2XDAA

Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-2-(2-cyclopropyl)ethyl-4,6,7- trihydroxy-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
150
structure length
150
Chain Sequence
b'MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Tetrahydrobenzothiophene derivatives: conformationally restricted inhibitors of type II dehydroquinase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 55
structure length 150
sequence length 150
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2xdaA00
2Y77A 4CIYA 1UQRA 4ZC1A 1GU1A 2C4WA 3N86A 4KIWA 4B6SA 4B6QA 1D0IA 2BT4A 2CJFA 4L8LA 4RHCA 3KIPA 1H0RA 3N59A 4CIWA 2DHQA 2WKSA 2XDAA 4KIJA 4B6PA 4CKWB 3U80A 4CKXA 4KI7A 1H05A 2UYGA 3N8KA 1H0SA 3N7AA 4CIVA 4B6RA 4B6OA 4CL0A 1J2YA 4CKYA 5WRFA 1GQOA 4KIUA 4V0SA 5B6PA 4RC9A 1GTZA 4CIXA 3N87A 2XB8A 1GU0A 2Y71A 2C57A 1V1JA 3LWZA 3N76A 3N8NA 2XB9A 4CKWA 4CKZA 2C4VA 2Y76A 2XD9A
chains in the Genus database with same CATH superfamily
2IXAA 2IGTA 4P4TA 4HNAB 1AKUA 3LW7A 3DCIA 2OO7A 4RDIA 4Q9AA 1TJ4A 1ZIDA 3EAGA 3L7LA 3DQQA 1U7OA 2ACVA 3C39A 5ALEA 1CS0A 1CG6A 3AUYA 3D6AA 3EVAA 3QLJA 1I6KA 3TTYA 1HYBA 3LUKA 4URWR 2QPAA 1T4CA 1TT5B 3KEOA 4I99A 4TKVB 1RWXA 2VYVA 3PZBA 4G5XA 4ZD6A 3D3WB 3HM9A 4HNRA 1E1QD 2QLNA 4FR2A 5CA0A 3G0CA 4YUXA 1GAJA 4EFDA 1JU9A 2I6TA 4BVFA 1UDWA 3GYGA 1P1BA 1SXJE 3BXZA 3CG0A 3LGAA 2ZRBA 3PC8C 1N36B 5KNDH 3UANA 2DR0A 5JPIA 1NR1A 1G8PA 3C5VA 5JFTA 1JA1A 3L43A 4NCJA 4M4SA 2NSHA 3IJEB 5KPDA 2EFJA 1X8JA 4J4TA 1DFGA 5CH8A 4JUCA 4M0PA 2X2PA 3A9TA 3CZ9A 1LUAA 4G3XA 4UNPA 5TY0A 4B1FA 2W2OA 3A6DA 4B7ZA 4BO2A 3OJOA 4GZMA 4L78A 1YA4A 1R88A 1XVTA 2D5AA 4PFKA 4QUKA 3CMMA 1YE8A 1M7HA 2XUHA 5EJ5A 3ELBA 2GERA 1YRQA 3K73O 3PHJA 4FEEA 4UXIA 1L8AA 4K87A 1IZ7A 3ZWMA 5IC4A 4PIMA 5EJMA 4X85A 3MINA 2NO7A 2HBYA 2G9VA 3R5KA 4HZUB 4BPRA 3G1TA 4YP7A 2F1JA 2LV8A 2ZB4A 3A25A 4YMIA 4WBNA 3NLLA 2V7QD 3ZQ4A 1TTHA 2JA1A 2WIFA 5K1ZA 3H16A 4RTSA 3QKSB 2ZSAA 1O2DA 1WXIA 3RWOA 4EI2A 1IPHA 1PU2A 1E2PA 3FPKA 1G6KA 3KWLA 1SVSA 5FI1B 3ZYZA 4DNPA 1YOVB 2VRBA 5AKEA 2G4CA 3UH0A 4PX2A 3U4MA 2F2TA 2O05A 3RC9A 1J33A 2DQ4A 2NXEA 4O4JB 3R74A 1RE0A 1XTBA 3WYDA 1LRKA 2OHVA 2CVOA 4A16A 5CA1A 4XAQA 1O96A 2JFUA 2XNCA 4CDGA 1LV7A 1VJDA 4XIFA 4Q3OA 3U5ZB 1Z16A 3BREA 3NTRA 4LX8A 2TYSB 1YZNA 1E3TA 3VU9B 2BMWA 2AFIA 2JGNA 4N7MA 1T3LA 3C1UA 5K3BA 4RJIA 3X1YA 2I3DA 4WA8A 1IAVA 5F73A 1ETUA 2HBQA 1BXKA 1OAOA 3JW8A 2JBWA 1TM1E 5FJIA 3LC2O 4A1FA 4FJ2A 1DJPA 1UDXA 1P5HA 3MELA 3U9SA 3ZWPA 2C3YA 3OIDA 4JA0A 3PF9A 4OY3A 3ADCA 4UEOA 1TVCA 4AO8A 1DS6A 4RM3A 3HDJA 2PT6A 5B6PA 1QR6A 5L3SB 4NMHA 3I04A 1HWYA 1W88B 3LTEA 3OC0A 4DCNA 3M33A 4JLWA 1NQUA 2UZ4A 4I3HA 1TADA 1KJ9A 2YWXA 1L7AA 3CPHA 1NWHA 4I55A 3CHYA 3TKAA 5J1TB 3M2TA 4M1OA 1P2VA 1Z6AA 3DE5X 4IZIA 5DK4A 2GZRA 2I1VB 5ALHA 2WJHA 1OFUX 4QVIA 4ZHSA 5LFAA 1T1RA 3X1KA 2ZXUA 3WDSA 3RSFA 1DEKA 4P0PB 1WXEA 2XNDA 2YMMA 2D0DA 4BQPA 4WAUA 1OPXA 1ZZGA 1NKVA 2YFHA 2RGXA 3PQEA 4IMRA 1NSYA 3ZY2A 8AT1A 1ZD5A 2PPLA 4YRNA 2C95A 4U9IS 5T5QA 3UJ9A 3AIMA 2C57A 4UNSA 1YH3A 2FE4A 4W9NC 3GCDA 5LLTA 2D0PB 2PKXA 3DUWA 1YRAA 4CCSA 4EEZA 3ETEA 4YXFA 4JIGA 1US8A 1VRWA 2G09A 4W99A 5F98A 4L0QA 1GQYA 3BFPA 5CX4A 2Q0QA 4Z6KA 2WT4A 3DEIA 4N3GA 2ZB2A 4PO8A 1DELA 4YREA 4EVQA 3DJYA 3CUTA 4NYJR 1DAKA 1K08A 1OSNA 1PHRA 4QSMA 4BQQA 5JARA 3C8DA 4YDRA 5IXYA 3HU2A 2VYCA 3A7DA 4RFSB 3L07A 4IV8A 5CPFA 3V00A 4A8TA 4QXPA 5BN5A 3F7MA 4C4XA 3TTWA 2J3LA 1CEQA 2WTEA 1RXYA 1WSBA 3K20A 4LK2A 4A4DA 2VTVA 1RI3A 5I3CA 4KGDA 3RV3A 5DF1A 1TYDE 3UPTA 1Q1QA 3FZEA 4QU9A 1W5TA 2CFIA 4LZWA 3QU9A 1CNMA 1Z08A 3PGLA 3KSZO 3K6SA 3WTBA 2H16A 3P2EA 4UVIA 1FSPA 3L82B 1QTRA 2XUFA 4WBNF 2I80A 3ZHCA 5E7MA 2I3AA 4IJKA 2E21A 2QPOA 3E0XA 1T2EA 1P61B 2QTMA 2R6ZA 2XMBA 4K2AA 4JY7A 4AX4A 1DJMA 3RNLA 2C7BA 3UICA 1E1RD 1UC8A 1X0VA 1IOZA 1BE1A 1H05A 1H94A 4K1LA 3ZW9A 4IHQA 1EVKA 1MQAA 1WHTB 2C9BA 1QYVA 2GBLC 2NAFA 5CA1F 2H1VA 2BGNA 1P7PA 4U2KA 1OW3B 2X86A 3IEPA 3PL5A 2X42A 1G1MA 1EHCA 4WX2B 2VK1A 3GQVA 2V74B 3OJEA 5G0UA 2ODWA 1JHAA 1PTJC 3BRCA 2JKZA 1CRZA 5B2ZA 2O2GA 5HKKA 3SNKA 5D1HA 4GXNA 5A5FA 4IEEA 3K4QA 1JNXX 2JHPA 2NV2B 1KYZA 2J9RA 3B1ZA 3K7EA 5BN3A 3ZTYA 3CUYA 1Y4AE 5K0SA 1KC3A 4GSKA 4PCUA 2OQVA 2A5DA 3H2GA 4D9EA 4NS1A 5H9VA 1DBSA 1EFRD 1JXAA 1GPYA 1QV7A 3OUUA 4J16C 3TSAA 3DZDA 1UXJA 4EKGA 2F67A 2GX6A 1AK1A 3L93A 4MV4A 3CT4A 3OTIA 3V34A 2FDRA 2X15A 4KKVA 2H1OA 4YAWA 3TM5A 3R3ZA 5CDFA 3C8HA 3A28A 1MJNA 10MHA 4YGYA 3SZMA 4L76A 2V5UA 2WDZA 2YHSA 3T9EA 1NTRA 1LVUA 1XAHA 2GA8A 2O8NA 5DTRA 5MN6A 5JCJA 4D99A 1XXLA 1L3BA 1L8LA 5KTRA 2O59A 2JEOA 3HB1A 2C5SA 3A1FA 3FETA 2NQTA 4R8SA 3QJYA 3BZUA 2LUOA 1VYTA 2FCRA 1KJWA 3IH5A 1KDYA 1ZHHA 2GBGA 1PZXA 1T9DA 3X1DA 3UMMA 3PYLA 2VHVA 1I4DD 1TJPB 2GAJA 1MQ8B 3PJFA 2AJCA 3BB3A 3NAGA 2C5GA 3DEAA 5TMBA 5SZIA 4EPVA 2X0RA 3CR7A 4B74A 5HZGA 3ZHVA 3FYUC 5B7PA 3M1IA 4B2PA 4Q15A 1NLUA 2JJ1A 2PT9A 2ZPAA 1I3CA 3EQ6A 1XZFA 5A03A 1T3TA 4V0NA 3HXPA 4J7UA 5C81A 2RKOA 3SJUA 3VOSA 1C8BA 2RHHA 5F5NA 4XJXA 1HO3A 1MC1A 3S28A 2C4VA 1NDHA 1GZDA 2VTKA 1V26A 3N0TA 3OETA 3G3EA 3KB2A 1H2WA 2QX9A 5KZMB 3OQNA 4ZYLA 1MORA 1UZNA 4MH0R 2Z6AA 1JTVA 1K5HA 3CZPA 3GBPA 1Y8AA 2J87A 3KTAA 1E62A 4F0JA 2WPNA 2ID7A 3IOCA 1JHZA 1GD1O 3EOBI 3WO1A 4K9PA 3DHVA 3GVXA 4MQUA 1UK9A 4B6JA 5I7HA 1ZC3A 4TV8B 4DSAA 5EXSA 4W5NA 3WAKA 3TB6A 2PWZA 4JI8B 3UA4A 2JANA 1VCIA 4YBRA 3DC7A 3WNDA 1RXVA 2O8DA 3FYDA 1I2DA 3P9YA 3QOFA 1QYXA 3BMQA 2GM4A 2WZCA 1FMLA 1D03A 2EQAA 3NFYA 1X2EA 2HTFA 1I1QB 2NN3C 4Z4EA 4GX2A 1KNQA 4G0PA 1CWUA 1H2YA 4GOXA 5HJEA 2ZR9A 1OF1A 3G8YA 2DHRA 1YS4A 4F2PA 2AXNA 5EIBD 2BZ1A 3CX4A 1M6NA 4W1SA 4OXYA 2II6A 4JS0A 2GO1A 3NT4A 2Q4DA 3BMOA 3CNHA 4MWCA 3Q7QA 4B9AA 3AMVA 1SUCA 3JAWB 1MB4A 3BRWA 1CLUA 3EZXA 3AVQA 3FROA 4LOAA 4F2DA 3LCMA 4RZIA 3F2VA 4S1VA 2JFGA 3BJMA 4FWBA 5HE8A 3MOIA 3Q10A 4U3JB 4AMYA 1K68A 2FUCA 1P18A 1OXSC 3IILA 3QYFA 1ZA1A 5M3BA 2W2KB 1JQJC 2E3JA 1R0SA 3BWMA 5TC4A 3SFZA 3UWPA 1DHRA 3IJ5A 3KAQA 4FR0A 3H4VA 2FK8A 3F9IA 1XZGA 3DDHA 5EJEA 4KPEC 4W5HA 5CB4B 3OZWA 1JFFA 5CXXA 2GMWA 5TIIA 1ISMA 1B14A 2QKYA 1DRKA 3TPCA 5BWLA 3R77A 4ZTZB 1OC4A 4QULA 3D59A 1HFKA 2BGRA 2QL7A 3EE6A 4GO1A 5DXFA 2J5RA 5T4BA 1AN0A 2PYZA 1M2GA 5EJAA 4LNAA 2NPFA 3WJ7A 4MLZA 5THQA 4EL0A 1QE0A 3LCUA 1HBJA 4ALJA 5GGYA 1N4AA 1ONSA 4JGBA 5FUBA 2W2NA 4C3OB 2BEWB 2MYPA 1JEOA 2WTUA 4N6OA 2JJQA 3P94A 4CW7A 2HDHA 5BQ5A 2ZJBA 2ZYGA 2REQA 3NUZA 1KARA 3LUCA 3L7CA 4GPZA 1ST2A 1HFJA 3N8NA 4MW0A 3UYLA 1JSXA 4BFXA 4ZRNA 3TQTA 1FNBA 3CRVA 3NXSA 2JHCA 2ZRQA 3U9LA 4C5CA 4K0KB 3D9QX 4LQ4A 3RBXA 4ZU3A 2XT0A 3UB2A 1NIJA 4MZXA 1JZSA 2P0YA 5KJ1A 2J3DA 4MRAA 1TU4A 1UJCA 1TMYA 3AK4A 2Z57A 3C8MA 3GOHA 3SZUA 3SLRA 3ZU3A 5K0BA 1GXSB 3OH8A 3P26A 4M55A 5AKIA 1HUQA 1Q7RA 3Q6MA 4R1QA 5IC5A 1EGHA 1KJZA 2QP3A 2XRMA 3RSQA 5HTOA 1HQYE 1YONA 2ZTUA 4PCAA 5EPUA 1B6GA 4BU0A 5CLFA 1N2XA 3RWBA 2P1ZA 4WCVA 3F98A 1G21E 1H8HA 4FFVA 3FSGA 3LM8A 3WGJA 2G1KA 2PGIA 4FBLA 4ZC8A 3UCFA 1MG5A 3IQZA 3A4IA 4K05A 4OQYA 4HH3C 1PFQA 2G82A 4G36A 1TKCA 4K03A 4XASA 4Y6PA 4DLLA 4Z3OA 3L7OA 5F77A 1HNNA 3OZUA 2NYAA 2PSHA 1EUDB 5CT9A 1XNRB 2DGDA 4W5QA 1U8CB 4EYOA 4HEHA 3SF8A 1WRBA 4WY5A 3QLVC 5F2OA 1UODA 2HA3A 1CUFA 5HJ7A 3T7KA 1T4MA 5T3UA 5LJLA 4GI7A 4R5HA 3NHBA 3NVDA 4EP1A 5CAEA 4RXTA 1X7ZA 4CR6A 3HY6A 4BVKA 2OSBA 3EUAA 3CVOA 2WV7A 3X43A 1AKTA 5EXTA 4ZT7A 1XDSA 4HQLA 1U8XX 3TL2A 4J2HA 4LSZA 4ZAXA 5AJTA 4X90A 5ICMA 2IS4A 4PE5B 1QYIA 3KZKA 2GA9A 1GOTA 1F2UA 1T2CA 1M5TA 1GVHA 3NUGA 3R0XA 4MUGA 1KI6B 3OTQA 1LA2A 2JIPA 2XZTA 3D8TA 3H99A 3IV7A 4ITUA 1AB5A 1SBCA 4OI4A 5JSUA 4QODA 1F4LA 4POAA 1ZN7A 2RG7A 5A3QA 1OC2A 2OLEA 4R0MA 1E9EA 4HJRA 2X3UA 1DKMA 3MT0A 4P92A 3FWKA 1GPKA 2Q2QA 4G9BA 4CQNA 1H4SA 4M9QA 1AHIA 1UXGA 3SEQA 4FD2A 1KU0A 4OP3A 3SSMA 2R44A 1I14A 1U3DA 2AN3A 3PP8A 4ZQGA 1IULA 1R5JA 2E55A 3KOWA 4P82A 1UH5A 3VDXA 2C0QA 2WI8A 3GDGA 3SC2A 1U04A 2RB4A 4QTYA 3HXQA 5DM4A 4DE5A 1NRWA 5FORA 2P9YA 1K06A 3FPAA 4YAFA 4B31A 7YASA 1Q19A 2XT9A 3SQNA 4Y2YA 5FX2A 2DUNA 4K6KA 3QYJA 2XX3A 1R4MB 3EDCA 3RRYA 3CKYA 4PV7A 3QENA 3R41A 3ZLBA 3G85A 4ZJYA 1JLRA 1U7DA 3O4FA 3T7SA 4BP9A 2WVJA 3JZMA 3ORSA 3MUFA 1NMEA 1Y5MA 2HPVA 3O8OB 3D3NA 4WOPA 3TECE 1BVHA 4G97A 4H7KA 1H9CA 2XIJA 1U2SA 1BU8A 2FFJA 2HWXA 2QQFA 2G4VA 3WLNA 1T9GS 1UF9A 2OT3B 2X1MA 3MEQA 3N7TA 1UK6A 4XA8A 4KIUA 3KKOA 5F1KA 1FFDA 3E15A 1BRMA 3RIGA 5IWCA 5CVUA 1NLZA 5D3KA 2V4UA 3QUSA 4XIJA 4GEKA 5TGZA 2HDOA 2XOKD 3BG5A 1SXJA 5JAOA 1F5NA 1LBTA 2IPOA 3ND7A 1JJVA 1XNGA 2K2QB 3IJRA 4R3NA 3UN1A 4DF3A 4BVHA 2OPBA 2WSYB 2A1IA 1X80B 2CJYA 1JUDA 2HLHA 2A0WA 2WE7A 4JITA 1W4AA 1E61A 3HMKA 5H3LA 1ISSA 2WTXA 1XQ1A 4YWJA 3KKMA 4ZWNA 1M1YA 1W87A 4WFQA 2P9ZA 2RHTA 3UWKA 3WL5A 4B33A 1YI0A 3G9XA 1SVOA 4RE5A 1A8IA 2RI1A 5ED4A 1PWZA 3BHIA 4ZGWA 4DNXA 1CEXA 1XLTA 1Q1AA 3LKDA 3HCFA 4O4IB 3JY6A 1ZNWA 4GSYA 4YI5A 4RSHA 5BNFA 4AIIA 4F7WA 2PRZA 2QBYB 4LQDA 1U80A 3AONB 2OV3A 1P9NA 1D0SA 1WZCA 2V7GA 3DVQX 3LIIA 5JRZA 2AD5A 3TVYA 2JGRA 1A95A 3ZXUB 1QFXA 1F3LA 1GKUB 1JYEA 2WYIA 2FOXA 3G2KA 1KO4A 3KQWA 4V0QA 4DPMA 3G5TA 1EGVB 4WCFB 3RE1A 3RKUA 4BIMA 1DAOA 1XD2B 2UUCB 3PFWO 4G5FA 4JBIA 2HBZA 1H9AA 2EFCB 3TZCA 5L4LA 1F51E 3D7SA 3MCUA 1E1CB 2MSCB 2X4IA 2PX4A 3BFXA 5DPMA 1S02A 4OMDA 5CFMA 1B00A 4IUBS 1EG2A 2L42A 1RLJA 4IIYA 4NNOA 4PGFA 1J06A 3R7WB 4BX0A 3KT8A 3DXZA 4D9GA 3OPMA 3BC1A 1J0EA 4FI3F 4KGZA 2HHCA 3OZRA 4J0EA 2WFZA 3KKKA 3A6LA 2XIQA 1TFUA 4TLCA 5IAGA 2C2KA 2EX4A 2AW3A 3CFYA 2BHNA 4IKOA 5JS7A 4IUDS 1D2CA 1ADYA 1RWQA 2PXAA 2QNRA 4RF2A 2A7XA 5C8YB 3K70B 3EDQA 3R3VA 4BO7A 2YNMD 3F47A 3REOA 1K8RA 5H02A 3IS3A 1WY7A 5KNCD 4B3IA 4ZYYA 3S81A 3R0VA 2QAGC 4EFNA 2D54A 3NBAA 3NH9A 3TW4A 3W8FA 4PVDA 2JI4A 1SJ9A 3ACDA 1BDHA 1QGDA 2AN1A 2WJYA 4OV6B 3WQRA 1TAQA 2BMDA 1P74A 2NSLA 2QSJA 2ZE7A 3KB1A 5JMWA 1C7FA 2EBFX 3AESB 3ZTWA 7MHTA 1LJLA 1GUAA 1P7WA 3U3XA 9LDTA 5HOEA 1TA9A 1C3LA 1JEAA 5DSXA 4REQA 4B5LA 5HJ2A 1Q74A 2IEIA 3DLHA 4QELA 3SHWA 4CLEA 1JI3A 3USCS 1BXGA 2HK8A 2Y0DA 3O9MA 3IUYA 4FR5A 5DWDA 4HFMA 3DV9A 1PR6A 5DNEA 1E6CA 2UVPA 3MWEA 3VO8A 2HF7A 4F4JA 1RHRA 2GJKA 1B23P 2GTIA 5FYDA 3RJZA 1DPFA 3F5MA 3J81A 1GA4A 3KP1A 1YCHA 4MYHA 2ZAYA 3FE2A 3GGPA 3PG5A 4O0MA 1KI1A 3MSCA 2WSSA 4R8MA 3CURA 4FB5A 2ZIXA 1UKZA 3R9XB 1TD9A 2GN2A 3KO8A 3BJRA 1P1FA 3CNLA 1DINA 4YP1A 4EHKA 5FQNA 1DXQA 1OA0A 3QBVA 5G41A 2RB5A 4EB6A 3TZEA 2NU8A 2J9GA 3ZUPA 1PL6A 2BKXA 2D3TA 2R1UA 3KALA 1AGYA 1MJGM 4HFJA 4YLEA 1RKUA 1WW2A 2IVZA 3ABIA 4IZHA 1J2JA 3DZBA 3TF5A 5G53C 2X8LA 3F6PA 5J63A 1XPUA 5FOQA 3BRSA 3JSXA 5COBA 4X5OA 3TNFA 3C3EA 5IX8A 3II6X 1KY5A 3WGQA 1KEPA 2O7RA 4BQEA 3KVNA 1T0BA 3NANA 3UIEA 5TRTA 3ILXA 1Q1GA 5CJPA 4ZVTA 5FPQA 4Q1AA 2FY8A 5B1SA 3N2IA 1X2BA 4N40A 3E82A 3PWKA 3N05A 3ORHA 3CJRA 3VR0A 2OQIA 5KYUB 1ACJA 2DP4E 2IZOA 3KSDO 1KMHA 4B3XA 1KFKB 1M0TA 2RHMA 5HIMA 2PQ6A 4IJVA 4EUSA 5B4VA 5E3JA 2CZCA 3PFNA 4GLOA 1RWKA 3VUEA 3I28A 4HDKA 4P33A 3MTGA 3RAGA 4XDZA 5BV8A 1T6BY 1ZDMA 3GG9A 4PC2A 3W5SA 3WFJA 2P3SA 5JI3E 2E1RA 3N9IA 3T12A 4LJ6A 1REQA 1U28A 5IJ0B 3GARA 3ZI4A 3W9SA 2X2EA 4HDSB 4NPCA 4EJ6A 2V7PA 1C1DB 1BJKA 1WTAA 4NXMB 1KI4A 1U9YA 3SKVA 2ATCA 2EFGA 2ORYA 2VUSA 2AN5A 1YAJA 3TRDA 2QM3A 2LCFA 3MTQA 1QG6A 4XM2A 2EIHA 3TW8A 3ZGLA 3PQ7A 2HU5A 4O02B 5LDDC 2E48A 4UDOA 3DEYX 5KU7A 4B3JA 3SSOA 3FG9A 3QFCA 1VHQA 2ZT6A 3SZGA 4M9SA 1ORHA 3Q88A 5CP8A 3VR4H 1XLUA 3DULA 3SYTA 2W0SA 1YS6A 1R6DA 1WZUA 2BMEA 4NZ9A 1ZEMA 3KR2A 2QAIA 3CV3A 5AK5A 3QOYA 4AF6A 4GDMA 1W48A 2J7PA 4GZLA 2ZIAA 2IIVA 5KYYB 4L3OA 4BPBA 4IUCS 3VISA 1QGED 1CY8A 2HWYA 4KW7A 4LYYA 1QQAA 5A9TA 1UDBA 1Z0UA 1WABA 1LDYA 1GGKA 3AR3A 3NGMA 4LX0A 2D4HA 4G81A 3ET4A 1UAYA 1J23A 3GNQA 2JAXA 4MS1A 5CJ2A 2QYTA 5FB3A 4Q9JA 1K7YA 1TF2A 3IDZA 4HSEA 4I8IA 2XXBA 4QHTA 4F56A 1Y63A 1I0LA 1Z4IA 3A6GA 4MROA 4TLMB 1EFVA 3WK8A 1P6UA 4C0JA 1T10A 1X8LA 5FWYB 2ASVA 4CF7A 2D6FA 2I55A 4ES6A 4FJ0A 1KVSA 4FVTA 1IYZA 4QHSA 4UE6A 4NYJQ 2IOQA 1WKCA 1TPZA 3OJCA 5K2MA 4C03A 1IAQA 1UP6A 2PS0A 1U8ZA 4HYYA 1JF8A 4LN1A 3RYFB 1WMSA 3PIRA 1KVTA 1FVFA 2R6AA 1FSSA 2D2XA 3OBIA 4HF7A 4RD3A 3SX0A 3X1JA 3O73A 2PX2A 3PRJA 1KO8A 1PTKA 2BKLA 3A04A 3Q2IA 4NEQA 4GLBA 1FLAA 2H2GA 4DQKA 4TLLB 4BEWA 4UFNA 4AYTA 4P32A 3ZKWB 1OREA 1NBWB 2EYUA 6GPBA 4RAQA 4UCXA 1J8QA 4M6WB 4JVSB 3GAMA 4AJEA 4GF5A 4KBGA 2ZP1A 2ZUVA 4L4YA 3ISVA 3GFPA 2HLDD 2JZNA 4M49A 4RLQA 5CTJA 5G1PA 3FKQA 4IQ4A 1TX4B 2OUIA 3VSEA 4P58A 3S2ZA 1EG7A 2ZSHA 2ZOSA 5CFOA 2X0FA 3WBFA 4I9GA 4AKIA 1VZ2A 2QZ9A 1LKZA 3L6DA 5CLIA 1L5HA 3GD5A 3K8ZA 5BYBA 2FZKA 3X2EA 2QQ5A 2O1WA 3K2EA 1HNZB 4IP0A 3GV0A 1EFTA 3FAKA 1YU6A 3WKBA 2WZBA 2M1ZA 2QB5A 2PCLA 3FRJA 1BYIA 3RVKA 5HUHA 5JMTA 2AFHA 1RXUA 2C7VA 2CLDX 4OB7A 2B8WA 3M6MD 4FN5A 3WMEA 5IG2A 4OFXA 3U48A 3OU2A 3THWA 2NTNA 3DAFA 3EUFA 5LQJA 3GMDA 1SBQA 3LG2A 2WJ3A 1X13A 3UFBA 2FQXA 4YRZA 4TL6A 3URMA 4Y2XA 5DWVA 3HFJA 1BMFD 1PJZA 2L69A 2IW3A 1XNQB 1NYQA 3QMVA 1UKAA 2A9JA 4TVOA 3QNWA 4OBWA 5IDYA 3ZGXA 3ABQB 3GLTA 2OA0A 3I2GA 4PVCA 5M34A 3RYCB 3JQ8A 2Z9DA 4B6QA 4IVRA 5I4BA 1HEYA 2PZMA 2A1TR 2E82A 4KK3A 5D87A 4DYVA 3Q11A 1GGMA 3VVMA 3ZW7A 1NOKA 2VHZA 3OE5A 3QMPA 5EIAA 4D42A 3U7JA 1F8XA 2XNJA 4URUR 4Z0NA 5HF8A 4URHA 4AJHA 4ARZB 2CNLA 5ICEA 3FMVA 2XMZA 1T0UA 1XKTA 2BJHA 3TLBA 4BP3A 4C4RA 5C8ZA 2WOJA 2C1EA 3NCTA 1NW5A 1K6IA 3FUWA 1U81A 3LRXA 4DSZA 2Y6UA 1U4OA 2WWVD 4LE2A 2DR2A 4IS3A 1ZH6A 3D64A 1CK4A 4KQCA 1C30B 3HFGA 4ND7A 2WF7A 5J23A 2JCYA 3BSYA 1R8JA 5TR9A 1Q1NA 3P71T 3EXEB 4HAVA 3F6BX 2QN8A 4R7GA 1BA3A 2O4CA 4NZZA 4E32A 4OUDA 3HUEA 1D2HA 4ZO9A 3FPBA 3O82A 3VZCA 3JVEA 1GSOA 1QQ7A 2NAPA 1XYVA 1QIEA 1SVNA 3HS3A 3USES 2FYTA 3I3OA 4RE6A 3RTGA 1I1NA 5IHPA 4YP0A 2Q3JA 3GMSA 4AS3A 1WETA 2GJ4A 1FYVA 3T7AA 3ZGOA 2VUHB 3QXJA 1GPWB 3MXTA 4ND8B 1VPTA 3QXGA 3QX7A 2IOHA 3JQAB 3QXXA 4GMFA 1Y3AA 1ZVKA 1QGUA 1D0VA 1GLNA 1L1QA 1NC3A 3E4DA 1TO6A 3U3KA 3VH2A 1VGQA 3GVCA 4IKEA 2EBWA 2R6FA 1TJ5A 4LDZA 1QM5A 2XKAA 4LC9A 3NNNA 3OLCX 4RZQA 3NATA 4C5BA 1VL5A 3ZY5A 1FUUA 2BI8A 5J58A 2CDRA 2O06A 1VECA 3LQFA 3URKA 2I2WA 5FO1A 1SUAA 3I8OA 4ZVUA 4FUQA 2GASA 1MJ5A 1LB1B 3HSKA 1X19A 4GXQA 5IC6A 1ZWKA 1TJNA 2IYVA 4HLCA 1IOWA 5BWBA 5I47A 2HJWA 2YJ4A 3QTTA 5ENZA 5KPJA 1MOSA 5EXXA 3FVTA 1EU1A 1OBHA 4G84A 5DP2A 4CT5A 1PQYA 4Y9RA 1NOIA 2Z3VA 3JQGA 5BXYA 4EECA 5AM1A 2PKRA 3F90A 1IATA 5D85A 1RJ9B 2FPUA 4YX9A 2OXRA 2V7QA 3FFXA 1NVAA 4JHXA 1AZWA 1EZZA 2HMYB 1KSHA 3A4YA 3ENVA 3GNTA 3KEMA 2Q4TA 3L4SO 5EMMA 1AUOA 1ZVJA 2QWXA 2Y4NA 3VBCA 4F9TA 3H8JA 4ZICA 1HORA 1II8B 4YRQA 2WM8A 3CINA 3ZVMA 1U3CA 3V4RA 5FI0B 4CKXA 1Y6FA 3KPYA 2KM1A 3WKDA 5IFKA 2JZOA 1KH3A 2BDTA 1KJJA 1P29A 5LQCA 1SA0A 1E5TA 2RHBA 1MF7A 3B51X 5TF4A 2X0DA 4CN8A 2WWIA 3AEKB 5TVGA 1B43A 4J6FA 2AA3A 2UUBB 3QPWA 4FYJA 3K32A 2IYFA 1Z0FA 2QTLA 3BD6A 1JQLB 3CSDA 3UXEA 2C2OA 4X20B 1AE1A 4CQMD 1M1ZA 4P1ZA 5BMVA 1V7CA 2XCIA 2ZJ7A 5F12A 5HRCA 5KCZA 1BCSA 2YYAA 3H0KA 3Q1LA 5E1DA 5DW3A 1GARA 2E1PA 2P2NA 1Z6PA 3ZWNA 3OZCA 1JKXA 4UEKA 3Q9LA 4DMMA 1DARA 2EQBA 4U7PB 1CY7A 3KB6A 4TSFA 4ZPXA 3VPBA 1NGSA 1S89A 3HR7A 2OHXA 2ZRMA 3CEPB 2VPXA 4JVNA 1RT9A 1I33A 1UEXC 1LC3A 3TAXA 3W5VA 4GZ6A 4LOIA 4YV0A 1PGPA 3C3XA 2PKQO 3UB3A 3JWPA 4EG0A 1XXHA 2DY1A 4LVUA 1CQJB 3CQ9A 1G38A 2KYRA 2OGUA 4OHBA 2ZIUB 3ZCXA 3DE2X 2FPMA 3O8BA 1NXTA 3H97A 4KP7A 1Q91A 1TO1E 3T5BA 3D54D 5IVIA 1QHFA 5F9MA 3INYA 3HSYA 2F17A 4HS4A 1ZX1A 3E7XA 4RQBA 2Y0PA 3AHCA 4EY8A 1FYWA 5JEEA 2YH2A 4ZRMA 3GCXA 2F3PA 2JGDB 1GUYA 2ZIFA 3DOEA 1Q50A 3JQ7B 2R85A 5L45A 4KWHA 3E3AA 1UEJA 4WZZA 4NBUA 3KQLA 4R1NA 1T8TA 3SYLA 3LV8A 1XTVA 4PCVA 3I5MA 2JFHA 3DVAA 1NYTA 3HQ4O 4MK4A 1NXQA 4MPTA 2PX0A 1EA7A 4D44A 4P3XA 4BMZA 2X19A 3HGQA 1U99A 3S7TA 3V2UA 4FFSA 4JSRA 5ESDA 4AJ4A 5JXWA 1NX6A 2V96A 5KKAA 3H11B 4E5NA 3AEQA 2OHIA 1WCXA 5EP3A 1HEUA 4Z0HO 1J24A 3CM0A 3PCRB 1HOTA 1GNRA 1O8CA 1XRNA 3KZCA 3CZ5A 3NYWA 4FHDA 5SY4A 2LNDA 1QSGA 2W6IA 2CFRA 3BMNB 2BZGA 3KDSE 2OAP1 5DCWA 4KO3S 3UKJA 3GP3A 3P9XA 2I71A 3FNHA 3PR3A 3B5JA 3U7QB 1D4AA 3WSVA 4HQFA 1DKPA 5BSEA 3UW1A 3GA5A 4RD0A 1LW6E 3I1JA 3WLHA 3V1KA 1P3Y1 4MB0A 4MUFA 3C5EA 4BQNA 4JZKA 4CMJA 4P4SA 4K6GA 1IZYA 3EPHA 3L8CA 1XLTC 3LLUA 4H7FA 3EIXA 3LTNC 3ABRB 4B79A 3D8NA 2ZZMA 1KP2A 1CTQA 1SOUA 3S29A 2PX6A 4OBBA 2SNIE 4TS4A 1VYHA 2FP4A 2PX3A 1E1RA 1XRSB 5KOHB 2YJTD 3TL3A 2Y0EA 2VKTA 4HWPA 1FNMA 1XTPA 4S35A 2QXTA 1RRMA 1Z6GA 3DCYA 2A9VA 3NG1A 5KDDA 2CJFA 1THMA 4G67A 1U7TA 2E85A 4BKUA 3LHSA 2DH5A 4BNFA 2H51A 2O14A 4XX0B 2X8JB 3EY9A 4OXIA 4QFMA 4TXNA 4ESOA 1I13A 3LBFA 2B9EA 5H68A 5A62A 5BMVF 3ZNPA 4JP5A 2PN1A 4UVEA 4I6GA 1XC7A 4KE9A 1HPLA 4P4LA 4UQPA 3OZBA 4FUTA 4LXYA 3VNQA 5C9ZA 4CG0A 1W93A 4V0RA 4BDTA 3STHA 1AKMA 1EFRA 4L5BA 4LOJA 4D2IA 1JIQA 1A04A 5EHNA 4ND1A 1F14A 1N57A 1UWCA 2A33A 2FW1A 4JLAA 2FPRA 5LMNB 4R8KA 2NTYC 1GPNA 2VSXA 4FSHA 4U8HA 3O4JA 4ZHQA 3AYXB 5DGDA 2IDJA 1YV9A 1Y80A 5KINB 1NULA 4UJ5A 3NMUF 2PQMA 3PNMA 3T7CA 1NUAA 4HRXA 3EY4A 2EFDB 4B4DA 5DBIA 2QV0A 5MN4A 1N5RA 2JDIA 4KR9A 3PPYA 1W73A 2QLTA 4N6GA 3EIFA 1JLLA 3VHXB 4B6RA 4CWAA 2VQ3A 3HPQA 1NWCA 3JQDA 4G0YA 1BWQA 2DCMA 1CERA 1NJ1A 2QHXA 1G59A 2EZTA 3Q0EA 1RAAA 1TQ8A 1PJLA 2O54A 3IYLW 1MA3A 3NM6B 5IUKC 1SM4A 1V48A 2GXUA 5BVGA 1CQPA 2V8BA 3G2LA 2N9UA 3FNIA 3U4AA 4BWVA 3CUUA 4CETA 1C14A 1PWEA 4MV7A 1NASA 1GO2A 3VH3A 5JEDA 3VJRA 3RS8A 1X6VA 2FKAA 3SQDA 3OLXA 2VJLA 4XDHA 1DAIA 1EB8A 1MD9A 1O6FA 3BXOA 4RACA 5H81A 4D9HA 5HQ3B 4BNYA 1Z0IA 1ZKMA 4D82A 1LNQA 4DC1A 1GQRA 3A3NA 1O95A 5B2FA 1U7UA 3CGWA 1MJFA 5BNIA 4BB9A 1SVMA 4YCJA 5DASA 1E5DA 4UMEA 4R01A 1C4KA 2FG7C 4R9RA 2C7RA 4Z9XA 4GSLA 3EFOB 1W8IA 1I5RA 4WK2B 1XPRA 3ANSA 4X95A 4UQLA 3RRZA 4ND5A 2IYTA 5C5DA 2YFQA 3ZD7A 4RZHA 3OJ0A 5B3LA 4G1MB 2X8WA 3OCCA 4D92A 4OJNA 1A7UA 2HMSA 5FIUA 1ZNZA 4O8ZA 4PLHA 3RUEA 5DGTA 3V9AA 5H3HA 4P4NA 4HB3A 1Q0SA 1QC5B 1FFXB 1Q92A 5ECYA 1IN7A 3TOCA 1T25A 3A2LA 4OHVA 1C0LA 1HNXB 3PQCA 5DN6D 2VDWB 4PGAA 1H1TA 2YTZA 2OO5A 5F2NA 3D0OA 2OTCA 2EG5A 5ALJA 4KQ1A 3U3MA 1YKGA 4C20A 3BXFA 3UMYA 4OKSA 3BWXA 1B8NA 3ROXA 1K7SN 4BKMA 2JIMA 1EUZA 3BQNB 4JEHA 3H8SA 4AMZA 1V6AA 3JRNA 4YALA 1VDZA 4ILKA 4BAZA 621PA 1L4MA 1D4ZA 1W47A 2NSJA 4L0MA 2VDNB 4CV0A 4HX2A 4CM6A 4LWPA 3RSGA 1AKVA 4DQUA 1PK7A 1JPUA 1SCNE 2ANCA 4Q3KA 3JQPA 1K5PA 3O8DA 4F1JA 4XH9B 4PLGA 1U28C 2PYIA 1BVRA 5C34B 3HN6A 1GTRA 3UAVA 1FTSA 3A31A 1NW4A 3O47A 5BYKA 2QGFA 3RVPA 1NN3A 2F9FA 3UK1A 5JASA 3B3QA 4K9LA 3OJXA 4ZHQF 2VTBB 1PWYE 1RFGE 3KHTA 4WEOA 3IV6A 5CLLA 1FNCA 2W6JD 3VDMA 2JCBA 2KMLA 1JE0A 3IX7A 1LSSA 4NDAA 4B3TB 4MPDA 5EKDA 1VI6A 4O5AA 3ZCUA 3AF6A 4LDRA 3B7WA 2IYZA 3OSUA 1IONA 2JG3A 5GV8A 1DAMA 1SQ0A 3EXHA 3TFWA 3ZE1B 5IYZA 3FDJA 1V8DA 1GYRA 4JKOA 1ZONA 5FL7D 1A76A 2Q3DA 3AM4A 4XWTA 1JLKA 2PH3A 3BGDA 4PN3A 1X3LA 3C3MA 4FFDA 3W3AH 2ZWPA 5A06A 5IPFA 1OAKA 4EG5A 2AOXA 4DNQA 3QQPA 3UMBA 2O3QA 1XG5A 2X1LA 4JJFA 2P91A 2BFOA 3L7AA 2SICE 3MQFA 4LYGA 4X97A 1DEXA 1IQPA 2X2OA 4YJ3F 3ESZA 2HJVA 1PFGA 3K0EA 5BQPA 4V1CA 1P8JA 3CX8A 3W9BA 2WHXA 1DOZA 1TAHA 2GEBA 3EF1A 1JIXA 4KSCA 1OBFO 5BUCA 5MN5A 1Q7CA 1AV7A 3CF6R 3F7TA 5A3SA 4QREA 1PVDA 4H17A 2EWWA 2RHLA 2AH5A 4A0HA 2Z83A 1UZMA 4YPOA 5DNCA 4PQYA 4ZI2A 4WY2A 1NUTA 1JL3A 1QONA 3GEPA 4JL5A 3S0JA 2BTEA 1AQYA 1DL5A 4JBLA 3UK6A 1ZPDA 1GEGA 1WMAA 3LVFO 1EM6A 4RS4A 4CNBA 1FUYB 2DCUA 4ML3A 4DZRA 2YHIB 5E9AA 5EZYA 1FMJA 1E9RA 3AF5A 3VZBA 3NXKA 4MQFB 3NUQA 1WKBA 2I8LA 1Z7WA 3DXFA 1BQEA 1DTWA 3B12A 2ZYRA 2B36A 1T2UA 2XB8A 2XYRA 3DV0B 1PJAA 3EISA 3OD1A 3ONDA 4RTQA 1TEZA 2FWMX 1ULZA 1C1YA 5KHAA 5I9SA 4D9JA 5LUAA 4JI2B 2CLCX 1ZBQA 1FDVA 1HT1E 3B5EA 1P31A 1XK7A 2AQIA 2CXSA 2ZRDA 3CPSA 4FZ5A 1SKUA 3H1TA 4DHEA 3KUDA 2Z1MA 2DPGA 2QI9C 3EBPA 4BAGA 3FRHA 2HN9A 2ZRLA 3RS9A 5HX7A 1ISIA 1JHDA 3BEDA 2ZSFA 3NIGB 3ODGA 4HS9A 2Q0XA 4FFLA 4D0SA 1EAYA 2C7PA 3RU2A 2Z6VA 2F00A 2I4OA 1QYRA 3MAAC 4KRFA 3FNQA 3T4PA 2YIJA 1VBNA 4YUZA 3A4MA 1UJ4A 1QU3A 1SUBA 1S5PA 3QHAA 2A9QA 4BBAA 1NBMA 4RIFA 1XN1A 3HM2A 3VDNB 3WBBA 1V96A 5LLSA 5D5PA 1TFRA 4WLNA 5A4KA 1N2JA 3E3NA 2RAFA 2VTEA 3DH0A 4OSOA 1QIKA 1TM3E 1XDBA 3A0RB 1BRTA 3RODA 4B3MB 5J4HA 3SZLA 1KU6A 2CE2X 3C7TA 3IKMB 4MVJG 4EO7A 4KGXA 4M0EA 1LSOA 1YU9A 5JO9A 3FPGA 2PT5A 5LP6F 3U40A 3JRWA 4J4BA 5MGBA 2XWSA 4J3NA 3A9UA 4EGAA 4AQYB 1OLSB 1NKSA 2XZLA 5FUVA 1JRLA 1H0HA 1YQGA 2OQ2A 2PKYX 3HJFA 3LOQA 4QBGB 5JADA 3OJWA 1VLZA 5IT5A 5FBHA 4JB3A 1XCGB 1PX0A 4P9NA 5DCUA 1JIJA 3RFFA 5JHHB 2H8GA 3PC6A 4EHNA 1UMCB 4YV2A 3C7KA 2X5XA 5ARDA 4DMUB 5KMGB 1TRKA 1BXRB 1SC4A 2ZJ5A 2XE6A 3VR6D 2HIMA 1Y48E 1YZYA 1RWWA 2W22A 2I5PO 3GLKA 3DFKA 5YASA 1VRVA 1IXRC 4NCHA 1T0HB 2B6NA 1WB9A 3NIDB 1HE1C 1JJBA 2B0CA 2GAIA 5DBHX 4DGSA 1YIDA 5AD1A 5LOVB 1U1IA 3KJZA 1M2NA 4O2AA 1N5OX 3HJTA 4G25A 3ZHYA 2QZZA 2CUZA 2C7GA 1QTNA 2I76A 2BFFB 1ADBA 3FCEA 3RROA 4ER3A 1M2EA 2ILVA 3H6HA 5G2OA 1KBQA 3SD7A 1BC5A 5JLAA 4WNIA 4CLOA 3VZSA 1RNLA 3RK0A 2E6KA 1F0PA 2Y67A 3SJ7A 1TK2A 4CKWA 1BZYA 1I3LA 1YDWA 1KRHA 3PXBA 1GSIA 4PYKA 1UQUA 1ZD3A 4Q9HA 1XTQA 4XVQA 3K0BA 1FNNA 5HKLA 1J5PA 3NC4A 2GYWA 2A5GA 1BROA 3L6UA 2VG8A 3A9SA 4I1YA 5DVZA 4NCAA 3DXXA 3VJMA 4R3UC 3SFVA 5B12A 3GGGA 1IBKB 1OZAA 1ORWA 4D4KA 2NSYA 3DMPA 3U3OA 2RSLA 2P78A 4IY1A 4OU4A 1CZUA 5C1BA 3DL7A 4PFJA 2EG9A 2ORED 3SDBA 1DMRA 3HV2A 2B8JA 4FFBB 4S1NA 1ZH2A 1ZY2A 3ZXYA 1WULS 1XE3A 2E5WA 3A11A 1XZIA 4IH4A 5JSYA 3L1IA 1Y8RA 3EZ6A 1NV9A 3JALA 2BEJA 4F97A 2AZXA 5IWAB 3FDZB 4P0TA 1W25A 4Q47A 3AGPA 1NX9A 3OQJA 3D6FA 3RVSA 3N53A 2HKIA 4RU1A 4WLVA 1T36B 1E4EA 1FS4A 2JI9A 4ZOLA 4EKNB 1FYEA 2MR6A 5CB6A 1P4JA 3K5IA 4LK3A 3QMMA 1KQPA 1W0KA 3A1EA 1LK7A 1WWKA 2CEKA 3W8DA 1E7RA 1B2LA 4JP1A 3K0FB 2QG4A 3W6ZA 2RJOA 4N01A 3IAEA 4EG4A 3P9ZA 4L16A 4X8MA 1NMYA 2AEFA 4HLUC 2RKWA 1DAGA 3C8UA 2H29A 1Z28A 5KREA 1X14A 3OQBA 5AVYA 2QRUA 4XOUA 3ICVA 3BWBA 3LWDA 4LZOA 2CNWD 2QM0A 3LGXA 1HYEA 3C3DA 4IMPA 3K09A 3O4VA 3LT4A 2QPTA 2P9GA 4F2GA 5C80A 5KX5A 1RC8A 1UBTS 3SZ3A 5EHXA 4RKWA 1I7DA 4GR4A 2H7XA 4MO2A 3DZ8A 3UK0A 1QIHA 1G8SA 4QDKA 2W11A 3FZYA 2R5WA 3VSBA 4WEQA 2QUHA 4C4TA 3GL9A 1IN4A 1Z2NX 4F3CA 1WZNA 4KXWA 3GAAA 5ELMA 1X7DA 1AGXA 4HNAA 3AJ8A 3WL8A 2W6ZA 1MB0A 3NGLA 2IXGA 4M1KA 4YT8A 2VN8A 3BDVA 3OX4A 1FMFA 1PFYA 4FIDA 1G66A 4DA0A 2XDQA 4ENWA 2VHQA 4TKVA 2VF7A 1HMYA 3KJXA 3D3WA 4UZEA 3ROEA 4DSOA 1Z74A 1CZHA 4EPWA 1M5RA 1NNLA 4Y9DA 1QH8A 2WUGA 3L6OO 3DFFA 2ZDGA 3X44A 4D8YA 5J2UA 2WWYA 4AZSA 1QO0D 3MA0A 3TRIA 2W42A 2IIQA 2QN6A 3I9KA 2VT7A 1C1XB 3M70A 5C8DA 2IIBA 4M1QA 2GPYA 2W7TA 2VDUE 2AJLI 5AKLA 1NV8A 1FDSA 1CE8B 1XZQA 2DULA 3EXFA 3WDMA 3G2MA 4RS3A 4B4VA 3IA7A 2ZI6A 1XN4A 1R7RA 3BD8A 1HE3A 4KQGA 4LRUA 4OATA 3SE7A 3ZK9A 4K6OA 4IDGA 4XLTA 4EYSA 3WGIA 5CM9C 2CFCA 3OE7D 2A5LA 4XSGA 3UT6A 4EUEA 5KYGA 2C84A 2YXBA 3PNLA 3GFFA 3CO0S 4L4ZA 1C0IA 4PC7A 3L8GA 1M0EA 3SS8A 1IBRA 1EFPA 3ZU4A 4B6EA 3NWJA 3ESQA 4GZ3A 3J7AC 3PNKA 1EFUA 1VG0B 2ECFA 3ORRA 2EIXA 3QKSA 2NT4A 4MHOA 1SCUB 3AEZA 3Q2KA 2MYUA 4HLDA 2BEKA 2GTPA 1PEKE 3AB3A 2ROQA 1X0XA 1XMIA 2Z2YA 4O4JA 4DCCA 3DBHB 4Y0VA 4X71A 1Z5NA 1WF6A 4I1VA 1GPJA 4X6YA 1PNQA 1XZBA 1K8QA 1YT5A 1SIOA 1Q0RA 2BMVA 1E3QA 4CL2A 5AHRA 1ULSA 5L95A 3IT2A 4G1EB 1UADA 1GPLA 4FKZA 4BZQA 2BUAA 1NQOA 3T5GA 3DCJA 1QDUA 4YRPA 4X8LA 1QHXA 1J8VA 3G0HA 3UBTA 4Q9DA 4HRYA 1AGNA 6Q21A 3HRKA 3R7FA 4OIFA 2YS6A 4G8JA 1JGTA 1AXGA 1NPYA 1R0ZA 3H5NA 5CFZA 1GCUA 1Y82A 3F4LA 3E2MA 3QBDA 3IBTA 4UFPA 1UT5A 1XCJA 1IU9A 3NALA 4YFYA 2ZYWX 2X14A 4MRMA 4OPMA 2Q7DA 3NVAA 4G24A 4KIGA 3PUJA 3TZ6A 1IBLB 3SN6A 1ID1A 4WGFA 1P0FA 3QG5A 4YJKA 1LPAB 3ZU6A 5CFPA 3PFFA 3BH0A 4HNQA 1H3FA 4YECA 1N8KA 1E1DA 4JJ4A 1IEXA 4UPEA 5K09A 4TUYF 4BV3A 1QZXA 3REGA 1UFOA 4JAVC 4K6FA 1UKBA 1ZP6A 3ZBPA 4MJXA 1MIOB 3O5AA 2I8AA 2PUWA 1G3UA 2ZTSA 1JH9A 1YZVA 2QUKA 4DSUA 4XUGB 4RV5A 2B98A 1PVOA 3D6JA 3NBXX 1PJBA 1H5UA 2C1ZA 1M67A 4IINA 5DX0A 4EY3A 1TQHA 2Q3MA 5ALRA 1OXXK 2WD9A 5FCDA 5KVQA 3WP0A 1DCMA 1QVVA 4L85A 3K5HA 1SR8A 3RVNA 4D5GA 3U81A 3FLEA 2I03A 5B30A 2IW1A 4JASB 1FF9A 4IHJB 2FN7A 4V0SA 3FBGA 3ITKA 3RYHB 1F38A 1K4YA 5D51S 1RE1A 4R0NA 4R51A 2BM1A 2YV2A 1G5RA 1ICEA 3KR1A 4CF5A 5AVXA 3O93A 3DLCA 2XKKA 5F76A 4JI7B 2XWPA 4P2BA 1O94A 2Z8XA 4L7QA 3G2JA 2HQRA 4GVXA 4CMGA 1T9ZA 1S2LA 4MR9B 1PR4A 1NG9A 2HO5A 3BB1A 3PGMA 4MVXA 2MJLA 2O0MA 4BMCA 2VWHA 3T5PA 2WYUA 1X7YB 1H6CA 2H7YA 1C9DB 4HN4B 4ZAWA 3K9NA 4U6QA 1JJFA 1MX3A 2PUEA 4Z4GA 4S1PA 2PQ2A 3ESDA 3GJ7A 5BSFA 5HZMA 3MQ2A 821PA 4C6SA 4PXYA 3RYIA 1RKBA 3BE6A 1RU3A 3E35A 3HJHA 1JSCA 1B6RA 3G5UA 4I4IA 5JV5A 2O57A 3PJEA 1WDTA 3KNZA 1I6MA 4E2WA 3DWIA 5HCUA 1P6XA 4IF6A 4DLSA 1MHTA 1C3OB 3ON5A 5IAOA 1M2KA 1ISRA 2P4QA 5CD9A 3TS1A 3RB8A 2P11A 2FPIB 2IH4A 4FYKA 1GNSA 4KN5A 3MIIA 3MT7A 4HL6A 4HOYA 3E5RA 3VNAA 4MA0A 4CDMA 2FFQA 4J0KA 4EW1A 4MVCA 1Z8DA 3I39X 1S2OA 4A0SA 4ATNA 3GBSA 4IGEA 5T4EA 4YMVA 5FJJA 2OAEA 3M6LA 3IJPA 4URZR 1GFSA 4P8RA 5I6DA 5CDGA 4FW8A 3HN7A 2AQKA 1P8AA 1ZG3A 2Q41A 4M0MA 2W0MA 3S2SA 3IVGA 4PQFA 5EIBC 4JR1A 4L27A 3HY3A 3PUKA 4W1PA 5EUQB 3FWYA 1AH2A 5KO2A 1JXQA 1PE0A 2CNOA 2OG2A 3HVUA 4JD5A 1BVUA 3NDJA 3Q9SA 2P62A 1CZOA 1IWOA 4X9XA 4IIEA 3T3DA 2YW9A 1RD4A 5FH9A 1G7TA 2HQ1A 1QRAA 1ABEA 2QTAA 5K45A 1Z5ZA 1Q44A 2PGLA 3WLRA 2DT8A 4YT4A 2HXYA 1N25A 3RIHA 1GU1A 2C4WA 2HJSA 3CS3A 4TLAA 1L1RA 2J4CA 3IUSA 5KQMA 4C6TA 3PEWA 3P20A 1SAYA 4WMLA 3I9LA 4PQEA 2G83A 2AMVA 2FN9A 2C03A 3OT1A 2RBGA 4FGKA 1AZLA 1Y3DE 4QYMA 2APJA 8ADHA 1RXWA 3UHFA 3A37A 3D7KA 1KMCA 1K98A 1EWTA 1OZ0A 3G0OA 4R71A 4LJRA 1N8TA 2CXXA 3CXUA 4UU0A 2OFXA 2CXRA 2XA9A 1N3YA 3FYCA 1NT2A 2FW8A 4HFNA 4MCAA 4Q34A 5EE0A 3RUCA 5FFFA 3B7GA 4LVCA 4R31A 3FWHA 3FLAA 4LRSB 1WCWA 4EZIA 4PRLA 3OIWA 2E49A 4YMTA 1E2FA 1UANA 4UKDA 3PT9A 3T0FA 5C4MA 3RTEA 6LDHA 4MA4A 4BB6A 5A0FA 4YYEA 3ZHQA 3WBKA 5IN5A 4R9SA 1ANKA 4B7CA 5JS6A 1T5IA 5KSOA 3IB6A 1J6UA 3O8QA 4X63A 2QSUA 2B4AA 4WINA 2OV4A 2MSDB 3RFVA 4A8PA 3K9CA 1RM3A 2DKFA 3FW1A 3K6JA 4OM8A 1GRQA 2PFGA 2YDYA 2ZCUA 3AI3A 4MV5A 4YJHA 1XZPA 2ETVA 1EESA 3L8MA 3PUXA 3CZCA 4TN1A 5EVJA 5C1IA 1SC9A 4PHCA 3C1TA 1W76A 4CMEC 4EHIA 1J0DA 1XZAA 4FDMA 1UBHS 1ODKA 4E51A 1IM2A 2GYVA 4F04A 3Q3JB 2GNOA 3W2GA 3QLTA 2QD3A 1FU7A 2R79A 1OXMA 4E2FA 5K7SA 2QMZA 3UBMA 1TZKA 2RK4A 5K4AA 4OYLA 1SU6A 3E9EA 3L18A 1ZR4A 1MO3A 2O20A 1PZFA 3DMFA 3GYBA 1FSFA 2W2PA 3EOAI 1JQBA 2INGX 1RDFA 1FP1D 3HZHA 4FMCB 3PX2A 4ERXA 3K0AB 1H0KA 2FMTA 2ZIGA 1SD5A 2ZR0A 4D5EA 2P77A 1SIBE 1X74A 1K6JA 2BELA 4ZQFA 3EGXB 3MOSA 1FXUA 4QLOA 1KEVA 2GGSA 1EM8A 3GBVA 4KU4A 5FFNA 5B37A 5SZJA 2OXIA 1FZQA 2GKGA 4GPBA 1LSUA 3BZBA 1ZGHA 4QXOA 3P9SA 2QRQA 4JBGA 3U19A 1GG5A 3CEMA 1ZQ1A 3EARA 2AI1A 3P0JA 1KFBB 4OLBA 3ICEA 1J1IA 1GGEA 1FVXA 3E9DA 3JYHA 1J2RA 1GKKA 4YAUA 1YB7A 1WOMA 1NAHA 3MS7A 4P5EA 1WX1A 2HU7A 4EF4A 2CLHB 1YZQA 2NUPA 3ROZA 4KWCA 3LT0A 4OK5A 3SJZA 2ZBGA 4Q1DA 4DC0A 4G0MA 3C98A 3DWFA 3GG2A 1LWNA 4ABYA 1JDJA 2R8RA 2R8YA 3IMCA 3R6TA 5CYGA 1BJTA 4LMPA 4OI1A 2BM8A 1FTNA 2ZB8A 3HCPA 4XQ9A 4F2HA 4B9EA 5CFQA 4QOJA 3AUFA 4CQMA 3AZPA 1F8FA 1HDEA 1P33A 3VPAA 3X3HA 1YJQA 3HB4X 3AQ4A 3D7LA 3BD7A 5DBGA 3MJCA 5KNDD 1RPZA 4HX9A 1EIZA 2FN3A 4GDFA 4JELA 2X4GA 2I8CA 2YBEA 1QHIA 3QWAA 1UMDB 3RVMA 3MNFA 1S9DA 3WNZA 3IT0A 4IDQA 2BFBB 1D09A 1LY1A 3I5XA 1LDEA 1UWVA 3L79A 4GLFA 3TAHA 3ICWA 4ZV4A 2ASEA 2JVIA 4IWXA 1QRRA 1R5NA 3OF3A 2IY8A 3CX3A 1G20A 3JD0A 1FRVA 3FHTA 1KDZA 4Y2GA 3P9KA 3KJHA 3A3PA 2CHVA 1G63A 2VNHA 3KPJA 2QTVB 4M60A 1FS6A 1NRIA 2WSIA 3U13A 1RP1A 3KBBA 3MWLA 4Q4JA 1ULAA 2FQQA 4M1ZA 4Y6SA 4H6PA 1LWOA 3SM9A 1O5IA 2BZSA 3B2NA 4ER6A 4RKYA 3RLFA 4UOEA 1AQJA 1SRRA 4QC2A 4WKNA 1G16A 2HA0A 2X3FA 1YZFA 2H2FA 1TKBA 2H6EA 2XKBA 3DE1X 2QZJA 1A9TA 3QUQA 3U3JA 2WP8J 1I6LA 4B4KA 3EZGA 4BTLA 1CZLA 3GMTA 3I6IA 4M36A 2J9YB 5KEIA 2HA6A 4KN8A 1JQ3A 3I5YA 3FB1A 3EG9A 4IYRA 2OCGA 1EP1B 1MNQA 1W52X 5I7AA 3WZLA 2Q0SA 4ZI3A 3LPLA 3T41A 3ZCVA 2XYQA 3OZFA 1FPQA 2Y1FA 2QYOA 2ZUFA 1QH1B 3LZDA 1PO7A 4TV8F 2C83A 2W37A 4MIEA 1C7QA 1EUDA 4JEIA 1W4BA 4WN9B 1D2EA 4ZXPA 1XFDA 2YICA 1DBWA 1G8JA 2WTBA 1B42A 5KJFA 2JA2A 3C5HA 4JDPA 4EDHA 2J85A 3CNQS 4XD7A 1DWUA 3F9CA 1COZA 4FX2A 2GBCA 4RD6A 4RF4A 1PGOA 3MJRA 5T6BA 1CDEA 3SQXA 1G8YA 3FYUB 5TQ2B 3AVTA 5JVDA 2FR8C 2FDCA 2BHRA 3AF2A 3UUGA 1ECCA 1J5EB 3P8ZA 5THXA 1OCEA 3HNOA 3FJOA 2R8EA 4WOBA 1KI6A 3TQIA 3PI6A 2R6JA 2MOKA 1NVXQ 1TNDA 3LC7O 5EWLB 5FOSA 1Z5VA 3T99A 1RBYA 4OO3A 4GBED 4WOJA 2PV7A 3RSZA 1JXMA 3KZOA 3IEIA 3TJRA 3W9UA 4PSUA 5KUTA 1W9HA 3MLBA 4OH1A 3IMFA 5F51A 3R75A 4BS9A 3S2GA 3HI6A 4HNGA 1FFGA 3DTNA 1QQTA 1GCOA 4RFLA 1TOAA 3QEBZ 4GLJA 2D1QA 4A26A 3S2EA 5CB4F 1EK5A 4Z4FA 3TRHA 1G3MA 1S8AA 3ZVKA 3EXIB 5A5VA 2CUTA 4QM7A 4LXUA 1MG0A 2BFEB 2OM2A 1MC4A 3JTMA 1DXHA 4JT8A 1CSEE 3TLAA 3WMXA 5DHRA 4F3TA 5BUSA 3OIYA 2I3ZA 3BMCA 2O8FB 2X13A 2ZTHA 1QRTA 4CYMA 2C77A 1HDGO 3PYXA 4H7IA 2YNMC 1GILA 1MVLA 4NCIA 4IO0A 5EHZA 4JXJA 4L9WA 1JFLA 1I7QB 4RBNA 3C4QA 5CJJA 5JTUA 1A7JA 1Z8HA 3BTVA 4XGIA 1G6OA 3Q0TA 3PUHA 3R6GA 4ZYVA 1WOYA 2H4FA 3IR7A 3HO8A 1IXZA 3OZEA 2OYCA 4AKGA 3AILA 1QVRA 1MHPA 1W2GA 1ZO8A 4X8HA 2XRYA 4FCVA 1KJYA 2H4YA 2VDVE 3B6IA 1VJCA 2WWRA 3P2OA 2RGGA 3CA8A 2M6RA 3WGLA 1CUAA 2IRWA 3EGIA 2NZXA 1LPBB 2PUCA 1ATZA 1F6BA 1AQLA 3RFCA 4WZBB 3AF1A 2OLJA 5AKYA 4Q6WA 3PFGA 5ALNA 2QJRA 2REBA 3BGWA 3EAFA 3QZUA 3RUFA 4RQTA 5IMBA 4ZQHA 2QNBA 4E6EA 1PLKA 3ELYA 3NJRA 2NW6A 1X80A 3NC0C 2J59A 1WZIA 4TKMA 1EVZA 1QRSA 1PT7A 1XLWA 1HDOA 2X5JO 4LNUB 1T43A 3W5IA 3IIJA 4IDOA 4YIKA 1MC5A 2YYZA 6AT1A 4TLBA 3W1EA 5C1DA 3PD7A 3M34A 4FQ7A 4Q02A 1VJTA 3LWBA 4PSCA 4TV9A 1DCFA 1G17A 5I5GA 4HRAA 3RUAA 4EH1A 1KZ1A 1Q77A 3UV3A 4YK7A 4GS5A 4O4IA 2R7AA 4MOWA 3BIWA 1HDIA 1R4NA 3MC1A 4LFCB 1TLFA 4I2NA 4RXMA 1RI5A 1VLJA 3JYLA 1VTKA 5ADHA 3TX2A 3LQ2A 4HJXA 3TNLA 5L3QA 1NUUA 5L7WA 4BMDA 2QBYA 2OBNA 5SY6A 4HWTA 3D5QA 3NIWA 4U9HS 1ZVQA 4KEAA 3EOZA 3NV9A 1CUDA 4PWZA 3LQQA 5DI3A 2JRCA 1EK0A 4IJWA 4DT1B 4EPXA 1F06A 2B1RA 2QN2A 5PGMA 2IF0A 5LYJB 2ZDQA 1OOEA 1VLMA 2Z5GA 2HNAA 2WEKA 4PAMA 3S2YA 4M0LA 2G9ZA 1ZL2A 1XJCA 2IDKA 3KS9A 5DN6A 5AXAA 4BWGA 5A2GA 3HWRA 1GUDA 1E1CA 3N28A 1O54A 3AKZA 2AMLA 2VDPB 4ZI7A 1XYYA 4AKEA 1Z4PX 3HP7A 1J2EA 2IUYA 3PQ2A 2MT9A 3Q7RA 1EHYA 2J07A 4JU9A 4OMFG 1UIRA 3KYJB 4KAFA 4QUEA 3R7WA 3CR3C 3WAJA 4BB0A 3HB9A 3SIWA 3ROQA 1HLDA 4DXAA 4JUBA 2BHTA 3JWGA 1HTTA 2IDZA 3FOWA 2D3WA 3CRW1 3HYRA 1BJRE 1CKEA 3H2IA 3QA9A 3Q8XB 4KQ9A 4TSKA 3H2BA 5KOYA 4HLNA 4R5MA 1EXWA 2ZJOA 3FIUA 4ASUA 9ABPA 1GM5A 3IERA 1K9SA 4IIXA 4C7JA 4Y9SA 3LGSA 3R23A 4EUHA 4PM4A 4XVUA 5NULA 2QRZA 1KKUA 1TCBA 5KKNB 2BGTA 2E4AA 4HV4A 4CMIA 1F48A 2OV2A 3QVGB 4XGKA 4DMKA 1WP4A 1ONNA 2DTXA 3EWAA 5JD5A 1YMUA 2ZT8A 3AJDA 1SZJG 1OWPA 1T1SA 2XA2A 1R9GA 4JR0A 4QXAA 5CLQA 1ZYUA 3AESA 1VL2A 5JSZB 1W36B 4BMSA 1L5VA 4GKBA 1N6LA 4MVJH 4PLZA 3VPSA 3WL3A 2I6SA 5B36A 4M98A 2I7CA 3AFGA 4TQAA 5JWOA 5L51A 3DPIA 4KNVA 4ALLA 3D3JA 2QLJA 3KWFA 2CSXA 3O3NB 3S1SA 4GPEA 3NEJA 5FL7A 3EEYA 4WHMA 2EJWA 2A8YA 1L4NA 3ZGZA 5KC9A 4KAJA 1V41E 4KQEA 1WKVA 4XDYA 1QTIA 2DUJA 4IIFA 4GFDA 2BGMA 1WVIA 4M99A 2GEVA 5H80A 1KC1A 2G3YA 3DYIA 4O1HA 3WL7A 2AJ8A 3R9XA 4G5YA 1D9ZA 3KZXA 4PLTA 2O2ZA 3O8NA 2D2VA 3O83A 1EEXB 2WHRA 4FZVA 3N74A 1OZFA 4LRQA 4OFBA 3F67A 2IBSA 5FLEX 4UOQA 2QR5A 1JG1A 4H15A 4V02A 5EMKA 5BW6B 4K9QA 2EJCA 2F62A 3KBOA 4AVYA 4X60A 4JUDX 5JECA 4IJUA 1M8GA 4O4IF 3H2YA 2P5YA 5KYWB 1PS8A 4TL9A 3KZMA 4FNAA 5EYPB 1H2XA 2GI4A 3RRMA 1VPVA 4V2UA 3I58A 4BCBA 1CZKA 5BP7A 2FFRA 4IWYA 4QGSA 2PRSA 4A15A 4TM8A 1YMVA 1ZOOA 4BGEA 2KWIA 2OFOA 3ROFA 3OZDA 1OWMA 1CRWG 3B6JA 3IFSA 1RADA 2PVSA 2X76A 3QE2A 1AK9A 2H0RA 3AW8A 3B53X 1A9OA 2WIAA 4YRKA 4X8OA 4I1SA 4FILA 2D1SA 2H17A 4ZVMA 3N3BC 4DVGA 4ZCSA 5FRDA 2XCQA 3IVAA 4MKGA 4DM7A 2G8NA 1YNSA 1CS0B 4S12A 5U9CA 2X9QA 3C7AA 1P4HA 2CYBA 2QROA 4P7JA 3TOSA 1XWWA 2FUG1 1S96A 2C61A 2IITA 5CM2Z 1K75A 3BWEA 4G23A 2QMYA 2BW0A 5FUQA 5CA0B 5JNWA 1JAZA 5JNUA 4Q9NA 2A67A 4FMBB 5BWCA 4CG2A 1LTQA 3MJDA 3LNCA 3AUTA 1ECPA 1U5BA 4HDSA 3NEPX 2HU2A 4DTIA 5AVTA 3F5QA 1NRJB 1T2FA 2ZVQX 4GRIA 4IILA 1UXOA 2SECE 3RKSA 5C8YF 1XT6A 4G0ZA 1KIFA 3F6YA 3GUUA 3QTLA 4PANA 2ZPTX 4FT2A 3KKEA 3RUDA 1AQUA 2AK2A 5FA8A 1GZ6A 3T95A 5A6VA 5DHTA 1MDBA 3DUFA 5MF6A 3KHKA 1ZMRA 4QGGA 3FTQA 3KOYA 4P4UA 4R9VA 1PNTA 3TCNA 4A2WA 1XDDA 4QG3A 3I9MA 5E9QA 4ZYWA 2E5LB 1Z4JA 4IVNA 4KE6A 2QA5A 4Y98A 3LWZA 1S4QA 2CMDA 2VBGA 1LFAA 3R5XA 1B8PA 4JEUA 1P73A 4O5OA 1ORDA 3BE8A 1T15A 3DJFA 5CB8A 5KYYA 4CR7A 3L8YA 3M8KA 1GCGA 1T24A 4GEGA 3PHGA 1EPUA 1MO6A 2A7QA 4BO1A 4EVIA 4FS8A 2BRUC 1F17A 2P3LA 2OCAA 2D7JA 2W6OA 2WTMA 3P45A 5AKZA 4DEVA 2H1HA 4R98A 4H27A 2DH6A 2JIBA 3JQFC 4M38A 4OEHA 2V6FA 3RWMB 1LBEA 3F8WA 3IO5A 5FWYA 1DDGA 2H2WA 4PO3X 2CBXA 2Q2WA 2P1RA 3GB9A 3HK2A 1J2YA 4HQKA 1WPGA 1SXHA 1RCTE 3A3KA 1QK4A 2NXNA 3H13A 3U4IA 5F52A 2DTEA 4FZRA 2W6PA 5H7XA 4DWVA 3PNYA 1YRHA 4GWLA 3UAXA 2P2LA 4YRTA 4D0RA 3HRIA 3JQBA 1Y8CA 4F92B 3RADC 1JB9A 2UZ1A 4OSPA 4NNJA 5U4XA 5DGHA 1CR1A 1MQ9A 1OZGA 2EF0A 3G59A 3I05A 4H2DA 2Q7XA 4OXQA 4U7FA 5AM4A 3U6KA 1EB9A 3OFND 2PO5A 4M6WA 4P5PA 3E1GA 2HW8A 1N1DA 3ZJ4A 2V0NA 5DTIA 1BNCA 4RVNA 5C5IA 2BYTA 2ZS8A 3GJZA 4MW6A 4NABA 1IEQA 1LF0A 3L1HA 3DVRX 1GNLA 4I55B 1ZUD1 1QU2A 1H93A 2V55B 4MQMA 3NU1A 4EQZA 4GI5A 2JEZA 3QU4A 1VG8A 4C01A 4EPRA 4J76A 3T1VA 4M2LA 7AT1A 3VVLA 1ZXXA 1RQPA 4HBZA 4DV6B 1E6EA 2IDMA 1FQJA 4MJ7A 3SP1A 4CV1A 2IH5A 3ONFA 3QYAA 1JVNA 3EGWA 4P83A 2BR4A 1DDOA 2QIPA 3VC3A 2FRDC 3BT7A 4XCVA 5FR1A 3T9DA 4Q7JB 2O52A 1E60A 2A9FA 2SBTA 3EGOA 4KXNA 1S8OA 1T8YA 2LDBA 4PZCA 4EM6A 4R7TA 2R0QC 1PQWA 3WGNA 4GQBA 1OH5A 1MAVA 1SBIA 1Y1LA 4NICA 3OESA 5JNSA 4MQLA 3OFJA 3FI0A 1FNSA 5FP0A 3G2OA 1VHLA 2JIZD 4LOLA 4DMGA 4M7WA 3RYCA 2KB0A 4TQUS 2XAUA 3M4ZA 4OL0A 5ILGA 4H1WA 5J4YA 4OHPA 1NQWA 2ZU6A 3RFUA 3LSTA 4GKJB 4ZV7A 3L9WA 1MIHA 1Y4DE 2JIRA 3WR5A 2C00A 3JWIA 2QPLA 5AH0A 2IV7A 3IL2A 1D1SA 2Y93A 1QJCA 5BN5B 5KYXA 4KUEA 4ARZA 1IQRA 1ZM3A 3A26A 2CMGA 4L08A 3C3KA 3I4LA 2I34A 4EMBA 3LDHA 2M2IA 4L15A 5BMOA 4C0BA 1NAIA 4F5ZA 1DTEA 3COVA 3CZRA 4GP9A 3EFEA 3IP5A 4D25A 3ED1A 3THYA 3D4PA 1GKIA 3TL6A 3K6SB 3COSA 3OF2A 3T5AA 3VKWA 1QK5A 2GSDA 2QE7D 4F4FA 1DMSA 5EJ2A 3QKIA 3ZHTA 3GPBA 4K9OA 3INRA 3PQDA 4BVLA 3NHPA 3SQWA 1K0UA 1GRRA 1UP4A 2IODA 3ELUA 1Y6RA 3KJFA 2FMXA 2IP4A 4LJAA 4N8EA 3EXEA 4PLPA 3I6BA 4MB6A 4C08A 3PGXA 5G0VA 4I14A 1PJ3A 5HMLA 1EP2B 1G5IA 2X5NA 3N87A 3QVLA 2RBKA 3MBKA 1DQPA 1OGIA 1V1JA 1GPUA 1XCMA 4QYWA 5TE9A 1N2CA 4DV5B 3U60B 4E14A 3N5KA 4XWKA 3TIGA 1U31A 3FYHA 4Q21A 3GRZA 5JAZA 3ZQKA 3UXYA 5KWJA 1YRWA 3R44A 1FNDA 2LW7A 3KEGA 5FAXA 3HCAA 1GL3A 4PGGA 2UKDA 2F7SA 3GI1A 4GVLA 4Q7QA 1VSUA 4FGWA 2XYGA 5EZ6B 2IS6A 4MIKA 4ILEA 4EHLA 2C8LA 1XU9A 3JQAA 4IF4A 3T0IA 2X9VA 1HH4A 5A7GA 4NKRA 2XSZD 2WJPA 3IAFA 1W5FA 4PYIA 5I9BA 4HAXA 4FYWA 4HC4A 3T4EA 4D96A 3FFBA 3GLSA 2PIAA 5K0JA 1QLWA 1TB4A 2QT9A 1ODJA 2Z4SA 4OQMA 4R8RA 5F23A 5HIAA 3FA2A 4L6CA 2G06A 4II3A 5I45A 2A30A 4FTWA 4XYLA 3H2JA 5IK2A 1DG9A 4NV1A 3L1UA 4OTZA 4QVGA 3D2LA 2F43B 5E4TA 1H65A 5D7BA 1VL6A 1AGRA 4JQCA 4TMFA 2VF8A 5KVVA 4F9GA 1NZJA 1QBGA 2CNKA 3LI2A 4L4RA 2WU0A 3U7IA 4DRXA 5LIRA 2XTAA 4E22A 1GL9B 2Z95A 3NP7A 4W82A 2XMQA 1ZIPA 1RJ9A 1BG6A 1DP4A 5JAUA 1R6BX 3DFIA 3AVWA 1T9GR 3D8HA 3FIJA 3UG6A 1VBMA 2C7QA 5KYTA 1F5SA 2O8EA 1WQ3A 3QIVA 1DXYA 3BL8A 5K51A 1II8A 4DN6A 2ATIA 3PSAA 3ILSA 4LY3A 1U7ZA 1UBRS 3LQ4A 3NRCA 1IUNA 3LUBA 4RD4A 3HBNA 1Y9AA 1BCRA 1DUSA 3EVGA 3RH0A 1KK2A 1R66A 1MKYA 1RAFA 1PGJA 2Q3LA 1CDDA 3FDFA 1IJFA 1MCZA 1WB6A 3PS9A 4OOEA 5HE9A 1TUBA 4H7HA 3WWEA 4AZ3A 3KYBA 3AEKA 3W5HA 4N76A 2Q5FA 1RKVA 1P2UA 1DO8A 2ZAIA 1ZRNA 1M72A 4ZT2A 3P27A 4AUKA 2G70A 2B9VA 4ZO7A 3SY8A 2G1AA 2JFPA 3BPSA 4F1WA 4DV2B 3FMGA 4X20A 2YBDA 4J9VA 3I72A 1JBKA 2YZKA 4JQZA 3KTAB 3DXYA 1LBIA 1RBZA 1KEKA 2IZ6A 3W1WA 2O8BA 4D97A 1DIRA 1QNLA 4A10A 2H9YA 4CR8A 4Q4AA 5CDHA 1SXGA 3KLNA 5IKMA 3IE1A 5FF9A 1G8KA 1IUKA 2ZRCA 3AHJA 1CDOA 1U2RA 4HGZA 4ZEMA 2Y77A 2F4VB 2O8DB 1VDMA 2CXUA 2RGWA 4ZC1A 3PDJA 5DKFA 2FMFA 3ENNA 3BMQB 1ZK0A 1Q11A 3OE1A 4RZSA 4UHHA 1VKHA 5F1OA 2B83A 4CHGA 4PZLA 4DV3B 4WI1A 1Y7PA 2QTRA 2R97A 3AR2A 2FWIA 3LPCA 2VDKB 4KQWA 1CQJA 4MINA 3LYHA 3TD9A 5CURA 5IM4A 5AW9A 3MJTA 2XBUA 2RH9B 5FPPA 2GNAA 4TL8A 3B9BA 4YACA 1FLDA 2BBOA 4JDUA 4J1TA 4UTOA 2HA2A 2QUAA 5J59A 4BVJA 2FUG6 2R84A 3G68A 2OFFA 4CRWB 2HRZA 2HRDA 3LHIA 1DRVA 2JGDA 1ZCFA 1M1XB 4XWAA 4YCMA 1G8GA 3NRBA 2HK9A 2F9LA 4ETNA 5JNLA 1MRNA 4G0QA 2P6RA 1XPJA 2A1UA 3VR5A 4B44A 1JAHA 2DHCA 4KQHA 3MUEA 4IKPA 1B15A 1H5NA 3CUEF 4C21A 2ZYDA 1UDRA 3W6PA 4RTLA 1OFTA 4G5OA 3BIJA 1W94A 3NASA 1GDHA 5I7OA 4OHMA 3H11A 3D7RA 4Y67A 3CEAA 1WVMA 2J5XA 1JFFB 1U8FO 2FU5C 4GOKA 2JS7A 4CUZA 3MTJA 3HFSA 3L7BA 4A8JC 4BZWA 1IDN1 3BMNA 2XUDA 1P0QA 1LCIA 2ZS9A 1UC5B 2B1IA 2PSSA 4ZVVA 4E12A 3G5AA 3AEYA 1CRLA 4KX3A 5CH5A 4AC9A 4F6CA 4OJTA 2H1RA 2ZKIA 4PIPA 3SXUA 3O21A 1TIKA 3BXHA 3CIOA 3FZGA 4BNDB 2PUBA 9MHTA 1V8OA 3LDGA 3QUCA 3NX4A 2IKSA 3V4LA 3VR4D 4BFCA 4DAEA 3PE6A 1JHUA 1SOWA 4WXHA 5JZ9A 1QE5A 2GEDA 3PXGA 3P0HA 5L9AA 1YR9A 5C0OE 4D3YA 4HUJA 3Q0IA 2YFKA 4RHEA 2CKMA 1G5PA 1XK6A 2FTKE 2NNLD 3LA6A 4HVCA 1VP3A 4M8IA 3WIDA 3NH6A 3AY6A 3PC3A 5LZ7A 1AT1A 5ECDA 4A6PA 4BWFB 3BZWA 3IP7A 2VP6A 3KPVA 3T15A 1LRLA 1JQEA 4W9MC 2W2XA 1IBSA 2Y0BA 3NTLA 5ITSA 2IOYA 2VLBA 4E46A 1K63A 1Q12A 1FU4A 1T6YA 2Y71A 3PTLA 3PSHA 4NOMA 1AS2A 4I9UA 2XCLA 5IBQA 3ROGA 4LFBB 1KZGB 1OFUA 1Z4NA 2B99A 2FCAA 2X8JA 3PK0A 2AN9A 4WXPA 2FSHA 1E99A 4YJ2B 1N7GA 2H31A 3HKCA 3GOQA 3TZLA 3UHJA 5A1TA 3WIUA 4EO9A 3MWFA 2DFNA 3IELA 4DHWA 4CM4A 1K7FB 1UBGA 2Y27A 1Y3IA 3BE4A 2G9RA 3WZMA 5B4UA 1BN7A 4HAIA 4D4JA 5TMEA 4F84A 4XD2A 2OSVA 1H0SA 1ZD2P 2R7MA 3DMDA 2V3VA 2H5IA 3C7DB 3OEYA 4I1UA 1L5NA 3SF8B 2VEOA 1EWQA 1E79A 3NAQA 2QGZA 3PKIA 2CV0A 4INJA 4DLVA 4E5VA 4HN9A 2KPOA 3UHAA 1CJVC 3NWEA 3ESRA 4DPLA 4PPQA 5IM4F 4CT0A 2Z4TA 5EP1A 2BGUA 1LI5A 2ZS7A 3LY8A 4I4TA 2ISSD 3L7MA 4K7JA 1QMGA 4PY2A 5E1MA 2ZYAA 1WMEA 3VHXA 1T9HA 2CDBA 3ZV7A 1COWD 1YFJA 4R2WA 4KXMA 3A05A 5BSWA 5KDOA 2OBBA 2QW1A 3CY6A 3FYTA 4L9SA 4LVOA 1JDTA 1RYBA 3WLKX 3ZK8A 4DY6A 5C4IA 3KEFA 3NHMA 1S2IA 1W1WA 3PQ5A 1SBNE 3OKCA 4WK6A 1JZQA 1X1DA 1GR1A 4JODA 4KH0A 1N8NA 2SKEA 1ZUIA 4BBZA 3HEMA 3KZNA 5C3UA 1KQ3A 4L5AA 5EUMA 1YJ5A 3SI7A 4D9NA 4KQFA 3QSGA 3WLPA 1KDRA 2Z2JA 1X92A 3EJ6A 4LZNA 2R8OA 4NHOA 5FV4A 4RC9A 2GM9A 2WWFA 1QIIA 4BLSA 2ZUTA 2A5YB 2JATA 3QJGA 1GEEA 1KY3A 2WW8A 1MU0A 3FCOA 4OQNA 2ODAA 5IAJA 3SC2B 1A77A 1UQTA 3TDMA 3ZBTA 1Q21A 3IRVA 4HGNA 3W2EA 2EWVA 2WLTA 3GJRA 1W5AA 3THOA 1ADGA 1EFHA 2GRJA 1T5DX 1E7WA 1KORA 3DTYA 3WV4A 4AJJA 2PK3A 3VUFA 2G7ZA 5CT4A 3TDNA 5BWOA 3Q3EA 4J7XA 3W4IA 3L7NA 2OWEA 5BV0A 1DAFA 2HL6A 3V1MA 1G291 1Y9EA 5DLQC 3VDRA 2EW8A 3PNPA 1T35A 4QBIA 3L8ZA 2X0NA 4OHUA 1GL7A 2YV5A 4JUFA 5H5JA 4H4DA 1NXWA 2H1WA 1DBPA 1UAGA 4C87A 5EFOA 2PXHA 5IAAA 2VSNA 2WY2D 4AS1A 1ZM4A 4EVSA 1WE2A 2O1XA 2WMNB 2X0EA 3O03A 1U8UA 4LF9B 4NDZA 3QVKA 5HDQA 1UJNA 3KOOA 1QYDA 1E77A 1AQNA 2I67A 2VK2A 3F6SA 2HHLA 4N8SA 3RVLA 4HDNA 1G19A 3WBJA 4X62B 4PXSA 3DDWA 2PWAA 2WD7A 5LPNA 3Q41A 4RQUA 1M8KA 2N46A 4FC7A 3SIXA 1SK8A 4CUJA 4TMYA 4DJFC 3C15C 3QBJA 3LXMA 4CT4B 4JQSA 1OE0A 3AKDA 1OXUA 1P2SA 3E3MA 3QVWA 1XEXB 4MITA 1WHSA 3OQ1A 1J1ZA 4K6CA 4I1PA 4NESA 1JN0A 4ZVKA 2FEOA 5BXQC 3K3PA 2XHZA 4PLYA 4Z9BA 3HCOA 1OH8A 1Z6XA 4RORA 4DR7B 1Q20A 1M1YB 4LJ4A 2Q1WA 3FUUA 4RF3A 2H00A 3T34A 3WHLA 2PZEA 2FPSA 1KAEA 4U7HA 5B3KA 4F9FA 4K8OA 1XPOA 2VTBA 1CUSA 1LW7A 3AHEA 1DO0A 4F5EA 2UXBB 3P0IA 3TMYA 4B35A 4DUZB 3OQ6A 4KLRA 3A9CA 2J48A 3GLHA 1JR3A 3NW9A 5BVHA 4EJFA 1RABA 1JBEA 4YMWA 1SXIA 1ESMA 3P2JA 1XCLA 4ZIRA 1C29B 2HNBA 2PH7A 4G2NA 1U3TA 4XYEA 1IPEA 1UPTA 4NK5A 3CF0A 4V3BA 3WRVA 2YWHA 3QFSA 5EFZA 2VHTA 5BSRA 3X2FA 4LJ8A 3A6ZA 4B0OA 3H86A 3OQMA 2BR5A 4IRXA 2QTCA 2R65A 4PX5A 3W4KA 4LRYA 2M98A 3DWGA 4RCYA 1WLYA 2VEDA 1ZVMA 3P2KA 4IDDA 4CN9A 4YAIA 1NP6A 1QFZA 1R4AA 2CKDA 3K1YA 2NZWA 4U2BA 3TIVA 1YJCA 2GILA 4ECEA 2BF7A 1UOEA 3LBYA 4ZANA 1RWPA 1V1RB 1PFWA 4GRDA 4ISBA 2BGIA 3S40A 5H59A 1LVGA 1XTJA 5IT0A 1B73A 4LQLA 1PGQA 2HPHA 2UYYA 2YCBA 1DG3A 3IIIA 2WHEA 3KQSA 3NHFA 4JJEA 5JWRA 4PPYA 3OCWA 3GJ8A 5ALQA 5AW3A 5ICCA 3H7AA 4ZMRA 5DNWA 3HDYA 2F9MA 2AJDA 4FIZA 4Q4LA 1L7MA 1V9SA 5JJLA 2Q6KA 5DNVA 3FKJA 3HKDA 4RMGA 1G60A 5TT0A 4MDHA 1CP3A 1CUGA 1H8ED 3KYCB 4HVTA 4UDYX 4D74A 2GK7A 2OORA 1QZUA 2QMHA 3DLIA 3JCZA 3O2SB 3AWIA 2Q49A 3HH8A 4I5EA 4JN6B 5BN4B 3RU3A 3TSYA 1X86B 3FFTA 1B26A 3IEUA 1GG9A 3IVRA 4G0XA 5FWDA 5GY7A 4ETWA 1ABFA 3LECA 4XJVA 3BA6A 4UUMA 1E2NA 1MZVA 2HWUA 4XYBA 3DV0A 1T4GA 1USUA 4REQB 4W7HA 2FR0A 1QG0A 2XYVA 2AD1A 5AOBA 1GFWA 5JAPA 1IBMB 4B3DA 2PTHA 1BXGB 3D7NA 4QNMA 1E7MA 1G2IA 3U7EB 2ECOA 4JVMA 4WKCA 2TMKA 3MWEB 3SYMA 2GZ3A 3GGSA 2V7BA 4U7TB 2A0FA 4RESA 1GFZA 4J94A 5FOTA 3WICA 4XDGA 2VNSA 3WWPA 3IKTA 1VKRA 3NJ8A 5HUJA 3U7FB 1T8RA 2GVDC 5HQJA 3RRNA 4S05A 2NM0A 1HDZA 1GRVA 2V1XA 1SO8A 5IJZA 4NRDA 1E2IA 2ZIXB 4F4UA 1F8GA 4BZPA 4RTJA 1QAMA 4IBOA 2XCOA 1K97A 3OQPA 3FCYA 4Z7QB 5JSHA 4EB6B 1V7QA 3WX0A 3QVMA 3TOVA 5C8VA 1P1CA 3HJAA 4EBBA 3HVJA 1M8PA 5L3VA 1R27A 1N7HA 3KJEA 1FX0B 1J99A 1UBUS 5EQDA 2WQ6A 2VF5X 4H7DA 4L2IB 5KSPA 4BNTA 5KYXB 5K0GA 3B9PA 3QXHA 2YZGA 4O29A 3V7FA 3E5MA 3W79A 4DCVA 4IEIA 2QJWA 4I4LA 1WW8A 3WYFA 5F21A 1ENYA 2X1VA 3AL3A 3RVJA 5HQTA 3H8WA 4OJYA 4XPZA 2RD2A 4GRAA 3GUYA