP3A 3HHTB 4M75B 3DB3A 3VKIA 4QVCA 3G4SA 2IVWA 2JOYA 4JUVA 4M77A 3CC2A 4M78A 3HP9A 5LJ5e 4C0GA 1WJRA 4FM4B 4D6WA 1KQ2A 1N6AA 2QXFA 3CCVT 1UGSB 1VIFA 3S3OA 4OMFB 1QVGA 4PJOC 2PUKB 1WPYA 2WSFE 4C8QE 4EMGA 1UGPB 4XU1A 4CI0C 2E10A 3UPUA 4DA4A 2HAXA 2VC8A 3OY9A 3J80E 1B34B 3GNGA 5LJ3h 3L2QA 4RCCA 3QKJA 1KC8C 3M55A 2P0PA 2FHDA 3M53A 4IKFA 4M7DE 4BB7A 1NE8A 1XNIA 1K73C 2X4XA 4XTYA 4M75E 4NOYA 3FDRA 3WVDB 3VUBA 1I5LA 4JRIA 2CYZB 3OBWA 2XHCA 3CC7T 4BI8B 3BFMA 3QIIA 1OI1A 3EFRA 4QW2A 2K3YA 4LD6A 2EQUA 4M77B 4M78B 5CVIA 3E1SA 3V8KA 5LJ5f 3CCMT 4ZTFA 1JB0E 4IUQA 2OTLA 1M4ZA 2PUOB 2VXFA 2KMTA 2D0QB 1VQ4A 2E12A 3GLXA 4C92A 4NL3A 1EIFA 5GAN6 3QUIA 4J5YA 4N4HA 5D6WA 3G4ST 3G71T 1PSFA 4X9CA 1KD1U 1H641 1N9SA 2IG0A 5GANd 2VUBA 1FWZA 1WJQA 3RKXA 5IT9E 3HKSA 4IUUA 1G3YA 3CBOA 2O4XA 2QQAA 4F7UF 3OW2A 5GMKi 4ZGJB 3OSSC 2M16A 4TVRA 4XQ3A 2F69A 3JCMV 5A2QE 1FX7A 4M75D 1X75C 4M77E 5J3BA 4M78E 4L6V5 4ZTJA 4RG8A 5FRMA 3OYYA 4LDWA 2KSSA 3LGFA 2RJDA 4QQ6A 4Z02A 2CGHA 3JCMW 4O5VA 4II1A 3G7ZA 4Y91A 1I4K1 3PTAA 2PVDB 3BW1A 3CPFA 3M4GA 2K5FA 3H6ZA 3RKYA 3CXCS 4JS4A 1KG1A 2M9UA 4XTUA 5CAIA 5DLOA 4C92B 1VQMT 2K5IA 5FU7C 4XU0A 5GAMe 3MP8A 3CCRT 2YLBA 1YI2A 4MDXA 2H3JA 3A8LB 4YTLA 4OGEA 1ZHIA 4R56A 1S72A 3DLLA 2JVVA 2O4XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ATO A;  2XD0 A;  4GLK A;  2XDB A;  2XDD A;  4RMO A; 
#chains in the Genus database with same CATH topology
 2GFU A;  3QHS A;  2Z0W A;  4X1V A;  2LNH B;  1YIJ A;  4HKE A;  1JU5 C;  2Y4Y A;  4M77 D;  1IHW A;  2I2L A;  1M3B A;  1MHN A;  5I11 A;  1NPP A;  4EMK A;  2YLC A;  3E9G A;  1WHJ A;  4RTT A;  2MOX A;  1NLP C;  2FL7 A;  3P8B B;  3NHN A;  5GAM f;  2JZ2 A;  1SKU B;  1KQ1 A;  3L2V A;  1Q81 C;  2QI2 A;  1SRM A;  4J9I A;  1MUZ A;  2DK3 A;  3MEA A;  2KXD A;  3VS6 A;  1QLY A;  4X34 A;  1E6H A;  2BZX A;  1ZSZ B;  1WHL A;  4AFQ C;  1I0C A;  2IPO B;  2CSQ A;  2JN0 A;  4RKU E;  2L2P A;  1X2K A;  4EPC A;  3JCM P;  3RKW A;  1M90 R;  2LRQ A;  3VS4 A;  3SDZ A;  2Y4X A;  3WXM B;  4FIB A;  2RHY A;  2RF0 A;  4C0Z A;  4C0D C;  1K9M C;  3A8G B;  1OU8 A;  1NEG A;  1WJS A;  3M0P A;  3V7R A;  3VS7 A;  2VGN A;  3JCM W;  5FRO A;  3OS0 A;  4E7S A;  4RTU A;  4OB0 B;  4RG2 A;  2JJ9 A;  2HMA A;  1ZLM A;  5IN1 A;  1TWB A;  5HCK A;  4CRI A;  3HRU A;  3QG1 A;  4OMN A;  2MWP A;  4DEY A;  3OW2 P;  4JRP A;  2YHT A;  2ZPF B;  1OX8 A;  3R6O A;  1U3O A;  2V26 A;  4QQD A;  1WQW A;  2YSQ A;  2PTK A;  3CCS Q;  2O2O A;  2MAM A;  1N27 A;  1QWF A;  3MPU B;  3NPF A;  4IUP A;  1OYX A;  1NYG A;  3JAM E;  2Y90 A;  1TH7 A;  2F5K A;  1ZBX A;  2AIR B;  5LJ3 g;  2HL5 C;  1YJW A;  1QCF A;  1J3T A;  2H8H A;  3MEU A;  1OUL A;  3CCS T;  1I1J A;  4HA8 A;  2HD0 A;  5GAN f;  5FLX E;  3O5Z A;  3OB9 A;  2ESW A;  2RI3 A;  2RHI A;  1OPL A;  3OYH A;  1YI2 Q;  1WNL A;  3T9N A;  3M57 A;  4XK8 E;  2QA4 A;  1BBZ A;  1JO8 A;  4PNO A;  2YT6 A;  1YIJ Q;  2JXB A;  4ZGE B;  3INZ A;  4KGZ B;  1AOJ A;  2K57 A;  3SFM A;  1RAC B;  3EAE A;  4JPB W;  2DIG A;  3OYM A;  4C5I A;  4LDY A;  5C6S A;  3LW5 E;  4F14 A;  4KGV B;  3JCM f;  3JCM c;  2QQ9 A;  3PFS A;  4F7U E;  2DYB A;  3EH2 A;  1YI2 T;  5FU6 B;  2XK0 A;  2P4T A;  2BZ8 A;  2LQ8 A;  2KRO A;  4C92 D;  5GAO m;  1YIJ T;  2KRS A;  3REB B;  3CCV Q;  3EHR A;  1Y96 A;  2RHU A;  2FRW A;  5CK9 A;  3CQT A;  1QP2 A;  2ZCF B;  3CC7 A;  2O31 A;  2NYS A;  3JCM b;  2DL5 A;  1OZ2 A;  4DEX A;  3V7C A;  2RJC A;  1A0N B;  3S3N A;  3A1P A;  3FEO A;  3X28 B;  3CCM A;  4HT9 A;  3VYG A;  5CKH A;  3HTR A;  2YUP A;  2HBW A;  2EVR A;  1D3B A;  3SWN B;  1WDX A;  3N5B B;  4JJN K;  5KYW A;  3QYH B;  1O9S A;  2D8J A;  3LGL A;  1WHH A;  4PJO E;  3CMA A;  2FPD A;  3TCJ A;  4NS5 A;  2RPN A;  4XTV A;  2VKN A;  1RLP C;  4M75 G;  3OYE A;  1DJ7 B;  4RCB A;  1K8A U;  5GAN 7;  1B7T A;  1JBM A;  2X3X D;  2EKO A;  3KUF A;  1MGQ A;  1GCQ A;  2GQI A;  1YCS B;  3CCJ A;  3OYK A;  2EQK A;  3A98 A;  2K3X A;  3PE0 A;  2RJF A;  4OGC A;  3CME A;  1PSE A;  4FW1 A;  4N0A A;  2DTO A;  2PVO B;  3OMG A;  4ELY C;  4KUL A;  1O75 A;  2I0N A;  3JCM J;  1Y7X A;  2KQW A;  3RUX A;  3MP1 A;  3V8J A;  2DER A;  4FYW B;  1QQJ A;  4BE0 A;  2DIQ A;  3UT1 A;  1WFW A;  5I2S A;  1K4U S;  1AT1 B;  3LYI A;  2A28 A;  5GAO q;  2YUN A;  4E47 A;  3FJP A;  3V8L A;  4M7A E;  1D1A A;  1GCP A;  1ZUY A;  2VVK A;  1NJI R;  4E6R A;  2B8A A;  2RHZ A;  1YIT Q;  4Y92 A;  2VGM A;  1YJW T;  2L3S A;  1AEY A;  1Y57 A;  2DF6 A;  2ZZD A;  2OTJ A;  2E6Z A;  1C1A A;  3MEV A;  4XTZ A;  4C5G A;  1BI3 A;  2W10 A;  2DE0 X;  1Q82 R;  5GAN 2;  4OP0 A;  3QSU A;  3EGD A;  4J6W A;  1NPR A;  1XOV A;  3VS0 A;  1I5O B;  4CC4 B;  4AG2 C;  1CSK A;  4RMO A;  2XD0 A;  2DRK A;  3VS1 A;  3UDC A;  6AT1 B;  4HCC A;  2FG0 A;  4HVW A;  2RM4 A;  5KYY A;  2DL4 A;  1QVG P;  4M7D B;  1G5V A;  4E7I A;  2HBP A;  3OS1 A;  3VKI A;  1RAE B;  4QVC A;  4M78 A;  5LJ5 e;  4C0G A;  1KQ2 A;  4D6W A;  1QVG A;  2K2M A;  2WSF E;  4DA4 A;  4C8Q E;  1EFN A;  2HAX A;  3L2Q A;  3M55 A;  3VS3 A;  2FHD A;  3G4S Q;  4IKF A;  3CC2 Q;  4BB7 A;  1NE8 A;  1XNI A;  8ATC B;  1K73 C;  1PKS A;  1SHG A;  1D0Z A;  1OV3 A;  1I07 A;  2X51 A;  3VS2 A;  4JRI A;  4CC2 A;  3CC7 T;  4BI8 B;  1OI1 A;  2K3Y A;  4LD6 A;  4M77 B;  3E1S A;  3CCM T;  2CP6 A;  1K8A R;  2VXF A;  2KMT A;  1ABO A;  5KYX A;  4C92 A;  1BB9 A;  4PFO A;  5GAN 6;  4J5Y A;  4N4H A;  2CSI A;  3G4S T;  1WJQ A;  2EKH A;  4IUU A;  3UAT A;  1X27 A;  1G3Y A;  1M30 A;  4F7U F;  2QK0 A;  3OSS C;  4XQ3 A;  3CCJ Q;  4M75 D;  2KT1 A;  3LGF A;  2EPD A;  2CGH A;  2H3E B;  1R0C B;  1I4K 1;  2PVD B;  2K5F A;  3H6Z A;  5CAI A;  2AZV A;  2O9V A;  2ECZ A;  5DLO A;  2K5I A;  5GAM e;  1K0S A;  3PVQ A;  4MDX A;  1UE9 A;  4YTL A;  1GL5 A;  2JVV A;  1ZBJ A;  2CP5 A;  1E6G A;  3CCJ T;  3QJ6 A;  1ZSZ A;  3AHU A;  1JXM A;  5D6X A;  1U1T A;  1UFF A;  3E9F A;  3BY7 A;  4J9F A;  1GCQ C;  4F16 A;  3QYG B;  5ECA A;  4RTZ A;  4LXC A;  3VV0 A;  1RAH B;  3SB2 A;  2PVG B;  3U23 A;  4PJJ A;  2IIM A;  4PK4 A;  4N0A C;  2P0K A;  1SPK A;  4J9E A;  4A4F A;  2OTJ Q;  1UEC A;  4AT1 B;  4Q5W A;  5CR2 A;  2DMO A;  3FJ5 A;  4XAX B;  1BU1 A;  3J7A F;  2LCC A;  4ORZ A;  4F7U G;  2QQS A;  3CCU A;  3EGX B;  3X25 B;  2DBM A;  3H9N A;  3TQ7 P;  4V2S A;  1W6X A;  1EX4 A;  1OX9 A;  2JNG A;  4B6M A;  1W2B P;  1FYN A;  1YJ9 Q;  4J7F A;  4PFP A;  5LJ3 f;  3J81 E;  4E7L A;  3JB9 D;  1ZA1 B;  2OTJ T;  1K0X A;  4C0F A;  4M78 F;  3ZL7 C;  1Y71 A;  3C4S A;  2DO3 A;  1W2B A;  1NEB A;  2JM9 A;  5KYU B;  4C5E A;  1AZE A;  3LWI A;  4J6X A;  1VQ7 Q;  2OI3 A;  2K3B A;  4PJM A;  2EWN A;  4HT8 A;  5J26 A;  3QPH A;  2XIC A;  3VJP A;  5CQY A;  3M59 A;  1YJ9 T;  1UB4 A;  4PJO G;  2X9H A;  3OQ5 A;  2DET A;  3GPL A;  1H3Z A;  2CDT A;  4M7A F;  1IZ6 A;  3CCS A;  1QVG S;  3I5S A;  1HSQ A;  2DJZ A;  2L3R A;  2RB6 A;  3EHQ A;  5EC7 A;  2FPE A;  4KH0 B;  4IUT A;  1Q7Y C;  4OB2 B;  1YHQ Q;  4MZP A;  1QVF P;  3MP6 A;  1VQ8 Q;  4M7D D;  3D7S B;  5GAN e;  2DM1 A;  1UGV A;  4M78 C;  2P84 A;  3G6E Q;  1KQS P;  2RQU A;  1WHG A;  1IO6 A;  2KAF A;  4HVU A;  4N4I A;  4LDU A;  1QVF A;  4EMH A;  1RAG B;  4VUB A;  2KGT A;  2F5T X;  4XU2 A;  3GIB A;  1LJO A;  1PNJ A;  1YHQ T;  1KQS A;  3CCL Q;  3UWN A;  3KXT A;  1VQ8 T;  1YNZ A;  2DXU A;  3C12 A;  1G3W A;  4KUI A;  4M7A C;  1U8R A;  1PM3 A;  3JV3 A;  5EG2 A;  3LWH A;  1X2Q A;  2BKD N;  3JCM e;  2LDM A;  1ZUU A;  4C8Q F;  1M27 C;  1WGS A;  5IXF A;  2VV5 A;  2KYM A;  1W4S A;  1M2V B;  4M7A G;  3FC3 A;  1M1K C;  1N8R R;  3F70 A;  2YWW A;  1AHJ B;  3THK A;  1U5S A;  2FZG B;  5I21 A;  2HKN A;  3RR6 A;  5CKF A;  2CP2 A;  1VQK Q;  3PT9 A;  4KUD K;  2LQK A;  3A5Z B;  2D1X A;  4FSS A;  3CCV A;  2A08 A;  4D8D A;  3SWN A;  2ZPG B;  2MWO A;  4OMQ A;  4R55 A;  3QZ9 B;  2DBK A;  2CS7 A;  4Z88 A;  4GLK A;  2LP5 A;  2M0O A;  5CIU A;  2CUB A;  3HRS A;  1KSW A;  3L2W A;  1PKT A;  4PLL A;  4XTX A;  3A8M B;  4E2F B;  1WXT A;  5LL6 S;  3CCU Q;  1VQK T;  4NL2 A;  1VQ6 Q;  4C8Q C;  1RI0 A;  4ME7 A;  4E7K A;  3HSB A;  2DL3 A;  1M90 C;  5DY9 A;  3VS5 A;  3JSC A;  1V29 B;  2FO0 A;  4C8Q G;  3CCU T;  1JEG A;  1VQ6 T;  2JM8 A;  5GMK e;  2L3P A;  1W2B S;  2ROT A;  2E1H A;  4DBR A;  4ZGD B;  1WXU A;  1T3S A;  2LNV A;  4N4G A;  2OAU A;  4BD3 A;  1D1B A;  1U1S A;  4HCK A;  2DPP B;  4P5N A;  2CH4 A;  2WSE E;  3CXC P;  1WYX A;  3M0S A;  4JDS A;  4AMC A;  1UHC A;  1YJN Q;  1M1F A;  2M02 A;  2A36 A;  2JTM A;  3RMQ A;  2KVQ G;  2KBT A;  4ESR A;  4PJO D;  3CXC A;  2C0O A;  4A54 A;  1V76 A;  4DBQ A;  1MMA A;  4K11 A;  5KE3 A;  3TRE A;  1HK9 A;  1XTD A;  5I2M A;  2ZPI B;  2NWM A;  2FRY A;  3X20 B;  3VU3 C;  1YJN T;  3ZBD A;  1RAA B;  3I56 Q;  2L3Q A;  3JCM X;  1QVF S;  3V7S A;  2LT4 A;  2DA9 A;  2MK5 A;  1TS9 A;  2AZS A;  4JRK A;  2ZPE B;  1I81 A;  2K9G A;  4O6J A;  2FPF A;  2HL3 A;  1YIT A;  3VRY A;  5KCO A;  2RA2 A;  1X6O A;  1NJI U;  1KQS S;  2ROL A;  4BI3 A;  1JJ2 A;  4FYV B;  3CC4 Q;  1IRE B;  2FB7 A;  2RQT A;  1UUE A;  1PC0 A;  2WAC A;  3HFO A;  3I55 Q;  3EFS A;  2E5K A;  2AT1 B;  4DOW A;  1X69 A;  4M7D A;  2YUQ A;  2MMP A;  5CCA A;  1Q82 U;  4BAC A;  1RLQ C;  5CKE A;  1Y0M A;  4MZT A;  4FYX B;  3ZEH A;  1PRM C;  1BYM A;  3JRZ A;  1KIK A;  1JQQ A;  2CP7 A;  4GY5 A;  4BE1 A;  3C0C A;  3VUZ A;  1Q86 U;  3I55 T;  2QEX A;  4F17 A;  2SRC A;  4DBH A;  1M9S A;  2JS2 A;  2EJG A;  3PMT A;  4FSX A;  3OYB A;  4RTW A;  2LX9 A;  5IHN A;  4EMK C;  1M3C A;  2V1Q A;  1QP3 A;  4M75 B;  3DB3 A;  3G4S A;  4JUV A;  3CC2 A;  1PWT A;  4M77 A;  3HP9 A;  1F1B B;  1N6A A;  1WLP B;  4OMM A;  3CCV T;  1UGS B;  1WPY A;  3UPU A;  4XU1 A;  4CI0 C;  2EW3 A;  2VC8 A;  1IRX A;  3GNG A;  2QYZ A;  3M53 A;  3EG3 A;  2X4X A;  2SEM A;  2M0Y A;  4NOY A;  3WVD B;  3VUB A;  4J9D A;  2CYZ B;  2DVJ A;  2XHC A;  4J9H A;  3QII A;  1VYT A;  1YN8 A;  2RQV A;  2EQU A;  3V8K A;  1AZG B;  4LN2 A;  1VQ4 A;  2E12 A;  3GLX A;  2KXC A;  4E7Z A;  1SEM A;  5D6W A;  4X9C A;  2IG0 A;  4GLM A;  3RKX A;  3HKS A;  3H0H A;  8AT1 B;  1QWE A;  1KD1 R;  5A2Q E;  1FX7 A;  1X75 C;  5KYN A;  4M78 E;  4L6V 5;  2FZK B;  5FRM A;  4LDW A;  2KSS A;  4LNP A;  5IXB A;  1IGU A;  3G7Z A;  3UF4 A;  2HDA A;  3BW1 A;  3CXC S;  4XTU A;  3GBQ A;  1TUC A;  5FU7 C;  2HCK A;  2YLB A;  4LUE A;  2VB6 A;  1ZHI A;  4R56 A;  2KRN A;  2CZ6 B;  1NG2 A;  1G3T A;  3EFO B;  1RAF B;  1YFN A;  3EGX A;  4FT4 A;  2GTO A;  3LH0 A;  1MV0 B;  3DB4 A;  2COY A;  2RK2 A;  1X6B A;  4C92 E;  3I9Q A;  5D6Y A;  3ASK A;  1S72 Q;  2DTI A;  5HKC A;  5LJ3 e;  1U06 A;  2QGF B;  3LLR A;  1JRI A;  1KK7 A;  1SG5 A;  1CKA A;  7AT1 B;  2NUZ A;  5LJ5 j;  1R0B G;  1JJ2 S;  3OA6 A;  5GAN 4;  1NJI C;  4EDU A;  5KYU A;  1YJ9 A;  2DL8 A;  2J05 A;  2KY9 A;  3EG9 B;  3FRN A;  1UHF A;  1Z9Z A;  1YIT T;  1Q86 R;  2FVU A;  3JB9 J;  1XQH A;  2LZ6 B;  3HRT A;  2KR3 A;  1S72 T;  1WHK A;  2C06 A;  1Q82 C;  2V1R A;  4UC4 A;  2KE9 A;  2QEX Q;  2RI2 A;  3NTK A;  2BUD A;  2VXE A;  2R57 A;  2FYK A;  2ZPH B;  2DNU A;  1VQ7 A;  1GBR A;  3EG0 A;  2PU9 B;  1ABQ A;  4M77 F;  2AKK A;  2KRM A;  2DVE A;  2LT1 A;  2JW4 A;  2DZ9 A;  1N5Z A;  5GAO l;  1BIB A;  2E65 A;  3HFN A;  4A4H A;  5GAN 3;  3QDR B;  2CT3 A;  1VQ9 Q;  3BE3 A;  2QEX T;  3PGG A;  3E2U A;  2HEQ A;  1VQN Q;  2L8D A;  4CC7 A;  2EQI A;  3AT1 B;  2G6F X;  2RI5 A;  3RIR A;  3X26 B;  1YHQ A;  1M8M A;  2CUD A;  2RH2 A;  2YRV A;  1VQ8 A;  2CP0 A;  4HVV A;  4E7H A;  3CEY A;  2KEA A;  1BIA A;  3M0T A;  2QDL A;  4IUV A;  3RDV A;  3G6E A;  2DFU A;  5GAM j;  3CC2 T;  3A8O B;  4IIM A;  2BIV A;  1VQ9 T;  3OBY A;  2K6D A;  1VQN T;  4J83 A;  1VQ4 Q;  4A63 B;  2HQX A;  4M77 C;  1K8A C;  3CCL A;  1VIE A;  2E5Q A;  5L8R E;  4GBQ A;  4AFZ C;  4IIO A;  2ENM A;  5CKB A;  2ZPB B;  1M2V A;  2DKG A;  4J9C A;  4BDZ A;  2K2V A;  2MYS A;  2KT8 A;  5GJW B;  1UGQ B;  4M77 G;  2J7I A;  4RTY A;  2MIO A;  1QCO A;  2EYZ A;  1WIE A;  5C0M A;  1N9R A;  1VQ4 T;  1RUW A;  3QDF A;  3NTH A;  2KDS A;  1ACM B;  2XU8 A;  2XDD A;  5GAM d;  1YWO A;  2MPX C;  2P0Q A;  2LJ3 A;  3L42 A;  2K5L A;  3ME9 A;  4J9G A;  1N8R U;  3H0F A;  2CZ1 B;  1VQK A;  1QMC A;  1SSF A;  2X4W A;  2CZ7 B;  4F7U B;  2RO0 A;  3QJY A;  3M0Q A;  3WVE B;  1Q81 U;  1WA7 A;  2CKK A;  4J6Y A;  1VQ5 Q;  1VQL Q;  2J6F A;  2HNI A;  3OSV A;  3TSW A;  3UA7 A;  2L89 A;  4BY6 B;  4PJL A;  2QTX A;  4ANJ A;  2R5A A;  3LH5 A;  3H41 A;  2CRE A;  1R8O B;  3I35 A;  3P8H A;  1VQ6 A;  2DTH A;  1RAD B;  3M5A A;  1Y07 A;  1YBY A;  2AHJ B;  2EYY A;  1VQ5 T;  2L0A A;  1W70 A;  3H0I A;  4AFS C;  2BE9 B;  1UG1 A;  3BDL A;  4QVD A;  5HK3 A;  4KH1 B;  2D8H A;  4PJO B;  2XDB A;  2JTF A;  4MDW A;  1VA7 A;  2LJ0 A;  3MET A;  1AWX A;  1LNX A;  3QO3 A;  1T0H A;  2B86 A;  1QKX A;  4J8O A;  1KC8 R;  3CD6 Q;  1M1G A;  4PJN A;  4L5G A;  3JB9 H;  2MCN A;  5GAN j;  5GAO r;  5HK0 A;  1GFD A;  3M4Y A;  4FYY B;  1GXI E;  2XI9 A;  1X6G A;  1OOT A;  1SSH A;  2R5M A;  1YJN A;  4A4K A;  1RAI B;  2ZAE A;  2DIL A;  3TEE A;  3FIF A;  2KK4 A;  2E64 A;  4MMK A;  3PNW C;  1VQ7 T;  3CD6 T;  4C92 F;  3A8H B;  2A0F B;  3EGU A;  2KI7 A;  2J06 A;  1TSF A;  3DLM A;  1B07 A;  3FLG A;  4B9X A;  5L23 A;  2XKO C;  2XG8 D;  4JJD A;  3X24 B;  2NUP B;  1QW1 A;  4WCI A;  3P8D A;  1T0J A;  3OYG A;  2MI6 A;  4FT2 A;  4JRQ A;  1LPL A;  1OEB A;  1UDL A;  2AK5 A;  4JZ3 A;  1YCY A;  3CCE Q;  4HCZ A;  2QQB A;  2EJ9 A;  4PFZ A;  1I8F A;  2DLP A;  2E41 A;  5LJ5 h;  1MMG A;  3I56 A;  1AWW A;  1HXD A;  1S1N A;  3CCR Q;  2NLU A;  1NBE B;  2O9S A;  4ATO A;  5A0L A;  1VQP Q;  4M78 G;  3QZ5 B;  1ZQ1 A;  1PRL C;  1X43 A;  4M7A B;  3JB9 I;  3ZFJ A;  2DXB A;  3G6E T;  2PNI A;  5IHI A;  3CC4 A;  2RQW A;  1D1C A;  3I55 A;  5CQX A;  4RTV A;  1UJ0 A;  4C92 C;  3CCE T;  3OMC A;  3QWX X;  1Q95 G;  1VYV A;  4BDY A;  5DLQ E;  1VQO Q;  1SRL A;  3CCL T;  3MEW A;  1MND A;  3JCM d;  1P92 A;  1VQP T;  3M9Q A;  3LX7 A;  2DEU A;  2L5Q A;  2EQJ A;  3M58 A;  3TSZ A;  3GP8 A;  2YXY A;  4E7J A;  1D0X A;  1TTH B;  1G3S A;  2XMF A;  4D8K A;  1Q81 R;  4C92 G;  1FMW A;  1PCX A;  2E3H A;  3KBG A;  2DAQ A;  4M75 A;  4OB1 B;  2A7Y A;  1HD3 A;  2ZGW A;  1N8R C;  2CZ0 B;  1VQO T;  1IHV A;  3PMI A;  3RNJ A;  3G1J A;  1WX6 A;  2VYT A;  1SHF A;  2O01 E;  1WQ7 A;  2CT4 A;  9ATC B;  1ZSZ C;  1UGR B;  1PD0 A;  2QAZ A;  5GMK j;  2X4J A;  3SHW A;  4C8Q B;  4C0D B;  5GAM h;  1QCN A;  1AD5 A;  2WSC E;  5GAN 8;  2EAY A;  2RK1 A;  3OYC A;  1K9M R;  2D9T A;  2F2W A;  2COW A;  2A3L A;  2X35 A;  1AWO A;  4L59 A;  3OYN A;  2GF7 A;  2LCS A;  2RJE A;  2GTJ A;  3HHT B;  2IVW A;  2JOY A;  2DJQ A;  2ATC B;  1WJR A;  4RUG A;  2GBQ A;  2RMO A;  1UGP B;  3J80 E;  2K79 A;  1B34 B;  1W1F A;  1VOM A;  3QKJ A;  2LMJ A;  4M7D E;  2YUO A;  5IHK A;  4LUD A;  3EG2 A;  4XTY A;  2HZY A;  5AT1 B;  2NUT B;  1I5L A;  1H3H A;  3OBW A;  1QKW A;  1YWP A;  2EYX A;  2OTL A;  2CH4 W;  1JB0 E;  4IUQ A;  2PUO B;  4NL3 A;  1EIF A;  3QUI A;  1AVZ C;  1KD1 U;  1H64 1;  1N9S A;  1FWZ A;  1K1Z A;  3CBO A;  2QQA A;  3OW2 A;  5GMK i;  2X3W D;  3EFO A;  4TVR A;  2F69 A;  5J3B A;  4M77 E;  5I22 A;  4ZTJ A;  4RG8 A;  1C6V X;  4AG1 C;  4QQ6 A;  1BCO A;  4Z02 A;  4O5V A;  5FWB A;  1JJ2 P;  1M3A A;  4FW2 A;  1EZZ B;  4XU0 A;  3REA B;  4J9B A;  3MP8 A;  2H3J A;  3A8L B;  1S72 A;  1C0M A;  3DLL A;  2O4X B;  3ULR B;  1KFZ A;  3EG9 A;  5CKD A;  1UJY A;  2DL7 A;  3S3M A;  4OF1 A;  2GGR A;  4M78 D;  3I56 T;  3OYI A;  4Z89 A;  2G3R A;  5KH6 A;  5GAN h;  2J6K A;  3GF5 A;  1PG5 B;  3M0U A;  2LVM A;  5LJ5 g;  4KGX B;  2R58 A;  3RBB B;  4JS5 A;  2RHX A;  2DXT A;  4M75 F;  2BE7 D;  2OAW A;  1IB8 A;  3CC4 T;  3QBY A;  2HKQ B;  2LC4 A;  4HCB A;  2EJF A;  4M7A D;  3MJX A;  3GNF B;  3MKD A;  5FU6 C;  2E70 A;  4FCY A;  1G83 A;  4EMK B;  4FU6 A;  4IUR A;  4PL6 A;  3JCM h;  4DOV A;  2EYQ A;  4FL6 A;  1K9A A;  2EGA A;  1VQ9 A;  5KE2 A;  5GAN 5;  1MV3 A;  5DM7 R;  2F1L A;  2DZC A;  2QG9 B;  1VQN A;  2F2V A;  1K73 U;  4PLI A;  1TUG B;  3OS5 A;  4JJB A;  1HYO A;  1OU9 A;  2DD5 A;  2BZY A;  1H92 A;  2DYI A;  3SD4 A;  1XJW B;  1UEB A;  3SWN C;  4KBM B;  2EGC A;  4M75 C;  4BI4 A;  4JLG A;  2E6N A;  4R0K A;  3JCM Q;  1BKB A;  3CPW P;  3MCA B;  3MO8 A;  3NMZ C;  3PIO A;  1KHC A;  2K4Y A;  4LDV A;  2DD4 A;  1D0Y A;  4ELZ C;  4ZNX A;  2M51 A;  4WTO B;  5GMK m;  4F04 B;  5GAM g;  2LTO A;  3CPW A;  3RES A;  2E4H A;  4C8Q D;  3HPW A;  2EYW A;  3NFC A;  5CO7 A;  4ZN3 A;  2OTL Q;  1BI1 A;  4HXJ A;  3JB9 F;  3BDU A;  2DXC A;  1BI0 A;  1CKB A;  4CC3 A;  3L2Z A;  1TU0 B;  3EG1 A;  2JS0 A;  2F2X A;  4JZ4 A;  2KNB B;  3C94 A;  4OMO A;  3HL8 A;  1NZ9 A;  1ZX6 A;  4F7U A;  5LJ3 j;  3L2R A;  2DEQ A;  2HSP A;  1WHM A;  5FU7 B;  2HQE A;  1KD1 C;  4PKC C;  1WZO A;  3OW2 S;  2OTL T;  1OQK A;  3C95 A;  5GMK h;  4XTW A;  3H8Z A;  1YJW Q;  3UA6 A;  2VWF A;  2LQW A;  1VQ5 A;  1VQL A;  1LOJ A;  2ED0 A;  4BE2 A;  3PIP A;  2LX7 A;  4EIK A;  3ER0 A;  1T3L A;  1AWJ A;  1VUB A;  4M7D F;  3EH1 A;  3L1A A;  2K7A A;  3OYD A;  4A4G A;  2JUF A;  1KHI A;  4DBF A;  2GFA A;  3CCQ A;  2M1H A;  4PJO A;  5KCH A;  2V8K A;  2DRM A;  5LJ3 d;  2QDY B;  3FB9 A;  4A53 A;  2E3I A;  2QA4 Q;  1FXX A;  1V1C A;  5FRN A;  3GOX A;  3VYH B;  3JB9 G;  4MZM A;  1TOV A;  1QVP A;  3QXE B;  2VAS A;  2ED1 A;  5IH2 A;  3DKM A;  2MF2 A;  2EIF A;  5A0D A;  2YRD A;  3VRZ A;  1R77 A;  3CD6 A;  1KC8 U;  1TG0 A;  2EFI A;  1Q86 C;  3R6N A;  3S6W A;  1GFC A;  1LCK A;  3Q1J A;  2QA4 T;  1TXQ A;  2KYB A;  4M7D C;  2JT4 A;  2ABL A;  3URG A;  5LJ5 d;  4M4Z A;  2OX7 A;  5GAN g;  1K73 R;  1IGQ A;  2FZC B;  4XU3 A;  3G71 A;  4OB3 B;  1HJD A;  2XDP A;  2QTV A;  3CC7 Q;  5GAO p;  2NUP A;  1PD1 A;  1ZSG A;  3CCM Q;  2GCX A;  3CBP A;  3OYF A;  2EBP A;  1Q7Y U;  1Y96 B;  4RTX A;  3TU4 K;  4M7D G;  1RAB B;  1PHT A;  3OYL A;  4J7I A;  5J39 A;  3RMS A;  3I5R A;  1OPK A;  4KT0 E;  1TUD A;  4DQ2 A;  1GBQ A;  3E19 A;  1RI9 A;  1H8K A;  1GRI A;  4QVZ A;  3CMA Q;  2JMC A;  5HY6 A;  4M7A A;  2AKL A;  4WF2 A;  1VQM A;  2GNC A;  5AYF A;  1D3B B;  4AFU C;  3CCE A;  3NTI A;  3MHX A;  3JCM g;  3KFV A;  5KYW B;  3CCR A;  2D6F A;  4BUG A;  4JJC A;  2FEI A;  1VQP A;  5IAY A;  4QKU A;  3IQL A;  2XID A;  1MNE A;  2A37 A;  5FW9 A;  3CPW S;  2PQW A;  3CMA T;  1OZ3 A;  4Y28 E;  1D09 B;  5M9O A;  2GQV A;  2HQH A;  1M5Q 1;  2RN8 A;  4QQG A;  1KJW A;  5GMK l;  1VQO A;  2QAS A;  3CME Q;  1FMK A;  4OML A;  2QQR A;  2LJ1 A;  3PVL A;  3NGP A;  2QGG A;  5D7U A;  1M1K U;  1NLO C;  2YDL A;  2RQR A;  1VYU A;  3L2U A;  4LD9 K;  2LCL A;  1YP5 A;  1MMD A;  5A0G A;  1ZA2 B;  4B9W A;  2LQN A;  4C8Q A;  2J6O A;  4ZN1 A;  2RD1 A;  1RL2 A;  5FWC A;  4PJO F;  3CME T;  3M0R A;  2COZ A;  2EGE A;  2V8I A;  2X4Y A;  4X9D A;  2P4R A;  5GAO n;  2HSE B;  3CCQ Q;  1FMV A;  4C5H A;  3TVT A;  2EQM A;  4OVA A;  1X01 A;  3RER A;  3M56 A;  1BK2 A;  2D0N A;  3OS2 A;  4BY6 C;  1ARK A;  1VQL T;  3OYA A;  1K9M U;  1B34 A;  1G2B A;  4A4E A;  4JLI A;  3M54 A;  2V8J A;  1NM7 A;  4LDX A;  1MMN A;  1M90 U;  2DX1 A;  2C0T A;  1M8V A;  3OYJ A;  1BI2 A;  2JMA A;  2NUT A;  1BCM A;  1K76 A;  3CBM A;  3O8V A;  4MML A;  3CCQ T;  2YRC A;  4FM4 B;  4QT7 A;  2QXF A;  4PJO C;  1VIF A;  3S3O A;  2RNA A;  4OMF B;  1WI7 A;  2PUK B;  1UTI A;  4EMG A;  3EGD B;  3SEM A;  2E10 A;  3OY9 A;  5LJ3 h;  4RCC A;  1KC8 C;  3G71 Q;  2OJ2 A;  2P0P A;  1M2O A;  1Q7Y R;  4M75 E;  3FDR A;  5KYY B;  2PZ1 A;  3QWY A;  1LVK A;  2W0Z A;  3BFM A;  3EFR A;  4QW2 A;  2JTE A;  4M78 B;  5CVI A;  4ZTF A;  5LJ5 f;  1B3Q A;  1WXB A;  1M4Z A;  2D0Q B;  3G71 T;  1PSF A;  1VQM Q;  5GAN d;  2VUB A;  5IT9 E;  4KRT A;  2O4X A;  1E7O A;  4OMP A;  4ZGJ B;  1IXD A;  1G8X A;  2M16 A;  3JCM V;  2CP3 A;  1JXO A;  3OYY A;  2RJD A;  4II1 A;  1Z9Q A;  4Y91 A;  5GJV B;  3PTA A;  4LE9 A;  3CPF A;  3M4G A;  2O88 A;  2BTT A;  3RKY A;  4JS4 A;  1KG1 A;  1NYF A;  2M9U A;  5KYX B;  4C92 B;  1VQM T;  4Z8A A;  3CCR T;  1ZUK A;  1SF9 A;  1YI2 A;  2C0I A;  4OGE A;  1M1K R; 
#chains in the Genus database with same CATH homology
 2GFU A;  2CZ6 B;  3QHS A;  5CKD A;  3CCJ T;  3QJ6 A;  3AHU A;  1YIJ A;  4HKE A;  5D6X A;  1G3T A;  1U1T A;  2Y4Y A;  3S3M A;  4FT4 A;  3E9F A;  3LH0 A;  4OF1 A;  3DB4 A;  4M77 D;  4M78 D;  3I56 T;  3BY7 A;  3OYI A;  2I2L A;  2RK2 A;  1MHN A;  2G3R A;  4C92 E;  5KH6 A;  1NPP A;  3QYG B;  2YLC A;  4EMK A;  3E9G A;  5GAN h;  5D6Y A;  3ASK A;  3GF5 A;  2DTI A;  5HKC A;  5LJ3 e;  3VV0 A;  3LLR A;  2FL7 A;  2LVM A;  1JRI A;  5LJ5 g;  2R58 A;  3SB2 A;  3P8B B;  2PVG B;  4JS5 A;  2RHX A;  2DXT A;  4M75 F;  5GAM f;  5LJ5 j;  2JZ2 A;  1JJ2 S;  3OA6 A;  1KQ1 A;  4N0A C;  2P0K A;  5GAN 4;  3L2V A;  3QBY A;  2QI2 A;  2LC4 A;  3CC4 T;  1Q81 C;  4A4F A;  4HCB A;  4EDU A;  3MEA A;  2DK3 A;  1YJ9 A;  2EJF A;  4Q5W A;  4X34 A;  5CR2 A;  2KY9 A;  4M7A D;  3FRN A;  4XAX B;  3J7A F;  1YIT T;  2LCC A;  4F7U G;  2FVU A;  2QQS A;  3JB9 J;  3CCU A;  1XQH A;  3X25 B;  2JN0 A;  4RKU E;  3HRT A;  3GNF B;  4V2S A;  5FU6 C;  1S72 T;  2E70 A;  4EPC A;  3JCM P;  2JNG A;  1Q82 C;  3RKW A;  2C06 A;  4UC4 A;  2LRQ A;  2RI2 A;  3NTK A;  4FU6 A;  2BUD A;  4EMK B;  4IUR A;  2VXE A;  4J7F A;  2R57 A;  2FYK A;  2ZPH B;  3SDZ A;  4PL6 A;  2Y4X A;  5LJ3 f;  3JCM h;  3WXM B;  3J81 E;  4FIB A;  4E7L A;  1VQ7 A;  4DOV A;  2EYQ A;  4FL6 A;  3JB9 D;  2RHY A;  1VQ9 A;  5KE2 A;  5GAN 5;  2PU9 B;  5DM7 R;  2OTJ T;  2DZC A;  4C0Z A;  4M7D F;  4M77 F;  4C0F A;  4M78 F;  4C0D C;  1K9M C;  1Y71 A;  1VQN A;  1K73 U;  3C4S A;  2DO3 A;  4PLI A;  1W2B A;  3OS5 A;  3A8G B;  2DVE A;  2LT1 A;  4C5E A;  2DD5 A;  1WJS A;  3LWI A;  4J6X A;  2DZ9 A;  3V7R A;  3SD4 A;  5GAO l;  1BIB A;  2E65 A;  2EWN A;  1UEB A;  2VGN A;  3HFN A;  3SWN C;  3QDR B;  4KBM B;  5J26 A;  5FRO A;  5GAN 3;  3QPH A;  2XIC A;  3OS0 A;  4M75 C;  3VJP A;  5CQY A;  2QEX T;  3PGG A;  4BI4 A;  3M59 A;  4JLG A;  2E6N A;  3JCM Q;  1YJ9 T;  2L8D A;  4OB0 B;  1UB4 A;  1BKB A;  4PJO G;  3OQ5 A;  3MCA B;  4RG2 A;  2RI5 A;  3RIR A;  3X26 B;  3MO8 A;  1YHQ A;  3PIO A;  5IN1 A;  3GPL A;  1H3Z A;  2RH2 A;  1KHC A;  1IZ6 A;  2YRV A;  3HRU A;  2K4Y A;  3QG1 A;  4CRI A;  4LDV A;  3CCS A;  1QVG S;  2DD4 A;  2MWP A;  4E7H A;  4JRP A;  3CEY A;  4ELZ C;  2YHT A;  2DJZ A;  1BIA A;  4IUV A;  5GMK m;  2ZPF B;  2L3R A;  2RB6 A;  3G6E A;  5GAM g;  2LTO A;  3R6O A;  3CPW A;  1Q7Y C;  4IUT A;  3RES A;  4C8Q D;  4OB2 B;  5GAM j;  3HPW A;  3CC2 T;  3A8O B;  2BIV A;  1WQW A;  4QQD A;  4MZP A;  3NFC A;  3MP6 A;  1VQ9 T;  5CO7 A;  4M7D D;  4ZN3 A;  1BI1 A;  5GAN e;  2MAM A;  3JB9 F;  1N27 A;  3BDU A;  2DXC A;  3OBY A;  1VQN T;  4J83 A;  2HQX A;  1BI0 A;  4M77 C;  4IUP A;  4M78 C;  3L2Z A;  1K8A C;  4A4H A;  3CCL A;  1OYX A;  3JAM E;  2KAF A;  2Y90 A;  1VIE A;  2E5Q A;  1TH7 A;  4N4I A;  4LDU A;  5L8R E;  1QVF A;  3C94 A;  2F5K A;  4EMH A;  4VUB A;  1ZBX A;  3HL8 A;  1NZ9 A;  5CKB A;  4F7U A;  2ZPB B;  2F5T X;  5LJ3 g;  4XU2 A;  1YJW A;  2DKG A;  4BDZ A;  3GIB A;  2K2V A;  5LJ3 j;  3L2R A;  2DEQ A;  1LJO A;  1YHQ T;  5FU7 B;  1KQS A;  3UWN A;  1UGQ B;  2HQE A;  3KXT A;  1KD1 C;  3MEU A;  4PKC C;  4M77 G;  1VQ8 T;  3CCS T;  3OW2 S;  2OTL T;  2DXU A;  3C12 A;  1G3W A;  4KUI A;  5C0M A;  4M7A C;  3C95 A;  1U8R A;  5GMK h;  1N9R A;  4HA8 A;  4XTW A;  1VQ4 T;  5EG2 A;  2HD0 A;  3LWH A;  1JJ2 A;  5GAN f;  3H8Z A;  5FLX E;  3NTH A;  2KDS A;  2BKD N;  3OB9 A;  3JCM e;  2XU8 A;  2XDD A;  1VQ5 A;  1VQL A;  5GAM d;  2LDM A;  1LOJ A;  2RI3 A;  2P0Q A;  2RHI A;  3L42 A;  1N8R U;  2K5L A;  3ME9 A;  4BE2 A;  4C8Q F;  3OYH A;  2CZ1 B;  3PIP A;  1VQK A;  1WGS A;  3ER0 A;  1SSF A;  1WNL A;  2X4W A;  3T9N A;  2CZ7 B;  2VV5 A;  1VUB A;  1W4S A;  2RO0 A;  3M57 A;  3QJY A;  3L1A A;  4XK8 E;  3WVE B;  4F7U B;  4PNO A;  3OYD A;  3FC3 A;  2QA4 A;  1Q81 U;  3F70 A;  1M1K C;  4M7A G;  2CKK A;  4J6Y A;  4A4G A;  2JUF A;  1AHJ B;  1KHI A;  3CCQ A;  2GFA A;  5I21 A;  2M1H A;  2HNI A;  3INZ A;  4ZGE B;  4PJO A;  3OSV A;  2K57 A;  2L89 A;  3SFM A;  4BY6 B;  5KCH A;  5CKF A;  3PT9 A;  2V8K A;  2QTX A;  3EAE A;  2DIG A;  4KUD K;  2R5A A;  3OYM A;  4C5I A;  5LJ3 d;  2LQK A;  3A5Z B;  4LDY A;  2QDY B;  3FB9 A;  5C6S A;  4A53 A;  3LW5 E;  3CCV A;  1FXX A;  5FRN A;  3SWN A;  3GOX A;  3VYH B;  2ZPG B;  2MWO A;  3JCM f;  3JB9 G;  1R8O B;  2QQ9 A;  3PFS A;  3JCM c;  4MZM A;  4F7U E;  3P8H A;  4R55 A;  1YI2 T;  3QZ9 B;  1QVP A;  2CS7 A;  3QXE B;  1VQ6 A;  4GLK A;  5FU6 B;  2XK0 A;  2P4T A;  2DTH A;  3DKM A;  2LQ8 A;  2M0O A;  2MF2 A;  1Y07 A;  3HRS A;  3M5A A;  1YBY A;  2AHJ B;  2EIF A;  5CIU A;  4C92 D;  5GAO m;  3L2W A;  5A0D A;  4PLL A;  1YIJ T;  4XTX A;  3A8M B;  1VQ5 T;  1VQ8 A;  3CD6 A;  1Y96 A;  2RHU A;  5CK9 A;  5LL6 S;  3BDL A;  4QVD A;  5HK3 A;  1QP2 A;  1KC8 U;  1VQK T;  4NL2 A;  2ZCF B;  2EFI A;  3CC7 A;  1Q86 C;  2JTF A;  2XDB A;  4PJO B;  4MDW A;  4C8Q C;  3JCM b;  3S6W A;  1RI0 A;  3MET A;  1OZ2 A;  1LNX A;  2RJC A;  3QO3 A;  4ME7 A;  3V7C A;  3FEO A;  4E7K A;  3S3N A;  2QA4 T;  3Q1J A;  3X28 B;  3CCM A;  3HSB A;  4HT9 A;  3VYG A;  4J8O A;  5CKH A;  1M90 C;  4M7D C;  5DY9 A;  3URG A;  1M1G A;  5LJ5 d;  1D3B A;  3SWN B;  5GAN g;  3N5B B;  4L5G A;  4XU3 A;  3G71 A;  3JB9 H;  4JJN K;  4OB3 B;  3QYH B;  3JSC A;  1V29 B;  2XDP A;  5HK0 A;  1O9S A;  5GAO r;  5GAO p;  5GAN j;  3LGL A;  3M4Y A;  4C8Q G;  1GXI E;  4PJO E;  3CMA A;  2XI9 A;  3TCJ A;  2GCX A;  3CBP A;  3OYF A;  3CCU T;  4NS5 A;  1Q7Y U;  1Y96 B;  4XTV A;  3TU4 K;  1VQ6 T;  4M7D G;  5GMK e;  3OYL A;  1W2B S;  2R5M A;  4J7I A;  5J39 A;  1YJN A;  3RMS A;  4A4K A;  2E1H A;  4KT0 E;  4M75 G;  3TEE A;  4ZGD B;  3FIF A;  2KK4 A;  2E64 A;  4DQ2 A;  2LNV A;  3E19 A;  4MMK A;  4N4G A;  3PNW C;  1VQ7 T;  3CD6 T;  2OAU A;  4BD3 A;  4QVZ A;  3OYE A;  1U1S A;  4C92 F;  2DPP B;  4P5N A;  5HY6 A;  1DJ7 B;  2WSE E;  4RCB A;  1K8A U;  4M7A A;  4WF2 A;  3A8H B;  4JDS A;  1VQM A;  5AYF A;  1D3B B;  5GAN 7;  3CCE A;  3NTI A;  3MHX A;  4B9X A;  3DLM A;  3FLG A;  1JBM A;  3JCM g;  1M1F A;  2XKO C;  3CCR A;  2XG8 D;  3X24 B;  2EKO A;  2D6F A;  1QW1 A;  3KUF A;  1MGQ A;  4BUG A;  3P8D A;  1VQP A;  5IAY A;  2JTM A;  3RMQ A;  3OYG A;  3OYK A;  3CCJ A;  2KVQ G;  2MI6 A;  4FT2 A;  4PJO D;  4JRQ A;  3CXC A;  2XID A;  2EQK A;  2K3X A;  1YCY A;  2RJF A;  4HCZ A;  2QQB A;  2EJ9 A;  4OGC A;  3CME A;  1I8F A;  2E41 A;  3I56 A;  5LJ5 h;  3CPW S;  1HXD A;  4A54 A;  1PSE A;  2NLU A;  5KE3 A;  2PQW A;  3CMA T;  4ATO A;  5A0L A;  3TRE A;  1OZ3 A;  4N0A A;  4Y28 E;  5M9O A;  1HK9 A;  4M78 G;  2GQV A;  3QZ5 B;  1M5Q 1;  1ZQ1 A;  1XTD A;  5I2M A;  2ZPI B;  2DTO A;  4QQG A;  2PVO B;  3X20 B;  3OMG A;  4M7A B;  4ELY C;  3VU3 C;  4KUL A;  3JB9 I;  1YJN T;  5GMK l;  1O75 A;  1VQO A;  3ZFJ A;  3ZBD A;  3JCM J;  1Y7X A;  2DXB A;  3G6E T;  2KQW A;  3CC4 A;  3JCM X;  3I55 A;  5CQX A;  1QVF S;  3RUX A;  3V7S A;  2QQR A;  3MP1 A;  3V8J A;  2LT4 A;  1M1K U;  4BE0 A;  2DIQ A;  4JRK A;  4C92 C;  2ZPE B;  3L2U A;  1I81 A;  3UT1 A;  4LD9 K;  4O6J A;  3OMC A;  1YIT A;  5I2S A;  3CCE T;  2LCL A;  5KCO A;  3LYI A;  4BDY A;  5DLQ E;  2RA2 A;  1X6O A;  5GAO q;  1NJI U;  1KQS S;  4BI3 A;  3CCL T;  3MEW A;  3JCM d;  1P92 A;  4E47 A;  3FJP A;  3V8L A;  1IRE B;  2FB7 A;  3LX7 A;  2L5Q A;  3M9Q A;  5A0G A;  2EQJ A;  2WAC A;  3HFO A;  4M7A E;  4B9W A;  3EFS A;  3M58 A;  3GP8 A;  4C8Q A;  4E7J A;  1G3S A;  4DOW A;  4ZN1 A;  2RD1 A;  1RL2 A;  2B8A A;  2RHZ A;  1YJW T;  2VGM A;  4PJO F;  3CME T;  4C92 G;  2V8I A;  4M7D A;  2MMP A;  5CCA A;  2X4Y A;  2ZZD A;  4X9D A;  2OTJ A;  5GAO n;  1Q82 U;  2E6Z A;  4BAC A;  3KBG A;  2DAQ A;  4M75 A;  4OB1 B;  2A7Y A;  2ZGW A;  3MEV A;  4MZT A;  4XTZ A;  5CKE A;  4C5H A;  4C5G A;  1N8R C;  4HT8 A;  2EQM A;  4OVA A;  1X01 A;  3ZEH A;  1BYM A;  3RER A;  1BI3 A;  3JRZ A;  1VQP T;  3M56 A;  2CZ0 B;  1VQO T;  5GAN 2;  3PMI A;  4GY5 A;  4BE1 A;  1NJI C;  4OP0 A;  3VUZ A;  3QSU A;  3OS2 A;  4BY6 C;  4J6W A;  1Q86 U;  1VQL T;  3OYA A;  1NPR A;  1XOV A;  3I55 T;  2QEX A;  1K9M U;  1B34 A;  4A4E A;  2VYT A;  4JLI A;  3M54 A;  2O01 E;  2V8J A;  1WQ7 A;  4LDX A;  4RMO A;  1M90 U;  2XD0 A;  1M9S A;  5GMK j;  1UGR B;  2EJG A;  1M8V A;  2X4J A;  4C8Q B;  5GAM h;  4C0D B;  3UDC A;  4HCC A;  4M7A F;  2WSC E;  5GAN 8;  3OYC A;  1BI2 A;  2EAY A;  2RK1 A;  3OYJ A;  2RM4 A;  3PMT A;  2D9T A;  3CBM A;  3O8V A;  4FSX A;  3OYB A;  4MML A;  2A3L A;  4M7D B;  2X35 A;  1G5V A;  4L59 A;  2LX9 A;  3CCQ T;  4E7I A;  3OYN A;  2HBP A;  2GF7 A;  4EMK C;  2RJE A;  3OS1 A;  1QP3 A;  3HHT B;  4M75 B;  3DB3 A;  3VKI A;  4QVC A;  3G4S A;  2IVW A;  2JOY A;  4JUV A;  4M77 A;  3CC2 A;  4M78 A;  3HP9 A;  5LJ5 e;  4C0G A;  1WJR A;  4FM4 B;  4D6W A;  1KQ2 A;  1N6A A;  2QXF A;  3CCV T;  1UGS B;  1VIF A;  3S3O A;  4OMF B;  1QVG A;  4PJO C;  2PUK B;  1WPY A;  2WSF E;  4C8Q E;  4EMG A;  1UGP B;  4XU1 A;  4CI0 C;  2E10 A;  3UPU A;  4DA4 A;  2HAX A;  2VC8 A;  3OY9 A;  3J80 E;  1B34 B;  3GNG A;  5LJ3 h;  3L2Q A;  4RCC A;  3QKJ A;  1KC8 C;  3M55 A;  2P0P A;  2FHD A;  3M53 A;  4IKF A;  4M7D E;  4BB7 A;  1NE8 A;  1XNI A;  1K73 C;  2X4X A;  4XTY A;  4M75 E;  4NOY A;  3FDR A;  3WVD B;  3VUB A;  1I5L A;  4JRI A;  2CYZ B;  3OBW A;  2XHC A;  3CC7 T;  4BI8 B;  3BFM A;  3QII A;  1OI1 A;  3EFR A;  4QW2 A;  2K3Y A;  4LD6 A;  2EQU A;  4M77 B;  4M78 B;  5CVI A;  3E1S A;  3V8K A;  5LJ5 f;  3CCM T;  4ZTF A;  1JB0 E;  4IUQ A;  2OTL A;  1M4Z A;  2PUO B;  2VXF A;  2KMT A;  2D0Q B;  1VQ4 A;  2E12 A;  3GLX A;  4C92 A;  4NL3 A;  1EIF A;  5GAN 6;  3QUI A;  4J5Y A;  4N4H A;  5D6W A;  3G4S T;  3G71 T;  1PSF A;  4X9C A;  1KD1 U;  1H64 1;  1N9S A;  2IG0 A;  5GAN d;  2VUB A;  1FWZ A;  1WJQ A;  3RKX A;  5IT9 E;  3HKS A;  4IUU A;  1G3Y A;  3CBO A;  2O4X A;  2QQA A;  4F7U F;  3OW2 A;  5GMK i;  4ZGJ B;  3OSS C;  2M16 A;  4TVR A;  4XQ3 A;  2F69 A;  3JCM V;  5A2Q E;  1FX7 A;  4M75 D;  1X75 C;  4M77 E;  5J3B A;  4M78 E;  4L6V 5;  4ZTJ A;  4RG8 A;  5FRM A;  3OYY A;  4LDW A;  2KSS A;  3LGF A;  2RJD A;  4QQ6 A;  4Z02 A;  2CGH A;  3JCM W;  4O5V A;  4II1 A;  3G7Z A;  4Y91 A;  1I4K 1;  3PTA A;  2PVD B;  3BW1 A;  3CPF A;  3M4G A;  2K5F A;  3H6Z A;  3RKY A;  3CXC S;  4JS4 A;  1KG1 A;  2M9U A;  4XTU A;  5CAI A;  5DLO A;  4C92 B;  1VQM T;  2K5I A;  5FU7 C;  4XU0 A;  5GAM e;  3MP8 A;  3CCR T;  2YLB A;  1YI2 A;  4MDX A;  2H3J A;  3A8L B;  4YTL A;  4OGE A;  1ZHI A;  4R56 A;  1S72 A;  3DLL A;  2JVV A;  2O4X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...