2XEJA

Human glutamate carboxypeptidase ii in complex with arm-m4, urea- based inhibitor
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVQPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 264
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xejA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xejA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xejA02
2PJ5A 3PB4X 4P4EA 4C84A 2PJ7A 2XEJA 1XJOA 4G1PA 1CP6A 4MHZA 1VHOA 3WT4A 3SJFA 5J1QA 3D7HA 2DEAA 3BHXA 3PRTA 1RTQA 3FECA 4H2KA 3VTAA 3B7IA 1BLLE 3I6SA 5CPAA 4OC2A 2ZEHA 4X8IA 3PB6X 3NFZA 4P4FA 4R7MA 3CT9A 3D7DA 4MHNA 3S9NA 4MCPA 4FWUA 4NGMA 4ZX9A 3V7ZA 1WVMA 2C6CA 3NH5A 4P4JA 3NA6A 5IB9A 1HDUA 4C8TA 4C9VA 7CPAA 3KZWA 2AFSA 3PB9X 2PIYA 4MRIA 1KWMA 4P4IA 2OOTA 3QNVA 1YLOA 4ZYQA 5JGFA 3KI9A 1F57A 2CF4A 3HLPA 3WC7A 4OIWA 4IAVA 4ZI6A 3B35A 1FNOA 4MHPA 2Q4ZA 3I1UA 3FEEA 4LQGA 5LRGA 3LWUA 4K3NA 4WWVA 3TX8A 2ZOGA 3D4UA 4UIBA 1IGBA 1XF1A 2CTBA 2G9DA 4TWEA 2GLJA 2PVWA 4F9VA 3GLJA 4OC5A 4ONWA 2ZELA 1QQ9A 1BPNA 2JBKA 2C1CA 4PQAA 1TXRA 2FVGA 5HVGA 3EIFA 4OC3A 1LCPA 4EFDA 1CP7A 5K8OA 4C8UA 2IMOA 3MRUA 2C6PA 3KQZA 2XEGA 3B3WA 4R6TA 4F8ZA 1ZG7A 4PXDA 3BI1A 3PFEA 5HXDA 3KHZA 3FMCA 2NSMA 2PJ1A 4R76A 5HVHA 2ZEMA 2V8GA 4TJVA 2I3CA 2AFMA 2RB7A 2CIJA 3N5FA 3D66A 3CPXA 3S9MA 2QVPA 4GM5A 3SI2A 3CDXA 1DTDA 3B3VA 4C9AA 1F2OA 1ARLA 3PB8X 4W9YA 4X2TA 4NJRA 5D8NA 4C8FA 4NGPA 4C9RA 2ZEPA 3WABA 4UEEA 3IEHA 4C8CA 1CPXA 1ELMP 2AFUA 4DJLA 1UWYA 3KASA 3RAMA 4OC0A 1ZG9A 5I4MA 1XMBA 3DLJA 1GYTA 1PCAA 1BAVA 1BPMA 4NGTA 1LFWA 4C8AA 1CG2A 3PBBA 2ZEOA 3K9TA 2XEFA 2PJCA 3B3CA 1LAPA 2GU2A 2EK9A 2ZEFA 2V8HA 1Y0YA 3D7GA 2XEIA 3IWWA 2ZOFA 4C85A 4C9EA 1CBXA 1VHEA 3SJXA 2AFZA 4DYOA 4ZY1A 4A39A 1NSAA 2J9AA 3H8FA 4PXBA 8CPAA 3SJGA 3RZAA 2QYVA 2GLFA 1XBUA 2ABZA 3K2KA 5D29A 3MN8A 2PIZA 5HVFA 1PYTB 1H8LA 1ZLIA 3NH4A 3PBEA 4UF4A 4P45A 4P4DA 1ZLHA 2BO9A 2PJBA 3CPAA 3FEDA 2PE3A 2ZEEA 3I74A 1CX8A 4OKOA 3L2NA 2JBJA 3FJUA 3D68A 5LRJA 2POKA 1F2PA 1ARMA 6CPAA 2CTCA 3LMSA 2QJ8A 4C9UA 4KSIA 5LYFA 1Y7EA 2PJ3A 1TKFA 4MXUA 3JRUA 3KR5A 4NGRA 2V77A 4NGNA 4IHMA 3IO1A 3SJEA 3PEIA 2AFXA 5JM6A 5K8PA 5LYDA 1YMEA 4EMEA 2EWBA 2PJ2A 4FBEA 1LAMA 4FUUA 4OP4A 4C8PA 3WC5A 5CBMA 4C99A 4KNGE 3DGVA 1YSJA 4CPAA 1OBRA 1Z8LA 3S9LA 3IFEA 4ZX8A 4AXVA 2F8HA 2PJ9A 3B3SA 3SI1A 1VGYA 2WYRA 1DE4C 3KHXA 5K8MA 2IQ6A 2HB6A 4YWYA 3ISZA 4NGQA 1TF9A 5LYIA 4NGSA 4F9UA 2PRQA 2BOAA 3VH9A 3GB0A 1M4LA 2WZNA 3ISXA 3KR4A 4MCSA 2V8VA 3TC8A 4YU9A 4BD9A 3KL9A 4ZY0A 3ICUA 5THWA 3HUVA 3IJ3A 5LRKA 4NFRA 2Q43A 2EK8A 3GUXA 1AMPA 1Z2LA 4JYWA 2PJ8A 3D7FA 1LOKA 4A37A 1R3NA 1HEEA 1EE3P 4RUHA 3PFOA 3FX6A 2BCOA 4ZY2A 2Q51A 2AFOA 4UEZA 4P6YA 3KQXA 4MHYA 4TJXA 2V8DA 5ELYA 2ANPA 1FT7A 2C6GA 2PJAA 2PJ6A 2PJ0A 4YN3A 4MMOA 3SI0A 1HDQA 1TKHA 1LANA 3IC1A 1VIXA 1YW6A 1YW4A 2O4HA 4OC1A 4P4BA 4JZ0A 1IY7A 4TNUA 3WC6A 4MCRA 3IIBA 4MCQA 2HC9A 2JEWA 3B2YA 5K8NA 3FF3A 4DUKA 3D67A 1TF8A 4B6ZA 4CDKA 2NYQA 1TKJA 1Y0RA 3T8WA 4O23A 3NH8A 4Z65A 2VL1A 4PPZA 3VARA 4IK2A 3H8GA 2ZEDA 3PB7X 2ZENA 2ZEGA 4PXCA 1CPSA 4PXEA 3H8EA 1R43A 4OIDA 1XFOA 1ELLP 5F09A 5LYLA 3KGQA 3RBUA 2OR4A 5DS0A 4UIAA 4A38A 3FH4A 4Q7AA 3FVLA 4OMEA 5JH9A 2PCUA 4WJBA 1Y9ZA 1XRYA 4UEFA 4OC4A 3B3TA 1AYEA 2PVVA 2F7VA 1Z5RA 4CDJA 1QMUA 4X3RA 2AFWA 3V38A 4NJQA 4EWTA 2O53A 3BXMA 1V6CA 3BI0A 3VATA 1Q7LA 4C86A 1ZG8A 1JQGA 2RFHA 4FAIA 4R8FA 4P10A 2GREA 2PJ4A 4A94A 2IJZA 4P44A
chains in the Genus database with same CATH superfamily
4NEXA 4A31A 2I79A 2PJ5A 4AG7A 3PB4X 4P4EA 3GY9A 2HUZA 4C84A 4H6ZA 4KOXA 2PJ7A 2XEJA 4RS2A 4IF5A 1ZL0A 1XJOA 4G1PA 2IL4A 1CP6A 4MHZA 1VHOA 1XEBA 3SJFA 1QSNA 3WT4A 4C68A 5J1QA 3D7HA 4OADA 2DEAA 3BHXA 3T5MA 4UCNA 4KSFA 3PRTA 4JD6A 1RTQA 3FECA 4RI1A 2DF5A 4H2KA 3VRQA 2B4DB 3VTAA 4BINA 1YR0A 3B7IA 2Q4YA 3R9FA 1BLLE 3I6SA 4AVCA 5IR2A 2B4DA 4CYQA 5CPAA 4OC2A 2ZEHA 4X8IA 2ATRA 4LUAA 4U5YA 5E96A 4QB9A 1NSLA 5AG4A 4NF1A 3PB6X 1IOIA 2ZW6A 3NFZA 4P4FA 3CXPA 3DR8A 1YK3A 3OP0A 1OZPA 1X10A 4R7MA 3TO6A 5HKWA 5HMNA 3CT9A 3D7DA 4MHNA 3S9NA 4MCPA 2GIVA 5J8FA 4PK3A 1VHSA 3QAYA 4FWUA 2B5GB 4NGMA 1MJBA 4MFZA 3S6GA 2A4NA 2OZUA 5KTAA 1NXJA 4ZX9A 3V7ZA 1WVMA 2C6CA 4INJA 3NH5A 4P4JA 3NA6A 5IB9A 1HDUA 2O28A 4PSXA 5G1ZA 4EVYA 3C8OA 4C8TA 1R57A 4C9VA 3T90A 2G3TA 1YLEA 3TLAA 1M1DA 2B3UA 3KZWA 7CPAA 2AFSA 5A27A 1Z4EA 1Z8TA 2PIYA 3PB9X 4MRIA 2FE7A 1KWMA 4P4IA 5BY0A 2Q44A 3VWEA 2OOTA 4A30A 1VBGA 3QNVA 1YLOA 3U88C 4B5OA 2VZYA 4ZYQA 2FCKA 5JGFA 4Q38A 3KI9A 4U9ZA 4HNYB 1YREA 5JPHA 1F57A 2CF4A 1RXTA 3HLPA 4GS4A 4OIWA 1MK4A 3P2HA 3WC7A 4BTFA 3JTKA 1CS0B 5F9MA 4AVAA 4PK2A 4IAVA 4ZI6A 3B35A 2J8NA 5IB0A 1FNOA 2PCNA 3EZEA 4MHPA 4OAEA 4AB7A 1YQEA 2Q4ZA 4C86A 3I1UA 4C2YA 3FEEA 1CE8B 4LQGA 5LRGA 2PQ8A 3LWUA 4K3NA 5F47A 2Z3KA 5EBVA 4WWVA 3TX8A 4CYOA 3BUNB 2ZOGA 3D4UA 3TFYA 1P4NA 4YGOA 3PLFB 2CY2A 4FD4A 4UIBA 2FT0A 4MY0A 3PP9A 2K5TA 1IGBA 2OU2A 1XF1A 2CTBA 2XPLA 3PT1A 2G9DA 4R3LA 3S6FA 4MFKA 3G8WA 4ZBGA 4TWEA 4KS9A 2GLJA 2PVWA 4F9VA 4LQ6A 3KRVA 4GXHA 4UCMA 3GLJA 3EC4A 5ISVA 4B12A 4CGNA 4OC5A 3GYAA 4ONWA 2ZELA 5C88A 3F9KC 1BPNA 1QQ9A 4J0NA 3MGDA 2Y1MA 2JBKA 2C1CA 2WSAA 5J8CA 2OB0A 4PQAA 2X7BA 2P6GA 2N3AB 1TXRA 2FVGA 2DPTA 5HVGA 1KUYA 1SQHA 3F8KA 3I3GA 4OC3A 5AG7A 2AUMA 3EIFA 1LCPA 3FIXA 1CP7A 3I9SA 4CGMA 4EFDA 5K8OA 4CAVA 4C8UA 4EYSA 3F0AA 2IMOA 1VKCA 3MRUA 2C6PA 3KQZA 2XEGA 3B3WA 4IUSA 3G23A 4R6TA 4F8ZA 2I00A 5JQ4A 1J3LA 1ZG7A 5DWNA 3TCVA 4CRYB 3OB1B 3HMJG 1KUXA 4PXDA 4UFXA 2DPSA 1EO0A 1Z8XA 1NE9A 2JEVA 1UFHA 3BI1A 5G21A 1KEEB 4CO9A 3T0TA 3PFEA 5HXDA 2VBQA 3KHZA 3VWDA 2ARHA 3FMCA 2NSMA 2PJ1A 3FYNA 4R76A 2ZEMA 3TO7A 3W6XA 5HVHA 2V8GA 3F5BA 3IWGA 4TJVA 2I3CA 4CRZB 4KUBA 2AFMA 3NFQA 2YJTA 5HKYA 4H89A 3TLBA 2RB7A 4RN7A 3TLCA 2REFA 2CIJA 2PC1A 3G3SA 3V8IA 2BL1A 3N5FA 2F5IA 3D66A 3CPXA 3S9MA 2QVPA 4GM5A 2D4PA 4ONUA 2YNCA 1Q2DA 3VROA 3CDXA 4HKFA 3SI2A 4C7IA 4YFJA 1DTDA 2Q4VA 4JJXA 2R82A 2VEZA 3B3VA 4C9AA 3IGRA 3VRPA 1F2OA 1ARLA 3PB8X 4W9YA 1DIKA 4I49A 1S3ZA 2D0PA 4F6AA 4X2TA 1YGHA 4CAEA 4NJRA 5D8NA 3D8PA 4C8FA 1JDEA 2GP4A 1QSMA 4QBJA 4NGPA 3DNSA 4C9RA 1WWZA 1A9XB 5DWMA 1S7NA 2ZEPA 5AGEA 2CXAA 2WPWA 3WABA 4C7HA 2HI6A 4UEEA 3IEHA 4C8CA 1CPXA 1ELMP 2AFUA 4A4BA 4FD6A 3WR7A 4DJLA 5HH1A 1UWYA 3EO4A 4HPSA 3KASA 1Y9KA 4Y49B 5G22A 3RAMA 4E94A 4OC0A 1ZG9A 5I4MA 4PSWA 3ZZIA 3D3SA 3HPHE 2AJ6A 1XMBA 4XPKA 4AG9A 5IX3A 4IIXA 1S5KA 4B5PA 2ZPAA 3DLJA 3R9GA 4R9MA 2VZZA 4FD7A 3EY5A 1C30B 2ODFA 2WPXA 1GYTA 1NBWA 1PCAA 3PFVA 1BAVA 1BPMA 1AUGA 2R1IA 4NGTA 4XNHB 4ZGYB 1LFWA 4C8AA 3GJZA 4IIYA 1CG2A 3PBBA 2FIAA 3TOBA 2ZEOA 2FS5A 5H84A 4CAXA 3K9TA 4LX9A 2XEFA 3NOJA 2PJCA 3B3CA 3NE7A 2XPOA 1LAPA 2YNEA 1KUVA 4UBRA 2GU2A 1BO4A 2Q0YA 2REEA 4K30A 2EK9A 2ZEFA 2V8HA 3W6SA 3RO0A 1Z8WA 1Y0YA 4XPDB 2QMLA 3JVNA 3D7GA 3SXNA 2XEIA 3IWWA 3D2PA 2ZOFA 4HNXB 3TO9A 3EZBA 4C85A 3BJ8A 4C9EA 1CBXA 1VHEA 4UA3A 3SJXA 1JWQA 2AFZA 4DYOA 2PRBA 3R9EA 4ZY1A 2B4BA 1Q2CA 3ZNIA 3K9UA 4A39A 3B8GA 1MJ9A 1NSAA 2J9AA 3H8FA 3OWCA 4XPLA 1C3OB 3TYXA 4CYPA 4PXBA 8CPAA 3SJGA 3RZAA 2QYVA 3BUMB 5BWAB 2GLFA 2G0BA 3FNCA 3T9YA 1XBUA 2ABZA 1VI4A 2E28A 3K2KA 5D29A 2FIWA 2ZW5A 5AXIA 2NMTA 2PDOA 3MN8A 4E8OA 3ZJ0A 2OZGA 2PIZA 3QB8A 5HVFA 2Z0ZA 4M6GA 1PYTB 1H8LA 1ZLIA 2Q04A 2Y1NA 2ZW7A 3LODA 3NH4A 2FM4A 2EBJA 2J8RA 3PBEA 4UWIA 4UF4A 4P45A 4P4DA 2D4OA 3DR6A 3IU2A 4JVOA 1CM0A 1ZLHA 2BO9A 2PJBA 4M8DA 3TLGB 2AE6A 3CPAA 3FEDA 2PE3A 2ZEEA 3I74A 1CX8A 1IU8A 4OKOA 4KLVA 3L2NA 3VGOA 4B10A 2JBJA 3TLYA 3FJUA 3D68A 3TLGA 2GE3A 3VRRA 5LRJA 2POKA 4MFPA 1F2PA 1VBHA 1ARMA 3GKRA 6CPAA 1ON0A 2CTCA 3FXTA 5EC4A 3LMSA 2QJ8A 3TTHA 1BXRB 2B0AA 4C9UA 4KSIA 1LRZA 1M4DA 1XOVA 1Y7EA 5LYFA 4KSAA 2Q7SA 2PJ3A 4A32A 1ZYMA 1TKFA 2YNDA 4MXUA 3UY5A 3JRUA 3KR5A 4NGRA 2UV8G 4NGNA 2V77A 2JDDA 3BLNA 3IO1A 4IHMA 3SJEA 3PEIA 2AFXA 2R8VA 5JM6A 5K8PA 2VI7A 1YMEA 5LYDA 4Y49C 4DNCA 4EMEA 1U6MA 2EWBA 2VXKA 3H5ZA 3R1KA 4KOUA 4AVBA 4CYNA 4JXRA 1J4JA 2FSRA 2YJVA 3FBUA 4BMHA 2PJ2A 3R96A 3EZAA 3RNZA 4FBEA 1LAMA 2FXFA 4FUUA 4OP4A 5FD8A 4UWJA 3WC5A 5CBMA 4KOVA 4C99A 4RR2B 4JWPA 4KNGE 4KORA 2YGWA 1FBVA 3DGVA 1YSJA 4CPAA 1OBRA 3H4QA 1Z8LA 3S9LA 2Z10A 5AG6A 4E5SA 5J3XA 3IFEA 4XNHC 4ZX8A 4KOTA 4MJ8A 1EZBA 3QAHA 2ZW4A 4AXVA 4KOSA 2BEIA 4UFVA 2F8HA 2PJ9A 4H1HA 5A28A 4MHDA 3B3SA 4C2ZA 3SI1A 1VGYA 2WYRA 1DE4C 4B13A 3S6KA 2XPNA 3KHXA 5K8MA 3PGPA 2IQ6A 1YVOA 2HB6A 2RC4A 2B58A 4MBUA 4BBHA 4YWYA 3ISZA 3D2MA 5I0CA 4NGQA 1K4JA 1TF9A 2P6FA 4J3GA 4XPDC 2PR1A 1Q5XA 4BPUB 1XE4A 4KVME 3OB2B 2QIRA 5LYIA 1L0CA 4NGSA 1MJAA 2FL4A 4OLLA 5F46A 4MI4A 4F9UA 2PRQA 1WK4A 4A4CA 2BOAA 4KOWA 4NXYA 4BPXB 3VH9A 3GB0A 2DLAA 2C27A 4PV6A 1M4LA 2WZNA 3ISXA 5F49A 1QSTA 4GPLB 3DDDA 3KR4A 4KLWA 4MCSA 2V8VA 3TC8A 1IYKA 4A95A 4B5PB 1QSOA 4YU9A 5G20A 2P6EA 4CGOA 4BD9A 1R61A 3K4IA 1YVHA 3KL9A 4MI1A 4R57A 4ZY0A 3ICUA 3LACA 2GANA 5THWA 3HUVA 2VKZG 2QECA 1IOFA 3IJ3A 5LRKA 1PU9A 4NFRA 1WJTA 2Q43A 1I12A 2EK8A 2C5QA 4CZ1A 2OZHA 1AMPA 3GUXA 1QSRA 2Z3LA 1YX0A 1RO5A 1Z2LA 4UFWA 4JYWA 5CNPA 4A33A 2PJ8A 5H86A 1M6VB 2GFQA 3D7FA 3O8ZA 4HNWB 1LOKA 4A37A 5F13A 1R3NA 1JDBC 1B47A 1Z4RA 1HEEA 1EE3P 4RUHA 2EZAA 5AG5A 3PFOA 3FX6A 3P2FA 4KVXA 4COBA 1XMTA 2BCOA 1IB1E 4KVOE 5EMIA 4YRHA 4ZY2A 2HQYA 5F48A 2WUUA 1S7KA 4L89A 2Q51A 2AFOA 3NE8A 4UEZA 4FD5A 5C82A 4P6YA 5K99A 1BOBA 3KQXA 4MHYA 2CNSA 4M6IA 2HROA 4TJXA 5ELYA 1Z9UA 2V8DA 1PUAA 4CAWA 3SXOA 4BPWB 1CJWA 3W91A 1EZAA 2ANPA 1ZRSA 3CXQA 4QUSA 2EZBA 1FT7A 2C6GA 1M4IA 2PJAA 2PJ6A 2OLSA 4F0YA 2PJ0A 2XPPA 1S7FA 3GIUA 4MMOA 4QVTA 3SI0A 1HDQA 1TKHA 1LANA 3IC1A 3R95A 1V0CA 4MFQA 1VIXA 2Z3MA 1YW6A 4M85A 1YW4A 3N7ZA 2H5MA 3C26A 2DXQA 2O4HA 2B5GA 4OC1A 4M3SA 4C2XA 4P4BA 2EUIA 1M44A 4JZ0A 1IY7A 4CGPA 3EXNA 2B3VA 2CNMA 2Y0MA 4TNUA 4NSQA 3WC6A 4MCRA 2AUNA 2DIKA 2CBLA 5F1YA 2Z3PA 5KTCA 1IICA 2PR8A 3IIBA 4E2AA 4MCQA 2HC9A 2JEWA 4JXQA 5HKZA 2YNCC 2Q7BA 3BUXB 3B2YA 4MJXA 3SHPA 5K8NA 3FF3A 4ORFA 3D67A 4DUKA 1TF8A 1N71A 2OH1A 4B6ZA 1Q2YA 4KZTA 3TLEA 3RYOA 4CDKA 2R98A 2NYQA 1TKJA 1Y0RA 3T8WA 4F0XA 3CXSA 4B11A 4II9A 3TT2A 1GGOA 4MFLA 2PSWA 4O23A 3NH8A 4QC6A 2MP0A 3LD2A 4Z65A 2Z3OA 2VL1A 4C8PA 3U1BA 4PPZA 1I21A 3VARA 2X0SA 5JYBA 4IK2A 4B14A 2R7HA 3DSBA 3E0KA 3H8GA 5KTDA 2HV2A 5F5XA 1KC7A 3JUWA 2ZEDA 1KZFA 3PB7X 1YVKA 2BSWA 2ZENA 2ZEGA 5JVLA 4PXCA 1CPSA 3HPGG 3VRNA 1M4GA 2J8MA 3A9LA 3H8EA 4PXEA 1R43A 3BJ7A 3EFAA 4OIDA 2HWGA 1T36B 1XFOA 1ELLP 3TOAA 5F09A 5LYLA 3T05A 3KGQA 3RBUA 5FVJA 3TLZA 4X5KA 2OR4A 4H6UA 4A2ZA 5DS0A 4M6HA 4UIAA 1S60A 4MFJA 3BUOB 4A38A 5GCNA 2Z11A 1KBLA 3FRMA 4YN3A 1IYLA 3FH4A 1Y7RA 1X12A 4Q7AA 2BUEA 3FVLA 4OMEA 4CS0B 2EVNA 2P0WA 4L8AA 1XF8A 4R87A 3S6HA 2VQYA 4Q36A 3CZXA 2PCUA 5JH9A 4WJBA 1Y9ZA 1XIXA 2ZXVA 2JDCA 2EZCA 4U9YA 1XRYA 3T07A 4COGA 3IWEA 4UEFA 3PZJA 1GHEA 4JLYA 4OC4A 3B3TA 1AYEA 3FB3A 2PVVA 4MY3A 2CNTA 4KUAA 3OAKA 2F7VA 5IV0A 1Z5RA 4UCPA 4CGLA 3KKWA 4CDJA 1QMUA 4R3KA 2D0OA 4CAFA 4X3RA 2AFWA 1I1DA 3V38A 1TIQA 1IIDA 2G3AA 4KOYA 2KCWA 4NJQA 4EWTA 4E0AA 1ZO0A 2O53A 3SR3A 1NMTA 1S7LA 3BXMA 1B6BA 1FY7A 1Z9EA 3BI0A 2Z3NA 1Q7LA 3VATA 3TE4A 1V6CA 1ZG8A 1JQGA 2EO8A 2RFHA 3IU1A 4R8FA 3BUWB 4P10A 4FAIA 2GREA 2JLMA 1B87A 1P0HA 2IJZA 4P44A 1Y9WA 2PJ4A 4NCZA 4A94A 2B4JC 1A2ZA
chains in the Genus database with same CATH topology
2PJ5A 3PB4X 4P4EA 4C84A 2PJ7A 2XEJA 1XJOA 4G1PA 1CP6A 4MHZA 1VHOA 3WT4A 3SJFA 5J1QA 3D7HA 2DEAA 3BHXA 3PRTA 1RTQA 3FECA 4H2KA 3VTAA 3B7IA 1BLLE 3I6SA 5IR2A 5CPAA 4OC2A 2ZEHA 4X8IA 3PB6X 3NFZA 4P4FA 4R7MA 3CT9A 3D7DA 4MHNA 3S9NA 4MCPA 4FWUA 4NGMA 4ZX9A 3V7ZA 1WVMA 2C6CA 3NH5A 4P4JA 3NA6A 5IB9A 1HDUA 4C8TA 4C9VA 7CPAA 3KZWA 2AFSA 3PB9X 2PIYA 4MRIA 1KWMA 4P4IA 2OOTA 3QNVA 1YLOA 4ZYQA 5JGFA 3KI9A 1F57A 2CF4A 3HLPA 3WC7A 4OIWA 4IAVA 4ZI6A 3B35A 1FNOA 4MHPA 2Q4ZA 3I1UA 3FEEA 4LQGA 5LRGA 3LWUA 4K3NA 4WWVA 3TX8A 2ZOGA 3D4UA 4UIBA 1IGBA 1XF1A 2CTBA 2G9DA 4TWEA 2GLJA 2PVWA 4F9VA 3GLJA 4OC5A 4ONWA 2ZELA 1QQ9A 1BPNA 2JBKA 2C1CA 4PQAA 1TXRA 2FVGA 5HVGA 3EIFA 4OC3A 1LCPA 4EFDA 1CP7A 5K8OA 4C8UA 2IMOA 3MRUA 2C6PA 3KQZA 2XEGA 3B3WA 4R6TA 4F8ZA 1ZG7A 4PXDA 3BI1A 3PFEA 5HXDA 3KHZA 3FMCA 2NSMA 2PJ1A 4R76A 5HVHA 2ZEMA 2V8GA 4TJVA 2I3CA 2AFMA 2RB7A 2CIJA 3N5FA 3D66A 3CPXA 3S9MA 2QVPA 4GM5A 3SI2A 3CDXA 1DTDA 3B3VA 4C9AA 1F2OA 1ARLA 3PB8X 4W9YA 4X2TA 4NJRA 5D8NA 4C8FA 2GP4A 4NGPA 4C9RA 2ZEPA 3WABA 4UEEA 3IEHA 4C8CA 1CPXA 1ELMP 2AFUA 4DJLA 1UWYA 3KASA 3RAMA 4OC0A 1ZG9A 5I4MA 1XMBA 3DLJA 1GYTA 1PCAA 1BAVA 1BPMA 4NGTA 1LFWA 4C8AA 1CG2A 3PBBA 2ZEOA 3K9TA 2XEFA 2PJCA 3B3CA 1LAPA 2GU2A 2EK9A 2ZEFA 2V8HA 1Y0YA 3D7GA 2XEIA 3IWWA 2ZOFA 4C85A 4C9EA 1CBXA 1VHEA 3SJXA 2AFZA 4DYOA 4ZY1A 4A39A 1NSAA 2J9AA 3H8FA 4PXBA 8CPAA 3SJGA 3RZAA 2QYVA 2GLFA 1XBUA 2ABZA 3K2KA 5D29A 3MN8A 2PIZA 5HVFA 1PYTB 1H8LA 1ZLIA 3NH4A 3PBEA 4UF4A 4P45A 4P4DA 1ZLHA 2BO9A 2PJBA 3CPAA 3FEDA 2PE3A 2ZEEA 3I74A 1CX8A 4OKOA 3L2NA 2JBJA 3FJUA 3D68A 5LRJA 2POKA 1F2PA 1ARMA 6CPAA 2CTCA 3LMSA 2QJ8A 4C9UA 4KSIA 5LYFA 1Y7EA 2PJ3A 1TKFA 4MXUA 3JRUA 3KR5A 4NGRA 2V77A 4NGNA 4IHMA 3IO1A 3SJEA 3PEIA 2AFXA 5JM6A 5K8PA 5LYDA 1YMEA 4EMEA 2EWBA 2PJ2A 4FBEA 1LAMA 4FUUA 4OP4A 4C8PA 3WC5A 5CBMA 4C99A 4KNGE 3DGVA 1YSJA 4CPAA 1OBRA 1Z8LA 3S9LA 3IFEA 4ZX8A 4AXVA 2F8HA 2PJ9A 3B3SA 3SI1A 1VGYA 2WYRA 1DE4C 3KHXA 5K8MA 2IQ6A 2HB6A 4YWYA 3ISZA 4NGQA 1TF9A 5LYIA 4NGSA 4F9UA 2PRQA 2BOAA 3VH9A 3GB0A 1M4LA 2WZNA 3ISXA 3KR4A 4MCSA 2V8VA 3TC8A 4YU9A 4BD9A 3KL9A 4ZY0A 3ICUA 5THWA 3HUVA 3IJ3A 5LRKA 4NFRA 2Q43A 2EK8A 2C5QA 3GUXA 1AMPA 1Z2LA 4JYWA 2PJ8A 3D7FA 1LOKA 4A37A 1R3NA 1HEEA 1EE3P 4RUHA 3PFOA 3FX6A 2BCOA 4ZY2A 2Q51A 2AFOA 4UEZA 4P6YA 3KQXA 4MHYA 4TJXA 2V8DA 5ELYA 2ANPA 1FT7A 2C6GA 2PJAA 2PJ6A 2PJ0A 4YN3A 4MMOA 3SI0A 1HDQA 1TKHA 1LANA 3IC1A 1VIXA 1YW6A 1YW4A 2O4HA 4OC1A 4P4BA 4JZ0A 1IY7A 4TNUA 3WC6A 4MCRA 3IIBA 4MCQA 2HC9A 2JEWA 3B2YA 5K8NA 3FF3A 4DUKA 3D67A 1TF8A 4B6ZA 4CDKA 2NYQA 1TKJA 1Y0RA 3T8WA 4O23A 3NH8A 4Z65A 2VL1A 4PPZA 3VARA 4IK2A 3H8GA 2ZEDA 3PB7X 2ZENA 2ZEGA 4PXCA 1CPSA 4PXEA 3H8EA 1R43A 4OIDA 1XFOA 1ELLP 5F09A 5LYLA 3KGQA 3RBUA 2OR4A 5DS0A 4UIAA 4A38A 3FH4A 4Q7AA 3FVLA 4OMEA 5JH9A 2PCUA 4WJBA 1Y9ZA 1XRYA 4UEFA 4OC4A 3B3TA 1AYEA 2PVVA 2F7VA 1Z5RA 4CDJA 1QMUA 4X3RA 2AFWA 3V38A 4NJQA 4EWTA 2O53A 3BXMA 1V6CA 3BI0A 3VATA 1Q7LA 4C86A 1ZG8A 1JQGA 2RFHA 4FAIA 4R8FA 4P10A 2GREA 2PJ4A 4A94A 2IJZA 4P44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ5 A;  3PB4 X;  4P4E A;  4C84 A;  2PJ7 A;  2XEJ A;  1XJO A;  4G1P A;  1CP6 A;  4MHZ A;  1VHO A;  3WT4 A;  3SJF A;  5J1Q A;  3D7H A;  2DEA A;  3BHX A;  3PRT A;  1RTQ A;  3FEC A;  4H2K A;  3VTA A;  3B7I A;  1BLL E;  3I6S A;  5CPA A;  4OC2 A;  2ZEH A;  4X8I A;  3PB6 X;  3NFZ A;  4P4F A;  4R7M A;  3CT9 A;  3D7D A;  4MHN A;  3S9N A;  4MCP A;  4FWU A;  4NGM A;  4ZX9 A;  3V7Z A;  1WVM A;  2C6C A;  3NH5 A;  4P4J A;  3NA6 A;  5IB9 A;  1HDU A;  4C8T A;  4C9V A;  7CPA A;  3KZW A;  2AFS A;  3PB9 X;  2PIY A;  4MRI A;  1KWM A;  4P4I A;  2OOT A;  3QNV A;  1YLO A;  4ZYQ A;  5JGF A;  3KI9 A;  1F57 A;  2CF4 A;  3HLP A;  3WC7 A;  4OIW A;  4IAV A;  4ZI6 A;  3B35 A;  1FNO A;  4MHP A;  2Q4Z A;  3I1U A;  3FEE A;  4LQG A;  5LRG A;  3LWU A;  4K3N A;  4WWV A;  3TX8 A;  2ZOG A;  3D4U A;  4UIB A;  1IGB A;  1XF1 A;  2CTB A;  2G9D A;  4TWE A;  2GLJ A;  2PVW A;  4F9V A;  3GLJ A;  4OC5 A;  4ONW A;  2ZEL A;  1QQ9 A;  1BPN A;  2JBK A;  2C1C A;  4PQA A;  1TXR A;  2FVG A;  5HVG A;  3EIF A;  4OC3 A;  1LCP A;  4EFD A;  1CP7 A;  5K8O A;  4C8U A;  2IMO A;  3MRU A;  2C6P A;  3KQZ A;  2XEG A;  3B3W A;  4R6T A;  4F8Z A;  1ZG7 A;  4PXD A;  3BI1 A;  3PFE A;  5HXD A;  3KHZ A;  3FMC A;  2NSM A;  2PJ1 A;  4R76 A;  5HVH A;  2ZEM A;  2V8G A;  4TJV A;  2I3C A;  2AFM A;  2RB7 A;  2CIJ A;  3N5F A;  3D66 A;  3CPX A;  3S9M A;  2QVP A;  4GM5 A;  3SI2 A;  3CDX A;  1DTD A;  3B3V A;  4C9A A;  1F2O A;  1ARL A;  3PB8 X;  4W9Y A;  4X2T A;  4NJR A;  5D8N A;  4C8F A;  4NGP A;  4C9R A;  2ZEP A;  3WAB A;  4UEE A;  3IEH A;  4C8C A;  1CPX A;  1ELM P;  2AFU A;  4DJL A;  1UWY A;  3KAS A;  3RAM A;  4OC0 A;  1ZG9 A;  5I4M A;  1XMB A;  3DLJ A;  1GYT A;  1PCA A;  1BAV A;  1BPM A;  4NGT A;  1LFW A;  4C8A A;  1CG2 A;  3PBB A;  2ZEO A;  3K9T A;  2XEF A;  2PJC A;  3B3C A;  1LAP A;  2GU2 A;  2EK9 A;  2ZEF A;  2V8H A;  1Y0Y A;  3D7G A;  2XEI A;  3IWW A;  2ZOF A;  4C85 A;  4C9E A;  1CBX A;  1VHE A;  3SJX A;  2AFZ A;  4DYO A;  4ZY1 A;  4A39 A;  1NSA A;  2J9A A;  3H8F A;  4PXB A;  8CPA A;  3SJG A;  3RZA A;  2QYV A;  2GLF A;  1XBU A;  2ABZ A;  3K2K A;  5D29 A;  3MN8 A;  2PIZ A;  5HVF A;  1PYT B;  1H8L A;  1ZLI A;  3NH4 A;  3PBE A;  4UF4 A;  4P45 A;  4P4D A;  1ZLH A;  2BO9 A;  2PJB A;  3CPA A;  3FED A;  2PE3 A;  2ZEE A;  3I74 A;  1CX8 A;  4OKO A;  3L2N A;  2JBJ A;  3FJU A;  3D68 A;  5LRJ A;  2POK A;  1F2P A;  1ARM A;  6CPA A;  2CTC A;  3LMS A;  2QJ8 A;  4C9U A;  4KSI A;  5LYF A;  1Y7E A;  2PJ3 A;  1TKF A;  4MXU A;  3JRU A;  3KR5 A;  4NGR A;  2V77 A;  4NGN A;  4IHM A;  3IO1 A;  3SJE A;  3PEI A;  2AFX A;  5JM6 A;  5K8P A;  5LYD A;  1YME A;  4EME A;  2EWB A;  2PJ2 A;  4FBE A;  1LAM A;  4FUU A;  4OP4 A;  4C8P A;  3WC5 A;  5CBM A;  4C99 A;  4KNG E;  3DGV A;  1YSJ A;  4CPA A;  1OBR A;  1Z8L A;  3S9L A;  3IFE A;  4ZX8 A;  4AXV A;  2F8H A;  2PJ9 A;  3B3S A;  3SI1 A;  1VGY A;  2WYR A;  1DE4 C;  3KHX A;  5K8M A;  2IQ6 A;  2HB6 A;  4YWY A;  3ISZ A;  4NGQ A;  1TF9 A;  5LYI A;  4NGS A;  4F9U A;  2PRQ A;  2BOA A;  3VH9 A;  3GB0 A;  1M4L A;  2WZN A;  3ISX A;  3KR4 A;  4MCS A;  2V8V A;  3TC8 A;  4YU9 A;  4BD9 A;  3KL9 A;  4ZY0 A;  3ICU A;  5THW A;  3HUV A;  3IJ3 A;  5LRK A;  4NFR A;  2Q43 A;  2EK8 A;  3GUX A;  1AMP A;  1Z2L A;  4JYW A;  2PJ8 A;  3D7F A;  1LOK A;  4A37 A;  1R3N A;  1HEE A;  1EE3 P;  4RUH A;  3PFO A;  3FX6 A;  2BCO A;  4ZY2 A;  2Q51 A;  2AFO A;  4UEZ A;  4P6Y A;  3KQX A;  4MHY A;  4TJX A;  2V8D A;  5ELY A;  2ANP A;  1FT7 A;  2C6G A;  2PJA A;  2PJ6 A;  2PJ0 A;  4YN3 A;  4MMO A;  3SI0 A;  1HDQ A;  1TKH A;  1LAN A;  3IC1 A;  1VIX A;  1YW6 A;  1YW4 A;  2O4H A;  4OC1 A;  4P4B A;  4JZ0 A;  1IY7 A;  4TNU A;  3WC6 A;  4MCR A;  3IIB A;  4MCQ A;  2HC9 A;  2JEW A;  3B2Y A;  5K8N A;  3FF3 A;  4DUK A;  3D67 A;  1TF8 A;  4B6Z A;  4CDK A;  2NYQ A;  1TKJ A;  1Y0R A;  3T8W A;  4O23 A;  3NH8 A;  4Z65 A;  2VL1 A;  4PPZ A;  3VAR A;  4IK2 A;  3H8G A;  2ZED A;  3PB7 X;  2ZEN A;  2ZEG A;  4PXC A;  1CPS A;  4PXE A;  3H8E A;  1R43 A;  4OID A;  1XFO A;  1ELL P;  5F09 A;  5LYL A;  3KGQ A;  3RBU A;  2OR4 A;  5DS0 A;  4UIA A;  4A38 A;  3FH4 A;  4Q7A A;  3FVL A;  4OME A;  5JH9 A;  2PCU A;  4WJB A;  1Y9Z A;  1XRY A;  4UEF A;  4OC4 A;  3B3T A;  1AYE A;  2PVV A;  2F7V A;  1Z5R A;  4CDJ A;  1QMU A;  4X3R A;  2AFW A;  3V38 A;  4NJQ A;  4EWT A;  2O53 A;  3BXM A;  1V6C A;  3BI0 A;  3VAT A;  1Q7L A;  4C86 A;  1ZG8 A;  1JQG A;  2RFH A;  4FAI A;  4R8F A;  4P10 A;  2GRE A;  2PJ4 A;  4A94 A;  2IJZ A;  4P44 A; 
#chains in the Genus database with same CATH topology
 4NEX A;  4A31 A;  2I79 A;  2PJ5 A;  4AG7 A;  3PB4 X;  4P4E A;  3GY9 A;  2HUZ A;  4C84 A;  4H6Z A;  4KOX A;  2PJ7 A;  2XEJ A;  4RS2 A;  4IF5 A;  1ZL0 A;  1XJO A;  4G1P A;  2IL4 A;  1CP6 A;  4MHZ A;  1VHO A;  1XEB A;  3SJF A;  1QSN A;  3WT4 A;  4C68 A;  5J1Q A;  3D7H A;  4OAD A;  2DEA A;  3BHX A;  3T5M A;  4UCN A;  4KSF A;  3PRT A;  4JD6 A;  1RTQ A;  3FEC A;  4RI1 A;  2DF5 A;  4H2K A;  3VRQ A;  2B4D B;  3VTA A;  4BIN A;  1YR0 A;  3B7I A;  2Q4Y A;  3R9F A;  1BLL E;  3I6S A;  4AVC A;  5IR2 A;  2B4D A;  4CYQ A;  5CPA A;  4OC2 A;  2ZEH A;  4X8I A;  2ATR A;  4LUA A;  4U5Y A;  5E96 A;  4QB9 A;  1NSL A;  5AG4 A;  4NF1 A;  3PB6 X;  1IOI A;  2ZW6 A;  3NFZ A;  4P4F A;  3CXP A;  3DR8 A;  1YK3 A;  3OP0 A;  1OZP A;  1X10 A;  4R7M A;  3TO6 A;  5HKW A;  5HMN A;  3CT9 A;  3D7D A;  4MHN A;  3S9N A;  4MCP A;  2GIV A;  5J8F A;  4PK3 A;  1VHS A;  3QAY A;  4FWU A;  2B5G B;  4NGM A;  1MJB A;  4MFZ A;  3S6G A;  2A4N A;  2OZU A;  5KTA A;  1NXJ A;  4ZX9 A;  3V7Z A;  1WVM A;  2C6C A;  4INJ A;  3NH5 A;  4P4J A;  3NA6 A;  5IB9 A;  1HDU A;  2O28 A;  4PSX A;  5G1Z A;  4EVY A;  3C8O A;  4C8T A;  1R57 A;  4C9V A;  3T90 A;  2G3T A;  1YLE A;  3TLA A;  1M1D A;  2B3U A;  3KZW A;  7CPA A;  2AFS A;  5A27 A;  1Z4E A;  1Z8T A;  2PIY A;  3PB9 X;  4MRI A;  2FE7 A;  1KWM A;  4P4I A;  5BY0 A;  2Q44 A;  3VWE A;  2OOT A;  4A30 A;  1VBG A;  3QNV A;  1YLO A;  3U88 C;  4B5O A;  2VZY A;  4ZYQ A;  2FCK A;  5JGF A;  4Q38 A;  3KI9 A;  4U9Z A;  4HNY B;  1YRE A;  5JPH A;  1F57 A;  2CF4 A;  1RXT A;  3HLP A;  4GS4 A;  4OIW A;  1MK4 A;  3P2H A;  3WC7 A;  4BTF A;  3JTK A;  1CS0 B;  5F9M A;  4AVA A;  4PK2 A;  4IAV A;  4ZI6 A;  3B35 A;  2J8N A;  5IB0 A;  1FNO A;  2PCN A;  3EZE A;  4MHP A;  4OAE A;  4AB7 A;  1YQE A;  2Q4Z A;  4C86 A;  3I1U A;  4C2Y A;  3FEE A;  1CE8 B;  4LQG A;  5LRG A;  2PQ8 A;  3LWU A;  4K3N A;  5F47 A;  2Z3K A;  5EBV A;  4WWV A;  3TX8 A;  4CYO A;  3BUN B;  2ZOG A;  3D4U A;  3TFY A;  1P4N A;  4YGO A;  3PLF B;  2CY2 A;  4FD4 A;  4UIB A;  2FT0 A;  4MY0 A;  3PP9 A;  2K5T A;  1IGB A;  2OU2 A;  1XF1 A;  2CTB A;  2XPL A;  3PT1 A;  2G9D A;  4R3L A;  3S6F A;  4MFK A;  3G8W A;  4ZBG A;  4TWE A;  4KS9 A;  2GLJ A;  2PVW A;  4F9V A;  4LQ6 A;  3KRV A;  4GXH A;  4UCM A;  3GLJ A;  3EC4 A;  5ISV A;  4B12 A;  4CGN A;  4OC5 A;  3GYA A;  4ONW A;  2ZEL A;  5C88 A;  3F9K C;  1BPN A;  1QQ9 A;  4J0N A;  3MGD A;  2Y1M A;  2JBK A;  2C1C A;  2WSA A;  5J8C A;  2OB0 A;  4PQA A;  2X7B A;  2P6G A;  2N3A B;  1TXR A;  2FVG A;  2DPT A;  5HVG A;  1KUY A;  1SQH A;  3F8K A;  3I3G A;  4OC3 A;  5AG7 A;  2AUM A;  3EIF A;  1LCP A;  3FIX A;  1CP7 A;  3I9S A;  4CGM A;  4EFD A;  5K8O A;  4CAV A;  4C8U A;  4EYS A;  3F0A A;  2IMO A;  1VKC A;  3MRU A;  2C6P A;  3KQZ A;  2XEG A;  3B3W A;  4IUS A;  3G23 A;  4R6T A;  4F8Z A;  2I00 A;  5JQ4 A;  1J3L A;  1ZG7 A;  5DWN A;  3TCV A;  4CRY B;  3OB1 B;  3HMJ G;  1KUX A;  4PXD A;  4UFX A;  2DPS A;  1EO0 A;  1Z8X A;  1NE9 A;  2JEV A;  1UFH A;  3BI1 A;  5G21 A;  1KEE B;  4CO9 A;  3T0T A;  3PFE A;  5HXD A;  2VBQ A;  3KHZ A;  3VWD A;  2ARH A;  3FMC A;  2NSM A;  2PJ1 A;  3FYN A;  4R76 A;  2ZEM A;  3TO7 A;  3W6X A;  5HVH A;  2V8G A;  3F5B A;  3IWG A;  4TJV A;  2I3C A;  4CRZ B;  4KUB A;  2AFM A;  3NFQ A;  2YJT A;  5HKY A;  4H89 A;  3TLB A;  2RB7 A;  4RN7 A;  3TLC A;  2REF A;  2CIJ A;  2PC1 A;  3G3S A;  3V8I A;  2BL1 A;  3N5F A;  2F5I A;  3D66 A;  3CPX A;  3S9M A;  2QVP A;  4GM5 A;  2D4P A;  4ONU A;  2YNC A;  1Q2D A;  3VRO A;  3CDX A;  4HKF A;  3SI2 A;  4C7I A;  4YFJ A;  1DTD A;  2Q4V A;  4JJX A;  2R82 A;  2VEZ A;  3B3V A;  4C9A A;  3IGR A;  3VRP A;  1F2O A;  1ARL A;  3PB8 X;  4W9Y A;  1DIK A;  4I49 A;  1S3Z A;  2D0P A;  4F6A A;  4X2T A;  1YGH A;  4CAE A;  4NJR A;  5D8N A;  3D8P A;  4C8F A;  1JDE A;  2GP4 A;  1QSM A;  4QBJ A;  4NGP A;  3DNS A;  4C9R A;  1WWZ A;  1A9X B;  5DWM A;  1S7N A;  2ZEP A;  5AGE A;  2CXA A;  2WPW A;  3WAB A;  4C7H A;  2HI6 A;  4UEE A;  3IEH A;  4C8C A;  1CPX A;  1ELM P;  2AFU A;  4A4B A;  4FD6 A;  3WR7 A;  4DJL A;  5HH1 A;  1UWY A;  3EO4 A;  4HPS A;  3KAS A;  1Y9K A;  4Y49 B;  5G22 A;  3RAM A;  4E94 A;  4OC0 A;  1ZG9 A;  5I4M A;  4PSW A;  3ZZI A;  3D3S A;  3HPH E;  2AJ6 A;  1XMB A;  4XPK A;  4AG9 A;  5IX3 A;  4IIX A;  1S5K A;  4B5P A;  2ZPA A;  3DLJ A;  3R9G A;  4R9M A;  2VZZ A;  4FD7 A;  3EY5 A;  1C30 B;  2ODF A;  2WPX A;  1GYT A;  1NBW A;  1PCA A;  3PFV A;  1BAV A;  1BPM A;  1AUG A;  2R1I A;  4NGT A;  4XNH B;  4ZGY B;  1LFW A;  4C8A A;  3GJZ A;  4IIY A;  1CG2 A;  3PBB A;  2FIA A;  3TOB A;  2ZEO A;  2FS5 A;  5H84 A;  4CAX A;  3K9T A;  4LX9 A;  2XEF A;  3NOJ A;  2PJC A;  3B3C A;  3NE7 A;  2XPO A;  1LAP A;  2YNE A;  1KUV A;  4UBR A;  2GU2 A;  1BO4 A;  2Q0Y A;  2REE A;  4K30 A;  2EK9 A;  2ZEF A;  2V8H A;  3W6S A;  3RO0 A;  1Z8W A;  1Y0Y A;  4XPD B;  2QML A;  3JVN A;  3D7G A;  3SXN A;  2XEI A;  3IWW A;  3D2P A;  2ZOF A;  4HNX B;  3TO9 A;  3EZB A;  4C85 A;  3BJ8 A;  4C9E A;  1CBX A;  1VHE A;  4UA3 A;  3SJX A;  1JWQ A;  2AFZ A;  4DYO A;  2PRB A;  3R9E A;  4ZY1 A;  2B4B A;  1Q2C A;  3ZNI A;  3K9U A;  4A39 A;  3B8G A;  1MJ9 A;  1NSA A;  2J9A A;  3H8F A;  3OWC A;  4XPL A;  1C3O B;  3TYX A;  4CYP A;  4PXB A;  8CPA A;  3SJG A;  3RZA A;  2QYV A;  3BUM B;  5BWA B;  2GLF A;  2G0B A;  3FNC A;  3T9Y A;  1XBU A;  2ABZ A;  1VI4 A;  2E28 A;  3K2K A;  5D29 A;  2FIW A;  2ZW5 A;  5AXI A;  2NMT A;  2PDO A;  3MN8 A;  4E8O A;  3ZJ0 A;  2OZG A;  2PIZ A;  3QB8 A;  5HVF A;  2Z0Z A;  4M6G A;  1PYT B;  1H8L A;  1ZLI A;  2Q04 A;  2Y1N A;  2ZW7 A;  3LOD A;  3NH4 A;  2FM4 A;  2EBJ A;  2J8R A;  3PBE A;  4UWI A;  4UF4 A;  4P45 A;  4P4D A;  2D4O A;  3DR6 A;  3IU2 A;  4JVO A;  1CM0 A;  1ZLH A;  2BO9 A;  2PJB A;  4M8D A;  3TLG B;  2AE6 A;  3CPA A;  3FED A;  2PE3 A;  2ZEE A;  3I74 A;  1CX8 A;  1IU8 A;  4OKO A;  4KLV A;  3L2N A;  3VGO A;  4B10 A;  2JBJ A;  3TLY A;  3FJU A;  3D68 A;  3TLG A;  2GE3 A;  3VRR A;  5LRJ A;  2POK A;  4MFP A;  1F2P A;  1VBH A;  1ARM A;  3GKR A;  6CPA A;  1ON0 A;  2CTC A;  3FXT A;  5EC4 A;  3LMS A;  2QJ8 A;  3TTH A;  1BXR B;  2B0A A;  4C9U A;  4KSI A;  1LRZ A;  1M4D A;  1XOV A;  1Y7E A;  5LYF A;  4KSA A;  2Q7S A;  2PJ3 A;  4A32 A;  1ZYM A;  1TKF A;  2YND A;  4MXU A;  3UY5 A;  3JRU A;  3KR5 A;  4NGR A;  2UV8 G;  4NGN A;  2V77 A;  2JDD A;  3BLN A;  3IO1 A;  4IHM A;  3SJE A;  3PEI A;  2AFX A;  2R8V A;  5JM6 A;  5K8P A;  2VI7 A;  1YME A;  5LYD A;  4Y49 C;  4DNC A;  4EME A;  1U6M A;  2EWB A;  2VXK A;  3H5Z A;  3R1K A;  4KOU A;  4AVB A;  4CYN A;  4JXR A;  1J4J A;  2FSR A;  2YJV A;  3FBU A;  4BMH A;  2PJ2 A;  3R96 A;  3EZA A;  3RNZ A;  4FBE A;  1LAM A;  2FXF A;  4FUU A;  4OP4 A;  5FD8 A;  4UWJ A;  3WC5 A;  5CBM A;  4KOV A;  4C99 A;  4RR2 B;  4JWP A;  4KNG E;  4KOR A;  2YGW A;  1FBV A;  3DGV A;  1YSJ A;  4CPA A;  1OBR A;  3H4Q A;  1Z8L A;  3S9L A;  2Z10 A;  5AG6 A;  4E5S A;  5J3X A;  3IFE A;  4XNH C;  4ZX8 A;  4KOT A;  4MJ8 A;  1EZB A;  3QAH A;  2ZW4 A;  4AXV A;  4KOS A;  2BEI A;  4UFV A;  2F8H A;  2PJ9 A;  4H1H A;  5A28 A;  4MHD A;  3B3S A;  4C2Z A;  3SI1 A;  1VGY A;  2WYR A;  1DE4 C;  4B13 A;  3S6K A;  2XPN A;  3KHX A;  5K8M A;  3PGP A;  2IQ6 A;  1YVO A;  2HB6 A;  2RC4 A;  2B58 A;  4MBU A;  4BBH A;  4YWY A;  3ISZ A;  3D2M A;  5I0C A;  4NGQ A;  1K4J A;  1TF9 A;  2P6F A;  4J3G A;  4XPD C;  2PR1 A;  1Q5X A;  4BPU B;  1XE4 A;  4KVM E;  3OB2 B;  2QIR A;  5LYI A;  1L0C A;  4NGS A;  1MJA A;  2FL4 A;  4OLL A;  5F46 A;  4MI4 A;  4F9U A;  2PRQ A;  1WK4 A;  4A4C A;  2BOA A;  4KOW A;  4NXY A;  4BPX B;  3VH9 A;  3GB0 A;  2DLA A;  2C27 A;  4PV6 A;  1M4L A;  2WZN A;  3ISX A;  5F49 A;  1QST A;  4GPL B;  3DDD A;  3KR4 A;  4KLW A;  4MCS A;  2V8V A;  3TC8 A;  1IYK A;  4A95 A;  4B5P B;  1QSO A;  4YU9 A;  5G20 A;  2P6E A;  4CGO A;  4BD9 A;  1R61 A;  3K4I A;  1YVH A;  3KL9 A;  4MI1 A;  4R57 A;  4ZY0 A;  3ICU A;  3LAC A;  2GAN A;  5THW A;  3HUV A;  2VKZ G;  2QEC A;  1IOF A;  3IJ3 A;  5LRK A;  1PU9 A;  4NFR A;  1WJT A;  2Q43 A;  1I12 A;  2EK8 A;  2C5Q A;  4CZ1 A;  2OZH A;  1AMP A;  3GUX A;  1QSR A;  2Z3L A;  1YX0 A;  1RO5 A;  1Z2L A;  4UFW A;  4JYW A;  5CNP A;  4A33 A;  2PJ8 A;  5H86 A;  1M6V B;  2GFQ A;  3D7F A;  3O8Z A;  4HNW B;  1LOK A;  4A37 A;  5F13 A;  1R3N A;  1JDB C;  1B47 A;  1Z4R A;  1HEE A;  1EE3 P;  4RUH A;  2EZA A;  5AG5 A;  3PFO A;  3FX6 A;  3P2F A;  4KVX A;  4COB A;  1XMT A;  2BCO A;  1IB1 E;  4KVO E;  5EMI A;  4YRH A;  4ZY2 A;  2HQY A;  5F48 A;  2WUU A;  1S7K A;  4L89 A;  2Q51 A;  2AFO A;  3NE8 A;  4UEZ A;  4FD5 A;  5C82 A;  4P6Y A;  5K99 A;  1BOB A;  3KQX A;  4MHY A;  2CNS A;  4M6I A;  2HRO A;  4TJX A;  5ELY A;  1Z9U A;  2V8D A;  1PUA A;  4CAW A;  3SXO A;  4BPW B;  1CJW A;  3W91 A;  1EZA A;  2ANP A;  1ZRS A;  3CXQ A;  4QUS A;  2EZB A;  1FT7 A;  2C6G A;  1M4I A;  2PJA A;  2PJ6 A;  2OLS A;  4F0Y A;  2PJ0 A;  2XPP A;  1S7F A;  3GIU A;  4MMO A;  4QVT A;  3SI0 A;  1HDQ A;  1TKH A;  1LAN A;  3IC1 A;  3R95 A;  1V0C A;  4MFQ A;  1VIX A;  2Z3M A;  1YW6 A;  4M85 A;  1YW4 A;  3N7Z A;  2H5M A;  3C26 A;  2DXQ A;  2O4H A;  2B5G A;  4OC1 A;  4M3S A;  4C2X A;  4P4B A;  2EUI A;  1M44 A;  4JZ0 A;  1IY7 A;  4CGP A;  3EXN A;  2B3V A;  2CNM A;  2Y0M A;  4TNU A;  4NSQ A;  3WC6 A;  4MCR A;  2AUN A;  2DIK A;  2CBL A;  5F1Y A;  2Z3P A;  5KTC A;  1IIC A;  2PR8 A;  3IIB A;  4E2A A;  4MCQ A;  2HC9 A;  2JEW A;  4JXQ A;  5HKZ A;  2YNC C;  2Q7B A;  3BUX B;  3B2Y A;  4MJX A;  3SHP A;  5K8N A;  3FF3 A;  4ORF A;  3D67 A;  4DUK A;  1TF8 A;  1N71 A;  2OH1 A;  4B6Z A;  1Q2Y A;  4KZT A;  3TLE A;  3RYO A;  4CDK A;  2R98 A;  2NYQ A;  1TKJ A;  1Y0R A;  3T8W A;  4F0X A;  3CXS A;  4B11 A;  4II9 A;  3TT2 A;  1GGO A;  4MFL A;  2PSW A;  4O23 A;  3NH8 A;  4QC6 A;  2MP0 A;  3LD2 A;  4Z65 A;  2Z3O A;  2VL1 A;  4C8P A;  3U1B A;  4PPZ A;  1I21 A;  3VAR A;  2X0S A;  5JYB A;  4IK2 A;  4B14 A;  2R7H A;  3DSB A;  3E0K A;  3H8G A;  5KTD A;  2HV2 A;  5F5X A;  1KC7 A;  3JUW A;  2ZED A;  1KZF A;  3PB7 X;  1YVK A;  2BSW A;  2ZEN A;  2ZEG A;  5JVL A;  4PXC A;  1CPS A;  3HPG G;  3VRN A;  1M4G A;  2J8M A;  3A9L A;  3H8E A;  4PXE A;  1R43 A;  3BJ7 A;  3EFA A;  4OID A;  2HWG A;  1T36 B;  1XFO A;  1ELL P;  3TOA A;  5F09 A;  5LYL A;  3T05 A;  3KGQ A;  3RBU A;  5FVJ A;  3TLZ A;  4X5K A;  2OR4 A;  4H6U A;  4A2Z A;  5DS0 A;  4M6H A;  4UIA A;  1S60 A;  4MFJ A;  3BUO B;  4A38 A;  5GCN A;  2Z11 A;  1KBL A;  3FRM A;  4YN3 A;  1IYL A;  3FH4 A;  1Y7R A;  1X12 A;  4Q7A A;  2BUE A;  3FVL A;  4OME A;  4CS0 B;  2EVN A;  2P0W A;  4L8A A;  1XF8 A;  4R87 A;  3S6H A;  2VQY A;  4Q36 A;  3CZX A;  2PCU A;  5JH9 A;  4WJB A;  1Y9Z A;  1XIX A;  2ZXV A;  2JDC A;  2EZC A;  4U9Y A;  1XRY A;  3T07 A;  4COG A;  3IWE A;  4UEF A;  3PZJ A;  1GHE A;  4JLY A;  4OC4 A;  3B3T A;  1AYE A;  3FB3 A;  2PVV A;  4MY3 A;  2CNT A;  4KUA A;  3OAK A;  2F7V A;  5IV0 A;  1Z5R A;  4UCP A;  4CGL A;  3KKW A;  4CDJ A;  1QMU A;  4R3K A;  2D0O A;  4CAF A;  4X3R A;  2AFW A;  1I1D A;  3V38 A;  1TIQ A;  1IID A;  2G3A A;  4KOY A;  2KCW A;  4NJQ A;  4EWT A;  4E0A A;  1ZO0 A;  2O53 A;  3SR3 A;  1NMT A;  1S7L A;  3BXM A;  1B6B A;  1FY7 A;  1Z9E A;  3BI0 A;  2Z3N A;  1Q7L A;  3VAT A;  3TE4 A;  1V6C A;  1ZG8 A;  1JQG A;  2EO8 A;  2RFH A;  3IU1 A;  4R8F A;  3BUW B;  4P10 A;  4FAI A;  2GRE A;  2JLM A;  1B87 A;  1P0H A;  2IJZ A;  4P44 A;  1Y9W A;  2PJ4 A;  4NCZ A;  4A94 A;  2B4J C;  1A2Z A; 
#chains in the Genus database with same CATH homology
 2PJ5 A;  3PB4 X;  4P4E A;  4C84 A;  2PJ7 A;  2XEJ A;  1XJO A;  4G1P A;  1CP6 A;  4MHZ A;  1VHO A;  3WT4 A;  3SJF A;  5J1Q A;  3D7H A;  2DEA A;  3BHX A;  3PRT A;  1RTQ A;  3FEC A;  4H2K A;  3VTA A;  3B7I A;  1BLL E;  3I6S A;  5IR2 A;  5CPA A;  4OC2 A;  2ZEH A;  4X8I A;  3PB6 X;  3NFZ A;  4P4F A;  4R7M A;  3CT9 A;  3D7D A;  4MHN A;  3S9N A;  4MCP A;  4FWU A;  4NGM A;  4ZX9 A;  3V7Z A;  1WVM A;  2C6C A;  3NH5 A;  4P4J A;  3NA6 A;  5IB9 A;  1HDU A;  4C8T A;  4C9V A;  7CPA A;  3KZW A;  2AFS A;  3PB9 X;  2PIY A;  4MRI A;  1KWM A;  4P4I A;  2OOT A;  3QNV A;  1YLO A;  4ZYQ A;  5JGF A;  3KI9 A;  1F57 A;  2CF4 A;  3HLP A;  3WC7 A;  4OIW A;  4IAV A;  4ZI6 A;  3B35 A;  1FNO A;  4MHP A;  2Q4Z A;  3I1U A;  3FEE A;  4LQG A;  5LRG A;  3LWU A;  4K3N A;  4WWV A;  3TX8 A;  2ZOG A;  3D4U A;  4UIB A;  1IGB A;  1XF1 A;  2CTB A;  2G9D A;  4TWE A;  2GLJ A;  2PVW A;  4F9V A;  3GLJ A;  4OC5 A;  4ONW A;  2ZEL A;  1QQ9 A;  1BPN A;  2JBK A;  2C1C A;  4PQA A;  1TXR A;  2FVG A;  5HVG A;  3EIF A;  4OC3 A;  1LCP A;  4EFD A;  1CP7 A;  5K8O A;  4C8U A;  2IMO A;  3MRU A;  2C6P A;  3KQZ A;  2XEG A;  3B3W A;  4R6T A;  4F8Z A;  1ZG7 A;  4PXD A;  3BI1 A;  3PFE A;  5HXD A;  3KHZ A;  3FMC A;  2NSM A;  2PJ1 A;  4R76 A;  5HVH A;  2ZEM A;  2V8G A;  4TJV A;  2I3C A;  2AFM A;  2RB7 A;  2CIJ A;  3N5F A;  3D66 A;  3CPX A;  3S9M A;  2QVP A;  4GM5 A;  3SI2 A;  3CDX A;  1DTD A;  3B3V A;  4C9A A;  1F2O A;  1ARL A;  3PB8 X;  4W9Y A;  4X2T A;  4NJR A;  5D8N A;  4C8F A;  2GP4 A;  4NGP A;  4C9R A;  2ZEP A;  3WAB A;  4UEE A;  3IEH A;  4C8C A;  1CPX A;  1ELM P;  2AFU A;  4DJL A;  1UWY A;  3KAS A;  3RAM A;  4OC0 A;  1ZG9 A;  5I4M A;  1XMB A;  3DLJ A;  1GYT A;  1PCA A;  1BAV A;  1BPM A;  4NGT A;  1LFW A;  4C8A A;  1CG2 A;  3PBB A;  2ZEO A;  3K9T A;  2XEF A;  2PJC A;  3B3C A;  1LAP A;  2GU2 A;  2EK9 A;  2ZEF A;  2V8H A;  1Y0Y A;  3D7G A;  2XEI A;  3IWW A;  2ZOF A;  4C85 A;  4C9E A;  1CBX A;  1VHE A;  3SJX A;  2AFZ A;  4DYO A;  4ZY1 A;  4A39 A;  1NSA A;  2J9A A;  3H8F A;  4PXB A;  8CPA A;  3SJG A;  3RZA A;  2QYV A;  2GLF A;  1XBU A;  2ABZ A;  3K2K A;  5D29 A;  3MN8 A;  2PIZ A;  5HVF A;  1PYT B;  1H8L A;  1ZLI A;  3NH4 A;  3PBE A;  4UF4 A;  4P45 A;  4P4D A;  1ZLH A;  2BO9 A;  2PJB A;  3CPA A;  3FED A;  2PE3 A;  2ZEE A;  3I74 A;  1CX8 A;  4OKO A;  3L2N A;  2JBJ A;  3FJU A;  3D68 A;  5LRJ A;  2POK A;  1F2P A;  1ARM A;  6CPA A;  2CTC A;  3LMS A;  2QJ8 A;  4C9U A;  4KSI A;  5LYF A;  1Y7E A;  2PJ3 A;  1TKF A;  4MXU A;  3JRU A;  3KR5 A;  4NGR A;  2V77 A;  4NGN A;  4IHM A;  3IO1 A;  3SJE A;  3PEI A;  2AFX A;  5JM6 A;  5K8P A;  5LYD A;  1YME A;  4EME A;  2EWB A;  2PJ2 A;  4FBE A;  1LAM A;  4FUU A;  4OP4 A;  4C8P A;  3WC5 A;  5CBM A;  4C99 A;  4KNG E;  3DGV A;  1YSJ A;  4CPA A;  1OBR A;  1Z8L A;  3S9L A;  3IFE A;  4ZX8 A;  4AXV A;  2F8H A;  2PJ9 A;  3B3S A;  3SI1 A;  1VGY A;  2WYR A;  1DE4 C;  3KHX A;  5K8M A;  2IQ6 A;  2HB6 A;  4YWY A;  3ISZ A;  4NGQ A;  1TF9 A;  5LYI A;  4NGS A;  4F9U A;  2PRQ A;  2BOA A;  3VH9 A;  3GB0 A;  1M4L A;  2WZN A;  3ISX A;  3KR4 A;  4MCS A;  2V8V A;  3TC8 A;  4YU9 A;  4BD9 A;  3KL9 A;  4ZY0 A;  3ICU A;  5THW A;  3HUV A;  3IJ3 A;  5LRK A;  4NFR A;  2Q43 A;  2EK8 A;  2C5Q A;  3GUX A;  1AMP A;  1Z2L A;  4JYW A;  2PJ8 A;  3D7F A;  1LOK A;  4A37 A;  1R3N A;  1HEE A;  1EE3 P;  4RUH A;  3PFO A;  3FX6 A;  2BCO A;  4ZY2 A;  2Q51 A;  2AFO A;  4UEZ A;  4P6Y A;  3KQX A;  4MHY A;  4TJX A;  2V8D A;  5ELY A;  2ANP A;  1FT7 A;  2C6G A;  2PJA A;  2PJ6 A;  2PJ0 A;  4YN3 A;  4MMO A;  3SI0 A;  1HDQ A;  1TKH A;  1LAN A;  3IC1 A;  1VIX A;  1YW6 A;  1YW4 A;  2O4H A;  4OC1 A;  4P4B A;  4JZ0 A;  1IY7 A;  4TNU A;  3WC6 A;  4MCR A;  3IIB A;  4MCQ A;  2HC9 A;  2JEW A;  3B2Y A;  5K8N A;  3FF3 A;  4DUK A;  3D67 A;  1TF8 A;  4B6Z A;  4CDK A;  2NYQ A;  1TKJ A;  1Y0R A;  3T8W A;  4O23 A;  3NH8 A;  4Z65 A;  2VL1 A;  4PPZ A;  3VAR A;  4IK2 A;  3H8G A;  2ZED A;  3PB7 X;  2ZEN A;  2ZEG A;  4PXC A;  1CPS A;  4PXE A;  3H8E A;  1R43 A;  4OID A;  1XFO A;  1ELL P;  5F09 A;  5LYL A;  3KGQ A;  3RBU A;  2OR4 A;  5DS0 A;  4UIA A;  4A38 A;  3FH4 A;  4Q7A A;  3FVL A;  4OME A;  5JH9 A;  2PCU A;  4WJB A;  1Y9Z A;  1XRY A;  4UEF A;  4OC4 A;  3B3T A;  1AYE A;  2PVV A;  2F7V A;  1Z5R A;  4CDJ A;  1QMU A;  4X3R A;  2AFW A;  3V38 A;  4NJQ A;  4EWT A;  2O53 A;  3BXM A;  1V6C A;  3BI0 A;  3VAT A;  1Q7L A;  4C86 A;  1ZG8 A;  1JQG A;  2RFH A;  4FAI A;  4R8F A;  4P10 A;  2GRE A;  2PJ4 A;  4A94 A;  2IJZ A;  4P44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...