2XDAA

Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-2-(2-cyclopropyl)ethyl-4,6,7- trihydroxy-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
150
structure length
150
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrahydrobenzothiophene derivatives: conformationally restricted inhibitors of type II dehydroquinase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
total genus 55
structure length 150
sequence length 150
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2xdaA00
3N87A 4CKWA 4KIUA 4CIWA 3N7AA 3N76A 4ZC1A 2C4WA 3LWZA 3N8KA 2Y76A 1H0SA 2BT4A 4KI7A 4RHCA 1D0IA 4CKXA 1H05A 2Y71A 5B6PA 3U80A 2C4VA 4B6RA 4B6PA 2CJFA 2XDAA 4L8LA 2C57A 3KIPA 1J2YA 1UQRA 4CKWB 4KIWA 2UYGA 4CKYA 2Y77A 4CIYA 3N8NA 4B6OA 3N59A 2DHQA 1V1JA 1H0RA 4V0SA 4CL0A 1GU0A 1GQOA 4KIJA 1GTZA 4B6SA 2XB8A 4B6QA 1GU1A 2WKSA 3N86A 4RC9A 4CIXA 5WRFA 4CIVA 4CKZA 2XD9A 2XB9A
chains in the Genus database with same CATH superfamily
3JARA 5ICGA 4UJ5A 4HNHA 4FOTA 3GVPA 1NBHA 4FMBB 5BYBA 1XZCA 1X7WA 3IP8A 3B5EA 2UYOA 4OQFA 2Y3IA 1QYDA 1EE1A 3IBSA 3VSBA 3L8YA 4D3DA 2FQWA 4OLAA 5DTMA 4E5UA 1HQDA 4NAVA 2WPDD 4QJ3A 3I2JA 4LYAA 3HXOA 3QJ5A 2Q4RA 5LDGA 2NLOA 2NO6A 5IT9A 3KQMA 2PBFA 3RH0A 4UM9B 2HLDA 3ZWNA 4DL9A 1MN6A 4DV6B 1GLNA 3SM3A 3JD2A 1XALA 2B5VA 1LI4A 4RQBA 3AVXA 2ESRA 1FDRA 1KAEA 3BJIC 1DKQA 4F8EA 2H1WA 1H5QA 1SRQA 3WQQA 3BMOB 1H2ZA 4V24A 1HK7A 3PKIA 1CYDA 2AC7A 3ZCVA 3PFFA 1SIBE 1IAQA 2TS1A 3L7LA 2DPMA 3TTUA 1YJ5A 2WINI 1H66A 3L02A 3QFHA 4Q9LA 2X8JB 1RYZA 1S1MA 1ZM3A 1AUQA 2B1GA 2OCYC 2ZRQA 3K5WA 4DV2B 3U7HB 1NASA 1Q57A 3FSGA 4LF5B 1AXRA 4P4TA 4WCFC 3DWFA 1EHYA 3OX3A 5H82A 5B2ZA 3RDPA 3SIWA 5IKEA 1Z17A 5JXIA 1IVNA 2WIDA 3HYLA 5MN6A 1F14A 1G8KA 3X2SA 1N6PA 3FA2A 4JHLA 1YZFA 4W63A 3OZXA 3E5RA 1NVVR 4AF6A 2B7CA 5B4VA 1DB3A 1K8QA 1M83A 1YR3A 2YW2A 1U3CA 4G5XA 4RULA 4KN8A 4R1TA 1A69A 3KT0A 4N8DA 4ZI2A 4CIVA 4IILA 4PR0A 1ZR4A 4QQNA 4OV6B 1ZJYA 5TARA 3WB2A 3BE8A 5AH0A 2W48A 2JLCA 3OA0A 3LWZA 3OT4A 1TC2A 3P8ZA 2AA3A 5JMOA 2IGTA 2ZJ0A 5JTUA 3IP1A 1D0IA 4PFSA 2RH8A 4B82A 2OGZA 2BKUA 1NW5A 4TM8A 4GI7A 1CR2A 3OP1A 3HZZA 3TE7A 2WJ6A 5EUMA 4G1MB 4UOZA 1KQPA 1SQGA 1SOVA 1NDQA 1RQPA 4NDNE 3VBEA 2VYCA 2BTOA 1IOZA 3HFRA 4IBOA 2ZRDA 4NU0A 5CGZA 4LZLA 2QPAA 1TMYA 1W5SA 2R1VB 2QR5A 1A0OA 4O4JA 1VFNA 1VGRA 2UVQA 5C7OO 4YCDA 3RS9A 2ZSFA 1O94D 4X1OA 4J0HA 2A1IA 3TWOA 1EFPB 1JS1X 1EGAA 2I1VB 1G5RA 1GHTA 2Z04A 4G26A 4JJKA 3LBAA 2B7BA 3ROPA 4MVJF 3WWCA 3ZY6A 1MW8X 1CUSA 2R44A 4MARA 2VRCA 1NDUA 2W2LD 1ISIA 4HDCA 4PCLA 3PFNA 2GDZA 3FTNA 4G0VA 4UNRA 2FFAA 2O5EA 1SY7A 2R1UA 4OKSA 1Z2OX 4F1KA 3AP1A 3AUSA 4QPJC 3FDFA 1U8EA 4R0MA 4WESA 2CL5A 4D80A 2ZAYA 4OXQA 4ZOQI 4EKYA 5I3CA 2D7DA 1HL3A 1N9GA 5DBHX 3RVDA 1LRLA 1QBKC 2YRWA 4ECAA 3NDRA 3L1UA 2A7XA 2I2WA 2G17A 4I50A 3B52X 4AU1A 5B1IA 4UD2A 2EVWX 2JW5A 5T4FA 4G4GA 4FW9A 1KZYC 5AOVA 2XGGA 5EMHA 6PFKA 3OMXA 3UPDA 1P2VA 3KXPA 5JAIA 3E3LA 1X94A 2DHDA 2Q3BA 1K06A 1A71A 2IOYA 2FB9A 2NO9A 4RS4A 2CHGA 1L1RA 5G53C 1WB4A 2BFWA 4BUJA 4HSGA 3IMKA 1ULBA 2LKDA 3G7NA 3MGGA 1NQWA 1TW3A 1FX1A 1Q0RA 1NNUA 2BSQA 1WV0A 4ND8A 2FHPA 3K1TA 5U1PA 1S3IA 4YAJA 2B30A 2G25A 2GPNA 5I9SA 4YCCA 3A1WA 3OZSA 2OENG 4WSOA 3TDMA 1M2GA 1MENA 2WSBA 1YRWA 4TTRA 4FYHA 3U4DA 1M1NA 2G7MC 4FGZA 4H18A 3ROMA 4YRSA 3ESQA 1P7PA 4Q4CA 1U3GA 2GRUA 4RHTA 1JBEA 1ADYA 1DXOA 2FSHA 1FYXA 2D06A 4H1HA 1X1CA 4D2IA 2C2HA 1FQKA 3CF2A 3AEUA 4H6WA 1FNDA 3DDWA 3PWZA 4G3XA 1O96A 2E49A 2BUBA 4ZVMA 4BO9A 4JBHA 1D4ZA 4DQVA 3FCOA 4JB0A 1V5EA 2VXYA 2YNMC 2UZIR 2QS9A 1GQYA 1P8JA 1I4OA 2MMGA 1GGHA 2GO1A 3JZMA 2HFKA 4I5DA 3M9WA 1PO7A 1L5FA 1D7AA 1BGVA 1C1XA 3NC1C 1AT1A 1W30A 1KP2A 3GL9A 4K46A 2QK4A 5DVZA 1N0IA 3INTA 1SXJD 4EFLA 1U5CA 2BMWA 3B6EA 1T6ZA 1XN4A 1XQWA 2ECOA 2O8CA 4TYPA 4FFLA 1KI7A 3R7FA 2R6FA 4FT4A 3AM4A 1PU2A 2PG3A 3OZFA 4I4CA 4FSHA 4F3YA 1KFBB 3M33A 3AILA 2E9SA 3C1UA 3F5SA 2C7RA 3WGKA 4BEVA 1J8DA 1JBKA 2G9RA 3B82A 2BMVA 2WKQA 3LCJA 3N7TA 1N2CA 3F90A 1NBOA 3W9SA 1XYYA 4EQ6A 1BGXT 5A3SA 1I2CA 5ED4A 1HT3A 1GUYA 1XJCA 5TLSA 3NBFA 1NU8A 2X0RA 3F6RA 4ARSA 1PV2A 2XWJI 3QVKA 4PAQA 2ODNA 3CUSA 4NXNB 2DP4E 2OKGA 2XGJA 1DG3A 2XXJA 5IANA 1VJDA 2JFWA 4BB6A 4HEHA 1LDNA 2VHTA 3NNSA 3F7MA 4LVCA 2VRNA 2GH1A 4AF8A 5JAUA 2G1UA 2XDWA 3MHPA 1AKRA 3RANA 1E4VA 3OCJA 3IAFA 3U13A 5I9TA 4QBGB 2C4WA 2YCBA 1GRVA 3DC7A 3DPIA 2BDUA 4H7JA 4PZDA 3RABA 3HJTA 4NP6A 4CL8A 2BM9A 5SY4A 2D0IA 3R7NA 4XB2A 4HRVA 2HRQA 5IVHA 3PRJA 3MAGA 4G8BA 4V0OA 4A16A 1RU3A 2HR1A 2IH4A 4TZ6A 4NFSA 5DP1A 4DUPA 1EA7A 5EZ5A 1H93A 2IBTA 2KSQA 1XQ6A 4IIDA 1MF7A 3IAEA 4RHYA 4JL8A 1C0PA 1AUOA 1ZGJA 3RC1A 1DHTA 5IZCC 1OYYA 2D2IA 2P65A 2I6SA 2NPOA 3B5IA 3ADDA 1VHDA 3KPVA 3M83A 3DMRA 3K1AA 1QGUA 2EBWA 4LJYA 4DILA 4DZRA 1DG1G 1YQGA 3T3DA 1TA4A 2JFPA 4GT1A 4EHFA 1J22A 1B2LA 1CF2O 4IXDA 3BTSA 4P54A 1D09A 5BSVA 4U7WA 5T67A 3IEMA 4OPMA 2G0TA 2O14A 3DGFC 2NXEA 4XFDA 5EE0A 2BI4A 3OTHA 1N2ZA 3H97A 4QVGA 4WK6A 1GFIA 2YHIA 3BDVA 4GZLA 1U7XA 2QM3A 2OZVA 4CM8A 3F73A 4LYDA 1SKAA 2QL7A 3P0JA 2PQ2A 3SF0A 5BNFA 3HCAA 1O8BA 3UMSA 5C4IA 1PR1A 1SB9A 1VI2A 1XWIA 3WRWA 1CZKA 3M6XA 4QT4A 1EVQA 1UCFA 3DAPA 3R3UA 3SXUB 2ZUUA 4RHEA 4XJVA 1UK8A 2CXTA 1W5FA 4L8YA 3RAGA 5FNVA 4F2PA 1B8PA 1ML3A 3TKLA 3KTOA 5CA1F 3Q98A 1ZA1A 3RT9A 4XA8A 2H4XA 3RTDA 2GEVA 5B2FA 3N70A 4DMMA 3C8DA 1SOWA 2WLTA 3MJ4A 5F73A 3KPYA 1DDOA 4AY3A 3RD5A 2F2TA 4EZIA 3VRHA 4FZVA 4GBGA 3RU7A 2BC9A 2X2PA 1I4WA 4IIVA 4QJ5A 4R1OA 3V46A 4EATA 2F1HA 2GCGA 1IDOA 5I3ZA 4ZDJA 3KYIB 5KWSA 1M34B 1L4NA 2XXBA 4DEYA 4BMXA 1PR3A 3VDRA 3X1WA 4D8VA 2G1AA 3AY3A 4MRRA 4BX0A 3DB1A 1Q7CA 3I28A 3MOSA 2VSYA 2HLHA 2JFQA 2X13A 3PQ5A 2UZ1B 1OBHA 4UU0A 1UBOS 1UZNA 2XJ9A 4F3KA 3K96A 2PO5A 2HRRA 4D6XA 3UEOA 5JEDA 5E3IA 1FY2A 1C80A 1W0JA 1JUDA 2VSQA 4U5XA 2GZHA 2HC9A 4LRXA 4MP8A 3RRMA 2WTXA 2YOHA 3LZDA 4B71A 4OSPA 4EVSA 4YRNA 2QM8A 3IRUA 4Q12A 1CUJA 1QQ7A 3K9WA 3P26A 1M6NA 3V6LA 3C3CA 4HADA 2HLDD 1NKVA 2AFHA 2XTJA 2JI4A 2MSLA 3GBPA 4WWHA 3OZ7A 4XASA 3E2MA 3HEBA 4B7UA 4C3VA 3IEUA 1SKUA 3L0CA 3OQBA 3QLUC 4P53A 1YQDA 1ZGHA 1ZVVA 4Z86A 3GZNA 5IJ9A 5J59A 3V4RA 5DXAA 4RV5A 3IBCA 1Z0FA 1XQYA 1E1RA 2H6EA 1P0QA 2KE5A 2R25B 2W0MA 4K9PA 4PAGA 4QGFA 4CL0A 1VBMA 2VZEA 1NXTA 1XROA 1DBIA 4L0CA 3UWKA 4N0DA 5L3QA 5LC1A 4E4TA 4OHMA 2GF2A 5GADl 1CR1A 4OGGA 2CLMB 4R83A 2NQ2C 1ZZEA 4Y2GA 5AW3A 1UDRA 2V7VA 4OMFG 4RH3A 4RJIA 2BM8A 2RCNA 3FCUB 5ENVA 3LYUA 4DR1B 4X6UA 1SCBA 5FD8A 4LTMA 3VJKA 3U56A 3ZNPA 3UG6A 3PDUA 3FMPB 2JFNA 3CVWA 3Q3EA 1RWNA 2G4LA 2Y1KA 5CDYA 5CDTA 5BY2A 2AI2A 3W9BA 2DR0A 3EK2A 1P7CA 1T9HA 3MMSA 1CEYA 4LMBA 4WIAA 2JJYA 5F7JA 5JDIA 1IIBA 2OAP1 5CA0A 4Z3OA 1Q7TA 4F2DA 4F60A 5AUOB 3W5AA 1TAUA 2VCEA 2BR3A 1RM3A 3F4LA 4HEA1 3WP1B 5JECA 3CRZA 1ZN9A 2QTMA 2ZETA 5H4GA 2BFMA 2YFKA 3O9MA 5J2UA 5EXTA 3RNOA 2GBPA 4QVIA 4QICA 2ZULA 3BKXA 4RHUA 5FWYA 2QX7A 1ORWA 2JD1A 4HH4A 2C99A 2HU7A 4NCJA 3WQRA 4EUHA 4KGVA 3GY0A 1T1JA 2OBFA 4KO2S 3TZQA 1J5EB 4KLRA 5ERGB 2XYRA 3RC3A 1M1YB 1Q7EA 1YVDA 1J8QA 3O4FA 2VTVA 3T94A 1SZDA 3K6JA 3NG1A 3HY6A 4E14A 4QQFA 4JITA 1Y6FA 3H0KA 1KNXA 4JEUA 2AX4A 4M0DA 1PEDA 3IULA 1ADGA 4R9RA 1C3JA 5TPZA 4TX1A 4PGHA 1OAKA 1B41A 2QV7A 4R2JA 3IIIA 3PL5A 1MNQA 1IDN1 1WU8A 4FIDA 4LE1A 4MEJA 4FNGA 2MYPA 3ZY5A 4JELA 4B48A 4ABTA 4EJFA 4K8RB 1BS1A 1MGOA 2H5EA 1ADFA 2ATEA 4Y2TA 4XB1A 4A2CA 1TUGA 1HDEA 3PRKE 1T24A 4KGXA 3GPIA 4PXSA 4IHJF 2HW8A 3F5MA 1MJGA 3KDPA 3VZBA 2BIFA 5D01A 3ZWOA 2RHWA 4IG4A 3BB1A 1FPMA 4EMSA 3H9UA 4GKVA 4BLWA 4XJTA 1FQJA 5AKJA 4E3ZA 2M2IA 1FSZA 1CEEA 3SQLA 1YFZA 1Z33A 4B75A 1KRWA 3ZXSA 1DWPA 4U2DA 5E0OA 3T35A 2LNDA 4I8DA 2VHJA 3BGIA 2Q46A 3FLAA 3LQ2A 4KFUA 3WQBA 1QHFA 1R0CA 2KI5A 2P1DA 4FXOA 5NLLA 1CFZA 4QUIA 1YHYA 2MTBA 2QZZA 4JP5A 3VR5A 6GPBA 4PX9A 4I1YA 2JHCA 3HKEA 1ZEMA 3FPJA 1D5CA 1PEAA 4OYHA 2VBGA 3UGQA 4J1NA 1AUXA 2DUMA 2VA8A 3QVXA 3NYWA 3RUAA 5JNVA 1I5EA 2ZSBA 2CLEB 2R6DA 3LUHA 3TLYA 3EHDA 3UW1A 7AT1A 3CT6A 5I7VA 3FKSA 2IVZA 2A6PA 3MAJA 2QL5A 3DAGA 2NUAB 4R7ZA 4M9UA 1VSBA 3NGLA 4N0PA 4LI0A 1HDZA 4UBIA 4GP7A 1KE2A 5IVKA 1E1DA 1OROA 3JAMA 4J0IA 2WJWA 4D56A 1ODTC 3TW4A 2C00A 3QFFA 3PQ8A 4BPBA 3SIRA 2CMFA 4MUAA 1G7CA 3PDHA 2RHLA 4UBKA 4GYJA 4D9FA 2X4GA 2FWIA 1AK1A 3C3DA 3JYQA 3AQ4A 3KLOA 4YCBA 3DE2X 2TMYA 3UA3A 1OOEA 1Y3IA 5H59A 1DAHA 4JBIA 2JANA 3LI2A 1GPH1 2PUJA 2Q45A 1FSGA 4LJKA 4XI9A 3ZCXA 1RLMA 4DMRA 3W8FA 3H83A 3RUEA 1X80B 3P9QA 4OBXA 2QTHA 2XEXA 3VC1A 3X1KA 3N0WA 1VTKA 4B87A 3OQMA 1PQPA 5AVOA 3CLSD 2Q3DA 2G80A 3EXFA 2QD5A 2RARA 4Q24A 3DBLA 4CMIA 1Z5WA 1ENPA 2GZAA 2ORVA 4LF4B 3U19A 1SR8A 1VCMA 3R3SA 2G77B 1ODJA 1W44A 2WM8A 3DF7A 4BKQA 3SEQA 1XVAA 3PKJA 3BWMA 2HUPA 3U7QB 3JCZA 3LFHA 2WI8A 1FTWA 1S2DA 3K4QA 4WOPA 5K3FA 3W1WA 5FWDA 4F7WA 5B4UA 5TPWB 2EJTA 4ID3A 2XB4A 2YIJA 4D02A 2QUAA 3PGKA 2CUZA 1PFYA 1K5DA 4YDHB 1D6MA 2WK1A 1CSEE 5B36A 5FYDA 5ICCA 1VJGA 1XLTA 2Y67A 4X8LA 1BJKA 3HZOA 5MGBA 3U4QA 4RPJA 1W29A 3VJMA 1DAKA 3WNCA 2GNPA 2P4EA 1C7EA 1D6NA 1KIFA 4HZUA 4LYGA 4BNGA 4P5PA 4Q1CA 4F46A 4CMGA 121PA 1G8SA 2FPMA 1WD5A 3AM3A 3U62A 1ISJA 4HAVA 1XNGA 4X85A 2E4UA 4AZ3A 1E58A 5EJ6A 2PT5A 1JH9A 1KHHA 2YXLA 4TLCA 2J07A 4WLUA 1EBUA 3ESRA 1PDVA 2VJCA 3K4HA 3AFHA 4LQ4A 4PHCA 3R9IA 2AR7A 2VN8A 3IT2A 4KQKA 3ABOB 4KOEC 3GJYA 1K98A 4P0PB 2HBRA 2XQGA 2OPBA 4UQOA 5DYIA 1S0UA 2XYGA 1OLOA 3THRA 4TRNA 3I9MA 3GLGA 4GMDA 4QGSA 5JC8A 2OZPA 1BDJA 2VF4X 4XGIA 4ZQCB 4NMHA 4C4YA 1BIFA 4ACAA 3H9EO 4NPHA 4DEXA 1RXSA 4ENWA 2R8BA 3IQIX 4BC0A 1RYYA 2GAIA 2HGSA 4P35A 3LPCA 3IHKA 4EGSA 3PEYA 1SZCA 1QUEA 3C3PA 4MJ3A 5DWVA 4ZT4A 5HFJA 2I78A 2W2OA 1XEXA 3OQNA 1JILA 4GGOA 2AT1A 2J3MA 1V8ZA 1R0BA 1WF3A 5H0IA 1JG3A 4S24A 4O4IB 3ZW8A 1XD8A 3PNMA 1P18A 3A4LA 4TN1A 2RFLA 4FQ5A 4JQSA 5K6TA 4FI3F 4A3SA 4ZC8A 3IQDB 3VR2A 4IJ5A 3EA5A 2Q8PA 4AJIA 3A11A 4ZRDA 1SPBS 4Y6QA 5GONA 2I62A 3LQFA 3LV8A 3AVTA 2QMZA 2Y1OA 2E55A 2ODWA 1QMPA 3D3EA 1WQ3A 2FP3A 5B1SA 3B1ZA 1GNVA 1E9AA 1Y1SA 4QRIA 3UT0A 4B3MB 3DBHA 1KFJB 4ZRNA 5KYKA 4D82A 1GGJA 4X0EA 3HL0A 4BO6A 3AYZB 1HYQA 3ZZNA 1L8LA 4ZQBA 1QKIA 4EHLA 4BX9A 4FE3A 3T1OA 2BV3A 3QK7A 3EAFA 1CUXA 1AK2A 1KYWA 4DV3B 2V5UA 1LNSA 5JAQA 1XTVA 3SIXA 3SE7A 3V4PB 1K66A 4G01B 3R0QA 2W8ZA 2DQZA 4YALA 1UT6A 3A6HA 3GNSA 3MJVA 2OHVA 1RBYA 1L3IA 1JIQA 4YV7A 3T7TA 1A5TA 1WHTA 2XDQB 1S8FA 1YE3A 4GXNA 4LTNA 1QE5A 1UJBA 5K0LA 4ITUA 4K1LA 3BXGA 2XCOA 3LUGA 5REQA 2OPHA 4LHVA 2QTVA 4M0UA 5I9IA 1DV2A 5CFOA 5IC6A 1AZTA 1C0KA 2O20A 1WR8A 4U2GA 4YRJA 3CZCA 2OK7A 3OTOB 1N2XA 4RVUA 3ZHUA 1BEUB 1EFVA 4ZRMA 5E6SB 5AIBA 1COZA 2FGKA 3VNAA 3KQUA 4NBWA 4D6PA 3TZKA 1P8AA 4DREA 3Q9SA 1Y48E 1SVOA 4JYPA 4KIJA 4ALNA 4YAIA 1GU1A 2R6R1 2W2LA 3THWA 4TS9A 5EXDA 4JYCA 3HYSA 1YUBA 4A6PA 4KFCA 3OI7A 3VKUA 2BGRA 3M5DA 5JOQA 1KF0A 1LDGA 3UAVA 3JYLA 4C2AA 3F4KA 3HB7A 1Z2NX 3WGJA 2EDCA 4OXRA 3BK1A 5FHRA 5TMBA 4NENB 3LIPA 5JQGA 5IK2D 4OSEA 2AJCA 2P2CA 1QYVA 3RV3A 1AF7A 1LS1A 3ED1A 4MI6A 3D1JA 2H3EA 3TOVA 4OHXA 5ES4B 2I80A 4XKJA 2G9NA 2C88A 2F1RA 4KH0A 1GA4A 4BVJA 1OD6A 4H4EA 5F21A 4IXTA 1TIBA 2GJSA 1KH1A 2PIDA 1MDFA 1V47A 3OUZA 5EGSA 3E48A 1Y3DE 2HPHA 5DLQC 3ZY3A 2WT9A 2ZGVA 1RJGA 1DTWB 1OZHA 4BQNA 2AYZA 3M4XA 3RSCA 1P31A 2OORC 1IXSB 1OH8A 3S1LA 2G0NA 3UWOA 2J4CA 3U1BA 1JXAA 5IUKC 1J2JA 2PRZA 1QV7A 4UHKA 4ALLA 3V8NA 5JS2A 1QWOA 1TT5A 4F93B 4BWGA 4ED9A 3OJLA 4UXIA 3HA7A 3IOYA 2XWBF 2I3ZA 2D0PB 1KP3A 1FA9A 2D13A 2CF6A 4FFBA 2CNWA 4IZ6A 1KTVA 4DBZA 4JGGA 4K86A 4DIFA 4KITB 1AIPA 2NZYA 4UCXA 2FZGA 5LNK6 2FJPA 1YE8A 1PW5A 4FDAA 3K8ZA 2EGUA 4YJ3F 1SBHA 5F3DA 3L05A 2HSEA 2PV7A 2ZRIA 1VJ0A 1F0KA 1J8YF 3AIKA 3IUBA 4MDEA 3PC8C 4PTYA 3VYSB 3STXA 5CM9C 4LGMA 1C3EA 2NWQA 3QUTA 3MWDB 4JJFA 1D0VA 3SD7A 2CV0A 3ZS9A 4RACA 1TECE 4XYMA 5F7ZA 3HI4A 4AECA 4LCBA 1N5IA 3ETGA 1VJTA 4XLZA 1ACJA 5F5NA 1DT3A 2NT3A 4AIIA 2VQ3A 4GXRA 4NS1A 1HH4A 5BVGA 3FETA 2UZ0A 1BW9A 2EXXA 3E7WA 1VMDA 1J06A 1ZIPA 4OMDA 4P3PA 4XFJA 3TZBA 4FOPA 4C0QC 1RZVA 3VYTB 1NVUQ 2O0MA 5BQOA 3WY9A 1SQ6A 2OGUA 1BG6A 1Q7GA 2WJAA 4HN4B 4KWEA 4TUYB 4X9XA 3RTCA 4YMGA 1C29B 1WY5A 3VU1A 5HKKD 5KSPA 3TUZC 3MRSA 1WCWA 2IXDA 1EM8B 4OHWA 3QVGB 4W5QA 3C41J 1SD2A 2R00C 3L3BA 2IY7A 4BGVA 4XQ9A 3QOWA 4TT3D 1BFUA 2LP4Y 16PKA 4RFSB 1NMQA 5JE8A 3S6JA 4I55B 4Q9AA 4H1UA 4W5OA 3OPYB 1BOFA 3ESDA 3LHFA 2FFHA 4X44A 3S0JA 2Z98A 1TT7A 4HX5A 4E0BA 2POCA 2XBUA 3EARA 2ZU6A 1JU3A 3JSAA 3CWZA 5JXWA 3PCXA 5DCWA 2RHTA 3A1TA 1FLAA 5TGTA 1FMTA 1MX5A 1FIUA 1WHSA 5F2NA 2VP2A 4TZKA 1IG0A 4EB6B 3A4NA 5LZ7A 4PS1A 3DEFA 1T8SA 3EPHA 5KI6A 3BK2A 4V0KA 4JLJA 1M8PA 4ZEOA 1OT3A 3UJ8A 4NH4A 2FPOA 3AB3A 3GZ4A 1K0FA 1XZMA 2GCIA 2ZJ3A 2WUVA 5DTEA 3ROXA 1WP4A 1J2TA 5KYUB 2ZAMA 1GNPA 1KEEB 3FUCA 4XGNA 4RK7A 4ZAVA 1MO3A 3PV0A 2H4ZA 1P5ZB 1SC3A 1W0CA 3TPCA 4OYRA 2UV8A 4LBZA 5E7IA 5CCDA 1A5SB 1KIMA 3FHCB 3GXOA 1L7PA 4YCJA 3SYNA 3N74A 3ZI7A 2QRKA 5HMLA 3U17A 3RUFA 2ARKA 1RAIA 5AD1A 4R9VA 3HSYA 2PL5A 3QVWA 4GOJA 4GMFA 4O5OA 5C8YB 4TS4A 3SC6A 4BWVA 1QX3A 4FHEA 2C96A 3Q9NA 4UEKA 1GPAA 2IEGA 5CW2A 4DCUA 4CLRA 2QR2A 2ZDHA 5J40A 3QTBA 1RADA 1AHNA 4LHSA 1EFPA 5B3JA 1IRIA 5B58T 3BWXA 2AJTA 1LPPA 1T5IA 3DYBA 3I42A 3ZHRA 1A8QA 5FHQA 1UR5A 2WU3A 2ZWPA 3AONB 1ESCA 3N9IA 1Z25A 3ZU3A 2EJWA 3FPHA 2OTCA 3EVTA 1LPMA 4TSRA 4Q9IA 2NPFA 4L2IB 5T3YA 1Y1KE 1J1UA 2Q0XA 1GTMA 2C4HA 3PFIA 3MK31 3TRKA 4EY3A 4HRXA 3C85A 3LA8A 1NQXA 2J7KA 2QNRA 4FGUA 2OYCA 1COWA 3L0OA 1RC0A 3Q2OA 3UBTA 1RWOA 2OC4A 4FMDB 1TIKA 5EHIA 4Z0PA 4PLPA 1C7JA 2ZDGA 3GGJA 4O4HA 4RTRA 3RROA 5J4VA 1OGYA 1UMDB 4HG2A 3C3EA 5SZHB 4FMDF 1G20E 3NCHA 4V0NA 3H2YA 4ZARA 5JCOC 1SNYA 1GNQA 4AJHA 1IY0A 1KJJA 4YP7A 2A5JA 1N0UA 3FH0A 4ENSA 5JI2E 4YPFA 4N48A 2BBSA 2P9YA 1VLHA 3LRXA 3STYA 5HUQA 1HNXB 3U60B 3DKRA 3RRNA 1PJ3A 2CZGA 4AQ7A 1ITZA 3DDUA 1Y33E 1C9MA 1WXGA 2Q2VA 1D4AA 1MX1A 3OBIA 1V8FA 4MV8A 2G07A 1CLUA 3HRIA 3IEKA 4XQ0A 5IUJC 1KTIA 3HYTA 4J4TA 4CDMA 1AO0A 3NALA 1GUBA 4IW3B 1IN7A 1DKPA 2IT1A 1NX6A 2YYYA 5ALYA 5K05A 4PLGA 3NIWA 1L5HB 2PTGA 2VBFA 1XTQA 1DP4A 3KJEA 4JP3A 3I6ZA 4URYR 3IJ5A 4WZ6A 1E66A 5AW1A 2GGSA 2B83A 2O06A 2VQEB 2ZKLA 2HK9A 4CDRA 3UAOA 2BJVA 3OCXA 5AESA 4EO7A 1OIXA 1P2UA 1H5NA 3N8GA 4C4SA 5BSEA 3A25A 2WYVA 5L95A 4IUYA 1XXHE 1ZXLA 3EUAA 3SQOA 1XO1A 4G4IA 3TSZA 4E07A 2FZEA 4GW3A 4Y9TA 2CLFB 4MUJA 2QLBA 4FYWA 4EGCB 1IVYA 3I5YA 4LJRA 2O3RA 4EYQA 4X84A 4C9BA 3ZX4A 4UKDA 3TZHA 4UVIA 1CVRA 3K8YA 4ZA2A 3HSKA 1Z06A 3BH0A 3SX0A 2YFQA 4YMWA 5IEJA 2P40A 5IVIA 3C2QA 4OGFA 3KKQA 3O4VA 3WLMA 2I2DA 1EFRD 2FX3A 2Q6OA 2H48A 5IFKA 3D43A 1E9BA 4EB0A 1GU7A 3DE7X 5BQ5A 3ZH9B 3UT6A 2FLWA 4OU5A 1E4EB 3GN1A 4FS8A 4KWIA 1KYYA 1ZU4A 2V7TA 5FPPA 2CV2A 1JE1A 2YJ6A 1CE8A 4U2BA 2WZDA 3PXGA 3KZVA 4AZVA 2WB2A 1X87A 2CXUA 1MFPA 3B6KA 4E2FA 1KEWA 2AG0A 2YYSA 2WUWE 1IBLB 1OI2A 4QUBA 1RPAA 4FX2A 1GZ4A 3H2GA 1ICIA 3HP4A 3FSEA 4NFHA 5IWCA 2Q8QA 1OXMA 2QEQA 2W93A 2X8BA 3NWJA 4JJZA 3EBLA 3LO8A 4CF3A 2RMKA 3W5SA 4FFRA 1OIVA 1RYHA 3EEQA 3C39A 4JI8B 1UKEA 5DI3A 1WVIA 1KGSA 4KREA 2D00A 5JH7A 1Z74A 3I23A 2VF2A 1SC4A 4K7JA 3Q9LA 3PCRB 3N87A 1D4OA 5DDIP 3EAGA 2HBZA 2V7BA 4I3FA 4LAFA 1MH9A 3WGOA 4ABYA 2ROQA 1QANA 3EVDA 1VYTA 3L40A 4LX8A 4X97A 4HLUC 2QT1A 4CTKA 2XYVA 3E9DA 1T5DX 1TTQB 2HMVA 2C5HA 2I7TA 1WIWA 2NT4A 3MERA 4ODIA 1XMQB 4AMUA 3W6UA 2MMCA 4BFLA 4DSOA 2G70A 3HWX1 4DIKA 5MN5A 2OCGA 4BNDA 1KVSA 3KJIA 2GLXA 1QPBA 1MG5A 3GRUA 1NAIA 1D9XA 2ZUBA 3N6RA 4AYWA 3EFEA 1XCGB 2CE2X 3E9EA 5H3LA 1BMFD 1A8HA 2AG5A 2GJAA 5FBQB 4ZXPA 5IYZF 3RKSA 4OOFA 2WRZA 3T12A 3G0HA 1N57A 2Q3EA 2Z5VA 4JLDA 1TA0A 3HM2A 4Q1AA 5DHRA 4Y2VA 4M1OA 4PZUA 3ZJUA 3OO1A 3IH5A 2AH5A 4DDTA 3RT1A 1UWKA 3QP9A 1D1TA 2CVQA 3CLUD 4MRMB 2SBTA 2Z95A 4M9QA 2R6GA 4H60A 3KXDA 4HTFB 1P1JA 3NV7A 3QGMA 3O82A 3QHPA 4QE3A 1R88A 2YQ4A 4HVAA 3H42B 4WZBE 4A8TA 2GDJA 2CLDX 1EAMA 1HZJA 2OOSA 2YY7A 1AQUA 3A1FA 3ZX5A 4BLTA 1JL3A 2JGLA 4I4IA 3E70C 3EGDB 1OZAA 4K6CA 4YFVA 5IM5A 5TMEA 3ZQJA 4BWYA 1T8YA 1EP9A 2EZ9A 4UZSA 1UEXC 1Z4OA 1W35A 1X19A 5CFQA 4ZT2A 1GG2A 2Q1SA 4ZP1A 1VE3A 3ZC3A 3B70A 1BHQ1 1ZMTA 1PL0A 2F3QA 5HVNA 1W4ZA 4Q4JB 3TG8A 2Y1CA 1XTPA 5J58A 1ZUNB 1YZNA 4F56A 2VHUA 5JNWA 3DC2A 4M9CA 1CEXA 2IXGA 3OESA 4DBVO 2O8EB 4OBWA 5I7RA 1O9BA 1JI3A 1DJQA 1G5FA 2OYSA 5H81A 4KFRA 2RHBA 1C1XB 4JDPA 1Z6GA 3SS7X 3ZV6A 5LD2B 1PLJA 1NW8A 3C74A 3IMEA 2WF6A 3OLXA 2WTEA 2I1LA 3GUVA 3OIWA 3HCBA 2G40A 3QXCA 1ZGGA 5HIAA 3SHQA 4M7RA 5IN5A 3FHTA 2HMUA 4ND7A 2G5PA 3QUAA 3TL2A 1TZKA 1B73A 1NF2A 5CG2A 3VNUA 2Y76A 5AVKA 1T1SA 4B33A 1RKXA 2RJOA 3NKLA 3PUKA 3MJCA 2AK3A 4BB0A 1R4ZA 4F7DA 5FTLA 5DJ5A 1F12A 2IYRA 3I61A 2FWJA 1CPYA 2QL9A 4UUMA 1EXVA 2R1ZA 1SMKA 3NVKI 2JJ2A 4WUVA 3PFBA 4AUEA 2J87A 3JSXA 4IIEA 3PGJA 3QYFA 2D0DA 2W7TA 4H59A 4MRAA 3RUCA 4YREA 5J4YA 1KK2A 1QTQA 2O7NA 3AUFA 3D8HA 2MINA 1P1IA 3GEBA 3SZRA 4URVR 1TM2A 2QTNA 2PYZA 3KZ1E 5CLJA 4LCJA 3N5KA 2HU8A 3C3AA 4MUGA 2BF7A 3A27A 2YDYA 5CK5A 4R54A 4YPOA 4D44A 2VUUA 2M1ZA 3WDLA 5CT6A 2GA9A 3ZGNA 4DFDA 3NDIA 3AF4A 1NP3A 5SY6A 3OKCA 4BNHA 1JDVA 3KQOA 4RTKA 1TMOA 5DGHA 1Z22A 3TTTA 1E1NA 2FP4B 4FOOA 2C9CA 3RRXA 2GKSA 4J2TA 3S70A 1ULSA 2LRHA 1Y6QA 3IXLA 4NFYA 3AF1A 1L7RA 1AKTA 1YBMA 3U9SA 2LGJA 4O4HB 4EJMA 1WZNA 4YVFA 4HDSA 2O4UX 5LQRA 3IP7A 5TB5A 2QMEA 3KV1A 1EX6A 1P1BA 1DXHA 1DAEA 4JFAA 3RUIA 1MORA 2DU8A 1Z7BA 2MYNA 3X44A 4GX1A 5ICMA 1RQXA 3AY7A 3GYGA 4A8PA 4X6YA 2XWSA 1TDJA 4C4ZA 5IAAA 3KXKA 5T5QA 4QASA 1NM5C 4TLAA 1TTTA 2D2FA 4DJTA 1TRKA 2CVZA 4JX8A 5ESDA 3KKOA 3ZD7A 1BXGA 1YI1A 3MFYA 2HBYA 1I3OA 3GI1A 4GNRA 2POQX 3AYXB 2BKEA 5FP0A 1EVEA 3C6MA 2H7XA 4ATNA 3BGVA 1NIPA 3EFBA 5D7BA 1YNSA 3NVAA 4FJ1A 3GJTA 2CXXA 3G2QA 4LK2A 1OAOA 5M3BA 4ARBA 3N39C 4CM3A 3FLMA 1YL7A 4B3SB 3BDIA 2H3HA 4JNCA 4GKAA 3UMBA 4HO1X 3UWPA 2AFIB 3VZCA 5HKBA 3BREA 2C9DA 1VG8A 2HF7A 2JBAA 3DYIA 5C18A 4F72A 10MHA 3LU1A 4V2IA 1K86A 4PG6A 2IHTA 2AMFA 2WHPA 1ZD1A 4HNAA 2C0CA 3DT8A 3ZYCA 3L4KA 5L6MB 1DAMA 4Q03A 4WZBA 1EIZA 5L7TA 2PT6A 4RLSA 3PFWO 5KHLB 2I4RA 4D9IA 3KOYA 2C5FA 2JAPA 2YZMA 3TQHA 4XWKA 1EFTA 3H1EA 3CM0A 4EG5A 5HX7A 1PR2A 1YL5A 3OEYA 4ISCA 3FWPA 5AXBA 1VMEA 1D6JA 3H7IA 4MVWA 1UK6A 2F1JA 4LF9B 1YIDA 1KU0A 3N8HA 5EHQA 2Z6AA 1CY8A 4PVCA 2AKAB 1Z0SA 1Q83A 3V3KA 5BVHB 2P91A 2ODAA 1Y98A 2C0PA 2OCXA 3GLSA 4QA9A 3UICA 4BNVA 4ZANA 4PYRA 3TQIA 1Q3KA 1JIIA 2XTAA 4FUQA 3V2GA 1USKA 1UOPA 4HMOA 4JJ4A 4MQFB 4URZR 2NO1A 3UCXA 1JDSA 3G2NA 3IKTA 1O0SA 3FVWA 1Y34E 2VUHB 3V8BA 4CM5A 1V96A 5DTRA 1I33A 4L78A 5J23A 5KYYB 4S1OA 2QXUA 1VECA 1F0PA 3L8FA 2CL0X 3SXJA 2VPIA 3QYJA 5CB8A 2BHRA 2UUAB 1D2AA 2BFFA 1NMXA 1Y7IA 3GK3A 3CUVA 4BO8A 1V4BA 4ZI7A 4BVHA 2ZLBA 4HKTA 3QX3A 1IU9A 2O7QA 2GTPA 3AO0B 2I87A 2XF2A 3DQPA 4PZEA 1UDBA 4KQCA 4TMXA 4CU5A 4D1YA 3KWJA 4LWZA 1WA5A 3D7LA 3TL6A 1PT8A 4Y7CA 1JWLA 4F4DA 1UP7A 2ZZKA 1E8DA 3AR4A 3QW4B 2C2KA 2AE1A 3PUZA 5HJ5A 2FA9A 3TZLA 2ZVDA 5KYWB 1QLWA 1Q15A 3UXHA 3HR4A 4CM8B 1AZWA 4DMUB 1SHTX 3U3RA 1U7OA 1WBJB 1LPBB 1VZ2A 3PGMA 2DGDA 3T4XA 2R8YA 2JJQA 3VR5H 2UXDB 1EUDA 1NI4A 1RXCA 5G0WA 1LTHR 2XVXA 3KHUA 3H18A 4QNMA 2JJ1A 1GQRA 4J0EA 1CK4A 4RY0A 4JI7B 4HLUA 2Y05A 1UC9A 2WM3A 4TWBA 3JR7A 2XMZA 4DLVA 1U0RA 3QKWA 4CI0B 3MB8A 2GHQA 2Z4RA 3L1IA 1KKUA 4C7MA 3TGLA 3G23A 2RDMA 5K0BA 3PPYA 1LDBA 3LTEA 2GXQA 1L2TA 4AXXA 4R81A 1GKLA 3TW8A 3W5JA 4YC7A 4RELA 4CKEA 3K3PA 1HPLA 2PRIA 3E9ZA 3U4AA 2B3DA 1E8MA 1EXNA 4FU0A 1LFDB 4DAEA 4TS3A 3AV0B 3HDVA 1KK3A 3ZV3A 5TF0A 4FB4A 4ZN6A 1GTVA 1L7NA 4DUGD 2BFBB 3B6IA 2WSSD 4LGYA 2PUCA 1K1EA 1U8ZA 3BH6A 3GGCA 4C2UA 1G5IA 3B89A 3KUUA 3QH4A 3F46A 4MRMA 1V1MA 1W85A 2CHVA 4DMHA 3PHHA 5D1HA 4Y9RA 4EF4A 1Y9EA 3IA7A 3TLBA 4B47A 1IPFA 2ETXA 1CUFA 2VO1A 3W2TA 4HGPA 3PQ2A 2BZSA 2V03A 4BMVA 3DFIA 3RTAA 5AVYA 5DX1A 1A5AB 2NYVA 4YBRA 3ADCA 1A7JA 2ZAOA 4KQJA 3NUQA 2W2QA 1N36B 1SUPA 2D7JA 3CX3A 5IP5A 1AKYA 1P3JA 5KNBA 2I3GA 3NT2A 4I2NA 3TD6A 2OZLB 3KBOA 3UAYA 3D3JA 1EH5A 2YMLA 3COYA 4DQUA 4ANFA 1WKBA 2ZJ4A 3BDAA 4RVFA 1NBAA 3I2FA 2VHQA 4Q1EA 5EZYB 2G1PA 3NV9A 3NXKA 1QUFA 2VHEA 1J2RA 3S3TA 2CHEA 3F5QA 3DAYA 3VHLB 3ZNQA 3ZWYA 4HVCA 1U8CB 1WXWA 4DWVA 1EX9A 1RS0A 2OGWA 4FFOA 3TLEA 5DGIA 1EJ0A 3HYCA 4C5BA 2FRDC 4F9TA 1LPNA 3SFVA 1SCQA 3GGOA 5JAPA 1YDFA 3I39X 2OD2A 4L50A 3J81k 4D57A 4E32A 2PGIA 2VNSA 3Q3GE 4QYTA 1P1KA 2IQ5A 4BBJA 4QEZA 5CK4A 1NC1A 3C16C 1SG0A 4XM1A 1UJ5A 3BULA 1Y3FE 3T0FA 3R7BA 3ZV5A 5JZSA 1GFSA 1QQ5A 4O2AA 3ORRA 4V1CI 2R66A 3CPSA 4ZIRA 1V9SA 1ZLXA 4E31A 1X0XA 4Q1FA 1RPJA 1DIOB 1UWCA 3BWVA 4PRKA 1UOOA 1P0IA 1SIWA 3UJ3X 2F62A 2KBEA 4CN8A 3JWPA 3CCCA 4JA0A 2EZ4A 3D2BA 3IQWA 2IXFA 4C0SA 4WXMA 1ZI9A 1DMRA 3KPUA 4O2LA 5AJYA 2VHXA 4YJFB 4PRZA 4QRDA 3RIHA 4RTNA 2V8OA 2ZRFA 1KC1A 4UEJA 5FO0A 5CB4F 2XE8A 3D2AA 4WASA 2P7HA 1GFZA 2WW8A 3CCBA 1ZYUA 3OCZA 4H7PA 4HFJA 3BAFA 2WD9A 3KS9A 3PF9A 1MA3A 4DM4A 3EXG1 3WIEA 2FEKA 4TL8A 1IUKA 4B09A 3T7SA 4KBFA 4MGHA 4ZPJA 4ZVOA 1VPDA 2NTVA 4H7FA 4QPNA 3MLBA 4UVGA 4JB3A 2NSYA 1ZMBA 4LRUA 2YIDA 4M8LA 4ARIA 5HOEA 4RZQA 5BSHA 1JU4A 1E89A 3A37A 4HQFA 1M0EA 4OJTA 1UQUA 3GCWA 1VRCA 5FLKA 3GVXA 3G5TA 1XXHB 2ZREA 2HEGA 3N3AC 2FMXA 4JIMA 4E33A 4KI0A 4YAEA 4X7BA 1IMJA 2A9KA 3OZCA 1XRPA 4MP6A 4ZK6A 1GTZA 1MXHA 3OZEA 2BFOA 3EZFA 1CUZA 1KP9A 2G0AA 2EW1A 2Z8YM 3WLLA 3PQCA 3KTFA 2BGIA 5JQWA 1QQAA 2GAJA 4UVEA 4S1PA 5IU6A 1GPMA 3HKDB 4QO8A 5G4KA 3GUCA 2B1RA 1GL6A 2GVZC 4W8HA 2ODBA 2J5QA 2XHZA 2HCFA 1FYFA 4WOBA 1E2BA 1OGIA 4OHKA 2J59A 1WB5A 1A2BA 2J0UA 1REQB 1BHO1 1M2VA 1F1JA 1YS6A 3BIWA 3PJEA 4QOJA 4CQMD 1EWVA 1R4NA 3B3FA 3M5CA 3PC8A 5EHGA 4DLBA 5J2TA 3B7WA 1EDZA 3HUUA 2HDOA 5I7WA 1Z5UA 2ZCVA 4LW8A 2O5VA 3FWYA 3GT4A 1WSWA 1YR8A 5EIWA 5A3RA 4IEIA 2E5WA 3LECA 1E3IA 3STWA 3BMXA 3FDZA 2CVFA 4QGHA 4A0QA 3K73O 4AJ4A 1X7DA 3VISA 4YB8A 4ER5A 2BLNA 2HL6A 1VIAA 3RE1A 4BQFA 1ZD5A 3QI2A 2GPBA 4IS3A 2IBMA 4W82A 2FRDA 2QUIA 2Z83A 3LZCA 1GN8A 3HGTA 1M6YA 3R8FA 1N2OA 1OE0A 1ZN2A 1DKLA 2VDPB 3IE0A 2FUKA 3L0DA 2FEPA 1ID1A 3HFSA 5CJ2A 3WBJA 3QEAZ 4MV5A 3EZLA 3PNSA 2KPOA 3RYCB 1OXKB 1W5TA 4A6XA 2NTJA 1S4QA 3W34A 1KMIY 3C48A 4LHZA 4JC5A 2IU3A 1KJ8A 2QZ4A 3VZQA 1D3AA 4F4HA 1HDOA 3WL4A 3QVMA 3DFMA 4HFRA 5GONF 4Z1MD 3AKEA 1FC0A 2B3TA 2CYBA 3RS7A 2DJIA 3QF7A 3W4JA 2HI0A 2H1FA 1UL1X 3CTMA 1CS0A 4FFMA 2FXVA 4HFNA 4QM6A 1UBCA 2J6HA 4BU0A 3TW0A 3WVNA 1WPRA 3QLEA 1NR7A 2ONYA 4RGQA 2HIHA 4Y1GA 4AUNA 5C9ZA 4Y2HA 1VKHA 2BFFB 4Z4FA 3H99A 4JP2A 1Y1RA 4Q3DA 2QF7A 4TM7A 1HT2E 5CTJA 5IDQA 1E6LA 4FSDA 1AV7A 3BILA 4BCDA 3U37A 3KVOA 1K7CA 1JALA 4Z99A 1ZO8A 2HU5A 4TXHA 2BDEA 2GEKA 3QA9A 4TMFA 2DKOA 5A0FA 4YMTA 4MLPA 5KMGB 5IM4A 2B9VA 3ANTA 1QFYA 1YVUA 2FF7A 1IM2A 3N2LA 1HG0A 2HWUA 5JZBA 1UMCB 4AN4A 2FMTA 2C4MA 1L5RA 1NFRA 2B1QA 2AOUA 4QRHA 2XE4A 1UT8A 5KC8A 4HNRA 2ZWIA 1E64A 4QTZA 2EW2A 2O8FA 4G9GA 4NYIR 2QGZA 3JVEA 4M0EA 2WVGA 3OTGA 1I3LA 5EJ9A 3RC8A 5BR4A 3ANXA 3BE6A 3KQQA 3OZAA 5I9NA 2YICA 2W00A 2ZWOA 3PT5A 4RF2A 3PTAA 2V97A 3H9JA 4L6CA 2H52A 3A4TA 2W2KB 1VSVA 3LNCA 2J9XB 1B6SA 1XRJA 1AV6A 2VDVE 1JHRA 5REQB 4EABA 3ZUPA 1VXOA 4FFVA 4ND1A 3K8QA 3RKUA 1JU9A 2IPAB 2OEPA 1QIIA 1B15A 4ZU3A 1VBNA 4EUFA 2CYAA 4DKJA 3O83A 1WZ2A 5FTNA 3GWGA 3Q6MA 3ZNNA 3UHPA 3V2HA 4ZTZB 1Y1QA 3EG5A 3MMZA 2VDQB 2BEJA 1R15A 3LPNA 1Z5ZA 4AJNA 1MC4A 2P62A 3M9LA 1EJBA 1DJNA 3WBKA 3HCNA 3OF3A 3PYXA 3A3PA 4FWBA 3RC7A 4DN6A 4EJ6A 4EI9A 2C5AA 2PS3A 1C8KA 4J2HA 1L7EA 4YT5A 1R9GA 1E1YA 4UBLA 3GJRA 5ITVA 1CB0A 1XMIA 2ZI5A 4JOBA 1UBUS 3QVOA 4NBUA 3IAAA 4OL9A 1KDOA 3GDFA 2J3EA 2YWFA 3GPCA 2X2EA 2QI9F 1W4AA 1H9CA 1AG9A 2OG2A 1LLCA 5GPBA 4EI2A 4YRKA 1TB4A 3UGTA 2HJHA 2KMLA 1W76A 4WKCA 2P9BA 5I5GA 2HSJA 1O94C 4ZVPA 2BGNA 3AK4A 1HYEA 4J0KA 5A4FS 5IVPA 4GLOA 2A5YB 3D4OA 1S7GA 1QAQA 2IHYA 3HM9A 1U7WA 2IZ5A 3Q88A 1NJ5A 3DWEX 5BYKA 4EY6A 1N3IA 1XG5A 4DZZA 5AVQA 4QUGA 3V6MA 1MQAA 1YR6A 3CPEA 5IAOA 4LF8B 5DFAA 2XZOA 2COUA 4F45A 5HM6A 1Y3BE 2DY0A 4MHTA 2WNSA 3W77A 3BE5A 3EUWA 2C97A 3RSSA 3VHQA 2EKQA 4FBMA 2J33A 3OX4A 3ZVKA 2HN9A 5J47A 1Z8DA 3ZWXA 2DSNA 3PZRA 4N5MA 3LF2A 2AR9A 1GLGA 1L5LA 4Z7OB 1VLJA 3KLBA 4HBGA 1GEGA 1CVLA 2NU9A 4M9RA 2W5UA 3V1LA 1RZRA 1U63A 2BUAA 1JG4A 2PNFA 3JAWA 1FFCA 4M86A 1A1VA 3WYCA 2JGNA 2UVPB 2Y1FA 4MR7B 4RETA 1PFQA 4X64B 2JATA 3QU2A 4ZVRA 3ZZUA 1SCUB 3OEHD 4EKGA 3D31A 1Q77A 2BEVB 1Q19A 2WILA 5C80A 1XDZA 1FZQA 4ZOAA 3KD3A 4X8HA 3AR6A 2QBYB 3ANLA 2J85A 3MS2A 2AD5A 2ONZA 3HBFA 1PG0A 1BCSA 3QU4A 4TT3A 3D7MA 3COSA 2X0JA 3CVJA 2XIQA 5EMJA 1OAOC 1LEHA 3EXHB 2JKVA 1X38A 4HZUB 2CJXA 1DDIA 1UPCA 1UDCA 3KALA 2QDKA 3R3ZA 2ENUA 4GVXA 3ZK9A 4J91A 5DOVA 1MA0A 3RS4A 1KS9A 3T7CA 1TJ4A 1BXZA 2C8VA 2VBIA 3SC2B 3H11A 1PHPA 3IQFA 3T52A 1X1DA 4XUGB 3N8DA 3ZLTA 4EYOA 3KYCB 4OL0A 3H75A 1N2HA 4I1OA 3A1EA 4Y2XA 1U80A 3D6HA 2I7VA 5DW3A 1MOQA 5B5SA 3NHKA 4MCAA 3ESZA 4EVRA 3LSTA 1BCRB 1U0OC 4GD3Q 1VBKA 3OY2A 4HDKA 2X9QA 5EE3A 1L8QA 3D8RA 4JUFA 1QFSA 4LVNA 4ER7A 4KXLA 5FV4A 5EG5A 4G89A 4LCEA 2JIQA 1KL7A 4E5NA 2HYDA 2MSCB 4TYWA 1NNSA 1C8VB 2XAAA 3SHTA 2HH9A 4LYFA 4BNZA 3OU6A 3U7JA 3ZQ4A 2C94A 1CFJA 2XNDD 3KB6A 5HBGA 3HJGA 1OMOA 1U4NA 2B35A 3CZ5A 5CFZA 1Y7PA 3TAXA 4ZQIA 4MPTA 3U81A 4GMHA 3BH7A 3FFTA 5EXEA 2YRFA 3DDCA 3EPKA 2ZJ5A 1K9SA 2E4WA 1BHJA 3FDXA 4MR7A 4RUKA 5GZ6A 5IZ4A 4C03A 3INGA 1FXWA 3NXSA 4UMVA 2WKRA 1PFVA 4D5GA 1ICEA 4MMYB 3K0SA 3K5HA 2E21A 2ZIZA 3F9IA 3JALB 4PO9A 4Z7NB 3V1NA 5K01A 1QNLA 2J1LA 1D04A 2IYUA 4G2TA 4M9SA 4YAOA 4DCPA 2Q1XA 1HEYA 4IDDA 5K0FA 4Z4QA 2ZRJA 5CHEA 1CY7A 1NUQA 3LG2A 1Y9AA 4INAA 2FR8A 3EFHA 1SH7A 2G71A 5FEMA 4V0LA 2DPYA 4RPKA 1L5MA 5HWSA 1E5TA 3P9RA 3FOZA 1T9DA 3BEOA 4R0NA 3LE8A 4R9NA 1ADJA 3T9CA 3JYPA 3VJLA 3W78A 5KWIA 4O2AF 3Q5DA 1SU6A 3C3YA 4K3UA 4S0XA 5FWXA 5EQJB 1Q50A 4BKRA 1YASA 3IRVA 4EGFA 1EWKA 3KYCA 2ZZMA 4W9NC 4KIGA 1RZUA 3PR3A 4DA6A 3OECA 1W8IA 2WOOA 3F2VA 3K0EA 1YKGA 2CNKA 2E87A 5HCUA 4Q19A 4Q15A 4Q05A 3FOCA 3A9CA 3DS8A 3HG7A 4QEKA 3AM1A 4DMLA 1NM5A 4EHJA 1R00A 2VAMA 3KUDA 1N0VC 2BGUA 1QG6A 4GF5A 1YL6A 4LYEA 5L53A 3QVGA 2R0QC 1JLHA 1QG4A 3HV2A 4ILKA 5FQOA 2PGXA 4LK3A 3IT3A 3SDZA 2E37A 2GILA 4WNCA 1T35A 1TXGA 4I9HA 3KOXA 4Y6GB 2XOXA 2ZUSA 4W5NA 3OQ6A 3S28A 3K4PA 3TEMA 1Z16A 3ZLUA 2Y27A 5B7GA 3WLAA 3R1IA 1ZGCA 1Z3CA 3D4BA 3RVOA 5HKKA 4H3HB 4F3TA 1RT9A 1Z8NA 1HE8B 3E9MA 2CF5A 3EUEA 1MDBA 1NI3A 3AR2A 3QI7A 2CV1A 2R7NA 3BZBA 4DBLC 3K6SA 3C7DB 1TKCA 1QGDA 5JI3E 2EP5A 3JTEA 3ZVRA 3BX1A 4FMCB 4OIMA 1L0BA 2P6OA 4KO1S 4TXLA 4XXHA 5B57C 3U7FB 1QO9A 2PQ6A 1IHUA 1RVDA 1ATIA 1UFQA 1LS6A 2BTQB 2BN4A 3EWSA 4QAJA 4V3BA 3ZZMA 3DEHA 4KTTE 1FB5A 3M6UA 4NBRA 4IIYA 5L45A 3RHZA 5A9TA 1TK3A 1XAHA 1SXIA 1VM6A 3QBEA 1W4BA 4LY6A 5E7MA 2Q2NA 2QTTA 2PWZA 5KDLA 2R1VA 4O4JB 3DL7A 1Y4UA 2QL6A 5FNVF 4AY6A 2WSIA 4UUNA 3THYA 1DTWA 2DFDA 4EG4A 5ADHA 3SGLA 4OO3A 5C34B 4BLOA 3EGDA 2R5WA 1JMVA 1JECA 3N53A 2NTNA 3V5NA 1NN1A 3LT1A 3BRWD 4B0OA 1SHLA 2JIPA 2VXCA 5EFZA 4QSMA 1AO3A 1QO0D 1ZUNA 3PX3A 4G56A 4ONEA 3O9VA 3KZKA 2NNLD 1PJ8A 3K9LA 5L3SA 1YZYA 3GO4A 3U7RA 3WK4A 4D8TA 1WUHS 1QCYA 4GO1A 3LC2O 1TYAE 1ECBA 2FPGB 4TYYA 2QXYA 2W37A 3QY9A 4RV4A 3ESAA 1OXBB 4CCWA 4K6HA 2WP0A 1JLMA 1O8CA 3TQQA 1QC5A 2JIZA 4YQZA 3TNJA 2PMWB 3OHMA 1IQPA 2FSPA 4PHHA 2J0VA 2FQXA 5GV8A 4PYMA 2XI4A 2P5TB 2GYUA 4FFNA 3PE6A 4O33A 1U1GA 3EPPA 4BGIA 1XAGA 2PBZA 5H5JA 1ZI8A 3AJAA 3VH1A 1C8BA 4IIXA 3K0AA 4JL6A 3HXTA 2BKVA 4IDOA 1KI2A 5JUWA 4J0CA 4NKRA 5K6AC 3LJKA 3MCWA 4CTJA 5LCXA 1XPJA 2Z08A 2Z6VA 4UTOA 3IAM1 5C8VA 1VFPA 3WGNA 2GWRA 5HIKA 5DHTA 5E38A 1SVIA 5T6BA 2ID4A 2IODA 4RNCA 1E9EA 1VL0A 2BFDA 2XUGA 3OZBA 3DBOB 3OLQA 3EF0A 1P5RA 1M1NB 2ZT8A 3OCCA 4P32A 1SGWA 2HFJA 1VP3A 4J3JA 1K27A 5EJEA 4M99A 2UVDA 5JDIC 3TIGA 3WMWA 1G63A 1QP4A 3NOOA 5CBKA 1KWKA 5EWJB 4ZAGA 2X14A 2CXOA 4IHAA 4RGVA 4QXMA 5BQXA 1XEFA 3SAJA 1QDEA 2ZUDA 2GXAA 2XMQA 3UENA 3GP8A 3FNGA 1P4SA 1GVNB 1QU3A 1KC3A 2AG1A 3LSYA 5B4TA 3GPDG 4GZ3A 4OBEA 1T0HB 3H1FA 5TF4A 5DBFA 3S29A 4UNQA 4LYJA 2E1RA 3EGWA 4JR0A 1RC8A 3H17A 2ZTLA 1KKMA 1FP4A 3E82A 3LOUA 3S8EA 4C7BA 1OXXK 5KNBH 4NL4H 3SNKA 3WK6A 1E3MA 3GGDA 4B6QA 3RJZA 1JEOA 1JHDA 2ODPA 3B8HA 4WCFB 4Z8XA 5E1MA 2JLXA 5K8TA 1QHNA 3QBVA 4JGIA 5KKNB 3PXAA 2ZBDA 1A8PA 2QZPA 5HE9A 5KU1A 3GP5A 2IZ0A 2QN8A 4C6RA 1T4CA 5H9VA 4DWOA 2BHTA 5BWMA 5IHPA 4GKJB 4MKHA 4MI9A 2FLVA 1FP1D 2OAGA 5TT1A 4UXJA 1TU3A 3RAPR 1D2GA 4QJ4A 1N3BA 3QVJA 3T5TA 4A9AA 4D8YA 5IAGA 1MX3A 4IGIA 4Z6KA 2BSXA 4DM7A 5GIOE 3VKHA 4HTFA 1KE1A 2BEWA 3FKQA 3KZXA 4EJ2A 1GXSB 2GJ8A 2WFAA 2OHJA 1G5HA 1GN9A 1JHZA 2WVJA 3R76A 4F4CA 2CLOB 1E32A 1NHWA 1RM4A 3O93A 4I9UA 1T9CA 2H57A 4HNAB 1X7XA 4FEEA 2KX7A 4HYYA 3RODA 1R0SA 4IHJB 3HV0A 2RB4A 4EEKA 3HU5A 4M8IA 5LOVF 4I9NA 5JBQA 3ZV7A 2QVYX 3WX0A 3R5XA 1N7HA 4W7IA 2JVKA 3M49A 821PA 1PJAA 3KZMA 4FONA 4L9AA 4YN3A 4PAMA 1WM1A 5KNCA 1ADBA 3ETDA 4WOJA 1E98A 1AGPA 2X0EA 3R9XA 2ZS8A 1ENYA 3EQ8A 1G2OA 1R3DA 1W4RA 3IUSA 1F2TA 5CPFA 5L4LA 1OFHA 1TMKA 4BKUA 1XWWA 3KOOA 2C4UA 1X1RA 2VTEA 1N3YA 1G41A 3KR2A 2NP7A 3MUFA 3PUHA 1SKYB 2YY5A 4IOMA 1F20A 2VWPA 4RENA 2RGRA 5HJ2A 2HK6A 1CQPA 4AJOA 3PKZA 2JGEA 4CKCA 1Y81A 2JFBA 3H3FA 3DCIA 5ETJA 3GOQA 3UATA 1VQ1A 4C6SA 1T26A 2XX3A 1ZL2A 2W0SA 1I36A 3PWTA 4F9FA 2A14A 1G4UR 3CNNA 2ZVQX 3BL6A 5HYVA 5AQEA 1QHIA 3NPAA 4OP1A 2DERA 2GCNA 1WZIA 2HPAA 4F12A 2QYOA 1JEYB 2O0LA 3N2KB 4PAOA 1OXVA 3I72A 1YJBA 4RZ2A 1ZESA 1G16A 2H2HA 2ZSHA 2ZYRA 3C3WA 3IDOA 3FIJA 3HCEA 2V5VA 3DE3X 4Z2YA 3VMFA 4MWDA 4DJDC 3HN2A 3GR6A 4REMA 1PCXA 1XCMA 3HKBB 4DCMA 3H0CA 2O54A 1QGAA 3TINA 4IYRA 4KLZA 4PHTA 2I8AA 3M82A 4H16A 4XD7A 4QXRA 5LWQA 1SVNA 1LUAA 1W1WA 4YJ2F 3ONNA 1FDVA 2D5BA 1WKVA 3ZDXB 1I7DA 4JX9A 4X3CA 4D9HA 2FUCA 3MBIA 1JVBA 1P6QA 4JSYA 1N2CE 1RWKA 4NU8X 5KDDA 1N5KA 2V7EA 3EBPA 5GZ1A 1MV8A 3ZWPA 2WTMA 3EXEA 4XDYA 3UYKA 3R3VA 3HDHA 2FWAA 1HT0A 2GSDA 1SXGA 1KMNA 2BHNA 3COZA 3HWRA 4J1QA 1M7BA 4BTEA 3DHNA 4E2ZA 4F04A 3TL3A 2O8NA 3C5HA 4PIPA 5E9QA 1R5JA 5KYXA 3ADBA 1HWYA 1PAUA 2DT8A 4H7IA 2XOKA 1NY5A 4AZSA 4M89A 4IFBA 2O8BA 4QEDA 1MJNA 2XKBA 1ENOA 1HDRA 4HBZA 3KKPA 3LXXA 4R84A 2L18A 3OFND 2YWEA 2H9YA 3CGGA 1JLRA 4F85A 1W96A 2PD3A 2OXTA 1CXZA 1LZKA 3QVTA 4P4UA 2OBMA 3I32A 4UDXX 4AZ0A 1BRMA 2Q3CA 2YY6A 1G60A 3G9ZA 4EG7A 2VH1A 1ULZA 3E3OA 3L0IB 2ISCA 2BCGY 2PANA 2Q49A 4PVDA 4ZCRA 1CIJA 1XJWA 2HF8A 1OLSA 3P97A 4MZXA 4OI2A 3S4YA 3WV4A 3A6KA 2QJOA 2I55A 4I1RA 1A77A 2XLBA 1JPVA 4JJEA 3OQJA 3CZ9A 4UMDA 4RVNA 2HIMA 1XK7A 1R27A 2PBLA 5JWRA 1T91A 3QNUA 1X92A 3OM0A 2FN4A 5HTKA 1Q74A 4G37A 1GWNA 1PK7A 1KIAA 2QMYA 4F5WA 8LDHA 1L7VC 2GJKA 3WQSB 5FUMA 4YMSA 3WHLA 1RHUA 5MFPA 1K6EA 1USGA 2E4ZA 2II6A 2QYTA 3IEXA 1H9AA 2HSWA 2X0KA 4E51A 5KNCH 3KQHA 3IPCA 1EFCA 3L7DA 2RK3A 3M6WA 4RA6B 5A9RA 2LKCA 1XCJA 5MDHA 2HRCA 3ESYA 4OH1A 3EAQA 5LZ9A 3IT1A 1O9HA 2DRIA 1IXYA 1HYBA 1NYQA 4H7EA 2UYYA 4LGVA 4OQPA 1T8UA 2WOJA 3AVOA 4JUIA 3VAAA 3ZGOA 2P0AA 3LNTA 3ZVLA 1SEPA 4RKFA 1VRVA 4WK0B 2NOAA 1E5QA 2WZCA 4CGZA 2IKSA 2OG1A 1ZDMA 2O2HA 3DG9A 1I2DA 1H6BA 5HEKA 2C7VA 1TIPA 3FFWA 2R79A 4GGMX 3KQVA 4ZIRB 1CD5A 2FFRA 5SICE 3SHVA 2R00A 5IYZB 3PXCX 3VU3A 4MKRA 3UK0A 1NW7A 1PK8A 2WU0A 5D6OA 4RZIA 4M21A 4ZOCA 1R66A 1Z62A 3ASZA 5IRCD 3OZRA 4GPTA 3L1JA 4GR9A 1H1LB 1OHHA 2DTEA 1W75A 2HJWA 4GDMA 4PANA 4YRCA 4D98A 2ZUWA 1V9CA 4A23A 2IDJA 1E59A 1MJGM 4NBVA 5JRZA 5LZ2A 1I51A 1B7GO 2I2XB 1XPOA 5I8ZA 4E5KA 1WETA 1E79A 4INZA 2YV3A 5EWMA 1IN1A 3M9XA 1WULS 3WL7A 2A7QA 4G8CA 2GD6A 3JD4A 4UM9D 2O8VA 3K5PA 4CFYA 3HCOA 4B40A 3NKVA 5BMVA 5BWLA 4Y3UA 2AMVA 5CLGA 1GPWB 2Z8ZA 2E4VA 3DDOA 4WFKA 4RLFA 4D5EA 2AEJA 5LKRA 3L04A 4UBMA 1GAQA 4EPVA 3G8AA 4WN9A 2RGWA 3MGAA 1H2FA 4KSYA 4DDMA 3EUFA 1BYUA 3LK7A 4YCAA 3K70C 2GN4A 5G1NA 1YCGA 3MTJA 3CW2A 3W3AH 4OCZA 1YZKA 4C0AC 5IT5A 3NNNA 5CMLA 4PCVA 4N6GA 1EWRA 4Q48A 1Q11A 1Q6ZA 4NK4A 1TC1A 5CU7A 4B2LA 3Q8KA 4OA8A 1FRQA 1HDGO 4TXJA 1UWVA 4P8RA 3K1AB 1TW2A 5BR8B 4I4TB 5AJWA 1JWBB 2OQRA 1L5GB 4YJ3A 3IC5A 3R6WA 4MW6A 2WYHA 3JX9A 3AMVA 1ES9A 3JQ8A 4X00A 1CDEA 1PX0A 1ZHFA 2COKA 2X9VA 2I2CA 4FYMA 4MWBA 3X1JA 4G0UA 3EZ6A 3TOZA 1Q12A 2AN1A 4FOSA 5KREA 1R5BA 3AI3A 4OGKA 2KM1A 4ES6A 5LZ4A 1E60A 3DP7A 4RVHA 2C57A 1P17A 2AJDA 4LS3A 4WX2B 5LBUA 5SYMA 1JJIA 1GKUB 3PHIA 4E09A 3BGOS 4AKSA 5GGXA 2XGOA 1G6KA 1Y3CE 5AM5A 4NYMR 1ZJZA 4DRXB 4RK0A 1ZLYA 2RH9B 5EPEA 4ZYZA 3FPLA 1IZYA 3MF4A 5ECDA 2KJQA 3VR3A 3EA4A 3ORFA 1OFTA 3WMFA 1WOYA 5BSGA 1T6YA 2XCSB 3T1QA 4DY4A 1EPUA 1N1EA 1N7IA 1UFOA 5KTMA 5L3ZA 4C05A 2GBGA 1NVBA 2Q4TA 4II3A 4MJXA 1XDGA 5LU9A 1LU9A 4H1WA 5T7BA 1SUWA 4COOA 4POOA 1Q91A 1GKKA 3I04M 4TTVA 5ALPA 4DT1B 3AI7A 3PUWA 4XGRA 5JQGF 2YJ5A 1Q1GA 4ZPXA 1KDZA 4CQJA 1RAHA 5CFRA 6ABPA 1G38A 3BXHA 1GIAA 3OHSX 1HXHA 1CUGA 2FAXA 1QOZA 3HB0A 4A8JB 1N5DA 4EPYA 2ANCA 3BSSA 1LWNA 2ZYGA 3AR7A 1QAMA 4C01A 3GMDA 4DA9A 4OFZA 4JLMA 5DM1A 1H94A 4MZDA 2R65A 4G5OA 3GLIA 1U7UA 3OE7D 4Y1FA 1XL0A 2WAOA 1LLUA 2DR3A 3N6VA 5ALRA 5TRTA 3UAWA 4H35A 4PG5A 4LV5B 1II9A 3OJXA 4BTLA 4D99A 5JNRA 4CV3A 1DBPA 3G68A 1LDMA 4TKMA 5K4GA 3O8NA 3WGIA 3FZQA 3GFPA 4HFMA 2XKKA 1NW4A 1Y5RA 1ZBQA 2JCGA 5TMDA 1FNCA 3KD2A 1I7QB 1OH7A 1WPXA 4YEDA 5AMXA 2RAVA 4R2MA 2IUUA 4MA5A 2VPTA 2X1HA 5DGCA 1L4KA 3MNFA 4B84A 2OBXA 4CT4B 4I0WB 1EEHA 4UASA 1I7LA 1U99A 3WGYA 3FM9A 5JJBA 1H0KA 1A4XA 1L4LA 5D87A 4C7VA 4JZKA 2D0OB 1IQRA 1C7FA 2H16A 4OMUA 3VPDA 2DF8A 2O2ZA 3GARA 1V7ZA 2BE7A 4ZVUA 3V1YA 3GFSA 4DDKA 1WBBA 2FY8A 3QZUA 2C3OA 3EDOA 3OURA 4HPWA 4C6TA 1ZUHA 3LXUX 1UXJA 3UYLA 4J8PA 2B6HA 2C42A 2PKCA 4H2DA 1CJMA 1T1GA 3BZUA 3SJ7A 1FS6A 1Y0BA 2PL3A 3DEYX 3GUHA 4NPCA 4FC7A 5AW9A 3WMXA 5F7OA 4UFOA 4XR9A 3CEHA 4KV7A 4LJ7A 3EF1A 4YH1A 5KPDA 4MS1B 1YBVA 5EP1A 4EOGA 1U9CA 4XIIA 1SD5A 5K6AA 3U44A 1ABEA 4WFIA 3O94A 4NOKA 2TMGA 4NLLA 1ISGA 2WA2A 3DONA 1IBMB 5G3YA 1WEKA 2B82A 5AJZA 1MUUA 1JDBC 4TYNA 2O0JA 3DCYA 5FFMA 3U7IA 2GN6A 3I9LA 3AESB 2WR8A 2ZJ1A 3EXIB 3FUVA 3B36A 3UMGA 2PMEA 4B7ZA 1Q1BA 4EJSB 3P9NA 1J24A 3WL8A 2O8BB 2G1JA 3FRHA 3BHMA 4KXYA 2IXTA 5A4AA 4MIKA 4MW7A 2PLWA 3ECCA 1TQ8A 3D4LA 1T25A 4U4AA 4ESHA 4MVJM 3L6EA 3SSAA 1NMSA 3ZK7A 3DNMA 4AJKA 5HPYB 5HZGA 1CZRA 1P3DA 1KZ9A 5HA5A 4GPAA 3AL3A 3G7UA 4AZ0B 1V3QE 3QLVA 1TVMA 3L8CA 4RL6A 2P9CA 5KVVA 1UBRS 1GPDG 1A2KC 3HS3A 3PXXA 3L46A 4QDXA 1MB0A 3AG6A 4JCOA 3BWCA 2AZXA 1R4NB 3PEVA 4MV7A 3LY7A 1U2TA 1K2WA 2AE2A 2RC5A 1YDWA 2GK6A 3E03A 2WWWA 3AIOA 5K3AA 2KLBA 3RU2A 3VPGA 1OTYA 3ZR4B 4CHTA 5F64A 3N8IA 3FSRA 4KQHA 3HN7A 1K7SN 4U3JB 5IBQA 5AICA 2WWXA 3BGDA 1XLTC 1ZEJA 1QDUA 2YJTD 1J6UA 1VMKA 3L5OA 5JS8A 1F8FA 1NZFA 4X1YA 1P62B 2O3SA 2NV6A 2RB5A 3P27A 4KQXA 4TQGA 2Z1MA 1EP1B 5FT9A 4HDNB 2V7QA 4ZT6A 4QOSA 1OLUB 4MDFA 4B2PA 2BLLA 3IQHX 4NS4A 2XQVA 5TV2A 1ORTA 4PHGA 4EG1A 2VPPA 1TTHA 2BZ1A 2CLHB 4NY1A 2JGAA 2QTBA 2ZS9A 2VCHA 1M0SA 1PVVA 4FMPA 4GPZA 3IKLA 1MNAA 4XPIB 3RW9A 1EFVB 2IYOA 1C0EA 5E6SA 2Y6VA 1SPXA 2FUEA 3N3BC 2GZ1A 4L27A 5KQPA 1A8SA 2ZJ6A 1NVDA 2Q4EA 4E88A 5FOUA 3B1WA 5F4BA 4BNJA 2PWYA 3C6ZA 5FWAA 4GG1A 2H2WA 3VO8A 1N2JA 2P3SA 3AX6A 1H85A 3LA6A 4HYQA 3LT4A 5KQGA 5AK3A 3G9TA 2P9EA 3INRA 4MQEB 2BYTA 3QPCA 1LTKA 2EFYA 1RI5A 1U8YA 5L51A 1LSUA 1W9MA 3JXEA 3VMMA 4Z9AA 3B7GA 2RKBA 1QO0A 2VYVD 3GT3A 4P3XA 3HB5X 4JQOA 1LCIA 4EARA 3QRWA 1OREA 2H31A 3AOEC 5JHHB 3QKUA 3OMLA 3NDBB 3E27A 3UMVA 3I3SR 4WKBA 1T5BA 4M88A 3ZY2A 3DKVA 1NYLA 221PA 4MVJG 2WKSA 1QJCA 4KQGA 2NZ2A 4OF4A 3K5IA 5A3VA 1R9JA 5AHRA 1L7DA 2PYIA 3ICPA 2B98A 1IHOA 2OZLA 2Q28A 4NONA 3EZ9A 1I6MA 4MI3A 4FGJA 3C98A 1PWZA 2NO5A 3CH6A 3FDZB 4YP6A 1UBTS 1YH3A 4IO1A 5FLYA 3WB1A 2QENA 1K88A 3EZYA 3N0TA 1RXIA 4EPXA 3FJOA 2JI7A 5EEHA 4A0SA 2NAPA 3O1LA 4MWEA 5JVDA 3RAFC 1XQXA 3DLPX 2XQKA 3A26A 3GGGA 4L0DA 4LN1A 5JD6A 1B8NA 3T5BA 5JS6A 2B1JA 1EZZA 2C4TA 2EKZA 4FT2A 4Q9JA 1GAJA 5ECYA 3UTDA 4Z1OA 1XCPA 3BZWA 3KL2A 3ZKWA 5TMPA 3O26A 4UHFA 4JJ7A 2PD6A 2J5BA 2ODQA 2O07A 1C9YA 1X8JA 1GRRA 3E15A 1FDIA 1Z4QA 2HA0A 4RC9A 3VDQA 5JMWA 1B1CA 4I4TA 4WL0A 1A50B 2I29A 4QUEA 4MS3A 3MWDA 2QTZA 1IJBA 3OU2A 4PO1A 7MDHA 4PYLA 4Z0HO 2QAGA 3TSYA 1S5PA 4LJ6A 3A9WA 2PAAA 1MH1A 5BN5B 2KHZA 3IUQA 3KJFA 2X22A 5IDXA 1D8TA 3THWB 1AUPA 1WUKS 2A59A 1GG5A 1RI4A 1I3KA 5J4KA 1AHHA 1XZBA 1SVUA 2AQHA 3ANMA 3C3KA 5AKIA 4JR2A 4R7TA 5AR1A 4IIHA 3KZNA 1LWOA 1O87A 1RKVA 1GZUA 2DBZA 2EWWA 4QIHA 2X9NA 4UPVA 4WNAB 3DBRB 5G3ZA 5JWOA 1E9CA 4D3XA 3LW7A 3ZWDA 1PQ4A 1QIFA 2ZE5A 3G2LA 4HY3A 1X39A 2PT7A 4NBNA 2WSLA 3OAAD 4H4CA 5JFOA 2WZBA 3BSYA 4A03A 3QMVA 5D3MA 3I0MA 5C8ZA 4JI4B 1N4DA 4N47A 5F2EA 2HT1A 2R3SA 1B3BA 1ZZGA 3BORA 3QBTA 4FEGA 4MRVA 3QWIA 3TZ6A 4DLPA 1PX2A 5DNYB 2QLLA 2QXTA 1YD7A 3JQ6A 4GE0A 5K09A 4IJ6A 2J6BA 4S1TA 2W90A 4Y30A 3AJDA 5FNZA 4YP9A 4ZYLA 2QU7A 3QY0A 4RK4A 1XEXB 2HHAA 3EZ2A 3G9QA 1CF9A 1UADA 3I9OA 4WECA 4BJ3A 2AX3A 5C5EA 1U28A 1R64A 4OTZA 3SR0A 3JVIA 3REQB 5KSZA 3IIJA 5AUPB 2FWRA 1XRRA 4MW4A 3COJA 1O2DA 4JC8A 1T3ZA 2AEEA 3IVMA 2B2CA 4QVKA 4Y1RB 3H4TA 4WA8A 2CE7A 4FFBB 1VE5A 4C1NA 1T9AA 1Z4KA 4JI6B 1U8UA 1JF8A 2IYZA 3DAOA 3L5KA 2W58A 4QU8A 3RVPA 3M70A 4BC1A 3LL7A 2D5LA 2VDJA 3G1TA 1ADCA 1E3TA 1XJ5A 1C3VA 1CDZA 3I4CA 3LWDA 3RVQA 4BQOA 1USUA 3EVFA 1C4OA 5E9JA 1VBFA 4HQNA 3K2BA 4P36A 4X95A 2QAGB 2I4OA 2BTQA 3LQQA 4C3ZA 2M6KA 1G59A 3DBHB 4EA6A 5J63A 3PDWA 1K0UA 2H4JA 2X4LA 4MR8B 5IEBA 5L3VA 2CMHA 3KFVA 2ZUCA 4HPJB 4XE5A 3GIDA 1MO5A 3VR6A 2IIPA 4TSKA 2A3NA 1T36A 4RKQA 3QLUA 1UXIA 3MRXA 1KS2A 3GA0A 2OCBA 2QAGC 3H9CA 2FOXA 4YJ2B 3RWMB 2BBTA 4KDFA 3SFTA 1OTXA 2F3UA 5CLLA 3ZE6A 4US2R 5LBTA 4RTMA 3A14A 4OFWA 3CRNA 3A2KA 3G8DA 3LPDA 5EIBD 1WDWB 5KSOA 1KJYA 1NI5A 1W5AA 4Z3KA 5K99A 1XVVA 3CBQA 4Y0NA 3RI3A 4B3IA 3BFKA 3IPRA 4K1XA 3T7AA 5G0TA 2X8AA 1LW7A 3CVXA 4D74A 3REOA 1B14A 3WBBA 1ZD9A 2G36A 1PJLA 4CLRB 2C78A 3NOVA 5C0OE 3CURA 1I10A 2WAAA 1ECGA 3JQ7B 4P0TA 3H2IA 3N7UA 5B1EA 3UMJA 1IBRA 3O38A 2GN8A 1FW8A 2KS6A 2Z0MA 3S55A 2X7XA 2BPOA 4L73A 1GUDA 1SBQA 4OQNA 3PG5A 4UHDA 5DYYA 3RG8A 5JARA 4AMBA 2WF7A 3KV3O 5D00A 5M7EA 2UXCB 1QC5B 1N0WA 1QIEA 2LCIA 2ZITA 2ZBGA 3FYTA 5ALZA 3MLEA 4TQAA 2YBEA 4DMCA 1ZKMA 3L6CA 1XZQA 3E81A 4JB2A 5DBOA 2VDUE 4FHGA 4KXWA 4F6RB 2XD9A 4ASUA 3BWYA 1OC4A 3C7TA 4U0KA 2QVCA 3OEHA 2DT5A 1RD4A 2NXJA 2BKLA 1G8HA 4WZZA 2PAFA 2UVPA 1E4YA 2IUFA 2EEZA 3IT0A 3QOYA 1VJ5A 2A1TS 3LCRA 4LXYA 3P32A 3C6BA 1E3LA 4GIBA 3CPHA 3ZCTA 5C1PA 4NABA 3SU8A 2PGLA 3Q7SA 4U9HS 2KB0A 1Q7BA 4H6VA 3W8NA 1RQ2A 1ZNQO 3PITA 3QM1A 5AUNB 4MUEA 2JEYA 3PD7A 4MULA 3W3ZB 1V4NA 4G8DA 5F3RA 1QORA 2LCFA 3L0BA 3OCYA 3K9BA 3T7IA 4MUKA 3BWEA 4C20A 3DDZX 1NFFA 2CXQA 2CXNA 1V1RA 2AJBA 3E5MA 3QPWA 1KPHA 4XRRA 2ENWA 2IPNA 3CC8A 2FUG6 3AETA 4C3OB 2JH9A 3KEFA 4DYDA 4J3NA 3FBWA 2O50A 2SECE 1QF6A 3TEJA 4OUDA 4XJXA 4ZZ2A 4E12A 1S7CA 1GG9A 2W2KA 5TC4A 1ZMRA 3T6KA 4BCBA 3I12A 1ORDA 3SI7A 3BFPA 4D8UA 2IS2A 1SURA 6Q21A 4LDRA 1Z6YA 2R9VA 1YZTA 4K9KA 3WL6A 2N47A 1J0AA 1Z7GA 4HMPA 2D1SA 4OP2A 2QUZA 1HLFA 3NTOA 2GZSA 4YJKA 1KFEB 2WIKA 1N3LA 3G6WA 4FD2A 4QBFA 2FZKA 1B2RA 2XTNA 2X9GA 1TE2A 4PYKA 5CRIA 1E2UA 2OO7A 5IXSA 2HCBA 1GGMA 4JH0A 3D7NA 3JAKB 3PSAA 4TWAA 5CNMA 2ZZNA 5MGNA 3QBJA 2FR8C 3PLAE 3KCQA 3CS3A 3RTBA 1EUZA 3ZDAA 1SXJC 3ZHQA 3UMMA 1JIUA 2YWGA 2VBCA 3ELUA 4IF6A 4A26A 1OSNA 1Q0TA 1BWQA 3LT2A 5JS1A 1UZMA 3MT0A 3X1MA 3FKJA 1SBZA 4HWRA 2WA1A 2WU1A 3UXMA 1UJ4A 2GF9A 2J3LA 1PQYA 1KR2A 3I5MA 3FTQA 3P9CA 4WXEA 2WEKA 4MVJE 1Z0UA 4ZI7F 2YXDA 4MS4A 4B80A 3NR2A 3CMMA 4KMRA 4TUYA 2HTFA 4P84A 3LHIA 4B6OA 2EJVA 3BFVA 3RSHA 2JBHA 1N8SA 1T1RA 3NDPA 3D3WA 4AULA 4OYLA 1MP0A 1QCCA 1RJFA 1UPAA 4HX9A 4JT2A 5IC5A 4X6XA 2P9ZA 3EGOA 4ZU6X 4B7CA 4WK4B 3RLFA 1ENZA 2OLEA 1O97D 2EFEB 1L5HA 3LGAA 1QS0B 1MIOB 1JZQA 4Z4IA 4CF4A 4DF3A 2DLCX 5CYPA 5K0NA 4B8ZA 4QHSA 3ZLJA 2HV9A 2GT1A 3BS4A 4QXQA 4UQPA 1KAOA 1BAPA 1FQOA 2AWNA 3ABRB 2W8BB 3OZUA 3RFUA 2QX8A 1SU7A 3RVMA 5L3SB 3O47A 4H7KA 4HT3B 4JUBA 1ELOA 3PTZA 4RZ3A 5LQSA 2A94A 3NQ41 1CS4C 1MVOA 1L7AA 3K31A 3E7DA 3EGIA 4TRMA 1MRNA 1MRSA 3I52A 3QYAA 2JFZA 4UZFA 3RJTA 4BNDB 1NLZA 1ZH2A 4DXDA 5FEUA 2WABA 4G85A 3OZTA 4KV9A 4E7PA 2O3JA 4Y2UA 2QBYA 4EAQA 4UNPA 2GESA 2WFZA 2VLBA 3RSGA 5IJZA 1XLUA 2VL7A 3OU7A 3EBOA 1V9LA 1M2OA 2IIVA 4J0JA 1J25A 1JHPA 2NGRA 2IITA 1RJDA 5JRJA 1A9PA 1KEKA 5JVDF 2HMSA 2J6CA 3O3NB 3WJ7A 1C3OA 1TAQA 2FPUA 1P9RA 2HMAA 3NM5A 4BNTA 4NMMA 3S1AB 3RPEA 3G7SA 5CDUA 2DTXA 1A5ZA 1FLNA 1P7WA 1CBUA 4JUCA 5AOAA 3FI0A 3GDGA 1ECLA 3NORA 4RF5A 1WCV1 3DQZA 4M1YA 2DWUA 3QU7A 4O02B 3VOTA 4ZD6A 4I1VA 5DXJA 1HBJA 1W36B 1FYDA 1T3LA 3GUZA 2XA2A 2BFDB 3NBZC 4NG5A 4ND8B 1QHGA 2A9JA 4EVIA 3LYHA 2N9UA 2X5XA 2OFXA 1NE7A 3WK8A 2C2ZA 3LYAA 2NUTB 4DG5A 3UQZA 1MVLA 1VCOA 1A76A 4YMUA 4XTRA 2CUNA 1EHIA 4B73A 3B60A 1QB7A 5DHSA 2OXIA 1ZIDA 1W6RA 3PXBA 4PLZA 3W5UA 4AL4A 3CX8A 1HE5A 2J67A 4J0DA 4E22A 5IJ0A 3NRBA 3JWIA 2DWCA 4ERNA 3DHVA 2P3QA 4NQRA 2YR0A 4PZLA 4LF7B 1Y8RB 1VIYA 2NZJA 4OKNA 1O96B 5GJBA 1ULUA 5FXMA 1X1AA 4BNFA 3BPSA 5TQ2A 3BTVA 3TOXA 4PSVA 1V37A 5F78A 2X19A 1CJCA 1VIMA 2CKMA 1IZ8A 1U0JA 4KQMA 1UC5B 5AM0A 4R1PA 1FRFS 1FUYB 3JW8A 1NF9A 5IAKA 4N1AA 3BJMA 4UDNA 2VKQA 3DM5A 2OXEA 4UPEA 1FDUA 3ENVA 4ZTUB 4NCHA 4GPD1 3W6ZA 1J8VA 1NIJA 5AVSA 5M34A 2Q5JA 1SAYA 2FFBA 2P8JA 3ZEIA 2IDMA 1M6VB 2QT0A 3AR3A 2C5BA 4QBIA 3WYGA 1JDZA 2Y9MB 1J70A 2A9RA 3AFNA 4BO0A 4GC5A 5BOSB 4WHMA 4L3WA 5FWXB 3L6BA 1AN9A 4MV9A 1P45A 3RSQA 3UFXB 1XMOB 1GPNA 5JBIA 2C2OA 3HVIA 4RD1A 2Z8XA 3NHAA 1JQ3A 2WFMA 5EFOA 2Q0SA 4N3CA 2JGIA 3GEIA 4V1CB 1ZKDA 3KQLA 3QSYA 3RK1A 1I2MA 4JC4A