2XEGA

Human glutamate carboxypeptidase ii in complex with antibody- recruiting molecule arm-p4
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVQPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
total genus 268
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xegA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xegA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xegA02
1CG2A 4OC1A 2PJ5A 4C9VA 2PJ9A 1HDUA 4UIBA 1YW6A 3D7HA 1F2PA 1BPMA 1LAPA 3KQXA 4MHPA 5CPAA 1CPXA 2JBJA 3KHXA 2FVGA 2PVVA 2EWBA 2PCUA 4NFRA 3I74A 3B2YA 3IFEA 3ISXA 1Y9ZA 5THWA 3SJEA 2F8HA 5LRKA 4IAVA 2GREA 3HLPA 4R8FA 3ICUA 2CF4A 3NFZA 4FUUA 2PVWA 1QMUA 2BO9A 2XEFA 4P4FA 4PXEA 4K3NA 1Z5RA 4FBEA 3FVLA 3FF3A 3I1UA 2ZEFA 4C86A 2QVPA 2NSMA 3TC8A 1H8LA 1ZG8A 1CX8A 2IJZA 4JZ0A 4KNGE 1Z2LA 1TF8A 3NH8A 4P4BA 4YN3A 3CPXA 1EE3P 5J1QA 4OIWA 4MHZA 4NJQA 4O23A 4PQAA 1XJOA 4DUKA 1IY7A 3T8WA 2V8DA 3FX6A 2J9AA 3KASA 1Z8LA 2AFUA 4OIDA 2PJBA 2WZNA 3PBBA 1CPSA 3KL9A 2ZELA 3MN8A 3IWWA 3NH5A 4WJBA 4EFDA 3KZWA 4OP4A 1CP7A 4PXBA 3FJUA 2PJ7A 5K8MA 4H2KA 3VATA 3S9NA 2JEWA 1XF1A 2IQ6A 4NGMA 2OOTA 2PJ8A 2ZEPA 2HC9A 3B3WA 3PB8X 3IJ3A 5K8OA 2ZEDA 1Y7EA 1XBUA 2ABZA 3D68A 4PXCA 2POKA 1BAVA 1NSAA 1LANA 4ONWA 4P6YA 5I4MA 3D7FA 3ISZA 2ZEOA 4YWYA 2PJ6A 4OC2A 4C9UA 3TX8A 3CPAA 1LCPA 4DYOA 1PCAA 2C6GA 4R6TA 3GUXA 4TJXA 5LYIA 1R43A 1R3NA 1TF9A 4C8AA 1TKFA 3SI2A 4C9EA 4BD9A 4MCRA 3IO1A 2PJAA 3PB6X 1ZLHA 1IGBA 8CPAA 2EK9A 3GLJA 3B3CA 2V8GA 3WC7A 4P10A 5D8NA 2OR4A 2PJCA 3BI0A 3PB7X 1HEEA 1ZG9A 4G1PA 2V8VA 4TWEA 1PYTB 5LRGA 1LFWA 2AFXA 2EK8A 2XEIA 4R7MA 4F9UA 3KGQA 5HXDA 4Z65A 3SI0A 2ZOFA 4ZX9A 3D67A 3V38A 4NGTA 4X3RA 4P44A 1WVMA 4NGSA 3PFEA 2RB7A 3HUVA 5IB9A 1V6CA 4UEFA 4UIAA 1BLLE 2VL1A 5HVHA 2AFMA 1LAMA 3VTAA 4NGNA 4A39A 4WWVA 1Q7LA 4TJVA 3FEDA 4NGQA 4GM5A 1AMPA 2C1CA 4C85A 4P4DA 3H8EA 3D7DA 4B6ZA 4JYWA 4P45A 3SJGA 4W9YA 2QYVA 3RBUA 3B3TA 4F9VA 3D7GA 1ZLIA 1YW4A 3EIFA 3WABA 4MMOA 2DEAA 3CT9A 3MRUA 3NA6A 3I6SA 5LYFA 1VGYA 2PRQA 3KI9A 1DTDA 3BXMA 1DE4C 2O4HA 4MXUA 3PRTA 3B7IA 4CDKA 5F09A 1FT7A 3B3SA 1VHEA 2ZEHA 4EWTA 4ZY0A 4ZY1A 3IC1A 2AFOA 4ZY2A 2XEGA 2PJ0A 2PJ3A 1QQ9A 3H8FA 4FAIA 3DLJA 4IHMA 3N5FA 3QNVA 3LWUA 3BI1A 4OC4A 2ZEMA 1XFOA 3PB9X 4RUHA 2Q51A 3S9MA 4R76A 3B3VA 2CTCA 5K8PA 4Q7AA 1TXRA 3WT4A 4MHNA 5K8NA 2ZEGA 3GB0A 1UWYA 3PBEA 4OMEA 5DS0A 1F2OA 2NYQA 3NH4A 2CTBA 2PIYA 2V77A 4A38A 3RZAA 3VARA 4C8PA 2GLFA 2PJ2A 4C84A 3S9LA 4AXVA 1GYTA 5LYDA 3V7ZA 4MHYA 4NJRA 2IMOA 4C9RA 2CIJA 2QJ8A 2G9DA 1M4LA 3D4UA 4OC0A 3KQZA 4C99A 3JRUA 4FWUA 5JGFA 2ZEEA 4C8FA 2C6CA 2WYRA 2O53A 2PE3A 1ELMP 4OKOA 4OC5A 4KSIA 2XEJA 2AFZA 2BCOA 1OBRA 7CPAA 2ANPA 4CPAA 1TKHA 4UEZA 3L2NA 2ZENA 1Y0YA 3FMCA 4P4EA 3PFOA 1ZG7A 1JQGA 4MCPA 1ELLP 3KR5A 3IEHA 4YU9A 1XMBA 5D29A 3CDXA 2BOAA 1BPNA 3SJFA 2Q43A 2Q4ZA 4C8CA 4CDJA 2HB6A 4IK2A 2JBKA 4LQGA 4A37A 4X2TA 1LOKA 2GLJA 3BHXA 5HVGA 4NGPA 2PJ1A 1CP6A 3WC6A 4MCQA 5ELYA 1AYEA 3D66A 1VHOA 3FH4A 3WC5A 4ZX8A 5LRJA 1ARLA 3LMSA 5HVFA 3SI1A 1F57A 3PB4X 4C9AA 4P4IA 4ZYQA 3KHZA 4TNUA 3B35A 2I3CA 5CBMA 3FEEA 3SJXA 4C8UA 1KWMA 3H8GA 4NGRA 1RTQA 6CPAA 1YMEA 2GU2A 2V8HA 1FNOA 1HDQA 1YLOA 3PEIA 2PJ4A 1CBXA 2F7VA 1ARMA 2RFHA 3DGVA 1Y0RA 2AFWA 4UEEA 4DJLA 5JH9A 3VH9A 4ZI6A 2C6PA 2ZOGA 4UF4A 1XRYA 4C8TA 4EMEA 1YSJA 1TKJA 4F8ZA 4OC3A 3KR4A 3K9TA 4X8IA 4MRIA 3RAMA 4PXDA 4P4JA 2AFSA 4A94A 4MCSA 3FECA 4PPZA 2PIZA 5JM6A 3K2KA 5LYLA 3IIBA 1VIXA
chains in the Genus database with same CATH superfamily
4QB9A 1CG2A 2GP4A 2G0BA 2AJ6A 2PDOA 4EYSA 2JLMA 4OC1A 4AVBA 1FBVA 1RXTA 2R1IA 1S3ZA 2R98A 4CZ1A 2PJ5A 2G3TA 2D4PA 2ZW5A 4C9VA 5JYBA 2B3VA 2AUNA 4B10A 2PJ9A 1HDUA 2JDCA 4UIBA 1YW6A 4MFJA 2FSRA 4KLVA 2ZPAA 2D0OA 3D7HA 3ZJ0A 1XF8A 1F2PA 1BPMA 1LAPA 3KQXA 4MHPA 2ATRA 4PV6A 4OAEA 2YNCC 4PSWA 5CPAA 1CPXA 2JBJA 2R7HA 3GYAA 3KHXA 3OP0A 2FVGA 2PVVA 1S7KA 2DPSA 2EWBA 2PCUA 4NFRA 1P0HA 2CXAA 1CM0A 2ARHA 1YQEA 2VI7A 3D3SA 3DR8A 3B2YA 2GFQA 4J3GA 3IFEA 5AXIA 3I74A 2VXKA 4CGPA 3ISXA 4HKFA 1ZRSA 4UFVA 5ISVA 1Y9ZA 3LACA 4LUAA 5THWA 2HROA 1YGHA 1NXJA 3SJEA 3VRQA 1Y7RA 2F8HA 2I79A 2B5GB 1RO5A 3F0AA 4HPSA 5G20A 2Z3LA 5LRKA 1IIDA 4IAVA 2GREA 1KEEB 3HLPA 3TLAA 4R8FA 4B5OA 2CF4A 4B14A 3ICUA 4A32A 3NFZA 3QB8A 2YJTA 4FUUA 4RS2A 1PUAA 2PVWA 1QMUA 4R3LA 1Z9EA 2BO9A 4CGOA 2XEFA 4P4FA 2HI6A 4PXEA 1SQHA 4K3NA 1Z5RA 4CAEA 4ZGYB 4FBEA 4E0AA 3IIBA 3FVLA 5EBVA 2PCNA 3FF3A 3I1UA 1XOVA 4EVYA 2ZEFA 4YFJA 4CGLA 1Z4EA 4CYQA 1Z8TA 4C86A 2QVPA 2VZYA 4RR2B 4INJA 1MJ9A 2NSMA 3TC8A 1H8LA 1ZG8A 1CX8A 2IJZA 3R95A 2HV2A 4JZ0A 4KNGE 4CAVA 2FL4A 3PZJA 4PK3A 2XPNA 4BPUB 3HMJG 1Z2LA 4B5PB 4MFQA 1TF8A 4KOSA 3NH8A 3OAKA 4P4BA 1PU9A 2Q04A 4YRHA 1X12A 3D8PA 2J8NA 4AG7A 4MI1A 3CPXA 1EE3P 5J1QA 4NSQA 4OIWA 4MHZA 4NJQA 2P6GA 4O23A 4UCPA 4PQAA 3KRVA 1XJOA 4AVAA 2K5TA 3EC4A 4CGNA 4DUKA 4BPXB 1IY7A 3P2FA 4RI1A 1Y9WA 3T8WA 3BJ7A 2V8DA 4MY0A 2J9AA 3FX6A 3KASA 3TO6A 1Z8LA 2AFUA 5HKWA 2PJBA 2WZNA 4OIDA 2FM4A 3PBBA 1CPSA 3KL9A 3O8ZA 2ZELA 3BUMB 2VEZA 2EZBA 5EMIA 1S7FA 3MN8A 4GS4A 3IWWA 1B87A 4KZTA 3NH5A 3PGPA 4A4BA 4Q36A 4WJBA 4EFDA 2AUMA 3EO4A 3KZWA 1CP7A 4OP4A 4PXBA 4UWIA 2PSWA 3FJUA 3EZAA 5K99A 2PJ7A 4CAFA 4QVTA 4C68A 3TFYA 5K8MA 1YVHA 2FIAA 5J8CA 4NXYA 5AG6A 4H2KA 3VATA 3S9NA 3OWCA 2JEWA 4R87A 2VZZA 5F47A 1XF1A 4K30A 1NBWA 1I1DA 2IQ6A 3K4IA 4NGMA 2CNTA 3VROA 2OOTA 4GPLB 4MI4A 2O28A 2PJ8A 2ZEPA 3TE4A 4E5SA 2HC9A 1Q2YA 3PT1A 3B3WA 3PB8X 4HNYB 3IJ3A 4AVCA 1WK4A 5K8OA 1MJAA 1Y7EA 1XBUA 2ABZA 2ZEDA 3VRPA 3D68A 4PXCA 3QAYA 1B6BA 3PLFB 4PK2A 4KOVA 4A30A 1NMTA 1M4GA 2P6FA 2POKA 3EXNA 2B0AA 1BAVA 1NSAA 1LANA 2Z3MA 4ORFA 4ONWA 4P6YA 1U6MA 1A2ZA 2AE6A 2Z11A 3D7FA 3DR6A 3ISZA 2ZEOA 5A28A 4YWYA 1T36B 2R82A 2X0SA 5AG4A 3PFVA 2PJ6A 4OC2A 3TLBA 4C9UA 4CRYB 1YK3A 4L89A 3TX8A 3CPAA 2PQ8A 3T9YA 1QSNA 1BOBA 2B58A 5AGEA 3R9GA 2FS5A 4C2ZA 2ZXVA 1LCPA 2QECA 5HKZA 3TOBA 4FD7A 1A9XB 2FE7A 4DYOA 1PCAA 2C6GA 4R6TA 1CE8B 4H1HA 4KVXA 3EFAA 3TO9A 3EY5A 2EZCA 3GUXA 3ZNIA 4MY3A 5KTAA 3S6KA 3TT2A 4TJXA 4XPDC 2E28A 2OZHA 5G1ZA 4C7HA 1J4JA 2Q0YA 4BTFA 5LYIA 3T05A 1R43A 1R3NA 5BWAB 2KCWA 2XPOA 1TF9A 4KVME 1TKFA 4C8AA 3JVNA 1VHSA 4E2AA 2NMTA 5FD8A 1XMTA 5CNPA 4YGOA 3SI2A 4C9EA 2YGWA 2YNCA 4BD9A 4MCRA 2JDDA 3IO1A 3LD2A 2Q7BA 5F46A 2PJAA 1S60A 2QMLA 3PB6X 1ZL0A 4M8DA 1EO0A 1ZLHA 3EZBA 2EUIA 1IGBA 5J8FA 3SR3A 8CPAA 2EK9A 1Q5XA 1VBGA 3GLJA 1KUYA 3B3CA 1ZO0A 4B13A 2V8GA 5I4MA 4MJ8A 3WC7A 1QSRA 4P10A 5D8NA 3SXNA 2OR4A 1OZPA 2PJCA 4MHDA 4M3SA 3TLYA 2I00A 4C2YA 3BI0A 4E8OA 3LODA 1ON0A 1HEEA 2EVNA 3PB7X 2C5QA 5JPHA 3BUXB 1Z8XA 2CNMA 1P4NA 1ZG9A 3VRRA 1L0CA 3C26A 4G1PA 4KOTA 3GIUA 2V8VA 4KSFA 3FRMA 1PYTB 4TWEA 2P0WA 5LRGA 5KTDA 4YN3A 1LFWA 2AFXA 1Y9KA 1BO4A 2XEIA 2EK8A 4MBUA 4R7MA 4CO9A 3D2PA 4F9UA 4KOXA 4M6HA 1CJWA 3KGQA 3KKWA 4KORA 5HXDA 5HMNA 3SHPA 1Q2DA 4CRZB 4Z65A 4KSAA 3SI0A 4XPLA 2ZOFA 4ZX9A 1IYLA 3D67A 5F1YA 3CXPA 1WJTA 5DWNA 2Y0MA 3V38A 1J3LA 3P2HA 3SXOA 2VKZG 4NGTA 2EO8A 2ODFA 4LQ6A 3NE8A 3FNCA 3ZZIA 2EZAA 1N71A 4X3RA 2Q4YA 2HQYA 4P44A 1WVMA 4HNWB 4NGSA 4J0NA 3PFEA 2RB7A 3HUVA 5IB9A 4OLLA 1V6CA 3GY9A 4UEFA 3S6FA 2GANA 3E0KA 2J8RA 4A2ZA 2YJVA 4UIAA 1BLLE 2BEIA 2VL1A 3CXQA 2AFMA 4JJXA 4AG9A 2Y1NA 5HVHA 1LAMA 1X10A 2Z10A 4CS0B 3VTAA 4JXQA 4NGNA 4A39A 1YLEA 4WWVA 1Q7LA 2OZUA 4B12A 4CYNA 3FEDA 4TJVA 4NGQA 2FT0A 2N3AB 4GM5A 1EZAA 3TLGA 1AMPA 2C1CA 4C85A 4UFWA 1KUVA 1IYKA 4UA3A 4P4DA 3H8EA 3D7DA 5I0CA 2WSAA 2HWGA 3U88C 4B6ZA 4JYWA 4X5KA 2HUZA 2B5GA 4P45A 3SJGA 3T0TA 4W9YA 4F6AA 2QYVA 3RBUA 2OB0A 3B3TA 2Z3OA 2WUUA 4A95A 2FIWA 3K9UA 4F9VA 3EZEA 3D7GA 1S7LA 1ZLIA 2XPPA 1YW4A 3CZXA 4M6IA 3R96A 4UCNA 3RYOA 3BUWB 3EIFA 5HH1A 3WABA 2DPTA 1KC7A 2EBJA 4MMOA 4Y49C 1EZBA 3IU1A 5BY0A 1QSOA 2PR1A 1DIKA 2DEAA 3CT9A 3MRUA 4M85A 4Q38A 4UBRA 4U9ZA 1I12A 5F5XA 1IICA 2BL1A 3NA6A 3R1KA 5LYFA 3C8OA 5F48A 3I6SA 1NE9A 1VGYA 1K4JA 2PRQA 3KI9A 3T5MA 1DTDA 3BXMA 1YVOA 3OB2B 1Z8WA 1DE4C 2O4HA 3G3SA 4MXUA 4KOWA 2OLSA 3UY5A 2QIRA 3PRTA 3JUWA 1Z9UA 3B7IA 4II9A 4JWPA 4CDKA 5F09A 1FT7A 1FY7A 3B3SA 1VHEA 2ZEHA 1V0CA 1XIXA 4EWTA 3NFQA 1IU8A 4IIYA 3DSBA 4PSXA 4ZY0A 5G22A 3D2MA 4ZY1A 3IC1A 2AFOA 4ZY2A 2XEGA 2PJ0A 2DIKA 1M4DA 2PJ3A 1QQ9A 2B3UA 3H8FA 4FAIA 3DLJA 3IGRA 4IHMA 3N5FA 3QNVA 4KS9A 1S7NA 3TO7A 4UFXA 3W6SA 3LWUA 4C2XA 4DNCA 1MJBA 3BI1A 5E96A 3T07A 2PC1A 4OC4A 2Q4VA 4COBA 2ZEMA 4FD5A 3TLGB 2DLAA 4KUBA 4F0XA 2OZGA 1XFOA 3PB9X 3BJ8A 1JDBC 4RUHA 2Q51A 3S9MA 4R76A 3G8WA 3OB1B 4RN7A 3B3VA 1Z4RA 2A4NA 4CYOA 3I9SA 3G23A 2CTCA 3S6GA 4Y49B 2Z0ZA 3GJZA 5K8PA 2IL4A 2JEVA 4Q7AA 4XNHB 3HPHE 1TXRA 4MFPA 5IB0A 4UCMA 1QSMA 1XE4A 4MHNA 4XPDB 3WT4A 4CGMA 4QBJA 2CNSA 5K8NA 4OADA 2ZEGA 2B4DA 3GB0A 5F9MA 2ZW6A 1UWYA 2YNDA 3PBEA 4OMEA 5H86A 4JD6A 1F2OA 2NYQA 3FXTA 5DS0A 3RO0A 3DDDA 1C30B 1VI4A 3FBUA 4KVOE 2Z3KA 3IU2A 3NH4A 4IUSA 4L8AA 4R9MA 5AG7A 4JXRA 5AG5A 2RC4A 4U9YA 1R61A 1R57A 4A4CA 2CTBA 2PIYA 2V77A 4KLWA 3RZAA 4A38A 4MFZA 3VARA 4C8PA 2GLFA 2PJ2A 4C84A 1S5KA 3TLCA 3S9LA 3V8IA 1GYTA 4AXVA 4BINA 3N7ZA 1YREA 1JWQA 5LYDA 3R9FA 3V7ZA 5J3XA 3QAHA 4MHYA 4NJRA 2IMOA 4C9RA 4B5PA 2GIVA 2CIJA 2QJ8A 2DF5A 1KZFA 2G9DA 1M4LA 3DNSA 3D4UA 4UWJA 3TYXA 4OC0A 3KQZA 3S6HA 4U5YA 2CBLA 2B4JC 4C99A 4QC6A 3JRUA 4FWUA 4A33A 1M4IA 5A27A 5JGFA 2ZEEA 4C8FA 2C6CA 2WYRA 4F0YA 1TIQA 4H6ZA 2Z3PA 2O53A 2PE3A 1ELMP 2XPLA 4NEXA 4MFLA 4OKOA 4OC5A 2OU2A 1B47A 2GE3A 4KSIA 2PR8A 4XPKA 3TTHA 2BUEA 1UFHA 4R57A 4A31A 1CS0B 2XEJA 2AFZA 2BCOA 2X7BA 1WWZA 2G3AA 1OBRA 2VBQA 4KOYA 3RNZA 4M6GA 7CPAA 2OH1A 5G21A 4BPWB 3H4QA 3W6XA 2ANPA 5IR2A 4CPAA 3HPGG 1TKHA 4UEZA 4NCZA 4CAXA 4BBHA 1VBHA 2Y1MA 3IWEA 5DWMA 3L2NA 2ZENA 1Y0YA 4GXHA 3FMCA 4P4EA 3BLNA 2FXFA 2UV8G 1AUGA 3PFOA 5JQ4A 1ZG7A 2H5MA 1JQGA 4MCPA 2VQYA 2B4BA 4FD4A 3GKRA 1ELLP 4MFKA 3KR5A 5IX3A 2FCKA 3IEHA 1GGOA 4YU9A 4NF1A 1XMBA 5D29A 1GHEA 4MJXA 3CDXA 2BOAA 3T90A 1BPNA 3SJFA 2Q43A 1C3OB 5HKYA 1M44A 1VKCA 2Q4ZA 2REFA 3A9LA 5IV0A 4C8CA 4H89A 2YNEA 4CDJA 4KOUA 2HB6A 1KBLA 1JDEA 3TLEA 2MP0A 5F13A 4IK2A 1Q2CA 3FYNA 3VWEA 2JBKA 3F8KA 4HNXB 4LQGA 3PP9A 4A37A 2PRBA 4IIXA 4X2TA 1LOKA 2GLJA 1ZYMA 3BHXA 3I3GA 2Z3NA 4LX9A 5HVGA 3NOJA 1QSTA 4NGPA 3U1BA 2PJ1A 1CP6A 3F5BA 4H6UA 5EC4A 3WC6A 4MCQA 5ELYA 1AYEA 2J8MA 2Q7SA 2ZW7A 3D66A 3VRNA 1VHOA 3FH4A 4ONUA 3WC5A 4CYPA 4ZX8A 5LRJA 2C27A 5C82A 1ARLA 3LMSA 3VWDA 5HVFA 1XEBA 5JVLA 3WR7A 3IWGA 1YVKA 2WPWA 3SI1A 1MK4A 1F57A 3PB4X 4C9AA 5H84A 4P4IA 1BXRB 2ZW4A 3F9KC 2D4OA 3H5ZA 4ZYQA 2P6EA 3KHZA 4KUAA 4C7IA 4TNUA 3B35A 2I3CA 1NSLA 5CBMA 4R3KA 1LRZA 3FEEA 3SJXA 5F49A 4C8UA 1YX0A 1KWMA 3H8GA 1M6VB 4FD6A 5GCNA 4NGRA 1RTQA 4E94A 6CPAA 1YMEA 3JTKA 4B11A 1KUXA 2GU2A 2V8HA 1FNOA 4AB7A 2D0PA 1HDQA 1YLOA 2B4DB 2F5IA 3PEIA 2PJ4A 1IOIA 2WPXA 1CBXA 1IB1E 2F7VA 4XNHC 1ARMA 3CXSA 2DXQA 2RFHA 3DGVA 1Y0RA 2AFWA 4UEEA 2R8VA 3BUNB 2Q44A 4QUSA 3FIXA 4I49A 1YR0A 4DJLA 5JH9A 3VH9A 3W91A 2C6PA 4CAWA 2ZOGA 4UF4A 1XRYA 4ZI6A 4C8TA 3B8GA 4EMEA 1YSJA 4IF5A 1TKJA 1IOFA 5KTCA 4F8ZA 4OC3A 3MGDA 2CY2A 5C88A 2REEA 4JVOA 3KR4A 3VGOA 1M1DA 3K9TA 4JLYA 4X8IA 4MRIA 3RAMA 4PXDA 4P4JA 2AFSA 4COGA 4A94A 3TLZA 3R9EA 3BUOB 2BSWA 4ZBGA 4MCSA 3FECA 3NE7A 4PPZA 5FVJA 4BMHA 2PIZA 3TCVA 5JM6A 3K2KA 5LYLA 3TOAA 3FB3A 1I21A 1VIXA
chains in the Genus database with same CATH topology
1CG2A 2GP4A 4OC1A 2PJ5A 4C9VA 2PJ9A 1HDUA 4UIBA 1YW6A 3D7HA 1F2PA 1BPMA 1LAPA 3KQXA 4MHPA 5CPAA 1CPXA 2JBJA 3KHXA 2FVGA 2PVVA 2EWBA 2PCUA 4NFRA 3I74A 3B2YA 3IFEA 3ISXA 1Y9ZA 5THWA 3SJEA 2F8HA 5LRKA 4IAVA 2GREA 3HLPA 4R8FA 3ICUA 2CF4A 3NFZA 4FUUA 2PVWA 1QMUA 2BO9A 2XEFA 4P4FA 4PXEA 4K3NA 1Z5RA 4FBEA 3FVLA 3FF3A 3I1UA 2ZEFA 4C86A 2QVPA 2NSMA 3TC8A 1H8LA 1ZG8A 1CX8A 2IJZA 4JZ0A 4KNGE 1Z2LA 1TF8A 3NH8A 4P4BA 4YN3A 3CPXA 1EE3P 5J1QA 4OIWA 4MHZA 4NJQA 4O23A 4PQAA 1XJOA 4DUKA 1IY7A 3T8WA 2V8DA 3FX6A 2J9AA 3KASA 1Z8LA 2AFUA 4OIDA 2PJBA 2WZNA 3PBBA 1CPSA 3KL9A 2ZELA 3MN8A 3IWWA 3NH5A 4WJBA 4EFDA 3KZWA 4OP4A 1CP7A 4PXBA 3FJUA 2PJ7A 5K8MA 4H2KA 3VATA 3S9NA 2JEWA 1XF1A 2IQ6A 4NGMA 2OOTA 2PJ8A 2ZEPA 2HC9A 3B3WA 3PB8X 3IJ3A 5K8OA 2ZEDA 1Y7EA 1XBUA 2ABZA 3D68A 4PXCA 2POKA 1BAVA 1NSAA 1LANA 4ONWA 4P6YA 5I4MA 3D7FA 3ISZA 2ZEOA 4YWYA 2PJ6A 4OC2A 4C9UA 3TX8A 3CPAA 1LCPA 4DYOA 1PCAA 2C6GA 4R6TA 3GUXA 4TJXA 5LYIA 1R43A 1R3NA 1TF9A 4C8AA 1TKFA 3SI2A 4C9EA 4BD9A 4MCRA 3IO1A 2PJAA 3PB6X 1ZLHA 1IGBA 8CPAA 2EK9A 3GLJA 3B3CA 2V8GA 3WC7A 4P10A 5D8NA 2OR4A 2PJCA 3BI0A 3PB7X 1HEEA 2C5QA 1ZG9A 4G1PA 2V8VA 4TWEA 1PYTB 5LRGA 1LFWA 2AFXA 2EK8A 2XEIA 4R7MA 4F9UA 3KGQA 5HXDA 4Z65A 3SI0A 2ZOFA 4ZX9A 3D67A 3V38A 4NGTA 4X3RA 4P44A 1WVMA 4NGSA 3PFEA 2RB7A 3HUVA 5IB9A 1V6CA 4UEFA 4UIAA 1BLLE 2VL1A 5HVHA 2AFMA 1LAMA 3VTAA 4NGNA 4A39A 4WWVA 1Q7LA 4TJVA 3FEDA 4NGQA 4GM5A 1AMPA 2C1CA 4C85A 4P4DA 3H8EA 3D7DA 4B6ZA 4JYWA 4P45A 3SJGA 4W9YA 2QYVA 3RBUA 3B3TA 4F9VA 3D7GA 1ZLIA 1YW4A 3EIFA 3WABA 4MMOA 2DEAA 3CT9A 3MRUA 3NA6A 3I6SA 5LYFA 1VGYA 2PRQA 3KI9A 1DTDA 3BXMA 1DE4C 2O4HA 4MXUA 3PRTA 3B7IA 4CDKA 5F09A 1FT7A 3B3SA 1VHEA 2ZEHA 4EWTA 4ZY0A 4ZY1A 3IC1A 2AFOA 4ZY2A 2XEGA 2PJ0A 2PJ3A 1QQ9A 3H8FA 4FAIA 3DLJA 4IHMA 3N5FA 3QNVA 3LWUA 3BI1A 4OC4A 2ZEMA 1XFOA 3PB9X 4RUHA 2Q51A 3S9MA 4R76A 3B3VA 2CTCA 5K8PA 4Q7AA 1TXRA 3WT4A 4MHNA 5K8NA 2ZEGA 3GB0A 1UWYA 3PBEA 4OMEA 5DS0A 1F2OA 2NYQA 3NH4A 2CTBA 2PIYA 2V77A 4A38A 3RZAA 3VARA 4C8PA 2GLFA 2PJ2A 4C84A 3S9LA 4AXVA 1GYTA 5LYDA 3V7ZA 4MHYA 4NJRA 2IMOA 4C9RA 2CIJA 2QJ8A 2G9DA 1M4LA 3D4UA 4OC0A 3KQZA 4C99A 3JRUA 4FWUA 5JGFA 2ZEEA 4C8FA 2C6CA 2WYRA 2O53A 2PE3A 1ELMP 4OKOA 4OC5A 4KSIA 2XEJA 2AFZA 2BCOA 1OBRA 7CPAA 2ANPA 5IR2A 4CPAA 1TKHA 4UEZA 3L2NA 2ZENA 1Y0YA 3FMCA 4P4EA 3PFOA 1ZG7A 1JQGA 4MCPA 1ELLP 3KR5A 3IEHA 4YU9A 1XMBA 5D29A 3CDXA 2BOAA 1BPNA 3SJFA 2Q43A 2Q4ZA 4C8CA 4CDJA 2HB6A 4IK2A 2JBKA 4LQGA 4A37A 4X2TA 1LOKA 2GLJA 3BHXA 5HVGA 4NGPA 2PJ1A 1CP6A 3WC6A 4MCQA 5ELYA 1AYEA 3D66A 1VHOA 3FH4A 3WC5A 4ZX8A 5LRJA 1ARLA 3LMSA 5HVFA 3SI1A 1F57A 3PB4X 4C9AA 4P4IA 4ZYQA 3KHZA 4TNUA 3B35A 2I3CA 5CBMA 3FEEA 3SJXA 4C8UA 1KWMA 3H8GA 4NGRA 1RTQA 6CPAA 1YMEA 2GU2A 2V8HA 1FNOA 1HDQA 1YLOA 3PEIA 2PJ4A 1CBXA 2F7VA 1ARMA 2RFHA 3DGVA 1Y0RA 2AFWA 4UEEA 4DJLA 5JH9A 3VH9A 4ZI6A 2C6PA 2ZOGA 4UF4A 1XRYA 4C8TA 4EMEA 1YSJA 1TKJA 4F8ZA 4OC3A 3KR4A 3K9TA 4X8IA 4MRIA 3RAMA 4PXDA 4P4JA 2AFSA 4A94A 4MCSA 3FECA 4PPZA 2PIZA 5JM6A 3K2KA 5LYLA 3IIBA 1VIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CG2 A;  4OC1 A;  2PJ5 A;  4C9V A;  2PJ9 A;  1HDU A;  4UIB A;  1YW6 A;  3D7H A;  1F2P A;  1BPM A;  1LAP A;  3KQX A;  4MHP A;  5CPA A;  1CPX A;  2JBJ A;  3KHX A;  2FVG A;  2PVV A;  2EWB A;  2PCU A;  4NFR A;  3I74 A;  3B2Y A;  3IFE A;  3ISX A;  1Y9Z A;  5THW A;  3SJE A;  2F8H A;  5LRK A;  4IAV A;  2GRE A;  3HLP A;  4R8F A;  3ICU A;  2CF4 A;  3NFZ A;  4FUU A;  2PVW A;  1QMU A;  2BO9 A;  2XEF A;  4P4F A;  4PXE A;  4K3N A;  1Z5R A;  4FBE A;  3FVL A;  3FF3 A;  3I1U A;  2ZEF A;  4C86 A;  2QVP A;  2NSM A;  3TC8 A;  1H8L A;  1ZG8 A;  1CX8 A;  2IJZ A;  4JZ0 A;  4KNG E;  1Z2L A;  1TF8 A;  3NH8 A;  4P4B A;  4YN3 A;  3CPX A;  1EE3 P;  5J1Q A;  4OIW A;  4MHZ A;  4NJQ A;  4O23 A;  4PQA A;  1XJO A;  4DUK A;  1IY7 A;  3T8W A;  2V8D A;  3FX6 A;  2J9A A;  3KAS A;  1Z8L A;  2AFU A;  4OID A;  2PJB A;  2WZN A;  3PBB A;  1CPS A;  3KL9 A;  2ZEL A;  3MN8 A;  3IWW A;  3NH5 A;  4WJB A;  4EFD A;  3KZW A;  4OP4 A;  1CP7 A;  4PXB A;  3FJU A;  2PJ7 A;  5K8M A;  4H2K A;  3VAT A;  3S9N A;  2JEW A;  1XF1 A;  2IQ6 A;  4NGM A;  2OOT A;  2PJ8 A;  2ZEP A;  2HC9 A;  3B3W A;  3PB8 X;  3IJ3 A;  5K8O A;  2ZED A;  1Y7E A;  1XBU A;  2ABZ A;  3D68 A;  4PXC A;  2POK A;  1BAV A;  1NSA A;  1LAN A;  4ONW A;  4P6Y A;  5I4M A;  3D7F A;  3ISZ A;  2ZEO A;  4YWY A;  2PJ6 A;  4OC2 A;  4C9U A;  3TX8 A;  3CPA A;  1LCP A;  4DYO A;  1PCA A;  2C6G A;  4R6T A;  3GUX A;  4TJX A;  5LYI A;  1R43 A;  1R3N A;  1TF9 A;  4C8A A;  1TKF A;  3SI2 A;  4C9E A;  4BD9 A;  4MCR A;  3IO1 A;  2PJA A;  3PB6 X;  1ZLH A;  1IGB A;  8CPA A;  2EK9 A;  3GLJ A;  3B3C A;  2V8G A;  3WC7 A;  4P10 A;  5D8N A;  2OR4 A;  2PJC A;  3BI0 A;  3PB7 X;  1HEE A;  1ZG9 A;  4G1P A;  2V8V A;  4TWE A;  1PYT B;  5LRG A;  1LFW A;  2AFX A;  2EK8 A;  2XEI A;  4R7M A;  4F9U A;  3KGQ A;  5HXD A;  4Z65 A;  3SI0 A;  2ZOF A;  4ZX9 A;  3D67 A;  3V38 A;  4NGT A;  4X3R A;  4P44 A;  1WVM A;  4NGS A;  3PFE A;  2RB7 A;  3HUV A;  5IB9 A;  1V6C A;  4UEF A;  4UIA A;  1BLL E;  2VL1 A;  5HVH A;  2AFM A;  1LAM A;  3VTA A;  4NGN A;  4A39 A;  4WWV A;  1Q7L A;  4TJV A;  3FED A;  4NGQ A;  4GM5 A;  1AMP A;  2C1C A;  4C85 A;  4P4D A;  3H8E A;  3D7D A;  4B6Z A;  4JYW A;  4P45 A;  3SJG A;  4W9Y A;  2QYV A;  3RBU A;  3B3T A;  4F9V A;  3D7G A;  1ZLI A;  1YW4 A;  3EIF A;  3WAB A;  4MMO A;  2DEA A;  3CT9 A;  3MRU A;  3NA6 A;  3I6S A;  5LYF A;  1VGY A;  2PRQ A;  3KI9 A;  1DTD A;  3BXM A;  1DE4 C;  2O4H A;  4MXU A;  3PRT A;  3B7I A;  4CDK A;  5F09 A;  1FT7 A;  3B3S A;  1VHE A;  2ZEH A;  4EWT A;  4ZY0 A;  4ZY1 A;  3IC1 A;  2AFO A;  4ZY2 A;  2XEG A;  2PJ0 A;  2PJ3 A;  1QQ9 A;  3H8F A;  4FAI A;  3DLJ A;  4IHM A;  3N5F A;  3QNV A;  3LWU A;  3BI1 A;  4OC4 A;  2ZEM A;  1XFO A;  3PB9 X;  4RUH A;  2Q51 A;  3S9M A;  4R76 A;  3B3V A;  2CTC A;  5K8P A;  4Q7A A;  1TXR A;  3WT4 A;  4MHN A;  5K8N A;  2ZEG A;  3GB0 A;  1UWY A;  3PBE A;  4OME A;  5DS0 A;  1F2O A;  2NYQ A;  3NH4 A;  2CTB A;  2PIY A;  2V77 A;  4A38 A;  3RZA A;  3VAR A;  4C8P A;  2GLF A;  2PJ2 A;  4C84 A;  3S9L A;  4AXV A;  1GYT A;  5LYD A;  3V7Z A;  4MHY A;  4NJR A;  2IMO A;  4C9R A;  2CIJ A;  2QJ8 A;  2G9D A;  1M4L A;  3D4U A;  4OC0 A;  3KQZ A;  4C99 A;  3JRU A;  4FWU A;  5JGF A;  2ZEE A;  4C8F A;  2C6C A;  2WYR A;  2O53 A;  2PE3 A;  1ELM P;  4OKO A;  4OC5 A;  4KSI A;  2XEJ A;  2AFZ A;  2BCO A;  1OBR A;  7CPA A;  2ANP A;  4CPA A;  1TKH A;  4UEZ A;  3L2N A;  2ZEN A;  1Y0Y A;  3FMC A;  4P4E A;  3PFO A;  1ZG7 A;  1JQG A;  4MCP A;  1ELL P;  3KR5 A;  3IEH A;  4YU9 A;  1XMB A;  5D29 A;  3CDX A;  2BOA A;  1BPN A;  3SJF A;  2Q43 A;  2Q4Z A;  4C8C A;  4CDJ A;  2HB6 A;  4IK2 A;  2JBK A;  4LQG A;  4A37 A;  4X2T A;  1LOK A;  2GLJ A;  3BHX A;  5HVG A;  4NGP A;  2PJ1 A;  1CP6 A;  3WC6 A;  4MCQ A;  5ELY A;  1AYE A;  3D66 A;  1VHO A;  3FH4 A;  3WC5 A;  4ZX8 A;  5LRJ A;  1ARL A;  3LMS A;  5HVF A;  3SI1 A;  1F57 A;  3PB4 X;  4C9A A;  4P4I A;  4ZYQ A;  3KHZ A;  4TNU A;  3B35 A;  2I3C A;  5CBM A;  3FEE A;  3SJX A;  4C8U A;  1KWM A;  3H8G A;  4NGR A;  1RTQ A;  6CPA A;  1YME A;  2GU2 A;  2V8H A;  1FNO A;  1HDQ A;  1YLO A;  3PEI A;  2PJ4 A;  1CBX A;  2F7V A;  1ARM A;  2RFH A;  3DGV A;  1Y0R A;  2AFW A;  4UEE A;  4DJL A;  5JH9 A;  3VH9 A;  4ZI6 A;  2C6P A;  2ZOG A;  4UF4 A;  1XRY A;  4C8T A;  4EME A;  1YSJ A;  1TKJ A;  4F8Z A;  4OC3 A;  3KR4 A;  3K9T A;  4X8I A;  4MRI A;  3RAM A;  4PXD A;  4P4J A;  2AFS A;  4A94 A;  4MCS A;  3FEC A;  4PPZ A;  2PIZ A;  5JM6 A;  3K2K A;  5LYL A;  3IIB A;  1VIX A; 
#chains in the Genus database with same CATH topology
 4QB9 A;  1CG2 A;  2GP4 A;  2G0B A;  2AJ6 A;  2PDO A;  4EYS A;  2JLM A;  4OC1 A;  4AVB A;  1FBV A;  1RXT A;  2R1I A;  1S3Z A;  2R98 A;  4CZ1 A;  2PJ5 A;  2G3T A;  2D4P A;  2ZW5 A;  4C9V A;  5JYB A;  2B3V A;  2AUN A;  4B10 A;  2PJ9 A;  1HDU A;  2JDC A;  4UIB A;  1YW6 A;  4MFJ A;  2FSR A;  4KLV A;  2ZPA A;  2D0O A;  3D7H A;  3ZJ0 A;  1XF8 A;  1F2P A;  1BPM A;  1LAP A;  3KQX A;  4MHP A;  2ATR A;  4PV6 A;  4OAE A;  2YNC C;  4PSW A;  5CPA A;  1CPX A;  2JBJ A;  2R7H A;  3GYA A;  3KHX A;  3OP0 A;  2FVG A;  2PVV A;  1S7K A;  2DPS A;  2EWB A;  2PCU A;  4NFR A;  1P0H A;  2CXA A;  1CM0 A;  2ARH A;  1YQE A;  2VI7 A;  3D3S A;  3DR8 A;  3B2Y A;  2GFQ A;  4J3G A;  3IFE A;  5AXI A;  3I74 A;  2VXK A;  4CGP A;  3ISX A;  4HKF A;  1ZRS A;  4UFV A;  5ISV A;  1Y9Z A;  3LAC A;  4LUA A;  5THW A;  2HRO A;  1YGH A;  1NXJ A;  3SJE A;  3VRQ A;  1Y7R A;  2F8H A;  2I79 A;  2B5G B;  1RO5 A;  3F0A A;  4HPS A;  5G20 A;  2Z3L A;  5LRK A;  1IID A;  4IAV A;  2GRE A;  1KEE B;  3HLP A;  3TLA A;  4R8F A;  4B5O A;  2CF4 A;  4B14 A;  3ICU A;  4A32 A;  3NFZ A;  3QB8 A;  2YJT A;  4FUU A;  4RS2 A;  1PUA A;  2PVW A;  1QMU A;  4R3L A;  1Z9E A;  2BO9 A;  4CGO A;  2XEF A;  4P4F A;  2HI6 A;  4PXE A;  1SQH A;  4K3N A;  1Z5R A;  4CAE A;  4ZGY B;  4FBE A;  4E0A A;  3IIB A;  3FVL A;  5EBV A;  2PCN A;  3FF3 A;  3I1U A;  1XOV A;  4EVY A;  2ZEF A;  4YFJ A;  4CGL A;  1Z4E A;  4CYQ A;  1Z8T A;  4C86 A;  2QVP A;  2VZY A;  4RR2 B;  4INJ A;  1MJ9 A;  2NSM A;  3TC8 A;  1H8L A;  1ZG8 A;  1CX8 A;  2IJZ A;  3R95 A;  2HV2 A;  4JZ0 A;  4KNG E;  4CAV A;  2FL4 A;  3PZJ A;  4PK3 A;  2XPN A;  4BPU B;  3HMJ G;  1Z2L A;  4B5P B;  4MFQ A;  1TF8 A;  4KOS A;  3NH8 A;  3OAK A;  4P4B A;  1PU9 A;  2Q04 A;  4YRH A;  1X12 A;  3D8P A;  2J8N A;  4AG7 A;  4MI1 A;  3CPX A;  1EE3 P;  5J1Q A;  4NSQ A;  4OIW A;  4MHZ A;  4NJQ A;  2P6G A;  4O23 A;  4UCP A;  4PQA A;  3KRV A;  1XJO A;  4AVA A;  2K5T A;  3EC4 A;  4CGN A;  4DUK A;  4BPX B;  1IY7 A;  3P2F A;  4RI1 A;  1Y9W A;  3T8W A;  3BJ7 A;  2V8D A;  4MY0 A;  2J9A A;  3FX6 A;  3KAS A;  3TO6 A;  1Z8L A;  2AFU A;  5HKW A;  2PJB A;  2WZN A;  4OID A;  2FM4 A;  3PBB A;  1CPS A;  3KL9 A;  3O8Z A;  2ZEL A;  3BUM B;  2VEZ A;  2EZB A;  5EMI A;  1S7F A;  3MN8 A;  4GS4 A;  3IWW A;  1B87 A;  4KZT A;  3NH5 A;  3PGP A;  4A4B A;  4Q36 A;  4WJB A;  4EFD A;  2AUM A;  3EO4 A;  3KZW A;  1CP7 A;  4OP4 A;  4PXB A;  4UWI A;  2PSW A;  3FJU A;  3EZA A;  5K99 A;  2PJ7 A;  4CAF A;  4QVT A;  4C68 A;  3TFY A;  5K8M A;  1YVH A;  2FIA A;  5J8C A;  4NXY A;  5AG6 A;  4H2K A;  3VAT A;  3S9N A;  3OWC A;  2JEW A;  4R87 A;  2VZZ A;  5F47 A;  1XF1 A;  4K30 A;  1NBW A;  1I1D A;  2IQ6 A;  3K4I A;  4NGM A;  2CNT A;  3VRO A;  2OOT A;  4GPL B;  4MI4 A;  2O28 A;  2PJ8 A;  2ZEP A;  3TE4 A;  4E5S A;  2HC9 A;  1Q2Y A;  3PT1 A;  3B3W A;  3PB8 X;  4HNY B;  3IJ3 A;  4AVC A;  1WK4 A;  5K8O A;  1MJA A;  1Y7E A;  1XBU A;  2ABZ A;  2ZED A;  3VRP A;  3D68 A;  4PXC A;  3QAY A;  1B6B A;  3PLF B;  4PK2 A;  4KOV A;  4A30 A;  1NMT A;  1M4G A;  2P6F A;  2POK A;  3EXN A;  2B0A A;  1BAV A;  1NSA A;  1LAN A;  2Z3M A;  4ORF A;  4ONW A;  4P6Y A;  1U6M A;  1A2Z A;  2AE6 A;  2Z11 A;  3D7F A;  3DR6 A;  3ISZ A;  2ZEO A;  5A28 A;  4YWY A;  1T36 B;  2R82 A;  2X0S A;  5AG4 A;  3PFV A;  2PJ6 A;  4OC2 A;  3TLB A;  4C9U A;  4CRY B;  1YK3 A;  4L89 A;  3TX8 A;  3CPA A;  2PQ8 A;  3T9Y A;  1QSN A;  1BOB A;  2B58 A;  5AGE A;  3R9G A;  2FS5 A;  4C2Z A;  2ZXV A;  1LCP A;  2QEC A;  5HKZ A;  3TOB A;  4FD7 A;  1A9X B;  2FE7 A;  4DYO A;  1PCA A;  2C6G A;  4R6T A;  1CE8 B;  4H1H A;  4KVX A;  3EFA A;  3TO9 A;  3EY5 A;  2EZC A;  3GUX A;  3ZNI A;  4MY3 A;  5KTA A;  3S6K A;  3TT2 A;  4TJX A;  4XPD C;  2E28 A;  2OZH A;  5G1Z A;  4C7H A;  1J4J A;  2Q0Y A;  4BTF A;  5LYI A;  3T05 A;  1R43 A;  1R3N A;  5BWA B;  2KCW A;  2XPO A;  1TF9 A;  4KVM E;  1TKF A;  4C8A A;  3JVN A;  1VHS A;  4E2A A;  2NMT A;  5FD8 A;  1XMT A;  5CNP A;  4YGO A;  3SI2 A;  4C9E A;  2YGW A;  2YNC A;  4BD9 A;  4MCR A;  2JDD A;  3IO1 A;  3LD2 A;  2Q7B A;  5F46 A;  2PJA A;  1S60 A;  2QML A;  3PB6 X;  1ZL0 A;  4M8D A;  1EO0 A;  1ZLH A;  3EZB A;  2EUI A;  1IGB A;  5J8F A;  3SR3 A;  8CPA A;  2EK9 A;  1Q5X A;  1VBG A;  3GLJ A;  1KUY A;  3B3C A;  1ZO0 A;  4B13 A;  2V8G A;  5I4M A;  4MJ8 A;  3WC7 A;  1QSR A;  4P10 A;  5D8N A;  3SXN A;  2OR4 A;  1OZP A;  2PJC A;  4MHD A;  4M3S A;  3TLY A;  2I00 A;  4C2Y A;  3BI0 A;  4E8O A;  3LOD A;  1ON0 A;  1HEE A;  2EVN A;  3PB7 X;  2C5Q A;  5JPH A;  3BUX B;  1Z8X A;  2CNM A;  1P4N A;  1ZG9 A;  3VRR A;  1L0C A;  3C26 A;  4G1P A;  4KOT A;  3GIU A;  2V8V A;  4KSF A;  3FRM A;  1PYT B;  4TWE A;  2P0W A;  5LRG A;  5KTD A;  4YN3 A;  1LFW A;  2AFX A;  1Y9K A;  1BO4 A;  2XEI A;  2EK8 A;  4MBU A;  4R7M A;  4CO9 A;  3D2P A;  4F9U A;  4KOX A;  4M6H A;  1CJW A;  3KGQ A;  3KKW A;  4KOR A;  5HXD A;  5HMN A;  3SHP A;  1Q2D A;  4CRZ B;  4Z65 A;  4KSA A;  3SI0 A;  4XPL A;  2ZOF A;  4ZX9 A;  1IYL A;  3D67 A;  5F1Y A;  3CXP A;  1WJT A;  5DWN A;  2Y0M A;  3V38 A;  1J3L A;  3P2H A;  3SXO A;  2VKZ G;  4NGT A;  2EO8 A;  2ODF A;  4LQ6 A;  3NE8 A;  3FNC A;  3ZZI A;  2EZA A;  1N71 A;  4X3R A;  2Q4Y A;  2HQY A;  4P44 A;  1WVM A;  4HNW B;  4NGS A;  4J0N A;  3PFE A;  2RB7 A;  3HUV A;  5IB9 A;  4OLL A;  1V6C A;  3GY9 A;  4UEF A;  3S6F A;  2GAN A;  3E0K A;  2J8R A;  4A2Z A;  2YJV A;  4UIA A;  1BLL E;  2BEI A;  2VL1 A;  3CXQ A;  2AFM A;  4JJX A;  4AG9 A;  2Y1N A;  5HVH A;  1LAM A;  1X10 A;  2Z10 A;  4CS0 B;  3VTA A;  4JXQ A;  4NGN A;  4A39 A;  1YLE A;  4WWV A;  1Q7L A;  2OZU A;  4B12 A;  4CYN A;  3FED A;  4TJV A;  4NGQ A;  2FT0 A;  2N3A B;  4GM5 A;  1EZA A;  3TLG A;  1AMP A;  2C1C A;  4C85 A;  4UFW A;  1KUV A;  1IYK A;  4UA3 A;  4P4D A;  3H8E A;  3D7D A;  5I0C A;  2WSA A;  2HWG A;  3U88 C;  4B6Z A;  4JYW A;  4X5K A;  2HUZ A;  2B5G A;  4P45 A;  3SJG A;  3T0T A;  4W9Y A;  4F6A A;  2QYV A;  3RBU A;  2OB0 A;  3B3T A;  2Z3O A;  2WUU A;  4A95 A;  2FIW A;  3K9U A;  4F9V A;  3EZE A;  3D7G A;  1S7L A;  1ZLI A;  2XPP A;  1YW4 A;  3CZX A;  4M6I A;  3R96 A;  4UCN A;  3RYO A;  3BUW B;  3EIF A;  5HH1 A;  3WAB A;  2DPT A;  1KC7 A;  2EBJ A;  4MMO A;  4Y49 C;  1EZB A;  3IU1 A;  5BY0 A;  1QSO A;  2PR1 A;  1DIK A;  2DEA A;  3CT9 A;  3MRU A;  4M85 A;  4Q38 A;  4UBR A;  4U9Z A;  1I12 A;  5F5X A;  1IIC A;  2BL1 A;  3NA6 A;  3R1K A;  5LYF A;  3C8O A;  5F48 A;  3I6S A;  1NE9 A;  1VGY A;  1K4J A;  2PRQ A;  3KI9 A;  3T5M A;  1DTD A;  3BXM A;  1YVO A;  3OB2 B;  1Z8W A;  1DE4 C;  2O4H A;  3G3S A;  4MXU A;  4KOW A;  2OLS A;  3UY5 A;  2QIR A;  3PRT A;  3JUW A;  1Z9U A;  3B7I A;  4II9 A;  4JWP A;  4CDK A;  5F09 A;  1FT7 A;  1FY7 A;  3B3S A;  1VHE A;  2ZEH A;  1V0C A;  1XIX A;  4EWT A;  3NFQ A;  1IU8 A;  4IIY A;  3DSB A;  4PSX A;  4ZY0 A;  5G22 A;  3D2M A;  4ZY1 A;  3IC1 A;  2AFO A;  4ZY2 A;  2XEG A;  2PJ0 A;  2DIK A;  1M4D A;  2PJ3 A;  1QQ9 A;  2B3U A;  3H8F A;  4FAI A;  3DLJ A;  3IGR A;  4IHM A;  3N5F A;  3QNV A;  4KS9 A;  1S7N A;  3TO7 A;  4UFX A;  3W6S A;  3LWU A;  4C2X A;  4DNC A;  1MJB A;  3BI1 A;  5E96 A;  3T07 A;  2PC1 A;  4OC4 A;  2Q4V A;  4COB A;  2ZEM A;  4FD5 A;  3TLG B;  2DLA A;  4KUB A;  4F0X A;  2OZG A;  1XFO A;  3PB9 X;  3BJ8 A;  1JDB C;  4RUH A;  2Q51 A;  3S9M A;  4R76 A;  3G8W A;  3OB1 B;  4RN7 A;  3B3V A;  1Z4R A;  2A4N A;  4CYO A;  3I9S A;  3G23 A;  2CTC A;  3S6G A;  4Y49 B;  2Z0Z A;  3GJZ A;  5K8P A;  2IL4 A;  2JEV A;  4Q7A A;  4XNH B;  3HPH E;  1TXR A;  4MFP A;  5IB0 A;  4UCM A;  1QSM A;  1XE4 A;  4MHN A;  4XPD B;  3WT4 A;  4CGM A;  4QBJ A;  2CNS A;  5K8N A;  4OAD A;  2ZEG A;  2B4D A;  3GB0 A;  5F9M A;  2ZW6 A;  1UWY A;  2YND A;  3PBE A;  4OME A;  5H86 A;  4JD6 A;  1F2O A;  2NYQ A;  3FXT A;  5DS0 A;  3RO0 A;  3DDD A;  1C30 B;  1VI4 A;  3FBU A;  4KVO E;  2Z3K A;  3IU2 A;  3NH4 A;  4IUS A;  4L8A A;  4R9M A;  5AG7 A;  4JXR A;  5AG5 A;  2RC4 A;  4U9Y A;  1R61 A;  1R57 A;  4A4C A;  2CTB A;  2PIY A;  2V77 A;  4KLW A;  3RZA A;  4A38 A;  4MFZ A;  3VAR A;  4C8P A;  2GLF A;  2PJ2 A;  4C84 A;  1S5K A;  3TLC A;  3S9L A;  3V8I A;  1GYT A;  4AXV A;  4BIN A;  3N7Z A;  1YRE A;  1JWQ A;  5LYD A;  3R9F A;  3V7Z A;  5J3X A;  3QAH A;  4MHY A;  4NJR A;  2IMO A;  4C9R A;  4B5P A;  2GIV A;  2CIJ A;  2QJ8 A;  2DF5 A;  1KZF A;  2G9D A;  1M4L A;  3DNS A;  3D4U A;  4UWJ A;  3TYX A;  4OC0 A;  3KQZ A;  3S6H A;  4U5Y A;  2CBL A;  2B4J C;  4C99 A;  4QC6 A;  3JRU A;  4FWU A;  4A33 A;  1M4I A;  5A27 A;  5JGF A;  2ZEE A;  4C8F A;  2C6C A;  2WYR A;  4F0Y A;  1TIQ A;  4H6Z A;  2Z3P A;  2O53 A;  2PE3 A;  1ELM P;  2XPL A;  4NEX A;  4MFL A;  4OKO A;  4OC5 A;  2OU2 A;  1B47 A;  2GE3 A;  4KSI A;  2PR8 A;  4XPK A;  3TTH A;  2BUE A;  1UFH A;  4R57 A;  4A31 A;  1CS0 B;  2XEJ A;  2AFZ A;  2BCO A;  2X7B A;  1WWZ A;  2G3A A;  1OBR A;  2VBQ A;  4KOY A;  3RNZ A;  4M6G A;  7CPA A;  2OH1 A;  5G21 A;  4BPW B;  3H4Q A;  3W6X A;  2ANP A;  5IR2 A;  4CPA A;  3HPG G;  1TKH A;  4UEZ A;  4NCZ A;  4CAX A;  4BBH A;  1VBH A;  2Y1M A;  3IWE A;  5DWM A;  3L2N A;  2ZEN A;  1Y0Y A;  4GXH A;  3FMC A;  4P4E A;  3BLN A;  2FXF A;  2UV8 G;  1AUG A;  3PFO A;  5JQ4 A;  1ZG7 A;  2H5M A;  1JQG A;  4MCP A;  2VQY A;  2B4B A;  4FD4 A;  3GKR A;  1ELL P;  4MFK A;  3KR5 A;  5IX3 A;  2FCK A;  3IEH A;  1GGO A;  4YU9 A;  4NF1 A;  1XMB A;  5D29 A;  1GHE A;  4MJX A;  3CDX A;  2BOA A;  3T90 A;  1BPN A;  3SJF A;  2Q43 A;  1C3O B;  5HKY A;  1M44 A;  1VKC A;  2Q4Z A;  2REF A;  3A9L A;  5IV0 A;  4C8C A;  4H89 A;  2YNE A;  4CDJ A;  4KOU A;  2HB6 A;  1KBL A;  1JDE A;  3TLE A;  2MP0 A;  5F13 A;  4IK2 A;  1Q2C A;  3FYN A;  3VWE A;  2JBK A;  3F8K A;  4HNX B;  4LQG A;  3PP9 A;  4A37 A;  2PRB A;  4IIX A;  4X2T A;  1LOK A;  2GLJ A;  1ZYM A;  3BHX A;  3I3G A;  2Z3N A;  4LX9 A;  5HVG A;  3NOJ A;  1QST A;  4NGP A;  3U1B A;  2PJ1 A;  1CP6 A;  3F5B A;  4H6U A;  5EC4 A;  3WC6 A;  4MCQ A;  5ELY A;  1AYE A;  2J8M A;  2Q7S A;  2ZW7 A;  3D66 A;  3VRN A;  1VHO A;  3FH4 A;  4ONU A;  3WC5 A;  4CYP A;  4ZX8 A;  5LRJ A;  2C27 A;  5C82 A;  1ARL A;  3LMS A;  3VWD A;  5HVF A;  1XEB A;  5JVL A;  3WR7 A;  3IWG A;  1YVK A;  2WPW A;  3SI1 A;  1MK4 A;  1F57 A;  3PB4 X;  4C9A A;  5H84 A;  4P4I A;  1BXR B;  2ZW4 A;  3F9K C;  2D4O A;  3H5Z A;  4ZYQ A;  2P6E A;  3KHZ A;  4KUA A;  4C7I A;  4TNU A;  3B35 A;  2I3C A;  1NSL A;  5CBM A;  4R3K A;  1LRZ A;  3FEE A;  3SJX A;  5F49 A;  4C8U A;  1YX0 A;  1KWM A;  3H8G A;  1M6V B;  4FD6 A;  5GCN A;  4NGR A;  1RTQ A;  4E94 A;  6CPA A;  1YME A;  3JTK A;  4B11 A;  1KUX A;  2GU2 A;  2V8H A;  1FNO A;  4AB7 A;  2D0P A;  1HDQ A;  1YLO A;  2B4D B;  2F5I A;  3PEI A;  2PJ4 A;  1IOI A;  2WPX A;  1CBX A;  1IB1 E;  2F7V A;  4XNH C;  1ARM A;  3CXS A;  2DXQ A;  2RFH A;  3DGV A;  1Y0R A;  2AFW A;  4UEE A;  2R8V A;  3BUN B;  2Q44 A;  4QUS A;  3FIX A;  4I49 A;  1YR0 A;  4DJL A;  5JH9 A;  3VH9 A;  3W91 A;  2C6P A;  4CAW A;  2ZOG A;  4UF4 A;  1XRY A;  4ZI6 A;  4C8T A;  3B8G A;  4EME A;  1YSJ A;  4IF5 A;  1TKJ A;  1IOF A;  5KTC A;  4F8Z A;  4OC3 A;  3MGD A;  2CY2 A;  5C88 A;  2REE A;  4JVO A;  3KR4 A;  3VGO A;  1M1D A;  3K9T A;  4JLY A;  4X8I A;  4MRI A;  3RAM A;  4PXD A;  4P4J A;  2AFS A;  4COG A;  4A94 A;  3TLZ A;  3R9E A;  3BUO B;  2BSW A;  4ZBG A;  4MCS A;  3FEC A;  3NE7 A;  4PPZ A;  5FVJ A;  4BMH A;  2PIZ A;  3TCV A;  5JM6 A;  3K2K A;  5LYL A;  3TOA A;  3FB3 A;  1I21 A;  1VIX A; 
#chains in the Genus database with same CATH homology
 1CG2 A;  2GP4 A;  4OC1 A;  2PJ5 A;  4C9V A;  2PJ9 A;  1HDU A;  4UIB A;  1YW6 A;  3D7H A;  1F2P A;  1BPM A;  1LAP A;  3KQX A;  4MHP A;  5CPA A;  1CPX A;  2JBJ A;  3KHX A;  2FVG A;  2PVV A;  2EWB A;  2PCU A;  4NFR A;  3I74 A;  3B2Y A;  3IFE A;  3ISX A;  1Y9Z A;  5THW A;  3SJE A;  2F8H A;  5LRK A;  4IAV A;  2GRE A;  3HLP A;  4R8F A;  3ICU A;  2CF4 A;  3NFZ A;  4FUU A;  2PVW A;  1QMU A;  2BO9 A;  2XEF A;  4P4F A;  4PXE A;  4K3N A;  1Z5R A;  4FBE A;  3FVL A;  3FF3 A;  3I1U A;  2ZEF A;  4C86 A;  2QVP A;  2NSM A;  3TC8 A;  1H8L A;  1ZG8 A;  1CX8 A;  2IJZ A;  4JZ0 A;  4KNG E;  1Z2L A;  1TF8 A;  3NH8 A;  4P4B A;  4YN3 A;  3CPX A;  1EE3 P;  5J1Q A;  4OIW A;  4MHZ A;  4NJQ A;  4O23 A;  4PQA A;  1XJO A;  4DUK A;  1IY7 A;  3T8W A;  2V8D A;  3FX6 A;  2J9A A;  3KAS A;  1Z8L A;  2AFU A;  4OID A;  2PJB A;  2WZN A;  3PBB A;  1CPS A;  3KL9 A;  2ZEL A;  3MN8 A;  3IWW A;  3NH5 A;  4WJB A;  4EFD A;  3KZW A;  4OP4 A;  1CP7 A;  4PXB A;  3FJU A;  2PJ7 A;  5K8M A;  4H2K A;  3VAT A;  3S9N A;  2JEW A;  1XF1 A;  2IQ6 A;  4NGM A;  2OOT A;  2PJ8 A;  2ZEP A;  2HC9 A;  3B3W A;  3PB8 X;  3IJ3 A;  5K8O A;  2ZED A;  1Y7E A;  1XBU A;  2ABZ A;  3D68 A;  4PXC A;  2POK A;  1BAV A;  1NSA A;  1LAN A;  4ONW A;  4P6Y A;  5I4M A;  3D7F A;  3ISZ A;  2ZEO A;  4YWY A;  2PJ6 A;  4OC2 A;  4C9U A;  3TX8 A;  3CPA A;  1LCP A;  4DYO A;  1PCA A;  2C6G A;  4R6T A;  3GUX A;  4TJX A;  5LYI A;  1R43 A;  1R3N A;  1TF9 A;  4C8A A;  1TKF A;  3SI2 A;  4C9E A;  4BD9 A;  4MCR A;  3IO1 A;  2PJA A;  3PB6 X;  1ZLH A;  1IGB A;  8CPA A;  2EK9 A;  3GLJ A;  3B3C A;  2V8G A;  3WC7 A;  4P10 A;  5D8N A;  2OR4 A;  2PJC A;  3BI0 A;  3PB7 X;  1HEE A;  2C5Q A;  1ZG9 A;  4G1P A;  2V8V A;  4TWE A;  1PYT B;  5LRG A;  1LFW A;  2AFX A;  2EK8 A;  2XEI A;  4R7M A;  4F9U A;  3KGQ A;  5HXD A;  4Z65 A;  3SI0 A;  2ZOF A;  4ZX9 A;  3D67 A;  3V38 A;  4NGT A;  4X3R A;  4P44 A;  1WVM A;  4NGS A;  3PFE A;  2RB7 A;  3HUV A;  5IB9 A;  1V6C A;  4UEF A;  4UIA A;  1BLL E;  2VL1 A;  5HVH A;  2AFM A;  1LAM A;  3VTA A;  4NGN A;  4A39 A;  4WWV A;  1Q7L A;  4TJV A;  3FED A;  4NGQ A;  4GM5 A;  1AMP A;  2C1C A;  4C85 A;  4P4D A;  3H8E A;  3D7D A;  4B6Z A;  4JYW A;  4P45 A;  3SJG A;  4W9Y A;  2QYV A;  3RBU A;  3B3T A;  4F9V A;  3D7G A;  1ZLI A;  1YW4 A;  3EIF A;  3WAB A;  4MMO A;  2DEA A;  3CT9 A;  3MRU A;  3NA6 A;  3I6S A;  5LYF A;  1VGY A;  2PRQ A;  3KI9 A;  1DTD A;  3BXM A;  1DE4 C;  2O4H A;  4MXU A;  3PRT A;  3B7I A;  4CDK A;  5F09 A;  1FT7 A;  3B3S A;  1VHE A;  2ZEH A;  4EWT A;  4ZY0 A;  4ZY1 A;  3IC1 A;  2AFO A;  4ZY2 A;  2XEG A;  2PJ0 A;  2PJ3 A;  1QQ9 A;  3H8F A;  4FAI A;  3DLJ A;  4IHM A;  3N5F A;  3QNV A;  3LWU A;  3BI1 A;  4OC4 A;  2ZEM A;  1XFO A;  3PB9 X;  4RUH A;  2Q51 A;  3S9M A;  4R76 A;  3B3V A;  2CTC A;  5K8P A;  4Q7A A;  1TXR A;  3WT4 A;  4MHN A;  5K8N A;  2ZEG A;  3GB0 A;  1UWY A;  3PBE A;  4OME A;  5DS0 A;  1F2O A;  2NYQ A;  3NH4 A;  2CTB A;  2PIY A;  2V77 A;  4A38 A;  3RZA A;  3VAR A;  4C8P A;  2GLF A;  2PJ2 A;  4C84 A;  3S9L A;  4AXV A;  1GYT A;  5LYD A;  3V7Z A;  4MHY A;  4NJR A;  2IMO A;  4C9R A;  2CIJ A;  2QJ8 A;  2G9D A;  1M4L A;  3D4U A;  4OC0 A;  3KQZ A;  4C99 A;  3JRU A;  4FWU A;  5JGF A;  2ZEE A;  4C8F A;  2C6C A;  2WYR A;  2O53 A;  2PE3 A;  1ELM P;  4OKO A;  4OC5 A;  4KSI A;  2XEJ A;  2AFZ A;  2BCO A;  1OBR A;  7CPA A;  2ANP A;  5IR2 A;  4CPA A;  1TKH A;  4UEZ A;  3L2N A;  2ZEN A;  1Y0Y A;  3FMC A;  4P4E A;  3PFO A;  1ZG7 A;  1JQG A;  4MCP A;  1ELL P;  3KR5 A;  3IEH A;  4YU9 A;  1XMB A;  5D29 A;  3CDX A;  2BOA A;  1BPN A;  3SJF A;  2Q43 A;  2Q4Z A;  4C8C A;  4CDJ A;  2HB6 A;  4IK2 A;  2JBK A;  4LQG A;  4A37 A;  4X2T A;  1LOK A;  2GLJ A;  3BHX A;  5HVG A;  4NGP A;  2PJ1 A;  1CP6 A;  3WC6 A;  4MCQ A;  5ELY A;  1AYE A;  3D66 A;  1VHO A;  3FH4 A;  3WC5 A;  4ZX8 A;  5LRJ A;  1ARL A;  3LMS A;  5HVF A;  3SI1 A;  1F57 A;  3PB4 X;  4C9A A;  4P4I A;  4ZYQ A;  3KHZ A;  4TNU A;  3B35 A;  2I3C A;  5CBM A;  3FEE A;  3SJX A;  4C8U A;  1KWM A;  3H8G A;  4NGR A;  1RTQ A;  6CPA A;  1YME A;  2GU2 A;  2V8H A;  1FNO A;  1HDQ A;  1YLO A;  3PEI A;  2PJ4 A;  1CBX A;  2F7V A;  1ARM A;  2RFH A;  3DGV A;  1Y0R A;  2AFW A;  4UEE A;  4DJL A;  5JH9 A;  3VH9 A;  4ZI6 A;  2C6P A;  2ZOG A;  4UF4 A;  1XRY A;  4C8T A;  4EME A;  1YSJ A;  1TKJ A;  4F8Z A;  4OC3 A;  3KR4 A;  3K9T A;  4X8I A;  4MRI A;  3RAM A;  4PXD A;  4P4J A;  2AFS A;  4A94 A;  4MCS A;  3FEC A;  4PPZ A;  2PIZ A;  5JM6 A;  3K2K A;  5LYL A;  3IIB A;  1VIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...