2XD7A

Crystal structure of the macro domain of human core histone h2a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
GPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Macro Domain of Human Core Histone H2A
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords CORE HISTONE MACRO-H2A.2
total genus 63
structure length 192
sequence length 192
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2xd7A00
4ZY0A 5FSYA 3T8WA 4D86A 3EWOA 3GPOA 3GQEA 2XD7A 5CB3A 4IQYA 3EJGA 3H8FA 3SIHA 1ZR3A 1NJRA 5FSVA 4ZI6A 1BLLE 5HIHA 4GVWA 4R6TA 1LAPA 1HJZA 5DUSA 1TY8A 3Q6ZA 4J4ZA 4J5RA 3IIFA 2AFCA 1BPNA 4R76A 2L8RA 4ZY1A 1TXZA 3JZTA 4J5QA 4UMLA 5FSZA 4TU0A 5FSUA 3KR4A 5CB5A 3EKEA 1YD9A 2VRIA 2EEEA 2BFQA 4R7MA 5D8NA 4JCAA 2ACFA 3KR5A 2BFRA 3EWQA 2LGRA 1LANA 3V45A 3GPQA 4ETKA 3EWPA 3KZWA 3IJ3A 2FAVA 5CMSA 3V2BA 3SIGA 3KQXA 2EWBA 1VHUA 4JGKA 5E3BA 4K0CA 3GPGA 4ZX8A 4ZY2A 2FXKA 4JLLA 4ZX9A 3SIIA 2X47A 4J5SA 5HOLA 3Q71A 1ZR5A 1BPMA 1LAMA 4ZYQA 5FSXA 3SIJA 4GVVA 4KYBA 3H8EA 3IIDA 2DX6A 3H8GA 4X2TA 3JRUA 3EJFA 4JVVA 2FG1A 5AILA 5CBMA 1SPVA 2J9AA 3EWRA 3KQZA 3PEIA 4KSIA 4K3NA 3ETIA 1GYTA 4ABKA 4ETJA 4ESSA 4ABLA 1LCPA 3GQOA 3EW5A 3VFQA 4GUAA
chains in the Genus database with same CATH superfamily
4ZY0A 5FSYA 3T8WA 4D86A 3EWOA 3GPOA 3GQEA 2XD7A 5CB3A 4IQYA 3EJGA 3H8FA 3SIHA 1ZR3A 1NJRA 5FSVA 4ZI6A 1BLLE 5HIHA 4GVWA 4R6TA 1LAPA 1HJZA 5DUSA 1TY8A 3Q6ZA 4J4ZA 4J5RA 3IIFA 2AFCA 1BPNA 4R76A 2L8RA 4ZY1A 1TXZA 3JZTA 4J5QA 2KQVA 4UMLA 2RNKA 5FSZA 4TU0A 5FSUA 3KR4A 5CB5A 3EKEA 1YD9A 2VRIA 2WCTA 2EEEA 2BFQA 4R7MA 5D8NA 4JCAA 2ACFA 3KR5A 2BFRA 3EWQA 2JZDA 2LGRA 1LANA 3V45A 2W2GA 3GPQA 4ETKA 3EWPA 3KZWA 3IJ3A 2FAVA 5CMSA 3V2BA 3SIGA 3KQXA 2EWBA 1VHUA 2JZEA 4JGKA 5E3BA 4K0CA 3GPGA 4ZX8A 4ZY2A 2FXKA 4JLLA 4ZX9A 3SIIA 2X47A 4J5SA 5HOLA 3Q71A 1ZR5A 1BPMA 1LAMA 4ZYQA 5FSXA 3SIJA 4GVVA 4KYBA 3H8EA 3IIDA 2DX6A 3H8GA 4X2TA 3JRUA 3EJFA 2JZFA 4JVVA 2FG1A 5AILA 5CBMA 1SPVA 2J9AA 3EWRA 3KQZA 3PEIA 4KSIA 4K3NA 3ETIA 1GYTA 4ABKA 4ETJA 4ESSA 4ABLA 1LCPA 3GQOA 3EW5A 3VFQA 4GUAA
chains in the Genus database with same CATH topology
4ZY0A 5FSYA 3T8WA 4D86A 3EWOA 3GPOA 3GQEA 2XD7A 5CB3A 4IQYA 3EJGA 3H8FA 3SIHA 1ZR3A 1NJRA 5FSVA 4ZI6A 1BLLE 5HIHA 4GVWA 4R6TA 1LAPA 1HJZA 5DUSA 1TY8A 3Q6ZA 4J4ZA 4J5RA 3IIFA 2AFCA 1BPNA 4R76A 2L8RA 4ZY1A 1TXZA 3JZTA 4J5QA 4UMLA 5FSZA 4TU0A 5FSUA 3KR4A 5CB5A 3EKEA 1YD9A 2VRIA 2EEEA 2BFQA 4R7MA 5D8NA 4JCAA 2ACFA 3KR5A 2BFRA 3EWQA 2LGRA 1LANA 3V45A 3GPQA 4ETKA 3EWPA 3KZWA 3IJ3A 2FAVA 5CMSA 3V2BA 3SIGA 3KQXA 2EWBA 1VHUA 4JGKA 5E3BA 4K0CA 3GPGA 4ZX8A 4ZY2A 2FXKA 4JLLA 4ZX9A 3SIIA 2X47A 4J5SA 5HOLA 3Q71A 1ZR5A 1BPMA 1LAMA 4ZYQA 5FSXA 3SIJA 4GVVA 4KYBA 3H8EA 3IIDA 2DX6A 3H8GA 4X2TA 3JRUA 3EJFA 4JVVA 2FG1A 5AILA 5CBMA 1SPVA 2J9AA 3EWRA 3KQZA 3PEIA 4KSIA 4K3NA 3ETIA 1GYTA 4ABKA 4ETJA 4ESSA 4ABLA 1LCPA 3GQOA 3EW5A 3VFQA 4GUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZY0 A;  5FSY A;  3T8W A;  4D86 A;  3EWO A;  3GPO A;  3GQE A;  2XD7 A;  5CB3 A;  4IQY A;  3EJG A;  3H8F A;  3SIH A;  1ZR3 A;  1NJR A;  5FSV A;  4ZI6 A;  1BLL E;  5HIH A;  4GVW A;  4R6T A;  1LAP A;  1HJZ A;  5DUS A;  1TY8 A;  3Q6Z A;  4J4Z A;  4J5R A;  3IIF A;  2AFC A;  1BPN A;  4R76 A;  2L8R A;  4ZY1 A;  1TXZ A;  3JZT A;  4J5Q A;  4UML A;  5FSZ A;  4TU0 A;  5FSU A;  3KR4 A;  5CB5 A;  3EKE A;  1YD9 A;  2VRI A;  2EEE A;  2BFQ A;  4R7M A;  5D8N A;  4JCA A;  2ACF A;  3KR5 A;  2BFR A;  3EWQ A;  2LGR A;  1LAN A;  3V45 A;  3GPQ A;  4ETK A;  3EWP A;  3KZW A;  3IJ3 A;  2FAV A;  5CMS A;  3V2B A;  3SIG A;  3KQX A;  2EWB A;  1VHU A;  4JGK A;  5E3B A;  4K0C A;  3GPG A;  4ZX8 A;  4ZY2 A;  2FXK A;  4JLL A;  4ZX9 A;  3SII A;  2X47 A;  4J5S A;  5HOL A;  3Q71 A;  1ZR5 A;  1BPM A;  1LAM A;  4ZYQ A;  5FSX A;  3SIJ A;  4GVV A;  4KYB A;  3H8E A;  3IID A;  2DX6 A;  3H8G A;  4X2T A;  3JRU A;  3EJF A;  4JVV A;  2FG1 A;  5AIL A;  5CBM A;  1SPV A;  2J9A A;  3EWR A;  3KQZ A;  3PEI A;  4KSI A;  4K3N A;  3ETI A;  1GYT A;  4ABK A;  4ETJ A;  4ESS A;  4ABL A;  1LCP A;  3GQO A;  3EW5 A;  3VFQ A;  4GUA A; 
#chains in the Genus database with same CATH topology
 4ZY0 A;  5FSY A;  3T8W A;  4D86 A;  3EWO A;  3GPO A;  3GQE A;  2XD7 A;  5CB3 A;  4IQY A;  3EJG A;  3H8F A;  3SIH A;  1ZR3 A;  1NJR A;  5FSV A;  4ZI6 A;  1BLL E;  5HIH A;  4GVW A;  4R6T A;  1LAP A;  1HJZ A;  5DUS A;  1TY8 A;  3Q6Z A;  4J4Z A;  4J5R A;  3IIF A;  2AFC A;  1BPN A;  4R76 A;  2L8R A;  4ZY1 A;  1TXZ A;  3JZT A;  4J5Q A;  2KQV A;  4UML A;  2RNK A;  5FSZ A;  4TU0 A;  5FSU A;  3KR4 A;  5CB5 A;  3EKE A;  1YD9 A;  2VRI A;  2WCT A;  2EEE A;  2BFQ A;  4R7M A;  5D8N A;  4JCA A;  2ACF A;  3KR5 A;  2BFR A;  3EWQ A;  2JZD A;  2LGR A;  1LAN A;  3V45 A;  2W2G A;  3GPQ A;  4ETK A;  3EWP A;  3KZW A;  3IJ3 A;  2FAV A;  5CMS A;  3V2B A;  3SIG A;  3KQX A;  2EWB A;  1VHU A;  2JZE A;  4JGK A;  5E3B A;  4K0C A;  3GPG A;  4ZX8 A;  4ZY2 A;  2FXK A;  4JLL A;  4ZX9 A;  3SII A;  2X47 A;  4J5S A;  5HOL A;  3Q71 A;  1ZR5 A;  1BPM A;  1LAM A;  4ZYQ A;  5FSX A;  3SIJ A;  4GVV A;  4KYB A;  3H8E A;  3IID A;  2DX6 A;  3H8G A;  4X2T A;  3JRU A;  3EJF A;  2JZF A;  4JVV A;  2FG1 A;  5AIL A;  5CBM A;  1SPV A;  2J9A A;  3EWR A;  3KQZ A;  3PEI A;  4KSI A;  4K3N A;  3ETI A;  1GYT A;  4ABK A;  4ETJ A;  4ESS A;  4ABL A;  1LCP A;  3GQO A;  3EW5 A;  3VFQ A;  4GUA A; 
#chains in the Genus database with same CATH homology
 4ZY0 A;  5FSY A;  3T8W A;  4D86 A;  3EWO A;  3GPO A;  3GQE A;  2XD7 A;  5CB3 A;  4IQY A;  3EJG A;  3H8F A;  3SIH A;  1ZR3 A;  1NJR A;  5FSV A;  4ZI6 A;  1BLL E;  5HIH A;  4GVW A;  4R6T A;  1LAP A;  1HJZ A;  5DUS A;  1TY8 A;  3Q6Z A;  4J4Z A;  4J5R A;  3IIF A;  2AFC A;  1BPN A;  4R76 A;  2L8R A;  4ZY1 A;  1TXZ A;  3JZT A;  4J5Q A;  4UML A;  5FSZ A;  4TU0 A;  5FSU A;  3KR4 A;  5CB5 A;  3EKE A;  1YD9 A;  2VRI A;  2EEE A;  2BFQ A;  4R7M A;  5D8N A;  4JCA A;  2ACF A;  3KR5 A;  2BFR A;  3EWQ A;  2LGR A;  1LAN A;  3V45 A;  3GPQ A;  4ETK A;  3EWP A;  3KZW A;  3IJ3 A;  2FAV A;  5CMS A;  3V2B A;  3SIG A;  3KQX A;  2EWB A;  1VHU A;  4JGK A;  5E3B A;  4K0C A;  3GPG A;  4ZX8 A;  4ZY2 A;  2FXK A;  4JLL A;  4ZX9 A;  3SII A;  2X47 A;  4J5S A;  5HOL A;  3Q71 A;  1ZR5 A;  1BPM A;  1LAM A;  4ZYQ A;  5FSX A;  3SIJ A;  4GVV A;  4KYB A;  3H8E A;  3IID A;  2DX6 A;  3H8G A;  4X2T A;  3JRU A;  3EJF A;  4JVV A;  2FG1 A;  5AIL A;  5CBM A;  1SPV A;  2J9A A;  3EWR A;  3KQZ A;  3PEI A;  4KSI A;  4K3N A;  3ETI A;  1GYT A;  4ABK A;  4ETJ A;  4ESS A;  4ABL A;  1LCP A;  3GQO A;  3EW5 A;  3VFQ A;  4GUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...