2XEJA

Human glutamate carboxypeptidase ii in complex with arm-m4, urea- based inhibitor
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVQPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAMATE CARBOXYPEPTIDASE 2
publication title A Remote Arene-Binding Site on Prostate Specific Membrane Antigen Revealed by Antibody-Recruiting Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 264
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2xejA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2xejA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2xejA02
4NGPA 2PJCA 3PB9X 4BD9A 4MHYA 1PCAA 2C1CA 1BAVA 1VIXA 3D7HA 2FVGA 3D68A 2POKA 3KHXA 3WT4A 4EFDA 2IQ6A 3B3TA 3SI1A 3WC6A 1IGBA 4F9VA 2GREA 4KSIA 3B3WA 1F2PA 5K8PA 1Z8LA 4OC3A 5HXDA 2AFSA 3NH5A 4KNGE 1HDQA 2CIJA 1OBRA 3B3CA 4CPAA 4F9UA 2PJ5A 4H2KA 4C8AA 3PBBA 4PXCA 2QJ8A 2ZEHA 1BLLE 3I1UA 3FVLA 3BXMA 4DUKA 2NSMA 4DJLA 4UEEA 3BHXA 3PBEA 2XEJA 1F57A 4Z65A 2AFZA 1XFOA 3CPAA 2VL1A 2PIZA 4X8IA 2XEGA 3IO1A 2DEAA 4YU9A 2XEFA 3PFEA 5D29A 3LWUA 2ZEEA 1QQ9A 2Q51A 1XBUA 1Y0YA 4ZY1A 5LRKA 5HVFA 4ZYQA 2PRQA 3KGQA 4OIWA 2EWBA 2CTBA 4ZI6A 3TX8A 2QVPA 1TKFA 5JH9A 2I3CA 1XJOA 4CDJA 3ISZA 4OC5A 3H8EA 4MCPA 4TNUA 3D7FA 3TC8A 3V7ZA 4OC0A 2ZENA 1DTDA 2PCUA 4EMEA 1Y7EA 2BCOA 2AFXA 4MCQA 2ZEGA 2ZEOA 3VARA 4OC2A 5LYIA 5D8NA 3I6SA 4NGSA 5LYLA 2PJ1A 4Q7AA 1CP6A 4MMOA 1YW6A 3S9MA 3ISXA 4JYWA 3FECA 4IHMA 3FEDA 4TJVA 3BI1A 3KHZA 1FNOA 4X2TA 3FX6A 4ONWA 5CPAA 2C6PA 3KZWA 4UF4A 5J1QA 3KI9A 4OMEA 2ANPA 2OOTA 3SI0A 4JZ0A 2ZOFA 4YN3A 3GB0A 2Q4ZA 2RFHA 2PJ6A 4PXBA 1AYEA 3D67A 1CX8A 5HVGA 2PJ2A 2Q43A 4UEFA 2PJ7A 1TF8A 1EE3P 3V38A 4IK2A 2OR4A 1ARMA 1Y0RA 3N5FA 2ZEFA 3WABA 4G1PA 7CPAA 3RAMA 2F7VA 4MXUA 1CG2A 5K8MA 1YSJA 4ZY2A 3IIBA 1R43A 3PRTA 4UIBA 1NSAA 2V8GA 2JEWA 4C8FA 1LFWA 1XF1A 3VTAA 4C99A 3NH8A 2HB6A 5F09A 3D4UA 3FMCA 4MHZA 3D7DA 3IJ3A 2ZEMA 1ELLP 2AFUA 3CPXA 4MHNA 3FEEA 1Q7LA 4CDKA 1BPNA 3CT9A 5K8OA 3B3VA 3S9NA 2ABZA 4IAVA 1M4LA 4GM5A 1F2OA 1ZLIA 3PFOA 5ELYA 3MRUA 4R76A 4ZX8A 1YLOA 4RUHA 4YWYA 4A94A 1WVMA 4W9YA 1ZG8A 4OKOA 1IY7A 1ARLA 2O4HA 1ZG9A 3JRUA 3NFZA 1PYTB 3I74A 4UEZA 1KWMA 5LRGA 4A39A 1YMEA 4EWTA 2NYQA 2C6CA 2AFOA 3K2KA 2PJ0A 2QYVA 3PB4X 6CPAA 4O23A 3B3SA 5CBMA 3IEHA 2EK9A 4P4IA 3ICUA 1VGYA 1XRYA 4LQGA 4C8UA 2IMOA 1TKJA 2BO9A 2PVVA 3B35A 1TXRA 1LOKA 4OP4A 5HVHA 2V8VA 3WC5A 4P44A 3WC7A 3S9LA 1R3NA 4R6TA 2ZOGA 2PJ9A 5JM6A 3VH9A 4P45A 2XEIA 4MRIA 1YW4A 3H8FA 4FWUA 4C9UA 3KQXA 4WWVA 1HEEA 2CTCA 4P10A 3PB6X 3HLPA 4NGRA 4P4JA 4C85A 3HUVA 4X3RA 2F8HA 2HC9A 1H8LA 4DYOA 1XMBA 3FJUA 3PB8X 3FF3A 4ZX9A 3KL9A 4C86A 3BI0A 3T8WA 4MHPA 4FAIA 4TJXA 4P4FA 1ZLHA 3L2NA 4ZY0A 4TWEA 4FUUA 3K9TA 4WJBA 4MCSA 4P4DA 5JGFA 3VATA 3KASA 4OIDA 2PJ3A 2ZEDA 4OC1A 3LMSA 2RB7A 2JBJA 3PB7X 1Z5RA 4C8CA 3DLJA 3GUXA 1CPSA 2AFWA 4PXDA 4PPZA 3DGVA 5IB9A 4C9EA 2PJ4A 1CPXA 2G9DA 2ZEPA 4MCRA 5LYDA 2PE3A 3B2YA 3KR4A 1BPMA 4NGMA 4C8TA 2WYRA 1LAPA 3D66A 1JQGA 3KR5A 4FBEA 5I4MA 3IWWA 4C9RA 3IFEA 2AFMA 4PQAA 1Y9ZA 2V77A 3GLJA 3NA6A 4C8PA 3NH4A 2PIYA 1HDUA 4UIAA 1V6CA 4A38A 2C6GA 4K3NA 4NGTA 5K8NA 1AMPA 1UWYA 2PJ8A 5DS0A 4NGNA 5LRJA 3B7IA 1DE4C 3RZAA 3FH4A 1TKHA 2V8HA 3RBUA 2CF4A 4OC4A 1Z2LA 1FT7A 1ZG7A 3CDXA 3D7GA 2V8DA 4F8ZA 5LYFA 3PEIA 3IC1A 2PJAA 3SJEA 2PJBA 4AXVA 1TF9A 4P4BA 3EIFA 4NGQA 2JBKA 4C9VA 2EK8A 1RTQA 1LCPA 1ELMP 3SJGA 3SJFA 1CP7A 2J9AA 3MN8A 4A37A 4C84A 2WZNA 3QNVA 1VHEA 2O53A 2BOAA 3SI2A 4R7MA 3H8GA 1GYTA 4B6ZA 1QMUA 4NJQA 4NFRA 4P4EA 1LANA 2GU2A 1VHOA 3KQZA 8CPAA 2GLJA 5THWA 4C9AA 2ZELA 4R8FA 2IJZA 2PVWA 4PXEA 1LAMA 1CBXA 4NJRA 2GLFA 3SJXA 4P6YA
chains in the Genus database with same CATH superfamily
4NGPA 2PJCA 4UCNA 3PB9X 1B87A 4BD9A 4MHYA 4CYNA 1PCAA 2C1CA 3W91A 1BAVA 1VIXA 3D7HA 2FVGA 4B5OA 4CGMA 3C26A 1Z8XA 2Y1NA 4BBHA 3D68A 2POKA 3KHXA 3WR7A 5C88A 3WT4A 4DNCA 4EFDA 4AVAA 2B3UA 4H6ZA 2IQ6A 3D2PA 3B3TA 3SXNA 1IOFA 1IYLA 3SI1A 3BUXB 4XPDC 5J8FA 3WC6A 3TLAA 4KS9A 1IGBA 2B3VA 4F9VA 2GREA 4KSIA 3B3WA 4NF1A 1Q2YA 1F2PA 4GPLB 3CXSA 5K8PA 3TOBA 3VWEA 2HV2A 4U9YA 4CO9A 1Z8LA 1QSNA 2OLSA 2B5GA 4OLLA 4OC3A 2BEIA 1QSRA 5EBVA 4AVCA 2Z11A 2AFSA 3NH5A 5HXDA 4KNGE 3BUOB 2ZW4A 1HDQA 4QBJA 4JXQA 1Q5XA 3G3SA 2CIJA 1OBRA 2PSWA 4M6IA 3B3CA 5E96A 4CPAA 4F9UA 1KEEB 5F1YA 3DNSA 1M4GA 2PJ5A 1S3ZA 4H2KA 2B4JC 4QC6A 2GANA 3FBUA 3LD2A 4Y49C 4C8AA 1OZPA 1CM0A 3PBBA 4PXCA 2QJ8A 1R61A 2ZEHA 1WK4A 2A4NA 3TT2A 1BLLE 3I1UA 4CGPA 3QAHA 5A28A 1BOBA 3FVLA 3BXMA 3IU1A 3I9SA 1MK4A 2B4DA 2NSMA 4DUKA 4II9A 3TO9A 1WJTA 4UEEA 4DJLA 3BHXA 1S7FA 3TLYA 1XF8A 1P4NA 4F0YA 5F49A 3PBEA 4Y49B 2XEJA 1F57A 4MFKA 4C7HA 4Z65A 2AFZA 1XFOA 3CPAA 2VL1A 1XEBA 2PIZA 2XEGA 3CXPA 4X8IA 3IO1A 1NSLA 2DEAA 5CNPA 5GCNA 1YQEA 4YU9A 2XEFA 2OZUA 4R9MA 4CYPA 3HPGG 3PFEA 5D29A 3JTKA 3LWUA 2VQYA 2ZEEA 4A32A 2HI6A 4C68A 1QQ9A 2Q51A 1XBUA 1Y0YA 3R95A 3PFVA 2FIAA 4M6GA 4ZY1A 3R96A 5LRKA 3EZAA 4KOSA 2O28A 1QSOA 3PGPA 5HVFA 4ZYQA 3PT1A 2PRQA 3KGQA 4OIWA 4CS0B 5J3XA 4QB9A 2JEVA 4KLVA 2EWBA 4C7IA 2CTBA 3OB1B 3ZNIA 4E5SA 4ZI6A 2X0SA 2FL4A 5KTAA 2DIKA 3DDDA 3TX8A 2QVPA 4RR2B 1TKFA 2J8RA 1IOIA 1TIQA 5JH9A 2I3CA 4KOWA 1XJOA 2C5QA 4CDJA 1ZRSA 3ISZA 2GE3A 4B10A 4OC5A 2AJ6A 3H8EA 4KOUA 3H4QA 4A30A 5C82A 4MCPA 2J8MA 4TNUA 3D7FA 4H1HA 2OB0A 3TC8A 3V7ZA 2DPSA 4OC0A 4UCMA 3OP0A 2ZENA 4UFXA 1NBWA 3K4IA 2WPXA 1JDEA 1DTDA 3U88C 2G0BA 2PCUA 2YGWA 4ONUA 1Y7EA 4EMEA 2BCOA 2AFXA 3OB2B 4MCQA 2ZEGA 2IL4A 2ZEOA 1YVHA 4UWJA 3VARA 4OC2A 5LYIA 4MJ8A 5D8NA 5H86A 1XIXA 2ZXVA 5FVJA 3I6SA 4NGSA 2UV8G 5LYLA 2PJ1A 2YJVA 4EYSA 4Q7AA 2EVNA 1CP6A 4MMOA 3CZXA 1IYKA 3VRNA 1YW6A 3S9MA 3ISXA 4JYWA 2G3TA 2GP4A 1I1DA 3FECA 1NMTA 4X5KA 2Q7BA 4IHMA 4NCZA 3FEDA 1M1DA 4M3SA 2R1IA 4TJVA 4MY3A 3BI1A 5EC4A 3D3SA 2HWGA 3BUMB 5I4MA 1VBGA 1Y7RA 3FIXA 1FNOA 3KHZA 5DWNA 3S6KA 2EZBA 3NOJA 5HKZA 4FD6A 1Z8WA 2PR8A 2FXFA 4X2TA 2CNTA 4FD5A 4IUSA 3R9FA 3H5ZA 3FX6A 2CY2A 2R8VA 5F46A 4ONWA 3EY5A 5CPAA 2C6PA 3KZWA 3TTHA 4KORA 3R1KA 5JQ4A 4NSQA 4UF4A 1C3OB 4KOXA 5J1QA 2Y1MA 4OMEA 2ANPA 1XOVA 3KI9A 4P6YA 2OOTA 3SI0A 4CYOA 5G1ZA 4JZ0A 2REEA 2QIRA 1RO5A 2ZOFA 4YN3A 3GB0A 2Q4ZA 5F5XA 2RFHA 3BJ7A 2PJ6A 3TCVA 2FT0A 2GIVA 4PXBA 4A31A 1AYEA 3IU2A 4H89A 1Q2DA 4A4CA 3D67A 2YNCC 1CS0B 1CX8A 5HVGA 3SR3A 4YFJA 3TLBA 2PJ2A 2Q43A 4UEFA 2PJ7A 1TF8A 5JPHA 1EE3P 3EFAA 4CAXA 1C30B 2G3AA 4COGA 1KUXA 3V38A 1J4JA 4HPSA 4IK2A 2X7BA 2YNCA 2OR4A 5JYBA 1ARMA 3TLCA 1Y0RA 3N5FA 4GS4A 3BLNA 1EZAA 1T36B 2ZEFA 2HROA 4K30A 3WABA 1DIKA 1QSTA 2NMTA 2Z3LA 4G1PA 3T5MA 7CPAA 3RAMA 2F7VA 4MXUA 1CG2A 1CJWA 3EZBA 5K8MA 4H6UA 4A4BA 4LX9A 4U9ZA 5HH1A 4MFLA 1YSJA 2DLAA 4M6HA 3HMJG 1I21A 3IIBA 1R43A 4ZY2A 2ZPAA 2WSAA 3F9KC 3PRTA 4FD7A 4IIYA 4UIBA 1S7NA 4UCPA 2ARHA 1NSAA 2V8GA 2JEWA 3QB8A 4NEXA 2Y0MA 4M85A 2H5MA 4C8FA 1LFWA 5K99A 1XF1A 3VTAA 4C99A 3NH8A 5AGEA 3VRQA 4BPUB 2BSWA 2HB6A 3S6GA 4CAVA 4HNWB 5F09A 4LUAA 4E0AA 2E28A 2HQYA 3D4UA 3FMCA 2OZHA 4MHZA 5G21A 1XMTA 4R3LA 4B5PB 3TOAA 4E8OA 2K5TA 3D7DA 3IJ3A 2XPOA 2ZEMA 3FB3A 3TFYA 1ELLP 3NE7A 4JWPA 4MI4A 2AFUA 3CPXA 4KOTA 4KUAA 4MHNA 3SHPA 3FEEA 2XPLA 1Q7LA 3PZJA 1BPNA 3CT9A 5K8OA 4CDKA 3GYAA 2Z3OA 3B3VA 4YRHA 1VBHA 2VKZG 3S9NA 2ABZA 4RS2A 4UA3A 3RNZA 4IAVA 3VROA 4KOVA 1M4LA 2C27A 2Z3PA 1YR0A 4IIXA 4GM5A 1F2OA 5F48A 3V8IA 1S7LA 1X12A 1ZLIA 2YNDA 3KKWA 5ELYA 1A2ZA 3MRUA 1Y9KA 3PFOA 4J3GA 1YLOA 4R76A 2PC1A 4GXHA 4ZX8A 3ZJ0A 2VBQA 5H84A 4A2ZA 4PSWA 4RUHA 4YWYA 1EO0A 4A94A 1S7KA 1WVMA 4AG7A 4W9YA 1ZG8A 4OKOA 5HKYA 1IY7A 3T90A 5BY0A 4NXYA 4AG9A 2QMLA 5IB0A 1ARLA 5IX3A 4ORFA 1U6MA 2OU2A 2F5IA 1KBLA 4HNXB 5AG6A 2Q4VA 2O4HA 1ZG9A 3JRUA 4KSAA 3NFZA 4IF5A 1PYTB 1YK3A 1I12A 4XNHB 3I74A 3GY9A 3O8ZA 2OH1A 4XPLA 4UEZA 3T0TA 2DPTA 2CBLA 2AE6A 4F0XA 5I0CA 3G23A 2QECA 4PK2A 1GHEA 1KWMA 1L0CA 4KZTA 5LRGA 4CGLA 4A39A 2PDOA 4PK3A 1YMEA 3PP9A 5AG5A 1KUYA 1ON0A 2NYQA 4MFPA 4Q36A 2C6CA 1FBVA 3NE8A 4OADA 3R9GA 3T9YA 2AFOA 3K2KA 5HMNA 1Q2CA 2PJ0A 2DF5A 2QYVA 4EWTA 2D0PA 2DXQA 2XPNA 1KUVA 3E0KA 2Z3MA 3PB4X 4CAFA 6CPAA 3T05A 3OWCA 4O23A 4QUSA 3B3SA 3W6XA 1ZO0A 4XPKA 5CBMA 3U1BA 1NE9A 4JXRA 2RC4A 3IEHA 4KVOE 2EK9A 2Z3KA 1M44A 3GKRA 4P4IA 1KC7A 3ICUA 1VGYA 2FS5A 4U5YA 1YVOA 3N7ZA 1XRYA 4JVOA 4PSXA 4LQGA 3TYXA 4E2AA 3C8OA 2IMOA 4C8UA 4QVTA 4MBUA 1TKJA 2BO9A 2VI7A 5AG7A 2YJTA 2PR1A 2PVVA 3F0AA 3B35A 1TXRA 2Q04A 4RI1A 2I00A 2N3AB 1IIDA 1LOKA 1Z8TA 1PU9A 1PUAA 4LQ6A 4OP4A 4AB7A 2B0AA 5HVHA 4COBA 4KSFA 2V8VA 3WC5A 4P44A 3WC7A 3S9LA 2CNSA 2ZW5A 4UWIA 1R3NA 5IR2A 4R6TA 3BUWB 3FNCA 1N71A 1FY7A 5A27A 2ZOGA 2PJ9A 4MFJA 5JM6A 3VH9A 4P45A 2XEIA 4MRIA 1YW4A 4C2XA 4CAWA 1BXRB 3H8FA 4FWUA 3KRVA 4C9UA 4C8PA 3ZZIA 4L89A 2FM4A 3LODA 1IICA 3KQXA 4WWVA 4MHDA 4A33A 1HEEA 3D2MA 3DSBA 2CTCA 5DWMA 1KZFA 2FSRA 2P0WA 3QAYA 1B6BA 4KLWA 3PB6X 4P10A 3HLPA 3IGRA 1YX0A 4NGRA 4C2ZA 3FRMA 4P4JA 1BO4A 1EZBA 4C85A 3HUVA 4X3RA 2F8HA 4BPXB 1H8LA 2HC9A 1XMBA 2Q4YA 3FJUA 2D4PA 4DYOA 3PB8X 3EZEA 3TLGB 2VEZA 3FF3A 3F8KA 3F5BA 4ZX9A 2VZZA 3CXQA 5G22A 3KL9A 1Z9UA 4C86A 3BI0A 4JLYA 4UBRA 4MHPA 3T8WA 4CYQA 2ZW6A 3RO0A 3I3GA 4FAIA 1CE8B 4R3KA 4TJXA 1V0CA 4OAEA 4P4FA 1ZLHA 4A95A 1MJAA 1YGHA 4MFQA 4CRZB 3L2NA 3MGDA 4ZY0A 4TWEA 3TO7A 2JDDA 2PCNA 1JWQA 1RXTA 4FUUA 3K9TA 4B5PA 4WJBA 4MCSA 3T07A 4KVXA 4P4DA 4BPWB 5JGFA 3SXOA 3VATA 3KASA 2WUUA 3LACA 2PJ3A 4OIDA 4B12A 2ZEDA 4YGOA 2MP0A 4OC1A 2BUEA 3LMSA 2RB7A 2CXAA 2JBJA 3PB7X 5AXIA 4XPDB 1Z5RA 2B5GB 4JD6A 4C8CA 3DLJA 1AUGA 3GUXA 1CPSA 2AFWA 2GFQA 3EXNA 4PXDA 4PPZA 3R9EA 5BWAB 3DGVA 1NXJA 2D0OA 5IB9A 4RN7A 3PLFB 2EZAA 4C9EA 2PJ4A 1CPXA 1Y9WA 2WPWA 1YLEA 3W6SA 2G9DA 3VRRA 1WWZA 2ZEPA 5F47A 4MCRA 5LYDA 2PE3A 3B2YA 5EMIA 3KR4A 1QSMA 1BPMA 4NGMA 2P6FA 4CGNA 2AUNA 1LRZA 2B4BA 4JJXA 2EZCA 4C8TA 2Q7SA 2I79A 3S6HA 3DR6A 3TE4A 2WYRA 1LAPA 1XE4A 2JLMA 3D66A 1ZL0A 1IB1E 1B47A 1JQGA 3IWEA 3KR5A 3IWWA 3BUNB 1MJBA 2B58A 4FBEA 4C9RA 3IFEA 2AFMA 4PQAA 4CGOA 5IV0A 3VRPA 2EUIA 4XNHC 1VI4A 1Y9ZA 5F9MA 2B4DB 2V77A 1S60A 2R98A 1K4JA 3GLJA 3NA6A 4KUBA 5ISVA 3NH4A 1X10A 1HDUA 2PIYA 4UIAA 3B8GA 1V6CA 2VXKA 4ZBGA 2EO8A 4B13A 4M8DA 4I49A 4A38A 3TO6A 2C6GA 4K3NA 4NGTA 1VHSA 5K8NA 4CRYB 2D4OA 1AMPA 1UWYA 3A9LA 4HNYB 2PJ8A 1VKCA 5DS0A 4BINA 4MJXA 4CZ1A 4NGNA 1GGOA 5LRJA 1ZYMA 5FD8A 4PV6A 4MI1A 3B7IA 3JVNA 1DE4C 3RZAA 3FH4A 2OZGA 2R82A 1TKHA 2AUMA 2V8HA 2P6EA 3RBUA 2CF4A 2KCWA 4OC4A 1Z2LA 1FT7A 1S5KA 1SQHA 1ZG7A 3D7GA 1R57A 3CDXA 2BL1A 3GJZA 4J0NA 2V8DA 3P2FA 1YREA 5KTCA 3NFQA 2EBJA 2FIWA 3PEIA 3IC1A 4F8ZA 5LYFA 2PJAA 4E94A 2Z10A 3BJ8A 3SJEA 5AG4A 2PJBA 4AXVA 4BTFA 1TF9A 1J3LA 3TLZA 4HKFA 3K9UA 4P4BA 4FD4A 3UY5A 4ZGYB 3EIFA 4NGQA 4EVYA 2JBKA 1P0HA 4C9VA 3P2HA 2EK8A 2JDCA 4B14A 1RTQA 3D8PA 3RYOA 1LCPA 1A9XB 1ELMP 3SJGA 1JDBC 4KOYA 3SJFA 2FCKA 1CP7A 2J9AA 3MN8A 3VGOA 4KVME 4MFZA 2WZNA 4A37A 4C2YA 3QNVA 2HUZA 1VHEA 4C84A 2O53A 3OAKA 2BOAA 2Z0ZA 3SI2A 1Z4RA 5G20A 4B11A 3VWDA 3G8WA 4R57A 4R7MA 3H8GA 2ATRA 3EO4A 2R7HA 1M6VB 1GYTA 3JUWA 4B6ZA 4F6AA 4R87A 2P6GA 4INJA 1QMUA 4UFWA 2ZW7A 3DR8A 1Z9EA 4UFVA 2YNEA 4CAEA 4NJQA 4AVBA 5JVLA 2FE7A 2J8NA 4NFRA 1IU8A 1YVKA 4P4EA 1LANA 1Z4EA 2GU2A 1VHOA 2PQ8A 2VZYA 5F13A 3KQZA 4BMHA 8CPAA 2XPPA 2GLJA 3FYNA 5THWA 4C9AA 2REFA 2ZELA 4MY0A 4L8AA 3HPHE 2Q44A 4R8FA 2PRBA 3IWGA 2IJZA 3TLEA 3S6FA 2PVWA 4PXEA 4Q38A 2ODFA 1LAMA 2Q0YA 3EC4A 5KTDA 3FXTA 1CBXA 1MJ9A 2Z3NA 5J8CA 3GIUA 3TLGA 4NJRA 2GLFA 1M4IA 1M4DA 5HKWA 3SJXA 1UFHA 2CNMA
chains in the Genus database with same CATH topology
4NGPA 2PJCA 3PB9X 4BD9A 4MHYA 1PCAA 2C1CA 1BAVA 1VIXA 3D7HA 2FVGA 3D68A 2POKA 3KHXA 3WT4A 4EFDA 2IQ6A 3B3TA 3SI1A 3WC6A 1IGBA 4F9VA 2GREA 4KSIA 3B3WA 1F2PA 5K8PA 1Z8LA 4OC3A 5HXDA 2AFSA 3NH5A 4KNGE 1HDQA 2CIJA 1OBRA 3B3CA 4CPAA 4F9UA 2PJ5A 4H2KA 4C8AA 3PBBA 4PXCA 2QJ8A 2ZEHA 1BLLE 3I1UA 3FVLA 3BXMA 4DUKA 2NSMA 4DJLA 4UEEA 3BHXA 3PBEA 2XEJA 1F57A 4Z65A 2AFZA 1XFOA 3CPAA 2VL1A 2PIZA 4X8IA 2XEGA 3IO1A 2DEAA 4YU9A 2XEFA 3PFEA 5D29A 3LWUA 2ZEEA 1QQ9A 2Q51A 1XBUA 1Y0YA 4ZY1A 5LRKA 5HVFA 4ZYQA 2PRQA 3KGQA 4OIWA 2EWBA 2CTBA 4ZI6A 3TX8A 2QVPA 1TKFA 5JH9A 2I3CA 1XJOA 2C5QA 4CDJA 3ISZA 4OC5A 3H8EA 4MCPA 4TNUA 3D7FA 3TC8A 3V7ZA 4OC0A 2ZENA 1DTDA 2PCUA 4EMEA 1Y7EA 2BCOA 2AFXA 4MCQA 2ZEGA 2ZEOA 3VARA 4OC2A 5LYIA 5D8NA 3I6SA 4NGSA 5LYLA 2PJ1A 4Q7AA 1CP6A 4MMOA 1YW6A 3S9MA 3ISXA 4JYWA 2GP4A 3FECA 4IHMA 3FEDA 4TJVA 3BI1A 3KHZA 1FNOA 4X2TA 3FX6A 4ONWA 5CPAA 2C6PA 3KZWA 4UF4A 5J1QA 3KI9A 4OMEA 2ANPA 2OOTA 3SI0A 4JZ0A 2ZOFA 4YN3A 3GB0A 2Q4ZA 2RFHA 2PJ6A 4PXBA 1AYEA 3D67A 1CX8A 5HVGA 2PJ2A 2Q43A 4UEFA 2PJ7A 1TF8A 1EE3P 3V38A 4IK2A 2OR4A 1ARMA 1Y0RA 3N5FA 2ZEFA 3WABA 4G1PA 7CPAA 3RAMA 2F7VA 4MXUA 1CG2A 5K8MA 1YSJA 4ZY2A 3IIBA 1R43A 3PRTA 4UIBA 1NSAA 2V8GA 2JEWA 4C8FA 1LFWA 1XF1A 3VTAA 4C99A 3NH8A 2HB6A 5F09A 3D4UA 3FMCA 4MHZA 3D7DA 3IJ3A 2ZEMA 1ELLP 2AFUA 3CPXA 4MHNA 3FEEA 1Q7LA 4CDKA 1BPNA 3CT9A 5K8OA 3B3VA 3S9NA 2ABZA 4IAVA 1M4LA 4GM5A 1F2OA 1ZLIA 3PFOA 5ELYA 3MRUA 4R76A 4ZX8A 1YLOA 4RUHA 4YWYA 4A94A 1WVMA 4W9YA 1ZG8A 4OKOA 1IY7A 1ARLA 2O4HA 1ZG9A 3JRUA 3NFZA 1PYTB 3I74A 4UEZA 1KWMA 5LRGA 4A39A 1YMEA 4EWTA 2NYQA 2C6CA 2AFOA 3K2KA 2PJ0A 2QYVA 3PB4X 6CPAA 4O23A 3B3SA 5CBMA 3IEHA 2EK9A 4P4IA 3ICUA 1VGYA 1XRYA 4LQGA 4C8UA 2IMOA 1TKJA 2BO9A 2PVVA 3B35A 1TXRA 1LOKA 4OP4A 5HVHA 2V8VA 3WC5A 4P44A 3WC7A 3S9LA 1R3NA 5IR2A 4R6TA 2ZOGA 2PJ9A 5JM6A 3VH9A 4P45A 2XEIA 4MRIA 1YW4A 3H8FA 4FWUA 4C9UA 3KQXA 4WWVA 1HEEA 2CTCA 4P10A 3PB6X 3HLPA 4NGRA 4P4JA 4C85A 3HUVA 4X3RA 2F8HA 2HC9A 1H8LA 4DYOA 1XMBA 3FJUA 3PB8X 3FF3A 4ZX9A 3KL9A 4C86A 3BI0A 3T8WA 4MHPA 4FAIA 4TJXA 4P4FA 1ZLHA 3L2NA 4ZY0A 4TWEA 4FUUA 3K9TA 4WJBA 4MCSA 4P4DA 5JGFA 3VATA 3KASA 4OIDA 2PJ3A 2ZEDA 4OC1A 3LMSA 2RB7A 2JBJA 3PB7X 1Z5RA 4C8CA 3DLJA 3GUXA 1CPSA 2AFWA 4PXDA 4PPZA 3DGVA 5IB9A 4C9EA 2PJ4A 1CPXA 2G9DA 2ZEPA 4MCRA 5LYDA 2PE3A 3B2YA 3KR4A 1BPMA 4NGMA 4C8TA 2WYRA 1LAPA 3D66A 1JQGA 3KR5A 4FBEA 5I4MA 3IWWA 4C9RA 3IFEA 2AFMA 4PQAA 1Y9ZA 2V77A 3GLJA 3NA6A 4C8PA 3NH4A 2PIYA 1HDUA 4UIAA 1V6CA 4A38A 2C6GA 4K3NA 4NGTA 5K8NA 1AMPA 1UWYA 2PJ8A 5DS0A 4NGNA 5LRJA 3B7IA 1DE4C 3RZAA 3FH4A 1TKHA 2V8HA 3RBUA 2CF4A 4OC4A 1Z2LA 1FT7A 1ZG7A 3CDXA 3D7GA 2V8DA 4F8ZA 5LYFA 3PEIA 3IC1A 2PJAA 3SJEA 2PJBA 4AXVA 1TF9A 4P4BA 3EIFA 4NGQA 2JBKA 4C9VA 2EK8A 1RTQA 1LCPA 1ELMP 3SJGA 3SJFA 1CP7A 2J9AA 3MN8A 4A37A 4C84A 2WZNA 3QNVA 1VHEA 2O53A 2BOAA 3SI2A 4R7MA 3H8GA 1GYTA 4B6ZA 1QMUA 4NJQA 4NFRA 4P4EA 1LANA 2GU2A 1VHOA 3KQZA 8CPAA 2GLJA 5THWA 4C9AA 2ZELA 4R8FA 2IJZA 2PVWA 4PXEA 1LAMA 1CBXA 4NJRA 2GLFA 3SJXA 4P6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGP A;  2PJC A;  3PB9 X;  4BD9 A;  4MHY A;  1PCA A;  2C1C A;  1BAV A;  1VIX A;  3D7H A;  2FVG A;  3D68 A;  2POK A;  3KHX A;  3WT4 A;  4EFD A;  2IQ6 A;  3B3T A;  3SI1 A;  3WC6 A;  1IGB A;  4F9V A;  2GRE A;  4KSI A;  3B3W A;  1F2P A;  5K8P A;  1Z8L A;  4OC3 A;  5HXD A;  2AFS A;  3NH5 A;  4KNG E;  1HDQ A;  2CIJ A;  1OBR A;  3B3C A;  4CPA A;  4F9U A;  2PJ5 A;  4H2K A;  4C8A A;  3PBB A;  4PXC A;  2QJ8 A;  2ZEH A;  1BLL E;  3I1U A;  3FVL A;  3BXM A;  4DUK A;  2NSM A;  4DJL A;  4UEE A;  3BHX A;  3PBE A;  2XEJ A;  1F57 A;  4Z65 A;  2AFZ A;  1XFO A;  3CPA A;  2VL1 A;  2PIZ A;  4X8I A;  2XEG A;  3IO1 A;  2DEA A;  4YU9 A;  2XEF A;  3PFE A;  5D29 A;  3LWU A;  2ZEE A;  1QQ9 A;  2Q51 A;  1XBU A;  1Y0Y A;  4ZY1 A;  5LRK A;  5HVF A;  4ZYQ A;  2PRQ A;  3KGQ A;  4OIW A;  2EWB A;  2CTB A;  4ZI6 A;  3TX8 A;  2QVP A;  1TKF A;  5JH9 A;  2I3C A;  1XJO A;  4CDJ A;  3ISZ A;  4OC5 A;  3H8E A;  4MCP A;  4TNU A;  3D7F A;  3TC8 A;  3V7Z A;  4OC0 A;  2ZEN A;  1DTD A;  2PCU A;  4EME A;  1Y7E A;  2BCO A;  2AFX A;  4MCQ A;  2ZEG A;  2ZEO A;  3VAR A;  4OC2 A;  5LYI A;  5D8N A;  3I6S A;  4NGS A;  5LYL A;  2PJ1 A;  4Q7A A;  1CP6 A;  4MMO A;  1YW6 A;  3S9M A;  3ISX A;  4JYW A;  3FEC A;  4IHM A;  3FED A;  4TJV A;  3BI1 A;  3KHZ A;  1FNO A;  4X2T A;  3FX6 A;  4ONW A;  5CPA A;  2C6P A;  3KZW A;  4UF4 A;  5J1Q A;  3KI9 A;  4OME A;  2ANP A;  2OOT A;  3SI0 A;  4JZ0 A;  2ZOF A;  4YN3 A;  3GB0 A;  2Q4Z A;  2RFH A;  2PJ6 A;  4PXB A;  1AYE A;  3D67 A;  1CX8 A;  5HVG A;  2PJ2 A;  2Q43 A;  4UEF A;  2PJ7 A;  1TF8 A;  1EE3 P;  3V38 A;  4IK2 A;  2OR4 A;  1ARM A;  1Y0R A;  3N5F A;  2ZEF A;  3WAB A;  4G1P A;  7CPA A;  3RAM A;  2F7V A;  4MXU A;  1CG2 A;  5K8M A;  1YSJ A;  4ZY2 A;  3IIB A;  1R43 A;  3PRT A;  4UIB A;  1NSA A;  2V8G A;  2JEW A;  4C8F A;  1LFW A;  1XF1 A;  3VTA A;  4C99 A;  3NH8 A;  2HB6 A;  5F09 A;  3D4U A;  3FMC A;  4MHZ A;  3D7D A;  3IJ3 A;  2ZEM A;  1ELL P;  2AFU A;  3CPX A;  4MHN A;  3FEE A;  1Q7L A;  4CDK A;  1BPN A;  3CT9 A;  5K8O A;  3B3V A;  3S9N A;  2ABZ A;  4IAV A;  1M4L A;  4GM5 A;  1F2O A;  1ZLI A;  3PFO A;  5ELY A;  3MRU A;  4R76 A;  4ZX8 A;  1YLO A;  4RUH A;  4YWY A;  4A94 A;  1WVM A;  4W9Y A;  1ZG8 A;  4OKO A;  1IY7 A;  1ARL A;  2O4H A;  1ZG9 A;  3JRU A;  3NFZ A;  1PYT B;  3I74 A;  4UEZ A;  1KWM A;  5LRG A;  4A39 A;  1YME A;  4EWT A;  2NYQ A;  2C6C A;  2AFO A;  3K2K A;  2PJ0 A;  2QYV A;  3PB4 X;  6CPA A;  4O23 A;  3B3S A;  5CBM A;  3IEH A;  2EK9 A;  4P4I A;  3ICU A;  1VGY A;  1XRY A;  4LQG A;  4C8U A;  2IMO A;  1TKJ A;  2BO9 A;  2PVV A;  3B35 A;  1TXR A;  1LOK A;  4OP4 A;  5HVH A;  2V8V A;  3WC5 A;  4P44 A;  3WC7 A;  3S9L A;  1R3N A;  4R6T A;  2ZOG A;  2PJ9 A;  5JM6 A;  3VH9 A;  4P45 A;  2XEI A;  4MRI A;  1YW4 A;  3H8F A;  4FWU A;  4C9U A;  3KQX A;  4WWV A;  1HEE A;  2CTC A;  4P10 A;  3PB6 X;  3HLP A;  4NGR A;  4P4J A;  4C85 A;  3HUV A;  4X3R A;  2F8H A;  2HC9 A;  1H8L A;  4DYO A;  1XMB A;  3FJU A;  3PB8 X;  3FF3 A;  4ZX9 A;  3KL9 A;  4C86 A;  3BI0 A;  3T8W A;  4MHP A;  4FAI A;  4TJX A;  4P4F A;  1ZLH A;  3L2N A;  4ZY0 A;  4TWE A;  4FUU A;  3K9T A;  4WJB A;  4MCS A;  4P4D A;  5JGF A;  3VAT A;  3KAS A;  4OID A;  2PJ3 A;  2ZED A;  4OC1 A;  3LMS A;  2RB7 A;  2JBJ A;  3PB7 X;  1Z5R A;  4C8C A;  3DLJ A;  3GUX A;  1CPS A;  2AFW A;  4PXD A;  4PPZ A;  3DGV A;  5IB9 A;  4C9E A;  2PJ4 A;  1CPX A;  2G9D A;  2ZEP A;  4MCR A;  5LYD A;  2PE3 A;  3B2Y A;  3KR4 A;  1BPM A;  4NGM A;  4C8T A;  2WYR A;  1LAP A;  3D66 A;  1JQG A;  3KR5 A;  4FBE A;  5I4M A;  3IWW A;  4C9R A;  3IFE A;  2AFM A;  4PQA A;  1Y9Z A;  2V77 A;  3GLJ A;  3NA6 A;  4C8P A;  3NH4 A;  2PIY A;  1HDU A;  4UIA A;  1V6C A;  4A38 A;  2C6G A;  4K3N A;  4NGT A;  5K8N A;  1AMP A;  1UWY A;  2PJ8 A;  5DS0 A;  4NGN A;  5LRJ A;  3B7I A;  1DE4 C;  3RZA A;  3FH4 A;  1TKH A;  2V8H A;  3RBU A;  2CF4 A;  4OC4 A;  1Z2L A;  1FT7 A;  1ZG7 A;  3CDX A;  3D7G A;  2V8D A;  4F8Z A;  5LYF A;  3PEI A;  3IC1 A;  2PJA A;  3SJE A;  2PJB A;  4AXV A;  1TF9 A;  4P4B A;  3EIF A;  4NGQ A;  2JBK A;  4C9V A;  2EK8 A;  1RTQ A;  1LCP A;  1ELM P;  3SJG A;  3SJF A;  1CP7 A;  2J9A A;  3MN8 A;  4A37 A;  4C84 A;  2WZN A;  3QNV A;  1VHE A;  2O53 A;  2BOA A;  3SI2 A;  4R7M A;  3H8G A;  1GYT A;  4B6Z A;  1QMU A;  4NJQ A;  4NFR A;  4P4E A;  1LAN A;  2GU2 A;  1VHO A;  3KQZ A;  8CPA A;  2GLJ A;  5THW A;  4C9A A;  2ZEL A;  4R8F A;  2IJZ A;  2PVW A;  4PXE A;  1LAM A;  1CBX A;  4NJR A;  2GLF A;  3SJX A;  4P6Y A; 
#chains in the Genus database with same CATH topology
 4NGP A;  2PJC A;  4UCN A;  3PB9 X;  1B87 A;  4BD9 A;  4MHY A;  4CYN A;  1PCA A;  2C1C A;  3W91 A;  1BAV A;  1VIX A;  3D7H A;  2FVG A;  4B5O A;  4CGM A;  3C26 A;  1Z8X A;  2Y1N A;  4BBH A;  3D68 A;  2POK A;  3KHX A;  3WR7 A;  5C88 A;  3WT4 A;  4DNC A;  4EFD A;  4AVA A;  2B3U A;  4H6Z A;  2IQ6 A;  3D2P A;  3B3T A;  3SXN A;  1IOF A;  1IYL A;  3SI1 A;  3BUX B;  4XPD C;  5J8F A;  3WC6 A;  3TLA A;  4KS9 A;  1IGB A;  2B3V A;  4F9V A;  2GRE A;  4KSI A;  3B3W A;  4NF1 A;  1Q2Y A;  1F2P A;  4GPL B;  3CXS A;  5K8P A;  3TOB A;  3VWE A;  2HV2 A;  4U9Y A;  4CO9 A;  1Z8L A;  1QSN A;  2OLS A;  2B5G A;  4OLL A;  4OC3 A;  2BEI A;  1QSR A;  5EBV A;  4AVC A;  2Z11 A;  2AFS A;  3NH5 A;  5HXD A;  4KNG E;  3BUO B;  2ZW4 A;  1HDQ A;  4QBJ A;  4JXQ A;  1Q5X A;  3G3S A;  2CIJ A;  1OBR A;  2PSW A;  4M6I A;  3B3C A;  5E96 A;  4CPA A;  4F9U A;  1KEE B;  5F1Y A;  3DNS A;  1M4G A;  2PJ5 A;  1S3Z A;  4H2K A;  2B4J C;  4QC6 A;  2GAN A;  3FBU A;  3LD2 A;  4Y49 C;  4C8A A;  1OZP A;  1CM0 A;  3PBB A;  4PXC A;  2QJ8 A;  1R61 A;  2ZEH A;  1WK4 A;  2A4N A;  3TT2 A;  1BLL E;  3I1U A;  4CGP A;  3QAH A;  5A28 A;  1BOB A;  3FVL A;  3BXM A;  3IU1 A;  3I9S A;  1MK4 A;  2B4D A;  2NSM A;  4DUK A;  4II9 A;  3TO9 A;  1WJT A;  4UEE A;  4DJL A;  3BHX A;  1S7F A;  3TLY A;  1XF8 A;  1P4N A;  4F0Y A;  5F49 A;  3PBE A;  4Y49 B;  2XEJ A;  1F57 A;  4MFK A;  4C7H A;  4Z65 A;  2AFZ A;  1XFO A;  3CPA A;  2VL1 A;  1XEB A;  2PIZ A;  2XEG A;  3CXP A;  4X8I A;  3IO1 A;  1NSL A;  2DEA A;  5CNP A;  5GCN A;  1YQE A;  4YU9 A;  2XEF A;  2OZU A;  4R9M A;  4CYP A;  3HPG G;  3PFE A;  5D29 A;  3JTK A;  3LWU A;  2VQY A;  2ZEE A;  4A32 A;  2HI6 A;  4C68 A;  1QQ9 A;  2Q51 A;  1XBU A;  1Y0Y A;  3R95 A;  3PFV A;  2FIA A;  4M6G A;  4ZY1 A;  3R96 A;  5LRK A;  3EZA A;  4KOS A;  2O28 A;  1QSO A;  3PGP A;  5HVF A;  4ZYQ A;  3PT1 A;  2PRQ A;  3KGQ A;  4OIW A;  4CS0 B;  5J3X A;  4QB9 A;  2JEV A;  4KLV A;  2EWB A;  4C7I A;  2CTB A;  3OB1 B;  3ZNI A;  4E5S A;  4ZI6 A;  2X0S A;  2FL4 A;  5KTA A;  2DIK A;  3DDD A;  3TX8 A;  2QVP A;  4RR2 B;  1TKF A;  2J8R A;  1IOI A;  1TIQ A;  5JH9 A;  2I3C A;  4KOW A;  1XJO A;  2C5Q A;  4CDJ A;  1ZRS A;  3ISZ A;  2GE3 A;  4B10 A;  4OC5 A;  2AJ6 A;  3H8E A;  4KOU A;  3H4Q A;  4A30 A;  5C82 A;  4MCP A;  2J8M A;  4TNU A;  3D7F A;  4H1H A;  2OB0 A;  3TC8 A;  3V7Z A;  2DPS A;  4OC0 A;  4UCM A;  3OP0 A;  2ZEN A;  4UFX A;  1NBW A;  3K4I A;  2WPX A;  1JDE A;  1DTD A;  3U88 C;  2G0B A;  2PCU A;  2YGW A;  4ONU A;  1Y7E A;  4EME A;  2BCO A;  2AFX A;  3OB2 B;  4MCQ A;  2ZEG A;  2IL4 A;  2ZEO A;  1YVH A;  4UWJ A;  3VAR A;  4OC2 A;  5LYI A;  4MJ8 A;  5D8N A;  5H86 A;  1XIX A;  2ZXV A;  5FVJ A;  3I6S A;  4NGS A;  2UV8 G;  5LYL A;  2PJ1 A;  2YJV A;  4EYS A;  4Q7A A;  2EVN A;  1CP6 A;  4MMO A;  3CZX A;  1IYK A;  3VRN A;  1YW6 A;  3S9M A;  3ISX A;  4JYW A;  2G3T A;  2GP4 A;  1I1D A;  3FEC A;  1NMT A;  4X5K A;  2Q7B A;  4IHM A;  4NCZ A;  3FED A;  1M1D A;  4M3S A;  2R1I A;  4TJV A;  4MY3 A;  3BI1 A;  5EC4 A;  3D3S A;  2HWG A;  3BUM B;  5I4M A;  1VBG A;  1Y7R A;  3FIX A;  1FNO A;  3KHZ A;  5DWN A;  3S6K A;  2EZB A;  3NOJ A;  5HKZ A;  4FD6 A;  1Z8W A;  2PR8 A;  2FXF A;  4X2T A;  2CNT A;  4FD5 A;  4IUS A;  3R9F A;  3H5Z A;  3FX6 A;  2CY2 A;  2R8V A;  5F46 A;  4ONW A;  3EY5 A;  5CPA A;  2C6P A;  3KZW A;  3TTH A;  4KOR A;  3R1K A;  5JQ4 A;  4NSQ A;  4UF4 A;  1C3O B;  4KOX A;  5J1Q A;  2Y1M A;  4OME A;  2ANP A;  1XOV A;  3KI9 A;  4P6Y A;  2OOT A;  3SI0 A;  4CYO A;  5G1Z A;  4JZ0 A;  2REE A;  2QIR A;  1RO5 A;  2ZOF A;  4YN3 A;  3GB0 A;  2Q4Z A;  5F5X A;  2RFH A;  3BJ7 A;  2PJ6 A;  3TCV A;  2FT0 A;  2GIV A;  4PXB A;  4A31 A;  1AYE A;  3IU2 A;  4H89 A;  1Q2D A;  4A4C A;  3D67 A;  2YNC C;  1CS0 B;  1CX8 A;  5HVG A;  3SR3 A;  4YFJ A;  3TLB A;  2PJ2 A;  2Q43 A;  4UEF A;  2PJ7 A;  1TF8 A;  5JPH A;  1EE3 P;  3EFA A;  4CAX A;  1C30 B;  2G3A A;  4COG A;  1KUX A;  3V38 A;  1J4J A;  4HPS A;  4IK2 A;  2X7B A;  2YNC A;  2OR4 A;  5JYB A;  1ARM A;  3TLC A;  1Y0R A;  3N5F A;  4GS4 A;  3BLN A;  1EZA A;  1T36 B;  2ZEF A;  2HRO A;  4K30 A;  3WAB A;  1DIK A;  1QST A;  2NMT A;  2Z3L A;  4G1P A;  3T5M A;  7CPA A;  3RAM A;  2F7V A;  4MXU A;  1CG2 A;  1CJW A;  3EZB A;  5K8M A;  4H6U A;  4A4B A;  4LX9 A;  4U9Z A;  5HH1 A;  4MFL A;  1YSJ A;  2DLA A;  4M6H A;  3HMJ G;  1I21 A;  3IIB A;  1R43 A;  4ZY2 A;  2ZPA A;  2WSA A;  3F9K C;  3PRT A;  4FD7 A;  4IIY A;  4UIB A;  1S7N A;  4UCP A;  2ARH A;  1NSA A;  2V8G A;  2JEW A;  3QB8 A;  4NEX A;  2Y0M A;  4M85 A;  2H5M A;  4C8F A;  1LFW A;  5K99 A;  1XF1 A;  3VTA A;  4C99 A;  3NH8 A;  5AGE A;  3VRQ A;  4BPU B;  2BSW A;  2HB6 A;  3S6G A;  4CAV A;  4HNW B;  5F09 A;  4LUA A;  4E0A A;  2E28 A;  2HQY A;  3D4U A;  3FMC A;  2OZH A;  4MHZ A;  5G21 A;  1XMT A;  4R3L A;  4B5P B;  3TOA A;  4E8O A;  2K5T A;  3D7D A;  3IJ3 A;  2XPO A;  2ZEM A;  3FB3 A;  3TFY A;  1ELL P;  3NE7 A;  4JWP A;  4MI4 A;  2AFU A;  3CPX A;  4KOT A;  4KUA A;  4MHN A;  3SHP A;  3FEE A;  2XPL A;  1Q7L A;  3PZJ A;  1BPN A;  3CT9 A;  5K8O A;  4CDK A;  3GYA A;  2Z3O A;  3B3V A;  4YRH A;  1VBH A;  2VKZ G;  3S9N A;  2ABZ A;  4RS2 A;  4UA3 A;  3RNZ A;  4IAV A;  3VRO A;  4KOV A;  1M4L A;  2C27 A;  2Z3P A;  1YR0 A;  4IIX A;  4GM5 A;  1F2O A;  5F48 A;  3V8I A;  1S7L A;  1X12 A;  1ZLI A;  2YND A;  3KKW A;  5ELY A;  1A2Z A;  3MRU A;  1Y9K A;  3PFO A;  4J3G A;  1YLO A;  4R76 A;  2PC1 A;  4GXH A;  4ZX8 A;  3ZJ0 A;  2VBQ A;  5H84 A;  4A2Z A;  4PSW A;  4RUH A;  4YWY A;  1EO0 A;  4A94 A;  1S7K A;  1WVM A;  4AG7 A;  4W9Y A;  1ZG8 A;  4OKO A;  5HKY A;  1IY7 A;  3T90 A;  5BY0 A;  4NXY A;  4AG9 A;  2QML A;  5IB0 A;  1ARL A;  5IX3 A;  4ORF A;  1U6M A;  2OU2 A;  2F5I A;  1KBL A;  4HNX B;  5AG6 A;  2Q4V A;  2O4H A;  1ZG9 A;  3JRU A;  4KSA A;  3NFZ A;  4IF5 A;  1PYT B;  1YK3 A;  1I12 A;  4XNH B;  3I74 A;  3GY9 A;  3O8Z A;  2OH1 A;  4XPL A;  4UEZ A;  3T0T A;  2DPT A;  2CBL A;  2AE6 A;  4F0X A;  5I0C A;  3G23 A;  2QEC A;  4PK2 A;  1GHE A;  1KWM A;  1L0C A;  4KZT A;  5LRG A;  4CGL A;  4A39 A;  2PDO A;  4PK3 A;  1YME A;  3PP9 A;  5AG5 A;  1KUY A;  1ON0 A;  2NYQ A;  4MFP A;  4Q36 A;  2C6C A;  1FBV A;  3NE8 A;  4OAD A;  3R9G A;  3T9Y A;  2AFO A;  3K2K A;  5HMN A;  1Q2C A;  2PJ0 A;  2DF5 A;  2QYV A;  4EWT A;  2D0P A;  2DXQ A;  2XPN A;  1KUV A;  3E0K A;  2Z3M A;  3PB4 X;  4CAF A;  6CPA A;  3T05 A;  3OWC A;  4O23 A;  4QUS A;  3B3S A;  3W6X A;  1ZO0 A;  4XPK A;  5CBM A;  3U1B A;  1NE9 A;  4JXR A;  2RC4 A;  3IEH A;  4KVO E;  2EK9 A;  2Z3K A;  1M44 A;  3GKR A;  4P4I A;  1KC7 A;  3ICU A;  1VGY A;  2FS5 A;  4U5Y A;  1YVO A;  3N7Z A;  1XRY A;  4JVO A;  4PSX A;  4LQG A;  3TYX A;  4E2A A;  3C8O A;  2IMO A;  4C8U A;  4QVT A;  4MBU A;  1TKJ A;  2BO9 A;  2VI7 A;  5AG7 A;  2YJT A;  2PR1 A;  2PVV A;  3F0A A;  3B35 A;  1TXR A;  2Q04 A;  4RI1 A;  2I00 A;  2N3A B;  1IID A;  1LOK A;  1Z8T A;  1PU9 A;  1PUA A;  4LQ6 A;  4OP4 A;  4AB7 A;  2B0A A;  5HVH A;  4COB A;  4KSF A;  2V8V A;  3WC5 A;  4P44 A;  3WC7 A;  3S9L A;  2CNS A;  2ZW5 A;  4UWI A;  1R3N A;  5IR2 A;  4R6T A;  3BUW B;  3FNC A;  1N71 A;  1FY7 A;  5A27 A;  2ZOG A;  2PJ9 A;  4MFJ A;  5JM6 A;  3VH9 A;  4P45 A;  2XEI A;  4MRI A;  1YW4 A;  4C2X A;  4CAW A;  1BXR B;  3H8F A;  4FWU A;  3KRV A;  4C9U A;  4C8P A;  3ZZI A;  4L89 A;  2FM4 A;  3LOD A;  1IIC A;  3KQX A;  4WWV A;  4MHD A;  4A33 A;  1HEE A;  3D2M A;  3DSB A;  2CTC A;  5DWM A;  1KZF A;  2FSR A;  2P0W A;  3QAY A;  1B6B A;  4KLW A;  3PB6 X;  4P10 A;  3HLP A;  3IGR A;  1YX0 A;  4NGR A;  4C2Z A;  3FRM A;  4P4J A;  1BO4 A;  1EZB A;  4C85 A;  3HUV A;  4X3R A;  2F8H A;  4BPX B;  1H8L A;  2HC9 A;  1XMB A;  2Q4Y A;  3FJU A;  2D4P A;  4DYO A;  3PB8 X;  3EZE A;  3TLG B;  2VEZ A;  3FF3 A;  3F8K A;  3F5B A;  4ZX9 A;  2VZZ A;  3CXQ A;  5G22 A;  3KL9 A;  1Z9U A;  4C86 A;  3BI0 A;  4JLY A;  4UBR A;  4MHP A;  3T8W A;  4CYQ A;  2ZW6 A;  3RO0 A;  3I3G A;  4FAI A;  1CE8 B;  4R3K A;  4TJX A;  1V0C A;  4OAE A;  4P4F A;  1ZLH A;  4A95 A;  1MJA A;  1YGH A;  4MFQ A;  4CRZ B;  3L2N A;  3MGD A;  4ZY0 A;  4TWE A;  3TO7 A;  2JDD A;  2PCN A;  1JWQ A;  1RXT A;  4FUU A;  3K9T A;  4B5P A;  4WJB A;  4MCS A;  3T07 A;  4KVX A;  4P4D A;  4BPW B;  5JGF A;  3SXO A;  3VAT A;  3KAS A;  2WUU A;  3LAC A;  2PJ3 A;  4OID A;  4B12 A;  2ZED A;  4YGO A;  2MP0 A;  4OC1 A;  2BUE A;  3LMS A;  2RB7 A;  2CXA A;  2JBJ A;  3PB7 X;  5AXI A;  4XPD B;  1Z5R A;  2B5G B;  4JD6 A;  4C8C A;  3DLJ A;  1AUG A;  3GUX A;  1CPS A;  2AFW A;  2GFQ A;  3EXN A;  4PXD A;  4PPZ A;  3R9E A;  5BWA B;  3DGV A;  1NXJ A;  2D0O A;  5IB9 A;  4RN7 A;  3PLF B;  2EZA A;  4C9E A;  2PJ4 A;  1CPX A;  1Y9W A;  2WPW A;  1YLE A;  3W6S A;  2G9D A;  3VRR A;  1WWZ A;  2ZEP A;  5F47 A;  4MCR A;  5LYD A;  2PE3 A;  3B2Y A;  5EMI A;  3KR4 A;  1QSM A;  1BPM A;  4NGM A;  2P6F A;  4CGN A;  2AUN A;  1LRZ A;  2B4B A;  4JJX A;  2EZC A;  4C8T A;  2Q7S A;  2I79 A;  3S6H A;  3DR6 A;  3TE4 A;  2WYR A;  1LAP A;  1XE4 A;  2JLM A;  3D66 A;  1ZL0 A;  1IB1 E;  1B47 A;  1JQG A;  3IWE A;  3KR5 A;  3IWW A;  3BUN B;  1MJB A;  2B58 A;  4FBE A;  4C9R A;  3IFE A;  2AFM A;  4PQA A;  4CGO A;  5IV0 A;  3VRP A;  2EUI A;  4XNH C;  1VI4 A;  1Y9Z A;  5F9M A;  2B4D B;  2V77 A;  1S60 A;  2R98 A;  1K4J A;  3GLJ A;  3NA6 A;  4KUB A;  5ISV A;  3NH4 A;  1X10 A;  1HDU A;  2PIY A;  4UIA A;  3B8G A;  1V6C A;  2VXK A;  4ZBG A;  2EO8 A;  4B13 A;  4M8D A;  4I49 A;  4A38 A;  3TO6 A;  2C6G A;  4K3N A;  4NGT A;  1VHS A;  5K8N A;  4CRY B;  2D4O A;  1AMP A;  1UWY A;  3A9L A;  4HNY B;  2PJ8 A;  1VKC A;  5DS0 A;  4BIN A;  4MJX A;  4CZ1 A;  4NGN A;  1GGO A;  5LRJ A;  1ZYM A;  5FD8 A;  4PV6 A;  4MI1 A;  3B7I A;  3JVN A;  1DE4 C;  3RZA A;  3FH4 A;  2OZG A;  2R82 A;  1TKH A;  2AUM A;  2V8H A;  2P6E A;  3RBU A;  2CF4 A;  2KCW A;  4OC4 A;  1Z2L A;  1FT7 A;  1S5K A;  1SQH A;  1ZG7 A;  3D7G A;  1R57 A;  3CDX A;  2BL1 A;  3GJZ A;  4J0N A;  2V8D A;  3P2F A;  1YRE A;  5KTC A;  3NFQ A;  2EBJ A;  2FIW A;  3PEI A;  3IC1 A;  4F8Z A;  5LYF A;  2PJA A;  4E94 A;  2Z10 A;  3BJ8 A;  3SJE A;  5AG4 A;  2PJB A;  4AXV A;  4BTF A;  1TF9 A;  1J3L A;  3TLZ A;  4HKF A;  3K9U A;  4P4B A;  4FD4 A;  3UY5 A;  4ZGY B;  3EIF A;  4NGQ A;  4EVY A;  2JBK A;  1P0H A;  4C9V A;  3P2H A;  2EK8 A;  2JDC A;  4B14 A;  1RTQ A;  3D8P A;  3RYO A;  1LCP A;  1A9X B;  1ELM P;  3SJG A;  1JDB C;  4KOY A;  3SJF A;  2FCK A;  1CP7 A;  2J9A A;  3MN8 A;  3VGO A;  4KVM E;  4MFZ A;  2WZN A;  4A37 A;  4C2Y A;  3QNV A;  2HUZ A;  1VHE A;  4C84 A;  2O53 A;  3OAK A;  2BOA A;  2Z0Z A;  3SI2 A;  1Z4R A;  5G20 A;  4B11 A;  3VWD A;  3G8W A;  4R57 A;  4R7M A;  3H8G A;  2ATR A;  3EO4 A;  2R7H A;  1M6V B;  1GYT A;  3JUW A;  4B6Z A;  4F6A A;  4R87 A;  2P6G A;  4INJ A;  1QMU A;  4UFW A;  2ZW7 A;  3DR8 A;  1Z9E A;  4UFV A;  2YNE A;  4CAE A;  4NJQ A;  4AVB A;  5JVL A;  2FE7 A;  2J8N A;  4NFR A;  1IU8 A;  1YVK A;  4P4E A;  1LAN A;  1Z4E A;  2GU2 A;  1VHO A;  2PQ8 A;  2VZY A;  5F13 A;  3KQZ A;  4BMH A;  8CPA A;  2XPP A;  2GLJ A;  3FYN A;  5THW A;  4C9A A;  2REF A;  2ZEL A;  4MY0 A;  4L8A A;  3HPH E;  2Q44 A;  4R8F A;  2PRB A;  3IWG A;  2IJZ A;  3TLE A;  3S6F A;  2PVW A;  4PXE A;  4Q38 A;  2ODF A;  1LAM A;  2Q0Y A;  3EC4 A;  5KTD A;  3FXT A;  1CBX A;  1MJ9 A;  2Z3N A;  5J8C A;  3GIU A;  3TLG A;  4NJR A;  2GLF A;  1M4I A;  1M4D A;  5HKW A;  3SJX A;  1UFH A;  2CNM A; 
#chains in the Genus database with same CATH homology
 4NGP A;  2PJC A;  3PB9 X;  4BD9 A;  4MHY A;  1PCA A;  2C1C A;  1BAV A;  1VIX A;  3D7H A;  2FVG A;  3D68 A;  2POK A;  3KHX A;  3WT4 A;  4EFD A;  2IQ6 A;  3B3T A;  3SI1 A;  3WC6 A;  1IGB A;  4F9V A;  2GRE A;  4KSI A;  3B3W A;  1F2P A;  5K8P A;  1Z8L A;  4OC3 A;  5HXD A;  2AFS A;  3NH5 A;  4KNG E;  1HDQ A;  2CIJ A;  1OBR A;  3B3C A;  4CPA A;  4F9U A;  2PJ5 A;  4H2K A;  4C8A A;  3PBB A;  4PXC A;  2QJ8 A;  2ZEH A;  1BLL E;  3I1U A;  3FVL A;  3BXM A;  4DUK A;  2NSM A;  4DJL A;  4UEE A;  3BHX A;  3PBE A;  2XEJ A;  1F57 A;  4Z65 A;  2AFZ A;  1XFO A;  3CPA A;  2VL1 A;  2PIZ A;  4X8I A;  2XEG A;  3IO1 A;  2DEA A;  4YU9 A;  2XEF A;  3PFE A;  5D29 A;  3LWU A;  2ZEE A;  1QQ9 A;  2Q51 A;  1XBU A;  1Y0Y A;  4ZY1 A;  5LRK A;  5HVF A;  4ZYQ A;  2PRQ A;  3KGQ A;  4OIW A;  2EWB A;  2CTB A;  4ZI6 A;  3TX8 A;  2QVP A;  1TKF A;  5JH9 A;  2I3C A;  1XJO A;  2C5Q A;  4CDJ A;  3ISZ A;  4OC5 A;  3H8E A;  4MCP A;  4TNU A;  3D7F A;  3TC8 A;  3V7Z A;  4OC0 A;  2ZEN A;  1DTD A;  2PCU A;  4EME A;  1Y7E A;  2BCO A;  2AFX A;  4MCQ A;  2ZEG A;  2ZEO A;  3VAR A;  4OC2 A;  5LYI A;  5D8N A;  3I6S A;  4NGS A;  5LYL A;  2PJ1 A;  4Q7A A;  1CP6 A;  4MMO A;  1YW6 A;  3S9M A;  3ISX A;  4JYW A;  2GP4 A;  3FEC A;  4IHM A;  3FED A;  4TJV A;  3BI1 A;  3KHZ A;  1FNO A;  4X2T A;  3FX6 A;  4ONW A;  5CPA A;  2C6P A;  3KZW A;  4UF4 A;  5J1Q A;  3KI9 A;  4OME A;  2ANP A;  2OOT A;  3SI0 A;  4JZ0 A;  2ZOF A;  4YN3 A;  3GB0 A;  2Q4Z A;  2RFH A;  2PJ6 A;  4PXB A;  1AYE A;  3D67 A;  1CX8 A;  5HVG A;  2PJ2 A;  2Q43 A;  4UEF A;  2PJ7 A;  1TF8 A;  1EE3 P;  3V38 A;  4IK2 A;  2OR4 A;  1ARM A;  1Y0R A;  3N5F A;  2ZEF A;  3WAB A;  4G1P A;  7CPA A;  3RAM A;  2F7V A;  4MXU A;  1CG2 A;  5K8M A;  1YSJ A;  4ZY2 A;  3IIB A;  1R43 A;  3PRT A;  4UIB A;  1NSA A;  2V8G A;  2JEW A;  4C8F A;  1LFW A;  1XF1 A;  3VTA A;  4C99 A;  3NH8 A;  2HB6 A;  5F09 A;  3D4U A;  3FMC A;  4MHZ A;  3D7D A;  3IJ3 A;  2ZEM A;  1ELL P;  2AFU A;  3CPX A;  4MHN A;  3FEE A;  1Q7L A;  4CDK A;  1BPN A;  3CT9 A;  5K8O A;  3B3V A;  3S9N A;  2ABZ A;  4IAV A;  1M4L A;  4GM5 A;  1F2O A;  1ZLI A;  3PFO A;  5ELY A;  3MRU A;  4R76 A;  4ZX8 A;  1YLO A;  4RUH A;  4YWY A;  4A94 A;  1WVM A;  4W9Y A;  1ZG8 A;  4OKO A;  1IY7 A;  1ARL A;  2O4H A;  1ZG9 A;  3JRU A;  3NFZ A;  1PYT B;  3I74 A;  4UEZ A;  1KWM A;  5LRG A;  4A39 A;  1YME A;  4EWT A;  2NYQ A;  2C6C A;  2AFO A;  3K2K A;  2PJ0 A;  2QYV A;  3PB4 X;  6CPA A;  4O23 A;  3B3S A;  5CBM A;  3IEH A;  2EK9 A;  4P4I A;  3ICU A;  1VGY A;  1XRY A;  4LQG A;  4C8U A;  2IMO A;  1TKJ A;  2BO9 A;  2PVV A;  3B35 A;  1TXR A;  1LOK A;  4OP4 A;  5HVH A;  2V8V A;  3WC5 A;  4P44 A;  3WC7 A;  3S9L A;  1R3N A;  5IR2 A;  4R6T A;  2ZOG A;  2PJ9 A;  5JM6 A;  3VH9 A;  4P45 A;  2XEI A;  4MRI A;  1YW4 A;  3H8F A;  4FWU A;  4C9U A;  3KQX A;  4WWV A;  1HEE A;  2CTC A;  4P10 A;  3PB6 X;  3HLP A;  4NGR A;  4P4J A;  4C85 A;  3HUV A;  4X3R A;  2F8H A;  2HC9 A;  1H8L A;  4DYO A;  1XMB A;  3FJU A;  3PB8 X;  3FF3 A;  4ZX9 A;  3KL9 A;  4C86 A;  3BI0 A;  3T8W A;  4MHP A;  4FAI A;  4TJX A;  4P4F A;  1ZLH A;  3L2N A;  4ZY0 A;  4TWE A;  4FUU A;  3K9T A;  4WJB A;  4MCS A;  4P4D A;  5JGF A;  3VAT A;  3KAS A;  4OID A;  2PJ3 A;  2ZED A;  4OC1 A;  3LMS A;  2RB7 A;  2JBJ A;  3PB7 X;  1Z5R A;  4C8C A;  3DLJ A;  3GUX A;  1CPS A;  2AFW A;  4PXD A;  4PPZ A;  3DGV A;  5IB9 A;  4C9E A;  2PJ4 A;  1CPX A;  2G9D A;  2ZEP A;  4MCR A;  5LYD A;  2PE3 A;  3B2Y A;  3KR4 A;  1BPM A;  4NGM A;  4C8T A;  2WYR A;  1LAP A;  3D66 A;  1JQG A;  3KR5 A;  4FBE A;  5I4M A;  3IWW A;  4C9R A;  3IFE A;  2AFM A;  4PQA A;  1Y9Z A;  2V77 A;  3GLJ A;  3NA6 A;  4C8P A;  3NH4 A;  2PIY A;  1HDU A;  4UIA A;  1V6C A;  4A38 A;  2C6G A;  4K3N A;  4NGT A;  5K8N A;  1AMP A;  1UWY A;  2PJ8 A;  5DS0 A;  4NGN A;  5LRJ A;  3B7I A;  1DE4 C;  3RZA A;  3FH4 A;  1TKH A;  2V8H A;  3RBU A;  2CF4 A;  4OC4 A;  1Z2L A;  1FT7 A;  1ZG7 A;  3CDX A;  3D7G A;  2V8D A;  4F8Z A;  5LYF A;  3PEI A;  3IC1 A;  2PJA A;  3SJE A;  2PJB A;  4AXV A;  1TF9 A;  4P4B A;  3EIF A;  4NGQ A;  2JBK A;  4C9V A;  2EK8 A;  1RTQ A;  1LCP A;  1ELM P;  3SJG A;  3SJF A;  1CP7 A;  2J9A A;  3MN8 A;  4A37 A;  4C84 A;  2WZN A;  3QNV A;  1VHE A;  2O53 A;  2BOA A;  3SI2 A;  4R7M A;  3H8G A;  1GYT A;  4B6Z A;  1QMU A;  4NJQ A;  4NFR A;  4P4E A;  1LAN A;  2GU2 A;  1VHO A;  3KQZ A;  8CPA A;  2GLJ A;  5THW A;  4C9A A;  2ZEL A;  4R8F A;  2IJZ A;  2PVW A;  4PXE A;  1LAM A;  1CBX A;  4NJR A;  2GLF A;  3SJX A;  4P6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...