2XE1A

Molecular insights into clinically isolated ompc mutants and their role in multi-drug resistance
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
354
structure length
354
Chain Sequence
AEVYNKDGNKLDLYGKVDGLHYFSDDKSVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNAPESENNSWTRVAFAGLKFQDIGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGQNGSVSGENDPDFTGHGITNNGRKALRQNGDGVGGSITYDYEGFGVGAAVSSSKRTWDQNNTGLIGTGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSVAYLQSKGKNLGVVAGRNYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRAAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN C
publication title Altered Antibiotic Transport in Ompc Mutants Isolated from a Series of Clinical Strains of Multi-Drug Resistant E. Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 105
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2xe1A00
2QTKA 5DL5A 4FMSA 2J4UP 3K19A 6PRNA 3POXA 4D65A 2Y0HA 4RJWA 4AUIA 5PRNA 4C69X 1GFPA 1HXUA 4LSEA 2J1NA 4LSIA 2K4TA 8PRNA 3O0EA 4FSPA 4LSHA 2XE1A 4BUMX 2Y2XA 2XE2A 2O4VA 4GCPA 3T0SA 3SYSA 1GFMA 1HXTA 3SY9A 3WI4A 5JDPA 2PORA 3T20A 2FGQX 1E54A 4D5UA 2ZFGA 2XE5A 3VZTX 3JTYA 5DL7A 3NSGA 1OSMA 2FGRA 2Y0KA 5FVNA 2OMFA 3SY7A 1MPFA 2XE3A 4LSFA 3FYXA 4KR8A 4KR4A 1H6S1 5DL6A 3POUA 3WI5A 3UPGA 4D64A 2Y0LA 3VY9X 5DL8A 4FRXA 7PRNA 4JFBA 3HW9A 4FRTA 4RJXA 1PHOA 3POQA 1PRNA 1GFNA 4FOZA 3SYBA 1BT9A 3EMNX 3PRNA 2XG6A 3PORA 3T24A 1BH3A 3SZDA 4FSOA 1GFQA 3VY8X 2PRNA 2ODJA 3HWBA 1GFOA 4GCSA 3VZWX 4FT6A 1OPFA 4GCQA 1HXXA 3SZVA 3A2SX 3UU2A 3VZUX 2ZLDA 4KRAA
chains in the Genus database with same CATH superfamily
2QTKA 1ZHWA 2N2MA 5DL5A 4FQEA 4FMSA 3DWOX 4UB8O 2F1VA 3JCUO 5E79O 5KAIO 1ZHXA 2F1TA 3K19A 1BXWA 2R4NA 2KDYA 4O4XA 6PRNA 2J4UP 3POXA 3LK2A 3AA6B 4D65A 2Y0HA 2LFUA 4AYEC 3DZMA 3AAEB 4RJWA 5EE2A 2WJRA 4AUIA 1G90A 2ERVA 5PRNA 4C69X 1GFPA 1HXUA 1QJPA 2LHFA 1QJ9A 2XTRA 2J1NA 4LSEA 3V8UA 3PGUA 4LSIA 3RBHA 2K4TA 1T16A 8PRNA 4XNKA 1YS5A 2K0LA 3O0EA 4FSPA 4LSHA 4RLCA 3LK41 2R4PA 2XE1A 4N75A 3BS0A 2W81C 5ADXK 2M06A 2ZLDA 4BUMX 5T5FA 5ADXL 2Y2XA 3LK42 4C4VB 4C00A 2XE2A 3BRYA 2O4VA 4GF4A 3AA6A 2MNHA 4GCPA 4K3BA 4O3XB 3T0SA 5G3AA 2R4LA 3AAEA 3SYSA 3PQUA 1GFMA 1HXTA 2R89A 3SY9A 4AYDC 3TZGA 3WI4A 5JDPA 3PQSA 3DA3A 5G38A 2IWVA 1QJ8A 2PORA 3T20A 4XNLA 1MM4A 2KXPB 1ORMA 3PF1A 2FGQX 1E54A 2WVPA 4FZLA 4JCHA 4RLBA 5D5DA 4D5UA 5H2FO 3A0BO 4N58A 4C4VA 2ZFGA 4FESA 2R88A 3HOLA 4AKMA 4CTDA 2KC0A 1ZHTA 2JQYA 2X27X 2XE5A 3GP6A 4PR7A 3VZTX 3JTYA 5DL7A 3QRAA 4O3YA 4B61A 3HOEA 4FZNA 3NSGA 4QQ1A 2X9KA 1OSMA 2YNKA 3A0HO 5AFUK 4AYID 3DWNA 2FGRA 2KZ7B 3PGRA 3AA0B 3PGSA 5AFUL 2Y0KA 4U9CA 5FVNA 2IWWA 2OMFA 3C5OA 3SY7A 1MPFA 2KXPA 2W80C 2XE3A 2YPVA 3VE2A 4LSFA 5G39A 3DA4A 3FYXA 4KR8A 1H6S1 4KR4A 4PJ0O 4AFKA 5B5EO 3NJTA 2M07A 4FUVA 5DL6A 1Q9GA 3POUA 5GTIO 3WI5A 3UPGA 1MM5A 4D64A 5B66O 4F4BA 2Y0LA 5G26A 5TISO 3VY9X 4G75A 4GHBA 3G7GA 3AA7B 4FRXA 5DL8A 4AKRB 7PRNA 4O49A 4JFBA 4AZLA 1P4TA 3HW9A 4FRTA 4RL9A 2KZ7A 4E1SA 4RJXA 1PHOA 3AA0A 3KZIO 2XMXA 4G76A 3POQA 1PRNA 4AYMC 4O4UA 3WU2O 1GFNA 1T1LA 4FOZA 3VE1A 2R4OA 3AA1B 3SYBA 1THQA 1BT9A 3EMNX 3PRNA 2AXTO 2Y7SA 4FZMA 2F1CX 5GTHO 2GE4A 5IYUA 4K3CA 4PUXA 2XG6A 5KAFO 4E1TA 3PORA 4N59A 1Q9FA 4UB6O 4N74A 3T24A 3AA7A 1IZNB 2JMMA 3LK3B 4AKRA 1BH3A 3BRZA 3QRCA 3SZDA 4FSOA 5GV0A 1GFQA 3VY8X 3AAAA 2PRNA 2ODJA 2N2LA 3AA1A 3HWBA 1ZHZA 4IL6O 3LK2B 1ZHYA 2XTQA 4O3ZA 1GFOA 3KVDD 4GCSA 3UAQA 2R8AA 4O3WA 3VZWX 4FT6A 1OPFA 2MHLA 4GCQA 4Z3TA 1HXXA 3SZVA 4AYNA 3AAAB 3A2SX 2WJQA 3UU2A 3VZUX 1S5LO 1IZNA 4KRAA 3LK3A
chains in the Genus database with same CATH topology
2QTKA 1ZHWA 2N2MA 5DL5A 4FMSA 2F1VA 1ZHXA 2F1TA 3K19A 1BXWA 4O4XA 2KDYA 6PRNA 2J4UP 3POXA 3LK2A 3AA6B 4D65A 2Y0HA 2LFUA 4AYEC 3AAEB 4RJWA 5EE2A 4AUIA 1G90A 2ERVA 5PRNA 4C69X 1GFPA 1HXUA 1QJPA 2LHFA 1QJ9A 2XTRA 2J1NA 4LSEA 3V8UA 4LSIA 3RBHA 2K4TA 8PRNA 4XNKA 1YS5A 2K0LA 3O0EA 4FSPA 4LSHA 4RLCA 3LK41 2XE1A 2W81C 5ADXK 2M06A 2ZLDA 4BUMX 5T5FA 5ADXL 2Y2XA 3LK42 2XE2A 2O4VA 4GF4A 3AA6A 2MNHA 4GCPA 4O3XB 3T0SA 3AAEA 3SYSA 3PQUA 1GFMA 1HXTA 3SY9A 4AYDC 3TZGA 3WI4A 5JDPA 3PQSA 3DA3A 1QJ8A 2PORA 3T20A 4XNLA 1MM4A 2KXPB 1ORMA 4FZLA 2FGQX 1E54A 4JCHA 4RLBA 5D5DA 4D5UA 4N58A 2ZFGA 4FESA 3HOLA 4AKMA 2KC0A 1ZHTA 2X27X 2XE5A 3GP6A 4B61A 3VZTX 3JTYA 5DL7A 3QRAA 4O3YA 3HOEA 4FZNA 3NSGA 4QQ1A 1OSMA 2YNKA 5AFUK 4AYID 2FGRA 2KZ7B 3AA0B 5AFUL 2Y0KA 4U9CA 5FVNA 2OMFA 3C5OA 3SY7A 1MPFA 2KXPA 2W80C 2XE3A 2YPVA 3VE2A 4LSFA 3DA4A 3FYXA 4KR8A 1H6S1 4KR4A 4AFKA 2M07A 4FUVA 5DL6A 1Q9GA 3POUA 3WI5A 3UPGA 1MM5A 4D64A 4F4BA 2Y0LA 5G26A 3VY9X 4G75A 4GHBA 3G7GA 3AA7B 4FRXA 5DL8A 4AKRB 7PRNA 4O49A 4JFBA 4AZLA 1P4TA 3HW9A 4FRTA 4RL9A 2KZ7A 4E1SA 4RJXA 1PHOA 3AA0A 2XMXA 4G76A 3POQA 1PRNA 4AYMC 4O4UA 1GFNA 4FOZA 3VE1A 3AA1B 3SYBA 1THQA 1BT9A 3EMNX 3PRNA 2Y7SA 4FZMA 2GE4A 5IYUA 4PUXA 2XG6A 4E1TA 3PORA 4N59A 1Q9FA 4AKRA 3T24A 3AA7A 1IZNB 2JMMA 3LK3B 1BH3A 3SZDA 3QRCA 4FSOA 5GV0A 1GFQA 3VY8X 3AAAA 2PRNA 2ODJA 2N2LA 3AA1A 3HWBA 1ZHZA 3LK2B 1ZHYA 4O3ZA 1GFOA 3KVDD 4GCSA 3UAQA 4O3WA 3VZWX 4FT6A 1OPFA 2MHLA 4GCQA 4Z3TA 1HXXA 3SZVA 4AYNA 3AAAB 3A2SX 3UU2A 3VZUX 2XTQA 1IZNA 4KRAA 3LK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTK A;  5DL5 A;  4FMS A;  2J4U P;  3K19 A;  6PRN A;  3POX A;  4D65 A;  2Y0H A;  4RJW A;  4AUI A;  5PRN A;  4C69 X;  1GFP A;  1HXU A;  4LSE A;  2J1N A;  4LSI A;  2K4T A;  8PRN A;  3O0E A;  4FSP A;  4LSH A;  2XE1 A;  4BUM X;  2Y2X A;  2XE2 A;  2O4V A;  4GCP A;  3T0S A;  3SYS A;  1GFM A;  1HXT A;  3SY9 A;  3WI4 A;  5JDP A;  2POR A;  3T20 A;  2FGQ X;  1E54 A;  4D5U A;  2ZFG A;  2XE5 A;  3VZT X;  3JTY A;  5DL7 A;  3NSG A;  1OSM A;  2FGR A;  2Y0K A;  5FVN A;  2OMF A;  3SY7 A;  1MPF A;  2XE3 A;  4LSF A;  3FYX A;  4KR8 A;  4KR4 A;  1H6S 1;  5DL6 A;  3POU A;  3WI5 A;  3UPG A;  4D64 A;  2Y0L A;  3VY9 X;  5DL8 A;  4FRX A;  7PRN A;  4JFB A;  3HW9 A;  4FRT A;  4RJX A;  1PHO A;  3POQ A;  1PRN A;  1GFN A;  4FOZ A;  3SYB A;  1BT9 A;  3EMN X;  3PRN A;  2XG6 A;  3POR A;  3T24 A;  1BH3 A;  3SZD A;  4FSO A;  1GFQ A;  3VY8 X;  2PRN A;  2ODJ A;  3HWB A;  1GFO A;  4GCS A;  3VZW X;  4FT6 A;  1OPF A;  4GCQ A;  1HXX A;  3SZV A;  3A2S X;  3UU2 A;  3VZU X;  2ZLD A;  4KRA A; 
#chains in the Genus database with same CATH topology
 2QTK A;  1ZHW A;  2N2M A;  5DL5 A;  4FQE A;  4FMS A;  3DWO X;  4UB8 O;  2F1V A;  3JCU O;  5E79 O;  5KAI O;  1ZHX A;  2F1T A;  3K19 A;  1BXW A;  2R4N A;  2KDY A;  4O4X A;  6PRN A;  2J4U P;  3POX A;  3LK2 A;  3AA6 B;  4D65 A;  2Y0H A;  2LFU A;  4AYE C;  3DZM A;  3AAE B;  4RJW A;  5EE2 A;  2WJR A;  4AUI A;  1G90 A;  2ERV A;  5PRN A;  4C69 X;  1GFP A;  1HXU A;  1QJP A;  2LHF A;  1QJ9 A;  2XTR A;  2J1N A;  4LSE A;  3V8U A;  3PGU A;  4LSI A;  3RBH A;  2K4T A;  1T16 A;  8PRN A;  4XNK A;  1YS5 A;  2K0L A;  3O0E A;  4FSP A;  4LSH A;  4RLC A;  3LK4 1;  2R4P A;  2XE1 A;  4N75 A;  3BS0 A;  2W81 C;  5ADX K;  2M06 A;  2ZLD A;  4BUM X;  5T5F A;  5ADX L;  2Y2X A;  3LK4 2;  4C4V B;  4C00 A;  2XE2 A;  3BRY A;  2O4V A;  4GF4 A;  3AA6 A;  2MNH A;  4GCP A;  4K3B A;  4O3X B;  3T0S A;  5G3A A;  2R4L A;  3AAE A;  3SYS A;  3PQU A;  1GFM A;  1HXT A;  2R89 A;  3SY9 A;  4AYD C;  3TZG A;  3WI4 A;  5JDP A;  3PQS A;  3DA3 A;  5G38 A;  2IWV A;  1QJ8 A;  2POR A;  3T20 A;  4XNL A;  1MM4 A;  2KXP B;  1ORM A;  3PF1 A;  2FGQ X;  1E54 A;  2WVP A;  4FZL A;  4JCH A;  4RLB A;  5D5D A;  4D5U A;  5H2F O;  3A0B O;  4N58 A;  4C4V A;  2ZFG A;  4FES A;  2R88 A;  3HOL A;  4AKM A;  4CTD A;  2KC0 A;  1ZHT A;  2JQY A;  2X27 X;  2XE5 A;  3GP6 A;  4PR7 A;  3VZT X;  3JTY A;  5DL7 A;  3QRA A;  4O3Y A;  4B61 A;  3HOE A;  4FZN A;  3NSG A;  4QQ1 A;  2X9K A;  1OSM A;  2YNK A;  3A0H O;  5AFU K;  4AYI D;  3DWN A;  2FGR A;  2KZ7 B;  3PGR A;  3AA0 B;  3PGS A;  5AFU L;  2Y0K A;  4U9C A;  5FVN A;  2IWW A;  2OMF A;  3C5O A;  3SY7 A;  1MPF A;  2KXP A;  2W80 C;  2XE3 A;  2YPV A;  3VE2 A;  4LSF A;  5G39 A;  3DA4 A;  3FYX A;  4KR8 A;  1H6S 1;  4KR4 A;  4PJ0 O;  4AFK A;  5B5E O;  3NJT A;  2M07 A;  4FUV A;  5DL6 A;  1Q9G A;  3POU A;  5GTI O;  3WI5 A;  3UPG A;  1MM5 A;  4D64 A;  5B66 O;  4F4B A;  2Y0L A;  5G26 A;  5TIS O;  3VY9 X;  4G75 A;  4GHB A;  3G7G A;  3AA7 B;  4FRX A;  5DL8 A;  4AKR B;  7PRN A;  4O49 A;  4JFB A;  4AZL A;  1P4T A;  3HW9 A;  4FRT A;  4RL9 A;  2KZ7 A;  4E1S A;  4RJX A;  1PHO A;  3AA0 A;  3KZI O;  2XMX A;  4G76 A;  3POQ A;  1PRN A;  4AYM C;  4O4U A;  3WU2 O;  1GFN A;  1T1L A;  4FOZ A;  3VE1 A;  2R4O A;  3AA1 B;  3SYB A;  1THQ A;  1BT9 A;  3EMN X;  3PRN A;  2AXT O;  2Y7S A;  4FZM A;  2F1C X;  5GTH O;  2GE4 A;  5IYU A;  4K3C A;  4PUX A;  2XG6 A;  5KAF O;  4E1T A;  3POR A;  4N59 A;  1Q9F A;  4UB6 O;  4N74 A;  3T24 A;  3AA7 A;  1IZN B;  2JMM A;  3LK3 B;  4AKR A;  1BH3 A;  3BRZ A;  3QRC A;  3SZD A;  4FSO A;  5GV0 A;  1GFQ A;  3VY8 X;  3AAA A;  2PRN A;  2ODJ A;  2N2L A;  3AA1 A;  3HWB A;  1ZHZ A;  4IL6 O;  3LK2 B;  1ZHY A;  2XTQ A;  4O3Z A;  1GFO A;  3KVD D;  4GCS A;  3UAQ A;  2R8A A;  4O3W A;  3VZW X;  4FT6 A;  1OPF A;  2MHL A;  4GCQ A;  4Z3T A;  1HXX A;  3SZV A;  4AYN A;  3AAA B;  3A2S X;  2WJQ A;  3UU2 A;  3VZU X;  1S5L O;  1IZN A;  4KRA A;  3LK3 A; 
#chains in the Genus database with same CATH homology
 2QTK A;  1ZHW A;  2N2M A;  5DL5 A;  4FMS A;  2F1V A;  1ZHX A;  2F1T A;  3K19 A;  1BXW A;  4O4X A;  2KDY A;  6PRN A;  2J4U P;  3POX A;  3LK2 A;  3AA6 B;  4D65 A;  2Y0H A;  2LFU A;  4AYE C;  3AAE B;  4RJW A;  5EE2 A;  4AUI A;  1G90 A;  2ERV A;  5PRN A;  4C69 X;  1GFP A;  1HXU A;  1QJP A;  2LHF A;  1QJ9 A;  2XTR A;  2J1N A;  4LSE A;  3V8U A;  4LSI A;  3RBH A;  2K4T A;  8PRN A;  4XNK A;  1YS5 A;  2K0L A;  3O0E A;  4FSP A;  4LSH A;  4RLC A;  3LK4 1;  2XE1 A;  2W81 C;  5ADX K;  2M06 A;  2ZLD A;  4BUM X;  5T5F A;  5ADX L;  2Y2X A;  3LK4 2;  2XE2 A;  2O4V A;  4GF4 A;  3AA6 A;  2MNH A;  4GCP A;  4O3X B;  3T0S A;  3AAE A;  3SYS A;  3PQU A;  1GFM A;  1HXT A;  3SY9 A;  4AYD C;  3TZG A;  3WI4 A;  5JDP A;  3PQS A;  3DA3 A;  1QJ8 A;  2POR A;  3T20 A;  4XNL A;  1MM4 A;  2KXP B;  1ORM A;  4FZL A;  2FGQ X;  1E54 A;  4JCH A;  4RLB A;  5D5D A;  4D5U A;  4N58 A;  2ZFG A;  4FES A;  3HOL A;  4AKM A;  2KC0 A;  1ZHT A;  2X27 X;  2XE5 A;  3GP6 A;  4B61 A;  3VZT X;  3JTY A;  5DL7 A;  3QRA A;  4O3Y A;  3HOE A;  4FZN A;  3NSG A;  4QQ1 A;  1OSM A;  2YNK A;  5AFU K;  4AYI D;  2FGR A;  2KZ7 B;  3AA0 B;  5AFU L;  2Y0K A;  4U9C A;  5FVN A;  2OMF A;  3C5O A;  3SY7 A;  1MPF A;  2KXP A;  2W80 C;  2XE3 A;  2YPV A;  3VE2 A;  4LSF A;  3DA4 A;  3FYX A;  4KR8 A;  1H6S 1;  4KR4 A;  4AFK A;  2M07 A;  4FUV A;  5DL6 A;  1Q9G A;  3POU A;  3WI5 A;  3UPG A;  1MM5 A;  4D64 A;  4F4B A;  2Y0L A;  5G26 A;  3VY9 X;  4G75 A;  4GHB A;  3G7G A;  3AA7 B;  4FRX A;  5DL8 A;  4AKR B;  7PRN A;  4O49 A;  4JFB A;  4AZL A;  1P4T A;  3HW9 A;  4FRT A;  4RL9 A;  2KZ7 A;  4E1S A;  4RJX A;  1PHO A;  3AA0 A;  2XMX A;  4G76 A;  3POQ A;  1PRN A;  4AYM C;  4O4U A;  1GFN A;  4FOZ A;  3VE1 A;  3AA1 B;  3SYB A;  1THQ A;  1BT9 A;  3EMN X;  3PRN A;  2Y7S A;  4FZM A;  2GE4 A;  5IYU A;  4PUX A;  2XG6 A;  4E1T A;  3POR A;  4N59 A;  1Q9F A;  4AKR A;  3T24 A;  3AA7 A;  1IZN B;  2JMM A;  3LK3 B;  1BH3 A;  3SZD A;  3QRC A;  4FSO A;  5GV0 A;  1GFQ A;  3VY8 X;  3AAA A;  2PRN A;  2ODJ A;  2N2L A;  3AA1 A;  3HWB A;  1ZHZ A;  3LK2 B;  1ZHY A;  4O3Z A;  1GFO A;  3KVD D;  4GCS A;  3UAQ A;  4O3W A;  3VZW X;  4FT6 A;  1OPF A;  2MHL A;  4GCQ A;  4Z3T A;  1HXX A;  3SZV A;  4AYN A;  3AAA B;  3A2S X;  3UU2 A;  3VZU X;  2XTQ A;  1IZN A;  4KRA A;  3LK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...