2XDEA

Crystal structure of the complex of pf-3450074 with an engineered hiv capsid n terminal domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
136
structure length
136
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVGEPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title HIV Capsid is a Tractable Target for Small Molecule Therapeutic Intervention.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 47
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2xdeA00
3NTEA 2M8NA 4DGEC 2WLVA 5JPAA 2JPRA 2PWMA 4PH3A 3BP9A 1M9YC 2XGYA 4U0EA 1AK4C 4NX4C 4XFXA 1L6NA 4HTWA 5HGLA 1EM9A 4XROA 4U0BA 2LF4A 4DGAC 1AFVA 1M9EC 4INBA 4WYMA 2XGVA 1P7NA 4E92A 1M9CC 2M8PA 4U0FA 2GONA 1M9FC 1U7KA 4E91A 4U0AA 5HGKA 4XFYA 1G03A 1E6JP 2X2DD 4QNBA 4PH0A 4LQWC 2PWOA 1GWPA 2Y4ZA 4U0DA 5HGMA 4U0CA 1M9DC 2PXRC 5HGOA 1D1DA 2KGFA 3P05A 3MGEA 2XDEA 4PH2A 2EIAA 4XRQA 2GOLB 3H4EA 2XGUA 3H47A 4XFZA 4B4NA 1QRJA 1EIAA 2X83A 1M9XC 2V4XA 2X82A 4J93A 2WLVB 2M8LA 5HGNA
chains in the Genus database with same CATH superfamily
3NTEA 2M8NA 4DGEC 2WLVA 5JPAA 2JPRA 2PWMA 4PH3A 3BP9A 1M9YC 2XGYA 4U0EA 1AK4C 4NX4C 4XFXA 1L6NA 4HTWA 5HGLA 1EM9A 4XROA 4U0BA 2LF4A 4DGAC 1AFVA 1M9EC 4INBA 4WYMA 2XGVA 1P7NA 4E92A 1M9CC 2M8PA 4U0FA 2GONA 1M9FC 1U7KA 4E91A 4U0AA 5HGKA 4XFYA 1G03A 1E6JP 2X2DD 4QNBA 4PH0A 4LQWC 2PWOA 1GWPA 2Y4ZA 4U0DA 5HGMA 4U0CA 1M9DC 2PXRC 5HGOA 1D1DA 2KGFA 3P05A 3MGEA 2XDEA 4PH2A 2EIAA 4XRQA 2GOLB 3H4EA 2XGUA 3H47A 4XFZA 4B4NA 1QRJA 1EIAA 2X83A 1M9XC 2V4XA 2X82A 4J93A 2WLVB 2M8LA 5HGNA
chains in the Genus database with same CATH topology
3NTEA 2M8NA 4DGEC 2WLVA 5JPAA 2JPRA 2PWMA 4PH3A 3BP9A 1M9YC 2XGYA 4U0EA 1AK4C 4NX4C 4XFXA 1L6NA 4HTWA 5HGLA 1EM9A 4XROA 4U0BA 2LF4A 4DGAC 1AFVA 1M9EC 4INBA 4WYMA 2XGVA 1P7NA 4E92A 1M9CC 2M8PA 4U0FA 2GONA 1M9FC 1U7KA 4E91A 4U0AA 5HGKA 4XFYA 1G03A 1E6JP 2X2DD 4QNBA 4PH0A 4LQWC 2PWOA 1GWPA 2Y4ZA 4U0DA 5HGMA 4U0CA 1M9DC 2PXRC 5HGOA 1D1DA 2KGFA 3P05A 3MGEA 2XDEA 4PH2A 2EIAA 4XRQA 2GOLB 3H4EA 2XGUA 3H47A 4XFZA 4B4NA 1QRJA 1EIAA 2X83A 1M9XC 2V4XA 2X82A 4J93A 2WLVB 2M8LA 5HGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTE A;  2M8N A;  4DGE C;  2WLV A;  5JPA A;  2JPR A;  2PWM A;  4PH3 A;  3BP9 A;  1M9Y C;  2XGY A;  4U0E A;  1AK4 C;  4NX4 C;  4XFX A;  1L6N A;  4HTW A;  5HGL A;  1EM9 A;  4XRO A;  4U0B A;  2LF4 A;  4DGA C;  1AFV A;  1M9E C;  4INB A;  4WYM A;  2XGV A;  1P7N A;  4E92 A;  1M9C C;  2M8P A;  4U0F A;  2GON A;  1M9F C;  1U7K A;  4E91 A;  4U0A A;  5HGK A;  4XFY A;  1G03 A;  1E6J P;  2X2D D;  4QNB A;  4PH0 A;  4LQW C;  2PWO A;  1GWP A;  2Y4Z A;  4U0D A;  5HGM A;  4U0C A;  1M9D C;  2PXR C;  5HGO A;  1D1D A;  2KGF A;  3P05 A;  3MGE A;  2XDE A;  4PH2 A;  2EIA A;  4XRQ A;  2GOL B;  3H4E A;  2XGU A;  3H47 A;  4XFZ A;  4B4N A;  1QRJ A;  1EIA A;  2X83 A;  1M9X C;  2V4X A;  2X82 A;  4J93 A;  2WLV B;  2M8L A;  5HGN A; 
#chains in the Genus database with same CATH topology
 3NTE A;  2M8N A;  4DGE C;  2WLV A;  5JPA A;  2JPR A;  2PWM A;  4PH3 A;  3BP9 A;  1M9Y C;  2XGY A;  4U0E A;  1AK4 C;  4NX4 C;  4XFX A;  1L6N A;  4HTW A;  5HGL A;  1EM9 A;  4XRO A;  4U0B A;  2LF4 A;  4DGA C;  1AFV A;  1M9E C;  4INB A;  4WYM A;  2XGV A;  1P7N A;  4E92 A;  1M9C C;  2M8P A;  4U0F A;  2GON A;  1M9F C;  1U7K A;  4E91 A;  4U0A A;  5HGK A;  4XFY A;  1G03 A;  1E6J P;  2X2D D;  4QNB A;  4PH0 A;  4LQW C;  2PWO A;  1GWP A;  2Y4Z A;  4U0D A;  5HGM A;  4U0C A;  1M9D C;  2PXR C;  5HGO A;  1D1D A;  2KGF A;  3P05 A;  3MGE A;  2XDE A;  4PH2 A;  2EIA A;  4XRQ A;  2GOL B;  3H4E A;  2XGU A;  3H47 A;  4XFZ A;  4B4N A;  1QRJ A;  1EIA A;  2X83 A;  1M9X C;  2V4X A;  2X82 A;  4J93 A;  2WLV B;  2M8L A;  5HGN A; 
#chains in the Genus database with same CATH homology
 3NTE A;  2M8N A;  4DGE C;  2WLV A;  5JPA A;  2JPR A;  2PWM A;  4PH3 A;  3BP9 A;  1M9Y C;  2XGY A;  4U0E A;  1AK4 C;  4NX4 C;  4XFX A;  1L6N A;  4HTW A;  5HGL A;  1EM9 A;  4XRO A;  4U0B A;  2LF4 A;  4DGA C;  1AFV A;  1M9E C;  4INB A;  4WYM A;  2XGV A;  1P7N A;  4E92 A;  1M9C C;  2M8P A;  4U0F A;  2GON A;  1M9F C;  1U7K A;  4E91 A;  4U0A A;  5HGK A;  4XFY A;  1G03 A;  1E6J P;  2X2D D;  4QNB A;  4PH0 A;  4LQW C;  2PWO A;  1GWP A;  2Y4Z A;  4U0D A;  5HGM A;  4U0C A;  1M9D C;  2PXR C;  5HGO A;  1D1D A;  2KGF A;  3P05 A;  3MGE A;  2XDE A;  4PH2 A;  2EIA A;  4XRQ A;  2GOL B;  3H4E A;  2XGU A;  3H47 A;  4XFZ A;  4B4N A;  1QRJ A;  1EIA A;  2X83 A;  1M9X C;  2V4X A;  2X82 A;  4J93 A;  2WLV B;  2M8L A;  5HGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...