2XEFA

Human glutamate carboxypeptidase ii in complex with antibody- recruiting molecule arm-p8
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVQPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 268
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xefA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xefA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xefA02
2AFZA 4MRIA 4PXDA 4F9UA 3N5FA 1HDQA 1TF9A 2XEGA 3IFEA 3I1UA 2PJAA 1LANA 4P6YA 5JH9A 1EE3P 2EWBA 2Q51A 1R3NA 3TX8A 4BD9A 4NGQA 2EK8A 3B3CA 1QMUA 1ZLHA 2NSMA 3IJ3A 4MHZA 1R43A 1CBXA 1YLOA 5CBMA 5HVFA 2PE3A 1CP6A 3KL9A 3VTAA 2CF4A 3CDXA 4R8FA 4OC2A 4ZX8A 1HDUA 2ZEEA 2ZEDA 5J1QA 4NJRA 3BXMA 4P4FA 1Y9ZA 3CPXA 2Q4ZA 4ZY1A 1OBRA 4KNGE 4Q7AA 4CPAA 4ZY2A 2GLFA 2VL1A 1TKHA 2AFWA 4H2KA 2QYVA 2PJ7A 2CIJA 2POKA 3DGVA 3GB0A 4UEEA 3D7FA 1CPXA 1LAMA 3HLPA 3PFEA 3K9TA 5JM6A 1ZG7A 4C8CA 3BI1A 3FMCA 4R7MA 2GLJA 3H8FA 4NFRA 5LRKA 2ZOFA 5K8OA 1HEEA 3S9MA 1FNOA 1LCPA 6CPAA 3CPAA 4PXCA 4UIAA 4EMEA 5LYDA 3PBEA 2ZEGA 3VARA 4C9EA 3KQXA 2ZENA 1BPNA 1KWMA 2ANPA 1F2OA 3PRTA 2I3CA 4MCSA 2JBJA 4NGPA 3FX6A 3RAMA 3BHXA 4X8IA 3D67A 2CTCA 5THWA 1AMPA 3FEDA 2HC9A 2ZOGA 3V38A 4EFDA 5JGFA 4UF4A 4WJBA 3PB7X 2AFSA 1XFOA 3B3WA 4C99A 2V8HA 4MHPA 1XJOA 2PRQA 2DEAA 4NGTA 3NFZA 3PBBA 1ZG8A 3I6SA 2GU2A 1WVMA 2XEFA 5LRGA 3FH4A 4PPZA 5LRJA 2J9AA 1VIXA 5LYIA 4UEFA 4C9RA 1TXRA 3HUVA 2IMOA 2AFOA 4R6TA 4YWYA 2PJ5A 2WZNA 2ZEOA 2PVVA 2OR4A 2XEIA 8CPAA 2BOAA 1BPMA 5K8MA 3S9NA 2ZEPA 3TC8A 4DUKA 3H8EA 1F57A 2V8DA 3SI1A 4X3RA 2EK9A 4OIWA 3FEEA 1RTQA 4NGSA 1VHOA 5F09A 3KI9A 1ARLA 1CP7A 2BCOA 1Q7LA 2ZELA 4DYOA 3IC1A 4UEZA 1Z8LA 2QJ8A 4KSIA 4JYWA 4FWUA 4MMOA 5K8PA 4K3NA 1GYTA 5D8NA 1LFWA 3IWWA 1AYEA 3FJUA 3KHZA 4OC5A 3D7DA 4YN3A 1TKJA 1YMEA 4P10A 2C6GA 4OMEA 1YW6A 3CT9A 2PJ8A 3MRUA 4C86A 4RUHA 4X2TA 4F8ZA 3DLJA 4FAIA 2PJ6A 4C9VA 4OC0A 3KZWA 2JBKA 2JEWA 5LYFA 1TF8A 3WABA 4P45A 3D7HA 3RBUA 1YW4A 4TWEA 4C8AA 4C9AA 2C6CA 1V6CA 5CPAA 3PEIA 1IGBA 3MN8A 2PCUA 1ZLIA 3I74A 2PJ0A 5K8NA 2XEJA 4P4IA 3KQZA 5HVGA 3D66A 3PB8X 4A38A 1Y0YA 7CPAA 3B35A 3PB9X 3JRUA 4A39A 1NSAA 4P4EA 3S9LA 3B3VA 3WT4A 1XRYA 2IQ6A 4EWTA 1DE4C 1ELMP 3B3TA 4P4DA 3B3SA 1YSJA 3KHXA 3B7IA 2RB7A 1ZG9A 4OP4A 4ZYQA 4F9VA 3IO1A 4NJQA 3ICUA 4NGMA 1XF1A 3SJFA 4PXBA 4C9UA 1TKFA 5HXDA 2Q43A 4C8FA 2RFHA 3K2KA 4C85A 3ISXA 3SI2A 4TJVA 3T8WA 4OC3A 2CTBA 4P4JA 3WC7A 2V77A 2O53A 3NH8A 2OOTA 4YU9A 3D68A 3WC6A 4LQGA 4TJXA 4PXEA 1BLLE 4IK2A 5ELYA 3PB6X 1F2PA 3SJEA 4G1PA 4MXUA 4CDKA 5HVHA 4MHYA 3PFOA 2C1CA 4ZY0A 2ZEMA 3WC5A 2PJ1A 5I4MA 4A37A 3GUXA 1PYTB 4B6ZA 4ZX9A 1XMBA 4ONWA 4TNUA 1Z2LA 2GREA 1FT7A 2V8VA 1QQ9A 1H8LA 2PJ2A 1CX8A 4C8PA 3D7GA 4OC1A 3KGQA 2IJZA 4DJLA 2ZEFA 4C8UA 3VH9A 3BI0A 4JZ0A 3IEHA 3QNVA 3RZAA 1CG2A 4FUUA 4FBEA 4CDJA 2AFXA 4WWVA 2HB6A 3NH5A 4ZI6A 4C84A 2QVPA 4GM5A 1JQGA 1LOKA 4NGNA 4Z65A 4OIDA 2WYRA 3EIFA 2PJ3A 1Y7EA 3PB4X 2ZEHA 4R76A 1VGYA 3LMSA 3B2YA 2FVGA 5IB9A 2F8HA 3L2NA 1UWYA 2O4HA 3GLJA 2PVWA 4OKOA 5DS0A 2G9DA 3VATA 1Z5RA 2V8GA 3NA6A 4MCRA 3H8GA 1DTDA 3IIBA 3FVLA 4AXVA 4O23A 2AFMA 3D4UA 2AFUA 3LWUA 4IHMA 1ARMA 2F7VA 1LAPA 4MCPA 2PIZA 1BAVA 4NGRA 3KASA 1VHEA 2PJ9A 3FECA 2PIYA 4UIBA 4C8TA 3FF3A 5LYLA 3V7ZA 4MHNA 4IAVA 4A94A 3NH4A 1IY7A 1XBUA 4W9YA 1M4LA 5D29A 2BO9A 2C6PA 2PJBA 2PJCA 4PQAA 4P44A 1PCAA 2PJ4A 3SI0A 1CPSA 3SJXA 3ISZA 3SJGA 3KR4A 2ABZA 3KR5A 4P4BA 2NYQA 1Y0RA 1ELLP 4OC4A 4MCQA
chains in the Genus database with same CATH superfamily
2AFZA 4MRIA 2Q7SA 4PXDA 5IB0A 2ZW5A 3GKRA 4MI1A 1KZFA 4F9UA 3N5FA 1HDQA 2PDOA 1TF9A 2XEGA 3IFEA 3P2FA 2IL4A 1WK4A 3I1UA 2PJAA 4UBRA 4KLWA 1LANA 4P6YA 3W91A 5JH9A 1EE3P 2EWBA 2I79A 2Q51A 2Z3KA 1R3NA 3TX8A 2Z3NA 4CS0B 3TLYA 2J8RA 1J4JA 3H4QA 4NGQA 2EK8A 2B4JC 5CNPA 2HQYA 3BJ7A 4BD9A 5I0CA 2WSAA 2VZYA 4ZGYB 5F13A 3B3CA 1QMUA 1ZLHA 2NSMA 2CNTA 3IJ3A 2P6GA 4MHZA 1Y7RA 2Z3MA 5A28A 3TYXA 2WUUA 4GS4A 2O28A 3TO7A 5F1YA 2R8VA 4H89A 1R43A 1CBXA 1YLOA 2EVNA 3F0AA 3KKWA 3DSBA 4KZTA 5CBMA 5HVFA 3SXOA 1Z8TA 2PE3A 1CP6A 1S7FA 2DPTA 3KL9A 2JDDA 4KS9A 4A33A 2EZAA 4MJXA 2AJ6A 2WPXA 2CF4A 2GANA 3VTAA 2OB0A 4B5PB 3CDXA 1FY7A 4H1HA 1VKCA 4R8FA 4OC2A 4ZX8A 1VI4A 3S6GA 1HDUA 2ZEEA 2P0WA 1P4NA 3PLFB 2OH1A 3F8KA 2ZEDA 5J1QA 4NJRA 3BXMA 4BTFA 2GFQA 4F0XA 4P4FA 1Y9ZA 3CPXA 3T5MA 2Q0YA 2HI6A 2Q4ZA 4MBUA 4ZY1A 4J3GA 3R95A 4RS2A 1OBRA 4FD7A 1T36B 4KOTA 4KNGE 2ZW6A 4Q7AA 4CPAA 1QSOA 2R7HA 4ZY2A 3D2PA 1KEEB 2GLFA 3VRPA 2PSWA 4QVTA 1YGHA 2VL1A 1TKHA 2JLMA 4U9YA 2ZW7A 5IV0A 2AFWA 4H2KA 2B4BA 5KTDA 4MFJA 2EZBA 2QYVA 5EBVA 2PJ7A 2CIJA 1MJBA 2POKA 3DGVA 2DIKA 4KLVA 2GP4A 4C7HA 3GB0A 3S6HA 4UEEA 3D7FA 1CPXA 1LAMA 4UCPA 2OU2A 1XEBA 3HLPA 3RNZA 3PFEA 4CAWA 3K9TA 5JM6A 1IIDA 4C7IA 5IX3A 3SHPA 1ZG7A 1B87A 3JTKA 1VHSA 4C8CA 3BI1A 2VXKA 3FMCA 1Z4EA 4INJA 2Q44A 3VWDA 2ODFA 4R7MA 5EC4A 2GLJA 4NEXA 3H8FA 5G1ZA 1Q5XA 4NFRA 3LACA 1JDBC 2UV8G 5F5XA 5LRKA 2ZPAA 2ZOFA 4BBHA 5K8OA 1HEEA 2NMTA 3S9MA 3RYOA 4KOXA 1FNOA 1LCPA 1YR0A 4AB7A 4B5PA 6CPAA 3CPAA 1M4GA 4KVME 4PXCA 4UIAA 2D4OA 4EMEA 3OAKA 5GCNA 3D8PA 5LYDA 3PBEA 3VRQA 2ZEGA 5HH1A 3VARA 4A32A 5ISVA 4KOVA 4PK3A 1XF8A 3KQXA 4C9EA 2ZENA 1BPNA 5G21A 1YLEA 1MK4A 2CXAA 2VI7A 3JUWA 1KWMA 2EBJA 2ANPA 2P6EA 1S3ZA 4CAXA 1F2OA 3PRTA 4KORA 5KTAA 4RN7A 4HNYB 2I3CA 4BPXB 4MCSA 1Q2YA 2JBJA 4NGPA 4MFLA 3FX6A 3RAMA 1S7NA 4YGOA 4C68A 4L8AA 3BHXA 2YNDA 2GIVA 4OADA 2EO8A 4X8IA 2HWGA 3D67A 4UCMA 1I21A 2CTCA 4GPLB 5THWA 1AMPA 4KUBA 4E8OA 4KVOE 2B3VA 5BWAB 3W6SA 5IR2A 3FEDA 2HC9A 2VEZA 2ZOGA 3V38A 1B47A 2Q4YA 4EFDA 1DIKA 1NMTA 5JGFA 3KRVA 4AVBA 4B14A 4BINA 3EXNA 4UF4A 4WJBA 5EMIA 3PB7X 2AFSA 1XFOA 2ZW4A 1TIQA 3B3WA 4IUSA 4CYQA 1NBWA 4C99A 2V8HA 4MHPA 4MI4A 5HKZA 1XJOA 2PRQA 2DEAA 4NGTA 2Z11A 3BLNA 3MGDA 4OAEA 3NFZA 3BJ8A 4XNHB 4XNHC 4CRZB 2X0SA 5JPHA 2CNSA 4B11A 4R57A 3PBBA 3CZXA 4MY0A 1ZG8A 4ORFA 1ZL0A 3I6SA 2GU2A 1WVMA 3HPGG 2REFA 4A4CA 3FXTA 2XEFA 5LRGA 3QAHA 3T07A 3FH4A 4PPZA 5LRJA 2J9AA 1VIXA 5LYIA 1EZAA 3OWCA 3NE7A 4UEFA 1P0HA 4C9RA 1TXRA 3HUVA 2IMOA 4UWIA 3QAYA 4OLLA 4CGLA 1M44A 2AFOA 4PV6A 2B4DB 4R6TA 4UFVA 1NXJA 3TLBA 4YWYA 2PJ5A 1CE8B 2WZNA 2ZEOA 4FD6A 3BUOB 4RI1A 3T9YA 2PVVA 1L0CA 4DNCA 2OR4A 2XEIA 2GE3A 1I12A 3T05A 4EYSA 1S60A 8CPAA 5AG7A 5HKWA 2BOAA 1BPMA 5K8MA 3S9NA 4FD4A 4BPUB 1IYKA 3JVNA 2Z3OA 1IB1E 2ZEPA 3TC8A 4E0AA 1NE9A 4CYPA 4DUKA 3H8EA 3B8GA 2PCNA 3DR8A 4XPLA 2EUIA 4B5OA 1F57A 2V8DA 4YFJA 4IIYA 4XPKA 3SI1A 4X3RA 2EK9A 2FE7A 4CAVA 2Y0MA 1JDEA 1QSTA 2JDCA 4NXYA 3FEEA 1RTQA 1CM0A 2OZHA 4HKFA 4OIWA 4PK2A 4MFQA 4NGSA 1VHOA 3HMJG 5F09A 1MJAA 3IU1A 3G8WA 5FD8A 2K5TA 3BUMB 3FB3A 1ARLA 3KI9A 2Z3LA 5E96A 1ON0A 1CP7A 2BCOA 3I3GA 1Q7LA 3IGRA 1M4DA 2AUMA 2D0PA 2I00A 2ZELA 4PSWA 2YJVA 4Q36A 4DYOA 4COGA 2X7BA 3IC1A 4UEZA 1PUAA 3C8OA 1Z8LA 2QJ8A 3EZAA 5AXIA 4KSIA 3NOJA 5C88A 4JYWA 4KOYA 2Z10A 4FWUA 4MMOA 5AG6A 4R9MA 4K3NA 3TCVA 5K8PA 2FT0A 2YJTA 5HKYA 1GYTA 5D8NA 3R9EA 4CGOA 1IOFA 1LFWA 3IWWA 1AYEA 3FJUA 4XPDC 4XPDB 4BMHA 5JYBA 2FXFA 3KHZA 4OC5A 3C26A 3EFAA 1S7LA 3D7DA 4QBJA 4YN3A 2R98A 2YNCC 1TKJA 1YMEA 3G3SA 2FIAA 3DDDA 2C6GA 4P10A 4CGMA 3VRNA 4OMEA 1YW6A 3CT9A 2B5GB 2PJ8A 3MRUA 3TOBA 4J0NA 4C86A 4MFZA 4RUHA 1X12A 4X2TA 3EO4A 3VWEA 4F8ZA 3A9LA 3DLJA 4MFKA 2B4DA 4BPWB 1NSLA 4KSFA 4FAIA 1WJTA 2DLAA 2PJ6A 4C9VA 1BO4A 1EZBA 1Q2DA 2D4PA 3FYNA 3VROA 4OC0A 3KZWA 2AE6A 1KC7A 3QB8A 4E94A 2JBKA 2JEWA 1Z8XA 2Z0ZA 1M1DA 4CRYB 5LYFA 2Y1MA 1TF8A 3WABA 2XPPA 1RXTA 4P45A 3P2HA 3D7HA 3RBUA 3VRRA 1XE4A 1YW4A 3IWGA 4TWEA 4C8AA 2E28A 4C9AA 2C6CA 1KUXA 2JEVA 4NCZA 2R82A 4MJ8A 4R3LA 4KUAA 4LX9A 3LD2A 1V6CA 3EZBA 5CPAA 2DPSA 1YVOA 3PEIA 4U9ZA 1IGBA 3MN8A 2EZCA 1LRZA 3HPHE 2PCUA 1ZLIA 3I74A 2PJ0A 5K8NA 2G3TA 4HPSA 2XEJA 1M4IA 2PQ8A 3BUWB 4P4IA 3H5ZA 3KQZA 3D66A 5HVGA 2B0AA 3PB8X 4A38A 1Y0YA 2CNMA 7CPAA 4M85A 3B35A 4ZBGA 5DWNA 3PB9X 3R9FA 1WWZA 3JRUA 1Z8WA 4A39A 4GXHA 1NSAA 1BXRB 4KOSA 4UFWA 3WR7A 3V8IA 5KTCA 4EVYA 4R87A 4P4EA 4JVOA 3S9LA 4II9A 5F9MA 2G0BA 2PR8A 3NFQA 3B3VA 1XRYA 3F5BA 3WT4A 1J3LA 4MFPA 2IQ6A 4EWTA 4K30A 4UWJA 1DE4C 1ELMP 2Z3PA 1OZPA 3B3TA 5C82A 4JXRA 4P4DA 4UA3A 3OB2B 2YNCA 3TLGB 2BL1A 1AUGA 4KSAA 4E2AA 3B3SA 1YSJA 3F9KC 3KHXA 1YREA 2BEIA 3B7IA 3T90A 4KOWA 3BUXB 3TT2A 3W6XA 1ZYMA 2RB7A 1ZG9A 4OP4A 4U5YA 4ZYQA 5AG4A 5J8CA 2Q4VA 4F9VA 1N71A 3IO1A 4NJQA 2ATRA 4NGMA 3ICUA 1XF1A 3SJFA 4PXBA 4B12A 1C30B 2PR1A 1VBHA 1UFHA 1KUYA 4C9UA 1TKFA 5HXDA 2Q43A 4M6IA 4AVCA 4C8FA 3OB1B 2RFHA 3DR6A 3K2KA 2QIRA 2YGWA 4F0YA 2CY2A 1M6VB 1S7KA 2HV2A 4C85A 1CJWA 5F46A 3IU2A 3ISXA 3SI2A 4TJVA 3O8ZA 2QMLA 3T8WA 3TLCA 4ONUA 4OC3A 2MP0A 4M6GA 2CTBA 4P4JA 3WC7A 2V77A 2O53A 4M8DA 3NH8A 5JVLA 5J8FA 2HUZA 2OOTA 2RC4A 4YU9A 3D68A 3K4IA 5A27A 1A2ZA 4JXQA 4YRHA 3TLAA 3WC6A 4JJXA 4LQGA 4CO9A 2N3AB 2J8MA 4TJXA 2OZGA 4PXEA 2YNEA 1BLLE 4IK2A 5ELYA 1RO5A 3SR3A 1YVHA 3PB6X 1F2PA 3SJEA 2BUEA 3FNCA 4G1PA 4MXUA 3NE8A 3UY5A 4QB9A 4HNWB 5G20A 4CDKA 5HVHA 1QSNA 1KBLA 3I9SA 1Z9UA 2Y1NA 1JWQA 2B58A 1R61A 4MHYA 4AG9A 3PFOA 4X5KA 2XPNA 4HNXB 4I49A 2FCKA 5AGEA 2C1CA 3GJZA 3TLZA 4QC6A 1CS0B 3S6FA 5F49A 3EC4A 2DF5A 2ZEMA 3WC5A 2PJ1A 4ZY0A 5AG5A 5I4MA 3G23A 4A37A 3R1KA 3GUXA 1PYTB 4B6ZA 4ZX9A 5DWMA 1R57A 1XMBA 4ONWA 4TNUA 2VKZG 1S5KA 5G22A 1ZO0A 1Z2LA 3TLGA 2GREA 1FT7A 2V8VA 4CYOA 3PT1A 1QQ9A 5F47A 1H8LA 2WPWA 3S6KA 1K4JA 2PJ2A 1CX8A 2VQYA 4C8PA 3LODA 3D7GA 1IU8A 4OC1A 2QECA 1A9XB 1PU9A 4MY3A 2IJZA 3KGQA 4DJLA 4MHDA 5HMNA 4CAEA 2KCWA 4M6HA 2ZEFA 4L89A 3VH9A 4AVAA 4C8UA 3TLEA 3BI0A 4JZ0A 3GIUA 2ZXVA 4E5SA 4R3KA 4C2ZA 3IEHA 3CXQA 4KVXA 4CZ1A 3GY9A 2PRBA 1GHEA 4JLYA 1IYLA 3QNVA 2XPLA 1EO0A 1XOVA 1ZRSA 3RZAA 1VBGA 1QSMA 4A4BA 1CG2A 4FUUA 4CYNA 4FBEA 5F48A 4CGPA 3BUNB 3CXPA 4F6AA 5FVJA 2AFXA 4CDJA 2FM4A 3PZJA 1I1DA 4WWVA 2HB6A 3NH5A 4ZI6A 2CBLA 4IF5A 5JQ4A 2H5MA 4C84A 2OLSA 2QVPA 4GM5A 4KOUA 1JQGA 1LOKA 4NGNA 3SXNA 2XPOA 3TO6A 1YQEA 4C2YA 4Z65A 2Q04A 1GGOA 4OIDA 2WYRA 3EIFA 4NF1A 1BOBA 4UFXA 1KUVA 4Q38A 1FBVA 2PJ3A 1Z9EA 1SQHA 3PP9A 1Q2CA 1Y7EA 4H6UA 4JWPA 3PB4X 2ZEHA 4R76A 4A2ZA 3TFYA 3U1BA 1VGYA 1YX0A 3LMSA 4CAFA 3B2YA 4M3SA 2FVGA 2P6FA 3FIXA 3PFVA 5H84A 4C2XA 1B6BA 5IB9A 2F8HA 3EZEA 3L2NA 1UWYA 2O4HA 3GLJA 2PVWA 2VZZA 4OKOA 2B3UA 4QUSA 2G9DA 5DS0A 3VATA 1U6MA 1Z5RA 2FSRA 2V8GA 3NA6A 3N7ZA 4MCRA 2PC1A 2BSWA 3CXSA 4A31A 3H8GA 1DTDA 3DNSA 4A95A 3IIBA 3FVLA 4AXVA 2AUNA 5K99A 4RR2B 4O23A 2AFMA 2ARHA 3FBUA 3D4UA 2G3AA 2AFUA 3LWUA 4A30A 4IHMA 3RO0A 1ARMA 2F7VA 1LAPA 4MCPA 2PIZA 2VBQA 2OZUA 3GYAA 1BAVA 4NGRA 3OP0A 2FS5A 3KASA 4AG7A 1VHEA 1V0CA 1X10A 2PJ9A 3FECA 1Z4RA 2DXQA 2F5IA 5H86A 3FRMA 2FL4A 2FIWA 2A4NA 2PIYA 2B5GA 2Q7BA 2J8NA 3E0KA 4UIBA 3TOAA 4C8TA 3FF3A 5LYLA 1Y9WA 1XIXA 3D3SA 4UCNA 3K9UA 4FD5A 3V7ZA 4LUAA 3EY5A 4MHNA 4Y49B 3VGOA 4Y49C 3ZNIA 4IAVA 4A94A 1YVKA 3NH4A 1IY7A 4LQ6A 4COBA 1XBUA 2D0OA 4W9YA 1M4LA 4IIXA 2R1IA 5D29A 3U88C 2BO9A 2C6PA 2PJBA 2C5QA 5BY0A 3IWEA 2PJCA 4PQAA 4P44A 1PCAA 4JD6A 2PJ4A 4H6ZA 1IICA 1YK3A 3SI0A 4B13A 3T0TA 1CPSA 3SJXA 1Y9KA 3SJGA 3ISZA 4NSQA 4B10A 3KR4A 4CGNA 2ABZA 1MJ9A 3R96A 3D2MA 3PGPA 3ZZIA 3TE4A 3KR5A 3R9GA 1XMTA 4P4BA 5J3XA 3TO9A 2NYQA 1Y0RA 1C3OB 2HROA 1ELLP 4PSXA 3ZJ0A 1IOIA 2REEA 2C27A 3TTHA 4OC4A 1QSRA 4MCQA
chains in the Genus database with same CATH topology
2AFZA 4MRIA 4PXDA 4F9UA 3N5FA 1HDQA 1TF9A 2XEGA 3IFEA 3I1UA 2PJAA 1LANA 4P6YA 5JH9A 1EE3P 2EWBA 2Q51A 1R3NA 3TX8A 4BD9A 4NGQA 2EK8A 3B3CA 1QMUA 1ZLHA 2NSMA 3IJ3A 4MHZA 1R43A 1CBXA 1YLOA 5CBMA 5HVFA 2PE3A 1CP6A 3KL9A 3VTAA 2CF4A 3CDXA 4R8FA 4OC2A 4ZX8A 1HDUA 2ZEEA 2ZEDA 5J1QA 4NJRA 3BXMA 4P4FA 1Y9ZA 3CPXA 2Q4ZA 4ZY1A 1OBRA 4KNGE 4Q7AA 4CPAA 4ZY2A 2GLFA 2VL1A 1TKHA 2AFWA 4H2KA 2QYVA 2PJ7A 2CIJA 2POKA 3DGVA 2GP4A 3GB0A 4UEEA 3D7FA 1CPXA 1LAMA 3HLPA 3PFEA 3K9TA 5JM6A 1ZG7A 4C8CA 3BI1A 3FMCA 4R7MA 2GLJA 3H8FA 4NFRA 5LRKA 2ZOFA 5K8OA 1HEEA 3S9MA 1FNOA 1LCPA 6CPAA 3CPAA 4PXCA 4UIAA 4EMEA 5LYDA 3PBEA 2ZEGA 3VARA 4C9EA 3KQXA 2ZENA 1BPNA 1KWMA 2ANPA 1F2OA 3PRTA 2I3CA 4MCSA 2JBJA 4NGPA 3FX6A 3RAMA 3BHXA 4X8IA 3D67A 2CTCA 5THWA 1AMPA 5IR2A 3FEDA 2HC9A 2ZOGA 3V38A 4EFDA 5JGFA 4UF4A 4WJBA 3PB7X 2AFSA 1XFOA 3B3WA 4C99A 2V8HA 4MHPA 1XJOA 2PRQA 2DEAA 4NGTA 3NFZA 3PBBA 1ZG8A 3I6SA 2GU2A 1WVMA 2XEFA 5LRGA 3FH4A 4PPZA 5LRJA 2J9AA 1VIXA 5LYIA 4UEFA 4C9RA 1TXRA 3HUVA 2IMOA 2AFOA 4R6TA 4YWYA 2PJ5A 2WZNA 2ZEOA 2PVVA 2OR4A 2XEIA 8CPAA 2BOAA 1BPMA 5K8MA 3S9NA 2ZEPA 3TC8A 4DUKA 3H8EA 1F57A 2V8DA 3SI1A 4X3RA 2EK9A 4OIWA 3FEEA 1RTQA 4NGSA 1VHOA 5F09A 3KI9A 1ARLA 1CP7A 2BCOA 1Q7LA 2ZELA 4DYOA 3IC1A 4UEZA 1Z8LA 2QJ8A 4KSIA 4JYWA 4FWUA 4MMOA 5K8PA 4K3NA 1GYTA 5D8NA 1LFWA 3IWWA 1AYEA 3FJUA 3KHZA 4OC5A 3D7DA 4YN3A 1TKJA 1YMEA 4P10A 2C6GA 4OMEA 1YW6A 3CT9A 2PJ8A 3MRUA 4C86A 4RUHA 4X2TA 4F8ZA 3DLJA 4FAIA 2PJ6A 4C9VA 4OC0A 3KZWA 2JBKA 2JEWA 5LYFA 1TF8A 3WABA 4P45A 3D7HA 3RBUA 1YW4A 4TWEA 4C8AA 4C9AA 2C6CA 1V6CA 5CPAA 3PEIA 1IGBA 3MN8A 2PCUA 1ZLIA 3I74A 2PJ0A 5K8NA 2XEJA 4P4IA 3KQZA 5HVGA 3D66A 3PB8X 4A38A 1Y0YA 7CPAA 3B35A 3PB9X 3JRUA 4A39A 1NSAA 4P4EA 3S9LA 3B3VA 3WT4A 1XRYA 2IQ6A 4EWTA 1DE4C 1ELMP 3B3TA 4P4DA 3B3SA 1YSJA 3KHXA 3B7IA 2RB7A 1ZG9A 4OP4A 4ZYQA 4F9VA 3IO1A 4NJQA 3ICUA 4NGMA 1XF1A 3SJFA 4PXBA 4C9UA 1TKFA 5HXDA 2Q43A 4C8FA 2RFHA 3K2KA 4C85A 3ISXA 3SI2A 4TJVA 3T8WA 4OC3A 2CTBA 4P4JA 3WC7A 2V77A 2O53A 3NH8A 2OOTA 4YU9A 3D68A 3WC6A 4LQGA 4TJXA 4PXEA 1BLLE 4IK2A 5ELYA 3PB6X 1F2PA 3SJEA 4G1PA 4MXUA 4CDKA 5HVHA 4MHYA 3PFOA 2C1CA 4ZY0A 2ZEMA 3WC5A 2PJ1A 5I4MA 4A37A 3GUXA 1PYTB 4B6ZA 4ZX9A 1XMBA 4ONWA 4TNUA 1Z2LA 2GREA 1FT7A 2V8VA 1QQ9A 1H8LA 2PJ2A 1CX8A 4C8PA 3D7GA 4OC1A 3KGQA 2IJZA 4DJLA 2ZEFA 4C8UA 3VH9A 3BI0A 4JZ0A 3IEHA 3QNVA 3RZAA 1CG2A 4FUUA 4FBEA 4CDJA 2AFXA 4WWVA 2HB6A 3NH5A 4ZI6A 4C84A 2QVPA 4GM5A 1JQGA 1LOKA 4NGNA 4Z65A 4OIDA 2WYRA 3EIFA 2PJ3A 1Y7EA 3PB4X 2ZEHA 4R76A 1VGYA 3LMSA 3B2YA 2FVGA 5IB9A 2F8HA 3L2NA 1UWYA 2O4HA 3GLJA 2PVWA 4OKOA 5DS0A 2G9DA 3VATA 1Z5RA 2V8GA 3NA6A 4MCRA 3H8GA 1DTDA 3IIBA 3FVLA 4AXVA 4O23A 2AFMA 3D4UA 2AFUA 3LWUA 4IHMA 1ARMA 2F7VA 1LAPA 4MCPA 2PIZA 1BAVA 4NGRA 3KASA 1VHEA 2PJ9A 3FECA 2PIYA 4UIBA 4C8TA 3FF3A 5LYLA 3V7ZA 4MHNA 4IAVA 4A94A 3NH4A 1IY7A 1XBUA 4W9YA 1M4LA 5D29A 2BO9A 2C6PA 2PJBA 2C5QA 2PJCA 4PQAA 4P44A 1PCAA 2PJ4A 3SI0A 1CPSA 3SJXA 3ISZA 3SJGA 3KR4A 2ABZA 3KR5A 4P4BA 2NYQA 1Y0RA 1ELLP 4OC4A 4MCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFZ A;  4MRI A;  4PXD A;  4F9U A;  3N5F A;  1HDQ A;  1TF9 A;  2XEG A;  3IFE A;  3I1U A;  2PJA A;  1LAN A;  4P6Y A;  5JH9 A;  1EE3 P;  2EWB A;  2Q51 A;  1R3N A;  3TX8 A;  4BD9 A;  4NGQ A;  2EK8 A;  3B3C A;  1QMU A;  1ZLH A;  2NSM A;  3IJ3 A;  4MHZ A;  1R43 A;  1CBX A;  1YLO A;  5CBM A;  5HVF A;  2PE3 A;  1CP6 A;  3KL9 A;  3VTA A;  2CF4 A;  3CDX A;  4R8F A;  4OC2 A;  4ZX8 A;  1HDU A;  2ZEE A;  2ZED A;  5J1Q A;  4NJR A;  3BXM A;  4P4F A;  1Y9Z A;  3CPX A;  2Q4Z A;  4ZY1 A;  1OBR A;  4KNG E;  4Q7A A;  4CPA A;  4ZY2 A;  2GLF A;  2VL1 A;  1TKH A;  2AFW A;  4H2K A;  2QYV A;  2PJ7 A;  2CIJ A;  2POK A;  3DGV A;  3GB0 A;  4UEE A;  3D7F A;  1CPX A;  1LAM A;  3HLP A;  3PFE A;  3K9T A;  5JM6 A;  1ZG7 A;  4C8C A;  3BI1 A;  3FMC A;  4R7M A;  2GLJ A;  3H8F A;  4NFR A;  5LRK A;  2ZOF A;  5K8O A;  1HEE A;  3S9M A;  1FNO A;  1LCP A;  6CPA A;  3CPA A;  4PXC A;  4UIA A;  4EME A;  5LYD A;  3PBE A;  2ZEG A;  3VAR A;  4C9E A;  3KQX A;  2ZEN A;  1BPN A;  1KWM A;  2ANP A;  1F2O A;  3PRT A;  2I3C A;  4MCS A;  2JBJ A;  4NGP A;  3FX6 A;  3RAM A;  3BHX A;  4X8I A;  3D67 A;  2CTC A;  5THW A;  1AMP A;  3FED A;  2HC9 A;  2ZOG A;  3V38 A;  4EFD A;  5JGF A;  4UF4 A;  4WJB A;  3PB7 X;  2AFS A;  1XFO A;  3B3W A;  4C99 A;  2V8H A;  4MHP A;  1XJO A;  2PRQ A;  2DEA A;  4NGT A;  3NFZ A;  3PBB A;  1ZG8 A;  3I6S A;  2GU2 A;  1WVM A;  2XEF A;  5LRG A;  3FH4 A;  4PPZ A;  5LRJ A;  2J9A A;  1VIX A;  5LYI A;  4UEF A;  4C9R A;  1TXR A;  3HUV A;  2IMO A;  2AFO A;  4R6T A;  4YWY A;  2PJ5 A;  2WZN A;  2ZEO A;  2PVV A;  2OR4 A;  2XEI A;  8CPA A;  2BOA A;  1BPM A;  5K8M A;  3S9N A;  2ZEP A;  3TC8 A;  4DUK A;  3H8E A;  1F57 A;  2V8D A;  3SI1 A;  4X3R A;  2EK9 A;  4OIW A;  3FEE A;  1RTQ A;  4NGS A;  1VHO A;  5F09 A;  3KI9 A;  1ARL A;  1CP7 A;  2BCO A;  1Q7L A;  2ZEL A;  4DYO A;  3IC1 A;  4UEZ A;  1Z8L A;  2QJ8 A;  4KSI A;  4JYW A;  4FWU A;  4MMO A;  5K8P A;  4K3N A;  1GYT A;  5D8N A;  1LFW A;  3IWW A;  1AYE A;  3FJU A;  3KHZ A;  4OC5 A;  3D7D A;  4YN3 A;  1TKJ A;  1YME A;  4P10 A;  2C6G A;  4OME A;  1YW6 A;  3CT9 A;  2PJ8 A;  3MRU A;  4C86 A;  4RUH A;  4X2T A;  4F8Z A;  3DLJ A;  4FAI A;  2PJ6 A;  4C9V A;  4OC0 A;  3KZW A;  2JBK A;  2JEW A;  5LYF A;  1TF8 A;  3WAB A;  4P45 A;  3D7H A;  3RBU A;  1YW4 A;  4TWE A;  4C8A A;  4C9A A;  2C6C A;  1V6C A;  5CPA A;  3PEI A;  1IGB A;  3MN8 A;  2PCU A;  1ZLI A;  3I74 A;  2PJ0 A;  5K8N A;  2XEJ A;  4P4I A;  3KQZ A;  5HVG A;  3D66 A;  3PB8 X;  4A38 A;  1Y0Y A;  7CPA A;  3B35 A;  3PB9 X;  3JRU A;  4A39 A;  1NSA A;  4P4E A;  3S9L A;  3B3V A;  3WT4 A;  1XRY A;  2IQ6 A;  4EWT A;  1DE4 C;  1ELM P;  3B3T A;  4P4D A;  3B3S A;  1YSJ A;  3KHX A;  3B7I A;  2RB7 A;  1ZG9 A;  4OP4 A;  4ZYQ A;  4F9V A;  3IO1 A;  4NJQ A;  3ICU A;  4NGM A;  1XF1 A;  3SJF A;  4PXB A;  4C9U A;  1TKF A;  5HXD A;  2Q43 A;  4C8F A;  2RFH A;  3K2K A;  4C85 A;  3ISX A;  3SI2 A;  4TJV A;  3T8W A;  4OC3 A;  2CTB A;  4P4J A;  3WC7 A;  2V77 A;  2O53 A;  3NH8 A;  2OOT A;  4YU9 A;  3D68 A;  3WC6 A;  4LQG A;  4TJX A;  4PXE A;  1BLL E;  4IK2 A;  5ELY A;  3PB6 X;  1F2P A;  3SJE A;  4G1P A;  4MXU A;  4CDK A;  5HVH A;  4MHY A;  3PFO A;  2C1C A;  4ZY0 A;  2ZEM A;  3WC5 A;  2PJ1 A;  5I4M A;  4A37 A;  3GUX A;  1PYT B;  4B6Z A;  4ZX9 A;  1XMB A;  4ONW A;  4TNU A;  1Z2L A;  2GRE A;  1FT7 A;  2V8V A;  1QQ9 A;  1H8L A;  2PJ2 A;  1CX8 A;  4C8P A;  3D7G A;  4OC1 A;  3KGQ A;  2IJZ A;  4DJL A;  2ZEF A;  4C8U A;  3VH9 A;  3BI0 A;  4JZ0 A;  3IEH A;  3QNV A;  3RZA A;  1CG2 A;  4FUU A;  4FBE A;  4CDJ A;  2AFX A;  4WWV A;  2HB6 A;  3NH5 A;  4ZI6 A;  4C84 A;  2QVP A;  4GM5 A;  1JQG A;  1LOK A;  4NGN A;  4Z65 A;  4OID A;  2WYR A;  3EIF A;  2PJ3 A;  1Y7E A;  3PB4 X;  2ZEH A;  4R76 A;  1VGY A;  3LMS A;  3B2Y A;  2FVG A;  5IB9 A;  2F8H A;  3L2N A;  1UWY A;  2O4H A;  3GLJ A;  2PVW A;  4OKO A;  5DS0 A;  2G9D A;  3VAT A;  1Z5R A;  2V8G A;  3NA6 A;  4MCR A;  3H8G A;  1DTD A;  3IIB A;  3FVL A;  4AXV A;  4O23 A;  2AFM A;  3D4U A;  2AFU A;  3LWU A;  4IHM A;  1ARM A;  2F7V A;  1LAP A;  4MCP A;  2PIZ A;  1BAV A;  4NGR A;  3KAS A;  1VHE A;  2PJ9 A;  3FEC A;  2PIY A;  4UIB A;  4C8T A;  3FF3 A;  5LYL A;  3V7Z A;  4MHN A;  4IAV A;  4A94 A;  3NH4 A;  1IY7 A;  1XBU A;  4W9Y A;  1M4L A;  5D29 A;  2BO9 A;  2C6P A;  2PJB A;  2PJC A;  4PQA A;  4P44 A;  1PCA A;  2PJ4 A;  3SI0 A;  1CPS A;  3SJX A;  3ISZ A;  3SJG A;  3KR4 A;  2ABZ A;  3KR5 A;  4P4B A;  2NYQ A;  1Y0R A;  1ELL P;  4OC4 A;  4MCQ A; 
#chains in the Genus database with same CATH topology
 2AFZ A;  4MRI A;  2Q7S A;  4PXD A;  5IB0 A;  2ZW5 A;  3GKR A;  4MI1 A;  1KZF A;  4F9U A;  3N5F A;  1HDQ A;  2PDO A;  1TF9 A;  2XEG A;  3IFE A;  3P2F A;  2IL4 A;  1WK4 A;  3I1U A;  2PJA A;  4UBR A;  4KLW A;  1LAN A;  4P6Y A;  3W91 A;  5JH9 A;  1EE3 P;  2EWB A;  2I79 A;  2Q51 A;  2Z3K A;  1R3N A;  3TX8 A;  2Z3N A;  4CS0 B;  3TLY A;  2J8R A;  1J4J A;  3H4Q A;  4NGQ A;  2EK8 A;  2B4J C;  5CNP A;  2HQY A;  3BJ7 A;  4BD9 A;  5I0C A;  2WSA A;  2VZY A;  4ZGY B;  5F13 A;  3B3C A;  1QMU A;  1ZLH A;  2NSM A;  2CNT A;  3IJ3 A;  2P6G A;  4MHZ A;  1Y7R A;  2Z3M A;  5A28 A;  3TYX A;  2WUU A;  4GS4 A;  2O28 A;  3TO7 A;  5F1Y A;  2R8V A;  4H89 A;  1R43 A;  1CBX A;  1YLO A;  2EVN A;  3F0A A;  3KKW A;  3DSB A;  4KZT A;  5CBM A;  5HVF A;  3SXO A;  1Z8T A;  2PE3 A;  1CP6 A;  1S7F A;  2DPT A;  3KL9 A;  2JDD A;  4KS9 A;  4A33 A;  2EZA A;  4MJX A;  2AJ6 A;  2WPX A;  2CF4 A;  2GAN A;  3VTA A;  2OB0 A;  4B5P B;  3CDX A;  1FY7 A;  4H1H A;  1VKC A;  4R8F A;  4OC2 A;  4ZX8 A;  1VI4 A;  3S6G A;  1HDU A;  2ZEE A;  2P0W A;  1P4N A;  3PLF B;  2OH1 A;  3F8K A;  2ZED A;  5J1Q A;  4NJR A;  3BXM A;  4BTF A;  2GFQ A;  4F0X A;  4P4F A;  1Y9Z A;  3CPX A;  3T5M A;  2Q0Y A;  2HI6 A;  2Q4Z A;  4MBU A;  4ZY1 A;  4J3G A;  3R95 A;  4RS2 A;  1OBR A;  4FD7 A;  1T36 B;  4KOT A;  4KNG E;  2ZW6 A;  4Q7A A;  4CPA A;  1QSO A;  2R7H A;  4ZY2 A;  3D2P A;  1KEE B;  2GLF A;  3VRP A;  2PSW A;  4QVT A;  1YGH A;  2VL1 A;  1TKH A;  2JLM A;  4U9Y A;  2ZW7 A;  5IV0 A;  2AFW A;  4H2K A;  2B4B A;  5KTD A;  4MFJ A;  2EZB A;  2QYV A;  5EBV A;  2PJ7 A;  2CIJ A;  1MJB A;  2POK A;  3DGV A;  2DIK A;  4KLV A;  2GP4 A;  4C7H A;  3GB0 A;  3S6H A;  4UEE A;  3D7F A;  1CPX A;  1LAM A;  4UCP A;  2OU2 A;  1XEB A;  3HLP A;  3RNZ A;  3PFE A;  4CAW A;  3K9T A;  5JM6 A;  1IID A;  4C7I A;  5IX3 A;  3SHP A;  1ZG7 A;  1B87 A;  3JTK A;  1VHS A;  4C8C A;  3BI1 A;  2VXK A;  3FMC A;  1Z4E A;  4INJ A;  2Q44 A;  3VWD A;  2ODF A;  4R7M A;  5EC4 A;  2GLJ A;  4NEX A;  3H8F A;  5G1Z A;  1Q5X A;  4NFR A;  3LAC A;  1JDB C;  2UV8 G;  5F5X A;  5LRK A;  2ZPA A;  2ZOF A;  4BBH A;  5K8O A;  1HEE A;  2NMT A;  3S9M A;  3RYO A;  4KOX A;  1FNO A;  1LCP A;  1YR0 A;  4AB7 A;  4B5P A;  6CPA A;  3CPA A;  1M4G A;  4KVM E;  4PXC A;  4UIA A;  2D4O A;  4EME A;  3OAK A;  5GCN A;  3D8P A;  5LYD A;  3PBE A;  3VRQ A;  2ZEG A;  5HH1 A;  3VAR A;  4A32 A;  5ISV A;  4KOV A;  4PK3 A;  1XF8 A;  3KQX A;  4C9E A;  2ZEN A;  1BPN A;  5G21 A;  1YLE A;  1MK4 A;  2CXA A;  2VI7 A;  3JUW A;  1KWM A;  2EBJ A;  2ANP A;  2P6E A;  1S3Z A;  4CAX A;  1F2O A;  3PRT A;  4KOR A;  5KTA A;  4RN7 A;  4HNY B;  2I3C A;  4BPX B;  4MCS A;  1Q2Y A;  2JBJ A;  4NGP A;  4MFL A;  3FX6 A;  3RAM A;  1S7N A;  4YGO A;  4C68 A;  4L8A A;  3BHX A;  2YND A;  2GIV A;  4OAD A;  2EO8 A;  4X8I A;  2HWG A;  3D67 A;  4UCM A;  1I21 A;  2CTC A;  4GPL B;  5THW A;  1AMP A;  4KUB A;  4E8O A;  4KVO E;  2B3V A;  5BWA B;  3W6S A;  5IR2 A;  3FED A;  2HC9 A;  2VEZ A;  2ZOG A;  3V38 A;  1B47 A;  2Q4Y A;  4EFD A;  1DIK A;  1NMT A;  5JGF A;  3KRV A;  4AVB A;  4B14 A;  4BIN A;  3EXN A;  4UF4 A;  4WJB A;  5EMI A;  3PB7 X;  2AFS A;  1XFO A;  2ZW4 A;  1TIQ A;  3B3W A;  4IUS A;  4CYQ A;  1NBW A;  4C99 A;  2V8H A;  4MHP A;  4MI4 A;  5HKZ A;  1XJO A;  2PRQ A;  2DEA A;  4NGT A;  2Z11 A;  3BLN A;  3MGD A;  4OAE A;  3NFZ A;  3BJ8 A;  4XNH B;  4XNH C;  4CRZ B;  2X0S A;  5JPH A;  2CNS A;  4B11 A;  4R57 A;  3PBB A;  3CZX A;  4MY0 A;  1ZG8 A;  4ORF A;  1ZL0 A;  3I6S A;  2GU2 A;  1WVM A;  3HPG G;  2REF A;  4A4C A;  3FXT A;  2XEF A;  5LRG A;  3QAH A;  3T07 A;  3FH4 A;  4PPZ A;  5LRJ A;  2J9A A;  1VIX A;  5LYI A;  1EZA A;  3OWC A;  3NE7 A;  4UEF A;  1P0H A;  4C9R A;  1TXR A;  3HUV A;  2IMO A;  4UWI A;  3QAY A;  4OLL A;  4CGL A;  1M44 A;  2AFO A;  4PV6 A;  2B4D B;  4R6T A;  4UFV A;  1NXJ A;  3TLB A;  4YWY A;  2PJ5 A;  1CE8 B;  2WZN A;  2ZEO A;  4FD6 A;  3BUO B;  4RI1 A;  3T9Y A;  2PVV A;  1L0C A;  4DNC A;  2OR4 A;  2XEI A;  2GE3 A;  1I12 A;  3T05 A;  4EYS A;  1S60 A;  8CPA A;  5AG7 A;  5HKW A;  2BOA A;  1BPM A;  5K8M A;  3S9N A;  4FD4 A;  4BPU B;  1IYK A;  3JVN A;  2Z3O A;  1IB1 E;  2ZEP A;  3TC8 A;  4E0A A;  1NE9 A;  4CYP A;  4DUK A;  3H8E A;  3B8G A;  2PCN A;  3DR8 A;  4XPL A;  2EUI A;  4B5O A;  1F57 A;  2V8D A;  4YFJ A;  4IIY A;  4XPK A;  3SI1 A;  4X3R A;  2EK9 A;  2FE7 A;  4CAV A;  2Y0M A;  1JDE A;  1QST A;  2JDC A;  4NXY A;  3FEE A;  1RTQ A;  1CM0 A;  2OZH A;  4HKF A;  4OIW A;  4PK2 A;  4MFQ A;  4NGS A;  1VHO A;  3HMJ G;  5F09 A;  1MJA A;  3IU1 A;  3G8W A;  5FD8 A;  2K5T A;  3BUM B;  3FB3 A;  1ARL A;  3KI9 A;  2Z3L A;  5E96 A;  1ON0 A;  1CP7 A;  2BCO A;  3I3G A;  1Q7L A;  3IGR A;  1M4D A;  2AUM A;  2D0P A;  2I00 A;  2ZEL A;  4PSW A;  2YJV A;  4Q36 A;  4DYO A;  4COG A;  2X7B A;  3IC1 A;  4UEZ A;  1PUA A;  3C8O A;  1Z8L A;  2QJ8 A;  3EZA A;  5AXI A;  4KSI A;  3NOJ A;  5C88 A;  4JYW A;  4KOY A;  2Z10 A;  4FWU A;  4MMO A;  5AG6 A;  4R9M A;  4K3N A;  3TCV A;  5K8P A;  2FT0 A;  2YJT A;  5HKY A;  1GYT A;  5D8N A;  3R9E A;  4CGO A;  1IOF A;  1LFW A;  3IWW A;  1AYE A;  3FJU A;  4XPD C;  4XPD B;  4BMH A;  5JYB A;  2FXF A;  3KHZ A;  4OC5 A;  3C26 A;  3EFA A;  1S7L A;  3D7D A;  4QBJ A;  4YN3 A;  2R98 A;  2YNC C;  1TKJ A;  1YME A;  3G3S A;  2FIA A;  3DDD A;  2C6G A;  4P10 A;  4CGM A;  3VRN A;  4OME A;  1YW6 A;  3CT9 A;  2B5G B;  2PJ8 A;  3MRU A;  3TOB A;  4J0N A;  4C86 A;  4MFZ A;  4RUH A;  1X12 A;  4X2T A;  3EO4 A;  3VWE A;  4F8Z A;  3A9L A;  3DLJ A;  4MFK A;  2B4D A;  4BPW B;  1NSL A;  4KSF A;  4FAI A;  1WJT A;  2DLA A;  2PJ6 A;  4C9V A;  1BO4 A;  1EZB A;  1Q2D A;  2D4P A;  3FYN A;  3VRO A;  4OC0 A;  3KZW A;  2AE6 A;  1KC7 A;  3QB8 A;  4E94 A;  2JBK A;  2JEW A;  1Z8X A;  2Z0Z A;  1M1D A;  4CRY B;  5LYF A;  2Y1M A;  1TF8 A;  3WAB A;  2XPP A;  1RXT A;  4P45 A;  3P2H A;  3D7H A;  3RBU A;  3VRR A;  1XE4 A;  1YW4 A;  3IWG A;  4TWE A;  4C8A A;  2E28 A;  4C9A A;  2C6C A;  1KUX A;  2JEV A;  4NCZ A;  2R82 A;  4MJ8 A;  4R3L A;  4KUA A;  4LX9 A;  3LD2 A;  1V6C A;  3EZB A;  5CPA A;  2DPS A;  1YVO A;  3PEI A;  4U9Z A;  1IGB A;  3MN8 A;  2EZC A;  1LRZ A;  3HPH E;  2PCU A;  1ZLI A;  3I74 A;  2PJ0 A;  5K8N A;  2G3T A;  4HPS A;  2XEJ A;  1M4I A;  2PQ8 A;  3BUW B;  4P4I A;  3H5Z A;  3KQZ A;  3D66 A;  5HVG A;  2B0A A;  3PB8 X;  4A38 A;  1Y0Y A;  2CNM A;  7CPA A;  4M85 A;  3B35 A;  4ZBG A;  5DWN A;  3PB9 X;  3R9F A;  1WWZ A;  3JRU A;  1Z8W A;  4A39 A;  4GXH A;  1NSA A;  1BXR B;  4KOS A;  4UFW A;  3WR7 A;  3V8I A;  5KTC A;  4EVY A;  4R87 A;  4P4E A;  4JVO A;  3S9L A;  4II9 A;  5F9M A;  2G0B A;  2PR8 A;  3NFQ A;  3B3V A;  1XRY A;  3F5B A;  3WT4 A;  1J3L A;  4MFP A;  2IQ6 A;  4EWT A;  4K30 A;  4UWJ A;  1DE4 C;  1ELM P;  2Z3P A;  1OZP A;  3B3T A;  5C82 A;  4JXR A;  4P4D A;  4UA3 A;  3OB2 B;  2YNC A;  3TLG B;  2BL1 A;  1AUG A;  4KSA A;  4E2A A;  3B3S A;  1YSJ A;  3F9K C;  3KHX A;  1YRE A;  2BEI A;  3B7I A;  3T90 A;  4KOW A;  3BUX B;  3TT2 A;  3W6X A;  1ZYM A;  2RB7 A;  1ZG9 A;  4OP4 A;  4U5Y A;  4ZYQ A;  5AG4 A;  5J8C A;  2Q4V A;  4F9V A;  1N71 A;  3IO1 A;  4NJQ A;  2ATR A;  4NGM A;  3ICU A;  1XF1 A;  3SJF A;  4PXB A;  4B12 A;  1C30 B;  2PR1 A;  1VBH A;  1UFH A;  1KUY A;  4C9U A;  1TKF A;  5HXD A;  2Q43 A;  4M6I A;  4AVC A;  4C8F A;  3OB1 B;  2RFH A;  3DR6 A;  3K2K A;  2QIR A;  2YGW A;  4F0Y A;  2CY2 A;  1M6V B;  1S7K A;  2HV2 A;  4C85 A;  1CJW A;  5F46 A;  3IU2 A;  3ISX A;  3SI2 A;  4TJV A;  3O8Z A;  2QML A;  3T8W A;  3TLC A;  4ONU A;  4OC3 A;  2MP0 A;  4M6G A;  2CTB A;  4P4J A;  3WC7 A;  2V77 A;  2O53 A;  4M8D A;  3NH8 A;  5JVL A;  5J8F A;  2HUZ A;  2OOT A;  2RC4 A;  4YU9 A;  3D68 A;  3K4I A;  5A27 A;  1A2Z A;  4JXQ A;  4YRH A;  3TLA A;  3WC6 A;  4JJX A;  4LQG A;  4CO9 A;  2N3A B;  2J8M A;  4TJX A;  2OZG A;  4PXE A;  2YNE A;  1BLL E;  4IK2 A;  5ELY A;  1RO5 A;  3SR3 A;  1YVH A;  3PB6 X;  1F2P A;  3SJE A;  2BUE A;  3FNC A;  4G1P A;  4MXU A;  3NE8 A;  3UY5 A;  4QB9 A;  4HNW B;  5G20 A;  4CDK A;  5HVH A;  1QSN A;  1KBL A;  3I9S A;  1Z9U A;  2Y1N A;  1JWQ A;  2B58 A;  1R61 A;  4MHY A;  4AG9 A;  3PFO A;  4X5K A;  2XPN A;  4HNX B;  4I49 A;  2FCK A;  5AGE A;  2C1C A;  3GJZ A;  3TLZ A;  4QC6 A;  1CS0 B;  3S6F A;  5F49 A;  3EC4 A;  2DF5 A;  2ZEM A;  3WC5 A;  2PJ1 A;  4ZY0 A;  5AG5 A;  5I4M A;  3G23 A;  4A37 A;  3R1K A;  3GUX A;  1PYT B;  4B6Z A;  4ZX9 A;  5DWM A;  1R57 A;  1XMB A;  4ONW A;  4TNU A;  2VKZ G;  1S5K A;  5G22 A;  1ZO0 A;  1Z2L A;  3TLG A;  2GRE A;  1FT7 A;  2V8V A;  4CYO A;  3PT1 A;  1QQ9 A;  5F47 A;  1H8L A;  2WPW A;  3S6K A;  1K4J A;  2PJ2 A;  1CX8 A;  2VQY A;  4C8P A;  3LOD A;  3D7G A;  1IU8 A;  4OC1 A;  2QEC A;  1A9X B;  1PU9 A;  4MY3 A;  2IJZ A;  3KGQ A;  4DJL A;  4MHD A;  5HMN A;  4CAE A;  2KCW A;  4M6H A;  2ZEF A;  4L89 A;  3VH9 A;  4AVA A;  4C8U A;  3TLE A;  3BI0 A;  4JZ0 A;  3GIU A;  2ZXV A;  4E5S A;  4R3K A;  4C2Z A;  3IEH A;  3CXQ A;  4KVX A;  4CZ1 A;  3GY9 A;  2PRB A;  1GHE A;  4JLY A;  1IYL A;  3QNV A;  2XPL A;  1EO0 A;  1XOV A;  1ZRS A;  3RZA A;  1VBG A;  1QSM A;  4A4B A;  1CG2 A;  4FUU A;  4CYN A;  4FBE A;  5F48 A;  4CGP A;  3BUN B;  3CXP A;  4F6A A;  5FVJ A;  2AFX A;  4CDJ A;  2FM4 A;  3PZJ A;  1I1D A;  4WWV A;  2HB6 A;  3NH5 A;  4ZI6 A;  2CBL A;  4IF5 A;  5JQ4 A;  2H5M A;  4C84 A;  2OLS A;  2QVP A;  4GM5 A;  4KOU A;  1JQG A;  1LOK A;  4NGN A;  3SXN A;  2XPO A;  3TO6 A;  1YQE A;  4C2Y A;  4Z65 A;  2Q04 A;  1GGO A;  4OID A;  2WYR A;  3EIF A;  4NF1 A;  1BOB A;  4UFX A;  1KUV A;  4Q38 A;  1FBV A;  2PJ3 A;  1Z9E A;  1SQH A;  3PP9 A;  1Q2C A;  1Y7E A;  4H6U A;  4JWP A;  3PB4 X;  2ZEH A;  4R76 A;  4A2Z A;  3TFY A;  3U1B A;  1VGY A;  1YX0 A;  3LMS A;  4CAF A;  3B2Y A;  4M3S A;  2FVG A;  2P6F A;  3FIX A;  3PFV A;  5H84 A;  4C2X A;  1B6B A;  5IB9 A;  2F8H A;  3EZE A;  3L2N A;  1UWY A;  2O4H A;  3GLJ A;  2PVW A;  2VZZ A;  4OKO A;  2B3U A;  4QUS A;  2G9D A;  5DS0 A;  3VAT A;  1U6M A;  1Z5R A;  2FSR A;  2V8G A;  3NA6 A;  3N7Z A;  4MCR A;  2PC1 A;  2BSW A;  3CXS A;  4A31 A;  3H8G A;  1DTD A;  3DNS A;  4A95 A;  3IIB A;  3FVL A;  4AXV A;  2AUN A;  5K99 A;  4RR2 B;  4O23 A;  2AFM A;  2ARH A;  3FBU A;  3D4U A;  2G3A A;  2AFU A;  3LWU A;  4A30 A;  4IHM A;  3RO0 A;  1ARM A;  2F7V A;  1LAP A;  4MCP A;  2PIZ A;  2VBQ A;  2OZU A;  3GYA A;  1BAV A;  4NGR A;  3OP0 A;  2FS5 A;  3KAS A;  4AG7 A;  1VHE A;  1V0C A;  1X10 A;  2PJ9 A;  3FEC A;  1Z4R A;  2DXQ A;  2F5I A;  5H86 A;  3FRM A;  2FL4 A;  2FIW A;  2A4N A;  2PIY A;  2B5G A;  2Q7B A;  2J8N A;  3E0K A;  4UIB A;  3TOA A;  4C8T A;  3FF3 A;  5LYL A;  1Y9W A;  1XIX A;  3D3S A;  4UCN A;  3K9U A;  4FD5 A;  3V7Z A;  4LUA A;  3EY5 A;  4MHN A;  4Y49 B;  3VGO A;  4Y49 C;  3ZNI A;  4IAV A;  4A94 A;  1YVK A;  3NH4 A;  1IY7 A;  4LQ6 A;  4COB A;  1XBU A;  2D0O A;  4W9Y A;  1M4L A;  4IIX A;  2R1I A;  5D29 A;  3U88 C;  2BO9 A;  2C6P A;  2PJB A;  2C5Q A;  5BY0 A;  3IWE A;  2PJC A;  4PQA A;  4P44 A;  1PCA A;  4JD6 A;  2PJ4 A;  4H6Z A;  1IIC A;  1YK3 A;  3SI0 A;  4B13 A;  3T0T A;  1CPS A;  3SJX A;  1Y9K A;  3SJG A;  3ISZ A;  4NSQ A;  4B10 A;  3KR4 A;  4CGN A;  2ABZ A;  1MJ9 A;  3R96 A;  3D2M A;  3PGP A;  3ZZI A;  3TE4 A;  3KR5 A;  3R9G A;  1XMT A;  4P4B A;  5J3X A;  3TO9 A;  2NYQ A;  1Y0R A;  1C3O B;  2HRO A;  1ELL P;  4PSX A;  3ZJ0 A;  1IOI A;  2REE A;  2C27 A;  3TTH A;  4OC4 A;  1QSR A;  4MCQ A; 
#chains in the Genus database with same CATH homology
 2AFZ A;  4MRI A;  4PXD A;  4F9U A;  3N5F A;  1HDQ A;  1TF9 A;  2XEG A;  3IFE A;  3I1U A;  2PJA A;  1LAN A;  4P6Y A;  5JH9 A;  1EE3 P;  2EWB A;  2Q51 A;  1R3N A;  3TX8 A;  4BD9 A;  4NGQ A;  2EK8 A;  3B3C A;  1QMU A;  1ZLH A;  2NSM A;  3IJ3 A;  4MHZ A;  1R43 A;  1CBX A;  1YLO A;  5CBM A;  5HVF A;  2PE3 A;  1CP6 A;  3KL9 A;  3VTA A;  2CF4 A;  3CDX A;  4R8F A;  4OC2 A;  4ZX8 A;  1HDU A;  2ZEE A;  2ZED A;  5J1Q A;  4NJR A;  3BXM A;  4P4F A;  1Y9Z A;  3CPX A;  2Q4Z A;  4ZY1 A;  1OBR A;  4KNG E;  4Q7A A;  4CPA A;  4ZY2 A;  2GLF A;  2VL1 A;  1TKH A;  2AFW A;  4H2K A;  2QYV A;  2PJ7 A;  2CIJ A;  2POK A;  3DGV A;  2GP4 A;  3GB0 A;  4UEE A;  3D7F A;  1CPX A;  1LAM A;  3HLP A;  3PFE A;  3K9T A;  5JM6 A;  1ZG7 A;  4C8C A;  3BI1 A;  3FMC A;  4R7M A;  2GLJ A;  3H8F A;  4NFR A;  5LRK A;  2ZOF A;  5K8O A;  1HEE A;  3S9M A;  1FNO A;  1LCP A;  6CPA A;  3CPA A;  4PXC A;  4UIA A;  4EME A;  5LYD A;  3PBE A;  2ZEG A;  3VAR A;  4C9E A;  3KQX A;  2ZEN A;  1BPN A;  1KWM A;  2ANP A;  1F2O A;  3PRT A;  2I3C A;  4MCS A;  2JBJ A;  4NGP A;  3FX6 A;  3RAM A;  3BHX A;  4X8I A;  3D67 A;  2CTC A;  5THW A;  1AMP A;  5IR2 A;  3FED A;  2HC9 A;  2ZOG A;  3V38 A;  4EFD A;  5JGF A;  4UF4 A;  4WJB A;  3PB7 X;  2AFS A;  1XFO A;  3B3W A;  4C99 A;  2V8H A;  4MHP A;  1XJO A;  2PRQ A;  2DEA A;  4NGT A;  3NFZ A;  3PBB A;  1ZG8 A;  3I6S A;  2GU2 A;  1WVM A;  2XEF A;  5LRG A;  3FH4 A;  4PPZ A;  5LRJ A;  2J9A A;  1VIX A;  5LYI A;  4UEF A;  4C9R A;  1TXR A;  3HUV A;  2IMO A;  2AFO A;  4R6T A;  4YWY A;  2PJ5 A;  2WZN A;  2ZEO A;  2PVV A;  2OR4 A;  2XEI A;  8CPA A;  2BOA A;  1BPM A;  5K8M A;  3S9N A;  2ZEP A;  3TC8 A;  4DUK A;  3H8E A;  1F57 A;  2V8D A;  3SI1 A;  4X3R A;  2EK9 A;  4OIW A;  3FEE A;  1RTQ A;  4NGS A;  1VHO A;  5F09 A;  3KI9 A;  1ARL A;  1CP7 A;  2BCO A;  1Q7L A;  2ZEL A;  4DYO A;  3IC1 A;  4UEZ A;  1Z8L A;  2QJ8 A;  4KSI A;  4JYW A;  4FWU A;  4MMO A;  5K8P A;  4K3N A;  1GYT A;  5D8N A;  1LFW A;  3IWW A;  1AYE A;  3FJU A;  3KHZ A;  4OC5 A;  3D7D A;  4YN3 A;  1TKJ A;  1YME A;  4P10 A;  2C6G A;  4OME A;  1YW6 A;  3CT9 A;  2PJ8 A;  3MRU A;  4C86 A;  4RUH A;  4X2T A;  4F8Z A;  3DLJ A;  4FAI A;  2PJ6 A;  4C9V A;  4OC0 A;  3KZW A;  2JBK A;  2JEW A;  5LYF A;  1TF8 A;  3WAB A;  4P45 A;  3D7H A;  3RBU A;  1YW4 A;  4TWE A;  4C8A A;  4C9A A;  2C6C A;  1V6C A;  5CPA A;  3PEI A;  1IGB A;  3MN8 A;  2PCU A;  1ZLI A;  3I74 A;  2PJ0 A;  5K8N A;  2XEJ A;  4P4I A;  3KQZ A;  5HVG A;  3D66 A;  3PB8 X;  4A38 A;  1Y0Y A;  7CPA A;  3B35 A;  3PB9 X;  3JRU A;  4A39 A;  1NSA A;  4P4E A;  3S9L A;  3B3V A;  3WT4 A;  1XRY A;  2IQ6 A;  4EWT A;  1DE4 C;  1ELM P;  3B3T A;  4P4D A;  3B3S A;  1YSJ A;  3KHX A;  3B7I A;  2RB7 A;  1ZG9 A;  4OP4 A;  4ZYQ A;  4F9V A;  3IO1 A;  4NJQ A;  3ICU A;  4NGM A;  1XF1 A;  3SJF A;  4PXB A;  4C9U A;  1TKF A;  5HXD A;  2Q43 A;  4C8F A;  2RFH A;  3K2K A;  4C85 A;  3ISX A;  3SI2 A;  4TJV A;  3T8W A;  4OC3 A;  2CTB A;  4P4J A;  3WC7 A;  2V77 A;  2O53 A;  3NH8 A;  2OOT A;  4YU9 A;  3D68 A;  3WC6 A;  4LQG A;  4TJX A;  4PXE A;  1BLL E;  4IK2 A;  5ELY A;  3PB6 X;  1F2P A;  3SJE A;  4G1P A;  4MXU A;  4CDK A;  5HVH A;  4MHY A;  3PFO A;  2C1C A;  4ZY0 A;  2ZEM A;  3WC5 A;  2PJ1 A;  5I4M A;  4A37 A;  3GUX A;  1PYT B;  4B6Z A;  4ZX9 A;  1XMB A;  4ONW A;  4TNU A;  1Z2L A;  2GRE A;  1FT7 A;  2V8V A;  1QQ9 A;  1H8L A;  2PJ2 A;  1CX8 A;  4C8P A;  3D7G A;  4OC1 A;  3KGQ A;  2IJZ A;  4DJL A;  2ZEF A;  4C8U A;  3VH9 A;  3BI0 A;  4JZ0 A;  3IEH A;  3QNV A;  3RZA A;  1CG2 A;  4FUU A;  4FBE A;  4CDJ A;  2AFX A;  4WWV A;  2HB6 A;  3NH5 A;  4ZI6 A;  4C84 A;  2QVP A;  4GM5 A;  1JQG A;  1LOK A;  4NGN A;  4Z65 A;  4OID A;  2WYR A;  3EIF A;  2PJ3 A;  1Y7E A;  3PB4 X;  2ZEH A;  4R76 A;  1VGY A;  3LMS A;  3B2Y A;  2FVG A;  5IB9 A;  2F8H A;  3L2N A;  1UWY A;  2O4H A;  3GLJ A;  2PVW A;  4OKO A;  5DS0 A;  2G9D A;  3VAT A;  1Z5R A;  2V8G A;  3NA6 A;  4MCR A;  3H8G A;  1DTD A;  3IIB A;  3FVL A;  4AXV A;  4O23 A;  2AFM A;  3D4U A;  2AFU A;  3LWU A;  4IHM A;  1ARM A;  2F7V A;  1LAP A;  4MCP A;  2PIZ A;  1BAV A;  4NGR A;  3KAS A;  1VHE A;  2PJ9 A;  3FEC A;  2PIY A;  4UIB A;  4C8T A;  3FF3 A;  5LYL A;  3V7Z A;  4MHN A;  4IAV A;  4A94 A;  3NH4 A;  1IY7 A;  1XBU A;  4W9Y A;  1M4L A;  5D29 A;  2BO9 A;  2C6P A;  2PJB A;  2C5Q A;  2PJC A;  4PQA A;  4P44 A;  1PCA A;  2PJ4 A;  3SI0 A;  1CPS A;  3SJX A;  3ISZ A;  3SJG A;  3KR4 A;  2ABZ A;  3KR5 A;  4P4B A;  2NYQ A;  1Y0R A;  1ELL P;  4OC4 A;  4MCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...