2XEJA

Human glutamate carboxypeptidase ii in complex with arm-m4, urea- based inhibitor
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVQPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 264
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xejA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xejA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xejA02
3S9LA 1YSJA 4MHPA 5LRKA 4ONWA 4X3RA 2WYRA 4OC3A 4CDJA 1M4LA 5LRGA 2PJ3A 3B3CA 1BPNA 2XEGA 3B3WA 4PPZA 3D67A 2I3CA 4C9AA 2ZEHA 1TKHA 1XF1A 3I1UA 2GREA 3MRUA 1VIXA 1Z8LA 5JM6A 5IB9A 2QJ8A 4C8UA 2PJ2A 2PVVA 2AFUA 4C8AA 4A38A 1Y0RA 1XRYA 4TJXA 3KHZA 2OR4A 2BOAA 4KSIA 4MHZA 4B6ZA 3NA6A 4A37A 4C8CA 5D8NA 1TKFA 3WC7A 4WWVA 2ANPA 4W9YA 4FWUA 3IFEA 3NH5A 4KNGE 1Y0YA 2IJZA 2XEFA 4YN3A 3NH4A 3MN8A 2BO9A 3KQXA 2CTBA 4YWYA 1WVMA 2NSMA 1VHEA 4OIDA 1XFOA 1ARLA 3FJUA 1PYTB 2NYQA 3B7IA 3KGQA 5K8MA 3LMSA 1R3NA 3GUXA 2JEWA 2POKA 2C6GA 2PJ0A 1LCPA 1YW6A 4C8TA 4ZY1A 2PJ4A 4MCSA 4MCRA 4R76A 4P4JA 2PVWA 4BD9A 1AYEA 3DLJA 4X8IA 3KI9A 3V38A 2ZEDA 3BXMA 1CPSA 3B3TA 1F57A 2ZEEA 5LYIA 4P44A 4NGNA 3SI2A 5CPAA 2JBJA 4C9EA 2RB7A 4ZY2A 4PQAA 2ZEMA 3PB8X 3TX8A 3SJFA 1ZG8A 3PEIA 1ELMP 3BI0A 1HDUA 4FAIA 5LYDA 4RUHA 4C86A 2BCOA 5THWA 1DE4C 2GLFA 1ZG7A 1FNOA 2HC9A 2CIJA 4UEFA 1FT7A 2QVPA 3IEHA 4MMOA 1QMUA 4OMEA 2AFWA 4C84A 5I4MA 3ICUA 5CBMA 4PXBA 2PJ7A 4PXCA 1GYTA 2WZNA 3B3VA 2ZEGA 1ARMA 1Y9ZA 3KR5A 3B2YA 3JRUA 4DUKA 3FMCA 3IJ3A 4NFRA 2PRQA 2GU2A 4H2KA 3VTAA 1ZLHA 3HLPA 2EWBA 1Z5RA 3I6SA 1ELLP 3LWUA 4CDKA 4OC1A 2DEAA 3I74A 6CPAA 2C1CA 4PXDA 1EE3P 5F09A 2EK9A 2PJ9A 4P45A 3B3SA 2PIZA 3D7HA 3FEDA 4ZYQA 2Q51A 4K3NA 1LAPA 3SI0A 2CTCA 4YU9A 4R6TA 4P4IA 4FUUA 2V8VA 5LRJA 3NFZA 3SI1A 4AXVA 4P4FA 2V77A 1VGYA 3KZWA 3ISXA 3ISZA 4A39A 1H8LA 1PCAA 2VL1A 4ZX8A 1ZLIA 1KWMA 3GLJA 2PJ6A 4OC0A 3WT4A 3EIFA 3D66A 4Z65A 4OC4A 3B35A 3HUVA 4C9RA 3KL9A 3K2KA 5K8NA 2IMOA 3WC5A 5HVGA 3KHXA 3PFEA 2ZEOA 1BAVA 1HDQA 2HB6A 1CP7A 3PBEA 4UEEA 4OP4A 3WABA 3SJEA 4UEZA 4CPAA 1LAMA 3FEEA 3PBBA 4NGRA 1TXRA 4TWEA 1OBRA 2PJ8A 3FECA 1LFWA 2AFSA 1Y7EA 4EMEA 1YW4A 3H8GA 4G1PA 4FBEA 1XMBA 2PJAA 3QNVA 4DYOA 2QYVA 8CPAA 2O4HA 3V7ZA 5J1QA 5LYLA 5K8PA 2O53A 3DGVA 2EK8A 2C6PA 1RTQA 4ZY0A 7CPAA 1F2PA 4EFDA 4F9VA 4C8FA 1TKJA 2PJ1A 3S9NA 5D29A 3FX6A 2F8HA 5ELYA 3D68A 4R7MA 4WJBA 3BHXA 1CP6A 1LOKA 2AFXA 3D7DA 1LANA 1JQGA 3H8EA 3FH4A 4F8ZA 2ZEFA 1CG2A 4IAVA 3VATA 3IWWA 2V8HA 4NJRA 4OKOA 4PXEA 1QQ9A 3IIBA 3FF3A 4Q7AA 2PJBA 2J9AA 2XEIA 1CBXA 4DJLA 3KASA 2RFHA 2C6CA 3PFOA 2AFZA 5HXDA 4OC5A 3PB4X 1R43A 5JGFA 3IC1A 4MRIA 4C8PA 2IQ6A 5HVHA 5DS0A 2F7VA 4MCPA 4NGPA 3L2NA 4MXUA 1CPXA 4TNUA 4OIWA 4UF4A 1TF9A 2PJCA 2G9DA 2V8DA 3CPXA 1VHOA 3CT9A 3VARA 2CF4A 1NSAA 2ZELA 4ZI6A 3RZAA 2JBKA 3VH9A 4P4DA 3KR4A 2PJ5A 3RBUA 1V6CA 1TF8A 4A94A 4LQGA 1IY7A 3SJGA 3CDXA 3K9TA 1BLLE 4MHYA 4O23A 4C9UA 3D7FA 3PRTA 1AMPA 4C85A 3BI1A 3IO1A 3D7GA 5LYFA 4GM5A 3RAMA 2PCUA 1F2OA 4P4EA 4C9VA 4EWTA 3D4UA 3PB9X 2Q43A 5K8OA 4JZ0A 3N5FA 4MCQA 3PB6X 2ABZA 1XBUA 2FVGA 5JH9A 2AFOA 1Q7LA 2ZOGA 4UIBA 4R8FA 5HVFA 2PIYA 3WC6A 4F9UA 4NGSA 3SJXA 1IGBA 3KQZA 2ZEPA 3FVLA 2Q4ZA 4NGMA 3TC8A 1YLOA 1BPMA 4P10A 2PE3A 1DTDA 1ZG9A 3CPAA 4JYWA 2GLJA 3GB0A 2OOTA 2ZENA 4MHNA 2XEJA 4NJQA 4X2TA 4NGTA 4ZX9A 1XJOA 3S9MA 1Z2LA 2AFMA 4UIAA 4OC2A 4IHMA 3NH8A 1HEEA 1UWYA 4P4BA 3T8WA 3PB7X 4TJVA 4NGQA 2ZOFA 1YMEA 4IK2A 3H8FA 4P6YA 1CX8A 2V8GA 4C99A
chains in the Genus database with same CATH superfamily
3S9LA 1A2ZA 1YSJA 2EBJA 2YNCC 1XOVA 3PP9A 4MHPA 4ONWA 4X3RA 2WYRA 4PK2A 4OC3A 1M1DA 1M4LA 3CXSA 4CDJA 4E5SA 5LRGA 2PJ3A 3B3CA 1BPNA 2XEGA 3B3WA 2Q7BA 4PPZA 2EZAA 3D67A 2I3CA 4C9AA 2ZEHA 1TKHA 5AG5A 2WSAA 1XF1A 3I1UA 2XPLA 2P0WA 1YGHA 3N7ZA 2GREA 3MRUA 1VIXA 2FIWA 3S6GA 1Z8LA 5JM6A 3DDDA 5LRKA 4LUAA 1Z8WA 5IB9A 2QJ8A 4YFJA 3JUWA 2VQYA 4C2XA 4C8UA 3NE8A 5EMIA 2PJ2A 2PVVA 2AFUA 2P6EA 1ZYMA 1VI4A 4C8AA 1I21A 1KBLA 1J3LA 2Z3NA 4A38A 1Y0RA 4MFQA 4H1HA 1M4IA 3VRNA 3BUNB 2P6FA 4M6IA 2BUEA 4INJA 3SXOA 1XRYA 4TJXA 4CYQA 1MJBA 3KHZA 3GIUA 4KSAA 2OR4A 2BOAA 4KSIA 4MHZA 2P6GA 4B6ZA 2AUMA 1AUGA 3NA6A 2HI6A 2PC1A 4KOXA 4BBHA 2XPNA 3TCVA 4B5PA 4A37A 3T5MA 4C8CA 2JDCA 2VBQA 5D8NA 3EXNA 3R9GA 1TKFA 3R96A 3WC7A 5IB0A 4WWVA 3GJZA 2ANPA 2B3UA 2Z0ZA 5ISVA 3IU1A 2Z3PA 4EYSA 2FM4A 3EC4A 3IGRA 4KVXA 4W9YA 4FWUA 4XPDB 5F13A 2Z3OA 3IFEA 3NH5A 2J8NA 5F5XA 4DNCA 1MJ9A 4CGLA 2R7HA 4KNGE 1Y0YA 1X10A 2IJZA 1IIDA 2XEFA 4YN3A 3R95A 4JD6A 3NH4A 3MN8A 4FD7A 4NXYA 2B4BA 4XNHB 3T90A 2BO9A 3KQXA 2CTBA 4YWYA 1P4NA 2A4NA 2EVNA 4HPSA 4R3LA 1WK4A 2FE7A 5GCNA 1WVMA 4IIYA 2NSMA 1VHEA 2JEVA 2REFA 1XFOA 3BUWB 1ARLA 2VZZA 1PYTB 3FJUA 4OIDA 1Q2DA 3TOBA 2NYQA 3UY5A 5HKWA 1XEBA 3B7IA 4MFJA 3KGQA 4CGOA 2DPTA 4E0AA 3C26A 5BWAB 5K8MA 3LMSA 3H5ZA 1JDEA 1FBVA 2B4DA 1EZAA 5JVLA 2GP4A 1R3NA 3GUXA 2J8RA 2JEWA 2POKA 2C6GA 3BJ7A 2PJ0A 1SQHA 4E8OA 2Z10A 1QSMA 4LX9A 1LCPA 1YW6A 3DNSA 3RNZA 4C8TA 2JLMA 4ZY1A 1B6BA 2I00A 1LRZA 2PJ4A 4MCSA 3TLAA 4KOUA 4EVYA 4MCRA 4R76A 4P4JA 2PVWA 3TLZA 1Y9KA 4E2AA 1NE9A 2Q4YA 4BD9A 1AYEA 2Q4VA 2CNTA 3DLJA 2D0PA 3PGPA 1M4DA 2PQ8A 4X8IA 2OB0A 3KI9A 4BINA 5IX3A 2ZXVA 3V38A 2ZEDA 3IWEA 3BXMA 5J3XA 1CPSA 1F57A 2WPWA 2ZEEA 3B3TA 4M3SA 3PFVA 3FNCA 4P44A 4U9ZA 2PCNA 3R1KA 1R61A 1N71A 4NGNA 3VRRA 5IR2A 4A2ZA 3TLBA 3KKWA 3SI2A 1Z8XA 1IYLA 2D4OA 2CBLA 1ZO0A 5CPAA 2JBJA 4C68A 4C9EA 2Q7SA 2QECA 4UCPA 3O8ZA 2RB7A 2VI7A 4PQAA 4RI1A 2ZEMA 4ZY2A 3VRQA 5JQ4A 3PB8X 3TX8A 5IV0A 1BXRB 4E94A 3SJFA 1ZG8A 3PEIA 1ELMP 3BI0A 4RR2B 1YVHA 1HDUA 1Y7RA 4OLLA 4FAIA 4ONUA 4OAEA 4UFWA 2B4JC 3F5BA 5LYDA 4KLWA 2B4DB 2Z3LA 4RUHA 4C86A 2BCOA 2ZW7A 3TO9A 4LQ6A 1Z8TA 5THWA 1DE4C 4JXRA 1ZRSA 4X5KA 2GLFA 1ZG7A 1FNOA 2HC9A 2CIJA 1IICA 4UEFA 2CNSA 4A32A 3TE4A 4AG9A 1FT7A 2QVPA 3IEHA 4MMOA 3B8GA 4Q36A 1QMUA 4OMEA 4KVOE 2AFWA 4C84A 5KTAA 5I0CA 5E96A 4U9YA 3RYOA 3VWEA 2YGWA 4M6HA 4JVOA 4KVME 4NCZA 3W6SA 4B10A 5I4MA 3ICUA 3FYNA 3RO0A 2MP0A 1NSLA 5CBMA 4OADA 4PXBA 2DXQA 2PJ7A 4A33A 1T36B 4R9MA 2VKZG 3E0KA 2AE6A 4PXCA 4JJXA 1GYTA 2WZNA 3B3VA 2Y0MA 4MJ8A 4AVAA 3T0TA 2ZEGA 1ARMA 1Y9ZA 2PRBA 2EZBA 3NOJA 3KR5A 3F0AA 3B2YA 4B11A 3JRUA 2Z3KA 4DUKA 3FMCA 4BPUB 4PK3A 3TTHA 5DWMA 2K5TA 3IJ3A 4NFRA 2YJTA 2PRQA 2GU2A 3F8KA 5F46A 1IOIA 1KEEB 2X7BA 4H2KA 1KZFA 3VTAA 2I79A 1ZLHA 3HLPA 5AGEA 2EWBA 3DR8A 3F9KC 1Z5RA 2GIVA 3I6SA 1ELLP 3LWUA 4CDKA 1UFHA 2JDDA 4OC1A 1Q2YA 2DEAA 4CAVA 3I74A 4CRYB 3TLCA 6CPAA 5G21A 2C1CA 2CXAA 4PXDA 3FBUA 1JWQA 1EE3P 5DWNA 5F49A 5J8CA 3BJ8A 5F09A 2EK9A 4CGPA 3CXQA 3GKRA 1KUVA 3LACA 2WPXA 1L0CA 4NF1A 3ZZIA 2PJ9A 1YVKA 4P45A 2OH1A 3B3SA 2PIZA 2YNEA 3D7HA 3FB3A 4KOVA 2X0SA 3FEDA 1VKCA 1S3ZA 2Q51A 3U88C 2Y1NA 4ZYQA 4BPWB 2HROA 4K3NA 1BOBA 1LAPA 2CNMA 3SI0A 3W6XA 2REEA 5BY0A 1P0HA 2CTCA 2G3AA 1S7LA 2FSRA 4JLYA 4R6TA 4YU9A 5H86A 4P4IA 4FUUA 4KOTA 2V8VA 5LRJA 3ZNIA 2EUIA 3H4QA 3EZBA 2GANA 2UV8G 3NFZA 4M85A 5G20A 3SI1A 3KRVA 1A9XB 4AXVA 4P4FA 2FIAA 2V77A 1VGYA 2VZYA 3D2MA 2QMLA 3OB2B 1YX0A 1EO0A 3KZWA 3ISXA 1CJWA 1OZPA 2BL1A 3ISZA 4FD5A 3I3GA 4A39A 3TLEA 4CGNA 1H8LA 1PCAA 2VL1A 4ZX8A 1ZLIA 1KWMA 3GLJA 3HMJG 2PJ6A 4RS2A 4OC0A 3WT4A 1I12A 4F6AA 1IU8A 4Q38A 3EIFA 4NEXA 1KUYA 3D66A 3W91A 4Z65A 1I1DA 4OC4A 2G3TA 3B35A 3HUVA 4C9RA 3KL9A 2C5QA 3K2KA 5K8NA 2IMOA 2ZW4A 3JVNA 3P2FA 3KHXA 3PFEA 3WC5A 5HVGA 1BAVA 2ZEOA 4MJXA 1QSTA 2OU2A 4U5YA 4BTFA 1HDQA 2FT0A 1CP7A 2HB6A 3PBEA 4J3GA 4NSQA 4OP4A 4UEEA 1QSNA 4KOWA 2R98A 3VRPA 2F5IA 3LD2A 3SJEA 5JYBA 4UEZA 2ODFA 3OB1B 2VXKA 4CGMA 1S60A 5F9MA 4A4CA 1LAMA 4CPAA 3T05A 3FXTA 1C3OB 4IIXA 4MI1A 1X12A 3FEEA 3PBBA 3TLGB 4NGRA 1TXRA 4TWEA 1OBRA 2PJ8A 2C27A 3FECA 1LFWA 1CS0B 2AFSA 4GPLB 1Y7EA 2FCKA 1R57A 4EMEA 3EY5A 1Z4EA 1PU9A 5F48A 4KSFA 1YW4A 3D2PA 3H8GA 4G1PA 4FBEA 1RO5A 1XMBA 1Z9EA 2HV2A 2PJAA 4QB9A 4UA3A 1DIKA 2HWGA 2CY2A 3QNVA 4IUSA 5LYIA 4DYOA 2QYVA 3BLNA 4HNXB 8CPAA 2O4HA 3DR6A 3T9YA 4CAEA 3TOAA 1YK3A 2VEZA 3V7ZA 1CE8B 5J1QA 4R3KA 3TFYA 2QIRA 2FXFA 3QB8A 5LYLA 5K8PA 3DSBA 1EZBA 2O53A 3DGVA 1S7NA 4QC6A 2EK8A 2C6PA 1RTQA 1XMTA 2YNCA 4ZY0A 7CPAA 5JPHA 4JWPA 2RC4A 4MY0A 3TT2A 1F2PA 2Q0YA 3S6KA 4C7HA 4EFDA 2R82A 3A9LA 4CZ1A 2Z11A 4F9VA 4C8FA 1RXTA 4C7IA 5AG4A 3EO4A 5C88A 1TKJA 2PJ1A 3S9NA 1S7KA 2ZPAA 4UCNA 2ZW6A 5D29A 3IU2A 5F47A 3BUXB 3FX6A 1Z9UA 2F8HA 3NFQA 1WWZA 1WJTA 2XPOA 2Y1MA 5ELYA 3D68A 4MY3A 4R7MA 4UFXA 5C82A 4PSXA 4WJBA 3LODA 4II9A 3BHXA 2DLAA 1CP6A 1LOKA 4L8AA 2DIKA 2AFXA 3D7DA 1LANA 1S7FA 1JQGA 3ZJ0A 2OZGA 4MFKA 3H8EA 4GS4A 3GY9A 4RN7A 4Y49B 5AG6A 2Q04A 2KCWA 3FH4A 1U6MA 2YJVA 4MFZA 2B5GB 4YRHA 1NMTA 3EFAA 4F8ZA 2ZEFA 4R57A 1IOFA 3P2HA 1CG2A 4IAVA 3VATA 5EBVA 5F1YA 3IWWA 2V8HA 2EO8A 4NJRA 4OKOA 4PXEA 1IYKA 1QQ9A 3FF3A 1MJAA 2ZW5A 3IIBA 2NMTA 4AG7A 1C30B 1M4GA 4Q7AA 4UCMA 4XPLA 2PJBA 3K4IA 2J9AA 4UBRA 2XEIA 1CBXA 4DJLA 3KASA 4FD6A 4UWJA 4B12A 4CAFA 4ZGYB 2RFHA 5A27A 2C6CA 1MK4A 4HKFA 4KZTA 1NXJA 3VWDA 3PFOA 1GGOA 3NE7A 2AFZA 5G22A 5KTCA 5HXDA 2YNDA 4CYNA 4OC5A 3PB4X 4KS9A 1R43A 1XIXA 4CAWA 1GHEA 3IC1A 5JGFA 4MRIA 4L89A 4CYPA 4C8PA 2IQ6A 4KORA 5HVHA 1XE4A 5DS0A 2GE3A 4HNYB 2D4PA 2F7VA 2PR1A 3R9EA 4MCPA 2H5MA 3QAHA 4NGPA 2PSWA 2E28A 1NBWA 3L2NA 4MXUA 1YR0A 3K9UA 2B58A 5FVJA 1CPXA 4TNUA 1XF8A 4QVTA 1ON0A 3D8PA 4UFVA 4OIWA 2AUNA 3TLGA 5EC4A 4XPDC 5HH1A 4UF4A 1TF9A 3U1BA 4A4BA 2PJCA 3SR3A 2G9DA 2V8DA 3CPXA 1VHOA 3CT9A 3VARA 2CF4A 1NSAA 2BEIA 2ZELA 1YLEA 4KOYA 4ZI6A 3RZAA 2JBKA 2HUZA 4XNHC 3PT1A 4P4DA 3KR4A 3VH9A 4CRZB 2PJ5A 3RBUA 1V6CA 1TF8A 4CO9A 1V0CA 4A94A 3TLYA 1Z4RA 4LQGA 5A28A 1TIQA 1IY7A 3SHPA 2Q44A 2OLSA 4F0XA 1JDBC 3SJGA 3CDXA 1VBHA 3CXPA 3K9TA 1BLLE 4MHYA 4O23A 4C9UA 2N3AB 3D7FA 3JTKA 3PRTA 1AMPA 4I49A 4C85A 3V8IA 3BI1A 3IO1A 4MI4A 3MGDA 4A31A 4BMHA 5HMNA 3D7GA 1J4JA 3TO6A 4FD4A 3QAYA 4B5OA 5LYFA 3C8OA 5HKYA 4MFPA 4GM5A 3HPGG 2ATRA 4AVBA 4B13A 3RAMA 2PCUA 4A30A 5H84A 1F2OA 4P4EA 4H6ZA 4KOSA 5FD8A 4C9VA 4GXHA 4F0YA 4EWTA 3IWGA 2DF5A 3D4UA 2R1IA 3PB9X 2Q43A 5K8OA 4JZ0A 3N5FA 4QBJA 4MCQA 4AB7A 3PB6X 1M44A 5KTDA 3HPHE 4UWIA 1Q5XA 2ABZA 1XBUA 3OAKA 2FVGA 3I9SA 2AFOA 5JH9A 1YVOA 3OWCA 1ZL0A 1CM0A 2EZCA 1Q7LA 1KUXA 4MBUA 2D0OA 2ZOGA 2OZUA 4R8FA 4UIBA 5HVFA 1QSOA 1YQEA 2PIYA 4KUAA 3WC6A 4F9UA 2B5GA 4NGSA 3FRMA 3WR7A 3SJXA 3WABA 1Y9WA 1IGBA 3KQZA 2OZHA 5AXIA 2ZEPA 3FVLA 4PSWA 4PV6A 4B5PB 3G23A 4C2ZA 1S5KA 3OP0A 2Q4ZA 2ARHA 4NGMA 3SXNA 4CYOA 3TC8A 2B0AA 1YLOA 3D3SA 1YREA 1BPMA 2G0BA 2PE3A 2R8VA 3CZXA 4P10A 4A95A 1DTDA 5AG7A 3T07A 1ZG9A 2BSWA 4HNWB 4JXQA 3CPAA 4R87A 4JYWA 2GLJA 3GYAA 5G1ZA 3FIXA 3GB0A 1PUAA 1VHSA 2FS5A 1KC7A 2OOTA 2ZENA 4MHNA 2PR8A 2XEJA 3BUOB 3PZJA 4AVCA 4B14A 4COGA 3G3SA 4ORFA 4ZBGA 4MHDA 3TYXA 1IB1E 2J8MA 1K4JA 4NJQA 4X2TA 4NGTA 3BUMB 4ZX9A 4J0NA 3VROA 4CS0B 2DPSA 3S6HA 4CAXA 1XJOA 3S9MA 1FY7A 1Z2LA 2AFMA 5HKZA 4K30A 1VBGA 4UIAA 1B47A 3S6FA 4OC2A 2FL4A 4IHMA 5J8FA 4IF5A 3NH8A 3EZAA 4Y49C 5K99A 2XPPA 5CNPA 1HEEA 1UWYA 4C2YA 4P4BA 3G8WA 1Q2CA 1BO4A 2B3VA 4KUBA 3T8WA 3VGOA 3PB7X 4H6UA 4QUSA 3R9FA 4TJVA 2Z3MA 4M6GA 4NGQA 4BPXB 2IL4A 2ZOFA 4XPKA 3TO7A 2GFQA 4KLVA 1YMEA 4MFLA 4IK2A 3EZEA 2AJ6A 3H8FA 4YGOA 2WUUA 4P6YA 4M8DA 3PLFB 2O28A 1CX8A 2PDOA 2HQYA 4COBA 4H89A 2V8GA 1M6VB 1QSRA 4C99A 1B87A
chains in the Genus database with same CATH topology
3S9LA 1YSJA 4MHPA 5LRKA 4ONWA 4X3RA 2WYRA 4OC3A 4CDJA 1M4LA 5LRGA 2PJ3A 3B3CA 1BPNA 2XEGA 3B3WA 4PPZA 3D67A 2I3CA 4C9AA 2ZEHA 1TKHA 1XF1A 3I1UA 2GREA 3MRUA 1VIXA 1Z8LA 5JM6A 5IB9A 2QJ8A 4C8UA 2PJ2A 2PVVA 2AFUA 4C8AA 4A38A 1Y0RA 1XRYA 4TJXA 3KHZA 2OR4A 2BOAA 4KSIA 4MHZA 4B6ZA 3NA6A 4A37A 4C8CA 5D8NA 1TKFA 3WC7A 4WWVA 2ANPA 4W9YA 4FWUA 3IFEA 3NH5A 4KNGE 1Y0YA 2IJZA 2XEFA 4YN3A 3NH4A 3MN8A 2BO9A 3KQXA 2CTBA 4YWYA 1WVMA 2NSMA 1VHEA 4OIDA 1XFOA 1ARLA 3FJUA 1PYTB 2NYQA 3B7IA 3KGQA 5K8MA 3LMSA 2GP4A 1R3NA 3GUXA 2JEWA 2POKA 2C6GA 2PJ0A 1LCPA 1YW6A 4C8TA 4ZY1A 2PJ4A 4MCSA 4MCRA 4R76A 4P4JA 2PVWA 4BD9A 1AYEA 3DLJA 4X8IA 3KI9A 3V38A 2ZEDA 3BXMA 1CPSA 3B3TA 1F57A 2ZEEA 5LYIA 4P44A 4NGNA 5IR2A 3SI2A 5CPAA 2JBJA 4C9EA 2RB7A 4ZY2A 4PQAA 2ZEMA 3PB8X 3TX8A 3SJFA 1ZG8A 3PEIA 1ELMP 3BI0A 1HDUA 4FAIA 5LYDA 4RUHA 4C86A 2BCOA 5THWA 1DE4C 2GLFA 1ZG7A 1FNOA 2HC9A 2CIJA 4UEFA 1FT7A 2QVPA 3IEHA 4MMOA 1QMUA 4OMEA 2AFWA 4C84A 5I4MA 3ICUA 5CBMA 4PXBA 2PJ7A 4PXCA 1GYTA 2WZNA 3B3VA 2ZEGA 1ARMA 1Y9ZA 3KR5A 3B2YA 3JRUA 4DUKA 3FMCA 3IJ3A 4NFRA 2PRQA 2GU2A 4H2KA 3VTAA 1ZLHA 3HLPA 2EWBA 1Z5RA 3I6SA 1ELLP 3LWUA 4CDKA 4OC1A 2DEAA 3I74A 6CPAA 2C1CA 4PXDA 1EE3P 5F09A 2EK9A 2PJ9A 4P45A 3B3SA 2PIZA 3D7HA 3FEDA 4ZYQA 2Q51A 4K3NA 1LAPA 3SI0A 2CTCA 4YU9A 4R6TA 4P4IA 4FUUA 2V8VA 5LRJA 3NFZA 3SI1A 4AXVA 4P4FA 2V77A 1VGYA 3KZWA 3ISXA 3ISZA 4A39A 1H8LA 1PCAA 2VL1A 4ZX8A 1ZLIA 1KWMA 3GLJA 2PJ6A 4OC0A 3WT4A 3EIFA 3D66A 4Z65A 4OC4A 3B35A 3HUVA 4C9RA 3KL9A 2C5QA 3K2KA 5K8NA 2IMOA 3WC5A 5HVGA 3KHXA 3PFEA 2ZEOA 1BAVA 1HDQA 2HB6A 1CP7A 3PBEA 4UEEA 4OP4A 3WABA 3SJEA 4UEZA 4CPAA 1LAMA 3FEEA 3PBBA 4NGRA 1TXRA 4TWEA 1OBRA 2PJ8A 3FECA 1LFWA 2AFSA 1Y7EA 4EMEA 1YW4A 3H8GA 4G1PA 4FBEA 1XMBA 2PJAA 3QNVA 4DYOA 2QYVA 8CPAA 2O4HA 3V7ZA 5J1QA 5LYLA 5K8PA 2O53A 3DGVA 2EK8A 2C6PA 1RTQA 4ZY0A 7CPAA 1F2PA 4EFDA 4F9VA 4C8FA 1TKJA 2PJ1A 3S9NA 5D29A 3FX6A 2F8HA 5ELYA 3D68A 4R7MA 4WJBA 3BHXA 1CP6A 1LOKA 2AFXA 3D7DA 1LANA 1JQGA 3H8EA 3FH4A 4F8ZA 2ZEFA 1CG2A 4IAVA 3VATA 3IWWA 2V8HA 4NJRA 4OKOA 4PXEA 1QQ9A 3IIBA 3FF3A 4Q7AA 2PJBA 2J9AA 2XEIA 1CBXA 4DJLA 3KASA 2RFHA 2C6CA 3PFOA 2AFZA 5HXDA 4OC5A 3PB4X 1R43A 5JGFA 3IC1A 4MRIA 4C8PA 2IQ6A 5HVHA 5DS0A 2F7VA 4MCPA 4NGPA 3L2NA 4MXUA 1CPXA 4TNUA 4OIWA 4UF4A 1TF9A 2PJCA 2G9DA 2V8DA 3CPXA 1VHOA 3CT9A 3VARA 2CF4A 1NSAA 2ZELA 4ZI6A 3RZAA 2JBKA 3VH9A 4P4DA 3KR4A 2PJ5A 3RBUA 1V6CA 1TF8A 4A94A 4LQGA 1IY7A 3SJGA 3CDXA 3K9TA 1BLLE 4MHYA 4O23A 4C9UA 3D7FA 3PRTA 1AMPA 4C85A 3BI1A 3IO1A 3D7GA 5LYFA 4GM5A 3RAMA 2PCUA 1F2OA 4P4EA 4C9VA 4EWTA 3D4UA 3PB9X 2Q43A 5K8OA 4JZ0A 3N5FA 4MCQA 3PB6X 2ABZA 1XBUA 2FVGA 5JH9A 2AFOA 1Q7LA 2ZOGA 4UIBA 4R8FA 5HVFA 2PIYA 3WC6A 4F9UA 4NGSA 3SJXA 1IGBA 3KQZA 2ZEPA 3FVLA 2Q4ZA 4NGMA 3TC8A 1YLOA 1BPMA 4P10A 2PE3A 1DTDA 1ZG9A 3CPAA 4JYWA 2GLJA 3GB0A 2OOTA 2ZENA 4MHNA 2XEJA 4NJQA 4X2TA 4NGTA 4ZX9A 1XJOA 3S9MA 1Z2LA 2AFMA 4UIAA 4OC2A 4IHMA 3NH8A 1HEEA 1UWYA 4P4BA 3T8WA 3PB7X 4TJVA 4NGQA 2ZOFA 1YMEA 4IK2A 3H8FA 4P6YA 1CX8A 2V8GA 4C99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9L A;  1YSJ A;  4MHP A;  5LRK A;  4ONW A;  4X3R A;  2WYR A;  4OC3 A;  4CDJ A;  1M4L A;  5LRG A;  2PJ3 A;  3B3C A;  1BPN A;  2XEG A;  3B3W A;  4PPZ A;  3D67 A;  2I3C A;  4C9A A;  2ZEH A;  1TKH A;  1XF1 A;  3I1U A;  2GRE A;  3MRU A;  1VIX A;  1Z8L A;  5JM6 A;  5IB9 A;  2QJ8 A;  4C8U A;  2PJ2 A;  2PVV A;  2AFU A;  4C8A A;  4A38 A;  1Y0R A;  1XRY A;  4TJX A;  3KHZ A;  2OR4 A;  2BOA A;  4KSI A;  4MHZ A;  4B6Z A;  3NA6 A;  4A37 A;  4C8C A;  5D8N A;  1TKF A;  3WC7 A;  4WWV A;  2ANP A;  4W9Y A;  4FWU A;  3IFE A;  3NH5 A;  4KNG E;  1Y0Y A;  2IJZ A;  2XEF A;  4YN3 A;  3NH4 A;  3MN8 A;  2BO9 A;  3KQX A;  2CTB A;  4YWY A;  1WVM A;  2NSM A;  1VHE A;  4OID A;  1XFO A;  1ARL A;  3FJU A;  1PYT B;  2NYQ A;  3B7I A;  3KGQ A;  5K8M A;  3LMS A;  1R3N A;  3GUX A;  2JEW A;  2POK A;  2C6G A;  2PJ0 A;  1LCP A;  1YW6 A;  4C8T A;  4ZY1 A;  2PJ4 A;  4MCS A;  4MCR A;  4R76 A;  4P4J A;  2PVW A;  4BD9 A;  1AYE A;  3DLJ A;  4X8I A;  3KI9 A;  3V38 A;  2ZED A;  3BXM A;  1CPS A;  3B3T A;  1F57 A;  2ZEE A;  5LYI A;  4P44 A;  4NGN A;  3SI2 A;  5CPA A;  2JBJ A;  4C9E A;  2RB7 A;  4ZY2 A;  4PQA A;  2ZEM A;  3PB8 X;  3TX8 A;  3SJF A;  1ZG8 A;  3PEI A;  1ELM P;  3BI0 A;  1HDU A;  4FAI A;  5LYD A;  4RUH A;  4C86 A;  2BCO A;  5THW A;  1DE4 C;  2GLF A;  1ZG7 A;  1FNO A;  2HC9 A;  2CIJ A;  4UEF A;  1FT7 A;  2QVP A;  3IEH A;  4MMO A;  1QMU A;  4OME A;  2AFW A;  4C84 A;  5I4M A;  3ICU A;  5CBM A;  4PXB A;  2PJ7 A;  4PXC A;  1GYT A;  2WZN A;  3B3V A;  2ZEG A;  1ARM A;  1Y9Z A;  3KR5 A;  3B2Y A;  3JRU A;  4DUK A;  3FMC A;  3IJ3 A;  4NFR A;  2PRQ A;  2GU2 A;  4H2K A;  3VTA A;  1ZLH A;  3HLP A;  2EWB A;  1Z5R A;  3I6S A;  1ELL P;  3LWU A;  4CDK A;  4OC1 A;  2DEA A;  3I74 A;  6CPA A;  2C1C A;  4PXD A;  1EE3 P;  5F09 A;  2EK9 A;  2PJ9 A;  4P45 A;  3B3S A;  2PIZ A;  3D7H A;  3FED A;  4ZYQ A;  2Q51 A;  4K3N A;  1LAP A;  3SI0 A;  2CTC A;  4YU9 A;  4R6T A;  4P4I A;  4FUU A;  2V8V A;  5LRJ A;  3NFZ A;  3SI1 A;  4AXV A;  4P4F A;  2V77 A;  1VGY A;  3KZW A;  3ISX A;  3ISZ A;  4A39 A;  1H8L A;  1PCA A;  2VL1 A;  4ZX8 A;  1ZLI A;  1KWM A;  3GLJ A;  2PJ6 A;  4OC0 A;  3WT4 A;  3EIF A;  3D66 A;  4Z65 A;  4OC4 A;  3B35 A;  3HUV A;  4C9R A;  3KL9 A;  3K2K A;  5K8N A;  2IMO A;  3WC5 A;  5HVG A;  3KHX A;  3PFE A;  2ZEO A;  1BAV A;  1HDQ A;  2HB6 A;  1CP7 A;  3PBE A;  4UEE A;  4OP4 A;  3WAB A;  3SJE A;  4UEZ A;  4CPA A;  1LAM A;  3FEE A;  3PBB A;  4NGR A;  1TXR A;  4TWE A;  1OBR A;  2PJ8 A;  3FEC A;  1LFW A;  2AFS A;  1Y7E A;  4EME A;  1YW4 A;  3H8G A;  4G1P A;  4FBE A;  1XMB A;  2PJA A;  3QNV A;  4DYO A;  2QYV A;  8CPA A;  2O4H A;  3V7Z A;  5J1Q A;  5LYL A;  5K8P A;  2O53 A;  3DGV A;  2EK8 A;  2C6P A;  1RTQ A;  4ZY0 A;  7CPA A;  1F2P A;  4EFD A;  4F9V A;  4C8F A;  1TKJ A;  2PJ1 A;  3S9N A;  5D29 A;  3FX6 A;  2F8H A;  5ELY A;  3D68 A;  4R7M A;  4WJB A;  3BHX A;  1CP6 A;  1LOK A;  2AFX A;  3D7D A;  1LAN A;  1JQG A;  3H8E A;  3FH4 A;  4F8Z A;  2ZEF A;  1CG2 A;  4IAV A;  3VAT A;  3IWW A;  2V8H A;  4NJR A;  4OKO A;  4PXE A;  1QQ9 A;  3IIB A;  3FF3 A;  4Q7A A;  2PJB A;  2J9A A;  2XEI A;  1CBX A;  4DJL A;  3KAS A;  2RFH A;  2C6C A;  3PFO A;  2AFZ A;  5HXD A;  4OC5 A;  3PB4 X;  1R43 A;  5JGF A;  3IC1 A;  4MRI A;  4C8P A;  2IQ6 A;  5HVH A;  5DS0 A;  2F7V A;  4MCP A;  4NGP A;  3L2N A;  4MXU A;  1CPX A;  4TNU A;  4OIW A;  4UF4 A;  1TF9 A;  2PJC A;  2G9D A;  2V8D A;  3CPX A;  1VHO A;  3CT9 A;  3VAR A;  2CF4 A;  1NSA A;  2ZEL A;  4ZI6 A;  3RZA A;  2JBK A;  3VH9 A;  4P4D A;  3KR4 A;  2PJ5 A;  3RBU A;  1V6C A;  1TF8 A;  4A94 A;  4LQG A;  1IY7 A;  3SJG A;  3CDX A;  3K9T A;  1BLL E;  4MHY A;  4O23 A;  4C9U A;  3D7F A;  3PRT A;  1AMP A;  4C85 A;  3BI1 A;  3IO1 A;  3D7G A;  5LYF A;  4GM5 A;  3RAM A;  2PCU A;  1F2O A;  4P4E A;  4C9V A;  4EWT A;  3D4U A;  3PB9 X;  2Q43 A;  5K8O A;  4JZ0 A;  3N5F A;  4MCQ A;  3PB6 X;  2ABZ A;  1XBU A;  2FVG A;  5JH9 A;  2AFO A;  1Q7L A;  2ZOG A;  4UIB A;  4R8F A;  5HVF A;  2PIY A;  3WC6 A;  4F9U A;  4NGS A;  3SJX A;  1IGB A;  3KQZ A;  2ZEP A;  3FVL A;  2Q4Z A;  4NGM A;  3TC8 A;  1YLO A;  1BPM A;  4P10 A;  2PE3 A;  1DTD A;  1ZG9 A;  3CPA A;  4JYW A;  2GLJ A;  3GB0 A;  2OOT A;  2ZEN A;  4MHN A;  2XEJ A;  4NJQ A;  4X2T A;  4NGT A;  4ZX9 A;  1XJO A;  3S9M A;  1Z2L A;  2AFM A;  4UIA A;  4OC2 A;  4IHM A;  3NH8 A;  1HEE A;  1UWY A;  4P4B A;  3T8W A;  3PB7 X;  4TJV A;  4NGQ A;  2ZOF A;  1YME A;  4IK2 A;  3H8F A;  4P6Y A;  1CX8 A;  2V8G A;  4C99 A; 
#chains in the Genus database with same CATH topology
 3S9L A;  1A2Z A;  1YSJ A;  2EBJ A;  2YNC C;  1XOV A;  3PP9 A;  4MHP A;  4ONW A;  4X3R A;  2WYR A;  4PK2 A;  4OC3 A;  1M1D A;  1M4L A;  3CXS A;  4CDJ A;  4E5S A;  5LRG A;  2PJ3 A;  3B3C A;  1BPN A;  2XEG A;  3B3W A;  2Q7B A;  4PPZ A;  2EZA A;  3D67 A;  2I3C A;  4C9A A;  2ZEH A;  1TKH A;  5AG5 A;  2WSA A;  1XF1 A;  3I1U A;  2XPL A;  2P0W A;  1YGH A;  3N7Z A;  2GRE A;  3MRU A;  1VIX A;  2FIW A;  3S6G A;  1Z8L A;  5JM6 A;  3DDD A;  5LRK A;  4LUA A;  1Z8W A;  5IB9 A;  2QJ8 A;  4YFJ A;  3JUW A;  2VQY A;  4C2X A;  4C8U A;  3NE8 A;  5EMI A;  2PJ2 A;  2PVV A;  2AFU A;  2P6E A;  1ZYM A;  1VI4 A;  4C8A A;  1I21 A;  1KBL A;  1J3L A;  2Z3N A;  4A38 A;  1Y0R A;  4MFQ A;  4H1H A;  1M4I A;  3VRN A;  3BUN B;  2P6F A;  4M6I A;  2BUE A;  4INJ A;  3SXO A;  1XRY A;  4TJX A;  4CYQ A;  1MJB A;  3KHZ A;  3GIU A;  4KSA A;  2OR4 A;  2BOA A;  4KSI A;  4MHZ A;  2P6G A;  4B6Z A;  2AUM A;  1AUG A;  3NA6 A;  2HI6 A;  2PC1 A;  4KOX A;  4BBH A;  2XPN A;  3TCV A;  4B5P A;  4A37 A;  3T5M A;  4C8C A;  2JDC A;  2VBQ A;  5D8N A;  3EXN A;  3R9G A;  1TKF A;  3R96 A;  3WC7 A;  5IB0 A;  4WWV A;  3GJZ A;  2ANP A;  2B3U A;  2Z0Z A;  5ISV A;  3IU1 A;  2Z3P A;  4EYS A;  2FM4 A;  3EC4 A;  3IGR A;  4KVX A;  4W9Y A;  4FWU A;  4XPD B;  5F13 A;  2Z3O A;  3IFE A;  3NH5 A;  2J8N A;  5F5X A;  4DNC A;  1MJ9 A;  4CGL A;  2R7H A;  4KNG E;  1Y0Y A;  1X10 A;  2IJZ A;  1IID A;  2XEF A;  4YN3 A;  3R95 A;  4JD6 A;  3NH4 A;  3MN8 A;  4FD7 A;  4NXY A;  2B4B A;  4XNH B;  3T90 A;  2BO9 A;  3KQX A;  2CTB A;  4YWY A;  1P4N A;  2A4N A;  2EVN A;  4HPS A;  4R3L A;  1WK4 A;  2FE7 A;  5GCN A;  1WVM A;  4IIY A;  2NSM A;  1VHE A;  2JEV A;  2REF A;  1XFO A;  3BUW B;  1ARL A;  2VZZ A;  1PYT B;  3FJU A;  4OID A;  1Q2D A;  3TOB A;  2NYQ A;  3UY5 A;  5HKW A;  1XEB A;  3B7I A;  4MFJ A;  3KGQ A;  4CGO A;  2DPT A;  4E0A A;  3C26 A;  5BWA B;  5K8M A;  3LMS A;  3H5Z A;  1JDE A;  1FBV A;  2B4D A;  1EZA A;  5JVL A;  2GP4 A;  1R3N A;  3GUX A;  2J8R A;  2JEW A;  2POK A;  2C6G A;  3BJ7 A;  2PJ0 A;  1SQH A;  4E8O A;  2Z10 A;  1QSM A;  4LX9 A;  1LCP A;  1YW6 A;  3DNS A;  3RNZ A;  4C8T A;  2JLM A;  4ZY1 A;  1B6B A;  2I00 A;  1LRZ A;  2PJ4 A;  4MCS A;  3TLA A;  4KOU A;  4EVY A;  4MCR A;  4R76 A;  4P4J A;  2PVW A;  3TLZ A;  1Y9K A;  4E2A A;  1NE9 A;  2Q4Y A;  4BD9 A;  1AYE A;  2Q4V A;  2CNT A;  3DLJ A;  2D0P A;  3PGP A;  1M4D A;  2PQ8 A;  4X8I A;  2OB0 A;  3KI9 A;  4BIN A;  5IX3 A;  2ZXV A;  3V38 A;  2ZED A;  3IWE A;  3BXM A;  5J3X A;  1CPS A;  1F57 A;  2WPW A;  2ZEE A;  3B3T A;  4M3S A;  3PFV A;  3FNC A;  4P44 A;  4U9Z A;  2PCN A;  3R1K A;  1R61 A;  1N71 A;  4NGN A;  3VRR A;  5IR2 A;  4A2Z A;  3TLB A;  3KKW A;  3SI2 A;  1Z8X A;  1IYL A;  2D4O A;  2CBL A;  1ZO0 A;  5CPA A;  2JBJ A;  4C68 A;  4C9E A;  2Q7S A;  2QEC A;  4UCP A;  3O8Z A;  2RB7 A;  2VI7 A;  4PQA A;  4RI1 A;  2ZEM A;  4ZY2 A;  3VRQ A;  5JQ4 A;  3PB8 X;  3TX8 A;  5IV0 A;  1BXR B;  4E94 A;  3SJF A;  1ZG8 A;  3PEI A;  1ELM P;  3BI0 A;  4RR2 B;  1YVH A;  1HDU A;  1Y7R A;  4OLL A;  4FAI A;  4ONU A;  4OAE A;  4UFW A;  2B4J C;  3F5B A;  5LYD A;  4KLW A;  2B4D B;  2Z3L A;  4RUH A;  4C86 A;  2BCO A;  2ZW7 A;  3TO9 A;  4LQ6 A;  1Z8T A;  5THW A;  1DE4 C;  4JXR A;  1ZRS A;  4X5K A;  2GLF A;  1ZG7 A;  1FNO A;  2HC9 A;  2CIJ A;  1IIC A;  4UEF A;  2CNS A;  4A32 A;  3TE4 A;  4AG9 A;  1FT7 A;  2QVP A;  3IEH A;  4MMO A;  3B8G A;  4Q36 A;  1QMU A;  4OME A;  4KVO E;  2AFW A;  4C84 A;  5KTA A;  5I0C A;  5E96 A;  4U9Y A;  3RYO A;  3VWE A;  2YGW A;  4M6H A;  4JVO A;  4KVM E;  4NCZ A;  3W6S A;  4B10 A;  5I4M A;  3ICU A;  3FYN A;  3RO0 A;  2MP0 A;  1NSL A;  5CBM A;  4OAD A;  4PXB A;  2DXQ A;  2PJ7 A;  4A33 A;  1T36 B;  4R9M A;  2VKZ G;  3E0K A;  2AE6 A;  4PXC A;  4JJX A;  1GYT A;  2WZN A;  3B3V A;  2Y0M A;  4MJ8 A;  4AVA A;  3T0T A;  2ZEG A;  1ARM A;  1Y9Z A;  2PRB A;  2EZB A;  3NOJ A;  3KR5 A;  3F0A A;  3B2Y A;  4B11 A;  3JRU A;  2Z3K A;  4DUK A;  3FMC A;  4BPU B;  4PK3 A;  3TTH A;  5DWM A;  2K5T A;  3IJ3 A;  4NFR A;  2YJT A;  2PRQ A;  2GU2 A;  3F8K A;  5F46 A;  1IOI A;  1KEE B;  2X7B A;  4H2K A;  1KZF A;  3VTA A;  2I79 A;  1ZLH A;  3HLP A;  5AGE A;  2EWB A;  3DR8 A;  3F9K C;  1Z5R A;  2GIV A;  3I6S A;  1ELL P;  3LWU A;  4CDK A;  1UFH A;  2JDD A;  4OC1 A;  1Q2Y A;  2DEA A;  4CAV A;  3I74 A;  4CRY B;  3TLC A;  6CPA A;  5G21 A;  2C1C A;  2CXA A;  4PXD A;  3FBU A;  1JWQ A;  1EE3 P;  5DWN A;  5F49 A;  5J8C A;  3BJ8 A;  5F09 A;  2EK9 A;  4CGP A;  3CXQ A;  3GKR A;  1KUV A;  3LAC A;  2WPX A;  1L0C A;  4NF1 A;  3ZZI A;  2PJ9 A;  1YVK A;  4P45 A;  2OH1 A;  3B3S A;  2PIZ A;  2YNE A;  3D7H A;  3FB3 A;  4KOV A;  2X0S A;  3FED A;  1VKC A;  1S3Z A;  2Q51 A;  3U88 C;  2Y1N A;  4ZYQ A;  4BPW B;  2HRO A;  4K3N A;  1BOB A;  1LAP A;  2CNM A;  3SI0 A;  3W6X A;  2REE A;  5BY0 A;  1P0H A;  2CTC A;  2G3A A;  1S7L A;  2FSR A;  4JLY A;  4R6T A;  4YU9 A;  5H86 A;  4P4I A;  4FUU A;  4KOT A;  2V8V A;  5LRJ A;  3ZNI A;  2EUI A;  3H4Q A;  3EZB A;  2GAN A;  2UV8 G;  3NFZ A;  4M85 A;  5G20 A;  3SI1 A;  3KRV A;  1A9X B;  4AXV A;  4P4F A;  2FIA A;  2V77 A;  1VGY A;  2VZY A;  3D2M A;  2QML A;  3OB2 B;  1YX0 A;  1EO0 A;  3KZW A;  3ISX A;  1CJW A;  1OZP A;  2BL1 A;  3ISZ A;  4FD5 A;  3I3G A;  4A39 A;  3TLE A;  4CGN A;  1H8L A;  1PCA A;  2VL1 A;  4ZX8 A;  1ZLI A;  1KWM A;  3GLJ A;  3HMJ G;  2PJ6 A;  4RS2 A;  4OC0 A;  3WT4 A;  1I12 A;  4F6A A;  1IU8 A;  4Q38 A;  3EIF A;  4NEX A;  1KUY A;  3D66 A;  3W91 A;  4Z65 A;  1I1D A;  4OC4 A;  2G3T A;  3B35 A;  3HUV A;  4C9R A;  3KL9 A;  2C5Q A;  3K2K A;  5K8N A;  2IMO A;  2ZW4 A;  3JVN A;  3P2F A;  3KHX A;  3PFE A;  3WC5 A;  5HVG A;  1BAV A;  2ZEO A;  4MJX A;  1QST A;  2OU2 A;  4U5Y A;  4BTF A;  1HDQ A;  2FT0 A;  1CP7 A;  2HB6 A;  3PBE A;  4J3G A;  4NSQ A;  4OP4 A;  4UEE A;  1QSN A;  4KOW A;  2R98 A;  3VRP A;  2F5I A;  3LD2 A;  3SJE A;  5JYB A;  4UEZ A;  2ODF A;  3OB1 B;  2VXK A;  4CGM A;  1S60 A;  5F9M A;  4A4C A;  1LAM A;  4CPA A;  3T05 A;  3FXT A;  1C3O B;  4IIX A;  4MI1 A;  1X12 A;  3FEE A;  3PBB A;  3TLG B;  4NGR A;  1TXR A;  4TWE A;  1OBR A;  2PJ8 A;  2C27 A;  3FEC A;  1LFW A;  1CS0 B;  2AFS A;  4GPL B;  1Y7E A;  2FCK A;  1R57 A;  4EME A;  3EY5 A;  1Z4E A;  1PU9 A;  5F48 A;  4KSF A;  1YW4 A;  3D2P A;  3H8G A;  4G1P A;  4FBE A;  1RO5 A;  1XMB A;  1Z9E A;  2HV2 A;  2PJA A;  4QB9 A;  4UA3 A;  1DIK A;  2HWG A;  2CY2 A;  3QNV A;  4IUS A;  5LYI A;  4DYO A;  2QYV A;  3BLN A;  4HNX B;  8CPA A;  2O4H A;  3DR6 A;  3T9Y A;  4CAE A;  3TOA A;  1YK3 A;  2VEZ A;  3V7Z A;  1CE8 B;  5J1Q A;  4R3K A;  3TFY A;  2QIR A;  2FXF A;  3QB8 A;  5LYL A;  5K8P A;  3DSB A;  1EZB A;  2O53 A;  3DGV A;  1S7N A;  4QC6 A;  2EK8 A;  2C6P A;  1RTQ A;  1XMT A;  2YNC A;  4ZY0 A;  7CPA A;  5JPH A;  4JWP A;  2RC4 A;  4MY0 A;  3TT2 A;  1F2P A;  2Q0Y A;  3S6K A;  4C7H A;  4EFD A;  2R82 A;  3A9L A;  4CZ1 A;  2Z11 A;  4F9V A;  4C8F A;  1RXT A;  4C7I A;  5AG4 A;  3EO4 A;  5C88 A;  1TKJ A;  2PJ1 A;  3S9N A;  1S7K A;  2ZPA A;  4UCN A;  2ZW6 A;  5D29 A;  3IU2 A;  5F47 A;  3BUX B;  3FX6 A;  1Z9U A;  2F8H A;  3NFQ A;  1WWZ A;  1WJT A;  2XPO A;  2Y1M A;  5ELY A;  3D68 A;  4MY3 A;  4R7M A;  4UFX A;  5C82 A;  4PSX A;  4WJB A;  3LOD A;  4II9 A;  3BHX A;  2DLA A;  1CP6 A;  1LOK A;  4L8A A;  2DIK A;  2AFX A;  3D7D A;  1LAN A;  1S7F A;  1JQG A;  3ZJ0 A;  2OZG A;  4MFK A;  3H8E A;  4GS4 A;  3GY9 A;  4RN7 A;  4Y49 B;  5AG6 A;  2Q04 A;  2KCW A;  3FH4 A;  1U6M A;  2YJV A;  4MFZ A;  2B5G B;  4YRH A;  1NMT A;  3EFA A;  4F8Z A;  2ZEF A;  4R57 A;  1IOF A;  3P2H A;  1CG2 A;  4IAV A;  3VAT A;  5EBV A;  5F1Y A;  3IWW A;  2V8H A;  2EO8 A;  4NJR A;  4OKO A;  4PXE A;  1IYK A;  1QQ9 A;  3FF3 A;  1MJA A;  2ZW5 A;  3IIB A;  2NMT A;  4AG7 A;  1C30 B;  1M4G A;  4Q7A A;  4UCM A;  4XPL A;  2PJB A;  3K4I A;  2J9A A;  4UBR A;  2XEI A;  1CBX A;  4DJL A;  3KAS A;  4FD6 A;  4UWJ A;  4B12 A;  4CAF A;  4ZGY B;  2RFH A;  5A27 A;  2C6C A;  1MK4 A;  4HKF A;  4KZT A;  1NXJ A;  3VWD A;  3PFO A;  1GGO A;  3NE7 A;  2AFZ A;  5G22 A;  5KTC A;  5HXD A;  2YND A;  4CYN A;  4OC5 A;  3PB4 X;  4KS9 A;  1R43 A;  1XIX A;  4CAW A;  1GHE A;  3IC1 A;  5JGF A;  4MRI A;  4L89 A;  4CYP A;  4C8P A;  2IQ6 A;  4KOR A;  5HVH A;  1XE4 A;  5DS0 A;  2GE3 A;  4HNY B;  2D4P A;  2F7V A;  2PR1 A;  3R9E A;  4MCP A;  2H5M A;  3QAH A;  4NGP A;  2PSW A;  2E28 A;  1NBW A;  3L2N A;  4MXU A;  1YR0 A;  3K9U A;  2B58 A;  5FVJ A;  1CPX A;  4TNU A;  1XF8 A;  4QVT A;  1ON0 A;  3D8P A;  4UFV A;  4OIW A;  2AUN A;  3TLG A;  5EC4 A;  4XPD C;  5HH1 A;  4UF4 A;  1TF9 A;  3U1B A;  4A4B A;  2PJC A;  3SR3 A;  2G9D A;  2V8D A;  3CPX A;  1VHO A;  3CT9 A;  3VAR A;  2CF4 A;  1NSA A;  2BEI A;  2ZEL A;  1YLE A;  4KOY A;  4ZI6 A;  3RZA A;  2JBK A;  2HUZ A;  4XNH C;  3PT1 A;  4P4D A;  3KR4 A;  3VH9 A;  4CRZ B;  2PJ5 A;  3RBU A;  1V6C A;  1TF8 A;  4CO9 A;  1V0C A;  4A94 A;  3TLY A;  1Z4R A;  4LQG A;  5A28 A;  1TIQ A;  1IY7 A;  3SHP A;  2Q44 A;  2OLS A;  4F0X A;  1JDB C;  3SJG A;  3CDX A;  1VBH A;  3CXP A;  3K9T A;  1BLL E;  4MHY A;  4O23 A;  4C9U A;  2N3A B;  3D7F A;  3JTK A;  3PRT A;  1AMP A;  4I49 A;  4C85 A;  3V8I A;  3BI1 A;  3IO1 A;  4MI4 A;  3MGD A;  4A31 A;  4BMH A;  5HMN A;  3D7G A;  1J4J A;  3TO6 A;  4FD4 A;  3QAY A;  4B5O A;  5LYF A;  3C8O A;  5HKY A;  4MFP A;  4GM5 A;  3HPG G;  2ATR A;  4AVB A;  4B13 A;  3RAM A;  2PCU A;  4A30 A;  5H84 A;  1F2O A;  4P4E A;  4H6Z A;  4KOS A;  5FD8 A;  4C9V A;  4GXH A;  4F0Y A;  4EWT A;  3IWG A;  2DF5 A;  3D4U A;  2R1I A;  3PB9 X;  2Q43 A;  5K8O A;  4JZ0 A;  3N5F A;  4QBJ A;  4MCQ A;  4AB7 A;  3PB6 X;  1M44 A;  5KTD A;  3HPH E;  4UWI A;  1Q5X A;  2ABZ A;  1XBU A;  3OAK A;  2FVG A;  3I9S A;  2AFO A;  5JH9 A;  1YVO A;  3OWC A;  1ZL0 A;  1CM0 A;  2EZC A;  1Q7L A;  1KUX A;  4MBU A;  2D0O A;  2ZOG A;  2OZU A;  4R8F A;  4UIB A;  5HVF A;  1QSO A;  1YQE A;  2PIY A;  4KUA A;  3WC6 A;  4F9U A;  2B5G A;  4NGS A;  3FRM A;  3WR7 A;  3SJX A;  3WAB A;  1Y9W A;  1IGB A;  3KQZ A;  2OZH A;  5AXI A;  2ZEP A;  3FVL A;  4PSW A;  4PV6 A;  4B5P B;  3G23 A;  4C2Z A;  1S5K A;  3OP0 A;  2Q4Z A;  2ARH A;  4NGM A;  3SXN A;  4CYO A;  3TC8 A;  2B0A A;  1YLO A;  3D3S A;  1YRE A;  1BPM A;  2G0B A;  2PE3 A;  2R8V A;  3CZX A;  4P10 A;  4A95 A;  1DTD A;  5AG7 A;  3T07 A;  1ZG9 A;  2BSW A;  4HNW B;  4JXQ A;  3CPA A;  4R87 A;  4JYW A;  2GLJ A;  3GYA A;  5G1Z A;  3FIX A;  3GB0 A;  1PUA A;  1VHS A;  2FS5 A;  1KC7 A;  2OOT A;  2ZEN A;  4MHN A;  2PR8 A;  2XEJ A;  3BUO B;  3PZJ A;  4AVC A;  4B14 A;  4COG A;  3G3S A;  4ORF A;  4ZBG A;  4MHD A;  3TYX A;  1IB1 E;  2J8M A;  1K4J A;  4NJQ A;  4X2T A;  4NGT A;  3BUM B;  4ZX9 A;  4J0N A;  3VRO A;  4CS0 B;  2DPS A;  3S6H A;  4CAX A;  1XJO A;  3S9M A;  1FY7 A;  1Z2L A;  2AFM A;  5HKZ A;  4K30 A;  1VBG A;  4UIA A;  1B47 A;  3S6F A;  4OC2 A;  2FL4 A;  4IHM A;  5J8F A;  4IF5 A;  3NH8 A;  3EZA A;  4Y49 C;  5K99 A;  2XPP A;  5CNP A;  1HEE A;  1UWY A;  4C2Y A;  4P4B A;  3G8W A;  1Q2C A;  1BO4 A;  2B3V A;  4KUB A;  3T8W A;  3VGO A;  3PB7 X;  4H6U A;  4QUS A;  3R9F A;  4TJV A;  2Z3M A;  4M6G A;  4NGQ A;  4BPX B;  2IL4 A;  2ZOF A;  4XPK A;  3TO7 A;  2GFQ A;  4KLV A;  1YME A;  4MFL A;  4IK2 A;  3EZE A;  2AJ6 A;  3H8F A;  4YGO A;  2WUU A;  4P6Y A;  4M8D A;  3PLF B;  2O28 A;  1CX8 A;  2PDO A;  2HQY A;  4COB A;  4H89 A;  2V8G A;  1M6V B;  1QSR A;  4C99 A;  1B87 A; 
#chains in the Genus database with same CATH homology
 3S9L A;  1YSJ A;  4MHP A;  5LRK A;  4ONW A;  4X3R A;  2WYR A;  4OC3 A;  4CDJ A;  1M4L A;  5LRG A;  2PJ3 A;  3B3C A;  1BPN A;  2XEG A;  3B3W A;  4PPZ A;  3D67 A;  2I3C A;  4C9A A;  2ZEH A;  1TKH A;  1XF1 A;  3I1U A;  2GRE A;  3MRU A;  1VIX A;  1Z8L A;  5JM6 A;  5IB9 A;  2QJ8 A;  4C8U A;  2PJ2 A;  2PVV A;  2AFU A;  4C8A A;  4A38 A;  1Y0R A;  1XRY A;  4TJX A;  3KHZ A;  2OR4 A;  2BOA A;  4KSI A;  4MHZ A;  4B6Z A;  3NA6 A;  4A37 A;  4C8C A;  5D8N A;  1TKF A;  3WC7 A;  4WWV A;  2ANP A;  4W9Y A;  4FWU A;  3IFE A;  3NH5 A;  4KNG E;  1Y0Y A;  2IJZ A;  2XEF A;  4YN3 A;  3NH4 A;  3MN8 A;  2BO9 A;  3KQX A;  2CTB A;  4YWY A;  1WVM A;  2NSM A;  1VHE A;  4OID A;  1XFO A;  1ARL A;  3FJU A;  1PYT B;  2NYQ A;  3B7I A;  3KGQ A;  5K8M A;  3LMS A;  2GP4 A;  1R3N A;  3GUX A;  2JEW A;  2POK A;  2C6G A;  2PJ0 A;  1LCP A;  1YW6 A;  4C8T A;  4ZY1 A;  2PJ4 A;  4MCS A;  4MCR A;  4R76 A;  4P4J A;  2PVW A;  4BD9 A;  1AYE A;  3DLJ A;  4X8I A;  3KI9 A;  3V38 A;  2ZED A;  3BXM A;  1CPS A;  3B3T A;  1F57 A;  2ZEE A;  5LYI A;  4P44 A;  4NGN A;  5IR2 A;  3SI2 A;  5CPA A;  2JBJ A;  4C9E A;  2RB7 A;  4ZY2 A;  4PQA A;  2ZEM A;  3PB8 X;  3TX8 A;  3SJF A;  1ZG8 A;  3PEI A;  1ELM P;  3BI0 A;  1HDU A;  4FAI A;  5LYD A;  4RUH A;  4C86 A;  2BCO A;  5THW A;  1DE4 C;  2GLF A;  1ZG7 A;  1FNO A;  2HC9 A;  2CIJ A;  4UEF A;  1FT7 A;  2QVP A;  3IEH A;  4MMO A;  1QMU A;  4OME A;  2AFW A;  4C84 A;  5I4M A;  3ICU A;  5CBM A;  4PXB A;  2PJ7 A;  4PXC A;  1GYT A;  2WZN A;  3B3V A;  2ZEG A;  1ARM A;  1Y9Z A;  3KR5 A;  3B2Y A;  3JRU A;  4DUK A;  3FMC A;  3IJ3 A;  4NFR A;  2PRQ A;  2GU2 A;  4H2K A;  3VTA A;  1ZLH A;  3HLP A;  2EWB A;  1Z5R A;  3I6S A;  1ELL P;  3LWU A;  4CDK A;  4OC1 A;  2DEA A;  3I74 A;  6CPA A;  2C1C A;  4PXD A;  1EE3 P;  5F09 A;  2EK9 A;  2PJ9 A;  4P45 A;  3B3S A;  2PIZ A;  3D7H A;  3FED A;  4ZYQ A;  2Q51 A;  4K3N A;  1LAP A;  3SI0 A;  2CTC A;  4YU9 A;  4R6T A;  4P4I A;  4FUU A;  2V8V A;  5LRJ A;  3NFZ A;  3SI1 A;  4AXV A;  4P4F A;  2V77 A;  1VGY A;  3KZW A;  3ISX A;  3ISZ A;  4A39 A;  1H8L A;  1PCA A;  2VL1 A;  4ZX8 A;  1ZLI A;  1KWM A;  3GLJ A;  2PJ6 A;  4OC0 A;  3WT4 A;  3EIF A;  3D66 A;  4Z65 A;  4OC4 A;  3B35 A;  3HUV A;  4C9R A;  3KL9 A;  2C5Q A;  3K2K A;  5K8N A;  2IMO A;  3WC5 A;  5HVG A;  3KHX A;  3PFE A;  2ZEO A;  1BAV A;  1HDQ A;  2HB6 A;  1CP7 A;  3PBE A;  4UEE A;  4OP4 A;  3WAB A;  3SJE A;  4UEZ A;  4CPA A;  1LAM A;  3FEE A;  3PBB A;  4NGR A;  1TXR A;  4TWE A;  1OBR A;  2PJ8 A;  3FEC A;  1LFW A;  2AFS A;  1Y7E A;  4EME A;  1YW4 A;  3H8G A;  4G1P A;  4FBE A;  1XMB A;  2PJA A;  3QNV A;  4DYO A;  2QYV A;  8CPA A;  2O4H A;  3V7Z A;  5J1Q A;  5LYL A;  5K8P A;  2O53 A;  3DGV A;  2EK8 A;  2C6P A;  1RTQ A;  4ZY0 A;  7CPA A;  1F2P A;  4EFD A;  4F9V A;  4C8F A;  1TKJ A;  2PJ1 A;  3S9N A;  5D29 A;  3FX6 A;  2F8H A;  5ELY A;  3D68 A;  4R7M A;  4WJB A;  3BHX A;  1CP6 A;  1LOK A;  2AFX A;  3D7D A;  1LAN A;  1JQG A;  3H8E A;  3FH4 A;  4F8Z A;  2ZEF A;  1CG2 A;  4IAV A;  3VAT A;  3IWW A;  2V8H A;  4NJR A;  4OKO A;  4PXE A;  1QQ9 A;  3IIB A;  3FF3 A;  4Q7A A;  2PJB A;  2J9A A;  2XEI A;  1CBX A;  4DJL A;  3KAS A;  2RFH A;  2C6C A;  3PFO A;  2AFZ A;  5HXD A;  4OC5 A;  3PB4 X;  1R43 A;  5JGF A;  3IC1 A;  4MRI A;  4C8P A;  2IQ6 A;  5HVH A;  5DS0 A;  2F7V A;  4MCP A;  4NGP A;  3L2N A;  4MXU A;  1CPX A;  4TNU A;  4OIW A;  4UF4 A;  1TF9 A;  2PJC A;  2G9D A;  2V8D A;  3CPX A;  1VHO A;  3CT9 A;  3VAR A;  2CF4 A;  1NSA A;  2ZEL A;  4ZI6 A;  3RZA A;  2JBK A;  3VH9 A;  4P4D A;  3KR4 A;  2PJ5 A;  3RBU A;  1V6C A;  1TF8 A;  4A94 A;  4LQG A;  1IY7 A;  3SJG A;  3CDX A;  3K9T A;  1BLL E;  4MHY A;  4O23 A;  4C9U A;  3D7F A;  3PRT A;  1AMP A;  4C85 A;  3BI1 A;  3IO1 A;  3D7G A;  5LYF A;  4GM5 A;  3RAM A;  2PCU A;  1F2O A;  4P4E A;  4C9V A;  4EWT A;  3D4U A;  3PB9 X;  2Q43 A;  5K8O A;  4JZ0 A;  3N5F A;  4MCQ A;  3PB6 X;  2ABZ A;  1XBU A;  2FVG A;  5JH9 A;  2AFO A;  1Q7L A;  2ZOG A;  4UIB A;  4R8F A;  5HVF A;  2PIY A;  3WC6 A;  4F9U A;  4NGS A;  3SJX A;  1IGB A;  3KQZ A;  2ZEP A;  3FVL A;  2Q4Z A;  4NGM A;  3TC8 A;  1YLO A;  1BPM A;  4P10 A;  2PE3 A;  1DTD A;  1ZG9 A;  3CPA A;  4JYW A;  2GLJ A;  3GB0 A;  2OOT A;  2ZEN A;  4MHN A;  2XEJ A;  4NJQ A;  4X2T A;  4NGT A;  4ZX9 A;  1XJO A;  3S9M A;  1Z2L A;  2AFM A;  4UIA A;  4OC2 A;  4IHM A;  3NH8 A;  1HEE A;  1UWY A;  4P4B A;  3T8W A;  3PB7 X;  4TJV A;  4NGQ A;  2ZOF A;  1YME A;  4IK2 A;  3H8F A;  4P6Y A;  1CX8 A;  2V8G A;  4C99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...