2XEJA

Human glutamate carboxypeptidase ii in complex with arm-m4, urea- based inhibitor
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVQPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
total genus 264
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xejA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xejA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xejA02
2ZENA 3PB4X 4PQAA 4CDJA 1CX8A 2FVGA 3SJXA 2AFOA 4EMEA 4UEEA 1YMEA 4NGRA 2Q4ZA 2I3CA 4MHPA 3EIFA 2PCUA 2XEIA 3K9TA 4O23A 4BD9A 1TKJA 5LYFA 4FUUA 4PXEA 3IJ3A 3I74A 2O4HA 2QYVA 2V77A 1BLLE 4TWEA 3WABA 3LMSA 3CPAA 3B35A 3ISXA 4A38A 3H8FA 4MRIA 3PRTA 1XRYA 1TF9A 4NJQA 1CP7A 1LCPA 3IFEA 3IIBA 1YLOA 4PXBA 4C8CA 4IAVA 3DGVA 1WVMA 8CPAA 4ZX8A 2WZNA 4P6YA 5HVFA 2ABZA 4EFDA 5DS0A 4A94A 4C86A 1ELMP 1ZG8A 3HUVA 3PEIA 4ZY0A 1KWMA 4G1PA 4RUHA 1CPXA 1XBUA 3CPXA 2CTBA 2EWBA 4MCRA 3SJEA 1F57A 4DUKA 3D7FA 4OKOA 3S9NA 2O53A 2VL1A 1AMPA 1ZG7A 2NSMA 3B2YA 2AFMA 5D8NA 4P44A 3MN8A 1FNOA 1H8LA 2RFHA 1Z5RA 3RBUA 1ARLA 4NGQA 2ZEPA 4OC0A 4AXVA 1VIXA 3D7HA 4MCSA 3FJUA 1XJOA 4A39A 5JH9A 1LFWA 3HLPA 2Q43A 3BXMA 3KQZA 3WC7A 2AFUA 3KR4A 1LANA 2Q51A 2PJ1A 3D67A 2AFSA 3B3TA 2GLJA 4UF4A 3KZWA 3D66A 4NGMA 2AFZA 3D4UA 3SJFA 3SJGA 2QJ8A 4C9EA 4F8ZA 5K8MA 3IWWA 1QMUA 5HXDA 2PE3A 4C8PA 1UWYA 5LRGA 4F9UA 1XF1A 5K8NA 2JEWA 5THWA 2HC9A 4UIBA 4TNUA 1LOKA 2POKA 4WWVA 1ZLHA 1PYTB 1M4LA 4P10A 2PJ7A 4MCQA 4A37A 3PB8X 3V38A 4OC4A 2AFXA 2F7VA 3GUXA 3PBBA 5LYDA 2PIYA 2CF4A 3D7GA 4JYWA 1V6CA 2PJ0A 3FEEA 1R3NA 4P4DA 2ZOGA 3VATA 2G9DA 3KGQA 1DE4C 3BHXA 3ISZA 2EK8A 2ANPA 1Z8LA 2ZEOA 3NFZA 3IC1A 2PJ3A 3PB6X 6CPAA 3I1UA 1VHOA 1AYEA 3MRUA 2PRQA 5JGFA 4C9AA 2F8HA 3V7ZA 2PVVA 3LWUA 5LRKA 5F09A 2V8HA 2PVWA 3H8EA 1HEEA 4OC3A 2PJ5A 4UEFA 4UIAA 5I4MA 2ZEFA 4P4IA 2PJCA 2ZEHA 2PJ9A 2ZEDA 1Y9ZA 2BO9A 3FEDA 1Q7LA 1Z2LA 4OP4A 3PB9X 5CBMA 1QQ9A 2PJAA 4R8FA 4WJBA 4C9VA 4P4EA 1ZLIA 4P4JA 3B3VA 1R43A 3NA6A 4MMOA 4X3RA 2GLFA 3JRUA 2C6CA 2NYQA 2C6GA 2OR4A 1BAVA 5K8PA 2PJ8A 3FVLA 1LAPA 4YU9A 2ZEMA 4IHMA 4NJRA 3L2NA 4X2TA 1CPSA 3BI1A 2QVPA 2GU2A 4C9UA 5D29A 4B6ZA 3ICUA 2ZEGA 1YW6A 4R7MA 3KHXA 3PFOA 1OBRA 2WYRA 4MXUA 4OC5A 4ZY2A 3FECA 4OC1A 5ELYA 1YW4A 2PJBA 3K2KA 2XEJA 3DLJA 3NH4A 1GYTA 1XFOA 4GM5A 4CDKA 3RAMA 4C8UA 2PJ4A 5LYIA 3PBEA 1CG2A 3B3SA 4F9VA 3T8WA 4TJVA 4LQGA 3IEHA 4R6TA 3B3CA 4DYOA 4KNGE 1HDQA 2XEFA 1IY7A 3VTAA 1VHEA 4UEZA 4P45A 1ARMA 1BPMA 4PXDA 2GREA 4NGNA 3WT4A 3GB0A 4NFRA 4C8AA 4C99A 3D7DA 4YWYA 2JBKA 4W9YA 2RB7A 4ZYQA 1HDUA 5K8OA 3TC8A 3TX8A 5JM6A 1VGYA 4P4FA 4TJXA 2C6PA 4ZI6A 2IQ6A 3I6SA 5HVHA 1FT7A 4ZX9A 5LYLA 3VARA 2DEAA 4X8IA 5HVGA 3FX6A 3KL9A 3KHZA 1TKHA 2PJ6A 2HB6A 4YN3A 1Y0RA 3S9LA 1TXRA 4C8TA 2ZOFA 3CT9A 3SI1A 2CIJA 3S9MA 1NSAA 5LRJA 4R76A 4MHNA 3PB7X 2V8DA 1BPNA 2JBJA 2C1CA 2EK9A 3CDXA 4JZ0A 1Y7EA 2CTCA 4PXCA 1F2PA 4NGSA 2ZEEA 4DJLA 3FF3A 4OIDA 4H2KA 5IB9A 3KASA 4NGTA 1ELLP 2PIZA 3KI9A 4CPAA 3SI0A 1YSJA 1IGBA 3FMCA 5CPAA 4ZY1A 1F2OA 4Q7AA 4KSIA 3FH4A 1CP6A 4IK2A 4MCPA 1CBXA 3GLJA 4OC2A 4Z65A 4PPZA 3KR5A 3VH9A 4FAIA 2BOAA 4NGPA 4ONWA 2XEGA 4OIWA 3B3WA 3RZAA 2IJZA 4C9RA 3IO1A 7CPAA 4C84A 1TF8A 3KQXA 1EE3P 2V8VA 2IMOA 3WC5A 1LAMA 1RTQA 3NH5A 4C8FA 2BCOA 1XMBA 3NH8A 2OOTA 2AFWA 1JQGA 5J1QA 4FWUA 1Y0YA 4C85A 2PJ2A 3PFEA 4MHZA 1ZG9A 3WC6A 3BI0A 1DTDA 3H8GA 2ZELA 4MHYA 1PCAA 4K3NA 3B7IA 1TKFA 2V8GA 3D68A 3SI2A 4FBEA 4EWTA 2J9AA 4P4BA 4OMEA 3QNVA 3N5FA
chains in the Genus database with same CATH superfamily
2ZENA 3W6XA 1AUGA 3PB4X 4QB9A 4PQAA 3BJ7A 1CX8A 4CDJA 1EZBA 2FVGA 2MP0A 5G22A 4CAVA 3SJXA 3TO6A 5E96A 1MK4A 1CM0A 2Q04A 3PLFB 2AFOA 4EMEA 4UEEA 2OZHA 1YMEA 4NGRA 2Q4ZA 2G3AA 4U9YA 4MFLA 2I3CA 4MHPA 3FXTA 3D2PA 1M6VB 2PCUA 3EIFA 2XEIA 2DF5A 5IR2A 4YGOA 3K9TA 1IOFA 5H86A 2ATRA 2PQ8A 2I79A 4O23A 4XPKA 3TO9A 2Z3PA 4BD9A 2WPWA 1TKJA 5LYFA 1NXJA 4FUUA 1OZPA 2P0WA 4PXEA 4E0AA 3IJ3A 3I74A 3OP0A 2O4HA 1QSNA 2QYVA 2V77A 2ZPAA 3K9UA 3G23A 2Y0MA 1ZL0A 3TYXA 1BLLE 1K4JA 3EY5A 3F5BA 4TWEA 3VWEA 4U9ZA 4UFWA 3WABA 1MJBA 1Y9KA 3LMSA 1Q5XA 5F49A 4CYPA 4E8OA 4COGA 2HUZA 3VRRA 2Z3OA 4KVME 1M4DA 3CPAA 4OLLA 4IIXA 3B35A 3JUWA 1IICA 3ISXA 3BUWB 5IX3A 4A38A 3H8FA 4NXYA 4J0NA 2B3UA 4MRIA 3PRTA 1YK3A 1S60A 3ZJ0A 4MY3A 3VRPA 4PSWA 4B5OA 4H89A 5F46A 1XRYA 4AB7A 1TF9A 4NJQA 4IIYA 2P6FA 3CXSA 2R98A 1Z4EA 3TT2A 4AG9A 1CP7A 1LCPA 2X7BA 3IFEA 3IIBA 4XPDC 1T36B 3TLCA 2Q7BA 2FM4A 1YLOA 4PXBA 5KTDA 1IIDA 4IAVA 4YRHA 4C8CA 2VKZG 3DGVA 3F8KA 4M6HA 8CPAA 1WVMA 4ZX8A 1Z8WA 2WZNA 3DNSA 4C2ZA 1A2ZA 4P6YA 5C88A 5HVFA 4J3GA 2C5QA 2ABZA 3GJZA 4EFDA 4KOVA 3G3SA 4KUAA 5DS0A 4A94A 2VZZA 4UCNA 4C86A 2OB0A 1ELMP 1ZG8A 4A95A 3HUVA 3PEIA 4MBUA 4ZY0A 2WUUA 1KWMA 1S7LA 3VROA 4G1PA 4RUHA 2Q0YA 1CPXA 1L0CA 1XBUA 3CPXA 3DSBA 5DWMA 2G0BA 4BMHA 2CTBA 4E5SA 2FIWA 2JEVA 4R87A 4IF5A 4C68A 4UCMA 2FL4A 3BJ8A 2FT0A 1GHEA 1KBLA 2EWBA 2YNEA 4MCRA 3SJEA 4R9MA 1F57A 4DUKA 2J8NA 3D7FA 4OKOA 3S9NA 2O53A 2B4BA 4KVXA 2CBLA 5HMNA 4A33A 1C30B 3EZBA 3NFQA 4H6ZA 2J8RA 2ZXVA 5G1ZA 4KOSA 2VL1A 1AMPA 1ZG7A 2NSMA 3B2YA 2AFMA 5AG4A 1M44A 1XMTA 5D8NA 4QBJA 4P44A 2F5IA 3KKWA 5IB0A 3K4IA 3TLGA 3MN8A 4IUSA 4EVYA 4MI1A 3TLGB 1FNOA 1H8LA 4M6IA 3OB2B 3F0AA 3FBUA 1M4GA 3W6SA 2XPPA 1Z5RA 2RFHA 3TLZA 3RBUA 1ARLA 4NGQA 2ZEPA 4NCZA 4OC0A 4L8AA 5JVLA 1VI4A 4AXVA 1VIXA 3D7HA 4MCSA 4C7HA 2B5GB 3FJUA 1R61A 1XJOA 4A39A 4B11A 1VBGA 2VEZA 1IU8A 4MFQA 5JH9A 1LFWA 3HLPA 1XF8A 2Q43A 3T9YA 2EVNA 1YVKA 3BXMA 3KQZA 3TCVA 3WC7A 4CRZB 1JDBC 3O8ZA 2AFUA 2VBQA 2Z3NA 3KR4A 4COBA 4RN7A 1LANA 2Q51A 2PJ1A 3H4QA 3D67A 5JPHA 5KTCA 2AFSA 3B3TA 2ARHA 4C2XA 3NE8A 2OLSA 5J3XA 5ISVA 4GPLB 4BPUB 1IYKA 2GLJA 4M8DA 4UF4A 3BUXB 2FS5A 3KZWA 2N3AB 3D66A 4A32A 3S6KA 4NGMA 2AFZA 3D4UA 3SJFA 1C3OB 3A9LA 1NMTA 2BEIA 1QSRA 3EO4A 4MFJA 1WJTA 4ZGYB 5JQ4A 1KC7A 1XEBA 4LX9A 5A27A 1CJWA 3SJGA 2QJ8A 4KS9A 4AVCA 4C9EA 4F8ZA 5K8MA 3KRVA 3IWWA 1QMUA 5CNPA 3B8GA 5HXDA 3BUMB 2PE3A 2DLAA 2PDOA 2Q7SA 4M3SA 3I3GA 4C8PA 1YQEA 4UA3A 2DPSA 1UWYA 5LRGA 4F9UA 1XF1A 4CRYB 5K8NA 2AUNA 2JEWA 4GXHA 1M1DA 5THWA 4M6GA 2HC9A 4Y49B 4JWPA 3IWEA 4UIBA 4TNUA 4B12A 4OAEA 1LOKA 2POKA 4WWVA 1ZLHA 1PYTB 5KTAA 2FXFA 3DR8A 4C85A 1M4LA 4P10A 5BWAB 4R57A 4F6AA 4KVOE 2PJ7A 5J8FA 3SR3A 1IOIA 1B47A 4MCQA 1J4JA 2GANA 3TO7A 2CNMA 1MJAA 1Z9EA 2OH1A 4A37A 3PB8X 3V38A 4OC4A 5AG7A 2ZW5A 1MJ9A 2AFXA 2F7VA 4LUAA 3GUXA 3OWCA 2Z3MA 4H6UA 1BOBA 1S7NA 3PBBA 5LYDA 3ZZIA 3R95A 1FBVA 2PIYA 2B4JC 4CO9A 3JTKA 1Q2CA 3LODA 2YNCA 3PZJA 2B0AA 2CF4A 2FIAA 3D7GA 2XPLA 4JYWA 4HKFA 1V6CA 2PJ0A 5C82A 3FEEA 1R3NA 2OU2A 2X0SA 2A4NA 5HH1A 4P4DA 2ZOGA 3FRMA 3VATA 2G9DA 3KGQA 1DE4C 4DNCA 3BHXA 5AXIA 4XPLA 2QMLA 3ISZA 2Y1MA 4CAWA 4B13A 4L89A 2Q44A 1N71A 3PGPA 2EK8A 5F48A 2ANPA 1Z8LA 2PRBA 1I21A 4UFVA 2ZEOA 3NFZA 4E2AA 4E94A 3IC1A 2PJ3A 3PB6X 4A31A 6CPAA 3I1UA 1VHOA 1AYEA 2PRQA 3MRUA 4QUSA 4CYOA 5JGFA 4UFXA 4C9AA 2F8HA 3V7ZA 5HKWA 3T0TA 2Z0ZA 1DIKA 3UY5A 2PVVA 4RS2A 3LWUA 4CAFA 5LRKA 3SHPA 5F09A 4FD6A 3TLAA 2XPNA 4RI1A 1Q2YA 2V8HA 4CAXA 3BLNA 2PVWA 5DWNA 3H8EA 1HEEA 4QVTA 3G8WA 3I9SA 4OC3A 3QB8A 2PJ5A 4KLVA 2R7HA 2QIRA 1UFHA 4Y49C 3TFYA 4UEFA 3FNCA 3TLYA 4UIAA 5I4MA 2ZEFA 1S5KA 4H1HA 1YGHA 3RNZA 4P4IA 2PJCA 2EZBA 2ZEHA 2PJ9A 4ORFA 4PK3A 1Y9WA 2BSWA 2WSAA 2ZEDA 4MFPA 2WPXA 3TTHA 1Y9ZA 4RR2B 3FEDA 2BO9A 1RO5A 1NE9A 4C7IA 4KORA 1Q7LA 1Z2LA 4OP4A 3PB9X 3PFVA 2FCKA 2PCNA 2OZGA 3IWGA 2GIVA 5CBMA 4JD6A 1QQ9A 3HPHE 2REFA 4AVAA 3ZNIA 3EC4A 2PJAA 2VZYA 3VWDA 4R8FA 2GFQA 1J3LA 4WJBA 4A4CA 3F9KC 4C9VA 1Z8TA 5G20A 3SXOA 3TLBA 3R9FA 4P4EA 3BUNB 1ZLIA 4AG7A 4P4JA 2EUIA 3B3VA 3V8IA 3RYOA 1R43A 4MFZA 2GP4A 2EO8A 3NA6A 4MMOA 4X3RA 2GLFA 3JRUA 2C6CA 2NYQA 2C6GA 2YNDA 3FIXA 2OR4A 4HNYB 3TE4A 1BAVA 5K8PA 2Z3LA 2PJ8A 3FVLA 1LAPA 4UWJA 4KLWA 4YU9A 1XIXA 3C8OA 2ZEMA 4IHMA 4NJRA 3L2NA 3FYNA 4X2TA 1CPSA 3BI1A 1B6BA 1KUXA 2D4PA 2QVPA 2GU2A 4HPSA 4C9UA 2BL1A 4C2YA 4R3KA 5D29A 2B4DA 4KZTA 3T90A 2HQYA 2B4DB 3S6FA 4B6ZA 1ZRSA 1KZFA 4PSXA 4CGMA 2ZEGA 1VKCA 1FY7A 3ICUA 1YW6A 4Q38A 3R96A 2ZW7A 1IB1E 3R1KA 3MGDA 1BO4A 3KHXA 3PFOA 4KOUA 4R7MA 3HMJG 1OBRA 3E0KA 4B10A 2WYRA 3T05A 4HNWB 4MXUA 1PUAA 4OC5A 4ZY2A 4F0YA 3FECA 3GY9A 3DDDA 4OC1A 5ELYA 1YW4A 2PJBA 3S6GA 3K2KA 3IU2A 2XEJA 1QSMA 3DLJA 1B87A 2CXAA 3EFAA 3NH4A 4FD7A 4LQ6A 4NSQA 1GYTA 1XFOA 4GM5A 4JVOA 4CDKA 2PSWA 2R8VA 3RAMA 3GIUA 4CYQA 4C8UA 4UBRA 2PJ4A 2DXQA 5LYIA 3PBEA 4ZBGA 4CAEA 4QC6A 1QSOA 1CG2A 4CGPA 4BPXB 1YLEA 3C26A 3D2MA 4M85A 1S7KA 3QAYA 3U1BA 2YJVA 2P6EA 3B3SA 1Y7RA 2I00A 4F9VA 2EBJA 3R9GA 3TLEA 3T8WA 5I0CA 1Q2DA 2YJTA 4TJVA 1EZAA 3U88C 5J8CA 4LQGA 1KUVA 1KUYA 1P0HA 3IEHA 4R6TA 3B3CA 4MHDA 5F47A 4CGNA 4DYOA 4KOTA 4KNGE 1WK4A 3EZAA 1HDQA 1KEEB 2XEFA 1IY7A 5A28A 3VTAA 1VHEA 4INJA 1Z8XA 4P45A 1ARMA 1BPMA 1JWQA 4UEZA 2ZW6A 2OZUA 4KOWA 4XPDB 1ZYMA 4PXDA 2D0OA 1X12A 2GREA 4NGNA 3WT4A 4KOXA 1X10A 2CY2A 3GB0A 4NFRA 1RXTA 4C8AA 4C99A 1IYLA 2UV8G 2RC4A 3D7DA 3FB3A 4YWYA 1NBWA 2JBKA 4W9YA 2RB7A 4ZYQA 1HDUA 2QECA 3PP9A 5K8OA 3TC8A 3TX8A 4BINA 4KOYA 5JM6A 3GKRA 1VGYA 4P4FA 4JXQA 4TJXA 2HV2A 3EZEA 1XE4A 2ZW4A 2C6PA 2G3TA 4R3LA 4UCPA 4ZI6A 2IQ6A 3I6SA 4U5YA 4KUBA 5HVHA 4A4BA 2HI6A 2PC1A 1FT7A 4Q36A 4JLYA 3VRNA 4ZX9A 1SQHA 2D0PA 3W91A 3OB1B 5LYLA 1A9XB 4XNHC 1VBHA 2E28A 3VARA 2DEAA 2CNTA 4X8IA 5HVGA 1S3ZA 1I1DA 3FX6A 1XOVA 3KL9A 2IL4A 3KHZA 5EMIA 1TKHA 2XPOA 2PJ6A 2HB6A 5GCNA 4YN3A 2C27A 1YVOA 3S6HA 1Y0RA 5AG5A 2REEA 2Y1NA 4GS4A 3S9LA 1YREA 1TXRA 3DR6A 3IGRA 4CGOA 4C8TA 1CS0B 1PU9A 2BUEA 2ZOFA 3CT9A 2Q4VA 3SI1A 5HKZA 2CIJA 3S9MA 2VQYA 1NSAA 2YNCC 3D3SA 2VXKA 5LRJA 5JYBA 1LRZA 4R76A 2D4OA 2B3VA 4MHNA 3PB7X 4F0XA 2V8DA 1BPNA 2JBJA 2C1CA 2EK9A 3P2FA 3NOJA 3CDXA 2FSRA 4JZ0A 2J8MA 1NSLA 1ON0A 4BTFA 1Y7EA 3CXQA 2AE6A 1YVHA 2CTCA 4PXCA 1I12A 1F2PA 4NGSA 4A30A 2ZEEA 4CZ1A 3RO0A 4HNXB 4MI4A 3OAKA 5F13A 4DJLA 3FF3A 3WR7A 4OIDA 3NE7A 4H2KA 3BUOB 1YR0A 1M4IA 2VI7A 5H84A 5IB9A 2Q4YA 3KASA 1GGOA 3QAHA 4NGTA 1ELLP 4I49A 2PIZA 3KI9A 4CPAA 3SI0A 1YSJA 2JDDA 1IGBA 3FMCA 5HKYA 4JXRA 4ONUA 4KSFA 5CPAA 4ZY1A 4MJXA 5G21A 4K30A 2YGWA 1F2OA 4Q7AA 4NEXA 4CYNA 3JVNA 2PR1A 1R57A 2Z11A 2EZCA 3VRQA 2JLMA 1CP6A 3FH4A 4IK2A 4BPWB 4KSIA 4MFKA 4B5PB 4MCPA 2FE7A 4B5PA 1CBXA 4AVBA 1ZO0A 2H5MA 3GLJA 1U6MA 4OC2A 4MY0A 3HPGG 5AGEA 4PPZA 3KR5A 4Z65A 2KCWA 3VH9A 4FAIA 1EO0A 2B58A 2BOAA 3PT1A 4NGPA 4ONWA 5AG6A 4X5KA 3R9EA 2JDCA 4FD4A 2XEGA 3VGOA 4OIWA 3B3WA 3RZAA 4FD5A 2IJZA 3D8PA 5FVJA 1WWZA 3IO1A 2DIKA 5F1YA 4C9RA 7CPAA 2AUMA 4EYSA 4A2ZA 4C84A 4UWIA 2HROA 1TF8A 3KQXA 3N7ZA 1EE3P 2O28A 5EBVA 4II9A 5K99A 2V8VA 1QSTA 3TOAA 1BXRB 2IMOA 3WC5A 5FD8A 1LAMA 2CNSA 1RTQA 3NH5A 2B5GA 2DPTA 4PK2A 4C8FA 2BCOA 1V0CA 1XMBA 2ODFA 2PR8A 3NH8A 2EZAA 2OOTA 1Z4RA 4YFJA 2R1IA 2Z3KA 1CE8B 2AFWA 1JQGA 3CXPA 5J1QA 4FWUA 3P2HA 2R82A 3TOBA 2GE3A 2NMTA 3H5ZA 1Y0YA 1YX0A 2K5TA 3GYAA 3LACA 4BBHA 4XNHB 4CGLA 1P4NA 5F5XA 3T5MA 2PJ2A 3PFEA 4MHZA 1ZG9A 3WC6A 4MJ8A 3BI0A 1DTDA 3H8GA 2ZELA 4MHYA 1S7FA 2P6GA 3SXNA 3T07A 1PCAA 2AJ6A 1Z9UA 4K3NA 5EC4A 5F9MA 3CZXA 3EXNA 3B7IA 1TKFA 2HWGA 4B14A 4KSAA 2V8GA 3D68A 4PV6A 3SI2A 4FBEA 4OADA 3LD2A 4EWTA 5IV0A 2J9AA 4P4BA 1TIQA 4CS0B 5BY0A 4OMEA 3QNVA 3IU1A 1VHSA 3N5FA 4JJXA 4NF1A 1JDEA 2Z10A
chains in the Genus database with same CATH topology
2ZENA 3PB4X 4PQAA 4CDJA 1CX8A 2FVGA 3SJXA 2AFOA 4EMEA 4UEEA 1YMEA 4NGRA 2Q4ZA 2I3CA 4MHPA 3EIFA 2PCUA 2XEIA 5IR2A 3K9TA 4O23A 4BD9A 1TKJA 5LYFA 4FUUA 4PXEA 3IJ3A 3I74A 2O4HA 2QYVA 2V77A 1BLLE 4TWEA 3WABA 3LMSA 3CPAA 3B35A 3ISXA 4A38A 3H8FA 4MRIA 3PRTA 1XRYA 1TF9A 4NJQA 1CP7A 1LCPA 3IFEA 3IIBA 1YLOA 4PXBA 4C8CA 4IAVA 3DGVA 1WVMA 8CPAA 4ZX8A 2WZNA 4P6YA 2C5QA 5HVFA 2ABZA 4EFDA 5DS0A 4A94A 4C86A 1ELMP 1ZG8A 3HUVA 3PEIA 4ZY0A 1KWMA 4G1PA 4RUHA 1CPXA 1XBUA 3CPXA 2CTBA 2EWBA 4MCRA 3SJEA 1F57A 4DUKA 3D7FA 4OKOA 3S9NA 2O53A 2VL1A 1AMPA 1ZG7A 2NSMA 3B2YA 2AFMA 5D8NA 4P44A 3MN8A 1FNOA 1H8LA 2RFHA 1Z5RA 3RBUA 1ARLA 4NGQA 2ZEPA 4OC0A 4AXVA 1VIXA 3D7HA 4MCSA 3FJUA 1XJOA 4A39A 5JH9A 1LFWA 3HLPA 2Q43A 3BXMA 3KQZA 3WC7A 2AFUA 3KR4A 1LANA 2Q51A 2PJ1A 3D67A 2AFSA 3B3TA 2GLJA 4UF4A 3KZWA 3D66A 4NGMA 2AFZA 3D4UA 3SJFA 3SJGA 2QJ8A 4C9EA 4F8ZA 5K8MA 3IWWA 1QMUA 5HXDA 2PE3A 4C8PA 1UWYA 5LRGA 4F9UA 1XF1A 5K8NA 2JEWA 5THWA 2HC9A 4UIBA 4TNUA 1LOKA 2POKA 4WWVA 1ZLHA 1PYTB 1M4LA 4P10A 2PJ7A 4MCQA 4A37A 3PB8X 3V38A 4OC4A 2AFXA 2F7VA 3GUXA 3PBBA 5LYDA 2PIYA 2CF4A 3D7GA 4JYWA 1V6CA 2PJ0A 3FEEA 1R3NA 4P4DA 2ZOGA 3VATA 2G9DA 3KGQA 1DE4C 3BHXA 3ISZA 2EK8A 2ANPA 1Z8LA 2ZEOA 3NFZA 3IC1A 2PJ3A 3PB6X 6CPAA 3I1UA 1VHOA 1AYEA 3MRUA 2PRQA 5JGFA 4C9AA 2F8HA 3V7ZA 2PVVA 3LWUA 5LRKA 5F09A 2V8HA 2PVWA 3H8EA 1HEEA 4OC3A 2PJ5A 4UEFA 4UIAA 5I4MA 2ZEFA 4P4IA 2PJCA 2ZEHA 2PJ9A 2ZEDA 1Y9ZA 2BO9A 3FEDA 1Q7LA 1Z2LA 4OP4A 3PB9X 5CBMA 1QQ9A 2PJAA 4R8FA 4WJBA 4C9VA 4P4EA 1ZLIA 4P4JA 3B3VA 2GP4A 1R43A 3NA6A 4MMOA 4X3RA 2GLFA 3JRUA 2C6CA 2NYQA 2C6GA 2OR4A 1BAVA 5K8PA 2PJ8A 3FVLA 1LAPA 4YU9A 2ZEMA 4IHMA 4NJRA 3L2NA 4X2TA 1CPSA 3BI1A 2QVPA 2GU2A 4C9UA 5D29A 4B6ZA 3ICUA 2ZEGA 1YW6A 4R7MA 3KHXA 3PFOA 1OBRA 2WYRA 4MXUA 4OC5A 4ZY2A 3FECA 4OC1A 5ELYA 1YW4A 2PJBA 3K2KA 2XEJA 3DLJA 3NH4A 1GYTA 1XFOA 4GM5A 4CDKA 3RAMA 4C8UA 2PJ4A 5LYIA 3PBEA 1CG2A 3B3SA 4F9VA 3T8WA 4TJVA 4LQGA 3IEHA 4R6TA 3B3CA 4DYOA 4KNGE 1HDQA 2XEFA 1IY7A 3VTAA 1VHEA 4UEZA 4P45A 1ARMA 1BPMA 4PXDA 2GREA 4NGNA 3WT4A 3GB0A 4NFRA 4C8AA 4C99A 3D7DA 4YWYA 2JBKA 4W9YA 2RB7A 4ZYQA 1HDUA 5K8OA 3TC8A 3TX8A 5JM6A 1VGYA 4P4FA 4TJXA 2C6PA 4ZI6A 2IQ6A 3I6SA 5HVHA 1FT7A 4ZX9A 5LYLA 3VARA 2DEAA 4X8IA 5HVGA 3FX6A 3KL9A 3KHZA 1TKHA 2PJ6A 2HB6A 4YN3A 1Y0RA 3S9LA 1TXRA 4C8TA 2ZOFA 3CT9A 3SI1A 2CIJA 3S9MA 1NSAA 5LRJA 4R76A 4MHNA 3PB7X 2V8DA 1BPNA 2JBJA 2C1CA 2EK9A 3CDXA 4JZ0A 1Y7EA 2CTCA 4PXCA 1F2PA 4NGSA 2ZEEA 4DJLA 3FF3A 4OIDA 4H2KA 5IB9A 3KASA 4NGTA 1ELLP 2PIZA 3KI9A 4CPAA 3SI0A 1YSJA 1IGBA 3FMCA 5CPAA 4ZY1A 1F2OA 4Q7AA 4KSIA 3FH4A 1CP6A 4IK2A 4MCPA 1CBXA 3GLJA 4OC2A 4Z65A 4PPZA 3KR5A 3VH9A 4FAIA 2BOAA 4NGPA 4ONWA 2XEGA 4OIWA 3B3WA 3RZAA 2IJZA 4C9RA 3IO1A 7CPAA 4C84A 1TF8A 3KQXA 1EE3P 2V8VA 2IMOA 3WC5A 1LAMA 1RTQA 3NH5A 4C8FA 2BCOA 1XMBA 3NH8A 2OOTA 2AFWA 1JQGA 5J1QA 4FWUA 1Y0YA 4C85A 2PJ2A 3PFEA 4MHZA 1ZG9A 3WC6A 3BI0A 1DTDA 3H8GA 2ZELA 4MHYA 1PCAA 4K3NA 3B7IA 1TKFA 2V8GA 3D68A 3SI2A 4FBEA 4EWTA 2J9AA 4P4BA 4OMEA 3QNVA 3N5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEN A;  3PB4 X;  4PQA A;  4CDJ A;  1CX8 A;  2FVG A;  3SJX A;  2AFO A;  4EME A;  4UEE A;  1YME A;  4NGR A;  2Q4Z A;  2I3C A;  4MHP A;  3EIF A;  2PCU A;  2XEI A;  3K9T A;  4O23 A;  4BD9 A;  1TKJ A;  5LYF A;  4FUU A;  4PXE A;  3IJ3 A;  3I74 A;  2O4H A;  2QYV A;  2V77 A;  1BLL E;  4TWE A;  3WAB A;  3LMS A;  3CPA A;  3B35 A;  3ISX A;  4A38 A;  3H8F A;  4MRI A;  3PRT A;  1XRY A;  1TF9 A;  4NJQ A;  1CP7 A;  1LCP A;  3IFE A;  3IIB A;  1YLO A;  4PXB A;  4C8C A;  4IAV A;  3DGV A;  1WVM A;  8CPA A;  4ZX8 A;  2WZN A;  4P6Y A;  5HVF A;  2ABZ A;  4EFD A;  5DS0 A;  4A94 A;  4C86 A;  1ELM P;  1ZG8 A;  3HUV A;  3PEI A;  4ZY0 A;  1KWM A;  4G1P A;  4RUH A;  1CPX A;  1XBU A;  3CPX A;  2CTB A;  2EWB A;  4MCR A;  3SJE A;  1F57 A;  4DUK A;  3D7F A;  4OKO A;  3S9N A;  2O53 A;  2VL1 A;  1AMP A;  1ZG7 A;  2NSM A;  3B2Y A;  2AFM A;  5D8N A;  4P44 A;  3MN8 A;  1FNO A;  1H8L A;  2RFH A;  1Z5R A;  3RBU A;  1ARL A;  4NGQ A;  2ZEP A;  4OC0 A;  4AXV A;  1VIX A;  3D7H A;  4MCS A;  3FJU A;  1XJO A;  4A39 A;  5JH9 A;  1LFW A;  3HLP A;  2Q43 A;  3BXM A;  3KQZ A;  3WC7 A;  2AFU A;  3KR4 A;  1LAN A;  2Q51 A;  2PJ1 A;  3D67 A;  2AFS A;  3B3T A;  2GLJ A;  4UF4 A;  3KZW A;  3D66 A;  4NGM A;  2AFZ A;  3D4U A;  3SJF A;  3SJG A;  2QJ8 A;  4C9E A;  4F8Z A;  5K8M A;  3IWW A;  1QMU A;  5HXD A;  2PE3 A;  4C8P A;  1UWY A;  5LRG A;  4F9U A;  1XF1 A;  5K8N A;  2JEW A;  5THW A;  2HC9 A;  4UIB A;  4TNU A;  1LOK A;  2POK A;  4WWV A;  1ZLH A;  1PYT B;  1M4L A;  4P10 A;  2PJ7 A;  4MCQ A;  4A37 A;  3PB8 X;  3V38 A;  4OC4 A;  2AFX A;  2F7V A;  3GUX A;  3PBB A;  5LYD A;  2PIY A;  2CF4 A;  3D7G A;  4JYW A;  1V6C A;  2PJ0 A;  3FEE A;  1R3N A;  4P4D A;  2ZOG A;  3VAT A;  2G9D A;  3KGQ A;  1DE4 C;  3BHX A;  3ISZ A;  2EK8 A;  2ANP A;  1Z8L A;  2ZEO A;  3NFZ A;  3IC1 A;  2PJ3 A;  3PB6 X;  6CPA A;  3I1U A;  1VHO A;  1AYE A;  3MRU A;  2PRQ A;  5JGF A;  4C9A A;  2F8H A;  3V7Z A;  2PVV A;  3LWU A;  5LRK A;  5F09 A;  2V8H A;  2PVW A;  3H8E A;  1HEE A;  4OC3 A;  2PJ5 A;  4UEF A;  4UIA A;  5I4M A;  2ZEF A;  4P4I A;  2PJC A;  2ZEH A;  2PJ9 A;  2ZED A;  1Y9Z A;  2BO9 A;  3FED A;  1Q7L A;  1Z2L A;  4OP4 A;  3PB9 X;  5CBM A;  1QQ9 A;  2PJA A;  4R8F A;  4WJB A;  4C9V A;  4P4E A;  1ZLI A;  4P4J A;  3B3V A;  1R43 A;  3NA6 A;  4MMO A;  4X3R A;  2GLF A;  3JRU A;  2C6C A;  2NYQ A;  2C6G A;  2OR4 A;  1BAV A;  5K8P A;  2PJ8 A;  3FVL A;  1LAP A;  4YU9 A;  2ZEM A;  4IHM A;  4NJR A;  3L2N A;  4X2T A;  1CPS A;  3BI1 A;  2QVP A;  2GU2 A;  4C9U A;  5D29 A;  4B6Z A;  3ICU A;  2ZEG A;  1YW6 A;  4R7M A;  3KHX A;  3PFO A;  1OBR A;  2WYR A;  4MXU A;  4OC5 A;  4ZY2 A;  3FEC A;  4OC1 A;  5ELY A;  1YW4 A;  2PJB A;  3K2K A;  2XEJ A;  3DLJ A;  3NH4 A;  1GYT A;  1XFO A;  4GM5 A;  4CDK A;  3RAM A;  4C8U A;  2PJ4 A;  5LYI A;  3PBE A;  1CG2 A;  3B3S A;  4F9V A;  3T8W A;  4TJV A;  4LQG A;  3IEH A;  4R6T A;  3B3C A;  4DYO A;  4KNG E;  1HDQ A;  2XEF A;  1IY7 A;  3VTA A;  1VHE A;  4UEZ A;  4P45 A;  1ARM A;  1BPM A;  4PXD A;  2GRE A;  4NGN A;  3WT4 A;  3GB0 A;  4NFR A;  4C8A A;  4C99 A;  3D7D A;  4YWY A;  2JBK A;  4W9Y A;  2RB7 A;  4ZYQ A;  1HDU A;  5K8O A;  3TC8 A;  3TX8 A;  5JM6 A;  1VGY A;  4P4F A;  4TJX A;  2C6P A;  4ZI6 A;  2IQ6 A;  3I6S A;  5HVH A;  1FT7 A;  4ZX9 A;  5LYL A;  3VAR A;  2DEA A;  4X8I A;  5HVG A;  3FX6 A;  3KL9 A;  3KHZ A;  1TKH A;  2PJ6 A;  2HB6 A;  4YN3 A;  1Y0R A;  3S9L A;  1TXR A;  4C8T A;  2ZOF A;  3CT9 A;  3SI1 A;  2CIJ A;  3S9M A;  1NSA A;  5LRJ A;  4R76 A;  4MHN A;  3PB7 X;  2V8D A;  1BPN A;  2JBJ A;  2C1C A;  2EK9 A;  3CDX A;  4JZ0 A;  1Y7E A;  2CTC A;  4PXC A;  1F2P A;  4NGS A;  2ZEE A;  4DJL A;  3FF3 A;  4OID A;  4H2K A;  5IB9 A;  3KAS A;  4NGT A;  1ELL P;  2PIZ A;  3KI9 A;  4CPA A;  3SI0 A;  1YSJ A;  1IGB A;  3FMC A;  5CPA A;  4ZY1 A;  1F2O A;  4Q7A A;  4KSI A;  3FH4 A;  1CP6 A;  4IK2 A;  4MCP A;  1CBX A;  3GLJ A;  4OC2 A;  4Z65 A;  4PPZ A;  3KR5 A;  3VH9 A;  4FAI A;  2BOA A;  4NGP A;  4ONW A;  2XEG A;  4OIW A;  3B3W A;  3RZA A;  2IJZ A;  4C9R A;  3IO1 A;  7CPA A;  4C84 A;  1TF8 A;  3KQX A;  1EE3 P;  2V8V A;  2IMO A;  3WC5 A;  1LAM A;  1RTQ A;  3NH5 A;  4C8F A;  2BCO A;  1XMB A;  3NH8 A;  2OOT A;  2AFW A;  1JQG A;  5J1Q A;  4FWU A;  1Y0Y A;  4C85 A;  2PJ2 A;  3PFE A;  4MHZ A;  1ZG9 A;  3WC6 A;  3BI0 A;  1DTD A;  3H8G A;  2ZEL A;  4MHY A;  1PCA A;  4K3N A;  3B7I A;  1TKF A;  2V8G A;  3D68 A;  3SI2 A;  4FBE A;  4EWT A;  2J9A A;  4P4B A;  4OME A;  3QNV A;  3N5F A; 
#chains in the Genus database with same CATH topology
 2ZEN A;  3W6X A;  1AUG A;  3PB4 X;  4QB9 A;  4PQA A;  3BJ7 A;  1CX8 A;  4CDJ A;  1EZB A;  2FVG A;  2MP0 A;  5G22 A;  4CAV A;  3SJX A;  3TO6 A;  5E96 A;  1MK4 A;  1CM0 A;  2Q04 A;  3PLF B;  2AFO A;  4EME A;  4UEE A;  2OZH A;  1YME A;  4NGR A;  2Q4Z A;  2G3A A;  4U9Y A;  4MFL A;  2I3C A;  4MHP A;  3FXT A;  3D2P A;  1M6V B;  2PCU A;  3EIF A;  2XEI A;  2DF5 A;  5IR2 A;  4YGO A;  3K9T A;  1IOF A;  5H86 A;  2ATR A;  2PQ8 A;  2I79 A;  4O23 A;  4XPK A;  3TO9 A;  2Z3P A;  4BD9 A;  2WPW A;  1TKJ A;  5LYF A;  1NXJ A;  4FUU A;  1OZP A;  2P0W A;  4PXE A;  4E0A A;  3IJ3 A;  3I74 A;  3OP0 A;  2O4H A;  1QSN A;  2QYV A;  2V77 A;  2ZPA A;  3K9U A;  3G23 A;  2Y0M A;  1ZL0 A;  3TYX A;  1BLL E;  1K4J A;  3EY5 A;  3F5B A;  4TWE A;  3VWE A;  4U9Z A;  4UFW A;  3WAB A;  1MJB A;  1Y9K A;  3LMS A;  1Q5X A;  5F49 A;  4CYP A;  4E8O A;  4COG A;  2HUZ A;  3VRR A;  2Z3O A;  4KVM E;  1M4D A;  3CPA A;  4OLL A;  4IIX A;  3B35 A;  3JUW A;  1IIC A;  3ISX A;  3BUW B;  5IX3 A;  4A38 A;  3H8F A;  4NXY A;  4J0N A;  2B3U A;  4MRI A;  3PRT A;  1YK3 A;  1S60 A;  3ZJ0 A;  4MY3 A;  3VRP A;  4PSW A;  4B5O A;  4H89 A;  5F46 A;  1XRY A;  4AB7 A;  1TF9 A;  4NJQ A;  4IIY A;  2P6F A;  3CXS A;  2R98 A;  1Z4E A;  3TT2 A;  4AG9 A;  1CP7 A;  1LCP A;  2X7B A;  3IFE A;  3IIB A;  4XPD C;  1T36 B;  3TLC A;  2Q7B A;  2FM4 A;  1YLO A;  4PXB A;  5KTD A;  1IID A;  4IAV A;  4YRH A;  4C8C A;  2VKZ G;  3DGV A;  3F8K A;  4M6H A;  8CPA A;  1WVM A;  4ZX8 A;  1Z8W A;  2WZN A;  3DNS A;  4C2Z A;  1A2Z A;  4P6Y A;  5C88 A;  5HVF A;  4J3G A;  2C5Q A;  2ABZ A;  3GJZ A;  4EFD A;  4KOV A;  3G3S A;  4KUA A;  5DS0 A;  4A94 A;  2VZZ A;  4UCN A;  4C86 A;  2OB0 A;  1ELM P;  1ZG8 A;  4A95 A;  3HUV A;  3PEI A;  4MBU A;  4ZY0 A;  2WUU A;  1KWM A;  1S7L A;  3VRO A;  4G1P A;  4RUH A;  2Q0Y A;  1CPX A;  1L0C A;  1XBU A;  3CPX A;  3DSB A;  5DWM A;  2G0B A;  4BMH A;  2CTB A;  4E5S A;  2FIW A;  2JEV A;  4R87 A;  4IF5 A;  4C68 A;  4UCM A;  2FL4 A;  3BJ8 A;  2FT0 A;  1GHE A;  1KBL A;  2EWB A;  2YNE A;  4MCR A;  3SJE A;  4R9M A;  1F57 A;  4DUK A;  2J8N A;  3D7F A;  4OKO A;  3S9N A;  2O53 A;  2B4B A;  4KVX A;  2CBL A;  5HMN A;  4A33 A;  1C30 B;  3EZB A;  3NFQ A;  4H6Z A;  2J8R A;  2ZXV A;  5G1Z A;  4KOS A;  2VL1 A;  1AMP A;  1ZG7 A;  2NSM A;  3B2Y A;  2AFM A;  5AG4 A;  1M44 A;  1XMT A;  5D8N A;  4QBJ A;  4P44 A;  2F5I A;  3KKW A;  5IB0 A;  3K4I A;  3TLG A;  3MN8 A;  4IUS A;  4EVY A;  4MI1 A;  3TLG B;  1FNO A;  1H8L A;  4M6I A;  3OB2 B;  3F0A A;  3FBU A;  1M4G A;  3W6S A;  2XPP A;  1Z5R A;  2RFH A;  3TLZ A;  3RBU A;  1ARL A;  4NGQ A;  2ZEP A;  4NCZ A;  4OC0 A;  4L8A A;  5JVL A;  1VI4 A;  4AXV A;  1VIX A;  3D7H A;  4MCS A;  4C7H A;  2B5G B;  3FJU A;  1R61 A;  1XJO A;  4A39 A;  4B11 A;  1VBG A;  2VEZ A;  1IU8 A;  4MFQ A;  5JH9 A;  1LFW A;  3HLP A;  1XF8 A;  2Q43 A;  3T9Y A;  2EVN A;  1YVK A;  3BXM A;  3KQZ A;  3TCV A;  3WC7 A;  4CRZ B;  1JDB C;  3O8Z A;  2AFU A;  2VBQ A;  2Z3N A;  3KR4 A;  4COB A;  4RN7 A;  1LAN A;  2Q51 A;  2PJ1 A;  3H4Q A;  3D67 A;  5JPH A;  5KTC A;  2AFS A;  3B3T A;  2ARH A;  4C2X A;  3NE8 A;  2OLS A;  5J3X A;  5ISV A;  4GPL B;  4BPU B;  1IYK A;  2GLJ A;  4M8D A;  4UF4 A;  3BUX B;  2FS5 A;  3KZW A;  2N3A B;  3D66 A;  4A32 A;  3S6K A;  4NGM A;  2AFZ A;  3D4U A;  3SJF A;  1C3O B;  3A9L A;  1NMT A;  2BEI A;  1QSR A;  3EO4 A;  4MFJ A;  1WJT A;  4ZGY B;  5JQ4 A;  1KC7 A;  1XEB A;  4LX9 A;  5A27 A;  1CJW A;  3SJG A;  2QJ8 A;  4KS9 A;  4AVC A;  4C9E A;  4F8Z A;  5K8M A;  3KRV A;  3IWW A;  1QMU A;  5CNP A;  3B8G A;  5HXD A;  3BUM B;  2PE3 A;  2DLA A;  2PDO A;  2Q7S A;  4M3S A;  3I3G A;  4C8P A;  1YQE A;  4UA3 A;  2DPS A;  1UWY A;  5LRG A;  4F9U A;  1XF1 A;  4CRY B;  5K8N A;  2AUN A;  2JEW A;  4GXH A;  1M1D A;  5THW A;  4M6G A;  2HC9 A;  4Y49 B;  4JWP A;  3IWE A;  4UIB A;  4TNU A;  4B12 A;  4OAE A;  1LOK A;  2POK A;  4WWV A;  1ZLH A;  1PYT B;  5KTA A;  2FXF A;  3DR8 A;  4C85 A;  1M4L A;  4P10 A;  5BWA B;  4R57 A;  4F6A A;  4KVO E;  2PJ7 A;  5J8F A;  3SR3 A;  1IOI A;  1B47 A;  4MCQ A;  1J4J A;  2GAN A;  3TO7 A;  2CNM A;  1MJA A;  1Z9E A;  2OH1 A;  4A37 A;  3PB8 X;  3V38 A;  4OC4 A;  5AG7 A;  2ZW5 A;  1MJ9 A;  2AFX A;  2F7V A;  4LUA A;  3GUX A;  3OWC A;  2Z3M A;  4H6U A;  1BOB A;  1S7N A;  3PBB A;  5LYD A;  3ZZI A;  3R95 A;  1FBV A;  2PIY A;  2B4J C;  4CO9 A;  3JTK A;  1Q2C A;  3LOD A;  2YNC A;  3PZJ A;  2B0A A;  2CF4 A;  2FIA A;  3D7G A;  2XPL A;  4JYW A;  4HKF A;  1V6C A;  2PJ0 A;  5C82 A;  3FEE A;  1R3N A;  2OU2 A;  2X0S A;  2A4N A;  5HH1 A;  4P4D A;  2ZOG A;  3FRM A;  3VAT A;  2G9D A;  3KGQ A;  1DE4 C;  4DNC A;  3BHX A;  5AXI A;  4XPL A;  2QML A;  3ISZ A;  2Y1M A;  4CAW A;  4B13 A;  4L89 A;  2Q44 A;  1N71 A;  3PGP A;  2EK8 A;  5F48 A;  2ANP A;  1Z8L A;  2PRB A;  1I21 A;  4UFV A;  2ZEO A;  3NFZ A;  4E2A A;  4E94 A;  3IC1 A;  2PJ3 A;  3PB6 X;  4A31 A;  6CPA A;  3I1U A;  1VHO A;  1AYE A;  2PRQ A;  3MRU A;  4QUS A;  4CYO A;  5JGF A;  4UFX A;  4C9A A;  2F8H A;  3V7Z A;  5HKW A;  3T0T A;  2Z0Z A;  1DIK A;  3UY5 A;  2PVV A;  4RS2 A;  3LWU A;  4CAF A;  5LRK A;  3SHP A;  5F09 A;  4FD6 A;  3TLA A;  2XPN A;  4RI1 A;  1Q2Y A;  2V8H A;  4CAX A;  3BLN A;  2PVW A;  5DWN A;  3H8E A;  1HEE A;  4QVT A;  3G8W A;  3I9S A;  4OC3 A;  3QB8 A;  2PJ5 A;  4KLV A;  2R7H A;  2QIR A;  1UFH A;  4Y49 C;  3TFY A;  4UEF A;  3FNC A;  3TLY A;  4UIA A;  5I4M A;  2ZEF A;  1S5K A;  4H1H A;  1YGH A;  3RNZ A;  4P4I A;  2PJC A;  2EZB A;  2ZEH A;  2PJ9 A;  4ORF A;  4PK3 A;  1Y9W A;  2BSW A;  2WSA A;  2ZED A;  4MFP A;  2WPX A;  3TTH A;  1Y9Z A;  4RR2 B;  3FED A;  2BO9 A;  1RO5 A;  1NE9 A;  4C7I A;  4KOR A;  1Q7L A;  1Z2L A;  4OP4 A;  3PB9 X;  3PFV A;  2FCK A;  2PCN A;  2OZG A;  3IWG A;  2GIV A;  5CBM A;  4JD6 A;  1QQ9 A;  3HPH E;  2REF A;  4AVA A;  3ZNI A;  3EC4 A;  2PJA A;  2VZY A;  3VWD A;  4R8F A;  2GFQ A;  1J3L A;  4WJB A;  4A4C A;  3F9K C;  4C9V A;  1Z8T A;  5G20 A;  3SXO A;  3TLB A;  3R9F A;  4P4E A;  3BUN B;  1ZLI A;  4AG7 A;  4P4J A;  2EUI A;  3B3V A;  3V8I A;  3RYO A;  1R43 A;  4MFZ A;  2GP4 A;  2EO8 A;  3NA6 A;  4MMO A;  4X3R A;  2GLF A;  3JRU A;  2C6C A;  2NYQ A;  2C6G A;  2YND A;  3FIX A;  2OR4 A;  4HNY B;  3TE4 A;  1BAV A;  5K8P A;  2Z3L A;  2PJ8 A;  3FVL A;  1LAP A;  4UWJ A;  4KLW A;  4YU9 A;  1XIX A;  3C8O A;  2ZEM A;  4IHM A;  4NJR A;  3L2N A;  3FYN A;  4X2T A;  1CPS A;  3BI1 A;  1B6B A;  1KUX A;  2D4P A;  2QVP A;  2GU2 A;  4HPS A;  4C9U A;  2BL1 A;  4C2Y A;  4R3K A;  5D29 A;  2B4D A;  4KZT A;  3T90 A;  2HQY A;  2B4D B;  3S6F A;  4B6Z A;  1ZRS A;  1KZF A;  4PSX A;  4CGM A;  2ZEG A;  1VKC A;  1FY7 A;  3ICU A;  1YW6 A;  4Q38 A;  3R96 A;  2ZW7 A;  1IB1 E;  3R1K A;  3MGD A;  1BO4 A;  3KHX A;  3PFO A;  4KOU A;  4R7M A;  3HMJ G;  1OBR A;  3E0K A;  4B10 A;  2WYR A;  3T05 A;  4HNW B;  4MXU A;  1PUA A;  4OC5 A;  4ZY2 A;  4F0Y A;  3FEC A;  3GY9 A;  3DDD A;  4OC1 A;  5ELY A;  1YW4 A;  2PJB A;  3S6G A;  3K2K A;  3IU2 A;  2XEJ A;  1QSM A;  3DLJ A;  1B87 A;  2CXA A;  3EFA A;  3NH4 A;  4FD7 A;  4LQ6 A;  4NSQ A;  1GYT A;  1XFO A;  4GM5 A;  4JVO A;  4CDK A;  2PSW A;  2R8V A;  3RAM A;  3GIU A;  4CYQ A;  4C8U A;  4UBR A;  2PJ4 A;  2DXQ A;  5LYI A;  3PBE A;  4ZBG A;  4CAE A;  4QC6 A;  1QSO A;  1CG2 A;  4CGP A;  4BPX B;  1YLE A;  3C26 A;  3D2M A;  4M85 A;  1S7K A;  3QAY A;  3U1B A;  2YJV A;  2P6E A;  3B3S A;  1Y7R A;  2I00 A;  4F9V A;  2EBJ A;  3R9G A;  3TLE A;  3T8W A;  5I0C A;  1Q2D A;  2YJT A;  4TJV A;  1EZA A;  3U88 C;  5J8C A;  4LQG A;  1KUV A;  1KUY A;  1P0H A;  3IEH A;  4R6T A;  3B3C A;  4MHD A;  5F47 A;  4CGN A;  4DYO A;  4KOT A;  4KNG E;  1WK4 A;  3EZA A;  1HDQ A;  1KEE B;  2XEF A;  1IY7 A;  5A28 A;  3VTA A;  1VHE A;  4INJ A;  1Z8X A;  4P45 A;  1ARM A;  1BPM A;  1JWQ A;  4UEZ A;  2ZW6 A;  2OZU A;  4KOW A;  4XPD B;  1ZYM A;  4PXD A;  2D0O A;  1X12 A;  2GRE A;  4NGN A;  3WT4 A;  4KOX A;  1X10 A;  2CY2 A;  3GB0 A;  4NFR A;  1RXT A;  4C8A A;  4C99 A;  1IYL A;  2UV8 G;  2RC4 A;  3D7D A;  3FB3 A;  4YWY A;  1NBW A;  2JBK A;  4W9Y A;  2RB7 A;  4ZYQ A;  1HDU A;  2QEC A;  3PP9 A;  5K8O A;  3TC8 A;  3TX8 A;  4BIN A;  4KOY A;  5JM6 A;  3GKR A;  1VGY A;  4P4F A;  4JXQ A;  4TJX A;  2HV2 A;  3EZE A;  1XE4 A;  2ZW4 A;  2C6P A;  2G3T A;  4R3L A;  4UCP A;  4ZI6 A;  2IQ6 A;  3I6S A;  4U5Y A;  4KUB A;  5HVH A;  4A4B A;  2HI6 A;  2PC1 A;  1FT7 A;  4Q36 A;  4JLY A;  3VRN A;  4ZX9 A;  1SQH A;  2D0P A;  3W91 A;  3OB1 B;  5LYL A;  1A9X B;  4XNH C;  1VBH A;  2E28 A;  3VAR A;  2DEA A;  2CNT A;  4X8I A;  5HVG A;  1S3Z A;  1I1D A;  3FX6 A;  1XOV A;  3KL9 A;  2IL4 A;  3KHZ A;  5EMI A;  1TKH A;  2XPO A;  2PJ6 A;  2HB6 A;  5GCN A;  4YN3 A;  2C27 A;  1YVO A;  3S6H A;  1Y0R A;  5AG5 A;  2REE A;  2Y1N A;  4GS4 A;  3S9L A;  1YRE A;  1TXR A;  3DR6 A;  3IGR A;  4CGO A;  4C8T A;  1CS0 B;  1PU9 A;  2BUE A;  2ZOF A;  3CT9 A;  2Q4V A;  3SI1 A;  5HKZ A;  2CIJ A;  3S9M A;  2VQY A;  1NSA A;  2YNC C;  3D3S A;  2VXK A;  5LRJ A;  5JYB A;  1LRZ A;  4R76 A;  2D4O A;  2B3V A;  4MHN A;  3PB7 X;  4F0X A;  2V8D A;  1BPN A;  2JBJ A;  2C1C A;  2EK9 A;  3P2F A;  3NOJ A;  3CDX A;  2FSR A;  4JZ0 A;  2J8M A;  1NSL A;  1ON0 A;  4BTF A;  1Y7E A;  3CXQ A;  2AE6 A;  1YVH A;  2CTC A;  4PXC A;  1I12 A;  1F2P A;  4NGS A;  4A30 A;  2ZEE A;  4CZ1 A;  3RO0 A;  4HNX B;  4MI4 A;  3OAK A;  5F13 A;  4DJL A;  3FF3 A;  3WR7 A;  4OID A;  3NE7 A;  4H2K A;  3BUO B;  1YR0 A;  1M4I A;  2VI7 A;  5H84 A;  5IB9 A;  2Q4Y A;  3KAS A;  1GGO A;  3QAH A;  4NGT A;  1ELL P;  4I49 A;  2PIZ A;  3KI9 A;  4CPA A;  3SI0 A;  1YSJ A;  2JDD A;  1IGB A;  3FMC A;  5HKY A;  4JXR A;  4ONU A;  4KSF A;  5CPA A;  4ZY1 A;  4MJX A;  5G21 A;  4K30 A;  2YGW A;  1F2O A;  4Q7A A;  4NEX A;  4CYN A;  3JVN A;  2PR1 A;  1R57 A;  2Z11 A;  2EZC A;  3VRQ A;  2JLM A;  1CP6 A;  3FH4 A;  4IK2 A;  4BPW B;  4KSI A;  4MFK A;  4B5P B;  4MCP A;  2FE7 A;  4B5P A;  1CBX A;  4AVB A;  1ZO0 A;  2H5M A;  3GLJ A;  1U6M A;  4OC2 A;  4MY0 A;  3HPG G;  5AGE A;  4PPZ A;  3KR5 A;  4Z65 A;  2KCW A;  3VH9 A;  4FAI A;  1EO0 A;  2B58 A;  2BOA A;  3PT1 A;  4NGP A;  4ONW A;  5AG6 A;  4X5K A;  3R9E A;  2JDC A;  4FD4 A;  2XEG A;  3VGO A;  4OIW A;  3B3W A;  3RZA A;  4FD5 A;  2IJZ A;  3D8P A;  5FVJ A;  1WWZ A;  3IO1 A;  2DIK A;  5F1Y A;  4C9R A;  7CPA A;  2AUM A;  4EYS A;  4A2Z A;  4C84 A;  4UWI A;  2HRO A;  1TF8 A;  3KQX A;  3N7Z A;  1EE3 P;  2O28 A;  5EBV A;  4II9 A;  5K99 A;  2V8V A;  1QST A;  3TOA A;  1BXR B;  2IMO A;  3WC5 A;  5FD8 A;  1LAM A;  2CNS A;  1RTQ A;  3NH5 A;  2B5G A;  2DPT A;  4PK2 A;  4C8F A;  2BCO A;  1V0C A;  1XMB A;  2ODF A;  2PR8 A;  3NH8 A;  2EZA A;  2OOT A;  1Z4R A;  4YFJ A;  2R1I A;  2Z3K A;  1CE8 B;  2AFW A;  1JQG A;  3CXP A;  5J1Q A;  4FWU A;  3P2H A;  2R82 A;  3TOB A;  2GE3 A;  2NMT A;  3H5Z A;  1Y0Y A;  1YX0 A;  2K5T A;  3GYA A;  3LAC A;  4BBH A;  4XNH B;  4CGL A;  1P4N A;  5F5X A;  3T5M A;  2PJ2 A;  3PFE A;  4MHZ A;  1ZG9 A;  3WC6 A;  4MJ8 A;  3BI0 A;  1DTD A;  3H8G A;  2ZEL A;  4MHY A;  1S7F A;  2P6G A;  3SXN A;  3T07 A;  1PCA A;  2AJ6 A;  1Z9U A;  4K3N A;  5EC4 A;  5F9M A;  3CZX A;  3EXN A;  3B7I A;  1TKF A;  2HWG A;  4B14 A;  4KSA A;  2V8G A;  3D68 A;  4PV6 A;  3SI2 A;  4FBE A;  4OAD A;  3LD2 A;  4EWT A;  5IV0 A;  2J9A A;  4P4B A;  1TIQ A;  4CS0 B;  5BY0 A;  4OME A;  3QNV A;  3IU1 A;  1VHS A;  3N5F A;  4JJX A;  4NF1 A;  1JDE A;  2Z10 A; 
#chains in the Genus database with same CATH homology
 2ZEN A;  3PB4 X;  4PQA A;  4CDJ A;  1CX8 A;  2FVG A;  3SJX A;  2AFO A;  4EME A;  4UEE A;  1YME A;  4NGR A;  2Q4Z A;  2I3C A;  4MHP A;  3EIF A;  2PCU A;  2XEI A;  5IR2 A;  3K9T A;  4O23 A;  4BD9 A;  1TKJ A;  5LYF A;  4FUU A;  4PXE A;  3IJ3 A;  3I74 A;  2O4H A;  2QYV A;  2V77 A;  1BLL E;  4TWE A;  3WAB A;  3LMS A;  3CPA A;  3B35 A;  3ISX A;  4A38 A;  3H8F A;  4MRI A;  3PRT A;  1XRY A;  1TF9 A;  4NJQ A;  1CP7 A;  1LCP A;  3IFE A;  3IIB A;  1YLO A;  4PXB A;  4C8C A;  4IAV A;  3DGV A;  1WVM A;  8CPA A;  4ZX8 A;  2WZN A;  4P6Y A;  2C5Q A;  5HVF A;  2ABZ A;  4EFD A;  5DS0 A;  4A94 A;  4C86 A;  1ELM P;  1ZG8 A;  3HUV A;  3PEI A;  4ZY0 A;  1KWM A;  4G1P A;  4RUH A;  1CPX A;  1XBU A;  3CPX A;  2CTB A;  2EWB A;  4MCR A;  3SJE A;  1F57 A;  4DUK A;  3D7F A;  4OKO A;  3S9N A;  2O53 A;  2VL1 A;  1AMP A;  1ZG7 A;  2NSM A;  3B2Y A;  2AFM A;  5D8N A;  4P44 A;  3MN8 A;  1FNO A;  1H8L A;  2RFH A;  1Z5R A;  3RBU A;  1ARL A;  4NGQ A;  2ZEP A;  4OC0 A;  4AXV A;  1VIX A;  3D7H A;  4MCS A;  3FJU A;  1XJO A;  4A39 A;  5JH9 A;  1LFW A;  3HLP A;  2Q43 A;  3BXM A;  3KQZ A;  3WC7 A;  2AFU A;  3KR4 A;  1LAN A;  2Q51 A;  2PJ1 A;  3D67 A;  2AFS A;  3B3T A;  2GLJ A;  4UF4 A;  3KZW A;  3D66 A;  4NGM A;  2AFZ A;  3D4U A;  3SJF A;  3SJG A;  2QJ8 A;  4C9E A;  4F8Z A;  5K8M A;  3IWW A;  1QMU A;  5HXD A;  2PE3 A;  4C8P A;  1UWY A;  5LRG A;  4F9U A;  1XF1 A;  5K8N A;  2JEW A;  5THW A;  2HC9 A;  4UIB A;  4TNU A;  1LOK A;  2POK A;  4WWV A;  1ZLH A;  1PYT B;  1M4L A;  4P10 A;  2PJ7 A;  4MCQ A;  4A37 A;  3PB8 X;  3V38 A;  4OC4 A;  2AFX A;  2F7V A;  3GUX A;  3PBB A;  5LYD A;  2PIY A;  2CF4 A;  3D7G A;  4JYW A;  1V6C A;  2PJ0 A;  3FEE A;  1R3N A;  4P4D A;  2ZOG A;  3VAT A;  2G9D A;  3KGQ A;  1DE4 C;  3BHX A;  3ISZ A;  2EK8 A;  2ANP A;  1Z8L A;  2ZEO A;  3NFZ A;  3IC1 A;  2PJ3 A;  3PB6 X;  6CPA A;  3I1U A;  1VHO A;  1AYE A;  3MRU A;  2PRQ A;  5JGF A;  4C9A A;  2F8H A;  3V7Z A;  2PVV A;  3LWU A;  5LRK A;  5F09 A;  2V8H A;  2PVW A;  3H8E A;  1HEE A;  4OC3 A;  2PJ5 A;  4UEF A;  4UIA A;  5I4M A;  2ZEF A;  4P4I A;  2PJC A;  2ZEH A;  2PJ9 A;  2ZED A;  1Y9Z A;  2BO9 A;  3FED A;  1Q7L A;  1Z2L A;  4OP4 A;  3PB9 X;  5CBM A;  1QQ9 A;  2PJA A;  4R8F A;  4WJB A;  4C9V A;  4P4E A;  1ZLI A;  4P4J A;  3B3V A;  2GP4 A;  1R43 A;  3NA6 A;  4MMO A;  4X3R A;  2GLF A;  3JRU A;  2C6C A;  2NYQ A;  2C6G A;  2OR4 A;  1BAV A;  5K8P A;  2PJ8 A;  3FVL A;  1LAP A;  4YU9 A;  2ZEM A;  4IHM A;  4NJR A;  3L2N A;  4X2T A;  1CPS A;  3BI1 A;  2QVP A;  2GU2 A;  4C9U A;  5D29 A;  4B6Z A;  3ICU A;  2ZEG A;  1YW6 A;  4R7M A;  3KHX A;  3PFO A;  1OBR A;  2WYR A;  4MXU A;  4OC5 A;  4ZY2 A;  3FEC A;  4OC1 A;  5ELY A;  1YW4 A;  2PJB A;  3K2K A;  2XEJ A;  3DLJ A;  3NH4 A;  1GYT A;  1XFO A;  4GM5 A;  4CDK A;  3RAM A;  4C8U A;  2PJ4 A;  5LYI A;  3PBE A;  1CG2 A;  3B3S A;  4F9V A;  3T8W A;  4TJV A;  4LQG A;  3IEH A;  4R6T A;  3B3C A;  4DYO A;  4KNG E;  1HDQ A;  2XEF A;  1IY7 A;  3VTA A;  1VHE A;  4UEZ A;  4P45 A;  1ARM A;  1BPM A;  4PXD A;  2GRE A;  4NGN A;  3WT4 A;  3GB0 A;  4NFR A;  4C8A A;  4C99 A;  3D7D A;  4YWY A;  2JBK A;  4W9Y A;  2RB7 A;  4ZYQ A;  1HDU A;  5K8O A;  3TC8 A;  3TX8 A;  5JM6 A;  1VGY A;  4P4F A;  4TJX A;  2C6P A;  4ZI6 A;  2IQ6 A;  3I6S A;  5HVH A;  1FT7 A;  4ZX9 A;  5LYL A;  3VAR A;  2DEA A;  4X8I A;  5HVG A;  3FX6 A;  3KL9 A;  3KHZ A;  1TKH A;  2PJ6 A;  2HB6 A;  4YN3 A;  1Y0R A;  3S9L A;  1TXR A;  4C8T A;  2ZOF A;  3CT9 A;  3SI1 A;  2CIJ A;  3S9M A;  1NSA A;  5LRJ A;  4R76 A;  4MHN A;  3PB7 X;  2V8D A;  1BPN A;  2JBJ A;  2C1C A;  2EK9 A;  3CDX A;  4JZ0 A;  1Y7E A;  2CTC A;  4PXC A;  1F2P A;  4NGS A;  2ZEE A;  4DJL A;  3FF3 A;  4OID A;  4H2K A;  5IB9 A;  3KAS A;  4NGT A;  1ELL P;  2PIZ A;  3KI9 A;  4CPA A;  3SI0 A;  1YSJ A;  1IGB A;  3FMC A;  5CPA A;  4ZY1 A;  1F2O A;  4Q7A A;  4KSI A;  3FH4 A;  1CP6 A;  4IK2 A;  4MCP A;  1CBX A;  3GLJ A;  4OC2 A;  4Z65 A;  4PPZ A;  3KR5 A;  3VH9 A;  4FAI A;  2BOA A;  4NGP A;  4ONW A;  2XEG A;  4OIW A;  3B3W A;  3RZA A;  2IJZ A;  4C9R A;  3IO1 A;  7CPA A;  4C84 A;  1TF8 A;  3KQX A;  1EE3 P;  2V8V A;  2IMO A;  3WC5 A;  1LAM A;  1RTQ A;  3NH5 A;  4C8F A;  2BCO A;  1XMB A;  3NH8 A;  2OOT A;  2AFW A;  1JQG A;  5J1Q A;  4FWU A;  1Y0Y A;  4C85 A;  2PJ2 A;  3PFE A;  4MHZ A;  1ZG9 A;  3WC6 A;  3BI0 A;  1DTD A;  3H8G A;  2ZEL A;  4MHY A;  1PCA A;  4K3N A;  3B7I A;  1TKF A;  2V8G A;  3D68 A;  3SI2 A;  4FBE A;  4EWT A;  2J9A A;  4P4B A;  4OME A;  3QNV A;  3N5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...