2XEFA

Human glutamate carboxypeptidase ii in complex with antibody- recruiting molecule arm-p8
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVQPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 268
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xefA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xefA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xefA02
4X3RA 3CPAA 1LOKA 3SI2A 3WC7A 1Y9ZA 4OMEA 3PBBA 1HDQA 3SI0A 4C8FA 1TKFA 2PVVA 5JH9A 4WJBA 4OC5A 4ZYQA 5HXDA 2VL1A 4NGSA 4PQAA 4PXBA 3NFZA 4KSIA 2ZEGA 1LFWA 2C1CA 5DS0A 2PJ3A 3PB8X 1BLLE 4YWYA 1CPXA 1R3NA 3KI9A 3SJXA 5K8MA 1ARLA 3TX8A 2QJ8A 3LMSA 4C99A 1H8LA 4YN3A 5K8PA 3PBEA 2GU2A 2C6GA 3KGQA 2PRQA 1NSAA 2JEWA 3IJ3A 2AFWA 1PCAA 2IJZA 1YMEA 2EWBA 3GUXA 3GB0A 3D68A 3PFOA 2PJ1A 3WC5A 3K2KA 3B3VA 2JBKA 2GLJA 5LRKA 5LYDA 1VHOA 3H8EA 3VATA 4R76A 5J1QA 2Q43A 3TC8A 3BHXA 3S9LA 2ZEPA 1XRYA 3B2YA 1LANA 4P10A 3IEHA 4DJLA 3LWUA 1ZLHA 1CX8A 4NJQA 2OR4A 3KL9A 3I74A 3PB6X 1TKHA 1ZLIA 2PJ2A 2FVGA 1TKJA 1IGBA 4P4JA 1CBXA 4PXDA 3FECA 2NSMA 4DYOA 6CPAA 3D7DA 4NGRA 3EIFA 1DTDA 1QMUA 3KQXA 1LAPA 2XEJA 3KZWA 4ZY2A 1HDUA 4P4EA 3VH9A 2O53A 3DLJA 4MMOA 2PJ0A 4MCSA 4NGMA 4C8PA 1YLOA 4TNUA 3BXMA 1Z5RA 5JM6A 1F2PA 2RFHA 3CT9A 4CPAA 5K8OA 2ZEEA 4MHPA 3IC1A 2Q4ZA 5ELYA 4PXCA 4MHZA 2EK8A 4FUUA 5HVHA 1HEEA 2O4HA 1BAVA 3FF3A 3HLPA 2HB6A 1IY7A 1YW6A 4ONWA 5LRGA 2PIYA 2ZOFA 4FAIA 3KR5A 1PYTB 1ZG7A 4ZY1A 1AYEA 2CF4A 4F8ZA 3MN8A 4UIBA 2V8VA 2ZEDA 1M4LA 1XFOA 3ISXA 2AFZA 2POKA 3DGVA 1XMBA 2ZOGA 4R7MA 2GLFA 5LRJA 4MRIA 3B7IA 4PXEA 4X8IA 1JQGA 1LCPA 4NJRA 4TWEA 1BPNA 2HC9A 4P4IA 2JBJA 2PCUA 3I1UA 1XJOA 2V8DA 3D66A 1CPSA 4LQGA 1TF8A 3D7FA 1FNOA 1RTQA 2PJ5A 1VGYA 4OC0A 4A94A 4MHNA 3FVLA 1FT7A 4OIDA 3ICUA 4C9UA 2ZEFA 1XF1A 3SJGA 3PB9X 4Z65A 4AXVA 2J9AA 3NA6A 4P4BA 4OIWA 4C84A 4P4DA 1VIXA 3BI0A 2WZNA 5JGFA 3V7ZA 3IO1A 2CIJA 5CBMA 4IHMA 3VTAA 2EK9A 4C9RA 2PJ9A 4ZX8A 4C9VA 2ABZA 2GREA 4ZX9A 4A38A 2BO9A 4WWVA 4UIAA 3PFEA 4UF4A 4GM5A 4CDJA 2PJ8A 4ZI6A 4P4FA 2XEIA 4UEZA 3S9MA 5HVGA 4EWTA 3H8FA 1Y0YA 4C9EA 4B6ZA 5D8NA 3B3WA 4OC3A 2F7VA 2ZEHA 1UWYA 4KNGE 3S9NA 1CG2A 2PJ7A 4JZ0A 3I6SA 3FJUA 2BOAA 4C86A 2IQ6A 2OOTA 4MXUA 3H8GA 4IAVA 5I4MA 2CTCA 1CP7A 3B3TA 1YW4A 2AFSA 5HVFA 2PVWA 7CPAA 3IWWA 4FBEA 4JYWA 1WVMA 2AFXA 3PRTA 4MCQA 3QNVA 3WT4A 2QYVA 3KQZA 4ZY0A 2ZEMA 4MHYA 4F9UA 1ZG8A 3KHXA 3B3CA 4C85A 3SJEA 1XBUA 3NH5A 1DE4C 2NYQA 5IB9A 3FEDA 4NGPA 3FMCA 8CPAA 3D67A 3N5FA 2AFOA 1KWMA 2ZELA 4RUHA 3K9TA 2PJ4A 3V38A 2I3CA 3KR4A 2PJ6A 4PPZA 3L2NA 3RAMA 3WC6A 2Q51A 2C6CA 3MRUA 4C8AA 2C6PA 1Z2LA 5D29A 1Y7EA 2PJCA 4C9AA 4NFRA 3JRUA 3NH8A 3CPXA 2ANPA 2V77A 5LYLA 4H2KA 4A39A 1LAMA 3PB4X 3ISZA 1ARMA 1TF9A 3VARA 3KASA 3KHZA 3PEIA 5CPAA 4P44A 4F9VA 3FH4A 3RBUA 3GLJA 3D7HA 1YSJA 3B35A 3SJFA 3BI1A 2F8HA 4K3NA 2AFMA 4NGNA 1F57A 1Z8LA 4OP4A 2PIZA 1QQ9A 3RZAA 4EMEA 4C8TA 2RB7A 4UEFA 4C8UA 5THWA 2QVPA 4OC2A 1GYTA 2XEFA 4W9YA 3SI1A 3CDXA 4OC1A 1CP6A 1F2OA 1VHEA 1AMPA 2V8HA 2ZEOA 4EFDA 1ELLP 4TJVA 4MCPA 1OBRA 4G1PA 3D4UA 3T8WA 2PJAA 1BPMA 3FX6A 2G9DA 5LYFA 1ZG9A 5K8NA 2DEAA 2IMOA 4C8CA 1TXRA 4NGTA 4TJXA 1EE3P 4Q7AA 2V8GA 5F09A 2XEGA 4OKOA 4A37A 3FEEA 2BCOA 4P6YA 4IK2A 1R43A 4O23A 4YU9A 3NH4A 4FWUA 1ELMP 2ZENA 4MCRA 1Q7LA 5LYIA 4X2TA 4R8FA 4UEEA 3IFEA 3IIBA 1Y0RA 4BD9A 4R6TA 2CTBA 2WYRA 4CDKA 3B3SA 4NGQA 1V6CA 2PJBA 3D7GA 3WABA 4DUKA 2PE3A 3PB7X 4P45A 2AFUA 3HUVA 4OC4A
chains in the Genus database with same CATH superfamily
4C2ZA 3OP0A 4NSQA 4X3RA 5EC4A 3CPAA 3VGOA 1LOKA 3TLYA 3SI2A 3WC7A 5F13A 2Y1MA 4FD7A 4F0XA 1I21A 1Y9ZA 4OMEA 4MFZA 1Z9UA 3PBBA 4RN7A 3SXNA 4AG9A 1HDQA 3SI0A 1MJAA 1TKFA 2B3UA 2PVVA 4Y49B 2UV8G 4WJBA 3TOBA 5JH9A 4CRYB 5A28A 4OC5A 4ZYQA 5HMNA 5HXDA 2VL1A 3A9LA 4M6GA 3TT2A 4NGSA 1K4JA 1EZAA 4PQAA 3OB2B 4PXBA 3NFZA 2PR8A 4KSIA 2ZEGA 4XNHC 1LFWA 1Z4RA 5JGFA 3TLCA 2C1CA 4FD4A 2PJ3A 5DS0A 1S7NA 1YVOA 3PB8X 4MFJA 1BLLE 4YWYA 3R95A 1CPXA 2P6EA 2FL4A 4OLLA 4A33A 4QC6A 3LODA 1R3NA 3KI9A 1R57A 3EO4A 3TTHA 1FY7A 4JWPA 3SJXA 3G23A 5K8MA 1FBVA 2F5IA 4C7IA 4CZ1A 3TO7A 2Z3LA 2EZCA 1ARLA 2FM4A 3TX8A 2QJ8A 3SXOA 3LMSA 4C99A 2ATRA 1YX0A 4AB7A 1H8LA 4B10A 2ZPAA 4A2ZA 4YN3A 4FD6A 4IIXA 3BUXB 2B4JC 3PT1A 5K8PA 3PBEA 2FT0A 2C6GA 2GU2A 3KGQA 2D0PA 2PRQA 1NSAA 2JEWA 2Q7BA 4MJ8A 3IJ3A 2OH1A 2Q7SA 4C68A 4GS4A 2AFWA 2JDCA 1PCAA 2IJZA 1YMEA 1NBWA 2EWBA 3GUXA 4CAEA 1C30B 3BUMB 2GP4A 3GB0A 3EZAA 3D68A 3PFOA 2PJ1A 1S7FA 3WC5A 1LRZA 1S3ZA 2VQYA 4I49A 4KUAA 3K2KA 4KS9A 1EZBA 1S60A 5AG4A 4CGNA 3B3VA 5IR2A 2JBKA 2GLJA 5LRKA 3F0AA 5LYDA 5AGEA 4Q38A 1VHOA 3FYNA 3H8EA 3IWEA 3VATA 2R98A 4R76A 2Q43A 2BSWA 3TC8A 5J1QA 2DPSA 3BHXA 4BTFA 3S9LA 1XRYA 2EBJA 2ZEPA 3B2YA 3GIUA 5C82A 1LANA 4P10A 3F9KC 3IEHA 1TIQA 4DJLA 3LWUA 1ZLHA 1CX8A 4NJQA 4MBUA 2JDDA 2OR4A 3KL9A 3PP9A 3I74A 4AG7A 3ZNIA 3PB6X 1TKHA 1ZLIA 2PJ2A 2FVGA 1TKJA 1IGBA 5IX3A 5AG7A 4MJXA 3HMJG 4P4JA 1CBXA 4OADA 4PXDA 3HPGG 2AUNA 3VRPA 1M1DA 1JDBC 3FECA 1CM0A 3K4IA 1Y9WA 4NEXA 1RXTA 2NSMA 5H84A 4DYOA 6CPAA 3D7DA 4L8AA 4NF1A 2OZGA 4NGRA 3EIFA 1DTDA 1QMUA 4A30A 4ZBGA 3KQXA 1LAPA 2YGWA 4KLVA 2EUIA 2XEJA 5F9MA 3KZWA 4KOUA 4UFXA 4ZY2A 3S6GA 1HDUA 4P4EA 4MFPA 5AG5A 2O53A 2Z11A 3VH9A 3DLJA 3S6KA 1IICA 1M44A 4MCSA 1XOVA 2B5GB 2PJ0A 3DDDA 1M4IA 4NGMA 4MMOA 1XEBA 3BJ7A 4YGOA 1YLOA 3HPHE 4TNUA 4C8PA 2XPLA 4E2AA 1ZL0A 3BXMA 1Z5RA 5JM6A 1F2PA 2RFHA 1WK4A 3CT9A 1SQHA 4HNYB 1PUAA 4CPAA 3GYAA 4PSXA 5K8OA 2ZEEA 4MHPA 3IC1A 2AJ6A 5KTDA 2Q4ZA 5ELYA 4BPWB 2P6FA 2PCNA 3TLAA 2GE3A 4PXCA 4MHZA 2N3AB 1Z8XA 2EK8A 3TFYA 3QB8A 1C3OB 4FUUA 5HVHA 1HEEA 3IGRA 3TYXA 3IU2A 3UY5A 2O4HA 5E96A 1BAVA 3FF3A 1KUXA 3HLPA 4KZTA 3RYOA 4UCNA 4JJXA 3D3SA 4R9MA 4UA3A 2XPNA 3T90A 2HB6A 1AUGA 1IY7A 4A31A 3IWGA 2GIVA 5J8FA 1YW6A 1DIKA 4ONWA 5DWNA 5LRGA 5F5XA 2PIYA 5GCNA 2E28A 1XMTA 2ZOFA 4FAIA 1NXJA 3KR5A 1PYTB 4AVAA 1YK3A 1ZG7A 4XPKA 1AYEA 3R9GA 1Y7RA 2CF4A 4ZY1A 4CS0B 5ISVA 1B47A 2KCWA 5BY0A 4F8ZA 1Q5XA 1JWQA 2FCKA 3OB1B 2I00A 2AUMA 3MN8A 1RO5A 4UIBA 2XPPA 2V8VA 3TLGA 2ZEDA 2VKZG 2P0WA 1M4LA 4EYSA 2D0OA 1XFOA 2CBLA 1R61A 3ISXA 2AFZA 2VBQA 1VKCA 1YR0A 2G3AA 2POKA 4CYNA 2B4DA 2WPXA 3DGVA 1XMBA 1S5KA 4ZGYB 1B87A 2PR1A 2J8RA 2GLFA 2ZOGA 4R7MA 3D2MA 5G1ZA 4LUAA 4MRIA 5LRJA 2VI7A 3B7IA 3EY5A 3D8PA 1QSMA 4CAFA 1CS0B 1ZYMA 3D2PA 4PXEA 4X8IA 4CAXA 5F1YA 1JQGA 1LCPA 4NJRA 2MP0A 1V0CA 4U9ZA 4TWEA 3FNCA 4UBRA 4UFVA 3BUNB 4JXRA 1BPNA 2B4BA 2HC9A 3S6HA 4P4IA 2JBJA 2JEVA 2OLSA 2PCUA 3I1UA 4BMHA 3O8ZA 2O28A 1YQEA 5H86A 1XJOA 2V8DA 4H1HA 3D66A 3E0KA 4RR2B 1CPSA 5HKWA 5JPHA 1KUYA 2Z3MA 3G3SA 4B12A 3BUOB 4CGMA 5F47A 2R1IA 4LQGA 3VRQA 4FD5A 1TF8A 3D7FA 1FNOA 2I79A 4K30A 3ZJ0A 1RTQA 3HUVA 3CXSA 1T36B 3VROA 2PJ5A 2Q4YA 1VGYA 5BWAB 3DSBA 4AVBA 3H4QA 1Z4EA 4IUSA 4OC0A 4A94A 4MFQA 4MHNA 4E5SA 2HQYA 3FVLA 3WR7A 3R9FA 1FT7A 4CAWA 2REFA 3F8KA 3G8WA 4CAVA 1M6VB 5C88A 2YNCC 3VWDA 4OIDA 5KTAA 3ICUA 3C26A 3NOJA 4C9UA 1XE4A 2K5TA 2Z3PA 4Q36A 2ZEFA 1XF1A 3SJGA 3PB9X 4MFLA 4Z65A 3B8GA 4AXVA 2FIWA 4QUSA 2J9AA 3EZBA 3NA6A 2WPWA 3TOAA 4P4BA 1BOBA 4YRHA 3T5MA 3TO6A 4OIWA 1S7LA 4C84A 1IYKA 4P4DA 2X7BA 2R7HA 4HPSA 3SR3A 1VIXA 1IU8A 3BI0A 3K9UA 2WZNA 3F5BA 1U6MA 1CJWA 2FS5A 3IO1A 2CIJA 3JTKA 2DXQA 3V7ZA 4B14A 3U88C 4CYPA 5CBMA 2P6GA 1A2ZA 4H89A 4IHMA 4KOSA 4CYOA 1GGOA 2EK9A 4M8DA 2EVNA 3VTAA 4C9RA 5JVLA 2PJ9A 4ZX8A 4C9VA 4C8FA 2ABZA 2GREA 4RS2A 4OAEA 3JUWA 4KUBA 4B5PA 2B3VA 2Z3KA 2R82A 2D4PA 4GXHA 4ZX9A 5JYBA 4A38A 5AG6A 4NXYA 2BO9A 3PGPA 4JVOA 4WWVA 4F0YA 4KVOE 4UIAA 1NSLA 3GJZA 5AXIA 2YJTA 4BPUB 3PFEA 4UF4A 4GM5A 2FE7A 4CDJA 2PJ8A 1KBLA 4ZI6A 4P4FA 3RO0A 2HROA 4MI1A 5I0CA 2XEIA 4UEZA 3TO9A 1CE8B 3S9MA 4U5YA 4EWTA 5HVGA 1KEEB 3H8FA 1Y0YA 4C9EA 3W6XA 4B6ZA 3RNZA 2Z3NA 5D8NA 3B3WA 1VI4A 2ZW4A 4HNXB 2PSWA 4OC3A 2F7VA 2ZEHA 2YNCA 4XPLA 2C27A 1UWYA 4KNGE 3S9NA 2REEA 5G20A 1YGHA 1CG2A 2PJ7A 2Z10A 4XPDB 1QSNA 3I9SA 5G21A 4JZ0A 3PLFB 4H6ZA 4M6IA 4KORA 3FJUA 3CZXA 2H5MA 3I6SA 2BOAA 3P2HA 4UCMA 3DR8A 3LACA 4C86A 3BLNA 1BO4A 3EFAA 3EXNA 1IOFA 3R1KA 4KOWA 1ZRSA 3EC4A 2IQ6A 4R3KA 2ZW5A 2OOTA 1IIDA 2B58A 4MXUA 2HUZA 3H8GA 4IAVA 1Y9KA 3TLBA 5I4MA 2CTCA 1CP7A 3B3TA 1YVKA 1YW4A 2AFSA 4MFKA 2OZHA 5DWMA 3ZZIA 2CNTA 1Z8TA 3V8IA 4B11A 2AE6A 5HVFA 4BBHA 3QAHA 2PVWA 7CPAA 3IWWA 3JVNA 4FBEA 4C2XA 4KSAA 5F46A 4JYWA 3VRRA 1KUVA 1WVMA 2AFXA 3PRTA 4MCQA 1MJBA 3N7ZA 2QYVA 3KQZA 3QNVA 3WT4A 4ZY0A 1QSTA 2ZEMA 4MHYA 4F9UA 4KOTA 4XNHB 4JD6A 1ZG8A 1ZO0A 3KHXA 4COBA 3B3CA 2Y1NA 4C85A 3SJEA 4HKFA 2DLAA 2Q04A 3T9YA 4KVXA 1XBUA 2CXAA 2ODFA 2R8VA 1MJ9A 3NH5A 1EO0A 2Q44A 1DE4C 2NYQA 2ARHA 5A27A 3FEDA 1J4JA 4UCPA 2VEZA 4NGPA 5IB9A 3PFVA 1IOIA 2VXKA 4YFJA 3OWCA 3S6FA 4C2YA 3FMCA 4QB9A 1VBGA 2OU2A 8CPAA 3NFQA 3D67A 4PSWA 3N5FA 4M3SA 4J3GA 2AFOA 1KWMA 1Z8WA 4A4CA 4BINA 3BUWB 2CNMA 2ZELA 3GKRA 4IF5A 4RUHA 1A9XB 4INJA 1WJTA 1XF8A 2Y0MA 3K9TA 2BUEA 2PJ4A 4UWJA 3V38A 4BPXB 2I3CA 3KR4A 4II9A 2PJ6A 5JQ4A 1S7KA 2G3TA 1YLEA 3L2NA 4PPZA 4L89A 2CY2A 3RAMA 3WC6A 2A4NA 2Q51A 5EBVA 2C6CA 1Q2YA 3MRUA 3TE4A 4C8AA 2C6PA 1GHEA 1P0HA 1Z2LA 4HNWB 5FVJA 5D29A 1L0CA 2YJVA 5F49A 4MY3A 1Y7EA 2PC1A 4MI4A 2PJCA 1UFHA 3QAYA 4U9YA 5G22A 4AVCA 2C5QA 1VHSA 1NMTA 4RI1A 4NFRA 4C9AA 3JRUA 3NH8A 3CPXA 2ANPA 2V77A 2OB0A 5LYLA 4H2KA 4KLWA 4B5OA 1M4GA 5K99A 4X5KA 2QMLA 4A39A 2ZW6A 1LAMA 4KOYA 1IB1E 2WUUA 3NE8A 3PB4X 5HKYA 4GPLB 2Q4VA 4E8OA 5IB0A 3ISZA 4KSFA 1ARMA 4PK3A 1TF9A 3DNSA 3VARA 2X0SA 3FB3A 3KASA 4Y49C 1X10A 5CNPA 2B0AA 3VWEA 3FRMA 3KHZA 3PEIA 2NMTA 5CPAA 3R9EA 1JDEA 3T05A 3TLGB 4P44A 2PDOA 3IU1A 4F9VA 2FXFA 1KZFA 2J8NA 3OAKA 4JLYA 3SHPA 4CO9A 3FH4A 2GFQA 2B4DB 1X12A 2B5GA 2JLMA 3RBUA 2ZW7A 1I1DA 3GLJA 4PV6A 3D7HA 1YSJA 3B35A 3BJ8A 4KOVA 3KRVA 3SJFA 2YNDA 5F48A 2FSRA 3BI1A 4UFWA 2Q0YA 2F8HA 4CYQA 3TLEA 5HKZA 3R96A 4K3NA 2OZUA 3U1BA 1J3LA 3FIXA 2AFMA 4NGNA 1F57A 1QSRA 3I3GA 4COGA 5FD8A 1Q2CA 4MY0A 1Z8LA 3FBUA 4OP4A 2PIZA 1YVHA 2WSAA 2G0BA 1QQ9A 1I12A 4ORFA 3RZAA 3NE7A 4EMEA 4C8TA 1XIXA 2RB7A 4UEFA 4CRZB 4C8UA 1VBHA 5THWA 2QVPA 4DNCA 4R87A 4OC2A 1WWZA 4LX9A 4JXQA 4E0AA 5J3XA 1GYTA 1MK4A 2XEFA 4W9YA 4E94A 3TLZA 4CGPA 2J8MA 1YREA 2BEIA 2HI6A 3SI1A 1QSOA 3W6SA 4J0NA 3CDXA 4OC1A 1VHEA 1CP6A 1F2OA 2DF5A 1AMPA 4ONUA 2V8HA 2ZEOA 1ON0A 1OZPA 4EFDA 1Z9EA 4CGLA 1ELLP 4TJVA 4MCPA 1OBRA 4G1PA 4LQ6A 5HH1A 2EZBA 3D4UA 4A4BA 4PK2A 2BL1A 3T8WA 2PJAA 3KKWA 5J8CA 1BPMA 3FX6A 2Z3OA 1IYLA 2G9DA 2ZXVA 4CGOA 2PRBA 5LYFA 3PZJA 1BXRB 1ZG9A 5K8NA 2DEAA 2IMOA 5KTCA 4C8CA 1B6BA 4NGTA 1PU9A 1TXRA 2YNEA 4R3LA 4UWIA 4B13A 4EVYA 2DIKA 4IIYA 4TJXA 1N71A 1EE3P 3T07A 3CXPA 4MHDA 4M85A 4Q7AA 2DPTA 2V8GA 2D4OA 1NE9A 5IV0A 5F09A 1Q2DA 2XEGA 3FXTA 1P4NA 2HV2A 4OKOA 4B5PB 4A37A 3FEEA 2BCOA 4P6YA 4IK2A 4F6AA 1R43A 4H6UA 2QECA 4O23A 4YU9A 3NH4A 5EMIA 2VZYA 3C8OA 2HWGA 4FWUA 2IL4A 1ELMP 2ZENA 4MCRA 3GY9A 3LD2A 1Q7LA 3TCVA 3EZEA 3T0TA 3W91A 2CNSA 5LYIA 4X2TA 2GANA 3P2FA 2PQ8A 3IFEA 4NCZA 4R8FA 3VRNA 2VZZA 2XPOA 3IIBA 4UEEA 2EO8A 1Y0RA 4QVTA 4R57A 4R6TA 4A95A 4BD9A 2CTBA 4QBJA 2WYRA 4CDKA 4A32A 3B3SA 2FIAA 3H5ZA 3MGDA 2EZAA 4NGQA 1V6CA 1KC7A 2Z0ZA 2PJBA 4XPDC 3D7GA 3WABA 4C7HA 4DUKA 4KVME 2PE3A 2QIRA 2RC4A 3PB7X 1M4DA 4M6HA 4P45A 3DR6A 2AFUA 4KOXA 3CXQA 4OC4A
chains in the Genus database with same CATH topology
4X3RA 3CPAA 1LOKA 3SI2A 3WC7A 1Y9ZA 4OMEA 3PBBA 1HDQA 3SI0A 4C8FA 1TKFA 2PVVA 5JH9A 4WJBA 4OC5A 4ZYQA 5HXDA 2VL1A 4NGSA 4PQAA 4PXBA 3NFZA 4KSIA 2ZEGA 1LFWA 2C1CA 5DS0A 2PJ3A 3PB8X 1BLLE 4YWYA 1CPXA 1R3NA 3KI9A 3SJXA 5K8MA 1ARLA 3TX8A 2QJ8A 3LMSA 4C99A 1H8LA 4YN3A 5K8PA 3PBEA 2GU2A 2C6GA 3KGQA 2PRQA 1NSAA 2JEWA 3IJ3A 2AFWA 1PCAA 2IJZA 1YMEA 2EWBA 3GUXA 2GP4A 3GB0A 3D68A 3PFOA 2PJ1A 3WC5A 3K2KA 3B3VA 5IR2A 2JBKA 2GLJA 5LRKA 5LYDA 1VHOA 3H8EA 3VATA 4R76A 5J1QA 2Q43A 3TC8A 3BHXA 3S9LA 2ZEPA 1XRYA 3B2YA 1LANA 4P10A 3IEHA 4DJLA 3LWUA 1ZLHA 1CX8A 4NJQA 2OR4A 3KL9A 3I74A 3PB6X 1TKHA 1ZLIA 2PJ2A 2FVGA 1TKJA 1IGBA 4P4JA 1CBXA 4PXDA 3FECA 2NSMA 4DYOA 6CPAA 3D7DA 4NGRA 3EIFA 1DTDA 1QMUA 3KQXA 1LAPA 2XEJA 3KZWA 4ZY2A 1HDUA 4P4EA 3VH9A 2O53A 3DLJA 4MMOA 2PJ0A 4MCSA 4NGMA 4C8PA 1YLOA 4TNUA 3BXMA 1Z5RA 5JM6A 1F2PA 2RFHA 3CT9A 4CPAA 5K8OA 2ZEEA 4MHPA 3IC1A 2Q4ZA 5ELYA 4PXCA 4MHZA 2EK8A 4FUUA 5HVHA 1HEEA 2O4HA 1BAVA 3FF3A 3HLPA 2HB6A 1IY7A 1YW6A 4ONWA 5LRGA 2PIYA 2ZOFA 4FAIA 3KR5A 1PYTB 1ZG7A 4ZY1A 1AYEA 2CF4A 4F8ZA 3MN8A 4UIBA 2V8VA 2ZEDA 1M4LA 1XFOA 3ISXA 2AFZA 2POKA 3DGVA 1XMBA 2ZOGA 4R7MA 2GLFA 5LRJA 4MRIA 3B7IA 4PXEA 4X8IA 1JQGA 1LCPA 4NJRA 4TWEA 1BPNA 2HC9A 4P4IA 2JBJA 2PCUA 3I1UA 1XJOA 2V8DA 3D66A 1CPSA 4LQGA 1TF8A 3D7FA 1FNOA 1RTQA 2PJ5A 1VGYA 4OC0A 4A94A 4MHNA 3FVLA 1FT7A 4OIDA 3ICUA 4C9UA 2ZEFA 1XF1A 3SJGA 3PB9X 4Z65A 4AXVA 2J9AA 3NA6A 4P4BA 4OIWA 4C84A 4P4DA 1VIXA 3BI0A 2WZNA 5JGFA 3V7ZA 3IO1A 2CIJA 5CBMA 4IHMA 3VTAA 2EK9A 4C9RA 2PJ9A 4ZX8A 4C9VA 2ABZA 2GREA 4ZX9A 4A38A 2BO9A 4WWVA 4UIAA 3PFEA 4UF4A 4GM5A 4CDJA 2PJ8A 4ZI6A 4P4FA 2XEIA 4UEZA 3S9MA 5HVGA 4EWTA 3H8FA 1Y0YA 4C9EA 4B6ZA 5D8NA 3B3WA 4OC3A 2F7VA 2ZEHA 1UWYA 4KNGE 3S9NA 1CG2A 2PJ7A 4JZ0A 3I6SA 3FJUA 2BOAA 4C86A 2IQ6A 2OOTA 4MXUA 3H8GA 4IAVA 5I4MA 2CTCA 1CP7A 3B3TA 1YW4A 2AFSA 5HVFA 2PVWA 7CPAA 3IWWA 4FBEA 4JYWA 1WVMA 2AFXA 3PRTA 4MCQA 3QNVA 3WT4A 2QYVA 3KQZA 4ZY0A 2ZEMA 4MHYA 4F9UA 1ZG8A 3KHXA 3B3CA 4C85A 3SJEA 1XBUA 3NH5A 1DE4C 2NYQA 5IB9A 3FEDA 4NGPA 3FMCA 8CPAA 3D67A 3N5FA 2AFOA 1KWMA 2ZELA 4RUHA 3K9TA 2PJ4A 3V38A 2I3CA 3KR4A 2PJ6A 4PPZA 3L2NA 3RAMA 3WC6A 2Q51A 2C6CA 3MRUA 4C8AA 2C6PA 1Z2LA 5D29A 1Y7EA 2PJCA 2C5QA 4C9AA 4NFRA 3JRUA 3NH8A 3CPXA 2ANPA 2V77A 5LYLA 4H2KA 4A39A 1LAMA 3PB4X 3ISZA 1ARMA 1TF9A 3VARA 3KASA 3KHZA 3PEIA 5CPAA 4P44A 4F9VA 3FH4A 3RBUA 3GLJA 3D7HA 1YSJA 3B35A 3SJFA 3BI1A 2F8HA 4K3NA 2AFMA 4NGNA 1F57A 1Z8LA 4OP4A 2PIZA 1QQ9A 3RZAA 4EMEA 4C8TA 2RB7A 4UEFA 4C8UA 5THWA 2QVPA 4OC2A 1GYTA 2XEFA 4W9YA 3SI1A 3CDXA 4OC1A 1CP6A 1F2OA 1VHEA 1AMPA 2V8HA 2ZEOA 4EFDA 1ELLP 4TJVA 4MCPA 1OBRA 4G1PA 3D4UA 3T8WA 2PJAA 1BPMA 3FX6A 2G9DA 5LYFA 1ZG9A 5K8NA 2DEAA 2IMOA 4C8CA 1TXRA 4NGTA 4TJXA 1EE3P 4Q7AA 2V8GA 5F09A 2XEGA 4OKOA 4A37A 3FEEA 2BCOA 4P6YA 4IK2A 1R43A 4O23A 4YU9A 3NH4A 4FWUA 1ELMP 2ZENA 4MCRA 1Q7LA 5LYIA 4X2TA 4R8FA 4UEEA 3IFEA 3IIBA 1Y0RA 4BD9A 4R6TA 2CTBA 2WYRA 4CDKA 3B3SA 4NGQA 1V6CA 2PJBA 3D7GA 3WABA 4DUKA 2PE3A 3PB7X 4P45A 2AFUA 3HUVA 4OC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3R A;  3CPA A;  1LOK A;  3SI2 A;  3WC7 A;  1Y9Z A;  4OME A;  3PBB A;  1HDQ A;  3SI0 A;  4C8F A;  1TKF A;  2PVV A;  5JH9 A;  4WJB A;  4OC5 A;  4ZYQ A;  5HXD A;  2VL1 A;  4NGS A;  4PQA A;  4PXB A;  3NFZ A;  4KSI A;  2ZEG A;  1LFW A;  2C1C A;  5DS0 A;  2PJ3 A;  3PB8 X;  1BLL E;  4YWY A;  1CPX A;  1R3N A;  3KI9 A;  3SJX A;  5K8M A;  1ARL A;  3TX8 A;  2QJ8 A;  3LMS A;  4C99 A;  1H8L A;  4YN3 A;  5K8P A;  3PBE A;  2GU2 A;  2C6G A;  3KGQ A;  2PRQ A;  1NSA A;  2JEW A;  3IJ3 A;  2AFW A;  1PCA A;  2IJZ A;  1YME A;  2EWB A;  3GUX A;  3GB0 A;  3D68 A;  3PFO A;  2PJ1 A;  3WC5 A;  3K2K A;  3B3V A;  2JBK A;  2GLJ A;  5LRK A;  5LYD A;  1VHO A;  3H8E A;  3VAT A;  4R76 A;  5J1Q A;  2Q43 A;  3TC8 A;  3BHX A;  3S9L A;  2ZEP A;  1XRY A;  3B2Y A;  1LAN A;  4P10 A;  3IEH A;  4DJL A;  3LWU A;  1ZLH A;  1CX8 A;  4NJQ A;  2OR4 A;  3KL9 A;  3I74 A;  3PB6 X;  1TKH A;  1ZLI A;  2PJ2 A;  2FVG A;  1TKJ A;  1IGB A;  4P4J A;  1CBX A;  4PXD A;  3FEC A;  2NSM A;  4DYO A;  6CPA A;  3D7D A;  4NGR A;  3EIF A;  1DTD A;  1QMU A;  3KQX A;  1LAP A;  2XEJ A;  3KZW A;  4ZY2 A;  1HDU A;  4P4E A;  3VH9 A;  2O53 A;  3DLJ A;  4MMO A;  2PJ0 A;  4MCS A;  4NGM A;  4C8P A;  1YLO A;  4TNU A;  3BXM A;  1Z5R A;  5JM6 A;  1F2P A;  2RFH A;  3CT9 A;  4CPA A;  5K8O A;  2ZEE A;  4MHP A;  3IC1 A;  2Q4Z A;  5ELY A;  4PXC A;  4MHZ A;  2EK8 A;  4FUU A;  5HVH A;  1HEE A;  2O4H A;  1BAV A;  3FF3 A;  3HLP A;  2HB6 A;  1IY7 A;  1YW6 A;  4ONW A;  5LRG A;  2PIY A;  2ZOF A;  4FAI A;  3KR5 A;  1PYT B;  1ZG7 A;  4ZY1 A;  1AYE A;  2CF4 A;  4F8Z A;  3MN8 A;  4UIB A;  2V8V A;  2ZED A;  1M4L A;  1XFO A;  3ISX A;  2AFZ A;  2POK A;  3DGV A;  1XMB A;  2ZOG A;  4R7M A;  2GLF A;  5LRJ A;  4MRI A;  3B7I A;  4PXE A;  4X8I A;  1JQG A;  1LCP A;  4NJR A;  4TWE A;  1BPN A;  2HC9 A;  4P4I A;  2JBJ A;  2PCU A;  3I1U A;  1XJO A;  2V8D A;  3D66 A;  1CPS A;  4LQG A;  1TF8 A;  3D7F A;  1FNO A;  1RTQ A;  2PJ5 A;  1VGY A;  4OC0 A;  4A94 A;  4MHN A;  3FVL A;  1FT7 A;  4OID A;  3ICU A;  4C9U A;  2ZEF A;  1XF1 A;  3SJG A;  3PB9 X;  4Z65 A;  4AXV A;  2J9A A;  3NA6 A;  4P4B A;  4OIW A;  4C84 A;  4P4D A;  1VIX A;  3BI0 A;  2WZN A;  5JGF A;  3V7Z A;  3IO1 A;  2CIJ A;  5CBM A;  4IHM A;  3VTA A;  2EK9 A;  4C9R A;  2PJ9 A;  4ZX8 A;  4C9V A;  2ABZ A;  2GRE A;  4ZX9 A;  4A38 A;  2BO9 A;  4WWV A;  4UIA A;  3PFE A;  4UF4 A;  4GM5 A;  4CDJ A;  2PJ8 A;  4ZI6 A;  4P4F A;  2XEI A;  4UEZ A;  3S9M A;  5HVG A;  4EWT A;  3H8F A;  1Y0Y A;  4C9E A;  4B6Z A;  5D8N A;  3B3W A;  4OC3 A;  2F7V A;  2ZEH A;  1UWY A;  4KNG E;  3S9N A;  1CG2 A;  2PJ7 A;  4JZ0 A;  3I6S A;  3FJU A;  2BOA A;  4C86 A;  2IQ6 A;  2OOT A;  4MXU A;  3H8G A;  4IAV A;  5I4M A;  2CTC A;  1CP7 A;  3B3T A;  1YW4 A;  2AFS A;  5HVF A;  2PVW A;  7CPA A;  3IWW A;  4FBE A;  4JYW A;  1WVM A;  2AFX A;  3PRT A;  4MCQ A;  3QNV A;  3WT4 A;  2QYV A;  3KQZ A;  4ZY0 A;  2ZEM A;  4MHY A;  4F9U A;  1ZG8 A;  3KHX A;  3B3C A;  4C85 A;  3SJE A;  1XBU A;  3NH5 A;  1DE4 C;  2NYQ A;  5IB9 A;  3FED A;  4NGP A;  3FMC A;  8CPA A;  3D67 A;  3N5F A;  2AFO A;  1KWM A;  2ZEL A;  4RUH A;  3K9T A;  2PJ4 A;  3V38 A;  2I3C A;  3KR4 A;  2PJ6 A;  4PPZ A;  3L2N A;  3RAM A;  3WC6 A;  2Q51 A;  2C6C A;  3MRU A;  4C8A A;  2C6P A;  1Z2L A;  5D29 A;  1Y7E A;  2PJC A;  4C9A A;  4NFR A;  3JRU A;  3NH8 A;  3CPX A;  2ANP A;  2V77 A;  5LYL A;  4H2K A;  4A39 A;  1LAM A;  3PB4 X;  3ISZ A;  1ARM A;  1TF9 A;  3VAR A;  3KAS A;  3KHZ A;  3PEI A;  5CPA A;  4P44 A;  4F9V A;  3FH4 A;  3RBU A;  3GLJ A;  3D7H A;  1YSJ A;  3B35 A;  3SJF A;  3BI1 A;  2F8H A;  4K3N A;  2AFM A;  4NGN A;  1F57 A;  1Z8L A;  4OP4 A;  2PIZ A;  1QQ9 A;  3RZA A;  4EME A;  4C8T A;  2RB7 A;  4UEF A;  4C8U A;  5THW A;  2QVP A;  4OC2 A;  1GYT A;  2XEF A;  4W9Y A;  3SI1 A;  3CDX A;  4OC1 A;  1CP6 A;  1F2O A;  1VHE A;  1AMP A;  2V8H A;  2ZEO A;  4EFD A;  1ELL P;  4TJV A;  4MCP A;  1OBR A;  4G1P A;  3D4U A;  3T8W A;  2PJA A;  1BPM A;  3FX6 A;  2G9D A;  5LYF A;  1ZG9 A;  5K8N A;  2DEA A;  2IMO A;  4C8C A;  1TXR A;  4NGT A;  4TJX A;  1EE3 P;  4Q7A A;  2V8G A;  5F09 A;  2XEG A;  4OKO A;  4A37 A;  3FEE A;  2BCO A;  4P6Y A;  4IK2 A;  1R43 A;  4O23 A;  4YU9 A;  3NH4 A;  4FWU A;  1ELM P;  2ZEN A;  4MCR A;  1Q7L A;  5LYI A;  4X2T A;  4R8F A;  4UEE A;  3IFE A;  3IIB A;  1Y0R A;  4BD9 A;  4R6T A;  2CTB A;  2WYR A;  4CDK A;  3B3S A;  4NGQ A;  1V6C A;  2PJB A;  3D7G A;  3WAB A;  4DUK A;  2PE3 A;  3PB7 X;  4P45 A;  2AFU A;  3HUV A;  4OC4 A; 
#chains in the Genus database with same CATH topology
 4C2Z A;  3OP0 A;  4NSQ A;  4X3R A;  5EC4 A;  3CPA A;  3VGO A;  1LOK A;  3TLY A;  3SI2 A;  3WC7 A;  5F13 A;  2Y1M A;  4FD7 A;  4F0X A;  1I21 A;  1Y9Z A;  4OME A;  4MFZ A;  1Z9U A;  3PBB A;  4RN7 A;  3SXN A;  4AG9 A;  1HDQ A;  3SI0 A;  1MJA A;  1TKF A;  2B3U A;  2PVV A;  4Y49 B;  2UV8 G;  4WJB A;  3TOB A;  5JH9 A;  4CRY B;  5A28 A;  4OC5 A;  4ZYQ A;  5HMN A;  5HXD A;  2VL1 A;  3A9L A;  4M6G A;  3TT2 A;  4NGS A;  1K4J A;  1EZA A;  4PQA A;  3OB2 B;  4PXB A;  3NFZ A;  2PR8 A;  4KSI A;  2ZEG A;  4XNH C;  1LFW A;  1Z4R A;  5JGF A;  3TLC A;  2C1C A;  4FD4 A;  2PJ3 A;  5DS0 A;  1S7N A;  1YVO A;  3PB8 X;  4MFJ A;  1BLL E;  4YWY A;  3R95 A;  1CPX A;  2P6E A;  2FL4 A;  4OLL A;  4A33 A;  4QC6 A;  3LOD A;  1R3N A;  3KI9 A;  1R57 A;  3EO4 A;  3TTH A;  1FY7 A;  4JWP A;  3SJX A;  3G23 A;  5K8M A;  1FBV A;  2F5I A;  4C7I A;  4CZ1 A;  3TO7 A;  2Z3L A;  2EZC A;  1ARL A;  2FM4 A;  3TX8 A;  2QJ8 A;  3SXO A;  3LMS A;  4C99 A;  2ATR A;  1YX0 A;  4AB7 A;  1H8L A;  4B10 A;  2ZPA A;  4A2Z A;  4YN3 A;  4FD6 A;  4IIX A;  3BUX B;  2B4J C;  3PT1 A;  5K8P A;  3PBE A;  2FT0 A;  2C6G A;  2GU2 A;  3KGQ A;  2D0P A;  2PRQ A;  1NSA A;  2JEW A;  2Q7B A;  4MJ8 A;  3IJ3 A;  2OH1 A;  2Q7S A;  4C68 A;  4GS4 A;  2AFW A;  2JDC A;  1PCA A;  2IJZ A;  1YME A;  1NBW A;  2EWB A;  3GUX A;  4CAE A;  1C30 B;  3BUM B;  2GP4 A;  3GB0 A;  3EZA A;  3D68 A;  3PFO A;  2PJ1 A;  1S7F A;  3WC5 A;  1LRZ A;  1S3Z A;  2VQY A;  4I49 A;  4KUA A;  3K2K A;  4KS9 A;  1EZB A;  1S60 A;  5AG4 A;  4CGN A;  3B3V A;  5IR2 A;  2JBK A;  2GLJ A;  5LRK A;  3F0A A;  5LYD A;  5AGE A;  4Q38 A;  1VHO A;  3FYN A;  3H8E A;  3IWE A;  3VAT A;  2R98 A;  4R76 A;  2Q43 A;  2BSW A;  3TC8 A;  5J1Q A;  2DPS A;  3BHX A;  4BTF A;  3S9L A;  1XRY A;  2EBJ A;  2ZEP A;  3B2Y A;  3GIU A;  5C82 A;  1LAN A;  4P10 A;  3F9K C;  3IEH A;  1TIQ A;  4DJL A;  3LWU A;  1ZLH A;  1CX8 A;  4NJQ A;  4MBU A;  2JDD A;  2OR4 A;  3KL9 A;  3PP9 A;  3I74 A;  4AG7 A;  3ZNI A;  3PB6 X;  1TKH A;  1ZLI A;  2PJ2 A;  2FVG A;  1TKJ A;  1IGB A;  5IX3 A;  5AG7 A;  4MJX A;  3HMJ G;  4P4J A;  1CBX A;  4OAD A;  4PXD A;  3HPG G;  2AUN A;  3VRP A;  1M1D A;  1JDB C;  3FEC A;  1CM0 A;  3K4I A;  1Y9W A;  4NEX A;  1RXT A;  2NSM A;  5H84 A;  4DYO A;  6CPA A;  3D7D A;  4L8A A;  4NF1 A;  2OZG A;  4NGR A;  3EIF A;  1DTD A;  1QMU A;  4A30 A;  4ZBG A;  3KQX A;  1LAP A;  2YGW A;  4KLV A;  2EUI A;  2XEJ A;  5F9M A;  3KZW A;  4KOU A;  4UFX A;  4ZY2 A;  3S6G A;  1HDU A;  4P4E A;  4MFP A;  5AG5 A;  2O53 A;  2Z11 A;  3VH9 A;  3DLJ A;  3S6K A;  1IIC A;  1M44 A;  4MCS A;  1XOV A;  2B5G B;  2PJ0 A;  3DDD A;  1M4I A;  4NGM A;  4MMO A;  1XEB A;  3BJ7 A;  4YGO A;  1YLO A;  3HPH E;  4TNU A;  4C8P A;  2XPL A;  4E2A A;  1ZL0 A;  3BXM A;  1Z5R A;  5JM6 A;  1F2P A;  2RFH A;  1WK4 A;  3CT9 A;  1SQH A;  4HNY B;  1PUA A;  4CPA A;  3GYA A;  4PSX A;  5K8O A;  2ZEE A;  4MHP A;  3IC1 A;  2AJ6 A;  5KTD A;  2Q4Z A;  5ELY A;  4BPW B;  2P6F A;  2PCN A;  3TLA A;  2GE3 A;  4PXC A;  4MHZ A;  2N3A B;  1Z8X A;  2EK8 A;  3TFY A;  3QB8 A;  1C3O B;  4FUU A;  5HVH A;  1HEE A;  3IGR A;  3TYX A;  3IU2 A;  3UY5 A;  2O4H A;  5E96 A;  1BAV A;  3FF3 A;  1KUX A;  3HLP A;  4KZT A;  3RYO A;  4UCN A;  4JJX A;  3D3S A;  4R9M A;  4UA3 A;  2XPN A;  3T90 A;  2HB6 A;  1AUG A;  1IY7 A;  4A31 A;  3IWG A;  2GIV A;  5J8F A;  1YW6 A;  1DIK A;  4ONW A;  5DWN A;  5LRG A;  5F5X A;  2PIY A;  5GCN A;  2E28 A;  1XMT A;  2ZOF A;  4FAI A;  1NXJ A;  3KR5 A;  1PYT B;  4AVA A;  1YK3 A;  1ZG7 A;  4XPK A;  1AYE A;  3R9G A;  1Y7R A;  2CF4 A;  4ZY1 A;  4CS0 B;  5ISV A;  1B47 A;  2KCW A;  5BY0 A;  4F8Z A;  1Q5X A;  1JWQ A;  2FCK A;  3OB1 B;  2I00 A;  2AUM A;  3MN8 A;  1RO5 A;  4UIB A;  2XPP A;  2V8V A;  3TLG A;  2ZED A;  2VKZ G;  2P0W A;  1M4L A;  4EYS A;  2D0O A;  1XFO A;  2CBL A;  1R61 A;  3ISX A;  2AFZ A;  2VBQ A;  1VKC A;  1YR0 A;  2G3A A;  2POK A;  4CYN A;  2B4D A;  2WPX A;  3DGV A;  1XMB A;  1S5K A;  4ZGY B;  1B87 A;  2PR1 A;  2J8R A;  2GLF A;  2ZOG A;  4R7M A;  3D2M A;  5G1Z A;  4LUA A;  4MRI A;  5LRJ A;  2VI7 A;  3B7I A;  3EY5 A;  3D8P A;  1QSM A;  4CAF A;  1CS0 B;  1ZYM A;  3D2P A;  4PXE A;  4X8I A;  4CAX A;  5F1Y A;  1JQG A;  1LCP A;  4NJR A;  2MP0 A;  1V0C A;  4U9Z A;  4TWE A;  3FNC A;  4UBR A;  4UFV A;  3BUN B;  4JXR A;  1BPN A;  2B4B A;  2HC9 A;  3S6H A;  4P4I A;  2JBJ A;  2JEV A;  2OLS A;  2PCU A;  3I1U A;  4BMH A;  3O8Z A;  2O28 A;  1YQE A;  5H86 A;  1XJO A;  2V8D A;  4H1H A;  3D66 A;  3E0K A;  4RR2 B;  1CPS A;  5HKW A;  5JPH A;  1KUY A;  2Z3M A;  3G3S A;  4B12 A;  3BUO B;  4CGM A;  5F47 A;  2R1I A;  4LQG A;  3VRQ A;  4FD5 A;  1TF8 A;  3D7F A;  1FNO A;  2I79 A;  4K30 A;  3ZJ0 A;  1RTQ A;  3HUV A;  3CXS A;  1T36 B;  3VRO A;  2PJ5 A;  2Q4Y A;  1VGY A;  5BWA B;  3DSB A;  4AVB A;  3H4Q A;  1Z4E A;  4IUS A;  4OC0 A;  4A94 A;  4MFQ A;  4MHN A;  4E5S A;  2HQY A;  3FVL A;  3WR7 A;  3R9F A;  1FT7 A;  4CAW A;  2REF A;  3F8K A;  3G8W A;  4CAV A;  1M6V B;  5C88 A;  2YNC C;  3VWD A;  4OID A;  5KTA A;  3ICU A;  3C26 A;  3NOJ A;  4C9U A;  1XE4 A;  2K5T A;  2Z3P A;  4Q36 A;  2ZEF A;  1XF1 A;  3SJG A;  3PB9 X;  4MFL A;  4Z65 A;  3B8G A;  4AXV A;  2FIW A;  4QUS A;  2J9A A;  3EZB A;  3NA6 A;  2WPW A;  3TOA A;  4P4B A;  1BOB A;  4YRH A;  3T5M A;  3TO6 A;  4OIW A;  1S7L A;  4C84 A;  1IYK A;  4P4D A;  2X7B A;  2R7H A;  4HPS A;  3SR3 A;  1VIX A;  1IU8 A;  3BI0 A;  3K9U A;  2WZN A;  3F5B A;  1U6M A;  1CJW A;  2FS5 A;  3IO1 A;  2CIJ A;  3JTK A;  2DXQ A;  3V7Z A;  4B14 A;  3U88 C;  4CYP A;  5CBM A;  2P6G A;  1A2Z A;  4H89 A;  4IHM A;  4KOS A;  4CYO A;  1GGO A;  2EK9 A;  4M8D A;  2EVN A;  3VTA A;  4C9R A;  5JVL A;  2PJ9 A;  4ZX8 A;  4C9V A;  4C8F A;  2ABZ A;  2GRE A;  4RS2 A;  4OAE A;  3JUW A;  4KUB A;  4B5P A;  2B3V A;  2Z3K A;  2R82 A;  2D4P A;  4GXH A;  4ZX9 A;  5JYB A;  4A38 A;  5AG6 A;  4NXY A;  2BO9 A;  3PGP A;  4JVO A;  4WWV A;  4F0Y A;  4KVO E;  4UIA A;  1NSL A;  3GJZ A;  5AXI A;  2YJT A;  4BPU B;  3PFE A;  4UF4 A;  4GM5 A;  2FE7 A;  4CDJ A;  2PJ8 A;  1KBL A;  4ZI6 A;  4P4F A;  3RO0 A;  2HRO A;  4MI1 A;  5I0C A;  2XEI A;  4UEZ A;  3TO9 A;  1CE8 B;  3S9M A;  4U5Y A;  4EWT A;  5HVG A;  1KEE B;  3H8F A;  1Y0Y A;  4C9E A;  3W6X A;  4B6Z A;  3RNZ A;  2Z3N A;  5D8N A;  3B3W A;  1VI4 A;  2ZW4 A;  4HNX B;  2PSW A;  4OC3 A;  2F7V A;  2ZEH A;  2YNC A;  4XPL A;  2C27 A;  1UWY A;  4KNG E;  3S9N A;  2REE A;  5G20 A;  1YGH A;  1CG2 A;  2PJ7 A;  2Z10 A;  4XPD B;  1QSN A;  3I9S A;  5G21 A;  4JZ0 A;  3PLF B;  4H6Z A;  4M6I A;  4KOR A;  3FJU A;  3CZX A;  2H5M A;  3I6S A;  2BOA A;  3P2H A;  4UCM A;  3DR8 A;  3LAC A;  4C86 A;  3BLN A;  1BO4 A;  3EFA A;  3EXN A;  1IOF A;  3R1K A;  4KOW A;  1ZRS A;  3EC4 A;  2IQ6 A;  4R3K A;  2ZW5 A;  2OOT A;  1IID A;  2B58 A;  4MXU A;  2HUZ A;  3H8G A;  4IAV A;  1Y9K A;  3TLB A;  5I4M A;  2CTC A;  1CP7 A;  3B3T A;  1YVK A;  1YW4 A;  2AFS A;  4MFK A;  2OZH A;  5DWM A;  3ZZI A;  2CNT A;  1Z8T A;  3V8I A;  4B11 A;  2AE6 A;  5HVF A;  4BBH A;  3QAH A;  2PVW A;  7CPA A;  3IWW A;  3JVN A;  4FBE A;  4C2X A;  4KSA A;  5F46 A;  4JYW A;  3VRR A;  1KUV A;  1WVM A;  2AFX A;  3PRT A;  4MCQ A;  1MJB A;  3N7Z A;  2QYV A;  3KQZ A;  3QNV A;  3WT4 A;  4ZY0 A;  1QST A;  2ZEM A;  4MHY A;  4F9U A;  4KOT A;  4XNH B;  4JD6 A;  1ZG8 A;  1ZO0 A;  3KHX A;  4COB A;  3B3C A;  2Y1N A;  4C85 A;  3SJE A;  4HKF A;  2DLA A;  2Q04 A;  3T9Y A;  4KVX A;  1XBU A;  2CXA A;  2ODF A;  2R8V A;  1MJ9 A;  3NH5 A;  1EO0 A;  2Q44 A;  1DE4 C;  2NYQ A;  2ARH A;  5A27 A;  3FED A;  1J4J A;  4UCP A;  2VEZ A;  4NGP A;  5IB9 A;  3PFV A;  1IOI A;  2VXK A;  4YFJ A;  3OWC A;  3S6F A;  4C2Y A;  3FMC A;  4QB9 A;  1VBG A;  2OU2 A;  8CPA A;  3NFQ A;  3D67 A;  4PSW A;  3N5F A;  4M3S A;  4J3G A;  2AFO A;  1KWM A;  1Z8W A;  4A4C A;  4BIN A;  3BUW B;  2CNM A;  2ZEL A;  3GKR A;  4IF5 A;  4RUH A;  1A9X B;  4INJ A;  1WJT A;  1XF8 A;  2Y0M A;  3K9T A;  2BUE A;  2PJ4 A;  4UWJ A;  3V38 A;  4BPX B;  2I3C A;  3KR4 A;  4II9 A;  2PJ6 A;  5JQ4 A;  1S7K A;  2G3T A;  1YLE A;  3L2N A;  4PPZ A;  4L89 A;  2CY2 A;  3RAM A;  3WC6 A;  2A4N A;  2Q51 A;  5EBV A;  2C6C A;  1Q2Y A;  3MRU A;  3TE4 A;  4C8A A;  2C6P A;  1GHE A;  1P0H A;  1Z2L A;  4HNW B;  5FVJ A;  5D29 A;  1L0C A;  2YJV A;  5F49 A;  4MY3 A;  1Y7E A;  2PC1 A;  4MI4 A;  2PJC A;  1UFH A;  3QAY A;  4U9Y A;  5G22 A;  4AVC A;  2C5Q A;  1VHS A;  1NMT A;  4RI1 A;  4NFR A;  4C9A A;  3JRU A;  3NH8 A;  3CPX A;  2ANP A;  2V77 A;  2OB0 A;  5LYL A;  4H2K A;  4KLW A;  4B5O A;  1M4G A;  5K99 A;  4X5K A;  2QML A;  4A39 A;  2ZW6 A;  1LAM A;  4KOY A;  1IB1 E;  2WUU A;  3NE8 A;  3PB4 X;  5HKY A;  4GPL B;  2Q4V A;  4E8O A;  5IB0 A;  3ISZ A;  4KSF A;  1ARM A;  4PK3 A;  1TF9 A;  3DNS A;  3VAR A;  2X0S A;  3FB3 A;  3KAS A;  4Y49 C;  1X10 A;  5CNP A;  2B0A A;  3VWE A;  3FRM A;  3KHZ A;  3PEI A;  2NMT A;  5CPA A;  3R9E A;  1JDE A;  3T05 A;  3TLG B;  4P44 A;  2PDO A;  3IU1 A;  4F9V A;  2FXF A;  1KZF A;  2J8N A;  3OAK A;  4JLY A;  3SHP A;  4CO9 A;  3FH4 A;  2GFQ A;  2B4D B;  1X12 A;  2B5G A;  2JLM A;  3RBU A;  2ZW7 A;  1I1D A;  3GLJ A;  4PV6 A;  3D7H A;  1YSJ A;  3B35 A;  3BJ8 A;  4KOV A;  3KRV A;  3SJF A;  2YND A;  5F48 A;  2FSR A;  3BI1 A;  4UFW A;  2Q0Y A;  2F8H A;  4CYQ A;  3TLE A;  5HKZ A;  3R96 A;  4K3N A;  2OZU A;  3U1B A;  1J3L A;  3FIX A;  2AFM A;  4NGN A;  1F57 A;  1QSR A;  3I3G A;  4COG A;  5FD8 A;  1Q2C A;  4MY0 A;  1Z8L A;  3FBU A;  4OP4 A;  2PIZ A;  1YVH A;  2WSA A;  2G0B A;  1QQ9 A;  1I12 A;  4ORF A;  3RZA A;  3NE7 A;  4EME A;  4C8T A;  1XIX A;  2RB7 A;  4UEF A;  4CRZ B;  4C8U A;  1VBH A;  5THW A;  2QVP A;  4DNC A;  4R87 A;  4OC2 A;  1WWZ A;  4LX9 A;  4JXQ A;  4E0A A;  5J3X A;  1GYT A;  1MK4 A;  2XEF A;  4W9Y A;  4E94 A;  3TLZ A;  4CGP A;  2J8M A;  1YRE A;  2BEI A;  2HI6 A;  3SI1 A;  1QSO A;  3W6S A;  4J0N A;  3CDX A;  4OC1 A;  1VHE A;  1CP6 A;  1F2O A;  2DF5 A;  1AMP A;  4ONU A;  2V8H A;  2ZEO A;  1ON0 A;  1OZP A;  4EFD A;  1Z9E A;  4CGL A;  1ELL P;  4TJV A;  4MCP A;  1OBR A;  4G1P A;  4LQ6 A;  5HH1 A;  2EZB A;  3D4U A;  4A4B A;  4PK2 A;  2BL1 A;  3T8W A;  2PJA A;  3KKW A;  5J8C A;  1BPM A;  3FX6 A;  2Z3O A;  1IYL A;  2G9D A;  2ZXV A;  4CGO A;  2PRB A;  5LYF A;  3PZJ A;  1BXR B;  1ZG9 A;  5K8N A;  2DEA A;  2IMO A;  5KTC A;  4C8C A;  1B6B A;  4NGT A;  1PU9 A;  1TXR A;  2YNE A;  4R3L A;  4UWI A;  4B13 A;  4EVY A;  2DIK A;  4IIY A;  4TJX A;  1N71 A;  1EE3 P;  3T07 A;  3CXP A;  4MHD A;  4M85 A;  4Q7A A;  2DPT A;  2V8G A;  2D4O A;  1NE9 A;  5IV0 A;  5F09 A;  1Q2D A;  2XEG A;  3FXT A;  1P4N A;  2HV2 A;  4OKO A;  4B5P B;  4A37 A;  3FEE A;  2BCO A;  4P6Y A;  4IK2 A;  4F6A A;  1R43 A;  4H6U A;  2QEC A;  4O23 A;  4YU9 A;  3NH4 A;  5EMI A;  2VZY A;  3C8O A;  2HWG A;  4FWU A;  2IL4 A;  1ELM P;  2ZEN A;  4MCR A;  3GY9 A;  3LD2 A;  1Q7L A;  3TCV A;  3EZE A;  3T0T A;  3W91 A;  2CNS A;  5LYI A;  4X2T A;  2GAN A;  3P2F A;  2PQ8 A;  3IFE A;  4NCZ A;  4R8F A;  3VRN A;  2VZZ A;  2XPO A;  3IIB A;  4UEE A;  2EO8 A;  1Y0R A;  4QVT A;  4R57 A;  4R6T A;  4A95 A;  4BD9 A;  2CTB A;  4QBJ A;  2WYR A;  4CDK A;  4A32 A;  3B3S A;  2FIA A;  3H5Z A;  3MGD A;  2EZA A;  4NGQ A;  1V6C A;  1KC7 A;  2Z0Z A;  2PJB A;  4XPD C;  3D7G A;  3WAB A;  4C7H A;  4DUK A;  4KVM E;  2PE3 A;  2QIR A;  2RC4 A;  3PB7 X;  1M4D A;  4M6H A;  4P45 A;  3DR6 A;  2AFU A;  4KOX A;  3CXQ A;  4OC4 A; 
#chains in the Genus database with same CATH homology
 4X3R A;  3CPA A;  1LOK A;  3SI2 A;  3WC7 A;  1Y9Z A;  4OME A;  3PBB A;  1HDQ A;  3SI0 A;  4C8F A;  1TKF A;  2PVV A;  5JH9 A;  4WJB A;  4OC5 A;  4ZYQ A;  5HXD A;  2VL1 A;  4NGS A;  4PQA A;  4PXB A;  3NFZ A;  4KSI A;  2ZEG A;  1LFW A;  2C1C A;  5DS0 A;  2PJ3 A;  3PB8 X;  1BLL E;  4YWY A;  1CPX A;  1R3N A;  3KI9 A;  3SJX A;  5K8M A;  1ARL A;  3TX8 A;  2QJ8 A;  3LMS A;  4C99 A;  1H8L A;  4YN3 A;  5K8P A;  3PBE A;  2GU2 A;  2C6G A;  3KGQ A;  2PRQ A;  1NSA A;  2JEW A;  3IJ3 A;  2AFW A;  1PCA A;  2IJZ A;  1YME A;  2EWB A;  3GUX A;  2GP4 A;  3GB0 A;  3D68 A;  3PFO A;  2PJ1 A;  3WC5 A;  3K2K A;  3B3V A;  5IR2 A;  2JBK A;  2GLJ A;  5LRK A;  5LYD A;  1VHO A;  3H8E A;  3VAT A;  4R76 A;  5J1Q A;  2Q43 A;  3TC8 A;  3BHX A;  3S9L A;  2ZEP A;  1XRY A;  3B2Y A;  1LAN A;  4P10 A;  3IEH A;  4DJL A;  3LWU A;  1ZLH A;  1CX8 A;  4NJQ A;  2OR4 A;  3KL9 A;  3I74 A;  3PB6 X;  1TKH A;  1ZLI A;  2PJ2 A;  2FVG A;  1TKJ A;  1IGB A;  4P4J A;  1CBX A;  4PXD A;  3FEC A;  2NSM A;  4DYO A;  6CPA A;  3D7D A;  4NGR A;  3EIF A;  1DTD A;  1QMU A;  3KQX A;  1LAP A;  2XEJ A;  3KZW A;  4ZY2 A;  1HDU A;  4P4E A;  3VH9 A;  2O53 A;  3DLJ A;  4MMO A;  2PJ0 A;  4MCS A;  4NGM A;  4C8P A;  1YLO A;  4TNU A;  3BXM A;  1Z5R A;  5JM6 A;  1F2P A;  2RFH A;  3CT9 A;  4CPA A;  5K8O A;  2ZEE A;  4MHP A;  3IC1 A;  2Q4Z A;  5ELY A;  4PXC A;  4MHZ A;  2EK8 A;  4FUU A;  5HVH A;  1HEE A;  2O4H A;  1BAV A;  3FF3 A;  3HLP A;  2HB6 A;  1IY7 A;  1YW6 A;  4ONW A;  5LRG A;  2PIY A;  2ZOF A;  4FAI A;  3KR5 A;  1PYT B;  1ZG7 A;  4ZY1 A;  1AYE A;  2CF4 A;  4F8Z A;  3MN8 A;  4UIB A;  2V8V A;  2ZED A;  1M4L A;  1XFO A;  3ISX A;  2AFZ A;  2POK A;  3DGV A;  1XMB A;  2ZOG A;  4R7M A;  2GLF A;  5LRJ A;  4MRI A;  3B7I A;  4PXE A;  4X8I A;  1JQG A;  1LCP A;  4NJR A;  4TWE A;  1BPN A;  2HC9 A;  4P4I A;  2JBJ A;  2PCU A;  3I1U A;  1XJO A;  2V8D A;  3D66 A;  1CPS A;  4LQG A;  1TF8 A;  3D7F A;  1FNO A;  1RTQ A;  2PJ5 A;  1VGY A;  4OC0 A;  4A94 A;  4MHN A;  3FVL A;  1FT7 A;  4OID A;  3ICU A;  4C9U A;  2ZEF A;  1XF1 A;  3SJG A;  3PB9 X;  4Z65 A;  4AXV A;  2J9A A;  3NA6 A;  4P4B A;  4OIW A;  4C84 A;  4P4D A;  1VIX A;  3BI0 A;  2WZN A;  5JGF A;  3V7Z A;  3IO1 A;  2CIJ A;  5CBM A;  4IHM A;  3VTA A;  2EK9 A;  4C9R A;  2PJ9 A;  4ZX8 A;  4C9V A;  2ABZ A;  2GRE A;  4ZX9 A;  4A38 A;  2BO9 A;  4WWV A;  4UIA A;  3PFE A;  4UF4 A;  4GM5 A;  4CDJ A;  2PJ8 A;  4ZI6 A;  4P4F A;  2XEI A;  4UEZ A;  3S9M A;  5HVG A;  4EWT A;  3H8F A;  1Y0Y A;  4C9E A;  4B6Z A;  5D8N A;  3B3W A;  4OC3 A;  2F7V A;  2ZEH A;  1UWY A;  4KNG E;  3S9N A;  1CG2 A;  2PJ7 A;  4JZ0 A;  3I6S A;  3FJU A;  2BOA A;  4C86 A;  2IQ6 A;  2OOT A;  4MXU A;  3H8G A;  4IAV A;  5I4M A;  2CTC A;  1CP7 A;  3B3T A;  1YW4 A;  2AFS A;  5HVF A;  2PVW A;  7CPA A;  3IWW A;  4FBE A;  4JYW A;  1WVM A;  2AFX A;  3PRT A;  4MCQ A;  3QNV A;  3WT4 A;  2QYV A;  3KQZ A;  4ZY0 A;  2ZEM A;  4MHY A;  4F9U A;  1ZG8 A;  3KHX A;  3B3C A;  4C85 A;  3SJE A;  1XBU A;  3NH5 A;  1DE4 C;  2NYQ A;  5IB9 A;  3FED A;  4NGP A;  3FMC A;  8CPA A;  3D67 A;  3N5F A;  2AFO A;  1KWM A;  2ZEL A;  4RUH A;  3K9T A;  2PJ4 A;  3V38 A;  2I3C A;  3KR4 A;  2PJ6 A;  4PPZ A;  3L2N A;  3RAM A;  3WC6 A;  2Q51 A;  2C6C A;  3MRU A;  4C8A A;  2C6P A;  1Z2L A;  5D29 A;  1Y7E A;  2PJC A;  2C5Q A;  4C9A A;  4NFR A;  3JRU A;  3NH8 A;  3CPX A;  2ANP A;  2V77 A;  5LYL A;  4H2K A;  4A39 A;  1LAM A;  3PB4 X;  3ISZ A;  1ARM A;  1TF9 A;  3VAR A;  3KAS A;  3KHZ A;  3PEI A;  5CPA A;  4P44 A;  4F9V A;  3FH4 A;  3RBU A;  3GLJ A;  3D7H A;  1YSJ A;  3B35 A;  3SJF A;  3BI1 A;  2F8H A;  4K3N A;  2AFM A;  4NGN A;  1F57 A;  1Z8L A;  4OP4 A;  2PIZ A;  1QQ9 A;  3RZA A;  4EME A;  4C8T A;  2RB7 A;  4UEF A;  4C8U A;  5THW A;  2QVP A;  4OC2 A;  1GYT A;  2XEF A;  4W9Y A;  3SI1 A;  3CDX A;  4OC1 A;  1CP6 A;  1F2O A;  1VHE A;  1AMP A;  2V8H A;  2ZEO A;  4EFD A;  1ELL P;  4TJV A;  4MCP A;  1OBR A;  4G1P A;  3D4U A;  3T8W A;  2PJA A;  1BPM A;  3FX6 A;  2G9D A;  5LYF A;  1ZG9 A;  5K8N A;  2DEA A;  2IMO A;  4C8C A;  1TXR A;  4NGT A;  4TJX A;  1EE3 P;  4Q7A A;  2V8G A;  5F09 A;  2XEG A;  4OKO A;  4A37 A;  3FEE A;  2BCO A;  4P6Y A;  4IK2 A;  1R43 A;  4O23 A;  4YU9 A;  3NH4 A;  4FWU A;  1ELM P;  2ZEN A;  4MCR A;  1Q7L A;  5LYI A;  4X2T A;  4R8F A;  4UEE A;  3IFE A;  3IIB A;  1Y0R A;  4BD9 A;  4R6T A;  2CTB A;  2WYR A;  4CDK A;  3B3S A;  4NGQ A;  1V6C A;  2PJB A;  3D7G A;  3WAB A;  4DUK A;  2PE3 A;  3PB7 X;  4P45 A;  2AFU A;  3HUV A;  4OC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...