2XEVA

Crystal structure of the tpr domain of xanthomonas campestris ybgf
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
121
structure length
121
Chain Sequence
RTAYNVAFDALKNGKYDDASQLFLSFLELYPNGVYTPNALYWLGESYYATRNFQLAEAQFRDLVSRYPTHDKAAGGLLKLGLSQYGEGKNTEAQQTLQQVATQYPGSDAARVAQERLQSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tola Modulates the Oligomeric Status of Ybgf in the Bacterial Periplasm.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Metal binding
molecule keywords YBGF
total genus 51
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xevA00
1B89A 4GA1A 4N2QA 4N2SA 1OUVA 2P58C 4BTBA 3LKUA 4RG9A 2I6HA 3RKVA 3QDNA 1TJCA 4RG6A 5G04C 4BTAA 2C2LA 1QZ2A 2HR2A 2WQHA 3N71A 4WNFA 1KT1A 3E4BA 5EX0A 5G05C 5JJTA 3ASGA 4UQZA 2VSYA 4IN3B 3PE3A 4GYWA 5JJ6A 5KJMA 1XNFA 4HOSA 2NC9A 3Q47B 3RJVA 3RO2A 3MKRA 3ZPJA 3QWPA 2YQ8A 4GYOA 4B94A 4NRHB 4EQFA 2Q7FA 3MV2B 4GZ5A 3TG4A 4O6FA 3GYZA 3U3WA 1E96B 2VSNA 2XGOA 1KT0A 3KS2A 4JA9A 4U0SA 5ARFA 3S7DA 2IFUA 3MEKA 4G1TA 4GZ6A 2V5FA 2KCKA 2LNIA 3UUXA 3AS5A 5ARGA 3SF4A 4N39A 4A1SA 1ELRA 4Y6WA 4N3AA 5FJYA 4ME2A 3ASHA 3CV0A 4KYOB 4AY6A 3URZA 4J8EA 3Q5MA 4W9RA 4CDRA 5CCLA 5DBKA 5KJNA 1A17A 2LSUA 3QKYA 3FFLA 3QWWA 2UY1A 1W3BA 4U07A 3CK9A 4BT8A 2UY1B 5LCWJ 1HZ4A 1FCHA 2IF4A 2MHKA 4N5CA 4WUYA 5FZSA 1ZU2A 2C0MA 2L6JA 5BNWA 1HXIA 2VGXB 4KXKB 2Y4UA 1ZBPA 4GCNA 4YVQC 4ABNA 3PDNA 4I1AA 3QWVA 4XI9A 4AM9A 4CGVA 2BUGA 1WM5A 5BT1A 3KAEA 4GA2A 1KLXA 4XI0A 2QFCA 3WXXA 3CVPA 4G23A 3S7JA 4NQ0A 3S7FA 4HOTA 1ELWA 2VGXA 4U04A 4F3VA 2Y4TA 4GPKA 3RO3A 4I9EA 2PQNA 4J8DA 2VQ2A 2PQRA 2XPIA 3MV3B 1NA3A 3OXFA 3VTXA 4APOA 2FF4A 5HQ8A 5FT9A 4G26A 4UQYA 5CHEE 4BT9A 5EX3A 3TG5A 3ULQA 4UI9C 3Q15A 3UPVA 3QOUA 3LPZA 2XCCA 2VYIA 4G2VA 2HYZA 4UI9J 5D0OD 3Q4AB 4G25A 2PZIA 3OXLA 3NF1A 3SZ7A 3U4TA 3VTYA 2KC7A 3UQ3A 3O48A 4JL0A 1WAO1 2FI7A 2XCBA 3ZN3A 4U0ZA 1PC2A 4WNGA 3GZ2A 3MA5A 3ZHEB 5DIZA 3PE4A 2XGMA 1NZNA 3ESKA 5BW8C 2R5SA 3CVNA 4J8FA 1IYGA 5LCWC 3ASDA 4GCOA 1NA0A 3TAXA 3CVQA 3EDTB 4YVOA 4AY5A 1QQEA 3JYSA 4HORA 1P5QA 4LEUA 3LY8A 4GYYA 4JA7A 4I17A 2YHCA 4N3CA 3AS4A 5JJ7A 3LY7A 5G04J 4Y6CA 4J0UA 4CGWA 4AIFA 1IHGA 2WPVA 2FO7A 2PL2A 2JLBA 3CVLA 4UI9K 2KCLA 3AS8A 3ASFA 3HYMB 2OOEA 4XIFA 4YNDA 4GA0A 3IEGA 3ZGQA 5KJKA 4HOUA 3K9IA 4UQXA 3FWVA 4G24A 3CK7A 4WNDA 5EKQD 2C0LA 5HI7A 5M72A 3CKBA 3OXGA 3BEEA 3FP3A 5A6CA 3CKCA 2HO1A 3S7BA 2ONDA 2GW1A 2DBAA 4HOQA 5A7DB 3RIBA 2E2EA 4I2WA 4JHRA 3ZFWA 3TGOA 1YA0A 3RU0A 5KJLA 5FZRA 3GW4A 3ZHEA 2XGSA 2VGYA 4WNEA 3CK8A 3LYAA 4H7YA 4GZ3A 3LY9A 3R9AB 1HH8A 5G05J 4I2ZA 5FTPA 3CEQA 2AVPA 2KCVA 3LCAA 3GZ1A 3Q49B 2FEZA 1Y8MA 2J9QA 2KATA 4N3BA 2LSVA 4U0UA 5FZQA 5AYWD 2UWJG 5C1DA 3KD7A 5D0QD 4BWRA 4H7XA 4I9CA 2FBNA 4KBQA 2XEVA 5CCMA
chains in the Genus database with same CATH superfamily
3RRMB 5HKPA 3U66A 2HR2A 3ASGA 2R17C 4OAUC 3L82A 4O6FA 1N54A 2XGOA 1MHQA 3QC1A 3V31A 4AP2A 3Q78A 4ME2A 3F6QA 4UWKA 4IYPA 2LSUA 4PS7A 5CEDB 4AXHA 5AJDA 2V4LA 3QWVA 4F7AA 2XQ0A 4DUIA 5CHEE 4AV7A 4ANWA 1H6OA 4G2VA 3ZEFA 3QJZA 2R05A 2IOSA 3O48A 2Y1LE 5E76A 2R03A 4U95D 2R5SA 3PEUB 4HLLA 1QQEA 4ATZD 4K0RA 4I17A 4WWNA 3CHPA 5BPPA 3BG0B 4ILIA 2WQ7A 3PRZA 1O5MA 4KVOA 3HIZA 1PY1A 4I2WA 3X2QE 1DC2A 3RRUA 3E33A 1OCRE 4GB9A 4A63B 1V55E 3LCAA 4N3AA 3MYVA 4E85A 4BETA 3I5PA 4I6GA 4XEIG 4KBQA 2JEKA 4RG6A 3N71A 4GZDA 5ENSD 2VSYA 2ZGGA 4JZYA 2EINE 4BEPA 1E96B 1KT0A 4JXTA 1MZCA 2OEWA 3PZDA 3CR3A 4RVBA 3V79K 4W9RA 3SD5A 2ETAA 1A17A 1SW6A 2UY1A 3EIJA 5EYPF 3C5RA 1A5EA 5EYLA 2AXVA 2XPZA 4MBGA 3KEAA 1S0PA 4UWLA 1KLXA 4F1PA 3CVVA 2PQNA 2GRRB 1HE8A 5FT9A 4CEMA 3Q73A 4G26A 4BT9A 4UI9C 3QOUA 2XCCA 1FVFA 1X5BA 2I9CA 4WWOA 4B8AA 3GZ2A 3MA5A 1Q2ZA 1JCRA 2X6JA 3BQOA 4FULA 3LJ3A 3IHYA 3CVXA 3C3OA 4UI9K 2KCLA 1HFAA 3CVYA 2AXUA 5AQBA 2IU1A 4G24A 3BG1B 3BEEA 5JJ7A 3CKCA 4DX7D 2X6KA 3FH5A 3ABME 3G2TA 3CVUA 2WM9A 2XGSA 3FUMA 1TN8A 2UWJG 3FTVA 4BTBA 2IQCA 3RKVA 3D9IA 4A3VA 4UWFA 4KMOA 3P2BA 3MKRA 4GYOA 4EHMA 5LP0A 3SFXA 1L5JA 4XKCA 1IQRA 3UUXA 1X81A 3AS5A 3SF4A 3W9GA 1VDYA 3AU5A 1SA5A 3QB2A 1QBQA 1W3BA 4KT6B 4U07A 5ANRA 3HXBA 2IF4A 3T8MA 4KXKB 2Y4UA 5BT1A 3WXXA 1RW2A 3S7JA 3OAWA 2BKKB 1BI8B 3Q9UC 4BY6A 3EU9A 3VTXA 3DXKG 5J90A 2WXLA 3AU4A 3FUHA 3CSFA 1JUQA 3O4ZA 2XRYA 4U8HA 3LJNA 2OEVA 3ZYLA 2J49A 4YVOA 3NOCD 5ENNA 3LY7A 3ZVVA 3D9KA 1LD8A 2WPVA 2WXRA 2WXHA 3CQGB 3NZUA 2XS8A 2C0LA 2XEHA 3D9MA 5A7DB 4YDEA 4C48B 1TR4A 4I2ZA 3I3NA 2J9QA 2AWIA 1TNOA 4I1MA 4I9CA 4I1OB 4GA1A 3UMVA 2V8SE 1H6KA 4EZKA 1BD8A 1KT1A 2F8YA 4HLEA 2DYSE 4E6HA 4B94A 3DXMG 4U0SA 3V2OA 2KCKA 2ETBA 2H6IA 1E7VA 1HO8A 3ASHA 5BV0A 3RSEG 4I6EA 4DPRA 4BT8A 2UY1B 4B8CB 3AG2E 5BNWA 3CQCB 3DBSA 4ILGA 2I1JA 4MLPA 4UUCA 2B0OE 2A5UA 4F3VA 2M63A 1N0RA 1NI1A 4HRMB 5FQ6A 5D0OD 2VGEA 3HXCA 1O1TA 1PC2A 5BW8C 2P9IG 4WAFA 4AY5A 5ENQD 3AS4A 3MZLB 4J7WA 4GTPA 2JLBA 1SZAA 1OCZE 3UT7A 4GPMA 5JA4D 3RRNB 3DSUA 5CBOA 2AW6A 3UM3A 1YA0A 5J08A 1FVHA 3HXDA 3AG1E 3PUJA 3LVQE 1HG2A 3GZ1A 3C3QA 5B1AE 3KEZA 4HI8A 5CMWA 4L2LA 2P58C 5T4YA 3LKUA 1N4SA 3I4GA 4L2YA 3I4RB 2IJGX 4CZ2D 4OVUA 5JJ6A 4XX5A 3G2VA 3HG0D 1IKND 3B7UX 3ZYKA 4CRWA 3MEKA 3SI5A 2KZTB 3D9PA 3Q5MA 3TWWA 4KZCA 2DZNA 3U9WA 4GZCA 2BEDA 3ZIMA 2QZAA 2CFUA 3L9TA 4F6RD 1HS6A 2IOLA 4U04A 1NA3A 3D9NA 4UQYA 5FIOA 2LO6A 2R59A 2EIKE 2P9PG 1H19A 3TJPA 2R2LA 2P9UG 3CLJA 3ZRHA 3DSTA 4NIKA 2VTBA 4NACA 3FDHA 2F0YA 2H6HA 3AAAC 3ZKJA 4OVVA 4YNDA 3PH0C 4LG6A 3LVRE 4HOQA 3RIBA 3TWQA 4WWPA 2QYJA 3SGHA 3UKRG 3CK8A 1INZA 1S64A 1HH8A 2J07A 4R7LA 2DZOA 2ETCA 2RFAA 3C3RA 1OWLA 2PNNA 2XEVA 3TL5A 1OCCE 3ZXSA 3QDNA 4JVSA 4KZ0A 4XZ4A 4N5QA 5JJTA 5KJMA 3C98A 2V5QC 4HOSA 2NC9A 4GTRA 2IO3C 2YINA 2X6HA 1NP7A 2KZTA 3PZ3A 5BXOA 3TWSA 2WXQA 1OT8A 3QWWA 2MRIA 3U3WA 2A5EA 4GCNA 5AN8A 3RK6A 2A4ZA 1TNUA 3Q7AA 4EPZA 1EF1C 3ZU7B 3Q15A 5AQ7A 5D66A 3SBTB 2IONA 4G25A 4JB8P 2FI7A 3PE4A 3VLEA 4RSYA 3V2XA 5BXUA 2BF0X 5FQ4A 3NOGD 3R9MA 4J0UA 1H2UA 1D8EA 1UG3A 2DIWA 4HRLA 4L23A 2VJ8A 3ZGQA 2YNQA 3CK7A 2XHEA 1SQMA 3S7BA 2GW1A 4JW1A 4BFRA 1WDYA 3Q75A 2WXKA 3FY4A 2PM6A 3CEQA 3DSSA 4N3BA 1B89A 1RZ4A 3B13A 4U63A 3E32A 5B3SE 1TJCA 3FUJA 5EX0A 5G05C 1E8WA 4NRHB 4HFGA 2X6FA 4I6JA 3T5XA 2VSNA 2J8SD 2RD0A 4C9BB 3ZNGA 3EHRA 3L16A 2X6IA 1JWFA 3FUEA 4AVXA 2MHKA 5AENA 3J5PA 2X38A 4APFA 3UIPC 1LF8A 2VGXA 2GRNB 3HDXA 4GPKA 3RO3A 4J8DA 2PQRA 3MV3B 3TWRA 1FPPA 3DPDA 2GRQB 4DX5D 5ENOD 3VTYA 3TWTA 3ZUVB 2JABA 3NQPA 2OCCE 1K1BA 4GTQA 3EDTB 3JYSA 2B6CA 1P5QA 2IO2C 4TXPA 5AQAA 3CVWA 1H2VC 4O1OA 2P9NG 4AOFA 3AS8A 5G2NA 2QY7A 3IHVA 3LDZA 4UQXA 2WXFA 5EKQD 1IYGA 2ONDA 3ZFWA 3FUFA 3MCXA 3HVEB 1MX2A 4EZLA 3DEPA 1OWOA 1KPSB 2AVPA 3Q49B 2KATA 1Y8MA 4U0UA 4MKTA 4OAVB 2BTDA 4LSZE 4ATGA 4N2QA 1OUVA 5C2YA 2WMNA 1K1AA 3SY2A 1QZ2A 3SO8A 4TRQA 4JHJA 3B7SA 3PE3A 3ZPJA 3QWPA 4GMLA 3S2AA 2DCPA 3FUDA 2IFUA 2WXOA 5EIBE 3B7BA 2H6GA 4Y6WA 4KYOB 4K03A 1TNBA 5DBKA 1Z3YA 3QKYA 1HZ4A 3FTYA 4G8LA 4YVQC 4ABNA 4DX2A 1AP7A 4DI4A 2QFCA 3CVPA 4G23A 4FADA 2NYJA 1FT1A 4ZFHA 3TG5A 2RG8A 1TEZA 2VYIA 5T3RA 1TNZA 4RQIA 3R7RA 3ZYMA 1AWCB 3TXNA 3PNTB 1EDUA 4GTTA 4PS3A 1NZNA 2RKKA 3G2WA 3JUIA 3PS6A 2FO7A 3Q79A 2WVIA 2KXPC 3ASOE 4LERA 4HBDA 2J4BA 1TJFA 4ACLA 4HVBA 3QAQA 4WNEA 3HXEA 2P9KG 3PZ2A 3PVLA 4TV3A 4DJAA 5EIDA 4BTAA 3UT8A 4D10C 2KM4A 1XGWA 3HHMA 3CGHA 3Q47B 3MV2B 4GZ5A 3J5QB 5ARFA 1O1RA 1N4QA 3BU8A 5FJYA 1TN6A 2X3MA 3APDA 3FFLA 1U3CA 2WQ6A 5CERB 3S7FA 3ZXPA 1ELWA 2WXMA 3SNXA 2Y4TA 2LUHA 1LD7A 1Z5SC 1MYOA 4XKBA 1BLXB 5KNHD 3SZ7A 2LXMA 4K5CA 2E0IA 4V3IA 4U7EB 5KCMA 2V0PA 5FINA 4CGWA 4AIFA 4J8YA 3LXUX 1UN9A 5ENRD 3D9JA 3P1UA 2MYOA 5KJLA 2Y0BG 3LYAA 4H7YA 3DSXA 3R9AB 5G05J 4F53A 2WMOA 2XZTG 2FBNA 2L9BA 2IEJA 2P9LG 3FH7A 4RG9A 2LAHA 2ZISA 2C2LA 4PUCA 3WG7E 3RJVA 3CIAA 2FULA 4DI3A 5KWDA 3L17A 3ONKA 2LNIA 2F37A 4J6IA 5FQ7A 3CV0A 4TXQA 3L13A 3UM1A 4CDRA 1HU3A 3Q9NC 3ULEG 5E75A 4M3OA 4LNBA 3T9KA 3L22A 4XI9A 4UWGA 3T5VA 4BX8A 4GA2A 3CHMA 3PREA 3JQ1A 2H6FA 3JXIA 4Q94A 4PH4B 2L0TB 3ISMC 2ZXWE 3NF1A 4JL0A 5CBNA 4P29A 3AJIA 5LCWC 2AXZA 4Z68A 1UJJA 2I1KA 2CHXA 4A3TA 5FQ8A 3HYMB 3IEGA 1UN8A 2J08A 1IXVA 3SFYA 2WXNA 1YMPA 2ZGDA 4LCTA 3DSVA 1EPUA 2DBAA 2XPYA 4JHRA 2YHEA 1WY6A 3SFZA 4URKA 2VGYA 4MRUA 4B93B 4FP7A 1D8DA 5FTPA 5EN5D 5ENTD 4ACKA 4FLBA 2GROB 2Y69E 3EUVA 4FA6A 5CEAA 4N2SA 4GTVA 3HRAA 3FU5A 3MKQB 3W9FA 5G04C 2L6BA 2WQHA 3EHNA 3LEWA 4HI9A 4BX9A 3IXEA 5KNGA 3TG4A 3IV0A 2WXIA 3GYZA 4Q96A 3IBEA 1SZ9A 1MX6A 4N39A 4AEZC 1N0QA 4HXIA 4O60A 1JPLA 3ULYA 5KJNA 3CK9A 2CHWA 2VGXB 3TWXA 1U2VG 3UTMA 3T8KA 3JQ0A 2OV8A 5EILA 4U96D 4CCAA 3KSQA 4A55A 5AAOA 4G8KA 1TNYA 3EIQC 3U64A 3D9HA 2HYZA 1EYHA 4UI9J 2VSXE 2XCBA 1QYMA 3FULA 3ZHEB 5AJLA 2XGMA 4M7CA 3MGBA 1N95A 5JMND 4K5AB 3DWLG 4JA7A 3ZW3A 2YHCA 2CFZA 5CRUA 5KJKA 2R02A 1HF8A 3D9LA 3FWVA 4A1GA 3UPVA 4QQIA 3TGOA 4L9PA 4GZ3A 3FHEA 2V4HC 4JD2G 2FEZA 3B95A 5KBAA 3KD7A 1N9AA 4FJYA 4EZJA 3APFA 5JHAA 5CECB 3PZ1A 1Z3XA 5ITZF 2CG2A 3D3MA 4X8QA 4TXRA 4G1TA 1NL4A 4GZ6A 3L54A 2WXGA 4LRZA 4J8EA 5CCLA 2RFMA 2LXLA 1UW4B 2HE0A 1D9SA 4WUYA 4N5CA 2L6JA 1GW6A 1N4RA 4AM9A 3PDNA 4ZHBA 1WM5A 2VSOE 1SVXA 4GTMA 3ASNE 1IHBA 4I43A 5CRVA 5LFAA 4U8VD 4JEHA 1U3DA 1JWGA 2OVFA 1N94A 1OWPA 1KZOA 2OVBA 3TXMA 3FEXA 5ENPD 1DVPA 2HM8A 3JUEA 4Q69A 3CSTA 4U0ZA 5DIZA 4CT0A 1V54E 3ASDA 1JCQA 1NA0A 2GRMA 3FEYA 1MQSA 4DLQA 4YDOA 2OOEA 4XIFA 3UINC 5A6CA 3PUKA 3EHMA 4DLOA 3APCA 4J8SA 3UX4A 4HRNA 2KCVA 2LSVA 4CDNA 1H2TC 3UM0A 3Q7FA 2WXJA 3KSLA 2WXPA 2I6HA 2VTBB 4WNFA 5A23A 4GYWA 1WG0A 3ABKE 4HB5A 1XNFA 4B0ZA 3QK0A 3OTNA 5ANLA 4GMRA 1TYQG 4HQDA 3KS2A 3S7DA 3SBSA 3VLFA 2V5FA 5ARGA 3UKUG 2XEEA 1E90A 3EU5A 3URZA 2BKGA 5EDSA 1ZU2A 2C0MA 3KAEA 2EIJE 3FTSA 2GRLA 2XPIA 3OXFA 3ZYQA 4LNGA 3JXJA 5EX3A 3EJNA 4YDWA 3R7QA 1OCOE 1K3ZD 5JHBA 2J09A 3Q4AB 1H6PA 3TWVA 1N4PA 5HS0A 3UQ3A 1MJ0A 3FU3A 3B7RL 3RAUA 4JC8A 3ESKA 3CVNA 4IULA 4LEUA 3CHQA 3CHSA 3FTWA 2PL2A 3ML9A 1BU9A 4RLYA 1G3NB 4PS8A 4HOUA 5LX8A 4L1BA 3JCKC 1KZPA 2E2EA 3BUAA 3E34A 4C0EA 2NSZA 4FHJA 3LY9A 3GZSA 1BPOA 3EHQA 3U4TA 3NAWA 2KBXA 5FZQA 1UJKA 2QC9A 3FP3A 3MX3A 3ABLE 2GGFA 1OWMA 3L6AA 4BSXA 5FWQA 1BI7B 3ONLA 4HNAD 4JPSA 3PNLB 2XRZA 1MX4A 3CHRA 4FJZA 2CHZA 3NB2A 1FCHA 5FZSA 1HXIA 3E37A 4CGVA 3ML8A 3V30A 4F1SA 4XI0A 4B89A 4NQ0A 4HOTA 4DX6D 1E7UA 2VQ2A 3VLDA 4ILHB 5HQ8A 2AJAA 3LS8A 2J4DA 3FTUA 1DNPA 1H0AA 3UIOC 1N11A 5BV1A 4ANVA 3ZN3A 4DK5A 4TUMA 3TAXA 4GU5A 5H7PA 1S70B 4CYMD 3NZSA 1N52A 4CT4A 4Y6CA 1TN7A 3HVEA 1IHGA 3CVLA 4WNDA 1Z6TA 3G2UA 3CKBA 4UWHA 3DSWA 4FHKA 2ZIRA 4GAAA 5C1DA 5HRYA 4H7XA 3NBNB 4L7TA 4GTSA 3TWUA 1YCSB 3FTXA 3UM2A 1IQUA 4UQZA 3PEVB 2YQ8A 5BUZA 2WB2A 1ELKA 4JA9A 4A1SA 1LTXA 4GMJA 4ANXA 2ILRA 4XE0A 3D9OA 1Y6IA 1UOHA 3UXGA 3CHOA 5LCWJ 5AARA 1O1SA 1HG5A 4K5BA 1ZBPA 3QARA 4BERA 2EILE 4I1AA 2FO1E 3L08A 4JEUA 4OYSA 4I9EA 4EQFA 4APOA 2FF4A 3FTZA 3FUNA 5CMYA 3LPZA 3ESLA 4IRUA 5LOZA 4O1PA 4FC8A 2PZIA 2DVWA 3OXLA 2KC7A 2EQXA 4WNGA 4ANUA 4DX1A 3AG4E 3CVQA 4AJWA 5AQ9A 4LNUD 4N3CA 2Y3AA 3FU0A 5G04J 1E8ZA 3UT4A 2P9SG 1E8XA 3ASFA 5AIJA 1YYHA 3G2SA 4GA0A 4U8YD 3MJWA 1OWNA 3K9IA 3DEOA 5M72A 1ZB1A 3OXGA 1S63A 2HO1A 3DPYA 2XENA 5FZRA 3IKOB 3GW4A 4JHKA 3ZHEA 2XZDG 4G11A 4HORA 2EIME 1HX8A 4MS6A 3DRAA 1QNFA 4EBAA 4GTOA 3AG3E 3UI2A 1OXJA 3E4BA 4IN3B 3RO2A 2Q7FA 4NURA 2NXPA 2ZU6B 1ELRA 4AY6A 3SHFA 4TUUA 4YDYA 5D2MC 2QYUA 2I2OA 2BUGA 2L0IA 5B1BE 2P2CP 2CG3A 1OY3D 4KVMA 3FH8A 1FT2A 3MKQA 5T8IA 3QNKA 3ULQA 1E8YA 4BESA 4C0MA 4EBAG 1K8KG 3E30A 1WAO1 5G55A 2GRPB 4J8FA 2PM7A 4GCOA 5IY5E 1DCQA 1JCSA 2DYRE 3B7TA 3LY8A 4GYYA 4FLHA 1NFIE 4BSZB 4QFVA 2DWZA 3FUKA 1PAQA 3PZ4A 3FUIA 4LUNU 3SQVA 2XS1A 5HI7A 3FU6A 2F8XK 4HS2A 1DCEA 4FU3A 4PDXA 3RU0A 4CDMA 2IY0C 1SA4A 3ENEA 4EECA 3HXFA 5AYWD 2MOWA 3C72A 5D0QD 2LAIA 4BWRA 4DRXE 5CCMA
chains in the Genus database with same CATH topology
4L2LA 2P58C 3PVLA 5T4YA 4TV3A 2WXPA 3RRMB 3LKUA 4DJAA 2I6HA 3U66A 3I4GA 4L2YA 3I4RB 2HR2A 2KM4A 4WNFA 3UT8A 4BTAA 4D10C 1XGWA 5A23A 2VTBB 2IJGX 3ASGA 3CGHA 3HHMA 4OVUA 4GYWA 5JJ6A 4XX5A 1XNFA 4B0ZA 3QK0A 3Q47B 2R17C 3OTNA 5ANLA 3G2VA 3MV2B 3B7UX 4GZ5A 4O6FA 1N54A 2XGOA 3KS2A 1MHQA 3QC1A 5ARFA 3S7DA 3SBSA 3ZYKA 3MEKA 4CRWA 3VLFA 2V5FA 5ARGA 4AP2A 5FJYA 4ME2A 3SI5A 1E90A 2X3MA 3URZA 2KZTB 3D9PA 3Q5MA 5EDSA 4KZCA 4UWKA 4IYPA 2LSUA 3APDA 3FFLA 1U3CA 4PS7A 3U9WA 4GZCA 1ZU2A 2C0MA 3ZIMA 2CFUA 4AXHA 2WQ6A 5AJDA 2V4LA 3QWVA 1HS6A 3KAEA 3S7FA 4F7AA 1ELWA 2WXMA 3FTSA 2IOLA 3SNXA 4U04A 2Y4TA 2XQ0A 2GRLA 2XPIA 3OXFA 1NA3A 3ZYQA 3D9NA 4UQYA 5CHEE 4AV7A 2LO6A 5EX3A 4ANWA 3EJNA 2R59A 4G2VA 4XKBA 3R7QA 1H19A 5JHBA 2J09A 3TJPA 3Q4AB 3ZEFA 3QJZA 2IOSA 3SZ7A 3UQ3A 3O48A 5E76A 3FU3A 3B7RL 4AM9A 4JC8A 3CLJA 3ESKA 2E0IA 2R5SA 3CVNA 3PEUB 4V3IA 4IULA 3ZRHA 1QQEA 4LEUA 2VTBA 4K0RA 5KCMA 3CHQA 3CHSA 4I17A 3FTWA 4NACA 4WWNA 3CHPA 3FDHA 2V0PA 5BPPA 4CGWA 4AIFA 3BG0B 4ILIA 2PL2A 3ML9A 4OVVA 4YNDA 3LXUX 4PS8A 3PH0C 2WQ7A 3PRZA 4HOUA 1UN9A 3LVRE 5LX8A 4L1BA 3JCKC 3D9JA 4HOQA 3HIZA 1PY1A 4KVOA 3RIBA 2E2EA 3P1UA 4I2WA 4C0EA 5KJLA 2NSZA 4WWPA 3SGHA 3CK8A 3LYAA 4H7YA 4FHJA 3RRUA 3LY9A 1INZA 3GZSA 4GB9A 1HH8A 2J07A 4R7LA 1BPOA 3R9AB 5G05J 3U4TA 4F53A 3LCAA 4N3AA 2WMOA 3MYVA 4E85A 5FZQA 1UJKA 1OWLA 3I5PA 4I6GA 2FBNA 3FP3A 4KBQA 2XEVA 2L9BA 2JEKA 3TL5A 3FH7A 3MX3A 2LAHA 4RG9A 3ZXSA 3QDNA 4JVSA 2GGFA 4RG6A 1OWMA 4KZ0A 3L6AA 2C2LA 3N71A 4PUCA 4GZDA 4BSXA 5FWQA 4XZ4A 5JJTA 5KJMA 2VSYA 3C98A 3ONLA 5CMWA 4JZYA 4HOSA 2NC9A 3RJVA 3CIAA 2FULA 4DI3A 3L17A 1E96B 3ONKA 1KT0A 4JXTA 3PNLB 4JPSA 3PZDA 2LNIA 3CR3A 4RVBA 2YINA 2X6HA 2XRZA 1NP7A 4J6IA 5FQ7A 3CHRA 3CV0A 4FJZA 3L13A 2KZTA 2CHZA 4W9RA 4CDRA 3SD5A 2WXQA 1HU3A 1A17A 3QWWA 2MRIA 2UY1A 3U3WA 3EIJA 5E75A 1FCHA 5FZSA 4M3OA 1HXIA 3L22A 4GCNA 2AXVA 4XI9A 4UWGA 3RK6A 2XPZA 3ML8A 4BX8A 4CGVA 3T5VA 1S0PA 4GA2A 4UWLA 1KLXA 4XI0A 2A4ZA 4F1SA 3CHMA 4B89A 4NQ0A 3PREA 4HOTA 3JQ1A 3CVVA 4EPZA 2PQNA 1E7UA 2VQ2A 4Q94A 3VLDA 4ILHB 5HQ8A 1EF1C 1HE8A 5FT9A 4CEMA 4G26A 4PH4B 4BT9A 4UI9C 2L0TB 3Q15A 3QOUA 2XCCA 3LS8A 3SBTB 1FVFA 2IONA 2J4DA 3FTUA 1DNPA 1H0AA 1X5BA 4G25A 2I9CA 3NF1A 5BV1A 4ANVA 4JL0A 2FI7A 3ZN3A 4WWOA 4P29A 4B8AA 3GZ2A 3MA5A 2X6JA 3PE4A 3VLEA 4DK5A 4FULA 4RSYA 5LCWC 3LJ3A 3TAXA 2BF0X 2AXZA 4GU5A 5FQ4A 1UJJA 3IHYA 3CVXA 3NZSA 1N52A 2I1KA 2CHXA 4Y6CA 4J0UA 1H2UA 1UG3A 2DIWA 3HVEA 1IHGA 5FQ8A 4A3TA 4CT4A 4UI9K 3CVLA 2KCLA 1HFAA 3HYMB 4L23A 2VJ8A 3IEGA 3ZGQA 2AXUA 2YNQA 1UN8A 2J08A 3CVYA 2IU1A 4G24A 4WNDA 3CK7A 1Z6TA 2XHEA 2WXNA 3BG1B 3CKBA 3G2UA 3BEEA 4LCTA 1SQMA 3CKCA 5JJ7A 3S7BA 1EPUA 2DBAA 2GW1A 2XPYA 4UWHA 4JW1A 4JHRA 2X6KA 2YHEA 3FH5A 3G2TA 4BFRA 3CVUA 1WY6A 2WM9A 3SFZA 4URKA 2XGSA 2VGYA 4MRUA 4FP7A 2WXKA 3FY4A 4FHKA 3FUMA 2PM6A 4GAAA 3CEQA 5FTPA 4ACKA 4N3BA 4FLBA 2UWJG 5C1DA 4H7XA 3FTVA 4FA6A 1B89A 4N2SA 3B13A 4U63A 4L7TA 3FU5A 2IQCA 4BTBA 3MKQB 3RKVA 3D9IA 4A3VA 1TJCA 4UWFA 3FTXA 5G04C 4KMOA 2WQHA 3EHNA 3P2BA 3LEWA 3FUJA 5EX0A 5G05C 4BX9A 1IQUA 4UQZA 3PEVB 1E8WA 3MKRA 2YQ8A 4GYOA 5BUZA 4NRHB 4HFGA 5LP0A 3TG4A 3IV0A 2WXIA 2WB2A 2X6FA 3GYZA 4I6JA 1ELKA 1L5JA 2VSNA 4JA9A 4Q96A 3T5XA 2RD0A 3IBEA 4C9BB 1SZ9A 4XKCA 1IQRA 3UUXA 4A1SA 3AS5A 3SF4A 4N39A 4GMJA 4ANXA 4AEZC 2ILRA 4XE0A 3D9OA 1VDYA 1Y6IA 3AU5A 3L16A 4HXIA 2X6IA 3QB2A 3CHOA 1JPLA 5KJNA 1JWFA 1W3BA 4KT6B 3CK9A 4U07A 3FUEA 5ANRA 2IF4A 4AVXA 5LCWJ 2MHKA 5AENA 2CHWA 3T8MA 1HG5A 4KXKB 2VGXB 2Y4UA 1ZBPA 2X38A 3QARA 4I1AA 5BT1A 4APFA 3L08A 3WXXA 3S7JA 3JQ0A 3OAWA 1LF8A 2OV8A 2VGXA 4BY6A 3HDXA 4JEUA 4OYSA 4GPKA 3RO3A 4I9EA 4A55A 4J8DA 2PQRA 3MV3B 4CCAA 3VTXA 4EQFA 4APOA 2FF4A 3FTZA 5J90A 3FUNA 2WXLA 3DPDA 3AU4A 3FUHA 3EIQC 3U64A 5CMYA 3LPZA 3ESLA 3CSFA 4IRUA 2HYZA 1EYHA 1JUQA 4UI9J 5LOZA 3O4ZA 4FC8A 2PZIA 2XRYA 3OXLA 4U8HA 3VTYA 2KC7A 2VSXE 2XCBA 2EQXA 4WNGA 3FULA 3ZHEB 5AJLA 2XGMA 3NQPA 4ANUA 3MGBA 3ZYLA 2J49A 3CVQA 3EDTB 4YVOA 4AJWA 3JYSA 1P5QA 5ENNA 4JA7A 3ZW3A 2YHCA 2Y3AA 4N3CA 3LY7A 3FU0A 3ZVVA 3D9KA 5G04J 1E8ZA 3CVWA 1H2VC 2WPVA 3UT4A 4AOFA 2CFZA 3AS8A 5G2NA 1E8XA 2QY7A 3ASFA 3IHVA 2WXRA 3G2SA 4GA0A 5AIJA 5KJKA 3MJWA 2WXHA 1OWNA 3LDZA 3K9IA 1HF8A 3D9LA 3CQGB 3FWVA 3NZUA 2WXFA 2C0LA 4UQXA 5EKQD 4A1GA 5M72A 3OXGA 1IYGA 3UPVA 2HO1A 3D9MA 2ONDA 5A7DB 3FUFA 3MCXA 3ZFWA 3TGOA 3HVEB 4EZLA 5FZRA 3IKOB 3GW4A 4JHKA 3ZHEA 4GZ3A 3FHEA 4G11A 1OWOA 4I2ZA 3I3NA 2AVPA 3Q49B 4HORA 2FEZA 1HX8A 1Y8MA 2J9QA 2KATA 2AWIA 4U0UA 4MKTA 3KD7A 4I1MA 4MS6A 2BTDA 4I9CA 4I1OB 4ATGA 4GA1A 4FJYA 1QNFA 3UMVA 4N2QA 1OUVA 4EBAA 3APFA 4EZJA 2V8SE 5JHAA 5C2YA 2WMNA 1H6KA 4EZKA 1QZ2A 1KT1A 1Z3XA 3E4BA 4TRQA 4IN3B 4JHJA 3B7SA 3PE3A 4HLEA 3RO2A 3ZPJA 4E6HA 3QWPA 2CG2A 4GMLA 4B94A 3S2AA 2Q7FA 3D3MA 2DCPA 4NURA 3FUDA 4U0SA 2IFUA 2WXOA 4G1TA 4GZ6A 2KCKA 3L54A 2NXPA 2ZU6B 1ELRA 4Y6WA 1E7VA 1HO8A 2WXGA 3ASHA 4KYOB 5BV0A 4K03A 4AY6A 4LRZA 4J8EA 5CCLA 5DBKA 4I6EA 1Z3YA 3QKYA 4TUUA 3SHFA 1UW4B 4DPRA 4BT8A 2UY1B 1HZ4A 4WUYA 4N5CA 2L6JA 3FTYA 4B8CB 1GW6A 5BNWA 4YVQC 4ABNA 2I2OA 3CQCB 3DBSA 3PDNA 2I1JA 4ILGA 2BUGA 1WM5A 4MLPA 4DI4A 2L0IA 2QFCA 2CG3A 2VSOE 3CVPA 4G23A 4KVMA 3FH8A 2A5UA 4FADA 4I43A 4F3VA 2M63A 5LFAA 4JEHA 3MKQA 5T8IA 1U3DA 1JWGA 2OVFA 3QNKA 3TG5A 3ULQA 2RG8A 1TEZA 1E8YA 1OWPA 3TXMA 2OVBA 2VYIA 3FEXA 5FQ6A 4C0MA 5D0OD 1DVPA 2HM8A 5T3RA 3ZYMA 3R7RA 4Q69A 4EBAG 3TXNA 1WAO1 3PNTB 3CSTA 4U0ZA 1PC2A 1EDUA 5G55A 4PS3A 5DIZA 1NZNA 5BW8C 4CT0A 4J8FA 2PM7A 3ASDA 4GCOA 1NA0A 2GRMA 3FEYA 3G2WA 4WAFA 4AY5A 1MQSA 3B7TA 3LY8A 3JUIA 3PS6A 4GYYA 4FLHA 4DLQA 4QFVA 3AS4A 3MZLB 2FO7A 2JLBA 3FUKA 1PAQA 2WVIA 2OOEA 3FUIA 4XIFA 4LERA 1SZAA 4LUNU 3UT7A 3RRNB 5HI7A 3FU6A 5A6CA 3PUKA 3EHMA 4HS2A 2J4BA 4DLOA 2AW6A 3APCA 4FU3A 4PDXA 1YA0A 4J8SA 3RU0A 1TJFA 5J08A 4ACLA 4HVBA 3QAQA 4CDMA 1FVHA 4WNEA 3ENEA 3UX4A 3PUJA 3LVQE 2KCVA 1HG2A 3GZ1A 4EECA 5AYWD 2LSVA 2MOWA 4CDNA 1H2TC 5D0QD 2LAIA 4BWRA 3KEZA 2WXJA 5CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B89 A;  4GA1 A;  4N2Q A;  4N2S A;  1OUV A;  2P58 C;  4BTB A;  3LKU A;  4RG9 A;  2I6H A;  3RKV A;  3QDN A;  1TJC A;  4RG6 A;  5G04 C;  4BTA A;  2C2L A;  1QZ2 A;  2HR2 A;  2WQH A;  3N71 A;  4WNF A;  1KT1 A;  3E4B A;  5EX0 A;  5G05 C;  5JJT A;  3ASG A;  4UQZ A;  2VSY A;  4IN3 B;  3PE3 A;  4GYW A;  5JJ6 A;  5KJM A;  1XNF A;  4HOS A;  2NC9 A;  3Q47 B;  3RJV A;  3RO2 A;  3MKR A;  3ZPJ A;  3QWP A;  2YQ8 A;  4GYO A;  4B94 A;  4NRH B;  4EQF A;  2Q7F A;  3MV2 B;  4GZ5 A;  3TG4 A;  4O6F A;  3GYZ A;  3U3W A;  1E96 B;  2VSN A;  2XGO A;  1KT0 A;  3KS2 A;  4JA9 A;  4U0S A;  5ARF A;  3S7D A;  2IFU A;  3MEK A;  4G1T A;  4GZ6 A;  2V5F A;  2KCK A;  2LNI A;  3UUX A;  3AS5 A;  5ARG A;  3SF4 A;  4N39 A;  4A1S A;  1ELR A;  4Y6W A;  4N3A A;  5FJY A;  4ME2 A;  3ASH A;  3CV0 A;  4KYO B;  4AY6 A;  3URZ A;  4J8E A;  3Q5M A;  4W9R A;  4CDR A;  5CCL A;  5DBK A;  5KJN A;  1A17 A;  2LSU A;  3QKY A;  3FFL A;  3QWW A;  2UY1 A;  1W3B A;  4U07 A;  3CK9 A;  4BT8 A;  2UY1 B;  5LCW J;  1HZ4 A;  1FCH A;  2IF4 A;  2MHK A;  4N5C A;  4WUY A;  5FZS A;  1ZU2 A;  2C0M A;  2L6J A;  5BNW A;  1HXI A;  2VGX B;  4KXK B;  2Y4U A;  1ZBP A;  4GCN A;  4YVQ C;  4ABN A;  3PDN A;  4I1A A;  3QWV A;  4XI9 A;  4AM9 A;  4CGV A;  2BUG A;  1WM5 A;  5BT1 A;  3KAE A;  4GA2 A;  1KLX A;  4XI0 A;  2QFC A;  3WXX A;  3CVP A;  4G23 A;  3S7J A;  4NQ0 A;  3S7F A;  4HOT A;  1ELW A;  2VGX A;  4U04 A;  4F3V A;  2Y4T A;  4GPK A;  3RO3 A;  4I9E A;  2PQN A;  4J8D A;  2VQ2 A;  2PQR A;  2XPI A;  3MV3 B;  1NA3 A;  3OXF A;  3VTX A;  4APO A;  2FF4 A;  5HQ8 A;  5FT9 A;  4G26 A;  4UQY A;  5CHE E;  4BT9 A;  5EX3 A;  3TG5 A;  3ULQ A;  4UI9 C;  3Q15 A;  3UPV A;  3QOU A;  3LPZ A;  2XCC A;  2VYI A;  4G2V A;  2HYZ A;  4UI9 J;  5D0O D;  3Q4A B;  4G25 A;  2PZI A;  3OXL A;  3NF1 A;  3SZ7 A;  3U4T A;  3VTY A;  2KC7 A;  3UQ3 A;  3O48 A;  4JL0 A;  1WAO 1;  2FI7 A;  2XCB A;  3ZN3 A;  4U0Z A;  1PC2 A;  4WNG A;  3GZ2 A;  3MA5 A;  3ZHE B;  5DIZ A;  3PE4 A;  2XGM A;  1NZN A;  3ESK A;  5BW8 C;  2R5S A;  3CVN A;  4J8F A;  1IYG A;  5LCW C;  3ASD A;  4GCO A;  1NA0 A;  3TAX A;  3CVQ A;  3EDT B;  4YVO A;  4AY5 A;  1QQE A;  3JYS A;  4HOR A;  1P5Q A;  4LEU A;  3LY8 A;  4GYY A;  4JA7 A;  4I17 A;  2YHC A;  4N3C A;  3AS4 A;  5JJ7 A;  3LY7 A;  5G04 J;  4Y6C A;  4J0U A;  4CGW A;  4AIF A;  1IHG A;  2WPV A;  2FO7 A;  2PL2 A;  2JLB A;  3CVL A;  4UI9 K;  2KCL A;  3AS8 A;  3ASF A;  3HYM B;  2OOE A;  4XIF A;  4YND A;  4GA0 A;  3IEG A;  3ZGQ A;  5KJK A;  4HOU A;  3K9I A;  4UQX A;  3FWV A;  4G24 A;  3CK7 A;  4WND A;  5EKQ D;  2C0L A;  5HI7 A;  5M72 A;  3CKB A;  3OXG A;  3BEE A;  3FP3 A;  5A6C A;  3CKC A;  2HO1 A;  3S7B A;  2OND A;  2GW1 A;  2DBA A;  4HOQ A;  5A7D B;  3RIB A;  2E2E A;  4I2W A;  4JHR A;  3ZFW A;  3TGO A;  1YA0 A;  3RU0 A;  5KJL A;  5FZR A;  3GW4 A;  3ZHE A;  2XGS A;  2VGY A;  4WNE A;  3CK8 A;  3LYA A;  4H7Y A;  4GZ3 A;  3LY9 A;  3R9A B;  1HH8 A;  5G05 J;  4I2Z A;  5FTP A;  3CEQ A;  2AVP A;  2KCV A;  3LCA A;  3GZ1 A;  3Q49 B;  2FEZ A;  1Y8M A;  2J9Q A;  2KAT A;  4N3B A;  2LSV A;  4U0U A;  5FZQ A;  5AYW D;  2UWJ G;  5C1D A;  3KD7 A;  5D0Q D;  4BWR A;  4H7X A;  4I9C A;  2FBN A;  4KBQ A;  2XEV A;  5CCM A; 
#chains in the Genus database with same CATH topology
 3RRM B;  5HKP A;  3U66 A;  2HR2 A;  3ASG A;  2R17 C;  4OAU C;  3L82 A;  4O6F A;  1N54 A;  2XGO A;  1MHQ A;  3QC1 A;  3V31 A;  4AP2 A;  3Q78 A;  4ME2 A;  3F6Q A;  4UWK A;  4IYP A;  2LSU A;  4PS7 A;  5CED B;  4AXH A;  5AJD A;  2V4L A;  3QWV A;  4F7A A;  2XQ0 A;  4DUI A;  5CHE E;  4AV7 A;  4ANW A;  1H6O A;  4G2V A;  3ZEF A;  3QJZ A;  2R05 A;  2IOS A;  3O48 A;  2Y1L E;  5E76 A;  2R03 A;  4U95 D;  2R5S A;  3PEU B;  4HLL A;  1QQE A;  4ATZ D;  4K0R A;  4I17 A;  4WWN A;  3CHP A;  5BPP A;  3BG0 B;  4ILI A;  2WQ7 A;  3PRZ A;  1O5M A;  4KVO A;  3HIZ A;  1PY1 A;  4I2W A;  3X2Q E;  1DC2 A;  3RRU A;  3E33 A;  1OCR E;  4GB9 A;  4A63 B;  1V55 E;  3LCA A;  4N3A A;  3MYV A;  4E85 A;  4BET A;  3I5P A;  4I6G A;  4XEI G;  4KBQ A;  2JEK A;  4RG6 A;  3N71 A;  4GZD A;  5ENS D;  2VSY A;  2ZGG A;  4JZY A;  2EIN E;  4BEP A;  1E96 B;  1KT0 A;  4JXT A;  1MZC A;  2OEW A;  3PZD A;  3CR3 A;  4RVB A;  3V79 K;  4W9R A;  3SD5 A;  2ETA A;  1A17 A;  1SW6 A;  2UY1 A;  3EIJ A;  5EYP F;  3C5R A;  1A5E A;  5EYL A;  2AXV A;  2XPZ A;  4MBG A;  3KEA A;  1S0P A;  4UWL A;  1KLX A;  4F1P A;  3CVV A;  2PQN A;  2GRR B;  1HE8 A;  5FT9 A;  4CEM A;  3Q73 A;  4G26 A;  4BT9 A;  4UI9 C;  3QOU A;  2XCC A;  1FVF A;  1X5B A;  2I9C A;  4WWO A;  4B8A A;  3GZ2 A;  3MA5 A;  1Q2Z A;  1JCR A;  2X6J A;  3BQO A;  4FUL A;  3LJ3 A;  3IHY A;  3CVX A;  3C3O A;  4UI9 K;  2KCL A;  1HFA A;  3CVY A;  2AXU A;  5AQB A;  2IU1 A;  4G24 A;  3BG1 B;  3BEE A;  5JJ7 A;  3CKC A;  4DX7 D;  2X6K A;  3FH5 A;  3ABM E;  3G2T A;  3CVU A;  2WM9 A;  2XGS A;  3FUM A;  1TN8 A;  2UWJ G;  3FTV A;  4BTB A;  2IQC A;  3RKV A;  3D9I A;  4A3V A;  4UWF A;  4KMO A;  3P2B A;  3MKR A;  4GYO A;  4EHM A;  5LP0 A;  3SFX A;  1L5J A;  4XKC A;  1IQR A;  3UUX A;  1X81 A;  3AS5 A;  3SF4 A;  3W9G A;  1VDY A;  3AU5 A;  1SA5 A;  3QB2 A;  1QBQ A;  1W3B A;  4KT6 B;  4U07 A;  5ANR A;  3HXB A;  2IF4 A;  3T8M A;  4KXK B;  2Y4U A;  5BT1 A;  3WXX A;  1RW2 A;  3S7J A;  3OAW A;  2BKK B;  1BI8 B;  3Q9U C;  4BY6 A;  3EU9 A;  3VTX A;  3DXK G;  5J90 A;  2WXL A;  3AU4 A;  3FUH A;  3CSF A;  1JUQ A;  3O4Z A;  2XRY A;  4U8H A;  3LJN A;  2OEV A;  3ZYL A;  2J49 A;  4YVO A;  3NOC D;  5ENN A;  3LY7 A;  3ZVV A;  3D9K A;  1LD8 A;  2WPV A;  2WXR A;  2WXH A;  3CQG B;  3NZU A;  2XS8 A;  2C0L A;  2XEH A;  3D9M A;  5A7D B;  4YDE A;  4C48 B;  1TR4 A;  4I2Z A;  3I3N A;  2J9Q A;  2AWI A;  1TNO A;  4I1M A;  4I9C A;  4I1O B;  4GA1 A;  3UMV A;  2V8S E;  1H6K A;  4EZK A;  1BD8 A;  1KT1 A;  2F8Y A;  4HLE A;  2DYS E;  4E6H A;  4B94 A;  3DXM G;  4U0S A;  3V2O A;  2KCK A;  2ETB A;  2H6I A;  1E7V A;  1HO8 A;  3ASH A;  5BV0 A;  3RSE G;  4I6E A;  4DPR A;  4BT8 A;  2UY1 B;  4B8C B;  3AG2 E;  5BNW A;  3CQC B;  3DBS A;  4ILG A;  2I1J A;  4MLP A;  4UUC A;  2B0O E;  2A5U A;  4F3V A;  2M63 A;  1N0R A;  1NI1 A;  4HRM B;  5FQ6 A;  5D0O D;  2VGE A;  3HXC A;  1O1T A;  1PC2 A;  5BW8 C;  2P9I G;  4WAF A;  4AY5 A;  5ENQ D;  3AS4 A;  3MZL B;  4J7W A;  4GTP A;  2JLB A;  1SZA A;  1OCZ E;  3UT7 A;  4GPM A;  5JA4 D;  3RRN B;  3DSU A;  5CBO A;  2AW6 A;  3UM3 A;  1YA0 A;  5J08 A;  1FVH A;  3HXD A;  3AG1 E;  3PUJ A;  3LVQ E;  1HG2 A;  3GZ1 A;  3C3Q A;  5B1A E;  3KEZ A;  4HI8 A;  5CMW A;  4L2L A;  2P58 C;  5T4Y A;  3LKU A;  1N4S A;  3I4G A;  4L2Y A;  3I4R B;  2IJG X;  4CZ2 D;  4OVU A;  5JJ6 A;  4XX5 A;  3G2V A;  3HG0 D;  1IKN D;  3B7U X;  3ZYK A;  4CRW A;  3MEK A;  3SI5 A;  2KZT B;  3D9P A;  3Q5M A;  3TWW A;  4KZC A;  2DZN A;  3U9W A;  4GZC A;  2BED A;  3ZIM A;  2QZA A;  2CFU A;  3L9T A;  4F6R D;  1HS6 A;  2IOL A;  4U04 A;  1NA3 A;  3D9N A;  4UQY A;  5FIO A;  2LO6 A;  2R59 A;  2EIK E;  2P9P G;  1H19 A;  3TJP A;  2R2L A;  2P9U G;  3CLJ A;  3ZRH A;  3DST A;  4NIK A;  2VTB A;  4NAC A;  3FDH A;  2F0Y A;  2H6H A;  3AAA C;  3ZKJ A;  4OVV A;  4YND A;  3PH0 C;  4LG6 A;  3LVR E;  4HOQ A;  3RIB A;  3TWQ A;  4WWP A;  2QYJ A;  3SGH A;  3UKR G;  3CK8 A;  1INZ A;  1S64 A;  1HH8 A;  2J07 A;  4R7L A;  2DZO A;  2ETC A;  2RFA A;  3C3R A;  1OWL A;  2PNN A;  2XEV A;  3TL5 A;  1OCC E;  3ZXS A;  3QDN A;  4JVS A;  4KZ0 A;  4XZ4 A;  4N5Q A;  5JJT A;  5KJM A;  3C98 A;  2V5Q C;  4HOS A;  2NC9 A;  4GTR A;  2IO3 C;  2YIN A;  2X6H A;  1NP7 A;  2KZT A;  3PZ3 A;  5BXO A;  3TWS A;  2WXQ A;  1OT8 A;  3QWW A;  2MRI A;  3U3W A;  2A5E A;  4GCN A;  5AN8 A;  3RK6 A;  2A4Z A;  1TNU A;  3Q7A A;  4EPZ A;  1EF1 C;  3ZU7 B;  3Q15 A;  5AQ7 A;  5D66 A;  3SBT B;  2ION A;  4G25 A;  4JB8 P;  2FI7 A;  3PE4 A;  3VLE A;  4RSY A;  3V2X A;  5BXU A;  2BF0 X;  5FQ4 A;  3NOG D;  3R9M A;  4J0U A;  1H2U A;  1D8E A;  1UG3 A;  2DIW A;  4HRL A;  4L23 A;  2VJ8 A;  3ZGQ A;  2YNQ A;  3CK7 A;  2XHE A;  1SQM A;  3S7B A;  2GW1 A;  4JW1 A;  4BFR A;  1WDY A;  3Q75 A;  2WXK A;  3FY4 A;  2PM6 A;  3CEQ A;  3DSS A;  4N3B A;  1B89 A;  1RZ4 A;  3B13 A;  4U63 A;  3E32 A;  5B3S E;  1TJC A;  3FUJ A;  5EX0 A;  5G05 C;  1E8W A;  4NRH B;  4HFG A;  2X6F A;  4I6J A;  3T5X A;  2VSN A;  2J8S D;  2RD0 A;  4C9B B;  3ZNG A;  3EHR A;  3L16 A;  2X6I A;  1JWF A;  3FUE A;  4AVX A;  2MHK A;  5AEN A;  3J5P A;  2X38 A;  4APF A;  3UIP C;  1LF8 A;  2VGX A;  2GRN B;  3HDX A;  4GPK A;  3RO3 A;  4J8D A;  2PQR A;  3MV3 B;  3TWR A;  1FPP A;  3DPD A;  2GRQ B;  4DX5 D;  5ENO D;  3VTY A;  3TWT A;  3ZUV B;  2JAB A;  3NQP A;  2OCC E;  1K1B A;  4GTQ A;  3EDT B;  3JYS A;  2B6C A;  1P5Q A;  2IO2 C;  4TXP A;  5AQA A;  3CVW A;  1H2V C;  4O1O A;  2P9N G;  4AOF A;  3AS8 A;  5G2N A;  2QY7 A;  3IHV A;  3LDZ A;  4UQX A;  2WXF A;  5EKQ D;  1IYG A;  2OND A;  3ZFW A;  3FUF A;  3MCX A;  3HVE B;  1MX2 A;  4EZL A;  3DEP A;  1OWO A;  1KPS B;  2AVP A;  3Q49 B;  2KAT A;  1Y8M A;  4U0U A;  4MKT A;  4OAV B;  2BTD A;  4LSZ E;  4ATG A;  4N2Q A;  1OUV A;  5C2Y A;  2WMN A;  1K1A A;  3SY2 A;  1QZ2 A;  3SO8 A;  4TRQ A;  4JHJ A;  3B7S A;  3PE3 A;  3ZPJ A;  3QWP A;  4GML A;  3S2A A;  2DCP A;  3FUD A;  2IFU A;  2WXO A;  5EIB E;  3B7B A;  2H6G A;  4Y6W A;  4KYO B;  4K03 A;  1TNB A;  5DBK A;  1Z3Y A;  3QKY A;  1HZ4 A;  3FTY A;  4G8L A;  4YVQ C;  4ABN A;  4DX2 A;  1AP7 A;  4DI4 A;  2QFC A;  3CVP A;  4G23 A;  4FAD A;  2NYJ A;  1FT1 A;  4ZFH A;  3TG5 A;  2RG8 A;  1TEZ A;  2VYI A;  5T3R A;  1TNZ A;  4RQI A;  3R7R A;  3ZYM A;  1AWC B;  3TXN A;  3PNT B;  1EDU A;  4GTT A;  4PS3 A;  1NZN A;  2RKK A;  3G2W A;  3JUI A;  3PS6 A;  2FO7 A;  3Q79 A;  2WVI A;  2KXP C;  3ASO E;  4LER A;  4HBD A;  2J4B A;  1TJF A;  4ACL A;  4HVB A;  3QAQ A;  4WNE A;  3HXE A;  2P9K G;  3PZ2 A;  3PVL A;  4TV3 A;  4DJA A;  5EID A;  4BTA A;  3UT8 A;  4D10 C;  2KM4 A;  1XGW A;  3HHM A;  3CGH A;  3Q47 B;  3MV2 B;  4GZ5 A;  3J5Q B;  5ARF A;  1O1R A;  1N4Q A;  3BU8 A;  5FJY A;  1TN6 A;  2X3M A;  3APD A;  3FFL A;  1U3C A;  2WQ6 A;  5CER B;  3S7F A;  3ZXP A;  1ELW A;  2WXM A;  3SNX A;  2Y4T A;  2LUH A;  1LD7 A;  1Z5S C;  1MYO A;  4XKB A;  1BLX B;  5KNH D;  3SZ7 A;  2LXM A;  4K5C A;  2E0I A;  4V3I A;  4U7E B;  5KCM A;  2V0P A;  5FIN A;  4CGW A;  4AIF A;  4J8Y A;  3LXU X;  1UN9 A;  5ENR D;  3D9J A;  3P1U A;  2MYO A;  5KJL A;  2Y0B G;  3LYA A;  4H7Y A;  3DSX A;  3R9A B;  5G05 J;  4F53 A;  2WMO A;  2XZT G;  2FBN A;  2L9B A;  2IEJ A;  2P9L G;  3FH7 A;  4RG9 A;  2LAH A;  2ZIS A;  2C2L A;  4PUC A;  3WG7 E;  3RJV A;  3CIA A;  2FUL A;  4DI3 A;  5KWD A;  3L17 A;  3ONK A;  2LNI A;  2F37 A;  4J6I A;  5FQ7 A;  3CV0 A;  4TXQ A;  3L13 A;  3UM1 A;  4CDR A;  1HU3 A;  3Q9N C;  3ULE G;  5E75 A;  4M3O A;  4LNB A;  3T9K A;  3L22 A;  4XI9 A;  4UWG A;  3T5V A;  4BX8 A;  4GA2 A;  3CHM A;  3PRE A;  3JQ1 A;  2H6F A;  3JXI A;  4Q94 A;  4PH4 B;  2L0T B;  3ISM C;  2ZXW E;  3NF1 A;  4JL0 A;  5CBN A;  4P29 A;  3AJI A;  5LCW C;  2AXZ A;  4Z68 A;  1UJJ A;  2I1K A;  2CHX A;  4A3T A;  5FQ8 A;  3HYM B;  3IEG A;  1UN8 A;  2J08 A;  1IXV A;  3SFY A;  2WXN A;  1YMP A;  2ZGD A;  4LCT A;  3DSV A;  1EPU A;  2DBA A;  2XPY A;  4JHR A;  2YHE A;  1WY6 A;  3SFZ A;  4URK A;  2VGY A;  4MRU A;  4B93 B;  4FP7 A;  1D8D A;  5FTP A;  5EN5 D;  5ENT D;  4ACK A;  4FLB A;  2GRO B;  2Y69 E;  3EUV A;  4FA6 A;  5CEA A;  4N2S A;  4GTV A;  3HRA A;  3FU5 A;  3MKQ B;  3W9F A;  5G04 C;  2L6B A;  2WQH A;  3EHN A;  3LEW A;  4HI9 A;  4BX9 A;  3IXE A;  5KNG A;  3TG4 A;  3IV0 A;  2WXI A;  3GYZ A;  4Q96 A;  3IBE A;  1SZ9 A;  1MX6 A;  4N39 A;  4AEZ C;  1N0Q A;  4HXI A;  4O60 A;  1JPL A;  3ULY A;  5KJN A;  3CK9 A;  2CHW A;  2VGX B;  3TWX A;  1U2V G;  3UTM A;  3T8K A;  3JQ0 A;  2OV8 A;  5EIL A;  4U96 D;  4CCA A;  3KSQ A;  4A55 A;  5AAO A;  4G8K A;  1TNY A;  3EIQ C;  3U64 A;  3D9H A;  2HYZ A;  1EYH A;  4UI9 J;  2VSX E;  2XCB A;  1QYM A;  3FUL A;  3ZHE B;  5AJL A;  2XGM A;  4M7C A;  3MGB A;  1N95 A;  5JMN D;  4K5A B;  3DWL G;  4JA7 A;  3ZW3 A;  2YHC A;  2CFZ A;  5CRU A;  5KJK A;  2R02 A;  1HF8 A;  3D9L A;  3FWV A;  4A1G A;  3UPV A;  4QQI A;  3TGO A;  4L9P A;  4GZ3 A;  3FHE A;  2V4H C;  4JD2 G;  2FEZ A;  3B95 A;  5KBA A;  3KD7 A;  1N9A A;  4FJY A;  4EZJ A;  3APF A;  5JHA A;  5CEC B;  3PZ1 A;  1Z3X A;  5ITZ F;  2CG2 A;  3D3M A;  4X8Q A;  4TXR A;  4G1T A;  1NL4 A;  4GZ6 A;  3L54 A;  2WXG A;  4LRZ A;  4J8E A;  5CCL A;  2RFM A;  2LXL A;  1UW4 B;  2HE0 A;  1D9S A;  4WUY A;  4N5C A;  2L6J A;  1GW6 A;  1N4R A;  4AM9 A;  3PDN A;  4ZHB A;  1WM5 A;  2VSO E;  1SVX A;  4GTM A;  3ASN E;  1IHB A;  4I43 A;  5CRV A;  5LFA A;  4U8V D;  4JEH A;  1U3D A;  1JWG A;  2OVF A;  1N94 A;  1OWP A;  1KZO A;  2OVB A;  3TXM A;  3FEX A;  5ENP D;  1DVP A;  2HM8 A;  3JUE A;  4Q69 A;  3CST A;  4U0Z A;  5DIZ A;  4CT0 A;  1V54 E;  3ASD A;  1JCQ A;  1NA0 A;  2GRM A;  3FEY A;  1MQS A;  4DLQ A;  4YDO A;  2OOE A;  4XIF A;  3UIN C;  5A6C A;  3PUK A;  3EHM A;  4DLO A;  3APC A;  4J8S A;  3UX4 A;  4HRN A;  2KCV A;  2LSV A;  4CDN A;  1H2T C;  3UM0 A;  3Q7F A;  2WXJ A;  3KSL A;  2WXP A;  2I6H A;  2VTB B;  4WNF A;  5A23 A;  4GYW A;  1WG0 A;  3ABK E;  4HB5 A;  1XNF A;  4B0Z A;  3QK0 A;  3OTN A;  5ANL A;  4GMR A;  1TYQ G;  4HQD A;  3KS2 A;  3S7D A;  3SBS A;  3VLF A;  2V5F A;  5ARG A;  3UKU G;  2XEE A;  1E90 A;  3EU5 A;  3URZ A;  2BKG A;  5EDS A;  1ZU2 A;  2C0M A;  3KAE A;  2EIJ E;  3FTS A;  2GRL A;  2XPI A;  3OXF A;  3ZYQ A;  4LNG A;  3JXJ A;  5EX3 A;  3EJN A;  4YDW A;  3R7Q A;  1OCO E;  1K3Z D;  5JHB A;  2J09 A;  3Q4A B;  1H6P A;  3TWV A;  1N4P A;  5HS0 A;  3UQ3 A;  1MJ0 A;  3FU3 A;  3B7R L;  3RAU A;  4JC8 A;  3ESK A;  3CVN A;  4IUL A;  4LEU A;  3CHQ A;  3CHS A;  3FTW A;  2PL2 A;  3ML9 A;  1BU9 A;  4RLY A;  1G3N B;  4PS8 A;  4HOU A;  5LX8 A;  4L1B A;  3JCK C;  1KZP A;  2E2E A;  3BUA A;  3E34 A;  4C0E A;  2NSZ A;  4FHJ A;  3LY9 A;  3GZS A;  1BPO A;  3EHQ A;  3U4T A;  3NAW A;  2KBX A;  5FZQ A;  1UJK A;  2QC9 A;  3FP3 A;  3MX3 A;  3ABL E;  2GGF A;  1OWM A;  3L6A A;  4BSX A;  5FWQ A;  1BI7 B;  3ONL A;  4HNA D;  4JPS A;  3PNL B;  2XRZ A;  1MX4 A;  3CHR A;  4FJZ A;  2CHZ A;  3NB2 A;  1FCH A;  5FZS A;  1HXI A;  3E37 A;  4CGV A;  3ML8 A;  3V30 A;  4F1S A;  4XI0 A;  4B89 A;  4NQ0 A;  4HOT A;  4DX6 D;  1E7U A;  2VQ2 A;  3VLD A;  4ILH B;  5HQ8 A;  2AJA A;  3LS8 A;  2J4D A;  3FTU A;  1DNP A;  1H0A A;  3UIO C;  1N11 A;  5BV1 A;  4ANV A;  3ZN3 A;  4DK5 A;  4TUM A;  3TAX A;  4GU5 A;  5H7P A;  1S70 B;  4CYM D;  3NZS A;  1N52 A;  4CT4 A;  4Y6C A;  1TN7 A;  3HVE A;  1IHG A;  3CVL A;  4WND A;  1Z6T A;  3G2U A;  3CKB A;  4UWH A;  3DSW A;  4FHK A;  2ZIR A;  4GAA A;  5C1D A;  5HRY A;  4H7X A;  3NBN B;  4L7T A;  4GTS A;  3TWU A;  1YCS B;  3FTX A;  3UM2 A;  1IQU A;  4UQZ A;  3PEV B;  2YQ8 A;  5BUZ A;  2WB2 A;  1ELK A;  4JA9 A;  4A1S A;  1LTX A;  4GMJ A;  4ANX A;  2ILR A;  4XE0 A;  3D9O A;  1Y6I A;  1UOH A;  3UXG A;  3CHO A;  5LCW J;  5AAR A;  1O1S A;  1HG5 A;  4K5B A;  1ZBP A;  3QAR A;  4BER A;  2EIL E;  4I1A A;  2FO1 E;  3L08 A;  4JEU A;  4OYS A;  4I9E A;  4EQF A;  4APO A;  2FF4 A;  3FTZ A;  3FUN A;  5CMY A;  3LPZ A;  3ESL A;  4IRU A;  5LOZ A;  4O1P A;  4FC8 A;  2PZI A;  2DVW A;  3OXL A;  2KC7 A;  2EQX A;  4WNG A;  4ANU A;  4DX1 A;  3AG4 E;  3CVQ A;  4AJW A;  5AQ9 A;  4LNU D;  4N3C A;  2Y3A A;  3FU0 A;  5G04 J;  1E8Z A;  3UT4 A;  2P9S G;  1E8X A;  3ASF A;  5AIJ A;  1YYH A;  3G2S A;  4GA0 A;  4U8Y D;  3MJW A;  1OWN A;  3K9I A;  3DEO A;  5M72 A;  1ZB1 A;  3OXG A;  1S63 A;  2HO1 A;  3DPY A;  2XEN A;  5FZR A;  3IKO B;  3GW4 A;  4JHK A;  3ZHE A;  2XZD G;  4G11 A;  4HOR A;  2EIM E;  1HX8 A;  4MS6 A;  3DRA A;  1QNF A;  4EBA A;  4GTO A;  3AG3 E;  3UI2 A;  1OXJ A;  3E4B A;  4IN3 B;  3RO2 A;  2Q7F A;  4NUR A;  2NXP A;  2ZU6 B;  1ELR A;  4AY6 A;  3SHF A;  4TUU A;  4YDY A;  5D2M C;  2QYU A;  2I2O A;  2BUG A;  2L0I A;  5B1B E;  2P2C P;  2CG3 A;  1OY3 D;  4KVM A;  3FH8 A;  1FT2 A;  3MKQ A;  5T8I A;  3QNK A;  3ULQ A;  1E8Y A;  4BES A;  4C0M A;  4EBA G;  1K8K G;  3E30 A;  1WAO 1;  5G55 A;  2GRP B;  4J8F A;  2PM7 A;  4GCO A;  5IY5 E;  1DCQ A;  1JCS A;  2DYR E;  3B7T A;  3LY8 A;  4GYY A;  4FLH A;  1NFI E;  4BSZ B;  4QFV A;  2DWZ A;  3FUK A;  1PAQ A;  3PZ4 A;  3FUI A;  4LUN U;  3SQV A;  2XS1 A;  5HI7 A;  3FU6 A;  2F8X K;  4HS2 A;  1DCE A;  4FU3 A;  4PDX A;  3RU0 A;  4CDM A;  2IY0 C;  1SA4 A;  3ENE A;  4EEC A;  3HXF A;  5AYW D;  2MOW A;  3C72 A;  5D0Q D;  2LAI A;  4BWR A;  4DRX E;  5CCM A; 
#chains in the Genus database with same CATH homology
 4L2L A;  2P58 C;  3PVL A;  5T4Y A;  4TV3 A;  2WXP A;  3RRM B;  3LKU A;  4DJA A;  2I6H A;  3U66 A;  3I4G A;  4L2Y A;  3I4R B;  2HR2 A;  2KM4 A;  4WNF A;  3UT8 A;  4BTA A;  4D10 C;  1XGW A;  5A23 A;  2VTB B;  2IJG X;  3ASG A;  3CGH A;  3HHM A;  4OVU A;  4GYW A;  5JJ6 A;  4XX5 A;  1XNF A;  4B0Z A;  3QK0 A;  3Q47 B;  2R17 C;  3OTN A;  5ANL A;  3G2V A;  3MV2 B;  3B7U X;  4GZ5 A;  4O6F A;  1N54 A;  2XGO A;  3KS2 A;  1MHQ A;  3QC1 A;  5ARF A;  3S7D A;  3SBS A;  3ZYK A;  3MEK A;  4CRW A;  3VLF A;  2V5F A;  5ARG A;  4AP2 A;  5FJY A;  4ME2 A;  3SI5 A;  1E90 A;  2X3M A;  3URZ A;  2KZT B;  3D9P A;  3Q5M A;  5EDS A;  4KZC A;  4UWK A;  4IYP A;  2LSU A;  3APD A;  3FFL A;  1U3C A;  4PS7 A;  3U9W A;  4GZC A;  1ZU2 A;  2C0M A;  3ZIM A;  2CFU A;  4AXH A;  2WQ6 A;  5AJD A;  2V4L A;  3QWV A;  1HS6 A;  3KAE A;  3S7F A;  4F7A A;  1ELW A;  2WXM A;  3FTS A;  2IOL A;  3SNX A;  4U04 A;  2Y4T A;  2XQ0 A;  2GRL A;  2XPI A;  3OXF A;  1NA3 A;  3ZYQ A;  3D9N A;  4UQY A;  5CHE E;  4AV7 A;  2LO6 A;  5EX3 A;  4ANW A;  3EJN A;  2R59 A;  4G2V A;  4XKB A;  3R7Q A;  1H19 A;  5JHB A;  2J09 A;  3TJP A;  3Q4A B;  3ZEF A;  3QJZ A;  2IOS A;  3SZ7 A;  3UQ3 A;  3O48 A;  5E76 A;  3FU3 A;  3B7R L;  4AM9 A;  4JC8 A;  3CLJ A;  3ESK A;  2E0I A;  2R5S A;  3CVN A;  3PEU B;  4V3I A;  4IUL A;  3ZRH A;  1QQE A;  4LEU A;  2VTB A;  4K0R A;  5KCM A;  3CHQ A;  3CHS A;  4I17 A;  3FTW A;  4NAC A;  4WWN A;  3CHP A;  3FDH A;  2V0P A;  5BPP A;  4CGW A;  4AIF A;  3BG0 B;  4ILI A;  2PL2 A;  3ML9 A;  4OVV A;  4YND A;  3LXU X;  4PS8 A;  3PH0 C;  2WQ7 A;  3PRZ A;  4HOU A;  1UN9 A;  3LVR E;  5LX8 A;  4L1B A;  3JCK C;  3D9J A;  4HOQ A;  3HIZ A;  1PY1 A;  4KVO A;  3RIB A;  2E2E A;  3P1U A;  4I2W A;  4C0E A;  5KJL A;  2NSZ A;  4WWP A;  3SGH A;  3CK8 A;  3LYA A;  4H7Y A;  4FHJ A;  3RRU A;  3LY9 A;  1INZ A;  3GZS A;  4GB9 A;  1HH8 A;  2J07 A;  4R7L A;  1BPO A;  3R9A B;  5G05 J;  3U4T A;  4F53 A;  3LCA A;  4N3A A;  2WMO A;  3MYV A;  4E85 A;  5FZQ A;  1UJK A;  1OWL A;  3I5P A;  4I6G A;  2FBN A;  3FP3 A;  4KBQ A;  2XEV A;  2L9B A;  2JEK A;  3TL5 A;  3FH7 A;  3MX3 A;  2LAH A;  4RG9 A;  3ZXS A;  3QDN A;  4JVS A;  2GGF A;  4RG6 A;  1OWM A;  4KZ0 A;  3L6A A;  2C2L A;  3N71 A;  4PUC A;  4GZD A;  4BSX A;  5FWQ A;  4XZ4 A;  5JJT A;  5KJM A;  2VSY A;  3C98 A;  3ONL A;  5CMW A;  4JZY A;  4HOS A;  2NC9 A;  3RJV A;  3CIA A;  2FUL A;  4DI3 A;  3L17 A;  1E96 B;  3ONK A;  1KT0 A;  4JXT A;  3PNL B;  4JPS A;  3PZD A;  2LNI A;  3CR3 A;  4RVB A;  2YIN A;  2X6H A;  2XRZ A;  1NP7 A;  4J6I A;  5FQ7 A;  3CHR A;  3CV0 A;  4FJZ A;  3L13 A;  2KZT A;  2CHZ A;  4W9R A;  4CDR A;  3SD5 A;  2WXQ A;  1HU3 A;  1A17 A;  3QWW A;  2MRI A;  2UY1 A;  3U3W A;  3EIJ A;  5E75 A;  1FCH A;  5FZS A;  4M3O A;  1HXI A;  3L22 A;  4GCN A;  2AXV A;  4XI9 A;  4UWG A;  3RK6 A;  2XPZ A;  3ML8 A;  4BX8 A;  4CGV A;  3T5V A;  1S0P A;  4GA2 A;  4UWL A;  1KLX A;  4XI0 A;  2A4Z A;  4F1S A;  3CHM A;  4B89 A;  4NQ0 A;  3PRE A;  4HOT A;  3JQ1 A;  3CVV A;  4EPZ A;  2PQN A;  1E7U A;  2VQ2 A;  4Q94 A;  3VLD A;  4ILH B;  5HQ8 A;  1EF1 C;  1HE8 A;  5FT9 A;  4CEM A;  4G26 A;  4PH4 B;  4BT9 A;  4UI9 C;  2L0T B;  3Q15 A;  3QOU A;  2XCC A;  3LS8 A;  3SBT B;  1FVF A;  2ION A;  2J4D A;  3FTU A;  1DNP A;  1H0A A;  1X5B A;  4G25 A;  2I9C A;  3NF1 A;  5BV1 A;  4ANV A;  4JL0 A;  2FI7 A;  3ZN3 A;  4WWO A;  4P29 A;  4B8A A;  3GZ2 A;  3MA5 A;  2X6J A;  3PE4 A;  3VLE A;  4DK5 A;  4FUL A;  4RSY A;  5LCW C;  3LJ3 A;  3TAX A;  2BF0 X;  2AXZ A;  4GU5 A;  5FQ4 A;  1UJJ A;  3IHY A;  3CVX A;  3NZS A;  1N52 A;  2I1K A;  2CHX A;  4Y6C A;  4J0U A;  1H2U A;  1UG3 A;  2DIW A;  3HVE A;  1IHG A;  5FQ8 A;  4A3T A;  4CT4 A;  4UI9 K;  3CVL A;  2KCL A;  1HFA A;  3HYM B;  4L23 A;  2VJ8 A;  3IEG A;  3ZGQ A;  2AXU A;  2YNQ A;  1UN8 A;  2J08 A;  3CVY A;  2IU1 A;  4G24 A;  4WND A;  3CK7 A;  1Z6T A;  2XHE A;  2WXN A;  3BG1 B;  3CKB A;  3G2U A;  3BEE A;  4LCT A;  1SQM A;  3CKC A;  5JJ7 A;  3S7B A;  1EPU A;  2DBA A;  2GW1 A;  2XPY A;  4UWH A;  4JW1 A;  4JHR A;  2X6K A;  2YHE A;  3FH5 A;  3G2T A;  4BFR A;  3CVU A;  1WY6 A;  2WM9 A;  3SFZ A;  4URK A;  2XGS A;  2VGY A;  4MRU A;  4FP7 A;  2WXK A;  3FY4 A;  4FHK A;  3FUM A;  2PM6 A;  4GAA A;  3CEQ A;  5FTP A;  4ACK A;  4N3B A;  4FLB A;  2UWJ G;  5C1D A;  4H7X A;  3FTV A;  4FA6 A;  1B89 A;  4N2S A;  3B13 A;  4U63 A;  4L7T A;  3FU5 A;  2IQC A;  4BTB A;  3MKQ B;  3RKV A;  3D9I A;  4A3V A;  1TJC A;  4UWF A;  3FTX A;  5G04 C;  4KMO A;  2WQH A;  3EHN A;  3P2B A;  3LEW A;  3FUJ A;  5EX0 A;  5G05 C;  4BX9 A;  1IQU A;  4UQZ A;  3PEV B;  1E8W A;  3MKR A;  2YQ8 A;  4GYO A;  5BUZ A;  4NRH B;  4HFG A;  5LP0 A;  3TG4 A;  3IV0 A;  2WXI A;  2WB2 A;  2X6F A;  3GYZ A;  4I6J A;  1ELK A;  1L5J A;  2VSN A;  4JA9 A;  4Q96 A;  3T5X A;  2RD0 A;  3IBE A;  4C9B B;  1SZ9 A;  4XKC A;  1IQR A;  3UUX A;  4A1S A;  3AS5 A;  3SF4 A;  4N39 A;  4GMJ A;  4ANX A;  4AEZ C;  2ILR A;  4XE0 A;  3D9O A;  1VDY A;  1Y6I A;  3AU5 A;  3L16 A;  4HXI A;  2X6I A;  3QB2 A;  3CHO A;  1JPL A;  5KJN A;  1JWF A;  1W3B A;  4KT6 B;  3CK9 A;  4U07 A;  3FUE A;  5ANR A;  2IF4 A;  4AVX A;  5LCW J;  2MHK A;  5AEN A;  2CHW A;  3T8M A;  1HG5 A;  4KXK B;  2VGX B;  2Y4U A;  1ZBP A;  2X38 A;  3QAR A;  4I1A A;  5BT1 A;  4APF A;  3L08 A;  3WXX A;  3S7J A;  3JQ0 A;  3OAW A;  1LF8 A;  2OV8 A;  2VGX A;  4BY6 A;  3HDX A;  4JEU A;  4OYS A;  4GPK A;  3RO3 A;  4I9E A;  4A55 A;  4J8D A;  2PQR A;  3MV3 B;  4CCA A;  3VTX A;  4EQF A;  4APO A;  2FF4 A;  3FTZ A;  5J90 A;  3FUN A;  2WXL A;  3DPD A;  3AU4 A;  3FUH A;  3EIQ C;  3U64 A;  5CMY A;  3LPZ A;  3ESL A;  3CSF A;  4IRU A;  2HYZ A;  1EYH A;  1JUQ A;  4UI9 J;  5LOZ A;  3O4Z A;  4FC8 A;  2PZI A;  2XRY A;  3OXL A;  4U8H A;  3VTY A;  2KC7 A;  2VSX E;  2XCB A;  2EQX A;  4WNG A;  3FUL A;  3ZHE B;  5AJL A;  2XGM A;  3NQP A;  4ANU A;  3MGB A;  3ZYL A;  2J49 A;  3CVQ A;  3EDT B;  4YVO A;  4AJW A;  3JYS A;  1P5Q A;  5ENN A;  4JA7 A;  3ZW3 A;  2YHC A;  2Y3A A;  4N3C A;  3LY7 A;  3FU0 A;  3ZVV A;  3D9K A;  5G04 J;  1E8Z A;  3CVW A;  1H2V C;  2WPV A;  3UT4 A;  4AOF A;  2CFZ A;  3AS8 A;  5G2N A;  1E8X A;  2QY7 A;  3ASF A;  3IHV A;  2WXR A;  3G2S A;  4GA0 A;  5AIJ A;  5KJK A;  3MJW A;  2WXH A;  1OWN A;  3LDZ A;  3K9I A;  1HF8 A;  3D9L A;  3CQG B;  3FWV A;  3NZU A;  2WXF A;  2C0L A;  4UQX A;  5EKQ D;  4A1G A;  5M72 A;  3OXG A;  1IYG A;  3UPV A;  2HO1 A;  3D9M A;  2OND A;  5A7D B;  3FUF A;  3MCX A;  3ZFW A;  3TGO A;  3HVE B;  4EZL A;  5FZR A;  3IKO B;  3GW4 A;  4JHK A;  3ZHE A;  4GZ3 A;  3FHE A;  4G11 A;  1OWO A;  4I2Z A;  3I3N A;  2AVP A;  3Q49 B;  4HOR A;  2FEZ A;  1HX8 A;  1Y8M A;  2J9Q A;  2KAT A;  2AWI A;  4U0U A;  4MKT A;  3KD7 A;  4I1M A;  4MS6 A;  2BTD A;  4I9C A;  4I1O B;  4ATG A;  4GA1 A;  4FJY A;  1QNF A;  3UMV A;  4N2Q A;  1OUV A;  4EBA A;  3APF A;  4EZJ A;  2V8S E;  5JHA A;  5C2Y A;  2WMN A;  1H6K A;  4EZK A;  1QZ2 A;  1KT1 A;  1Z3X A;  3E4B A;  4TRQ A;  4IN3 B;  4JHJ A;  3B7S A;  3PE3 A;  4HLE A;  3RO2 A;  3ZPJ A;  4E6H A;  3QWP A;  2CG2 A;  4GML A;  4B94 A;  3S2A A;  2Q7F A;  3D3M A;  2DCP A;  4NUR A;  3FUD A;  4U0S A;  2IFU A;  2WXO A;  4G1T A;  4GZ6 A;  2KCK A;  3L54 A;  2NXP A;  2ZU6 B;  1ELR A;  4Y6W A;  1E7V A;  1HO8 A;  2WXG A;  3ASH A;  4KYO B;  5BV0 A;  4K03 A;  4AY6 A;  4LRZ A;  4J8E A;  5CCL A;  5DBK A;  4I6E A;  1Z3Y A;  3QKY A;  4TUU A;  3SHF A;  1UW4 B;  4DPR A;  4BT8 A;  2UY1 B;  1HZ4 A;  4WUY A;  4N5C A;  2L6J A;  3FTY A;  4B8C B;  1GW6 A;  5BNW A;  4YVQ C;  4ABN A;  2I2O A;  3CQC B;  3DBS A;  3PDN A;  2I1J A;  4ILG A;  2BUG A;  1WM5 A;  4MLP A;  4DI4 A;  2L0I A;  2QFC A;  2CG3 A;  2VSO E;  3CVP A;  4G23 A;  4KVM A;  3FH8 A;  2A5U A;  4FAD A;  4I43 A;  4F3V A;  2M63 A;  5LFA A;  4JEH A;  3MKQ A;  5T8I A;  1U3D A;  1JWG A;  2OVF A;  3QNK A;  3TG5 A;  3ULQ A;  2RG8 A;  1TEZ A;  1E8Y A;  1OWP A;  3TXM A;  2OVB A;  2VYI A;  3FEX A;  5FQ6 A;  4C0M A;  5D0O D;  1DVP A;  2HM8 A;  5T3R A;  3ZYM A;  3R7R A;  4Q69 A;  4EBA G;  3TXN A;  1WAO 1;  3PNT B;  3CST A;  4U0Z A;  1PC2 A;  1EDU A;  5G55 A;  4PS3 A;  5DIZ A;  1NZN A;  5BW8 C;  4CT0 A;  4J8F A;  2PM7 A;  3ASD A;  4GCO A;  1NA0 A;  2GRM A;  3FEY A;  3G2W A;  4WAF A;  4AY5 A;  1MQS A;  3B7T A;  3LY8 A;  3JUI A;  3PS6 A;  4GYY A;  4FLH A;  4DLQ A;  4QFV A;  3AS4 A;  3MZL B;  2FO7 A;  2JLB A;  3FUK A;  1PAQ A;  2WVI A;  2OOE A;  3FUI A;  4XIF A;  4LER A;  1SZA A;  4LUN U;  3UT7 A;  3RRN B;  5HI7 A;  3FU6 A;  5A6C A;  3PUK A;  3EHM A;  4HS2 A;  2J4B A;  4DLO A;  2AW6 A;  3APC A;  4FU3 A;  4PDX A;  1YA0 A;  4J8S A;  3RU0 A;  1TJF A;  5J08 A;  4ACL A;  4HVB A;  3QAQ A;  4CDM A;  1FVH A;  4WNE A;  3ENE A;  3UX4 A;  3PUJ A;  3LVQ E;  2KCV A;  1HG2 A;  3GZ1 A;  4EEC A;  5AYW D;  2LSV A;  2MOW A;  4CDN A;  1H2T C;  5D0Q D;  2LAI A;  4BWR A;  3KEZ A;  2WXJ A;  5CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...