2XEFA

Human glutamate carboxypeptidase ii in complex with antibody- recruiting molecule arm-p8
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVQPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
total genus 268
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xefA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xefA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xefA02
3RAMA 1ZG8A 4UEEA 3H8EA 2ANPA 3MRUA 3N5FA 5K8PA 2PJ6A 4P4FA 4C8UA 1CX8A 3BHXA 1DTDA 1YW6A 3HUVA 4MCSA 2AFOA 4F9VA 4GM5A 2Q43A 2QJ8A 4TJVA 5LRJA 2XEGA 1YMEA 2PJ7A 4C8FA 4FUUA 2ZEDA 1VHOA 4A38A 3IO1A 5LRKA 4P45A 4P44A 2J9AA 4CPAA 1XFOA 4P4BA 4ZY0A 5HVGA 2PJ4A 4IAVA 2PRQA 2PJBA 3KHXA 3I1UA 4KSIA 4FWUA 4ZX9A 4NGSA 2HC9A 1R3NA 3B3VA 3PFEA 1CBXA 3PFOA 4YWYA 2CTBA 3FECA 1TF8A 4R7MA 4H2KA 3WC6A 3K2KA 4NGPA 3WABA 3SJFA 2ZOGA 2V8HA 3L2NA 3SJEA 2PJ9A 3V38A 3IC1A 5J1QA 5CPAA 4UF4A 3NH4A 3GLJA 2XEFA 4FAIA 3B3SA 4PXCA 2C6GA 3ISXA 1XJOA 3B3TA 4G1PA 3I6SA 3PEIA 2PJ1A 2QYVA 3VTAA 1CG2A 4NGMA 3S9LA 5DS0A 1OBRA 1VIXA 3KGQA 2DEAA 3VH9A 2C6CA 4MCPA 4OMEA 5I4MA 1F57A 1ZLIA 4NJRA 1BPNA 4C8TA 3PBBA 4UIAA 1H8LA 2ZEOA 3D67A 1TXRA 3SJXA 1KWMA 3I74A 4C99A 3KQXA 4PXDA 1ELMP 3T8WA 2IQ6A 2PIZA 3H8GA 3PBEA 2VL1A 2RB7A 3NH8A 4NJQA 4ZI6A 3D4UA 4OIWA 4ONWA 4PPZA 2IMOA 3SI2A 4C9RA 3FVLA 5LYFA 4C8CA 2ZEEA 2XEJA 1QMUA 2ZELA 2F8HA 3K9TA 4TNUA 4PQAA 3D7FA 3S9MA 3EIFA 3BXMA 1R43A 4ZX8A 4P4DA 1YW4A 4WJBA 1F2OA 1V6CA 2G9DA 4MRIA 4F8ZA 2OOTA 2AFXA 4X8IA 2NSMA 2PJ8A 2CIJA 3PB8X 5D8NA 4EWTA 5HVFA 4BD9A 4ZYQA 2GU2A 3NFZA 2AFMA 2PVWA 3TX8A 4OC0A 4NGNA 3DGVA 3SJGA 2PJ0A 4C84A 3KR5A 1BAVA 3FMCA 4MHZA 3KZWA 1TKHA 2GLJA 2Q51A 1Z8LA 1EE3P 1HEEA 1AYEA 4ZY1A 2FVGA 2JBJA 3FEEA 5JM6A 1YSJA 3GUXA 4OC1A 4UEZA 1CP6A 3V7ZA 4OC5A 1LAMA 1IY7A 4NGRA 1HDQA 1Z5RA 1Z2LA 2ZEMA 2PJ2A 5LYIA 2C1CA 4C9VA 4CDKA 1ELLP 1WVMA 4OC4A 1LFWA 4P6YA 7CPAA 1Y9ZA 4IHMA 4RUHA 4W9YA 2JBKA 5CBMA 1AMPA 2EK9A 1PYTB 3BI0A 4P4IA 4PXEA 4P4JA 1LCPA 2F7VA 2PIYA 1TF9A 4AXVA 1CP7A 4P4EA 5HVHA 1Y0YA 3PRTA 3WT4A 3S9NA 3IJ3A 3B2YA 2RFHA 2AFWA 4TJXA 3RBUA 1VHEA 2PJAA 4NGQA 8CPAA 4MHYA 2WZNA 1XF1A 3RZAA 3SI0A 1VGYA 5D29A 2WYRA 3VATA 3CDXA 2PVVA 2ZEHA 1ARLA 2ZOFA 2AFZA 5LYDA 2IJZA 3D7HA 2ZEFA 4EMEA 4KNGE 2PJCA 2NYQA 1PCAA 3B3CA 1FNOA 3FX6A 3D7DA 4JZ0A 4X3RA 2ABZA 4F9UA 1NSAA 3GB0A 4DJLA 5JGFA 1Y7EA 2GLFA 4OIDA 1DE4C 1XRYA 3D7GA 5LYLA 4OC3A 4WWVA 4LQGA 1XBUA 2QVPA 1ZG7A 2V77A 2BOAA 3FJUA 1ARMA 4R8FA 4EFDA 1RTQA 1Y0RA 1ZG9A 1BPMA 1BLLE 1HDUA 4R6TA 4K3NA 3DLJA 3VARA 3B35A 3B3WA 3KHZA 5K8OA 3ICUA 4PXBA 1QQ9A 4JYWA 4CDJA 4IK2A 6CPAA 2CF4A 5F09A 1TKFA 3JRUA 4P10A 1M4LA 3CPAA 3PB6X 1F2PA 1IGBA 2ZEPA 4C8AA 3IWWA 4UEFA 2O4HA 4Z65A 3TC8A 3LWUA 4MCQA 4YN3A 3NH5A 3B7IA 3IIBA 3PB9X 2XEIA 2C6PA 4NGTA 5HXDA 2ZEGA 1CPXA 2V8GA 3SI1A 2BCOA 4OP4A 4C9EA 3KL9A 4X2TA 4TWEA 3HLPA 4A94A 3NA6A 2Q4ZA 3IEHA 5K8MA 3BI1A 3WC7A 3ISZA 1TKJA 4OKOA 1LAPA 4C9UA 1FT7A 4C9AA 3H8FA 4Q7AA 4MHPA 1UWYA 3FF3A 2EWBA 3WC5A 2CTCA 1LOKA 2AFSA 4FBEA 4DUKA 1YLOA 3MN8A 5K8NA 4A39A 2POKA 2EK8A 1ZLHA 5JH9A 4OC2A 2BO9A 2HB6A 4MHNA 2V8VA 3IFEA 2ZENA 3QNVA 4NFRA 4MMOA 2V8DA 2OR4A 2JEWA 3D66A 1GYTA 4UIBA 1XMBA 3LMSA 3FH4A 4MXUA 1CPSA 3PB7X 3KQZA 4R76A 3CPXA 5THWA 4C85A 4C8PA 5LRGA 3FEDA 2PJ5A 5ELYA 4O23A 3KR4A 2I3CA 4DYOA 3D68A 3KI9A 1LANA 5IB9A 2GREA 1JQGA 3KASA 3CT9A 2O53A 4A37A 4B6ZA 2PCUA 4MCRA 2AFUA 2PJ3A 4ZY2A 4YU9A 4C86A 1Q7LA 2PE3A 3PB4X
chains in the Genus database with same CATH superfamily
3RAMA 2DXQA 1ZG8A 4HNWB 4KORA 1ZRSA 4UEEA 4CAXA 3H8EA 4BPUB 2ANPA 3MRUA 2OZGA 1S60A 4JXRA 2Z0ZA 5AG5A 3N5FA 2VQYA 3FBUA 2OZUA 2PJ6A 5K8PA 4P4FA 5G22A 4A2ZA 4CYQA 5JQ4A 4C8UA 3TLCA 1CX8A 3T5MA 2JLMA 3BHXA 1DTDA 1YW6A 4II9A 2PDOA 3TO6A 3HUVA 4MCSA 2AFOA 2R98A 4GM5A 4F9VA 2Q43A 2QJ8A 4BMHA 4TJVA 3JVNA 5LRJA 3SXOA 1BOBA 2XEGA 1YMEA 3W6XA 2PJ7A 4C8FA 4EVYA 1A2ZA 1ZL0A 4IF5A 4FUUA 1NSLA 4MI1A 2ZEDA 2EUIA 1VHOA 4A38A 1A9XB 1P4NA 3IO1A 2Q04A 1S7LA 4P45A 4P44A 5LRKA 2J9AA 2R82A 3PLFB 4CPAA 1XFOA 4P4BA 2DF5A 4CYOA 4ZY0A 1Z8XA 5HVGA 1J4JA 2PJ4A 4MFJA 4IAVA 4A33A 1YVOA 2PRQA 3FXTA 2PJBA 1FY7A 3EFAA 3KHXA 1I21A 3I1UA 4KUAA 1YGHA 4UBRA 4U9ZA 4X5KA 1IYKA 4KSIA 2B4JC 1X10A 1GGOA 4HKFA 4A30A 4FWUA 5KTAA 2B5GB 4JWPA 3IWEA 4NGSA 4ZX9A 1ZYMA 2HC9A 3TLEA 1R3NA 2HV2A 3B3VA 3PFEA 4UFXA 1UFHA 1CBXA 4CRYB 4KVXA 3PFOA 5C82A 2XPPA 3BUXB 4YWYA 2CTBA 2VXKA 1XOVA 5EBVA 3FECA 2EZBA 3K4IA 1YX0A 1KBLA 1TF8A 2WUUA 4Q36A 4KLWA 4R7MA 4PSWA 4JJXA 3O8ZA 2ODFA 1Z4RA 1N71A 4H2KA 4H89A 4R57A 3WC6A 4C9EA 1ZO0A 3K2KA 5AGEA 4NGPA 1IB1E 4JD6A 2I00A 3WABA 3SJFA 5A28A 2ZOGA 2Q4YA 1B87A 2V8HA 3L2NA 4MBUA 3SJEA 2PJ9A 3V38A 4KOUA 3PP9A 3IC1A 4KOTA 5J1QA 3KRVA 3TLGA 1VHSA 2ATRA 4Y49C 5AG4A 5CPAA 3PT1A 2CBLA 2Z3PA 2Y0MA 4M6GA 4L89A 4NXYA 3D8PA 4UF4A 3GLJA 3NH4A 3IGRA 2XEFA 4NCZA 3B3SA 4PXCA 4FAIA 5EMIA 2JEVA 2VZYA 4PV6A 2B4DA 2C6GA 3ISXA 1XJOA 2GE3A 3B3TA 3GJZA 5J8FA 4G1PA 2QMLA 3I3GA 2Q0YA 2JDCA 4B5PA 4B11A 4BTFA 2D4OA 2OB0A 2D4PA 3I6SA 3PEIA 4MFQA 2PJ1A 2QYVA 3GIUA 3TOBA 1CG2A 3VTAA 3N7ZA 4E0AA 4NGMA 3S9LA 5DS0A 5FVJA 3FRMA 3GY9A 1VBGA 4MFLA 3GKRA 1OBRA 2Y1MA 5HKWA 1ON0A 1VIXA 3KGQA 5F47A 4F6AA 3F8KA 2PR1A 2DEAA 2XPLA 3VH9A 3GYAA 4CAEA 2C6CA 3S6HA 3EZAA 3TLGB 4MCPA 4OMEA 5I4MA 2GANA 4NF1A 4OADA 2B58A 1F57A 2WSAA 3W91A 3TLAA 2PC1A 1ZLIA 4MJXA 4L8AA 4NJRA 2BEIA 1BPNA 1CE8B 1T36B 2FXFA 4KUBA 1Q5XA 3PGPA 5G21A 4C8TA 2WPWA 3PBBA 4UIAA 1H8LA 2ZEOA 1BO4A 3OWCA 3D67A 3ZJ0A 3TTHA 1TXRA 1WK4A 2YNCC 4KZTA 2HWGA 3G8WA 5J8CA 4DNCA 2RC4A 2E28A 3SJXA 2GIVA 1KWMA 3I74A 2B0AA 4H1HA 4C99A 2PRBA 3KQXA 4GPLB 3R95A 4PXDA 1Y9WA 1ELMP 3QB8A 4MFPA 2IQ6A 3T8WA 4UFWA 4E5SA 4KSFA 3FIXA 4JXQA 5HVHA 3TE4A 2PIZA 1IOFA 3H8GA 3PBEA 2VL1A 2RB7A 3RO0A 4J0NA 2FCKA 4C2XA 4R3KA 3NH8A 1XE4A 4NJQA 4H6UA 3V8IA 2CXAA 2FT0A 3BJ7A 4ZI6A 5IV0A 2A4NA 3D4UA 4OIWA 3SHPA 3R9GA 3VWEA 1PU9A 3IU1A 4ONWA 2VZZA 4PPZA 4C68A 2IMOA 3SI2A 3SXNA 2Y1NA 3FVLA 5LYFA 1Q2YA 2B4DB 4UCNA 1B6BA 2REEA 4C8CA 4RS2A 2FL4A 2ZEEA 4MY3A 2XEJA 1QMUA 2ZELA 2F8HA 1TIQA 3K9TA 4TNUA 5G1ZA 3VRPA 4PQAA 3D7FA 3S9MA 4RN7A 3BUNB 3EIFA 4Q38A 3BXMA 1JDEA 3TFYA 2D0PA 2P0WA 4GXHA 1R43A 4ZX8A 4P4DA 1YW4A 4WJBA 5F1YA 4E94A 1F2OA 3FB3A 1XF8A 2PCNA 1YVHA 1V6CA 5E96A 2G9DA 2Q44A 4MRIA 4XNHC 4KS9A 2OOTA 4F8ZA 2AFXA 4X8IA 2HROA 2NSMA 2PJ8A 2CIJA 1K4JA 3C26A 3DDDA 1IIDA 3PB8X 1Z8TA 5D8NA 2B3UA 2CY2A 4EWTA 1KUYA 2XPNA 1Q2DA 2QECA 4HPSA 3W6SA 5IR2A 2FS5A 4OLLA 5J3XA 3TO7A 3T05A 5HVFA 2R1IA 4BD9A 2GU2A 4ZYQA 1B47A 4UA3A 2VEZA 3NFZA 1R61A 2AFMA 4COBA 3DR6A 2PVWA 3TX8A 4OC0A 4C2ZA 4JVOA 1M6VB 4NGNA 3DGVA 1C30B 3SJGA 2PJ0A 5IX3A 4C84A 4MFKA 1M4GA 1Z8WA 3KR5A 3R9EA 1BAVA 3FMCA 3T90A 4C2YA 4MJ8A 5AXIA 1CM0A 4UCPA 3R9FA 3TLZA 1TKHA 2GLJA 2WPXA 3KZWA 2Q51A 4MHZA 1Z8LA 4E8OA 2ARHA 1EE3P 1HEEA 1IOIA 1X12A 2ZW5A 3LODA 4KVOE 4UWIA 3OB2B 4A95A 4AG7A 1AYEA 4ZY1A 4KOYA 5JPHA 2EO8A 3TCVA 5KTDA 3BUOB 2FVGA 3P2HA 2JBJA 3FEEA 2CNMA 3TT2A 4PK2A 5JM6A 1Z9EA 1YSJA 3GUXA 4IIYA 3SR3A 3VROA 1S5KA 1M4IA 4OC1A 5DWMA 2G0BA 3C8OA 4UEZA 1CP6A 3V7ZA 4OC5A 3TLBA 1VKCA 1LAMA 3OAKA 5AG7A 2OH1A 1IY7A 1I1DA 2EVNA 2FE7A 4LUAA 4NGRA 2HUZA 1HDQA 1J3LA 1Z5RA 1KUVA 1Z2LA 4CYNA 1S7NA 3LD2A 1FBVA 2ZEMA 2PJ2A 4HNYB 2C1CA 5LYIA 4C9VA 2B5GA 4CDKA 2BSWA 5FD8A 4UWJA 1ELLP 3CXSA 4A32A 1WVMA 1U6MA 4J3GA 4QBJA 2JDDA 4OC4A 4KLVA 1LFWA 2H5MA 4NSQA 3EZBA 2C5QA 4P6YA 7CPAA 1Y9ZA 2OZHA 1S3ZA 1YR0A 4BBHA 4IHMA 5CNPA 4CS0B 4RUHA 4CRZB 1S7FA 1KC7A 4QUSA 4W9YA 1YVKA 2JBKA 2CNSA 5CBMA 1AMPA 2EK9A 4CGNA 3D2PA 1PYTB 1PUAA 2VI7A 5KTCA 4FD5A 5F49A 3BI0A 4P4IA 1JWQA 4PXEA 4CGPA 5BY0A 2AUNA 1NBWA 2Q4VA 2B4BA 2YNDA 1DIKA 4P4JA 4A4CA 1LCPA 1SQHA 2AJ6A 3FYNA 1Y9KA 2F7VA 2PIYA 3R1KA 3HMJG 1TF9A 5H84A 4AXVA 4M8DA 1CP7A 4CYPA 4NEXA 4P4EA 4KOVA 4MY0A 4AVAA 1Y0YA 3PRTA 2PSWA 3BJ8A 4KOXA 4CAVA 3WT4A 3S9NA 3IJ3A 1RXTA 3HPGG 1L0CA 3CZXA 3B2YA 4AVBA 3HPHE 4INJA 2F5IA 2RFHA 2MP0A 2AFWA 4TJXA 5F5XA 2EBJA 4B12A 3RBUA 2YGWA 3EXNA 1VHEA 2PJAA 4M6HA 4Y49B 4NGQA 8CPAA 1Z4EA 4MHYA 4B5PB 2WZNA 2KCWA 1XF1A 2Q7SA 5EC4A 3RZAA 3SI0A 1BXRB 1MK4A 1VGYA 3UY5A 2VBQA 5D29A 2NMTA 1VI4A 2WYRA 3NOJA 1GHEA 1QSOA 3VATA 5K99A 3CDXA 4BINA 4MFZA 2PVVA 2ZEHA 4U9YA 1ARLA 4PK3A 2ZOFA 1KUXA 1S7KA 2AFZA 1I12A 5LYDA 3FNCA 4F0XA 2IJZA 3D7HA 4KSAA 2ZW7A 2ZEFA 4EMEA 1YQEA 4H6ZA 1Q2CA 3A9LA 4KNGE 3OB1B 2BUEA 2PJCA 1Z9UA 3KKWA 1IU8A 2NYQA 3CXPA 1PCAA 2GFQA 1FNOA 3B3CA 4KOWA 3VWDA 3FX6A 2P6GA 2Z3KA 4C7IA 2OLSA 2B3VA 3D7DA 4JZ0A 1QSNA 1NXJA 1QSRA 3VRNA 1C3OB 2YJVA 4X3RA 2ABZA 4F9UA 3R96A 1NSAA 1Y7RA 2Z3OA 2FM4A 3GB0A 5IB0A 1XMTA 4DJLA 5JGFA 2PR8A 2R8VA 4R87A 5H86A 2X0SA 1Y7EA 2GLFA 3B8GA 2XPOA 1DE4C 1XRYA 3D7GA 2PQ8A 3EC4A 4OIDA 4OC3A 3QAYA 5LYLA 1VBHA 3TO9A 4WWVA 4FD6A 4LQGA 2P6EA 4OAEA 1XBUA 2QVPA 2FIWA 5HMNA 2J8MA 4MHDA 1ZG7A 4F0YA 2V77A 2BOAA 4QC6A 3FJUA 1ARMA 3S6GA 3T0TA 2EZCA 1KEEB 1MJBA 3F9KC 5F48A 4KOSA 4CAFA 3F5BA 4XNHB 3T9YA 4R8FA 4KVME 1IICA 3I9SA 2VKZG 2DPTA 4ONUA 1RTQA 4EFDA 1QSTA 1Y0RA 4A4BA 3S6FA 1ZG9A 3U1BA 1BPMA 5JVLA 1BLLE 2Z10A 3PZJA 1HDUA 4R6TA 4K3NA 3DLJA 3G23A 1OZPA 4RI1A 2HQYA 1NE9A 3LACA 3VARA 3B35A 3NFQA 3B3WA 4MI4A 2DPSA 3KHZA 2D0OA 3G3SA 5K8OA 3ICUA 4PXBA 1QQ9A 3IU2A 1R57A 4FD4A 2EZAA 3BUWB 4YRHA 4JYWA 1EO0A 4C7HA 4CGOA 4IK2A 3MGDA 4CDJA 6CPAA 2CF4A 3TYXA 5F09A 1TKFA 3JRUA 2YNEA 4M85A 4P10A 1M4LA 2OU2A 2DLAA 3CPAA 3PB6X 3E0KA 3ZZIA 1F2PA 1IGBA 3EO4A 2ZEPA 4C8AA 3JUWA 2ZW6A 3IWWA 2CNTA 4UEFA 4EYSA 2O4HA 4Z65A 2Z3NA 2ZXVA 2P6FA 3TC8A 3LWUA 3TLYA 4MCQA 4FD7A 2GP4A 4IUSA 2ZPAA 4YN3A 4QVTA 3NH5A 5F9MA 3VRQA 2O28A 4I49A 4ORFA 2G3AA 3B7IA 3IIBA 4BPXB 2Z11A 2DIKA 3PB9X 2XEIA 2C6PA 4NGTA 5A27A 2ZEGA 2X7BA 1CPXA 2V8GA 4AG9A 5HXDA 3SI1A 1CS0B 2YJTA 2BCOA 3DNSA 3WR7A 5F46A 4OP4A 3DR8A 4UCMA 4JLYA 3VRRA 3KL9A 4GS4A 1XEBA 4TWEA 3HLPA 4X2TA 4K30A 4A94A 4C9RA 5BWAB 4BPWB 2N3AB 4A31A 3NA6A 1M44A 2Q4ZA 3IEHA 3RNZA 1WJTA 5K8MA 4U5YA 3PFVA 3BI1A 2ZW4A 3WC7A 3ISZA 1M4DA 4B14A 2UV8G 1TKJA 4OKOA 3F0AA 3P2FA 1M1DA 4COGA 1LAPA 1XIXA 1FT7A 5AG6A 4C9AA 4C9UA 4IIXA 3H8FA 5G20A 4Q7AA 1WWZA 3OP0A 1UWYA 4MHPA 5DWNA 3FF3A 1LRZA 2EWBA 3WC5A 2CTCA 4R3LA 3D3SA 2C27A 1LOKA 3EZEA 2AFSA 5HKZA 3JTKA 2BL1A 2Q7BA 1AUGA 5HH1A 3D2MA 4DUKA 4FBEA 1YLOA 3MN8A 1MJAA 4AB7A 3ZNIA 5JYBA 4LX9A 5K8NA 4RR2B 2FSRA 3TOAA 4A39A 2POKA 2EK8A 2FIAA 3RYOA 1ZLHA 5JH9A 4OC2A 3CXQA 1CJWA 2BO9A 2HB6A 4MHNA 2AUMA 1YLEA 4PSXA 5F13A 4YGOA 4CGMA 1RO5A 2V8VA 3IFEA 3NE8A 3H4QA 1MJ9A 2J8NA 3T07A 2ZENA 3QNVA 4R9MA 1EZBA 4NFRA 4MMOA 3U88C 2V8DA 3EY5A 3IWGA 4AVCA 4B13A 4B5OA 2OR4A 3VGOA 2JEWA 3D66A 1QSMA 1GYTA 2AE6A 4UIBA 4YFJA 1V0CA 4CGLA 1XMBA 3K9UA 3LMSA 2YNCA 2R7HA 2IL4A 2QIRA 3NE7A 3FH4A 3PB7X 1CPSA 4MXUA 3KQZA 4XPDB 2I79A 2Z3MA 4QB9A 4R76A 4XPDC 3CPXA 5THWA 4C85A 4C8PA 2K5TA 5LRGA 3FEDA 2PJ5A 5ELYA 4O23A 1JDBC 5ISVA 1P0HA 4XPKA 3KR4A 1EZAA 2I3CA 4M6IA 3H5ZA 4DYOA 3D68A 3BLNA 3KI9A 1LANA 4UFVA 1YK3A 5IB9A 5HKYA 2GREA 1JQGA 4CZ1A 1KZFA 4B10A 3S6KA 2HI6A 3KASA 2G3TA 4LQ6A 4CAWA 4ZGYB 3QAHA 4ZBGA 4E2AA 4CO9A 3BUMB 1IYLA 3CT9A 3DSBA 5I0CA 4HNXB 2O53A 1YREA 5C88A 4A37A 2J8RA 4M3SA 4B6ZA 2PCUA 4MCRA 2Z3LA 5GCNA 2AFUA 2PJ3A 4ZY2A 1NMTA 4YU9A 4C86A 2REFA 1Q7LA 2PE3A 3PB4X 4XPLA
chains in the Genus database with same CATH topology
3RAMA 1ZG8A 4UEEA 3H8EA 2ANPA 3MRUA 3N5FA 5K8PA 2PJ6A 4P4FA 4C8UA 1CX8A 3BHXA 1DTDA 1YW6A 3HUVA 4MCSA 2AFOA 4F9VA 4GM5A 2Q43A 2QJ8A 4TJVA 5LRJA 2XEGA 1YMEA 2PJ7A 4C8FA 4FUUA 2ZEDA 1VHOA 4A38A 3IO1A 5LRKA 4P45A 4P44A 2J9AA 4CPAA 1XFOA 4P4BA 4ZY0A 5HVGA 2PJ4A 4IAVA 2PRQA 2PJBA 3KHXA 3I1UA 4KSIA 4FWUA 4ZX9A 4NGSA 2HC9A 1R3NA 3B3VA 3PFEA 1CBXA 3PFOA 4YWYA 2CTBA 3FECA 1TF8A 4R7MA 4H2KA 3WC6A 3K2KA 4NGPA 3WABA 3SJFA 2ZOGA 2V8HA 3L2NA 3SJEA 2PJ9A 3V38A 3IC1A 5J1QA 5CPAA 4UF4A 3NH4A 3GLJA 2XEFA 4FAIA 3B3SA 4PXCA 2C6GA 3ISXA 1XJOA 3B3TA 4G1PA 3I6SA 3PEIA 2PJ1A 2QYVA 3VTAA 1CG2A 4NGMA 3S9LA 5DS0A 1OBRA 1VIXA 3KGQA 2DEAA 3VH9A 2C6CA 4MCPA 4OMEA 5I4MA 1F57A 1ZLIA 4NJRA 1BPNA 4C8TA 3PBBA 4UIAA 1H8LA 2ZEOA 3D67A 1TXRA 3SJXA 1KWMA 3I74A 4C99A 3KQXA 4PXDA 1ELMP 3T8WA 2IQ6A 2PIZA 3H8GA 3PBEA 2VL1A 2RB7A 3NH8A 4NJQA 4ZI6A 3D4UA 4OIWA 4ONWA 4PPZA 2IMOA 3SI2A 4C9RA 3FVLA 5LYFA 4C8CA 2ZEEA 2XEJA 1QMUA 2ZELA 2F8HA 3K9TA 4TNUA 4PQAA 3D7FA 3S9MA 3EIFA 3BXMA 1R43A 4ZX8A 4P4DA 1YW4A 4WJBA 1F2OA 1V6CA 2G9DA 4MRIA 4F8ZA 2OOTA 2AFXA 4X8IA 2NSMA 2PJ8A 2CIJA 3PB8X 5D8NA 4EWTA 5IR2A 5HVFA 4BD9A 4ZYQA 2GU2A 3NFZA 2AFMA 2PVWA 3TX8A 4OC0A 4NGNA 3DGVA 3SJGA 2PJ0A 4C84A 3KR5A 1BAVA 3FMCA 4MHZA 3KZWA 1TKHA 2GLJA 2Q51A 1Z8LA 1EE3P 1HEEA 1AYEA 4ZY1A 2FVGA 2JBJA 3FEEA 5JM6A 1YSJA 3GUXA 4OC1A 4UEZA 1CP6A 3V7ZA 4OC5A 1LAMA 1IY7A 4NGRA 1HDQA 1Z5RA 1Z2LA 2ZEMA 2PJ2A 5LYIA 2C1CA 4C9VA 4CDKA 1ELLP 1WVMA 4OC4A 1LFWA 2C5QA 4P6YA 7CPAA 1Y9ZA 4IHMA 4RUHA 4W9YA 2JBKA 5CBMA 1AMPA 2EK9A 1PYTB 3BI0A 4P4IA 4PXEA 4P4JA 1LCPA 2F7VA 2PIYA 1TF9A 4AXVA 1CP7A 4P4EA 5HVHA 1Y0YA 3PRTA 3WT4A 3S9NA 3IJ3A 3B2YA 2RFHA 2AFWA 4TJXA 3RBUA 1VHEA 2PJAA 4NGQA 8CPAA 4MHYA 2WZNA 1XF1A 3RZAA 3SI0A 1VGYA 5D29A 2WYRA 3VATA 3CDXA 2PVVA 2ZEHA 1ARLA 2ZOFA 2AFZA 5LYDA 2IJZA 3D7HA 2ZEFA 4EMEA 4KNGE 2PJCA 2NYQA 1PCAA 3B3CA 1FNOA 3FX6A 3D7DA 4JZ0A 4X3RA 2ABZA 4F9UA 1NSAA 3GB0A 4DJLA 5JGFA 1Y7EA 2GLFA 4OIDA 1DE4C 1XRYA 3D7GA 5LYLA 4OC3A 4WWVA 4LQGA 1XBUA 2QVPA 1ZG7A 2V77A 2BOAA 3FJUA 1ARMA 4R8FA 4EFDA 1RTQA 1Y0RA 1ZG9A 1BPMA 1BLLE 1HDUA 4R6TA 4K3NA 3DLJA 3VARA 3B35A 3B3WA 3KHZA 5K8OA 3ICUA 4PXBA 1QQ9A 4JYWA 4CDJA 4IK2A 6CPAA 2CF4A 5F09A 1TKFA 3JRUA 4P10A 1M4LA 3CPAA 3PB6X 1F2PA 1IGBA 2ZEPA 4C8AA 3IWWA 4UEFA 2O4HA 4Z65A 3TC8A 3LWUA 4MCQA 2GP4A 4YN3A 3NH5A 3B7IA 3IIBA 3PB9X 2XEIA 2C6PA 4NGTA 5HXDA 2ZEGA 1CPXA 2V8GA 3SI1A 2BCOA 4OP4A 4C9EA 3KL9A 4X2TA 4TWEA 3HLPA 4A94A 3NA6A 2Q4ZA 3IEHA 5K8MA 3BI1A 3WC7A 3ISZA 1TKJA 4OKOA 1LAPA 4C9UA 1FT7A 4C9AA 3H8FA 4Q7AA 4MHPA 1UWYA 3FF3A 2EWBA 3WC5A 2CTCA 1LOKA 2AFSA 4FBEA 4DUKA 1YLOA 3MN8A 5K8NA 4A39A 2POKA 2EK8A 1ZLHA 5JH9A 4OC2A 2BO9A 2HB6A 4MHNA 2V8VA 3IFEA 2ZENA 3QNVA 4NFRA 4MMOA 2V8DA 2OR4A 2JEWA 3D66A 1GYTA 4UIBA 1XMBA 3LMSA 3FH4A 4MXUA 1CPSA 3PB7X 3KQZA 4R76A 3CPXA 5THWA 4C85A 4C8PA 5LRGA 3FEDA 2PJ5A 5ELYA 4O23A 3KR4A 2I3CA 4DYOA 3D68A 3KI9A 1LANA 5IB9A 2GREA 1JQGA 3KASA 3CT9A 2O53A 4A37A 4B6ZA 2PCUA 4MCRA 2AFUA 2PJ3A 4ZY2A 4YU9A 4C86A 1Q7LA 2PE3A 3PB4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RAM A;  1ZG8 A;  4UEE A;  3H8E A;  2ANP A;  3MRU A;  3N5F A;  5K8P A;  2PJ6 A;  4P4F A;  4C8U A;  1CX8 A;  3BHX A;  1DTD A;  1YW6 A;  3HUV A;  4MCS A;  2AFO A;  4F9V A;  4GM5 A;  2Q43 A;  2QJ8 A;  4TJV A;  5LRJ A;  2XEG A;  1YME A;  2PJ7 A;  4C8F A;  4FUU A;  2ZED A;  1VHO A;  4A38 A;  3IO1 A;  5LRK A;  4P45 A;  4P44 A;  2J9A A;  4CPA A;  1XFO A;  4P4B A;  4ZY0 A;  5HVG A;  2PJ4 A;  4IAV A;  2PRQ A;  2PJB A;  3KHX A;  3I1U A;  4KSI A;  4FWU A;  4ZX9 A;  4NGS A;  2HC9 A;  1R3N A;  3B3V A;  3PFE A;  1CBX A;  3PFO A;  4YWY A;  2CTB A;  3FEC A;  1TF8 A;  4R7M A;  4H2K A;  3WC6 A;  3K2K A;  4NGP A;  3WAB A;  3SJF A;  2ZOG A;  2V8H A;  3L2N A;  3SJE A;  2PJ9 A;  3V38 A;  3IC1 A;  5J1Q A;  5CPA A;  4UF4 A;  3NH4 A;  3GLJ A;  2XEF A;  4FAI A;  3B3S A;  4PXC A;  2C6G A;  3ISX A;  1XJO A;  3B3T A;  4G1P A;  3I6S A;  3PEI A;  2PJ1 A;  2QYV A;  3VTA A;  1CG2 A;  4NGM A;  3S9L A;  5DS0 A;  1OBR A;  1VIX A;  3KGQ A;  2DEA A;  3VH9 A;  2C6C A;  4MCP A;  4OME A;  5I4M A;  1F57 A;  1ZLI A;  4NJR A;  1BPN A;  4C8T A;  3PBB A;  4UIA A;  1H8L A;  2ZEO A;  3D67 A;  1TXR A;  3SJX A;  1KWM A;  3I74 A;  4C99 A;  3KQX A;  4PXD A;  1ELM P;  3T8W A;  2IQ6 A;  2PIZ A;  3H8G A;  3PBE A;  2VL1 A;  2RB7 A;  3NH8 A;  4NJQ A;  4ZI6 A;  3D4U A;  4OIW A;  4ONW A;  4PPZ A;  2IMO A;  3SI2 A;  4C9R A;  3FVL A;  5LYF A;  4C8C A;  2ZEE A;  2XEJ A;  1QMU A;  2ZEL A;  2F8H A;  3K9T A;  4TNU A;  4PQA A;  3D7F A;  3S9M A;  3EIF A;  3BXM A;  1R43 A;  4ZX8 A;  4P4D A;  1YW4 A;  4WJB A;  1F2O A;  1V6C A;  2G9D A;  4MRI A;  4F8Z A;  2OOT A;  2AFX A;  4X8I A;  2NSM A;  2PJ8 A;  2CIJ A;  3PB8 X;  5D8N A;  4EWT A;  5HVF A;  4BD9 A;  4ZYQ A;  2GU2 A;  3NFZ A;  2AFM A;  2PVW A;  3TX8 A;  4OC0 A;  4NGN A;  3DGV A;  3SJG A;  2PJ0 A;  4C84 A;  3KR5 A;  1BAV A;  3FMC A;  4MHZ A;  3KZW A;  1TKH A;  2GLJ A;  2Q51 A;  1Z8L A;  1EE3 P;  1HEE A;  1AYE A;  4ZY1 A;  2FVG A;  2JBJ A;  3FEE A;  5JM6 A;  1YSJ A;  3GUX A;  4OC1 A;  4UEZ A;  1CP6 A;  3V7Z A;  4OC5 A;  1LAM A;  1IY7 A;  4NGR A;  1HDQ A;  1Z5R A;  1Z2L A;  2ZEM A;  2PJ2 A;  5LYI A;  2C1C A;  4C9V A;  4CDK A;  1ELL P;  1WVM A;  4OC4 A;  1LFW A;  4P6Y A;  7CPA A;  1Y9Z A;  4IHM A;  4RUH A;  4W9Y A;  2JBK A;  5CBM A;  1AMP A;  2EK9 A;  1PYT B;  3BI0 A;  4P4I A;  4PXE A;  4P4J A;  1LCP A;  2F7V A;  2PIY A;  1TF9 A;  4AXV A;  1CP7 A;  4P4E A;  5HVH A;  1Y0Y A;  3PRT A;  3WT4 A;  3S9N A;  3IJ3 A;  3B2Y A;  2RFH A;  2AFW A;  4TJX A;  3RBU A;  1VHE A;  2PJA A;  4NGQ A;  8CPA A;  4MHY A;  2WZN A;  1XF1 A;  3RZA A;  3SI0 A;  1VGY A;  5D29 A;  2WYR A;  3VAT A;  3CDX A;  2PVV A;  2ZEH A;  1ARL A;  2ZOF A;  2AFZ A;  5LYD A;  2IJZ A;  3D7H A;  2ZEF A;  4EME A;  4KNG E;  2PJC A;  2NYQ A;  1PCA A;  3B3C A;  1FNO A;  3FX6 A;  3D7D A;  4JZ0 A;  4X3R A;  2ABZ A;  4F9U A;  1NSA A;  3GB0 A;  4DJL A;  5JGF A;  1Y7E A;  2GLF A;  4OID A;  1DE4 C;  1XRY A;  3D7G A;  5LYL A;  4OC3 A;  4WWV A;  4LQG A;  1XBU A;  2QVP A;  1ZG7 A;  2V77 A;  2BOA A;  3FJU A;  1ARM A;  4R8F A;  4EFD A;  1RTQ A;  1Y0R A;  1ZG9 A;  1BPM A;  1BLL E;  1HDU A;  4R6T A;  4K3N A;  3DLJ A;  3VAR A;  3B35 A;  3B3W A;  3KHZ A;  5K8O A;  3ICU A;  4PXB A;  1QQ9 A;  4JYW A;  4CDJ A;  4IK2 A;  6CPA A;  2CF4 A;  5F09 A;  1TKF A;  3JRU A;  4P10 A;  1M4L A;  3CPA A;  3PB6 X;  1F2P A;  1IGB A;  2ZEP A;  4C8A A;  3IWW A;  4UEF A;  2O4H A;  4Z65 A;  3TC8 A;  3LWU A;  4MCQ A;  4YN3 A;  3NH5 A;  3B7I A;  3IIB A;  3PB9 X;  2XEI A;  2C6P A;  4NGT A;  5HXD A;  2ZEG A;  1CPX A;  2V8G A;  3SI1 A;  2BCO A;  4OP4 A;  4C9E A;  3KL9 A;  4X2T A;  4TWE A;  3HLP A;  4A94 A;  3NA6 A;  2Q4Z A;  3IEH A;  5K8M A;  3BI1 A;  3WC7 A;  3ISZ A;  1TKJ A;  4OKO A;  1LAP A;  4C9U A;  1FT7 A;  4C9A A;  3H8F A;  4Q7A A;  4MHP A;  1UWY A;  3FF3 A;  2EWB A;  3WC5 A;  2CTC A;  1LOK A;  2AFS A;  4FBE A;  4DUK A;  1YLO A;  3MN8 A;  5K8N A;  4A39 A;  2POK A;  2EK8 A;  1ZLH A;  5JH9 A;  4OC2 A;  2BO9 A;  2HB6 A;  4MHN A;  2V8V A;  3IFE A;  2ZEN A;  3QNV A;  4NFR A;  4MMO A;  2V8D A;  2OR4 A;  2JEW A;  3D66 A;  1GYT A;  4UIB A;  1XMB A;  3LMS A;  3FH4 A;  4MXU A;  1CPS A;  3PB7 X;  3KQZ A;  4R76 A;  3CPX A;  5THW A;  4C85 A;  4C8P A;  5LRG A;  3FED A;  2PJ5 A;  5ELY A;  4O23 A;  3KR4 A;  2I3C A;  4DYO A;  3D68 A;  3KI9 A;  1LAN A;  5IB9 A;  2GRE A;  1JQG A;  3KAS A;  3CT9 A;  2O53 A;  4A37 A;  4B6Z A;  2PCU A;  4MCR A;  2AFU A;  2PJ3 A;  4ZY2 A;  4YU9 A;  4C86 A;  1Q7L A;  2PE3 A;  3PB4 X; 
#chains in the Genus database with same CATH topology
 3RAM A;  2DXQ A;  1ZG8 A;  4HNW B;  4KOR A;  1ZRS A;  4UEE A;  4CAX A;  3H8E A;  4BPU B;  2ANP A;  3MRU A;  2OZG A;  1S60 A;  4JXR A;  2Z0Z A;  5AG5 A;  3N5F A;  2VQY A;  3FBU A;  2OZU A;  2PJ6 A;  5K8P A;  4P4F A;  5G22 A;  4A2Z A;  4CYQ A;  5JQ4 A;  4C8U A;  3TLC A;  1CX8 A;  3T5M A;  2JLM A;  3BHX A;  1DTD A;  1YW6 A;  4II9 A;  2PDO A;  3TO6 A;  3HUV A;  4MCS A;  2AFO A;  2R98 A;  4GM5 A;  4F9V A;  2Q43 A;  2QJ8 A;  4BMH A;  4TJV A;  3JVN A;  5LRJ A;  3SXO A;  1BOB A;  2XEG A;  1YME A;  3W6X A;  2PJ7 A;  4C8F A;  4EVY A;  1A2Z A;  1ZL0 A;  4IF5 A;  4FUU A;  1NSL A;  4MI1 A;  2ZED A;  2EUI A;  1VHO A;  4A38 A;  1A9X B;  1P4N A;  3IO1 A;  2Q04 A;  1S7L A;  4P45 A;  4P44 A;  5LRK A;  2J9A A;  2R82 A;  3PLF B;  4CPA A;  1XFO A;  4P4B A;  2DF5 A;  4CYO A;  4ZY0 A;  1Z8X A;  5HVG A;  1J4J A;  2PJ4 A;  4MFJ A;  4IAV A;  4A33 A;  1YVO A;  2PRQ A;  3FXT A;  2PJB A;  1FY7 A;  3EFA A;  3KHX A;  1I21 A;  3I1U A;  4KUA A;  1YGH A;  4UBR A;  4U9Z A;  4X5K A;  1IYK A;  4KSI A;  2B4J C;  1X10 A;  1GGO A;  4HKF A;  4A30 A;  4FWU A;  5KTA A;  2B5G B;  4JWP A;  3IWE A;  4NGS A;  4ZX9 A;  1ZYM A;  2HC9 A;  3TLE A;  1R3N A;  2HV2 A;  3B3V A;  3PFE A;  4UFX A;  1UFH A;  1CBX A;  4CRY B;  4KVX A;  3PFO A;  5C82 A;  2XPP A;  3BUX B;  4YWY A;  2CTB A;  2VXK A;  1XOV A;  5EBV A;  3FEC A;  2EZB A;  3K4I A;  1YX0 A;  1KBL A;  1TF8 A;  2WUU A;  4Q36 A;  4KLW A;  4R7M A;  4PSW A;  4JJX A;  3O8Z A;  2ODF A;  1Z4R A;  1N71 A;  4H2K A;  4H89 A;  4R57 A;  3WC6 A;  4C9E A;  1ZO0 A;  3K2K A;  5AGE A;  4NGP A;  1IB1 E;  4JD6 A;  2I00 A;  3WAB A;  3SJF A;  5A28 A;  2ZOG A;  2Q4Y A;  1B87 A;  2V8H A;  3L2N A;  4MBU A;  3SJE A;  2PJ9 A;  3V38 A;  4KOU A;  3PP9 A;  3IC1 A;  4KOT A;  5J1Q A;  3KRV A;  3TLG A;  1VHS A;  2ATR A;  4Y49 C;  5AG4 A;  5CPA A;  3PT1 A;  2CBL A;  2Z3P A;  2Y0M A;  4M6G A;  4L89 A;  4NXY A;  3D8P A;  4UF4 A;  3GLJ A;  3NH4 A;  3IGR A;  2XEF A;  4NCZ A;  3B3S A;  4PXC A;  4FAI A;  5EMI A;  2JEV A;  2VZY A;  4PV6 A;  2B4D A;  2C6G A;  3ISX A;  1XJO A;  2GE3 A;  3B3T A;  3GJZ A;  5J8F A;  4G1P A;  2QML A;  3I3G A;  2Q0Y A;  2JDC A;  4B5P A;  4B11 A;  4BTF A;  2D4O A;  2OB0 A;  2D4P A;  3I6S A;  3PEI A;  4MFQ A;  2PJ1 A;  2QYV A;  3GIU A;  3TOB A;  1CG2 A;  3VTA A;  3N7Z A;  4E0A A;  4NGM A;  3S9L A;  5DS0 A;  5FVJ A;  3FRM A;  3GY9 A;  1VBG A;  4MFL A;  3GKR A;  1OBR A;  2Y1M A;  5HKW A;  1ON0 A;  1VIX A;  3KGQ A;  5F47 A;  4F6A A;  3F8K A;  2PR1 A;  2DEA A;  2XPL A;  3VH9 A;  3GYA A;  4CAE A;  2C6C A;  3S6H A;  3EZA A;  3TLG B;  4MCP A;  4OME A;  5I4M A;  2GAN A;  4NF1 A;  4OAD A;  2B58 A;  1F57 A;  2WSA A;  3W91 A;  3TLA A;  2PC1 A;  1ZLI A;  4MJX A;  4L8A A;  4NJR A;  2BEI A;  1BPN A;  1CE8 B;  1T36 B;  2FXF A;  4KUB A;  1Q5X A;  3PGP A;  5G21 A;  4C8T A;  2WPW A;  3PBB A;  4UIA A;  1H8L A;  2ZEO A;  1BO4 A;  3OWC A;  3D67 A;  3ZJ0 A;  3TTH A;  1TXR A;  1WK4 A;  2YNC C;  4KZT A;  2HWG A;  3G8W A;  5J8C A;  4DNC A;  2RC4 A;  2E28 A;  3SJX A;  2GIV A;  1KWM A;  3I74 A;  2B0A A;  4H1H A;  4C99 A;  2PRB A;  3KQX A;  4GPL B;  3R95 A;  4PXD A;  1Y9W A;  1ELM P;  3QB8 A;  4MFP A;  2IQ6 A;  3T8W A;  4UFW A;  4E5S A;  4KSF A;  3FIX A;  4JXQ A;  5HVH A;  3TE4 A;  2PIZ A;  1IOF A;  3H8G A;  3PBE A;  2VL1 A;  2RB7 A;  3RO0 A;  4J0N A;  2FCK A;  4C2X A;  4R3K A;  3NH8 A;  1XE4 A;  4NJQ A;  4H6U A;  3V8I A;  2CXA A;  2FT0 A;  3BJ7 A;  4ZI6 A;  5IV0 A;  2A4N A;  3D4U A;  4OIW A;  3SHP A;  3R9G A;  3VWE A;  1PU9 A;  3IU1 A;  4ONW A;  2VZZ A;  4PPZ A;  4C68 A;  2IMO A;  3SI2 A;  3SXN A;  2Y1N A;  3FVL A;  5LYF A;  1Q2Y A;  2B4D B;  4UCN A;  1B6B A;  2REE A;  4C8C A;  4RS2 A;  2FL4 A;  2ZEE A;  4MY3 A;  2XEJ A;  1QMU A;  2ZEL A;  2F8H A;  1TIQ A;  3K9T A;  4TNU A;  5G1Z A;  3VRP A;  4PQA A;  3D7F A;  3S9M A;  4RN7 A;  3BUN B;  3EIF A;  4Q38 A;  3BXM A;  1JDE A;  3TFY A;  2D0P A;  2P0W A;  4GXH A;  1R43 A;  4ZX8 A;  4P4D A;  1YW4 A;  4WJB A;  5F1Y A;  4E94 A;  1F2O A;  3FB3 A;  1XF8 A;  2PCN A;  1YVH A;  1V6C A;  5E96 A;  2G9D A;  2Q44 A;  4MRI A;  4XNH C;  4KS9 A;  2OOT A;  4F8Z A;  2AFX A;  4X8I A;  2HRO A;  2NSM A;  2PJ8 A;  2CIJ A;  1K4J A;  3C26 A;  3DDD A;  1IID A;  3PB8 X;  1Z8T A;  5D8N A;  2B3U A;  2CY2 A;  4EWT A;  1KUY A;  2XPN A;  1Q2D A;  2QEC A;  4HPS A;  3W6S A;  5IR2 A;  2FS5 A;  4OLL A;  5J3X A;  3TO7 A;  3T05 A;  5HVF A;  2R1I A;  4BD9 A;  2GU2 A;  4ZYQ A;  1B47 A;  4UA3 A;  2VEZ A;  3NFZ A;  1R61 A;  2AFM A;  4COB A;  3DR6 A;  2PVW A;  3TX8 A;  4OC0 A;  4C2Z A;  4JVO A;  1M6V B;  4NGN A;  3DGV A;  1C30 B;  3SJG A;  2PJ0 A;  5IX3 A;  4C84 A;  4MFK A;  1M4G A;  1Z8W A;  3KR5 A;  3R9E A;  1BAV A;  3FMC A;  3T90 A;  4C2Y A;  4MJ8 A;  5AXI A;  1CM0 A;  4UCP A;  3R9F A;  3TLZ A;  1TKH A;  2GLJ A;  2WPX A;  3KZW A;  2Q51 A;  4MHZ A;  1Z8L A;  4E8O A;  2ARH A;  1EE3 P;  1HEE A;  1IOI A;  1X12 A;  2ZW5 A;  3LOD A;  4KVO E;  4UWI A;  3OB2 B;  4A95 A;  4AG7 A;  1AYE A;  4ZY1 A;  4KOY A;  5JPH A;  2EO8 A;  3TCV A;  5KTD A;  3BUO B;  2FVG A;  3P2H A;  2JBJ A;  3FEE A;  2CNM A;  3TT2 A;  4PK2 A;  5JM6 A;  1Z9E A;  1YSJ A;  3GUX A;  4IIY A;  3SR3 A;  3VRO A;  1S5K A;  1M4I A;  4OC1 A;  5DWM A;  2G0B A;  3C8O A;  4UEZ A;  1CP6 A;  3V7Z A;  4OC5 A;  3TLB A;  1VKC A;  1LAM A;  3OAK A;  5AG7 A;  2OH1 A;  1IY7 A;  1I1D A;  2EVN A;  2FE7 A;  4LUA A;  4NGR A;  2HUZ A;  1HDQ A;  1J3L A;  1Z5R A;  1KUV A;  1Z2L A;  4CYN A;  1S7N A;  3LD2 A;  1FBV A;  2ZEM A;  2PJ2 A;  4HNY B;  2C1C A;  5LYI A;  4C9V A;  2B5G A;  4CDK A;  2BSW A;  5FD8 A;  4UWJ A;  1ELL P;  3CXS A;  4A32 A;  1WVM A;  1U6M A;  4J3G A;  4QBJ A;  2JDD A;  4OC4 A;  4KLV A;  1LFW A;  2H5M A;  4NSQ A;  3EZB A;  2C5Q A;  4P6Y A;  7CPA A;  1Y9Z A;  2OZH A;  1S3Z A;  1YR0 A;  4BBH A;  4IHM A;  5CNP A;  4CS0 B;  4RUH A;  4CRZ B;  1S7F A;  1KC7 A;  4QUS A;  4W9Y A;  1YVK A;  2JBK A;  2CNS A;  5CBM A;  1AMP A;  2EK9 A;  4CGN A;  3D2P A;  1PYT B;  1PUA A;  2VI7 A;  5KTC A;  4FD5 A;  5F49 A;  3BI0 A;  4P4I A;  1JWQ A;  4PXE A;  4CGP A;  5BY0 A;  2AUN A;  1NBW A;  2Q4V A;  2B4B A;  2YND A;  1DIK A;  4P4J A;  4A4C A;  1LCP A;  1SQH A;  2AJ6 A;  3FYN A;  1Y9K A;  2F7V A;  2PIY A;  3R1K A;  3HMJ G;  1TF9 A;  5H84 A;  4AXV A;  4M8D A;  1CP7 A;  4CYP A;  4NEX A;  4P4E A;  4KOV A;  4MY0 A;  4AVA A;  1Y0Y A;  3PRT A;  2PSW A;  3BJ8 A;  4KOX A;  4CAV A;  3WT4 A;  3S9N A;  3IJ3 A;  1RXT A;  3HPG G;  1L0C A;  3CZX A;  3B2Y A;  4AVB A;  3HPH E;  4INJ A;  2F5I A;  2RFH A;  2MP0 A;  2AFW A;  4TJX A;  5F5X A;  2EBJ A;  4B12 A;  3RBU A;  2YGW A;  3EXN A;  1VHE A;  2PJA A;  4M6H A;  4Y49 B;  4NGQ A;  8CPA A;  1Z4E A;  4MHY A;  4B5P B;  2WZN A;  2KCW A;  1XF1 A;  2Q7S A;  5EC4 A;  3RZA A;  3SI0 A;  1BXR B;  1MK4 A;  1VGY A;  3UY5 A;  2VBQ A;  5D29 A;  2NMT A;  1VI4 A;  2WYR A;  3NOJ A;  1GHE A;  1QSO A;  3VAT A;  5K99 A;  3CDX A;  4BIN A;  4MFZ A;  2PVV A;  2ZEH A;  4U9Y A;  1ARL A;  4PK3 A;  2ZOF A;  1KUX A;  1S7K A;  2AFZ A;  1I12 A;  5LYD A;  3FNC A;  4F0X A;  2IJZ A;  3D7H A;  4KSA A;  2ZW7 A;  2ZEF A;  4EME A;  1YQE A;  4H6Z A;  1Q2C A;  3A9L A;  4KNG E;  3OB1 B;  2BUE A;  2PJC A;  1Z9U A;  3KKW A;  1IU8 A;  2NYQ A;  3CXP A;  1PCA A;  2GFQ A;  1FNO A;  3B3C A;  4KOW A;  3VWD A;  3FX6 A;  2P6G A;  2Z3K A;  4C7I A;  2OLS A;  2B3V A;  3D7D A;  4JZ0 A;  1QSN A;  1NXJ A;  1QSR A;  3VRN A;  1C3O B;  2YJV A;  4X3R A;  2ABZ A;  4F9U A;  3R96 A;  1NSA A;  1Y7R A;  2Z3O A;  2FM4 A;  3GB0 A;  5IB0 A;  1XMT A;  4DJL A;  5JGF A;  2PR8 A;  2R8V A;  4R87 A;  5H86 A;  2X0S A;  1Y7E A;  2GLF A;  3B8G A;  2XPO A;  1DE4 C;  1XRY A;  3D7G A;  2PQ8 A;  3EC4 A;  4OID A;  4OC3 A;  3QAY A;  5LYL A;  1VBH A;  3TO9 A;  4WWV A;  4FD6 A;  4LQG A;  2P6E A;  4OAE A;  1XBU A;  2QVP A;  2FIW A;  5HMN A;  2J8M A;  4MHD A;  1ZG7 A;  4F0Y A;  2V77 A;  2BOA A;  4QC6 A;  3FJU A;  1ARM A;  3S6G A;  3T0T A;  2EZC A;  1KEE B;  1MJB A;  3F9K C;  5F48 A;  4KOS A;  4CAF A;  3F5B A;  4XNH B;  3T9Y A;  4R8F A;  4KVM E;  1IIC A;  3I9S A;  2VKZ G;  2DPT A;  4ONU A;  1RTQ A;  4EFD A;  1QST A;  1Y0R A;  4A4B A;  3S6F A;  1ZG9 A;  3U1B A;  1BPM A;  5JVL A;  1BLL E;  2Z10 A;  3PZJ A;  1HDU A;  4R6T A;  4K3N A;  3DLJ A;  3G23 A;  1OZP A;  4RI1 A;  2HQY A;  1NE9 A;  3LAC A;  3VAR A;  3B35 A;  3NFQ A;  3B3W A;  4MI4 A;  2DPS A;  3KHZ A;  2D0O A;  3G3S A;  5K8O A;  3ICU A;  4PXB A;  1QQ9 A;  3IU2 A;  1R57 A;  4FD4 A;  2EZA A;  3BUW B;  4YRH A;  4JYW A;  1EO0 A;  4C7H A;  4CGO A;  4IK2 A;  3MGD A;  4CDJ A;  6CPA A;  2CF4 A;  3TYX A;  5F09 A;  1TKF A;  3JRU A;  2YNE A;  4M85 A;  4P10 A;  1M4L A;  2OU2 A;  2DLA A;  3CPA A;  3PB6 X;  3E0K A;  3ZZI A;  1F2P A;  1IGB A;  3EO4 A;  2ZEP A;  4C8A A;  3JUW A;  2ZW6 A;  3IWW A;  2CNT A;  4UEF A;  4EYS A;  2O4H A;  4Z65 A;  2Z3N A;  2ZXV A;  2P6F A;  3TC8 A;  3LWU A;  3TLY A;  4MCQ A;  4FD7 A;  2GP4 A;  4IUS A;  2ZPA A;  4YN3 A;  4QVT A;  3NH5 A;  5F9M A;  3VRQ A;  2O28 A;  4I49 A;  4ORF A;  2G3A A;  3B7I A;  3IIB A;  4BPX B;  2Z11 A;  2DIK A;  3PB9 X;  2XEI A;  2C6P A;  4NGT A;  5A27 A;  2ZEG A;  2X7B A;  1CPX A;  2V8G A;  4AG9 A;  5HXD A;  3SI1 A;  1CS0 B;  2YJT A;  2BCO A;  3DNS A;  3WR7 A;  5F46 A;  4OP4 A;  3DR8 A;  4UCM A;  4JLY A;  3VRR A;  3KL9 A;  4GS4 A;  1XEB A;  4TWE A;  3HLP A;  4X2T A;  4K30 A;  4A94 A;  4C9R A;  5BWA B;  4BPW B;  2N3A B;  4A31 A;  3NA6 A;  1M44 A;  2Q4Z A;  3IEH A;  3RNZ A;  1WJT A;  5K8M A;  4U5Y A;  3PFV A;  3BI1 A;  2ZW4 A;  3WC7 A;  3ISZ A;  1M4D A;  4B14 A;  2UV8 G;  1TKJ A;  4OKO A;  3F0A A;  3P2F A;  1M1D A;  4COG A;  1LAP A;  1XIX A;  1FT7 A;  5AG6 A;  4C9A A;  4C9U A;  4IIX A;  3H8F A;  5G20 A;  4Q7A A;  1WWZ A;  3OP0 A;  1UWY A;  4MHP A;  5DWN A;  3FF3 A;  1LRZ A;  2EWB A;  3WC5 A;  2CTC A;  4R3L A;  3D3S A;  2C27 A;  1LOK A;  3EZE A;  2AFS A;  5HKZ A;  3JTK A;  2BL1 A;  2Q7B A;  1AUG A;  5HH1 A;  3D2M A;  4DUK A;  4FBE A;  1YLO A;  3MN8 A;  1MJA A;  4AB7 A;  3ZNI A;  5JYB A;  4LX9 A;  5K8N A;  4RR2 B;  2FSR A;  3TOA A;  4A39 A;  2POK A;  2EK8 A;  2FIA A;  3RYO A;  1ZLH A;  5JH9 A;  4OC2 A;  3CXQ A;  1CJW A;  2BO9 A;  2HB6 A;  4MHN A;  2AUM A;  1YLE A;  4PSX A;  5F13 A;  4YGO A;  4CGM A;  1RO5 A;  2V8V A;  3IFE A;  3NE8 A;  3H4Q A;  1MJ9 A;  2J8N A;  3T07 A;  2ZEN A;  3QNV A;  4R9M A;  1EZB A;  4NFR A;  4MMO A;  3U88 C;  2V8D A;  3EY5 A;  3IWG A;  4AVC A;  4B13 A;  4B5O A;  2OR4 A;  3VGO A;  2JEW A;  3D66 A;  1QSM A;  1GYT A;  2AE6 A;  4UIB A;  4YFJ A;  1V0C A;  4CGL A;  1XMB A;  3K9U A;  3LMS A;  2YNC A;  2R7H A;  2IL4 A;  2QIR A;  3NE7 A;  3FH4 A;  3PB7 X;  1CPS A;  4MXU A;  3KQZ A;  4XPD B;  2I79 A;  2Z3M A;  4QB9 A;  4R76 A;  4XPD C;  3CPX A;  5THW A;  4C85 A;  4C8P A;  2K5T A;  5LRG A;  3FED A;  2PJ5 A;  5ELY A;  4O23 A;  1JDB C;  5ISV A;  1P0H A;  4XPK A;  3KR4 A;  1EZA A;  2I3C A;  4M6I A;  3H5Z A;  4DYO A;  3D68 A;  3BLN A;  3KI9 A;  1LAN A;  4UFV A;  1YK3 A;  5IB9 A;  5HKY A;  2GRE A;  1JQG A;  4CZ1 A;  1KZF A;  4B10 A;  3S6K A;  2HI6 A;  3KAS A;  2G3T A;  4LQ6 A;  4CAW A;  4ZGY B;  3QAH A;  4ZBG A;  4E2A A;  4CO9 A;  3BUM B;  1IYL A;  3CT9 A;  3DSB A;  5I0C A;  4HNX B;  2O53 A;  1YRE A;  5C88 A;  4A37 A;  2J8R A;  4M3S A;  4B6Z A;  2PCU A;  4MCR A;  2Z3L A;  5GCN A;  2AFU A;  2PJ3 A;  4ZY2 A;  1NMT A;  4YU9 A;  4C86 A;  2REF A;  1Q7L A;  2PE3 A;  3PB4 X;  4XPL A; 
#chains in the Genus database with same CATH homology
 3RAM A;  1ZG8 A;  4UEE A;  3H8E A;  2ANP A;  3MRU A;  3N5F A;  5K8P A;  2PJ6 A;  4P4F A;  4C8U A;  1CX8 A;  3BHX A;  1DTD A;  1YW6 A;  3HUV A;  4MCS A;  2AFO A;  4F9V A;  4GM5 A;  2Q43 A;  2QJ8 A;  4TJV A;  5LRJ A;  2XEG A;  1YME A;  2PJ7 A;  4C8F A;  4FUU A;  2ZED A;  1VHO A;  4A38 A;  3IO1 A;  5LRK A;  4P45 A;  4P44 A;  2J9A A;  4CPA A;  1XFO A;  4P4B A;  4ZY0 A;  5HVG A;  2PJ4 A;  4IAV A;  2PRQ A;  2PJB A;  3KHX A;  3I1U A;  4KSI A;  4FWU A;  4ZX9 A;  4NGS A;  2HC9 A;  1R3N A;  3B3V A;  3PFE A;  1CBX A;  3PFO A;  4YWY A;  2CTB A;  3FEC A;  1TF8 A;  4R7M A;  4H2K A;  3WC6 A;  3K2K A;  4NGP A;  3WAB A;  3SJF A;  2ZOG A;  2V8H A;  3L2N A;  3SJE A;  2PJ9 A;  3V38 A;  3IC1 A;  5J1Q A;  5CPA A;  4UF4 A;  3NH4 A;  3GLJ A;  2XEF A;  4FAI A;  3B3S A;  4PXC A;  2C6G A;  3ISX A;  1XJO A;  3B3T A;  4G1P A;  3I6S A;  3PEI A;  2PJ1 A;  2QYV A;  3VTA A;  1CG2 A;  4NGM A;  3S9L A;  5DS0 A;  1OBR A;  1VIX A;  3KGQ A;  2DEA A;  3VH9 A;  2C6C A;  4MCP A;  4OME A;  5I4M A;  1F57 A;  1ZLI A;  4NJR A;  1BPN A;  4C8T A;  3PBB A;  4UIA A;  1H8L A;  2ZEO A;  3D67 A;  1TXR A;  3SJX A;  1KWM A;  3I74 A;  4C99 A;  3KQX A;  4PXD A;  1ELM P;  3T8W A;  2IQ6 A;  2PIZ A;  3H8G A;  3PBE A;  2VL1 A;  2RB7 A;  3NH8 A;  4NJQ A;  4ZI6 A;  3D4U A;  4OIW A;  4ONW A;  4PPZ A;  2IMO A;  3SI2 A;  4C9R A;  3FVL A;  5LYF A;  4C8C A;  2ZEE A;  2XEJ A;  1QMU A;  2ZEL A;  2F8H A;  3K9T A;  4TNU A;  4PQA A;  3D7F A;  3S9M A;  3EIF A;  3BXM A;  1R43 A;  4ZX8 A;  4P4D A;  1YW4 A;  4WJB A;  1F2O A;  1V6C A;  2G9D A;  4MRI A;  4F8Z A;  2OOT A;  2AFX A;  4X8I A;  2NSM A;  2PJ8 A;  2CIJ A;  3PB8 X;  5D8N A;  4EWT A;  5IR2 A;  5HVF A;  4BD9 A;  4ZYQ A;  2GU2 A;  3NFZ A;  2AFM A;  2PVW A;  3TX8 A;  4OC0 A;  4NGN A;  3DGV A;  3SJG A;  2PJ0 A;  4C84 A;  3KR5 A;  1BAV A;  3FMC A;  4MHZ A;  3KZW A;  1TKH A;  2GLJ A;  2Q51 A;  1Z8L A;  1EE3 P;  1HEE A;  1AYE A;  4ZY1 A;  2FVG A;  2JBJ A;  3FEE A;  5JM6 A;  1YSJ A;  3GUX A;  4OC1 A;  4UEZ A;  1CP6 A;  3V7Z A;  4OC5 A;  1LAM A;  1IY7 A;  4NGR A;  1HDQ A;  1Z5R A;  1Z2L A;  2ZEM A;  2PJ2 A;  5LYI A;  2C1C A;  4C9V A;  4CDK A;  1ELL P;  1WVM A;  4OC4 A;  1LFW A;  2C5Q A;  4P6Y A;  7CPA A;  1Y9Z A;  4IHM A;  4RUH A;  4W9Y A;  2JBK A;  5CBM A;  1AMP A;  2EK9 A;  1PYT B;  3BI0 A;  4P4I A;  4PXE A;  4P4J A;  1LCP A;  2F7V A;  2PIY A;  1TF9 A;  4AXV A;  1CP7 A;  4P4E A;  5HVH A;  1Y0Y A;  3PRT A;  3WT4 A;  3S9N A;  3IJ3 A;  3B2Y A;  2RFH A;  2AFW A;  4TJX A;  3RBU A;  1VHE A;  2PJA A;  4NGQ A;  8CPA A;  4MHY A;  2WZN A;  1XF1 A;  3RZA A;  3SI0 A;  1VGY A;  5D29 A;  2WYR A;  3VAT A;  3CDX A;  2PVV A;  2ZEH A;  1ARL A;  2ZOF A;  2AFZ A;  5LYD A;  2IJZ A;  3D7H A;  2ZEF A;  4EME A;  4KNG E;  2PJC A;  2NYQ A;  1PCA A;  3B3C A;  1FNO A;  3FX6 A;  3D7D A;  4JZ0 A;  4X3R A;  2ABZ A;  4F9U A;  1NSA A;  3GB0 A;  4DJL A;  5JGF A;  1Y7E A;  2GLF A;  4OID A;  1DE4 C;  1XRY A;  3D7G A;  5LYL A;  4OC3 A;  4WWV A;  4LQG A;  1XBU A;  2QVP A;  1ZG7 A;  2V77 A;  2BOA A;  3FJU A;  1ARM A;  4R8F A;  4EFD A;  1RTQ A;  1Y0R A;  1ZG9 A;  1BPM A;  1BLL E;  1HDU A;  4R6T A;  4K3N A;  3DLJ A;  3VAR A;  3B35 A;  3B3W A;  3KHZ A;  5K8O A;  3ICU A;  4PXB A;  1QQ9 A;  4JYW A;  4CDJ A;  4IK2 A;  6CPA A;  2CF4 A;  5F09 A;  1TKF A;  3JRU A;  4P10 A;  1M4L A;  3CPA A;  3PB6 X;  1F2P A;  1IGB A;  2ZEP A;  4C8A A;  3IWW A;  4UEF A;  2O4H A;  4Z65 A;  3TC8 A;  3LWU A;  4MCQ A;  2GP4 A;  4YN3 A;  3NH5 A;  3B7I A;  3IIB A;  3PB9 X;  2XEI A;  2C6P A;  4NGT A;  5HXD A;  2ZEG A;  1CPX A;  2V8G A;  3SI1 A;  2BCO A;  4OP4 A;  4C9E A;  3KL9 A;  4X2T A;  4TWE A;  3HLP A;  4A94 A;  3NA6 A;  2Q4Z A;  3IEH A;  5K8M A;  3BI1 A;  3WC7 A;  3ISZ A;  1TKJ A;  4OKO A;  1LAP A;  4C9U A;  1FT7 A;  4C9A A;  3H8F A;  4Q7A A;  4MHP A;  1UWY A;  3FF3 A;  2EWB A;  3WC5 A;  2CTC A;  1LOK A;  2AFS A;  4FBE A;  4DUK A;  1YLO A;  3MN8 A;  5K8N A;  4A39 A;  2POK A;  2EK8 A;  1ZLH A;  5JH9 A;  4OC2 A;  2BO9 A;  2HB6 A;  4MHN A;  2V8V A;  3IFE A;  2ZEN A;  3QNV A;  4NFR A;  4MMO A;  2V8D A;  2OR4 A;  2JEW A;  3D66 A;  1GYT A;  4UIB A;  1XMB A;  3LMS A;  3FH4 A;  4MXU A;  1CPS A;  3PB7 X;  3KQZ A;  4R76 A;  3CPX A;  5THW A;  4C85 A;  4C8P A;  5LRG A;  3FED A;  2PJ5 A;  5ELY A;  4O23 A;  3KR4 A;  2I3C A;  4DYO A;  3D68 A;  3KI9 A;  1LAN A;  5IB9 A;  2GRE A;  1JQG A;  3KAS A;  3CT9 A;  2O53 A;  4A37 A;  4B6Z A;  2PCU A;  4MCR A;  2AFU A;  2PJ3 A;  4ZY2 A;  4YU9 A;  4C86 A;  1Q7L A;  2PE3 A;  3PB4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...