2XDEA

Crystal structure of the complex of pf-3450074 with an engineered hiv capsid n terminal domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
136
structure length
136
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVGEPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title HIV Capsid is a Tractable Target for Small Molecule Therapeutic Intervention.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 47
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2xdeA00
2V4XA 4XFYA 1M9EC 1U7KA 2XGUA 4U0CA 5HGMA 2LF4A 2M8NA 4E92A 2KGFA 2PWOA 1P7NA 4INBA 3NTEA 4U0FA 4WYMA 3H4EA 1L6NA 4XRQA 4E91A 4U0BA 4DGAC 1M9XC 3P05A 1GWPA 2XGYA 2GONA 2Y4ZA 1M9FC 1M9DC 4DGEC 3MGEA 4XFXA 2PWMA 1EM9A 1AFVA 2X82A 4HTWA 4U0AA 2XDEA 4B4NA 4U0DA 2EIAA 1QRJA 4XFZA 2X2DD 5HGNA 4J93A 2M8LA 5HGKA 4NX4C 3H47A 4XROA 2X83A 4PH0A 2JPRA 2WLVB 5HGLA 1M9CC 1EIAA 1M9YC 2XGVA 1AK4C 4U0EA 4LQWC 2WLVA 2GOLB 4PH3A 2PXRC 4QNBA 1G03A 1E6JP 3BP9A 2M8PA 5JPAA 4PH2A 5HGOA 1D1DA
chains in the Genus database with same CATH superfamily
2V4XA 4XFYA 1M9EC 1U7KA 2XGUA 4U0CA 5HGMA 2LF4A 2M8NA 4E92A 2KGFA 2PWOA 1P7NA 4INBA 3NTEA 4U0FA 4WYMA 3H4EA 1L6NA 4XRQA 4E91A 4U0BA 4DGAC 1M9XC 3P05A 1GWPA 2XGYA 2GONA 2Y4ZA 1M9FC 1M9DC 4DGEC 3MGEA 4XFXA 2PWMA 1EM9A 1AFVA 2X82A 4HTWA 4U0AA 2XDEA 4B4NA 4U0DA 2EIAA 1QRJA 4XFZA 2X2DD 5HGNA 4J93A 2M8LA 5HGKA 4NX4C 3H47A 4XROA 2X83A 4PH0A 2JPRA 2WLVB 5HGLA 1M9CC 1EIAA 1M9YC 2XGVA 1AK4C 4U0EA 4LQWC 2WLVA 2GOLB 4PH3A 2PXRC 4QNBA 1G03A 1E6JP 3BP9A 2M8PA 5JPAA 4PH2A 5HGOA 1D1DA
chains in the Genus database with same CATH topology
2V4XA 4XFYA 1M9EC 1U7KA 2XGUA 4U0CA 5HGMA 2LF4A 2M8NA 4E92A 2KGFA 2PWOA 1P7NA 4INBA 3NTEA 4U0FA 4WYMA 3H4EA 1L6NA 4XRQA 4E91A 4U0BA 4DGAC 1M9XC 3P05A 1GWPA 2XGYA 2GONA 2Y4ZA 1M9FC 1M9DC 4DGEC 3MGEA 4XFXA 2PWMA 1EM9A 1AFVA 2X82A 4HTWA 4U0AA 2XDEA 4B4NA 4U0DA 2EIAA 1QRJA 4XFZA 2X2DD 5HGNA 4J93A 2M8LA 5HGKA 4NX4C 3H47A 4XROA 2X83A 4PH0A 2JPRA 2WLVB 5HGLA 1M9CC 1EIAA 1M9YC 2XGVA 1AK4C 4U0EA 4LQWC 2WLVA 2GOLB 4PH3A 2PXRC 4QNBA 1G03A 1E6JP 3BP9A 2M8PA 5JPAA 4PH2A 5HGOA 1D1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4X A;  4XFY A;  1M9E C;  1U7K A;  2XGU A;  4U0C A;  5HGM A;  2LF4 A;  2M8N A;  4E92 A;  2KGF A;  2PWO A;  1P7N A;  4INB A;  3NTE A;  4U0F A;  4WYM A;  3H4E A;  1L6N A;  4XRQ A;  4E91 A;  4U0B A;  4DGA C;  1M9X C;  3P05 A;  1GWP A;  2XGY A;  2GON A;  2Y4Z A;  1M9F C;  1M9D C;  4DGE C;  3MGE A;  4XFX A;  2PWM A;  1EM9 A;  1AFV A;  2X82 A;  4HTW A;  4U0A A;  2XDE A;  4B4N A;  4U0D A;  2EIA A;  1QRJ A;  4XFZ A;  2X2D D;  5HGN A;  4J93 A;  2M8L A;  5HGK A;  4NX4 C;  3H47 A;  4XRO A;  2X83 A;  4PH0 A;  2JPR A;  2WLV B;  5HGL A;  1M9C C;  1EIA A;  1M9Y C;  2XGV A;  1AK4 C;  4U0E A;  4LQW C;  2WLV A;  2GOL B;  4PH3 A;  2PXR C;  4QNB A;  1G03 A;  1E6J P;  3BP9 A;  2M8P A;  5JPA A;  4PH2 A;  5HGO A;  1D1D A; 
#chains in the Genus database with same CATH topology
 2V4X A;  4XFY A;  1M9E C;  1U7K A;  2XGU A;  4U0C A;  5HGM A;  2LF4 A;  2M8N A;  4E92 A;  2KGF A;  2PWO A;  1P7N A;  4INB A;  3NTE A;  4U0F A;  4WYM A;  3H4E A;  1L6N A;  4XRQ A;  4E91 A;  4U0B A;  4DGA C;  1M9X C;  3P05 A;  1GWP A;  2XGY A;  2GON A;  2Y4Z A;  1M9F C;  1M9D C;  4DGE C;  3MGE A;  4XFX A;  2PWM A;  1EM9 A;  1AFV A;  2X82 A;  4HTW A;  4U0A A;  2XDE A;  4B4N A;  4U0D A;  2EIA A;  1QRJ A;  4XFZ A;  2X2D D;  5HGN A;  4J93 A;  2M8L A;  5HGK A;  4NX4 C;  3H47 A;  4XRO A;  2X83 A;  4PH0 A;  2JPR A;  2WLV B;  5HGL A;  1M9C C;  1EIA A;  1M9Y C;  2XGV A;  1AK4 C;  4U0E A;  4LQW C;  2WLV A;  2GOL B;  4PH3 A;  2PXR C;  4QNB A;  1G03 A;  1E6J P;  3BP9 A;  2M8P A;  5JPA A;  4PH2 A;  5HGO A;  1D1D A; 
#chains in the Genus database with same CATH homology
 2V4X A;  4XFY A;  1M9E C;  1U7K A;  2XGU A;  4U0C A;  5HGM A;  2LF4 A;  2M8N A;  4E92 A;  2KGF A;  2PWO A;  1P7N A;  4INB A;  3NTE A;  4U0F A;  4WYM A;  3H4E A;  1L6N A;  4XRQ A;  4E91 A;  4U0B A;  4DGA C;  1M9X C;  3P05 A;  1GWP A;  2XGY A;  2GON A;  2Y4Z A;  1M9F C;  1M9D C;  4DGE C;  3MGE A;  4XFX A;  2PWM A;  1EM9 A;  1AFV A;  2X82 A;  4HTW A;  4U0A A;  2XDE A;  4B4N A;  4U0D A;  2EIA A;  1QRJ A;  4XFZ A;  2X2D D;  5HGN A;  4J93 A;  2M8L A;  5HGK A;  4NX4 C;  3H47 A;  4XRO A;  2X83 A;  4PH0 A;  2JPR A;  2WLV B;  5HGL A;  1M9C C;  1EIA A;  1M9Y C;  2XGV A;  1AK4 C;  4U0E A;  4LQW C;  2WLV A;  2GOL B;  4PH3 A;  2PXR C;  4QNB A;  1G03 A;  1E6J P;  3BP9 A;  2M8P A;  5JPA A;  4PH2 A;  5HGO A;  1D1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...