2XEGA

Human glutamate carboxypeptidase ii in complex with antibody- recruiting molecule arm-p4
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVQPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 268
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xegA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xegA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xegA02
2ANPA 2RB7A 1ZG7A 3GUXA 3D7FA 5LRJA 3SI0A 3SJFA 2AFXA 4C84A 4KNGE 3D67A 2PJCA 4MHYA 3WC5A 4UEFA 2PJ1A 2NYQA 2EWBA 3L2NA 2EK8A 5ELYA 4PXDA 3IJ3A 2Q43A 5LRGA 3FEDA 2QYVA 4OKOA 1VHOA 2O53A 4P4JA 4YN3A 4CDJA 5THWA 5IB9A 3NH4A 2WZNA 4FBEA 3B7IA 2OR4A 4OC2A 3I74A 2ZEDA 2IJZA 3PB8X 4MXUA 4JZ0A 1HEEA 1TKJA 3D7DA 2ZELA 1TKFA 5JGFA 4NJRA 3KI9A 4EMEA 3B35A 1R3NA 4C8PA 3QNVA 1QMUA 2WYRA 3KHXA 4H2KA 3VTAA 4IHMA 1BPMA 1RTQA 4ZY1A 5LYIA 1GYTA 2JEWA 4UEZA 4ZYQA 1V6CA 2AFMA 3JRUA 1PYTB 1ELLP 3V38A 4P4EA 1AMPA 3KQXA 2Q4ZA 5JM6A 1YMEA 4A39A 1CX8A 5CPAA 5JH9A 1ARMA 4MHZA 1CP7A 4DUKA 1UWYA 3PB6X 3SI2A 2ZEHA 2PVVA 3ISXA 4ZX9A 4FWUA 1TKHA 3IIBA 2PJ5A 2PJAA 1EE3P 1TF9A 1TF8A 3FECA 3WC7A 5K8OA 2GLFA 3VH9A 4Q7AA 2ZEEA 3B3WA 5CBMA 2PJ6A 2XEFA 5HVGA 3HUVA 4C9EA 3KQZA 4ONWA 4DJLA 2V8DA 3SJXA 3SJEA 6CPAA 4TJVA 3D66A 3VARA 4C99A 4PXCA 3S9NA 2AFSA 2V8VA 3D4UA 4MCRA 2PIZA 4IAVA 2CIJA 2EK9A 3BHXA 3B3CA 3TX8A 4PXEA 4C9VA 1LFWA 1PCAA 4MRIA 2PJ0A 3TC8A 4A94A 3T8WA 1CP6A 4R6TA 3FMCA 3I6SA 3S9MA 3FVLA 3FH4A 2J9AA 2PCUA 4PPZA 3NH5A 4OC3A 1H8LA 2G9DA 3BXMA 3IEHA 2CTBA 3WT4A 4P10A 3PRTA 2V8HA 4X8IA 4TWEA 2I3CA 2GU2A 2PRQA 2VL1A 1LANA 4C8UA 4GM5A 2XEJA 2NSMA 3D68A 3MRUA 1ELMP 2IMOA 4CDKA 4OP4A 2PIYA 2CTCA 2AFZA 4P4IA 3PB4X 7CPAA 3LMSA 3RAMA 4F9UA 5LYDA 4DYOA 2GLJA 2C1CA 3CDXA 3IWWA 4UF4A 2PJ9A 4NGNA 1R43A 4AXVA 1HDQA 4A37A 4P4DA 4C8AA 2ZOGA 4Z65A 3MN8A 2HC9A 2JBJA 4TNUA 5K8MA 1F2OA 1ZG9A 3V7ZA 2JBKA 2ZEPA 3D7GA 5J1QA 3KL9A 4MCPA 4K3NA 4NGTA 4MMOA 1DE4C 3B2YA 4UIBA 4C8TA 2GREA 1IY7A 2XEIA 4NGMA 3SJGA 1CBXA 3KZWA 3BI0A 2ZEMA 4FAIA 2V77A 3KHZA 3N5FA 4C9AA 4NGPA 4OIWA 4EWTA 3BI1A 3NFZA 4NGRA 2AFUA 4OC0A 4C9RA 3IO1A 1CPXA 2F8HA 3PB7X 4TJXA 3KASA 1KWMA 1IGBA 4OC5A 1YSJA 2O4HA 4R7MA 2ZEFA 4G1PA 2AFWA 4YWYA 5LYFA 3FEEA 2C6GA 3IC1A 4OIDA 5DS0A 2FVGA 4NJQA 1YW6A 4KSIA 1Y0RA 2Q51A 1CG2A 3LWUA 4R8FA 1VHEA 4P44A 4OMEA 1YLOA 1DTDA 4MHPA 1HDUA 4PXBA 4PQAA 4WJBA 3KR5A 1TXRA 5LYLA 3HLPA 1Z5RA 2AFOA 3DGVA 1VGYA 3ISZA 4X2TA 4B6ZA 4OC1A 2HB6A 2QVPA 3B3TA 3I1UA 2CF4A 4MCSA 1OBRA 4P4FA 5HVHA 2PE3A 5K8NA 4O23A 4P6YA 2PJ2A 2ABZA 4YU9A 4WWVA 3CPAA 5HVFA 3IFEA 4UIAA 1M4LA 1ZLIA 2V8GA 2QJ8A 3KGQA 1NSAA 1FNOA 1XF1A 1CPSA 4C85A 1LAPA 8CPAA 1Y9ZA 3FF3A 2XEGA 1ARLA 3PBEA 5F09A 4RUHA 3PEIA 3RZAA 2ZEGA 3PFOA 5D29A 4BD9A 2PJ4A 1QQ9A 3H8GA 2PJ3A 2PJ8A 1YW4A 1BLLE 4P45A 2IQ6A 3ICUA 3H8FA 3VATA 1AYEA 4OC4A 1LCPA 3FJUA 5K8PA 3CT9A 3SI1A 4UEEA 3B3VA 4NGSA 2BOAA 1Q7LA 4A38A 1ZG8A 2ZENA 4FUUA 3GLJA 4MCQA 4ZY2A 1FT7A 1Y7EA 4MHNA 4C8CA 2PJBA 4C86A 3PFEA 2OOTA 3PBBA 3GB0A 2PJ7A 3K9TA 1BAVA 1XRYA 5I4MA 5LRKA 1BPNA 1LOKA 3D7HA 3WC6A 3NH8A 4CPAA 4C8FA 3S9LA 4JYWA 2C6CA 3K2KA 4ZI6A 2BCOA 4F8ZA 1XJOA 1ZLHA 2F7VA 2ZOFA 2PVWA 1XMBA 3WABA 1WVMA 3CPXA 1Z8LA 2RFHA 1Z2LA 1VIXA 4IK2A 4ZY0A 3PB9X 1F57A 3EIFA 1JQGA 3NA6A 1Y0YA 4F9VA 4NFRA 4ZX8A 3H8EA 1F2PA 4R76A 5D8NA 4C9UA 4X3RA 1XBUA 4EFDA 4W9YA 2BO9A 2C6PA 3B3SA 4LQGA 2ZEOA 3DLJA 1LAMA 4P4BA 5HXDA 3KR4A 3RBUA 3FX6A 2POKA 2DEAA 1XFOA 4NGQA
chains in the Genus database with same CATH superfamily
5F47A 5JYBA 2EBJA 2ANPA 2KCWA 3T0TA 3TO7A 4CRZB 2RB7A 1ZG7A 2Z10A 3RO0A 2G0BA 4FD5A 5F13A 3VGOA 3D7FA 3GUXA 2PR8A 3SJFA 2AFXA 4MFQA 5LRJA 3SI0A 4C84A 1Y9WA 4KNGE 2ZXVA 3D67A 3R96A 2A4NA 2PJCA 4AVAA 1KEEB 2XPLA 3EC4A 4MHYA 3S6HA 3WC5A 4UEFA 3W6SA 5IX3A 3U1BA 2PJ1A 3E0KA 2NYQA 2EWBA 3L2NA 2B4JC 1PU9A 2EK8A 5ELYA 2B58A 2BUEA 2QECA 3IJ3A 2Q43A 4PXDA 4H1HA 4M8DA 2Z3KA 4A2ZA 5LRGA 3FEDA 2QYVA 1V0CA 4OKOA 1VHOA 5JVLA 2O53A 4P4JA 2XPOA 1XIXA 1MJ9A 4YN3A 2YJTA 4CDJA 2VBQA 4HKFA 5G22A 3EY5A 1QSRA 5AG6A 3NH4A 5THWA 5IB9A 4UA3A 2WZNA 1VHSA 3ZZIA 3H5ZA 1U6MA 3GY9A 4FBEA 3B7IA 1NBWA 2OR4A 5C88A 4UFWA 1JDEA 4OC2A 4EVYA 2EZCA 3I74A 2ZEDA 1GGOA 4F0YA 2IJZA 4INJA 2C27A 3PB8X 2EZAA 1CE8B 4AB7A 1P4NA 2DIKA 2JDDA 4MXUA 4JZ0A 4A32A 1HEEA 4FD4A 4QC6A 1TKJA 4CGPA 3HPHE 2FM4A 1XOVA 4B5OA 3D7DA 2ZELA 4KOWA 1TKFA 1VBHA 5JGFA 4NJRA 3KI9A 1N71A 3CXQA 1FBVA 2OH1A 2PSWA 4EMEA 5EBVA 5HMNA 1AUGA 3B35A 3G3SA 4Q38A 1R3NA 2H5MA 1MJAA 1Q2CA 5BY0A 2CXAA 4Y49C 1ZRSA 3QNVA 4C8PA 1QMUA 2FIWA 2WYRA 3KHXA 2HWGA 4H2KA 2WUUA 5F1YA 3ZNIA 4H89A 3VTAA 2FIAA 2Z3MA 4IHMA 3RNZA 1BPMA 3FB3A 1J3LA 1Z4RA 1RTQA 2PRBA 3FYNA 4ZY1A 5LYIA 1GYTA 2P6FA 1TIQA 2JEWA 4JXQA 4KOXA 4UEZA 1CS0B 1GHEA 5KTCA 4A4BA 3SXNA 3D3SA 4ZYQA 1YVOA 1V6CA 2X0SA 2AFMA 3D8PA 3JRUA 4QUSA 1PYTB 4CGNA 5H86A 3DR6A 1ELLP 2D4OA 4P4EA 3V38A 4CAVA 4ONUA 1AMPA 3EZBA 4ZBGA 3NFQA 3IU2A 3KQXA 2Q4ZA 4IF5A 1YMEA 4MFZA 4ORFA 4AVCA 4A39A 1CX8A 4JJXA 5JM6A 4BTFA 5CPAA 2GIVA 1ARMA 4HNXB 1YREA 5JH9A 1KZFA 4MHZA 4MFKA 4B13A 2OLSA 1CP7A 4A95A 4DUKA 1UWYA 4MBUA 1M4IA 3PB6X 5JQ4A 1VBGA 3T9YA 4MHDA 4CO9A 3F8KA 4B5PA 1IU8A 1ZYMA 4CGOA 4MJXA 3SI2A 5FD8A 2XPPA 2ZPAA 2R1IA 4BPUB 2ZEHA 2PR1A 4KS9A 2PVVA 3ISXA 5A27A 2DLAA 4ZX9A 1YX0A 3PT1A 4FWUA 4C2XA 4K30A 1TKHA 3IIBA 2X7BA 2PJ5A 5AG5A 3TFYA 4U9YA 2HROA 1S60A 4KOVA 4B14A 4QBJA 4MY3A 4JD6A 4E94A 2PJAA 5IB0A 1EE3P 2VEZA 1TF9A 3OP0A 1IB1E 2OZGA 1TF8A 1Q2YA 4L89A 4CAWA 2YNCC 3FECA 4CAXA 3IU1A 3WC7A 3P2HA 4YFJA 5K8OA 3FRMA 4M6HA 4B12A 3RYOA 1IICA 2GLFA 1QSNA 3VH9A 4R87A 1B47A 2J8NA 3T90A 4BBHA 4Q7AA 3GKRA 5F5XA 2HI6A 5HKWA 2QMLA 2ZEEA 1YVKA 4XPLA 5G21A 3OAKA 3B3WA 3NE8A 5CBMA 2PJ6A 4COBA 2XEFA 3SHPA 3HUVA 5HVGA 4C9EA 3CZXA 3KQZA 2FS5A 4ONWA 1YVHA 3R95A 3BLNA 1M4GA 1OZPA 4C7IA 2VZZA 4DJLA 2Q0YA 2CNMA 4HNYB 5IR2A 2YNEA 2HQYA 2V8DA 4RI1A 2GE3A 3VRRA 3SJXA 3SJEA 6CPAA 2R82A 4TJVA 2FL4A 4CZ1A 1EO0A 1CM0A 4U9ZA 3D66A 1Z8WA 2NMTA 3S6FA 3VRNA 4M85A 3VARA 4C99A 2B5GA 5ISVA 4PXCA 3S9NA 2AFSA 2V8VA 1Z9UA 1P0HA 3D4UA 4MCRA 5EMIA 4CGLA 3TCVA 2PIZA 2Z11A 4KLWA 4A33A 3TLEA 3C8OA 4IAVA 2CIJA 3TOBA 2EK9A 3BHXA 3B3CA 3I9SA 1S7FA 2R7HA 3TX8A 4KVOE 2GANA 2FT0A 4PXEA 4E0AA 2WPXA 4C9VA 1BOBA 5HKYA 4CGMA 4BPXB 1UFHA 4MFLA 1LFWA 1L0CA 1PCAA 3I3GA 5AXIA 4MRIA 1B6BA 3HPGG 2PJ0A 4KVME 3TC8A 4C7HA 2DPSA 2N3AB 4A94A 1JDBC 4A30A 2B0AA 3T8WA 3KRVA 3IWEA 1CP6A 4R6TA 3FMCA 2PQ8A 3I6SA 1IYKA 3G8WA 3S9MA 3TLCA 3U88C 3FVLA 3FH4A 4DNCA 5F49A 2GP4A 2D0OA 1SQHA 4ZGYB 2J9AA 4KSAA 2FE7A 2PCUA 4PPZA 1X12A 4KUBA 1VI4A 1Z9EA 4OC3A 2G9DA 1H8LA 3NH5A 3BXMA 1YR0A 2BSWA 2CTBA 2JLMA 1S7NA 2G3AA 3IEHA 3WT4A 1A9XB 1NSLA 4UFXA 4CYQA 4P10A 3PRTA 2V8HA 1ON0A 3N7ZA 4X8IA 4TWEA 3CXPA 2I3CA 2RC4A 1QSTA 1Y9KA 2GU2A 3SR3A 4C2ZA 2PRQA 2VL1A 4UWJA 1M44A 2DXQA 3PLFB 1LANA 4C8UA 4GM5A 2EVNA 2HV2A 2XEJA 2NSMA 3D68A 3MRUA 4KZTA 4MI1A 1ELMP 2IMOA 1YK3A 4YGOA 4B5PB 4KOSA 4CDKA 1KUYA 4OP4A 4M3SA 2OU2A 2J8RA 1EZBA 2PIYA 1M1DA 2CTCA 1PUAA 4P4IA 2AFZA 4F0XA 2D0PA 3PB4X 3UY5A 7CPAA 3WR7A 2R98A 3LMSA 1KBLA 1ZO0A 3RAMA 1WWZA 4F9UA 5LYDA 4DYOA 3OB2B 3BUMB 4E5SA 2DPTA 2ODFA 5I0CA 2GLJA 1IOIA 2C1CA 2FCKA 2YGWA 3C26A 3CDXA 3LODA 4OLLA 3IWWA 4UF4A 2PJ9A 4NGNA 4YRHA 1R43A 4AXVA 1HDQA 4A37A 4P4DA 4C8AA 3BUXB 2ZOGA 4Z65A 3MN8A 4IIYA 2HC9A 2JBJA 4COGA 4TNUA 3W91A 5K8MA 1Q5XA 1F2OA 1ZG9A 1C3OB 3V7ZA 4PSWA 2ATRA 4XPKA 4AG7A 2P6EA 1YLEA 3F5BA 2JBKA 1QSMA 3TYXA 3DDDA 3PGPA 2IL4A 4FD6A 3TTHA 2ZEPA 2Q4VA 4CYNA 3D7GA 2MP0A 2D4PA 5J1QA 3KL9A 4MCPA 4K3NA 4NGTA 4MMOA 1DE4C 1Z8TA 3B2YA 3B8GA 4B11A 1RXTA 2Q4YA 3FIXA 4H6ZA 2YNCA 3JVNA 4UIBA 1C30B 4C8TA 2Y1NA 3R1KA 3T5MA 3TLGA 2B5GB 3TLZA 2CBLA 2GREA 1IY7A 2XEIA 4OADA 2XPNA 1K4JA 4BMHA 3KKWA 5HKZA 1FY7A 4NGMA 2AUMA 3SJGA 1CBXA 4A31A 1X10A 1NMTA 3KZWA 5E96A 4LX9A 3P2FA 3BI0A 4JVOA 3JUWA 4KOTA 2ZEMA 4FAIA 2V77A 3KHZA 3N5FA 5IV0A 4C9AA 4CYPA 4NGPA 4BINA 4OIWA 1Q2DA 2EUIA 4GXHA 4J3GA 4EWTA 3BI1A 2VI7A 4JXRA 4MY0A 4UFVA 3NFZA 4NGRA 2ZW6A 2AFUA 4CAEA 2F5IA 3IWGA 4MFPA 4PSXA 3TOAA 5AGEA 4OC0A 5DWNA 3ZJ0A 3TE4A 4PV6A 4C9RA 3IO1A 1CPXA 2F8HA 4UCNA 3PB7X 4CS0B 4TJXA 1MK4A 3T07A 3KASA 1KWMA 3LACA 1BXRB 4FD7A 1IGBA 5J8FA 4KOYA 4OC5A 1J4JA 1IIDA 1YSJA 1B87A 2O4HA 4R7MA 2ZEFA 1R61A 3BUOB 4G1PA 2OZHA 2AFWA 3OWCA 1QSOA 4YWYA 3D2MA 1YQEA 2VXKA 1XF8A 3FEEA 2C6GA 5LYFA 3K4IA 2UV8G 1MJBA 1M4DA 1A2ZA 4Y49B 5G1ZA 3IC1A 4OIDA 2PC1A 5DS0A 3G23A 3QB8A 4KVXA 4NSQA 3HMJG 4GS4A 3SXOA 2FVGA 4M6IA 1R57A 4X5KA 3TLAA 2I79A 4H6UA 4NJQA 1YW6A 3NOJA 4LQ6A 2EZBA 3D2PA 5DWMA 4KSIA 3R9GA 1Y0RA 2Q51A 1CG2A 3CXSA 2I00A 3LWUA 3VROA 4R8FA 1VHEA 1S7LA 2ZW4A 4P44A 4OMEA 1YLOA 3A9LA 4RS2A 1DTDA 4XNHC 3QAHA 4AG9A 1WJTA 4MHPA 1HDUA 4PXBA 2Q04A 4PQAA 3TO6A 4WJBA 3KR5A 3TO9A 1TXRA 5J8CA 4E2AA 1I21A 2YNDA 1KUXA 5LYLA 3HLPA 1Z5RA 2AFOA 2OB0A 3DGVA 1VGYA 3ISZA 5J3XA 4KUAA 4MFJA 4X2TA 4B6ZA 4OC1A 3R9FA 1IYLA 4UBRA 1CJWA 2HB6A 4L8AA 4KLVA 2QVPA 3B3TA 2BEIA 5C82A 5BWAB 4NXYA 3I1UA 4CYOA 3R9EA 2E28A 3F9KC 2CF4A 4MCSA 1JWQA 4RN7A 1OBRA 5H84A 4P4FA 4IUSA 4M6GA 2Q44A 2PE3A 5HVHA 5K8NA 4O23A 5KTAA 4P6YA 2B4DA 2PJ2A 5F48A 2ABZA 4BPWB 2J8MA 4WWVA 4YU9A 3CPAA 2VQYA 5HVFA 3IFEA 4UIAA 4RR2B 1M4LA 3S6GA 3TLGB 1ZLIA 4UWIA 3FNCA 3LD2A 1DIKA 2ARHA 2V8GA 2QJ8A 5G20A 3KGQA 4R3LA 3V8IA 1NSAA 1FNOA 2PDOA 1XF1A 2B4BA 1CPSA 4C85A 1LAPA 3DSBA 1NE9A 2B3UA 1I1DA 8CPAA 5JPHA 3F0AA 2Z3OA 1Y9ZA 2OZUA 3K9UA 2BL1A 2AE6A 3FF3A 5F9MA 2XEGA 3O8ZA 3VWDA 1ARLA 3PBEA 2CNSA 3GYAA 5AG4A 4QB9A 5F09A 4RUHA 4R57A 3PEIA 4C68A 3BJ7A 3FXTA 3RZAA 2ZEGA 3PP9A 5EC4A 2Y1MA 2Z3PA 3PFOA 4PK2A 4E8OA 5D29A 4BD9A 2WSAA 2PJ4A 4XPDC 2PCNA 1QQ9A 3EZEA 3H8GA 5F46A 2PJ3A 2PJ8A 2REEA 2Q7BA 1YW4A 1BLLE 3EFAA 4P45A 2IQ6A 2HUZA 1S3ZA 3H8FA 3ICUA 3VATA 3DR8A 4GPLB 4I49A 1AYEA 1RO5A 4OC4A 1LCPA 3FJUA 4NF1A 5K8PA 5HH1A 3CT9A 1KC7A 4PK3A 3IGRA 3SI1A 2Z3NA 2VZYA 1YGHA 4F6AA 3VRPA 3GIUA 4R3KA 1M6VB 4UEEA 1S5KA 1T36B 2CNTA 3B3VA 4KSFA 2AJ6A 1Z4EA 4NGSA 2BOAA 4MJ8A 1KUVA 1Q7LA 2QIRA 5A28A 2VKZG 5K99A 4A38A 2FXFA 4A4CA 4XNHB 1ZG8A 2ZENA 1VKCA 2REFA 4EYSA 4FUUA 3GLJA 4MCQA 4ZY2A 1FT7A 1Y7EA 4MHNA 4C8CA 1Y7RA 2DF5A 2PJBA 5FVJA 1I12A 2B3VA 2P6GA 4C86A 1XE4A 3MGDA 1XMTA 3PFEA 4CRYB 2OOTA 3PBBA 4NCZA 2JDCA 3GB0A 3S6KA 1BO4A 3H4QA 4B10A 5KTDA 2PJ7A 3K9TA 1BAVA 1XRYA 4U5YA 3VWEA 5I4MA 5LRKA 2YJVA 2P0WA 2Y0MA 1Z8XA 1BPNA 2R8VA 1LOKA 3D7HA 3JTKA 3WC6A 3TLBA 3NH8A 4KORA 1WK4A 4CPAA 2G3TA 2ZW7A 3GJZA 4C8FA 3S9LA 2FSRA 4UCPA 4JYWA 3TLYA 2C6CA 3K2KA 3VRQA 4ZI6A 2BCOA 4F8ZA 4JWPA 1XJOA 1ZLHA 2Z3LA 2GFQA 2F7VA 2ZOFA 2PVWA 1XMBA 3EXNA 4C2YA 2ZW5A 2Z0ZA 3WABA 2O28A 3BUNB 3CPXA 1Z8LA 1WVMA 2RFHA 1Z2LA 4NEXA 4QVTA 1VIXA 4CAFA 2K5TA 4IIXA 4IK2A 4HNWB 4ZY0A 3PB9X 1F57A 2EO8A 5AG7A 1IOFA 1S7KA 1JQGA 3EIFA 3EO4A 5GCNA 2JEVA 1LRZA 3NA6A 4OAEA 1Y0YA 4F9VA 1ZL0A 2AUNA 2Q7SA 4NFRA 5CNPA 3EZAA 4ZX8A 3H8EA 1EZAA 1F2PA 2B4DB 3OB1B 4R76A 1NXJA 3T05A 5D8NA 2C5QA 4X3RA 4C9UA 4HPSA 4II9A 1XBUA 4EFDA 3NE7A 4W9YA 2BO9A 2C6PA 4UCMA 4J0NA 3B3SA 3DNSA 4MI4A 3BJ8A 4LQGA 4XPDB 1XEBA 2ZEOA 3DLJA 4LUAA 3TT2A 3PZJA 1LAMA 4Q36A 4P4BA 4R9MA 3BUWB 3PFVA 3RBUA 3KR4A 3QAYA 4JLYA 3W6XA 5HXDA 3FBUA 3FX6A 2CY2A 4KOUA 2POKA 4AVBA 2DEAA 1XFOA 4NGQA 2WPWA
chains in the Genus database with same CATH topology
2ANPA 2RB7A 1ZG7A 3GUXA 3D7FA 5LRJA 3SI0A 3SJFA 2AFXA 4C84A 4KNGE 3D67A 2PJCA 4MHYA 3WC5A 4UEFA 2PJ1A 2NYQA 2EWBA 3L2NA 2EK8A 5ELYA 4PXDA 3IJ3A 2Q43A 5LRGA 3FEDA 2QYVA 4OKOA 1VHOA 2O53A 4P4JA 4YN3A 4CDJA 5THWA 5IB9A 3NH4A 2WZNA 4FBEA 3B7IA 2OR4A 4OC2A 3I74A 2ZEDA 2IJZA 3PB8X 4MXUA 4JZ0A 1HEEA 1TKJA 3D7DA 2ZELA 1TKFA 5JGFA 4NJRA 3KI9A 4EMEA 3B35A 1R3NA 4C8PA 3QNVA 1QMUA 2WYRA 3KHXA 4H2KA 3VTAA 4IHMA 1BPMA 1RTQA 4ZY1A 5LYIA 1GYTA 2JEWA 4UEZA 4ZYQA 1V6CA 2AFMA 3JRUA 1PYTB 1ELLP 3V38A 4P4EA 1AMPA 3KQXA 2Q4ZA 5JM6A 1YMEA 4A39A 1CX8A 5CPAA 5JH9A 1ARMA 4MHZA 1CP7A 4DUKA 1UWYA 3PB6X 3SI2A 2ZEHA 2PVVA 3ISXA 4ZX9A 4FWUA 1TKHA 3IIBA 2PJ5A 2PJAA 1EE3P 1TF9A 1TF8A 3FECA 3WC7A 5K8OA 2GLFA 3VH9A 4Q7AA 2ZEEA 3B3WA 5CBMA 2PJ6A 2XEFA 5HVGA 3HUVA 4C9EA 3KQZA 4ONWA 4DJLA 5IR2A 2V8DA 3SJXA 3SJEA 6CPAA 4TJVA 3D66A 3VARA 4C99A 4PXCA 3S9NA 2AFSA 2V8VA 3D4UA 4MCRA 2PIZA 4IAVA 2CIJA 2EK9A 3BHXA 3B3CA 3TX8A 4PXEA 4C9VA 1LFWA 1PCAA 4MRIA 2PJ0A 3TC8A 4A94A 3T8WA 1CP6A 4R6TA 3FMCA 3I6SA 3S9MA 3FVLA 3FH4A 2GP4A 2J9AA 2PCUA 4PPZA 3NH5A 4OC3A 1H8LA 2G9DA 3BXMA 3IEHA 2CTBA 3WT4A 4P10A 3PRTA 2V8HA 4X8IA 4TWEA 2I3CA 2GU2A 2PRQA 2VL1A 1LANA 4C8UA 4GM5A 2XEJA 2NSMA 3D68A 3MRUA 1ELMP 2IMOA 4CDKA 4OP4A 2PIYA 2CTCA 2AFZA 4P4IA 3PB4X 7CPAA 3LMSA 3RAMA 4F9UA 5LYDA 4DYOA 2GLJA 2C1CA 3CDXA 3IWWA 4UF4A 2PJ9A 4NGNA 1R43A 4AXVA 1HDQA 4A37A 4P4DA 4C8AA 2ZOGA 4Z65A 3MN8A 2HC9A 2JBJA 4TNUA 5K8MA 1F2OA 1ZG9A 3V7ZA 2JBKA 2ZEPA 3D7GA 5J1QA 3KL9A 4MCPA 4K3NA 4NGTA 4MMOA 1DE4C 3B2YA 4UIBA 4C8TA 2GREA 1IY7A 2XEIA 4NGMA 3SJGA 1CBXA 3KZWA 3BI0A 2ZEMA 4FAIA 2V77A 3KHZA 3N5FA 4C9AA 4NGPA 4OIWA 4EWTA 3BI1A 3NFZA 4NGRA 2AFUA 4OC0A 4C9RA 3IO1A 1CPXA 2F8HA 3PB7X 4TJXA 3KASA 1KWMA 1IGBA 4OC5A 1YSJA 2O4HA 4R7MA 2ZEFA 4G1PA 2AFWA 4YWYA 5LYFA 3FEEA 2C6GA 3IC1A 4OIDA 5DS0A 2FVGA 4NJQA 1YW6A 4KSIA 1Y0RA 2Q51A 1CG2A 3LWUA 4R8FA 1VHEA 4P44A 4OMEA 1YLOA 1DTDA 4MHPA 1HDUA 4PXBA 4PQAA 4WJBA 3KR5A 1TXRA 5LYLA 3HLPA 1Z5RA 2AFOA 3DGVA 1VGYA 3ISZA 4X2TA 4B6ZA 4OC1A 2HB6A 2QVPA 3B3TA 3I1UA 2CF4A 4MCSA 1OBRA 4P4FA 5HVHA 2PE3A 5K8NA 4O23A 4P6YA 2PJ2A 2ABZA 4YU9A 4WWVA 3CPAA 5HVFA 3IFEA 4UIAA 1M4LA 1ZLIA 2V8GA 2QJ8A 3KGQA 1NSAA 1FNOA 1XF1A 1CPSA 4C85A 1LAPA 8CPAA 1Y9ZA 3FF3A 2XEGA 1ARLA 3PBEA 5F09A 4RUHA 3PEIA 3RZAA 2ZEGA 3PFOA 5D29A 4BD9A 2PJ4A 1QQ9A 3H8GA 2PJ3A 2PJ8A 1YW4A 1BLLE 4P45A 2IQ6A 3ICUA 3H8FA 3VATA 1AYEA 4OC4A 1LCPA 3FJUA 5K8PA 3CT9A 3SI1A 4UEEA 3B3VA 4NGSA 2BOAA 1Q7LA 4A38A 1ZG8A 2ZENA 4FUUA 3GLJA 4MCQA 4ZY2A 1FT7A 1Y7EA 4MHNA 4C8CA 2PJBA 4C86A 3PFEA 2OOTA 3PBBA 3GB0A 2PJ7A 3K9TA 1BAVA 1XRYA 5I4MA 5LRKA 1BPNA 1LOKA 3D7HA 3WC6A 3NH8A 4CPAA 4C8FA 3S9LA 4JYWA 2C6CA 3K2KA 4ZI6A 2BCOA 4F8ZA 1XJOA 1ZLHA 2F7VA 2ZOFA 2PVWA 1XMBA 3WABA 1WVMA 3CPXA 1Z8LA 2RFHA 1Z2LA 1VIXA 4IK2A 4ZY0A 3PB9X 1F57A 3EIFA 1JQGA 3NA6A 1Y0YA 4F9VA 4NFRA 4ZX8A 3H8EA 1F2PA 4R76A 5D8NA 2C5QA 4X3RA 4C9UA 1XBUA 4EFDA 4W9YA 2BO9A 2C6PA 3B3SA 4LQGA 2ZEOA 3DLJA 1LAMA 4P4BA 5HXDA 3KR4A 3RBUA 3FX6A 2POKA 2DEAA 1XFOA 4NGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ANP A;  2RB7 A;  1ZG7 A;  3GUX A;  3D7F A;  5LRJ A;  3SI0 A;  3SJF A;  2AFX A;  4C84 A;  4KNG E;  3D67 A;  2PJC A;  4MHY A;  3WC5 A;  4UEF A;  2PJ1 A;  2NYQ A;  2EWB A;  3L2N A;  2EK8 A;  5ELY A;  4PXD A;  3IJ3 A;  2Q43 A;  5LRG A;  3FED A;  2QYV A;  4OKO A;  1VHO A;  2O53 A;  4P4J A;  4YN3 A;  4CDJ A;  5THW A;  5IB9 A;  3NH4 A;  2WZN A;  4FBE A;  3B7I A;  2OR4 A;  4OC2 A;  3I74 A;  2ZED A;  2IJZ A;  3PB8 X;  4MXU A;  4JZ0 A;  1HEE A;  1TKJ A;  3D7D A;  2ZEL A;  1TKF A;  5JGF A;  4NJR A;  3KI9 A;  4EME A;  3B35 A;  1R3N A;  4C8P A;  3QNV A;  1QMU A;  2WYR A;  3KHX A;  4H2K A;  3VTA A;  4IHM A;  1BPM A;  1RTQ A;  4ZY1 A;  5LYI A;  1GYT A;  2JEW A;  4UEZ A;  4ZYQ A;  1V6C A;  2AFM A;  3JRU A;  1PYT B;  1ELL P;  3V38 A;  4P4E A;  1AMP A;  3KQX A;  2Q4Z A;  5JM6 A;  1YME A;  4A39 A;  1CX8 A;  5CPA A;  5JH9 A;  1ARM A;  4MHZ A;  1CP7 A;  4DUK A;  1UWY A;  3PB6 X;  3SI2 A;  2ZEH A;  2PVV A;  3ISX A;  4ZX9 A;  4FWU A;  1TKH A;  3IIB A;  2PJ5 A;  2PJA A;  1EE3 P;  1TF9 A;  1TF8 A;  3FEC A;  3WC7 A;  5K8O A;  2GLF A;  3VH9 A;  4Q7A A;  2ZEE A;  3B3W A;  5CBM A;  2PJ6 A;  2XEF A;  5HVG A;  3HUV A;  4C9E A;  3KQZ A;  4ONW A;  4DJL A;  2V8D A;  3SJX A;  3SJE A;  6CPA A;  4TJV A;  3D66 A;  3VAR A;  4C99 A;  4PXC A;  3S9N A;  2AFS A;  2V8V A;  3D4U A;  4MCR A;  2PIZ A;  4IAV A;  2CIJ A;  2EK9 A;  3BHX A;  3B3C A;  3TX8 A;  4PXE A;  4C9V A;  1LFW A;  1PCA A;  4MRI A;  2PJ0 A;  3TC8 A;  4A94 A;  3T8W A;  1CP6 A;  4R6T A;  3FMC A;  3I6S A;  3S9M A;  3FVL A;  3FH4 A;  2J9A A;  2PCU A;  4PPZ A;  3NH5 A;  4OC3 A;  1H8L A;  2G9D A;  3BXM A;  3IEH A;  2CTB A;  3WT4 A;  4P10 A;  3PRT A;  2V8H A;  4X8I A;  4TWE A;  2I3C A;  2GU2 A;  2PRQ A;  2VL1 A;  1LAN A;  4C8U A;  4GM5 A;  2XEJ A;  2NSM A;  3D68 A;  3MRU A;  1ELM P;  2IMO A;  4CDK A;  4OP4 A;  2PIY A;  2CTC A;  2AFZ A;  4P4I A;  3PB4 X;  7CPA A;  3LMS A;  3RAM A;  4F9U A;  5LYD A;  4DYO A;  2GLJ A;  2C1C A;  3CDX A;  3IWW A;  4UF4 A;  2PJ9 A;  4NGN A;  1R43 A;  4AXV A;  1HDQ A;  4A37 A;  4P4D A;  4C8A A;  2ZOG A;  4Z65 A;  3MN8 A;  2HC9 A;  2JBJ A;  4TNU A;  5K8M A;  1F2O A;  1ZG9 A;  3V7Z A;  2JBK A;  2ZEP A;  3D7G A;  5J1Q A;  3KL9 A;  4MCP A;  4K3N A;  4NGT A;  4MMO A;  1DE4 C;  3B2Y A;  4UIB A;  4C8T A;  2GRE A;  1IY7 A;  2XEI A;  4NGM A;  3SJG A;  1CBX A;  3KZW A;  3BI0 A;  2ZEM A;  4FAI A;  2V77 A;  3KHZ A;  3N5F A;  4C9A A;  4NGP A;  4OIW A;  4EWT A;  3BI1 A;  3NFZ A;  4NGR A;  2AFU A;  4OC0 A;  4C9R A;  3IO1 A;  1CPX A;  2F8H A;  3PB7 X;  4TJX A;  3KAS A;  1KWM A;  1IGB A;  4OC5 A;  1YSJ A;  2O4H A;  4R7M A;  2ZEF A;  4G1P A;  2AFW A;  4YWY A;  5LYF A;  3FEE A;  2C6G A;  3IC1 A;  4OID A;  5DS0 A;  2FVG A;  4NJQ A;  1YW6 A;  4KSI A;  1Y0R A;  2Q51 A;  1CG2 A;  3LWU A;  4R8F A;  1VHE A;  4P44 A;  4OME A;  1YLO A;  1DTD A;  4MHP A;  1HDU A;  4PXB A;  4PQA A;  4WJB A;  3KR5 A;  1TXR A;  5LYL A;  3HLP A;  1Z5R A;  2AFO A;  3DGV A;  1VGY A;  3ISZ A;  4X2T A;  4B6Z A;  4OC1 A;  2HB6 A;  2QVP A;  3B3T A;  3I1U A;  2CF4 A;  4MCS A;  1OBR A;  4P4F A;  5HVH A;  2PE3 A;  5K8N A;  4O23 A;  4P6Y A;  2PJ2 A;  2ABZ A;  4YU9 A;  4WWV A;  3CPA A;  5HVF A;  3IFE A;  4UIA A;  1M4L A;  1ZLI A;  2V8G A;  2QJ8 A;  3KGQ A;  1NSA A;  1FNO A;  1XF1 A;  1CPS A;  4C85 A;  1LAP A;  8CPA A;  1Y9Z A;  3FF3 A;  2XEG A;  1ARL A;  3PBE A;  5F09 A;  4RUH A;  3PEI A;  3RZA A;  2ZEG A;  3PFO A;  5D29 A;  4BD9 A;  2PJ4 A;  1QQ9 A;  3H8G A;  2PJ3 A;  2PJ8 A;  1YW4 A;  1BLL E;  4P45 A;  2IQ6 A;  3ICU A;  3H8F A;  3VAT A;  1AYE A;  4OC4 A;  1LCP A;  3FJU A;  5K8P A;  3CT9 A;  3SI1 A;  4UEE A;  3B3V A;  4NGS A;  2BOA A;  1Q7L A;  4A38 A;  1ZG8 A;  2ZEN A;  4FUU A;  3GLJ A;  4MCQ A;  4ZY2 A;  1FT7 A;  1Y7E A;  4MHN A;  4C8C A;  2PJB A;  4C86 A;  3PFE A;  2OOT A;  3PBB A;  3GB0 A;  2PJ7 A;  3K9T A;  1BAV A;  1XRY A;  5I4M A;  5LRK A;  1BPN A;  1LOK A;  3D7H A;  3WC6 A;  3NH8 A;  4CPA A;  4C8F A;  3S9L A;  4JYW A;  2C6C A;  3K2K A;  4ZI6 A;  2BCO A;  4F8Z A;  1XJO A;  1ZLH A;  2F7V A;  2ZOF A;  2PVW A;  1XMB A;  3WAB A;  1WVM A;  3CPX A;  1Z8L A;  2RFH A;  1Z2L A;  1VIX A;  4IK2 A;  4ZY0 A;  3PB9 X;  1F57 A;  3EIF A;  1JQG A;  3NA6 A;  1Y0Y A;  4F9V A;  4NFR A;  4ZX8 A;  3H8E A;  1F2P A;  4R76 A;  5D8N A;  4C9U A;  4X3R A;  1XBU A;  4EFD A;  4W9Y A;  2BO9 A;  2C6P A;  3B3S A;  4LQG A;  2ZEO A;  3DLJ A;  1LAM A;  4P4B A;  5HXD A;  3KR4 A;  3RBU A;  3FX6 A;  2POK A;  2DEA A;  1XFO A;  4NGQ A; 
#chains in the Genus database with same CATH topology
 5F47 A;  5JYB A;  2EBJ A;  2ANP A;  2KCW A;  3T0T A;  3TO7 A;  4CRZ B;  2RB7 A;  1ZG7 A;  2Z10 A;  3RO0 A;  2G0B A;  4FD5 A;  5F13 A;  3VGO A;  3D7F A;  3GUX A;  2PR8 A;  3SJF A;  2AFX A;  4MFQ A;  5LRJ A;  3SI0 A;  4C84 A;  1Y9W A;  4KNG E;  2ZXV A;  3D67 A;  3R96 A;  2A4N A;  2PJC A;  4AVA A;  1KEE B;  2XPL A;  3EC4 A;  4MHY A;  3S6H A;  3WC5 A;  4UEF A;  3W6S A;  5IX3 A;  3U1B A;  2PJ1 A;  3E0K A;  2NYQ A;  2EWB A;  3L2N A;  2B4J C;  1PU9 A;  2EK8 A;  5ELY A;  2B58 A;  2BUE A;  2QEC A;  3IJ3 A;  2Q43 A;  4PXD A;  4H1H A;  4M8D A;  2Z3K A;  4A2Z A;  5LRG A;  3FED A;  2QYV A;  1V0C A;  4OKO A;  1VHO A;  5JVL A;  2O53 A;  4P4J A;  2XPO A;  1XIX A;  1MJ9 A;  4YN3 A;  2YJT A;  4CDJ A;  2VBQ A;  4HKF A;  5G22 A;  3EY5 A;  1QSR A;  5AG6 A;  3NH4 A;  5THW A;  5IB9 A;  4UA3 A;  2WZN A;  1VHS A;  3ZZI A;  3H5Z A;  1U6M A;  3GY9 A;  4FBE A;  3B7I A;  1NBW A;  2OR4 A;  5C88 A;  4UFW A;  1JDE A;  4OC2 A;  4EVY A;  2EZC A;  3I74 A;  2ZED A;  1GGO A;  4F0Y A;  2IJZ A;  4INJ A;  2C27 A;  3PB8 X;  2EZA A;  1CE8 B;  4AB7 A;  1P4N A;  2DIK A;  2JDD A;  4MXU A;  4JZ0 A;  4A32 A;  1HEE A;  4FD4 A;  4QC6 A;  1TKJ A;  4CGP A;  3HPH E;  2FM4 A;  1XOV A;  4B5O A;  3D7D A;  2ZEL A;  4KOW A;  1TKF A;  1VBH A;  5JGF A;  4NJR A;  3KI9 A;  1N71 A;  3CXQ A;  1FBV A;  2OH1 A;  2PSW A;  4EME A;  5EBV A;  5HMN A;  1AUG A;  3B35 A;  3G3S A;  4Q38 A;  1R3N A;  2H5M A;  1MJA A;  1Q2C A;  5BY0 A;  2CXA A;  4Y49 C;  1ZRS A;  3QNV A;  4C8P A;  1QMU A;  2FIW A;  2WYR A;  3KHX A;  2HWG A;  4H2K A;  2WUU A;  5F1Y A;  3ZNI A;  4H89 A;  3VTA A;  2FIA A;  2Z3M A;  4IHM A;  3RNZ A;  1BPM A;  3FB3 A;  1J3L A;  1Z4R A;  1RTQ A;  2PRB A;  3FYN A;  4ZY1 A;  5LYI A;  1GYT A;  2P6F A;  1TIQ A;  2JEW A;  4JXQ A;  4KOX A;  4UEZ A;  1CS0 B;  1GHE A;  5KTC A;  4A4B A;  3SXN A;  3D3S A;  4ZYQ A;  1YVO A;  1V6C A;  2X0S A;  2AFM A;  3D8P A;  3JRU A;  4QUS A;  1PYT B;  4CGN A;  5H86 A;  3DR6 A;  1ELL P;  2D4O A;  4P4E A;  3V38 A;  4CAV A;  4ONU A;  1AMP A;  3EZB A;  4ZBG A;  3NFQ A;  3IU2 A;  3KQX A;  2Q4Z A;  4IF5 A;  1YME A;  4MFZ A;  4ORF A;  4AVC A;  4A39 A;  1CX8 A;  4JJX A;  5JM6 A;  4BTF A;  5CPA A;  2GIV A;  1ARM A;  4HNX B;  1YRE A;  5JH9 A;  1KZF A;  4MHZ A;  4MFK A;  4B13 A;  2OLS A;  1CP7 A;  4A95 A;  4DUK A;  1UWY A;  4MBU A;  1M4I A;  3PB6 X;  5JQ4 A;  1VBG A;  3T9Y A;  4MHD A;  4CO9 A;  3F8K A;  4B5P A;  1IU8 A;  1ZYM A;  4CGO A;  4MJX A;  3SI2 A;  5FD8 A;  2XPP A;  2ZPA A;  2R1I A;  4BPU B;  2ZEH A;  2PR1 A;  4KS9 A;  2PVV A;  3ISX A;  5A27 A;  2DLA A;  4ZX9 A;  1YX0 A;  3PT1 A;  4FWU A;  4C2X A;  4K30 A;  1TKH A;  3IIB A;  2X7B A;  2PJ5 A;  5AG5 A;  3TFY A;  4U9Y A;  2HRO A;  1S60 A;  4KOV A;  4B14 A;  4QBJ A;  4MY3 A;  4JD6 A;  4E94 A;  2PJA A;  5IB0 A;  1EE3 P;  2VEZ A;  1TF9 A;  3OP0 A;  1IB1 E;  2OZG A;  1TF8 A;  1Q2Y A;  4L89 A;  4CAW A;  2YNC C;  3FEC A;  4CAX A;  3IU1 A;  3WC7 A;  3P2H A;  4YFJ A;  5K8O A;  3FRM A;  4M6H A;  4B12 A;  3RYO A;  1IIC A;  2GLF A;  1QSN A;  3VH9 A;  4R87 A;  1B47 A;  2J8N A;  3T90 A;  4BBH A;  4Q7A A;  3GKR A;  5F5X A;  2HI6 A;  5HKW A;  2QML A;  2ZEE A;  1YVK A;  4XPL A;  5G21 A;  3OAK A;  3B3W A;  3NE8 A;  5CBM A;  2PJ6 A;  4COB A;  2XEF A;  3SHP A;  3HUV A;  5HVG A;  4C9E A;  3CZX A;  3KQZ A;  2FS5 A;  4ONW A;  1YVH A;  3R95 A;  3BLN A;  1M4G A;  1OZP A;  4C7I A;  2VZZ A;  4DJL A;  2Q0Y A;  2CNM A;  4HNY B;  5IR2 A;  2YNE A;  2HQY A;  2V8D A;  4RI1 A;  2GE3 A;  3VRR A;  3SJX A;  3SJE A;  6CPA A;  2R82 A;  4TJV A;  2FL4 A;  4CZ1 A;  1EO0 A;  1CM0 A;  4U9Z A;  3D66 A;  1Z8W A;  2NMT A;  3S6F A;  3VRN A;  4M85 A;  3VAR A;  4C99 A;  2B5G A;  5ISV A;  4PXC A;  3S9N A;  2AFS A;  2V8V A;  1Z9U A;  1P0H A;  3D4U A;  4MCR A;  5EMI A;  4CGL A;  3TCV A;  2PIZ A;  2Z11 A;  4KLW A;  4A33 A;  3TLE A;  3C8O A;  4IAV A;  2CIJ A;  3TOB A;  2EK9 A;  3BHX A;  3B3C A;  3I9S A;  1S7F A;  2R7H A;  3TX8 A;  4KVO E;  2GAN A;  2FT0 A;  4PXE A;  4E0A A;  2WPX A;  4C9V A;  1BOB A;  5HKY A;  4CGM A;  4BPX B;  1UFH A;  4MFL A;  1LFW A;  1L0C A;  1PCA A;  3I3G A;  5AXI A;  4MRI A;  1B6B A;  3HPG G;  2PJ0 A;  4KVM E;  3TC8 A;  4C7H A;  2DPS A;  2N3A B;  4A94 A;  1JDB C;  4A30 A;  2B0A A;  3T8W A;  3KRV A;  3IWE A;  1CP6 A;  4R6T A;  3FMC A;  2PQ8 A;  3I6S A;  1IYK A;  3G8W A;  3S9M A;  3TLC A;  3U88 C;  3FVL A;  3FH4 A;  4DNC A;  5F49 A;  2GP4 A;  2D0O A;  1SQH A;  4ZGY B;  2J9A A;  4KSA A;  2FE7 A;  2PCU A;  4PPZ A;  1X12 A;  4KUB A;  1VI4 A;  1Z9E A;  4OC3 A;  2G9D A;  1H8L A;  3NH5 A;  3BXM A;  1YR0 A;  2BSW A;  2CTB A;  2JLM A;  1S7N A;  2G3A A;  3IEH A;  3WT4 A;  1A9X B;  1NSL A;  4UFX A;  4CYQ A;  4P10 A;  3PRT A;  2V8H A;  1ON0 A;  3N7Z A;  4X8I A;  4TWE A;  3CXP A;  2I3C A;  2RC4 A;  1QST A;  1Y9K A;  2GU2 A;  3SR3 A;  4C2Z A;  2PRQ A;  2VL1 A;  4UWJ A;  1M44 A;  2DXQ A;  3PLF B;  1LAN A;  4C8U A;  4GM5 A;  2EVN A;  2HV2 A;  2XEJ A;  2NSM A;  3D68 A;  3MRU A;  4KZT A;  4MI1 A;  1ELM P;  2IMO A;  1YK3 A;  4YGO A;  4B5P B;  4KOS A;  4CDK A;  1KUY A;  4OP4 A;  4M3S A;  2OU2 A;  2J8R A;  1EZB A;  2PIY A;  1M1D A;  2CTC A;  1PUA A;  4P4I A;  2AFZ A;  4F0X A;  2D0P A;  3PB4 X;  3UY5 A;  7CPA A;  3WR7 A;  2R98 A;  3LMS A;  1KBL A;  1ZO0 A;  3RAM A;  1WWZ A;  4F9U A;  5LYD A;  4DYO A;  3OB2 B;  3BUM B;  4E5S A;  2DPT A;  2ODF A;  5I0C A;  2GLJ A;  1IOI A;  2C1C A;  2FCK A;  2YGW A;  3C26 A;  3CDX A;  3LOD A;  4OLL A;  3IWW A;  4UF4 A;  2PJ9 A;  4NGN A;  4YRH A;  1R43 A;  4AXV A;  1HDQ A;  4A37 A;  4P4D A;  4C8A A;  3BUX B;  2ZOG A;  4Z65 A;  3MN8 A;  4IIY A;  2HC9 A;  2JBJ A;  4COG A;  4TNU A;  3W91 A;  5K8M A;  1Q5X A;  1F2O A;  1ZG9 A;  1C3O B;  3V7Z A;  4PSW A;  2ATR A;  4XPK A;  4AG7 A;  2P6E A;  1YLE A;  3F5B A;  2JBK A;  1QSM A;  3TYX A;  3DDD A;  3PGP A;  2IL4 A;  4FD6 A;  3TTH A;  2ZEP A;  2Q4V A;  4CYN A;  3D7G A;  2MP0 A;  2D4P A;  5J1Q A;  3KL9 A;  4MCP A;  4K3N A;  4NGT A;  4MMO A;  1DE4 C;  1Z8T A;  3B2Y A;  3B8G A;  4B11 A;  1RXT A;  2Q4Y A;  3FIX A;  4H6Z A;  2YNC A;  3JVN A;  4UIB A;  1C30 B;  4C8T A;  2Y1N A;  3R1K A;  3T5M A;  3TLG A;  2B5G B;  3TLZ A;  2CBL A;  2GRE A;  1IY7 A;  2XEI A;  4OAD A;  2XPN A;  1K4J A;  4BMH A;  3KKW A;  5HKZ A;  1FY7 A;  4NGM A;  2AUM A;  3SJG A;  1CBX A;  4A31 A;  1X10 A;  1NMT A;  3KZW A;  5E96 A;  4LX9 A;  3P2F A;  3BI0 A;  4JVO A;  3JUW A;  4KOT A;  2ZEM A;  4FAI A;  2V77 A;  3KHZ A;  3N5F A;  5IV0 A;  4C9A A;  4CYP A;  4NGP A;  4BIN A;  4OIW A;  1Q2D A;  2EUI A;  4GXH A;  4J3G A;  4EWT A;  3BI1 A;  2VI7 A;  4JXR A;  4MY0 A;  4UFV A;  3NFZ A;  4NGR A;  2ZW6 A;  2AFU A;  4CAE A;  2F5I A;  3IWG A;  4MFP A;  4PSX A;  3TOA A;  5AGE A;  4OC0 A;  5DWN A;  3ZJ0 A;  3TE4 A;  4PV6 A;  4C9R A;  3IO1 A;  1CPX A;  2F8H A;  4UCN A;  3PB7 X;  4CS0 B;  4TJX A;  1MK4 A;  3T07 A;  3KAS A;  1KWM A;  3LAC A;  1BXR B;  4FD7 A;  1IGB A;  5J8F A;  4KOY A;  4OC5 A;  1J4J A;  1IID A;  1YSJ A;  1B87 A;  2O4H A;  4R7M A;  2ZEF A;  1R61 A;  3BUO B;  4G1P A;  2OZH A;  2AFW A;  3OWC A;  1QSO A;  4YWY A;  3D2M A;  1YQE A;  2VXK A;  1XF8 A;  3FEE A;  2C6G A;  5LYF A;  3K4I A;  2UV8 G;  1MJB A;  1M4D A;  1A2Z A;  4Y49 B;  5G1Z A;  3IC1 A;  4OID A;  2PC1 A;  5DS0 A;  3G23 A;  3QB8 A;  4KVX A;  4NSQ A;  3HMJ G;  4GS4 A;  3SXO A;  2FVG A;  4M6I A;  1R57 A;  4X5K A;  3TLA A;  2I79 A;  4H6U A;  4NJQ A;  1YW6 A;  3NOJ A;  4LQ6 A;  2EZB A;  3D2P A;  5DWM A;  4KSI A;  3R9G A;  1Y0R A;  2Q51 A;  1CG2 A;  3CXS A;  2I00 A;  3LWU A;  3VRO A;  4R8F A;  1VHE A;  1S7L A;  2ZW4 A;  4P44 A;  4OME A;  1YLO A;  3A9L A;  4RS2 A;  1DTD A;  4XNH C;  3QAH A;  4AG9 A;  1WJT A;  4MHP A;  1HDU A;  4PXB A;  2Q04 A;  4PQA A;  3TO6 A;  4WJB A;  3KR5 A;  3TO9 A;  1TXR A;  5J8C A;  4E2A A;  1I21 A;  2YND A;  1KUX A;  5LYL A;  3HLP A;  1Z5R A;  2AFO A;  2OB0 A;  3DGV A;  1VGY A;  3ISZ A;  5J3X A;  4KUA A;  4MFJ A;  4X2T A;  4B6Z A;  4OC1 A;  3R9F A;  1IYL A;  4UBR A;  1CJW A;  2HB6 A;  4L8A A;  4KLV A;  2QVP A;  3B3T A;  2BEI A;  5C82 A;  5BWA B;  4NXY A;  3I1U A;  4CYO A;  3R9E A;  2E28 A;  3F9K C;  2CF4 A;  4MCS A;  1JWQ A;  4RN7 A;  1OBR A;  5H84 A;  4P4F A;  4IUS A;  4M6G A;  2Q44 A;  2PE3 A;  5HVH A;  5K8N A;  4O23 A;  5KTA A;  4P6Y A;  2B4D A;  2PJ2 A;  5F48 A;  2ABZ A;  4BPW B;  2J8M A;  4WWV A;  4YU9 A;  3CPA A;  2VQY A;  5HVF A;  3IFE A;  4UIA A;  4RR2 B;  1M4L A;  3S6G A;  3TLG B;  1ZLI A;  4UWI A;  3FNC A;  3LD2 A;  1DIK A;  2ARH A;  2V8G A;  2QJ8 A;  5G20 A;  3KGQ A;  4R3L A;  3V8I A;  1NSA A;  1FNO A;  2PDO A;  1XF1 A;  2B4B A;  1CPS A;  4C85 A;  1LAP A;  3DSB A;  1NE9 A;  2B3U A;  1I1D A;  8CPA A;  5JPH A;  3F0A A;  2Z3O A;  1Y9Z A;  2OZU A;  3K9U A;  2BL1 A;  2AE6 A;  3FF3 A;  5F9M A;  2XEG A;  3O8Z A;  3VWD A;  1ARL A;  3PBE A;  2CNS A;  3GYA A;  5AG4 A;  4QB9 A;  5F09 A;  4RUH A;  4R57 A;  3PEI A;  4C68 A;  3BJ7 A;  3FXT A;  3RZA A;  2ZEG A;  3PP9 A;  5EC4 A;  2Y1M A;  2Z3P A;  3PFO A;  4PK2 A;  4E8O A;  5D29 A;  4BD9 A;  2WSA A;  2PJ4 A;  4XPD C;  2PCN A;  1QQ9 A;  3EZE A;  3H8G A;  5F46 A;  2PJ3 A;  2PJ8 A;  2REE A;  2Q7B A;  1YW4 A;  1BLL E;  3EFA A;  4P45 A;  2IQ6 A;  2HUZ A;  1S3Z A;  3H8F A;  3ICU A;  3VAT A;  3DR8 A;  4GPL B;  4I49 A;  1AYE A;  1RO5 A;  4OC4 A;  1LCP A;  3FJU A;  4NF1 A;  5K8P A;  5HH1 A;  3CT9 A;  1KC7 A;  4PK3 A;  3IGR A;  3SI1 A;  2Z3N A;  2VZY A;  1YGH A;  4F6A A;  3VRP A;  3GIU A;  4R3K A;  1M6V B;  4UEE A;  1S5K A;  1T36 B;  2CNT A;  3B3V A;  4KSF A;  2AJ6 A;  1Z4E A;  4NGS A;  2BOA A;  4MJ8 A;  1KUV A;  1Q7L A;  2QIR A;  5A28 A;  2VKZ G;  5K99 A;  4A38 A;  2FXF A;  4A4C A;  4XNH B;  1ZG8 A;  2ZEN A;  1VKC A;  2REF A;  4EYS A;  4FUU A;  3GLJ A;  4MCQ A;  4ZY2 A;  1FT7 A;  1Y7E A;  4MHN A;  4C8C A;  1Y7R A;  2DF5 A;  2PJB A;  5FVJ A;  1I12 A;  2B3V A;  2P6G A;  4C86 A;  1XE4 A;  3MGD A;  1XMT A;  3PFE A;  4CRY B;  2OOT A;  3PBB A;  4NCZ A;  2JDC A;  3GB0 A;  3S6K A;  1BO4 A;  3H4Q A;  4B10 A;  5KTD A;  2PJ7 A;  3K9T A;  1BAV A;  1XRY A;  4U5Y A;  3VWE A;  5I4M A;  5LRK A;  2YJV A;  2P0W A;  2Y0M A;  1Z8X A;  1BPN A;  2R8V A;  1LOK A;  3D7H A;  3JTK A;  3WC6 A;  3TLB A;  3NH8 A;  4KOR A;  1WK4 A;  4CPA A;  2G3T A;  2ZW7 A;  3GJZ A;  4C8F A;  3S9L A;  2FSR A;  4UCP A;  4JYW A;  3TLY A;  2C6C A;  3K2K A;  3VRQ A;  4ZI6 A;  2BCO A;  4F8Z A;  4JWP A;  1XJO A;  1ZLH A;  2Z3L A;  2GFQ A;  2F7V A;  2ZOF A;  2PVW A;  1XMB A;  3EXN A;  4C2Y A;  2ZW5 A;  2Z0Z A;  3WAB A;  2O28 A;  3BUN B;  3CPX A;  1Z8L A;  1WVM A;  2RFH A;  1Z2L A;  4NEX A;  4QVT A;  1VIX A;  4CAF A;  2K5T A;  4IIX A;  4IK2 A;  4HNW B;  4ZY0 A;  3PB9 X;  1F57 A;  2EO8 A;  5AG7 A;  1IOF A;  1S7K A;  1JQG A;  3EIF A;  3EO4 A;  5GCN A;  2JEV A;  1LRZ A;  3NA6 A;  4OAE A;  1Y0Y A;  4F9V A;  1ZL0 A;  2AUN A;  2Q7S A;  4NFR A;  5CNP A;  3EZA A;  4ZX8 A;  3H8E A;  1EZA A;  1F2P A;  2B4D B;  3OB1 B;  4R76 A;  1NXJ A;  3T05 A;  5D8N A;  2C5Q A;  4X3R A;  4C9U A;  4HPS A;  4II9 A;  1XBU A;  4EFD A;  3NE7 A;  4W9Y A;  2BO9 A;  2C6P A;  4UCM A;  4J0N A;  3B3S A;  3DNS A;  4MI4 A;  3BJ8 A;  4LQG A;  4XPD B;  1XEB A;  2ZEO A;  3DLJ A;  4LUA A;  3TT2 A;  3PZJ A;  1LAM A;  4Q36 A;  4P4B A;  4R9M A;  3BUW B;  3PFV A;  3RBU A;  3KR4 A;  3QAY A;  4JLY A;  3W6X A;  5HXD A;  3FBU A;  3FX6 A;  2CY2 A;  4KOU A;  2POK A;  4AVB A;  2DEA A;  1XFO A;  4NGQ A;  2WPW A; 
#chains in the Genus database with same CATH homology
 2ANP A;  2RB7 A;  1ZG7 A;  3GUX A;  3D7F A;  5LRJ A;  3SI0 A;  3SJF A;  2AFX A;  4C84 A;  4KNG E;  3D67 A;  2PJC A;  4MHY A;  3WC5 A;  4UEF A;  2PJ1 A;  2NYQ A;  2EWB A;  3L2N A;  2EK8 A;  5ELY A;  4PXD A;  3IJ3 A;  2Q43 A;  5LRG A;  3FED A;  2QYV A;  4OKO A;  1VHO A;  2O53 A;  4P4J A;  4YN3 A;  4CDJ A;  5THW A;  5IB9 A;  3NH4 A;  2WZN A;  4FBE A;  3B7I A;  2OR4 A;  4OC2 A;  3I74 A;  2ZED A;  2IJZ A;  3PB8 X;  4MXU A;  4JZ0 A;  1HEE A;  1TKJ A;  3D7D A;  2ZEL A;  1TKF A;  5JGF A;  4NJR A;  3KI9 A;  4EME A;  3B35 A;  1R3N A;  4C8P A;  3QNV A;  1QMU A;  2WYR A;  3KHX A;  4H2K A;  3VTA A;  4IHM A;  1BPM A;  1RTQ A;  4ZY1 A;  5LYI A;  1GYT A;  2JEW A;  4UEZ A;  4ZYQ A;  1V6C A;  2AFM A;  3JRU A;  1PYT B;  1ELL P;  3V38 A;  4P4E A;  1AMP A;  3KQX A;  2Q4Z A;  5JM6 A;  1YME A;  4A39 A;  1CX8 A;  5CPA A;  5JH9 A;  1ARM A;  4MHZ A;  1CP7 A;  4DUK A;  1UWY A;  3PB6 X;  3SI2 A;  2ZEH A;  2PVV A;  3ISX A;  4ZX9 A;  4FWU A;  1TKH A;  3IIB A;  2PJ5 A;  2PJA A;  1EE3 P;  1TF9 A;  1TF8 A;  3FEC A;  3WC7 A;  5K8O A;  2GLF A;  3VH9 A;  4Q7A A;  2ZEE A;  3B3W A;  5CBM A;  2PJ6 A;  2XEF A;  5HVG A;  3HUV A;  4C9E A;  3KQZ A;  4ONW A;  4DJL A;  5IR2 A;  2V8D A;  3SJX A;  3SJE A;  6CPA A;  4TJV A;  3D66 A;  3VAR A;  4C99 A;  4PXC A;  3S9N A;  2AFS A;  2V8V A;  3D4U A;  4MCR A;  2PIZ A;  4IAV A;  2CIJ A;  2EK9 A;  3BHX A;  3B3C A;  3TX8 A;  4PXE A;  4C9V A;  1LFW A;  1PCA A;  4MRI A;  2PJ0 A;  3TC8 A;  4A94 A;  3T8W A;  1CP6 A;  4R6T A;  3FMC A;  3I6S A;  3S9M A;  3FVL A;  3FH4 A;  2GP4 A;  2J9A A;  2PCU A;  4PPZ A;  3NH5 A;  4OC3 A;  1H8L A;  2G9D A;  3BXM A;  3IEH A;  2CTB A;  3WT4 A;  4P10 A;  3PRT A;  2V8H A;  4X8I A;  4TWE A;  2I3C A;  2GU2 A;  2PRQ A;  2VL1 A;  1LAN A;  4C8U A;  4GM5 A;  2XEJ A;  2NSM A;  3D68 A;  3MRU A;  1ELM P;  2IMO A;  4CDK A;  4OP4 A;  2PIY A;  2CTC A;  2AFZ A;  4P4I A;  3PB4 X;  7CPA A;  3LMS A;  3RAM A;  4F9U A;  5LYD A;  4DYO A;  2GLJ A;  2C1C A;  3CDX A;  3IWW A;  4UF4 A;  2PJ9 A;  4NGN A;  1R43 A;  4AXV A;  1HDQ A;  4A37 A;  4P4D A;  4C8A A;  2ZOG A;  4Z65 A;  3MN8 A;  2HC9 A;  2JBJ A;  4TNU A;  5K8M A;  1F2O A;  1ZG9 A;  3V7Z A;  2JBK A;  2ZEP A;  3D7G A;  5J1Q A;  3KL9 A;  4MCP A;  4K3N A;  4NGT A;  4MMO A;  1DE4 C;  3B2Y A;  4UIB A;  4C8T A;  2GRE A;  1IY7 A;  2XEI A;  4NGM A;  3SJG A;  1CBX A;  3KZW A;  3BI0 A;  2ZEM A;  4FAI A;  2V77 A;  3KHZ A;  3N5F A;  4C9A A;  4NGP A;  4OIW A;  4EWT A;  3BI1 A;  3NFZ A;  4NGR A;  2AFU A;  4OC0 A;  4C9R A;  3IO1 A;  1CPX A;  2F8H A;  3PB7 X;  4TJX A;  3KAS A;  1KWM A;  1IGB A;  4OC5 A;  1YSJ A;  2O4H A;  4R7M A;  2ZEF A;  4G1P A;  2AFW A;  4YWY A;  5LYF A;  3FEE A;  2C6G A;  3IC1 A;  4OID A;  5DS0 A;  2FVG A;  4NJQ A;  1YW6 A;  4KSI A;  1Y0R A;  2Q51 A;  1CG2 A;  3LWU A;  4R8F A;  1VHE A;  4P44 A;  4OME A;  1YLO A;  1DTD A;  4MHP A;  1HDU A;  4PXB A;  4PQA A;  4WJB A;  3KR5 A;  1TXR A;  5LYL A;  3HLP A;  1Z5R A;  2AFO A;  3DGV A;  1VGY A;  3ISZ A;  4X2T A;  4B6Z A;  4OC1 A;  2HB6 A;  2QVP A;  3B3T A;  3I1U A;  2CF4 A;  4MCS A;  1OBR A;  4P4F A;  5HVH A;  2PE3 A;  5K8N A;  4O23 A;  4P6Y A;  2PJ2 A;  2ABZ A;  4YU9 A;  4WWV A;  3CPA A;  5HVF A;  3IFE A;  4UIA A;  1M4L A;  1ZLI A;  2V8G A;  2QJ8 A;  3KGQ A;  1NSA A;  1FNO A;  1XF1 A;  1CPS A;  4C85 A;  1LAP A;  8CPA A;  1Y9Z A;  3FF3 A;  2XEG A;  1ARL A;  3PBE A;  5F09 A;  4RUH A;  3PEI A;  3RZA A;  2ZEG A;  3PFO A;  5D29 A;  4BD9 A;  2PJ4 A;  1QQ9 A;  3H8G A;  2PJ3 A;  2PJ8 A;  1YW4 A;  1BLL E;  4P45 A;  2IQ6 A;  3ICU A;  3H8F A;  3VAT A;  1AYE A;  4OC4 A;  1LCP A;  3FJU A;  5K8P A;  3CT9 A;  3SI1 A;  4UEE A;  3B3V A;  4NGS A;  2BOA A;  1Q7L A;  4A38 A;  1ZG8 A;  2ZEN A;  4FUU A;  3GLJ A;  4MCQ A;  4ZY2 A;  1FT7 A;  1Y7E A;  4MHN A;  4C8C A;  2PJB A;  4C86 A;  3PFE A;  2OOT A;  3PBB A;  3GB0 A;  2PJ7 A;  3K9T A;  1BAV A;  1XRY A;  5I4M A;  5LRK A;  1BPN A;  1LOK A;  3D7H A;  3WC6 A;  3NH8 A;  4CPA A;  4C8F A;  3S9L A;  4JYW A;  2C6C A;  3K2K A;  4ZI6 A;  2BCO A;  4F8Z A;  1XJO A;  1ZLH A;  2F7V A;  2ZOF A;  2PVW A;  1XMB A;  3WAB A;  1WVM A;  3CPX A;  1Z8L A;  2RFH A;  1Z2L A;  1VIX A;  4IK2 A;  4ZY0 A;  3PB9 X;  1F57 A;  3EIF A;  1JQG A;  3NA6 A;  1Y0Y A;  4F9V A;  4NFR A;  4ZX8 A;  3H8E A;  1F2P A;  4R76 A;  5D8N A;  2C5Q A;  4X3R A;  4C9U A;  1XBU A;  4EFD A;  4W9Y A;  2BO9 A;  2C6P A;  3B3S A;  4LQG A;  2ZEO A;  3DLJ A;  1LAM A;  4P4B A;  5HXD A;  3KR4 A;  3RBU A;  3FX6 A;  2POK A;  2DEA A;  1XFO A;  4NGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...