2XDEA

Crystal structure of the complex of pf-3450074 with an engineered hiv capsid n terminal domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
136
structure length
136
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVGEPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV Capsid is a Tractable Target for Small Molecule Therapeutic Intervention.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN
total genus 47
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2xdeA00
2M8LA 1E6JP 2WLVB 2PWMA 2KGFA 1M9FC 4XFXA 2V4XA 4XFZA 5HGNA 4NX4C 2Y4ZA 3P05A 4INBA 4LQWC 1GWPA 1P7NA 1M9XC 4QNBA 1M9EC 2WLVA 1QRJA 4B4NA 1AK4C 2X83A 4XRQA 3H4EA 4U0CA 4PH0A 2GONA 4PH2A 1AFVA 4U0FA 2X82A 4U0DA 4U0AA 4DGAC 2XGUA 1M9YC 3BP9A 4E92A 2GOLB 2PWOA 2XGYA 4J93A 5HGOA 1L6NA 1M9DC 4E91A 1G03A 2X2DD 4U0BA 5HGKA 2LF4A 3NTEA 1U7KA 5JPAA 3MGEA 1EIAA 4XFYA 2XDEA 4DGEC 2JPRA 5HGMA 2EIAA 3H47A 2M8PA 2XGVA 4PH3A 4XROA 4WYMA 5HGLA 1EM9A 1M9CC 2M8NA 4U0EA 1D1DA 4HTWA 2PXRC
chains in the Genus database with same CATH superfamily
2M8LA 1E6JP 2WLVB 2PWMA 2KGFA 1M9FC 4XFXA 2V4XA 4XFZA 5HGNA 4NX4C 2Y4ZA 3P05A 4INBA 4LQWC 1GWPA 1P7NA 1M9XC 4QNBA 1M9EC 2WLVA 1QRJA 4B4NA 1AK4C 2X83A 4XRQA 3H4EA 4U0CA 4PH0A 2GONA 4PH2A 1AFVA 4U0FA 2X82A 4U0DA 4U0AA 4DGAC 2XGUA 1M9YC 3BP9A 4E92A 2GOLB 2PWOA 2XGYA 4J93A 5HGOA 1L6NA 1M9DC 4E91A 1G03A 2X2DD 4U0BA 5HGKA 2LF4A 3NTEA 1U7KA 5JPAA 3MGEA 1EIAA 4XFYA 2XDEA 4DGEC 2JPRA 5HGMA 2EIAA 3H47A 2M8PA 2XGVA 4PH3A 4XROA 4WYMA 5HGLA 1EM9A 1M9CC 2M8NA 4U0EA 1D1DA 4HTWA 2PXRC
chains in the Genus database with same CATH topology
2M8LA 1E6JP 2WLVB 2PWMA 2KGFA 1M9FC 4XFXA 2V4XA 4XFZA 5HGNA 4NX4C 2Y4ZA 3P05A 4INBA 4LQWC 1GWPA 1P7NA 1M9XC 4QNBA 1M9EC 2WLVA 1QRJA 4B4NA 1AK4C 2X83A 4XRQA 3H4EA 4U0CA 4PH0A 2GONA 4PH2A 1AFVA 4U0FA 2X82A 4U0DA 4U0AA 4DGAC 2XGUA 1M9YC 3BP9A 4E92A 2GOLB 2PWOA 2XGYA 4J93A 5HGOA 1L6NA 1M9DC 4E91A 1G03A 2X2DD 4U0BA 5HGKA 2LF4A 3NTEA 1U7KA 5JPAA 3MGEA 1EIAA 4XFYA 2XDEA 4DGEC 2JPRA 5HGMA 2EIAA 3H47A 2M8PA 2XGVA 4PH3A 4XROA 4WYMA 5HGLA 1EM9A 1M9CC 2M8NA 4U0EA 1D1DA 4HTWA 2PXRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8L A;  1E6J P;  2WLV B;  2PWM A;  2KGF A;  1M9F C;  4XFX A;  2V4X A;  4XFZ A;  5HGN A;  4NX4 C;  2Y4Z A;  3P05 A;  4INB A;  4LQW C;  1GWP A;  1P7N A;  1M9X C;  4QNB A;  1M9E C;  2WLV A;  1QRJ A;  4B4N A;  1AK4 C;  2X83 A;  4XRQ A;  3H4E A;  4U0C A;  4PH0 A;  2GON A;  4PH2 A;  1AFV A;  4U0F A;  2X82 A;  4U0D A;  4U0A A;  4DGA C;  2XGU A;  1M9Y C;  3BP9 A;  4E92 A;  2GOL B;  2PWO A;  2XGY A;  4J93 A;  5HGO A;  1L6N A;  1M9D C;  4E91 A;  1G03 A;  2X2D D;  4U0B A;  5HGK A;  2LF4 A;  3NTE A;  1U7K A;  5JPA A;  3MGE A;  1EIA A;  4XFY A;  2XDE A;  4DGE C;  2JPR A;  5HGM A;  2EIA A;  3H47 A;  2M8P A;  2XGV A;  4PH3 A;  4XRO A;  4WYM A;  5HGL A;  1EM9 A;  1M9C C;  2M8N A;  4U0E A;  1D1D A;  4HTW A;  2PXR C; 
#chains in the Genus database with same CATH topology
 2M8L A;  1E6J P;  2WLV B;  2PWM A;  2KGF A;  1M9F C;  4XFX A;  2V4X A;  4XFZ A;  5HGN A;  4NX4 C;  2Y4Z A;  3P05 A;  4INB A;  4LQW C;  1GWP A;  1P7N A;  1M9X C;  4QNB A;  1M9E C;  2WLV A;  1QRJ A;  4B4N A;  1AK4 C;  2X83 A;  4XRQ A;  3H4E A;  4U0C A;  4PH0 A;  2GON A;  4PH2 A;  1AFV A;  4U0F A;  2X82 A;  4U0D A;  4U0A A;  4DGA C;  2XGU A;  1M9Y C;  3BP9 A;  4E92 A;  2GOL B;  2PWO A;  2XGY A;  4J93 A;  5HGO A;  1L6N A;  1M9D C;  4E91 A;  1G03 A;  2X2D D;  4U0B A;  5HGK A;  2LF4 A;  3NTE A;  1U7K A;  5JPA A;  3MGE A;  1EIA A;  4XFY A;  2XDE A;  4DGE C;  2JPR A;  5HGM A;  2EIA A;  3H47 A;  2M8P A;  2XGV A;  4PH3 A;  4XRO A;  4WYM A;  5HGL A;  1EM9 A;  1M9C C;  2M8N A;  4U0E A;  1D1D A;  4HTW A;  2PXR C; 
#chains in the Genus database with same CATH homology
 2M8L A;  1E6J P;  2WLV B;  2PWM A;  2KGF A;  1M9F C;  4XFX A;  2V4X A;  4XFZ A;  5HGN A;  4NX4 C;  2Y4Z A;  3P05 A;  4INB A;  4LQW C;  1GWP A;  1P7N A;  1M9X C;  4QNB A;  1M9E C;  2WLV A;  1QRJ A;  4B4N A;  1AK4 C;  2X83 A;  4XRQ A;  3H4E A;  4U0C A;  4PH0 A;  2GON A;  4PH2 A;  1AFV A;  4U0F A;  2X82 A;  4U0D A;  4U0A A;  4DGA C;  2XGU A;  1M9Y C;  3BP9 A;  4E92 A;  2GOL B;  2PWO A;  2XGY A;  4J93 A;  5HGO A;  1L6N A;  1M9D C;  4E91 A;  1G03 A;  2X2D D;  4U0B A;  5HGK A;  2LF4 A;  3NTE A;  1U7K A;  5JPA A;  3MGE A;  1EIA A;  4XFY A;  2XDE A;  4DGE C;  2JPR A;  5HGM A;  2EIA A;  3H47 A;  2M8P A;  2XGV A;  4PH3 A;  4XRO A;  4WYM A;  5HGL A;  1EM9 A;  1M9C C;  2M8N A;  4U0E A;  1D1D A;  4HTW A;  2PXR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...