2XEVA

Crystal structure of the tpr domain of xanthomonas campestris ybgf
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
121
structure length
121
Chain Sequence
b'RTAYNVAFDALKNGKYDDASQLFLSFLELYPNGVYTPNALYWLGESYYATRNFQLAEAQFRDLVSRYPTHDKAAGGLLKLGLSQYGEGKNTEAQQTLQQVATQYPGSDAARVAQERLQSIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YBGF
publication title Tola Modulates the Oligomeric Status of Ybgf in the Bacterial Periplasm.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Metal binding
total genus 51
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xevA00
4I2ZA 2C2LA 3N71A 4J8FA 4HOQA 3MV2B 2UY1B 3CVQA 2XGSA 3LPZA 4AY6A 4GCOA 3Q5MA 4N5CA 2HO1A 3ZN3A 4BTBA 4AY5A 4HOUA 4YVOA 5D0QD 2FO7A 1ELWA 1YA0A 3KD7A 1FCHA 4B94A 2HYZA 3VTXA 3S7FA 5BT1A 2FF4A 3PE4A 3CVNA 3CV0A 5FTPA 3KS2A 1P5QA 2KCKA 4KBQA 3Q49B 3AS4A 4GA2A 3OXGA 3SF4A 2PL2A 4G23A 4IN3B 4KXKB 3UPVA 1NZNA 2VGXB 4ABNA 3QWVA 2KC7A 2I6HA 3MV3B 3FP3A 5FZQA 4N3AA 3OXLA 4ME2A 2OOEA 4CGWA 4J8DA 2C0MA 4YNDA 4RG9A 5FJYA 2YHCA 3TAXA 4I9CA 4EQFA 5D0OD 2UY1A 3HYMB 1QZ2A 3LKUA 2Y4TA 4N3CA 1WM5A 3ULQA 3EDTB 4HOSA 1HXIA 4G26A 5ARGA 3ZHEB 2FI7A 4BTAA 4UI9C 3QOUA 4AIFA 3GZ1A 4AM9A 4RG6A 2IFUA 5JJ6A 4GYYA 3O48A 4I2WA 2VGXA 2PQRA 1B89A 3ZGQA 4BT9A 1KT0A 2FBNA 3QDNA 2LSUA 5JJ7A 5FZSA 3URZA 4CGVA 4I9EA 4WNFA 4F3VA 2C0LA 2QFCA 4NRHB 5KJKA 4UI9J 1TJCA 4HORA 3RU0A 2Q7FA 2NC9A 2WQHA 4WNEA 2P58C 2XPIA 2AVPA 4N2SA 4BWRA 4GZ3A 4JA7A 5EKQD 3TG4A 2KCLA 1W3BA 2GW1A 4YVQC 5LCWC 5DIZA 3QWWA 2VGYA 2MHKA 3ASFA 5KJNA 4XI0A 3MEKA 4BT8A 3QWPA 1ZU2A 5BNWA 2XEVA 3AS5A 4KYOB 1HH8A 1PC2A 4G24A 3ASHA 3MA5A 2LSVA 3CK8A 5EX0A 2XCBA 3NF1A 3BEEA 5CCLA 4J0UA 3S7BA 2HR2A 4WNDA 3IEGA 4GPKA 5CCMA 3WXXA 1ZBPA 3RIBA 3S7JA 3CK9A 4O6FA 5AYWD 4GYWA 3LY8A 1QQEA 3S7DA 4I1AA 2FEZA 4UQYA 2UWJG 2VSNA 4J8EA 4XIFA 3ZFWA 3JYSA 1IHGA 4U04A 3FWVA 5G05C 1E96B 3R9AB 2XGOA 1OUVA 2VQ2A 2PQNA 4GZ6A 5DBKA 2V5FA 3PDNA 4H7YA 3E4BA 3CK7A 4HOTA 5JJTA 4G2VA 2VYIA 3LCAA 3OXFA 4A1SA 3Q15A 3U3WA 4Y6WA 3VTYA 5CHEE 4GZ5A 4UQZA 4WUYA 1KLXA 3RO3A 3LYAA 4N2QA 5G04C 2ONDA 2R5SA 4GYOA 3K9IA 4N3BA 1ELRA 4GA0A 3CKCA 3QKYA 3Q47B 4UI9K 4UQXA 3ASGA 4Y6CA 2IF4A 4LEUA 1NA3A 3AS8A 5A7DB 4I17A 3PE3A 4H7XA 2DBAA 4U0SA 3ZHEA 2YQ8A 3LY7A 2JLBA 5G04J 5BW8C 2VSYA 3MKRA 3SZ7A 5M72A 5FT9A 5KJLA 3ASDA 5FZRA 3UUXA 1KT1A 1A17A 4U07A 5ARFA 5LCWJ 4N39A 3LY9A 2XCCA 1NA0A 3CKBA 3KAEA 3TG5A 3RKVA 5HI7A 2KATA 4GCNA 2KCVA 4WNGA 3CVPA 3GW4A 2BUGA 5KJMA 1WAO1 1HZ4A 1IYGA 2LNIA 2WPVA 4JHRA 4XI9A 1XNFA 2Y4UA 3GZ2A 3CVLA 4U0ZA 2E2EA 3FFLA 4NQ0A 3RJVA 3U4TA 3GYZA 4JA9A 4GA1A 1Y8MA 4U0UA 5C1DA 3TGOA 2J9QA 2PZIA 4CDRA 2L6JA 3ZPJA 5A6CA 4W9RA 3UQ3A 3RO2A 2XGMA 4APOA 4G25A 3Q4AB 4G1TA 5HQ8A 5G05J 3ESKA 4JL0A 3CEQA 5EX3A
chains in the Genus database with same CATH superfamily
1N52A 3ISMC 2X6IA 1DNPA 2UY1B 5LOZA 1H0AA 2WXPA 4AY6A 4GCOA 3C3OA 4V3IA 3ZYKA 4JXTA 5KNHD 5D0QD 2FO7A 5CECB 3KD7A 3AG1E 3IV0A 5EILA 1MX6A 1V54E 3FUNA 4L9PA 3CQGB 4DRXE 4EHMA 3SQVA 3FTYA 3VTXA 1TYQG 3Q9UC 2GRMA 2P9KG 4LNGA 3W9FA 3ZXSA 3CV0A 3LJ3A 1E90A 5FTPA 2ZGDA 3DXKG 2P9LG 2GRQB 2PL2A 1FPPA 3UPVA 2VGXB 3QWVA 2MOWA 5EN5D 2KC7A 2VTBB 1SVXA 3AU4A 4OAVB 4J8DA 3UT8A 4FLHA 3PNTB 4JEUA 1FT2A 3AU5A 4I1MA 3EIQC 3Q9NC 3TWVA 2Y4TA 3UIOC 3D9LA 2L0TB 4F1PA 1WM5A 2JABA 2NYJA 3ESLA 4TUMA 4HOSA 4HQDA 4LG6A 4YDOA 5LP0A 3FTXA 2A4ZA 4PS7A 3B7RL 3PZ2A 2R17C 2FI7A 2IU1A 2J08A 2J4BA 1UW4B 2GGFA 5LFAA 4U8YD 3UIPC 2WXNA 2P9UG 1JCSA 4KT6B 3JXIA 4UUCA 4TRQA 2QY7A 2Y1LE 5JJ6A 4B93B 3MKQB 1XGWA 1B89A 2CFUA 4EZKA 3FU6A 4G11A 4BERA 3SI5A 3CGHA 4YDYA 2IONA 4GMLA 3NOCD 3QJZA 5JJ7A 5FZSA 5ENRD 4GTSA 4NRHB 3PZ3A 1TR4A 1TJCA 2P9IG 4HORA 2AJAA 4J6IA 2Q7FA 1N4PA 2NC9A 4KMOA 4WNEA 2XPIA 4GZ3A 3BG1B 2CG3A 2DVWA 5B1BE 2PM7A 3TG4A 1E7VA 2I2OA 1BLXB 3Q79A 4GZCA 1OWMA 5KJNA 3MEKA 3L08A 3CHSA 1H2UA 4K5BA 3PEVB 3GZSA 5BNWA 3QC1A 1MYOA 4HNAD 3ASHA 3HIZA 3TWTA 3TWSA 3CK8A 3VLFA 4N5QA 3NF1A 4XKBA 4AP2A 4O60A 4DUIA 3UM2A 5CCLA 1PY1A 3B7BA 4DI4A 4DX7D 2HR2A 4WNDA 5CCMA 1ZBPA 4EPZA 1SW6A 3R7RA 4P29A 3CK9A 3LVRE 1N4RA 2XENA 3LY8A 4AXHA 3S7DA 1Z6TA 2FEZA 2VSNA 4XIFA 3ZFWA 1E96B 2X6JA 1Z3XA 3EU9A 5BUZA 3Q75A 3CSTA 2ETCA 2PQNA 3E34A 3B7SA 1JCRA 2RD0A 1X5BA 3CSFA 4GZ6A 5EDSA 5T4YA 1HX8A 3ABKE 5JJTA 4G2VA 2VYIA 3LCAA 2X6FA 2LXMA 3U64A 3U3WA 3VTYA 1QBQA 5CHEE 3EHNA 4U8HA 3RO3A 3EHMA 2F8YA 3NZSA 1EPUA 1HS6A 3HXDA 1YMPA 3L17A 1JWFA 4URKA 4N3BA 4B89A 3FTSA 3HXBA 1OY3D 3CKCA 3ONKA 3QKYA 4UI9K 4I6GA 3G2TA 1MZCA 1TNYA 4UQXA 4Y6CA 3B7TA 2DIWA 4DPRA 3FU3A 2WXHA 1UN8A 4LEUA 5FWQA 3AS8A 4A3VA 4I17A 3PE3A 4JEHA 3HVEA 2DBAA 4U0SA 2YQ8A 4RQIA 2JLBA 2RFMA 4F7AA 2VSYA 4IULA 2EIME 3DSTA 3DRAA 3ABME 5FT9A 1BPOA 5HRYA 4WAFA 4K5AB 3UUXA 1A17A 5ARFA 1MX2A 5EYPF 4GB9A 2QC9A 2X38A 2EIKE 5A23A 3CKBA 3EUVA 2M63A 1N95A 3TWXA 1AP7A 2KATA 3UMVA 4GCNA 5CMWA 2RKKA 3PZ1A 3GW4A 3ZYMA 5KJMA 1IYGA 1NP7A 2LNIA 4I43A 3R7QA 4DJAA 3CVXA 3D9OA 3L6AA 3GZ2A 3RSEG 1IXVA 4NQ0A 3CHQA 3ULYA 4FHKA 5CRVA 2DZNA 3C3QA 5C1DA 5FIOA 4FJZA 4CDRA 3ZPJA 1MHQA 4G25A 4K03A 3T5VA 4UWLA 5HQ8A 5AQAA 5EX3A 1SZ9A 3B7UX 4HBDA 3BUAA 4APFA 1JPLA 4HOQA 2WMNA 4HRNA 1INZA 3SNXA 4JPSA 1SQMA 3FH5A 5KNGA 2HO1A 3FTVA 4A3TA 2XHEA 1FT1A 4M7CA 4JD2G 2VGEA 3IKOB 2LUHA 3PNLB 2Y3AA 5BPPA 3CHMA 3I5PA 2GRLA 3SO8A 3FUJA 2KCKA 1WDYA 3TWQA 5ENTD 3UXGA 4A63B 4G23A 4CRWA 2ETAA 3QK0A 1FVFA 1NZNA 2WXFA 3PRZA 5CBOA 3S2AA 4ABNA 1WG0A 3SD5A 2I6HA 4FLBA 3FP3A 5FZQA 4L23A 3HHMA 1HG5A 3FTWA 4YNDA 1IQUA 2MRIA 4RG9A 3ZIMA 4HRLA 5FJYA 3MCXA 1UOHA 3TAXA 3TWRA 4F6RD 3DSWA 4EQFA 5D0OD 3MZLB 1QZ2A 5AJDA 1X81A 4N3CA 1SA5A 1Y6IA 3APDA 4TUUA 4R7LA 4JZYA 4C48B 3C72A 3JUIA 3EDTB 1TN8A 3V2XA 5J90A 2QYJA 3HVEB 2A5UA 3NOGD 1LD8A 3U66A 3J5QB 4BTAA 4UI9C 3ZNGA 4AIFA 1N4SA 3FTZA 3LVQE 2IFUA 4GYYA 3UKRG 4L2LA 4XE0A 3DXMG 2RG8A 1Z3YA 2DZOA 3PUJA 3ASNE 3NBNB 5D66A 1U3DA 4I9EA 4E6HA 3D9KA 4ANUA 4GMJA 2QFCA 3DEOA 2OEVA 4FP7A 4UI9J 1HF8A 3RU0A 2DCPA 2WXJA 5ANRA 1QYMA 2P58C 1SZAA 4BWRA 1TJFA 4JA7A 5EKQD 2KCLA 3ULEG 4YVQC 3DWLG 3KEZA 2E0IA 4DX6D 3ZYQA 1O1SA 1ZU2A 5CEAA 2XS1A 4AOFA 3AS5A 1UJJA 3DSUA 3X2QE 4KYOB 3EHQA 4X8QA 3D9PA 2WB2A 3I4RB 2ZXWE 2L9BA 3KSQA 4MLPA 4J7WA 4UWFA 3VLDA 5JHBA 4U7EB 2F0YA 3PVLA 4J0UA 3E30A 1OCZE 5FQ6A 3FEXA 4CT4A 4CEMA 1QNFA 4GPKA 2V4LA 3WXXA 5AQ9A 3D9HA 4J8SA 3PH0C 5AYWD 1GW6A 4GYWA 4WWNA 5AQ7A 1QQEA 3JQ0A 5AQBA 1IHGA 5BV0A 2GRNB 3FWVA 4MRUA 5G05C 3DSSA 3FU0A 5LX8A 1DC2A 3HG0D 3UT4A 1OCRE 1OUVA 3PUKA 1UJKA 4CDNA 2X6KA 5CEDB 3RRUA 5AENA 1YCSB 2OV8A 3FDHA 1S63A 4E85A 2XRYA 1D9SA 1ZB1A 4H7YA 4HVBA 5FQ4A 4CYMD 3CK7A 4HOTA 2Y69E 4A1SA 4J8YA 3UI2A 4GZ5A 4UQZA 2F37A 2ZU6B 4WUYA 4KZ0A 3LYAA 3HXCA 4FU3A 5ENPD 3K9IA 3APFA 1ELRA 4GA0A 4TV3A 3C98A 3IBEA 3T9KA 2EIJE 4BETA 2OVBA 2X3MA 1N54A 3T5XA 4Z68A 3DPDA 2WXOA 4OAUC 1IQRA 2DWZA 4WWPA 4Q94A 3LY7A 2CG2A 3ZKJA 2I1JA 1N9AA 3FU5A 3NQPA 3SZ7A 5HKPA 3PREA 4U63A 5KJLA 3ASDA 5FZRA 1EDUA 3NAWA 1ELKA 4U07A 4C0MA 2V0PA 4N39A 2ETBA 4GTMA 4PUCA 3L54A 3D9JA 3SY2A 4PS3A 3EIJA 4G8LA 4YDWA 1E8ZA 4OVUA 4Q96A 5KBAA 4JHRA 4O1PA 2IOLA 4BX9A 2Y4UA 3RK6A 5C2YA 5T8IA 2WXKA 2E2EA 2WVIA 4B8AA 3RJVA 4LSZE 3SBSA 3GYZA 4DX2A 4JA9A 4GA1A 4BEPA 3TGOA 2IO3C 4GTPA 2BF0X 4NURA 1PAQA 2L6JA 4ZFHA 4DLQA 4XEIG 3RO2A 4APOA 3Q4AB 2QYUA 3B95A 3ESKA 4Q69A 1KZPA 2J4DA 4I2ZA 2XQ0A 4GU5A 3N71A 4J8FA 3MV2B 3LXUX 3G2UA 2ZGGA 2XGSA 1U2VG 4EZLA 4N5CA 5FQ8A 3G2WA 1JCQA 3L13A 1ELWA 3ENEA 2KZTA 4JHJA 1H2VC 2HYZA 3FULA 1E8WA 2VSOE 4JVSA 1OXJA 4CZ2D 5BT1A 4NIKA 3PE4A 4L2YA 3TJPA 3KS2A 1JWGA 4KBQA 4FA6A 2H6HA 3AS4A 4GA2A 3SF4A 5BXUA 3UX4A 3B13A 1RZ4A 1HU3A 3AJIA 3IHVA 3Q7AA 3P1UA 4N3AA 1DCQA 3SFXA 3OXLA 2OOEA 3C5RA 2C0MA 4MBGA 4XX5A 1MQSA 1UG3A 3QARA 1OWOA 2R02A 5CBNA 1O1RA 3J5PA 2YHCA 4YDEA 4I9CA 2UY1A 5ANLA 4UWKA 5T3RA 5ENQD 4LERA 3V2OA 4AVXA 5AIJA 4U8VD 1OCOE 5FQ7A 3ULQA 5E75A 3NB2A 4BSZB 2FO1E 2OEWA 2A5EA 4U96D 4RLYA 1N11A 3LEWA 2PM6A 2XZTG 2EILE 3AAAC 1YYHA 4RG6A 1N0RA 3O48A 4I2WA 4OYSA 2VGXA 5E76A 4ILHB 2PQRA 3ZGQA 2AXZA 3CVUA 4AV7A 4BT9A 3P2BA 1KT0A 2VTBA 3DEPA 3I3NA 2LSUA 3E32A 3URZA 4CGVA 2CHXA 1Z5SC 1RW2A 5KJKA 4WWOA 4AJWA 3U9WA 1NL4A 5ENSD 2WQHA 4KVMA 4HI8A 3NZUA 1TN7A 1D8EA 1W3BA 2GW1A 2B0OE 5LCWC 4CT0A 5DIZA 4RSYA 2VGYA 2MHKA 3ASFA 5AARA 4BT8A 4BSXA 2IJGX 2BKKB 2XEVA 2I1KA 4BX8A 3D9IA 3UM0A 2XRZA 4HB5A 1UN9A 2XCBA 3OAWA 3MKQA 1H2TC 4F53A 1S0PA 3S7BA 3ZUVB 5EIBE 2GRPB 3CHRA 3UM3A 1N0QA 3RIBA 2HM8A 3S7JA 1IHBA 3KEAA 3SBTB 2XPZA 3FEYA 3MJWA 2WXQA 4CCAA 2L0IA 1L5JA 4UQYA 2I9CA 1O1TA 1LF8A 4I6EA 2UWJG 5BXOA 3JYSA 3RAUA 4U04A 1N94A 3R9AB 1K3ZD 3D9MA 2FULA 2XGOA 5BV1A 5FINA 3ZVVA 5H7PA 3FUKA 2XS8A 4OVVA 3LS8A 4UWHA 3V79K 2P9SG 2V5FA 1H19A 2DYSE 4LNUD 3UM1A 3UINC 4LCTA 5B1AE 3RRMB 4GTOA 2XEEA 5G55A 1FVHA 4HLEA 4K0RA 3ASOE 3UT7A 5HS0A 4A1GA 3V30A 4N2QA 5G04C 2ONDA 3DSXA 3LDZA 3Q47B 4GTTA 3ASGA 4HLLA 1KPSB 3E37A 3DPYA 2IEJA 2F8XK 4ATZD 3BG0B 1HO8A 4H7XA 2P2CP 3ZHEA 2HE0A 5G04J 5BW8C 4GTRA 5M72A 3BQOA 2KBXA 5KCMA 3Q7FA 4PS8A 2Y0BG 3TXMA 1KT1A 5CERB 1K1AA 4C9BB 1IKND 4G8KA 5JMND 2XCCA 5AN8A 4JC8A 1NA0A 5ITZF 2EQXA 3FUHA 2OCCE 2WXLA 4AEZC 2RFAA 5EIDA 5HI7A 3L16A 1N4QA 2KCVA 4MS6A 3AG3E 4GTQA 4M3OA 2WQ7A 2BUGA 1BD8A 1WAO1 1NI1A 2BEDA 4FULA 3SFYA 2DYRE 4TXQA 4XI9A 3OTNA 3WG7E 2JEKA 5CMYA 3U4TA 1Y8MA 2ZIRA 3TWUA 3JCKC 4HRMB 4RVBA 4GTVA 5JA4D 3DBSA 2PZIA 4DK5A 4JW1A 3CHOA 4W9RA 5AAOA 3UQ3A 2XGMA 3DSVA 3G2VA 2GRRB 4U95D 1HFAA 5G05J 4JL0A 3E33A 3CEQA 1H6KA 2GROB 3F6QA 4DLOA 4PDXA 2XZDG 2C2LA 1O5MA 1DVPA 1SA4A 3CVQA 3LPZA 4ZHBA 2YHEA 3Q5MA 4ANVA 2NXPA 3VLEA 3ZN3A 1DCEA 4BTBA 2B6CA 4AY5A 4HOUA 4YVOA 1YA0A 1FCHA 4B94A 3AG4E 4B8CB 5G2NA 2QZAA 3S7FA 1A5EA 3PS6A 2FF4A 3I4GA 4HI9A 2XEHA 3CVNA 2V8SE 2WM9A 1P5QA 4B0ZA 3Q49B 3OXGA 3V31A 4IN3B 3T8KA 4KXKB 4DI3A 3ZRHA 5CRUA 3PEUB 1S70B 2R03A 3ZXPA 3MV3B 2CFZA 2J8SD 4JB8P 2MYOA 4ME2A 2L6BA 4CGWA 2KXPC 3EU5A 3PZDA 4XZ4A 1JUQA 3FH7A 4I1OB 3HYMB 3LKUA 4IRUA 2P9PG 1VDYA 3UTMA 4LUNU 2WMOA 3Q73A 4QFVA 4L1BA 2BKGA 1H6OA 3MX3A 3ML9A 2YNQA 3W9GA 4EBAG 1HXIA 1S64A 3D9NA 4G26A 3CVYA 5ARGA 4EZJA 4IYPA 2VSXE 3ML8A 3ZHEB 2AWIA 4DX5D 3L22A 3QOUA 5D2MC 1KZOA 3GZ1A 4AM9A 3SHFA 3UKUG 2WXMA 2KM4A 4GMRA 1HG2A 3T8MA 4HFGA 4FHJA 3TXNA 2ILRA 3LJNA 2FBNA 2WXIA 3QDNA 3FUDA 4TXPA 2LAHA 1OCCE 3RRNB 3ZYLA 4DX1A 1LD7A 2VJ8A 1TNUA 5KWDA 4WNFA 4F3VA 2C0LA 1TNZA 2NSZA 2OVFA 4ACLA 1WY6A 4HXIA 4ILGA 1TNBA 3HXFA 4ILIA 2R59A 2R05A 2AVPA 4N2SA 2LO6A 3L9TA 3FUFA 3QAQA 5AJLA 4L7TA 2CHWA 4C0EA 3IXEA 2AW6A 3BU8A 3CQCB 5ENOD 1E8XA 3CVVA 3QWWA 1TEZA 4XI0A 3QWPA 1TN6A 1D8DA 2V5QC 4JHKA 3MGBA 4TXRA 1OWPA 2WQ6A 3SFZA 1HH8A 1PC2A 4G24A 3C3RA 3MA5A 2LSVA 3MYVA 5EX0A 4FJYA 2P9NG 3BEEA 5J08A 1NFIE 2ZISA 5ENNA 3FUIA 3IEGA 3CLJA 3D3MA 2AXVA 3CHPA 4GZDA 4O6FA 1LTXA 3CR3A 2WXGA 5JHAA 3SGHA 4I1AA 4ATGA 4PH4B 2J07A 1EF1C 4J8EA 4MKTA 1G3NB 1MX4A 3JUEA 3O4ZA 1BI8B 1Q2ZA 2VQ2A 4ACKA 3FUMA 5DBKA 1V55E 3KSLA 3PDNA 3E4BA 4FADA 4QQIA 5EYLA 3ABLE 4BFRA 2V4HC 3OXFA 3Q15A 2IO2C 4Y6WA 4GAAA 2PNNA 4BY6A 2LXLA 3CIAA 4F1SA 1BU9A 4D10C 1KLXA 2IY0C 3QB2A 3AG2E 4KVOA 2IOSA 2R5SA 4GYOA 1TNOA 4LRZA 3JXJA 3FTUA 4I6JA 3IHYA 3FH8A 4KZCA 1H6PA 2LAIA 4FC8A 2IQCA 1MJ0A 2IF4A 3R9MA 1E8YA 2J09A 4NACA 4CDMA 2AXUA 1NA3A 5IY5E 5A7DB 3QNKA 4ANWA 2J49A 4BESA 1EYHA 3APCA 1OWLA 1OWNA 2XPYA 3ZU7B 3ONLA 1U3CA 3MKRA 4GPMA 3G2SA 4EBAA 5LCWJ 3LY9A 4EECA 1K8KG 2EINE 3KAEA 3ZW3A 3TG5A 3RKVA 4XKCA 1OT8A 3L82A 4WNGA 2KZTB 3CVPA 1BI7B 3JQ1A 1HZ4A 3FHEA 3FUEA 1E7UA 3HRAA 3HDXA 1AWCB 2WPVA 2H6IA 2YINA 5B3SE 3EHRA 2H6GA 1XNFA 3CVLA 4U0ZA 2WXRA 3Q78A 3TL5A 2H6FA 4HS2A 3FFLA 4UWGA 2X6HA 3CVWA 2BTDA 3FY4A 4U0UA 4K5CA 4O1OA 3EJNA 2CHZA 2J9QA 1K1BA 5A6CA 4ANXA 4A55A 3PZ4A 4LNBA 2R2LA 4G1TA 3HXEA 1HE8A 3TWWA 3ZEFA
chains in the Genus database with same CATH topology
4I2ZA 4PDXA 1N52A 2XQ0A 2C2LA 4GU5A 2X6IA 3N71A 1DVPA 1JPLA 1DNPA 4J8FA 4HOQA 2WMNA 2UY1B 3MV2B 3G2UA 3LXUX 5LOZA 1H0AA 1INZA 3CVQA 2XGSA 3SNXA 4JPSA 3LPZA 2WXPA 4EZLA 1SQMA 4GCOA 4AY6A 2YHEA 3Q5MA 3FH5A 4N5CA 2NXPA 4V3IA 5FQ8A 3VLEA 2HO1A 3G2WA 3FTVA 3ZN3A 3ZYKA 4A3TA 4BTBA 4AY5A 4JXTA 2XHEA 4HOUA 4YVOA 5D0QD 2FO7A 3L13A 1ELWA 1YA0A 3KD7A 1FCHA 3ENEA 4B94A 2KZTA 4JHJA 3IV0A 1H2VC 3FUNA 3IKOB 2HYZA 3CQGB 3FULA 3PNLB 1E8WA 2VSOE 4B8CB 2Y3AA 5G2NA 5BPPA 4JVSA 3CHMA 3I5PA 2GRLA 3FTYA 3VTXA 3S7FA 2GRMA 3PS6A 5BT1A 2FF4A 3I4GA 3PE4A 3FUJA 4L2YA 3TJPA 3CVNA 3CV0A 3ZXSA 3LJ3A 1E90A 3KS2A 2V8SE 1JWGA 2WM9A 5FTPA 1P5QA 2KCKA 4B0ZA 4KBQA 4FA6A 3Q49B 3AS4A 4GA2A 3OXGA 3SF4A 2PL2A 4G23A 3UX4A 4IN3B 4CRWA 4KXKB 3B13A 3QK0A 1HU3A 3UPVA 1FVFA 1NZNA 2WXFA 2VGXB 4DI3A 3PRZA 3ZRHA 3S2AA 4ABNA 3IHVA 3QWVA 3PEUB 2MOWA 3SD5A 2KC7A 2VTBB 2I6HA 3MV3B 4FLBA 3FP3A 5FZQA 3AU4A 2CFZA 3P1UA 4L23A 4N3AA 3OXLA 3HHMA 2OOEA 4ME2A 4CGWA 4J8DA 2C0MA 1HG5A 3FTWA 4YNDA 1IQUA 3UT8A 3PZDA 4XX5A 1MQSA 4XZ4A 1JUQA 4FLHA 2MRIA 1UG3A 3QARA 4RG9A 1OWOA 3FH7A 3PNTB 3ZIMA 4JEUA 3MCXA 4I1OB 5FJYA 2YHCA 3TAXA 3AU5A 4I1MA 3EIQC 4I9CA 4EQFA 5D0OD 2UY1A 3HYMB 1QZ2A 3MZLB 5ANLA 3LKUA 4IRUA 4UWKA 5AJDA 2Y4TA 5T3RA 3D9LA 4N3CA 1VDYA 2L0TB 1WM5A 1Y6IA 4LERA 4LUNU 3ESLA 2WMOA 3APDA 4QFVA 4TUUA 4L1BA 4AVXA 5AIJA 3MX3A 4JZYA 4R7LA 5FQ7A 3ML9A 3JUIA 3ULQA 2YNQA 5E75A 4EBAG 3EDTB 4HOSA 1HXIA 5LP0A 3D9NA 4G26A 3CVYA 3FTXA 5J90A 5ARGA 4EZJA 2A4ZA 3HVEB 2A5UA 4PS7A 4IYPA 2VSXE 3B7RL 3ML8A 3ZHEB 2AWIA 2R17C 3LEWA 2PM6A 2FI7A 2IU1A 3L22A 3U66A 2J08A 2J4BA 4BTAA 1UW4B 2GGFA 5LFAA 4UI9C 3QOUA 4AIFA 2WXNA 3FTZA 3GZ1A 4AM9A 4KT6B 3LVQE 3SHFA 4RG6A 2WXMA 4TRQA 2QY7A 2IFUA 2KM4A 5JJ6A 4GYYA 3O48A 1HG2A 3MKQB 1XGWA 4I2WA 3T8MA 4OYSA 2VGXA 5E76A 4HFGA 4L2LA 4ILHB 2PQRA 1B89A 4XE0A 2CFUA 4FHJA 3TXNA 2AXZA 2RG8A 3FU6A 2ILRA 4G11A 3SI5A 3ZGQA 4AV7A 3P2BA 1KT0A 3CGHA 4BT9A 2FBNA 2WXIA 2VTBA 3QDNA 1Z3YA 3FUDA 2LAHA 2IONA 3PUJA 3I3NA 3RRNB 3ZYLA 2LSUA 4GMLA 3QJZA 5JJ7A 2VJ8A 5FZSA 1U3DA 3URZA 4CGVA 4I9EA 4E6HA 3D9KA 2CHXA 4ANUA 4WNFA 4F3VA 2C0LA 2NSZA 4GMJA 2OVFA 4ACLA 2QFCA 4NRHB 4ANVA 1WY6A 5KJKA 4FP7A 4UI9J 1TJCA 4WWOA 1HF8A 4HXIA 4ILGA 4HORA 3RU0A 4J6IA 4ILIA 2DCPA 4AJWA 2Q7FA 2R59A 3U9WA 2WXJA 2NC9A 2WQHA 4KMOA 4WNEA 2P58C 2XPIA 4KVMA 2AVPA 1SZAA 5ANRA 4N2SA 2LO6A 4BWRA 3FUFA 4GZ3A 3BG1B 3QAQA 5AJLA 2CG3A 3NZUA 2CHWA 4L7TA 1TJFA 4JA7A 2PM7A 4C0EA 5EKQD 3TG4A 1E7VA 2I2OA 1W3BA 2AW6A 2KCLA 2GW1A 4YVQC 5LCWC 3CQCB 3KEZA 1E8XA 4CT0A 5DIZA 2E0IA 3CVVA 3QWWA 4GZCA 4RSYA 1TEZA 2VGYA 1OWMA 2MHKA 3ASFA 5KJNA 4XI0A 3MEKA 3L08A 3CHSA 1H2UA 3PEVB 4BT8A 3QWPA 3ZYQA 4BSXA 1ZU2A 2IJGX 3GZSA 4AOFA 5BNWA 2XEVA 4JHKA 3AS5A 3MGBA 1UJJA 2I1KA 1OWPA 3QC1A 4APFA 4KYOB 2WQ6A 3SFZA 4BX8A 1HH8A 3D9PA 1PC2A 4G24A 2WB2A 3D9IA 3ASHA 3HIZA 3I4RB 2XRZA 3MA5A 2L9BA 2LSVA 1UN9A 3CK8A 3VLFA 3MYVA 5EX0A 2XCBA 3OAWA 3NF1A 3MKQA 4MLPA 4UWFA 3VLDA 4XKBA 4AP2A 5JHBA 1H2TC 4FJYA 4F53A 1S0PA 3BEEA 3PVLA 5CCLA 4J0UA 5J08A 3S7BA 1PY1A 3CHRA 5FQ6A 3FEXA 4CT4A 2HR2A 4WNDA 5ENNA 4CEMA 1QNFA 4DI4A 3FUIA 3IEGA 4GPKA 3CLJA 2V4LA 2AXVA 3D3MA 3CHPA 4GZDA 3WXXA 5CCMA 1ZBPA 3RIBA 4EPZA 3R7RA 2HM8A 4J8SA 3S7JA 4P29A 3CK9A 4O6FA 3PH0C 3SBTB 2XPZA 2WXGA 3CR3A 3FEYA 3LVRE 3MJWA 1GW6A 4GYWA 4WWNA 5AYWD 3SGHA 5JHAA 4AXHA 2WXQA 3LY8A 1QQEA 3JQ0A 3S7DA 1Z6TA 4CCAA 2L0IA 4I1AA 4ATGA 2FEZA 1L5JA 4UQYA 2I9CA 1LF8A 4PH4B 2J07A 4I6EA 1EF1C 2UWJG 2VSNA 4J8EA 4XIFA 4MKTA 3ZFWA 3JYSA 1IHGA 4U04A 5BV0A 3FWVA 4MRUA 5G05C 3FU0A 1E96B 3R9AB 5LX8A 2X6JA 1Z3XA 3D9MA 2FULA 2XGOA 3O4ZA 5BV1A 5BUZA 3UT4A 3ZVVA 1OUVA 3CSTA 3PUKA 1UJKA 4CDNA 2X6KA 3FUKA 2VQ2A 4OVVA 3RRUA 2PQNA 4ACKA 3LS8A 3B7SA 3FUMA 5AENA 2RD0A 1X5BA 3CSFA 4GZ6A 5EDSA 2OV8A 3FDHA 4UWHA 5DBKA 5T4YA 4E85A 2XRYA 2V5FA 1HX8A 3PDNA 4H7YA 1H19A 4HVBA 3E4BA 4FADA 5FQ4A 3CK7A 4HOTA 5JJTA 4BFRA 4G2VA 2VYIA 3LCAA 4LCTA 3RRMB 2X6FA 3OXFA 4A1SA 3U64A 3Q15A 3U3WA 4Y6WA 4GAAA 3VTYA 4BY6A 5CHEE 1FVHA 5G55A 4HLEA 3EHNA 4K0RA 3CIAA 4GZ5A 4U8HA 4F1SA 4UQZA 2J4DA 2ZU6B 3CVUA 4WUYA 4KZ0A 3UT7A 4D10C 1KLXA 3RO3A 3LYAA 3QB2A 4A1GA 3EHMA 3NZSA 1EPUA 4KVOA 1HS6A 4N2QA 4FU3A 2IOSA 2ONDA 2R5SA 4GYOA 4LRZA 3L17A 3K9IA 1JWFA 5G04C 4URKA 4N3BA 4B89A 3APFA 3FTSA 3FTUA 1ELRA 4GA0A 4I6JA 4TV3A 3C98A 3IHYA 3FH8A 3LDZA 4KZCA 4FC8A 2LAIA 2IQCA 3CKCA 3ONKA 3QKYA 3IBEA 3Q47B 4UI9K 4I6GA 3G2TA 4UQXA 3ASGA 4Y6CA 3B7TA 2OVBA 2DIWA 2IF4A 2X3MA 1N54A 3T5XA 4DPRA 1E8YA 3FU3A 2J09A 2WXHA 3DPDA 2WXOA 1IQRA 1UN8A 4WWPA 4LEUA 4NACA 5FWQA 4CDMA 2AXUA 1NA3A 3AS8A 4A3VA 5A7DB 3QNKA 4ANWA 2J49A 3BG0B 1HO8A 4I17A 3PE3A 4Q94A 4JEHA 4H7XA 3HVEA 1EYHA 2DBAA 3APCA 1OWLA 4U0SA 3ZHEA 1OWNA 2XPYA 2YQ8A 3LY7A 2JLBA 5G04J 2CG2A 5BW8C 4F7AA 2VSYA 3ONLA 1U3CA 3MKRA 2I1JA 4IULA 3FU5A 3NQPA 3SZ7A 5M72A 3PREA 5FT9A 1BPOA 4U63A 5KCMA 3G2SA 4WAFA 4EBAA 4PS8A 5KJLA 3ASDA 5FZRA 3UUXA 3TXMA 1EDUA 1ELKA 1KT1A 1A17A 4U07A 4C9BB 4C0MA 5ARFA 2V0PA 5LCWJ 4N39A 4GB9A 3LY9A 4EECA 2XCCA 2X38A 4JC8A 4PUCA 3L54A 5A23A 1NA0A 3CKBA 2EQXA 3FUHA 3D9JA 3KAEA 2WXLA 3TG5A 2M63A 4PS3A 3EIJA 3RKVA 4XKCA 4AEZC 3ZW3A 5HI7A 2KATA 3UMVA 4GCNA 5CMWA 3L16A 1E8ZA 2KCVA 4MS6A 4WNGA 4EZKA 2KZTB 4M3OA 3CVPA 3GW4A 2WQ7A 2BUGA 4OVUA 3ZYMA 5KJMA 1WAO1 3JQ1A 1HZ4A 3FHEA 4Q96A 3FUEA 4FULA 1IYGA 1NP7A 2LNIA 1E7UA 4I43A 3R7QA 3HDXA 4DJAA 2WPVA 2YINA 4JHRA 3CVXA 2IOLA 3D9OA 3L6AA 4XI9A 4BX9A 1XNFA 2Y4UA 3GZ2A 3OTNA 3RK6A 2JEKA 3CVLA 4U0ZA 5C2YA 2WXRA 5CMYA 5T8IA 2WXKA 2E2EA 2WVIA 3TL5A 4B8AA 4HS2A 3FFLA 4UWGA 4NQ0A 3CHQA 3RJVA 2X6HA 3U4TA 3SBSA 3GYZA 4FHKA 4JA9A 4GA1A 3CVWA 2BTDA 1Y8MA 3FY4A 3JCKC 4U0UA 5C1DA 4RVBA 3EJNA 3TGOA 4FJZA 2BF0X 3DBSA 2CHZA 2J9QA 2PZIA 4NURA 4CDRA 1PAQA 2L6JA 4DLQA 3ZPJA 4DK5A 5A6CA 4JW1A 4ANXA 3CHOA 4W9RA 4A55A 3UQ3A 1MHQA 3RO2A 2XGMA 3G2VA 4APOA 4G25A 4K03A 3T5VA 3Q4AB 4UWLA 4G1TA 1HFAA 5HQ8A 5G05J 3ESKA 4JL0A 4Q69A 3CEQA 5EX3A 1H6KA 1HE8A 3ZEFA 1SZ9A 3B7UX 4DLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2Z A;  2C2L A;  3N71 A;  4J8F A;  4HOQ A;  3MV2 B;  2UY1 B;  3CVQ A;  2XGS A;  3LPZ A;  4AY6 A;  4GCO A;  3Q5M A;  4N5C A;  2HO1 A;  3ZN3 A;  4BTB A;  4AY5 A;  4HOU A;  4YVO A;  5D0Q D;  2FO7 A;  1ELW A;  1YA0 A;  3KD7 A;  1FCH A;  4B94 A;  2HYZ A;  3VTX A;  3S7F A;  5BT1 A;  2FF4 A;  3PE4 A;  3CVN A;  3CV0 A;  5FTP A;  3KS2 A;  1P5Q A;  2KCK A;  4KBQ A;  3Q49 B;  3AS4 A;  4GA2 A;  3OXG A;  3SF4 A;  2PL2 A;  4G23 A;  4IN3 B;  4KXK B;  3UPV A;  1NZN A;  2VGX B;  4ABN A;  3QWV A;  2KC7 A;  2I6H A;  3MV3 B;  3FP3 A;  5FZQ A;  4N3A A;  3OXL A;  4ME2 A;  2OOE A;  4CGW A;  4J8D A;  2C0M A;  4YND A;  4RG9 A;  5FJY A;  2YHC A;  3TAX A;  4I9C A;  4EQF A;  5D0O D;  2UY1 A;  3HYM B;  1QZ2 A;  3LKU A;  2Y4T A;  4N3C A;  1WM5 A;  3ULQ A;  3EDT B;  4HOS A;  1HXI A;  4G26 A;  5ARG A;  3ZHE B;  2FI7 A;  4BTA A;  4UI9 C;  3QOU A;  4AIF A;  3GZ1 A;  4AM9 A;  4RG6 A;  2IFU A;  5JJ6 A;  4GYY A;  3O48 A;  4I2W A;  2VGX A;  2PQR A;  1B89 A;  3ZGQ A;  4BT9 A;  1KT0 A;  2FBN A;  3QDN A;  2LSU A;  5JJ7 A;  5FZS A;  3URZ A;  4CGV A;  4I9E A;  4WNF A;  4F3V A;  2C0L A;  2QFC A;  4NRH B;  5KJK A;  4UI9 J;  1TJC A;  4HOR A;  3RU0 A;  2Q7F A;  2NC9 A;  2WQH A;  4WNE A;  2P58 C;  2XPI A;  2AVP A;  4N2S A;  4BWR A;  4GZ3 A;  4JA7 A;  5EKQ D;  3TG4 A;  2KCL A;  1W3B A;  2GW1 A;  4YVQ C;  5LCW C;  5DIZ A;  3QWW A;  2VGY A;  2MHK A;  3ASF A;  5KJN A;  4XI0 A;  3MEK A;  4BT8 A;  3QWP A;  1ZU2 A;  5BNW A;  2XEV A;  3AS5 A;  4KYO B;  1HH8 A;  1PC2 A;  4G24 A;  3ASH A;  3MA5 A;  2LSV A;  3CK8 A;  5EX0 A;  2XCB A;  3NF1 A;  3BEE A;  5CCL A;  4J0U A;  3S7B A;  2HR2 A;  4WND A;  3IEG A;  4GPK A;  5CCM A;  3WXX A;  1ZBP A;  3RIB A;  3S7J A;  3CK9 A;  4O6F A;  5AYW D;  4GYW A;  3LY8 A;  1QQE A;  3S7D A;  4I1A A;  2FEZ A;  4UQY A;  2UWJ G;  2VSN A;  4J8E A;  4XIF A;  3ZFW A;  3JYS A;  1IHG A;  4U04 A;  3FWV A;  5G05 C;  1E96 B;  3R9A B;  2XGO A;  1OUV A;  2VQ2 A;  2PQN A;  4GZ6 A;  5DBK A;  2V5F A;  3PDN A;  4H7Y A;  3E4B A;  3CK7 A;  4HOT A;  5JJT A;  4G2V A;  2VYI A;  3LCA A;  3OXF A;  4A1S A;  3Q15 A;  3U3W A;  4Y6W A;  3VTY A;  5CHE E;  4GZ5 A;  4UQZ A;  4WUY A;  1KLX A;  3RO3 A;  3LYA A;  4N2Q A;  5G04 C;  2OND A;  2R5S A;  4GYO A;  3K9I A;  4N3B A;  1ELR A;  4GA0 A;  3CKC A;  3QKY A;  3Q47 B;  4UI9 K;  4UQX A;  3ASG A;  4Y6C A;  2IF4 A;  4LEU A;  1NA3 A;  3AS8 A;  5A7D B;  4I17 A;  3PE3 A;  4H7X A;  2DBA A;  4U0S A;  3ZHE A;  2YQ8 A;  3LY7 A;  2JLB A;  5G04 J;  5BW8 C;  2VSY A;  3MKR A;  3SZ7 A;  5M72 A;  5FT9 A;  5KJL A;  3ASD A;  5FZR A;  3UUX A;  1KT1 A;  1A17 A;  4U07 A;  5ARF A;  5LCW J;  4N39 A;  3LY9 A;  2XCC A;  1NA0 A;  3CKB A;  3KAE A;  3TG5 A;  3RKV A;  5HI7 A;  2KAT A;  4GCN A;  2KCV A;  4WNG A;  3CVP A;  3GW4 A;  2BUG A;  5KJM A;  1WAO 1;  1HZ4 A;  1IYG A;  2LNI A;  2WPV A;  4JHR A;  4XI9 A;  1XNF A;  2Y4U A;  3GZ2 A;  3CVL A;  4U0Z A;  2E2E A;  3FFL A;  4NQ0 A;  3RJV A;  3U4T A;  3GYZ A;  4JA9 A;  4GA1 A;  1Y8M A;  4U0U A;  5C1D A;  3TGO A;  2J9Q A;  2PZI A;  4CDR A;  2L6J A;  3ZPJ A;  5A6C A;  4W9R A;  3UQ3 A;  3RO2 A;  2XGM A;  4APO A;  4G25 A;  3Q4A B;  4G1T A;  5HQ8 A;  5G05 J;  3ESK A;  4JL0 A;  3CEQ A;  5EX3 A; 
#chains in the Genus database with same CATH topology
 1N52 A;  3ISM C;  2X6I A;  1DNP A;  2UY1 B;  5LOZ A;  1H0A A;  2WXP A;  4AY6 A;  4GCO A;  3C3O A;  4V3I A;  3ZYK A;  4JXT A;  5KNH D;  5D0Q D;  2FO7 A;  5CEC B;  3KD7 A;  3AG1 E;  3IV0 A;  5EIL A;  1MX6 A;  1V54 E;  3FUN A;  4L9P A;  3CQG B;  4DRX E;  4EHM A;  3SQV A;  3FTY A;  3VTX A;  1TYQ G;  3Q9U C;  2GRM A;  2P9K G;  4LNG A;  3W9F A;  3ZXS A;  3CV0 A;  3LJ3 A;  1E90 A;  5FTP A;  2ZGD A;  3DXK G;  2P9L G;  2GRQ B;  2PL2 A;  1FPP A;  3UPV A;  2VGX B;  3QWV A;  2MOW A;  5EN5 D;  2KC7 A;  2VTB B;  1SVX A;  3AU4 A;  4OAV B;  4J8D A;  3UT8 A;  4FLH A;  3PNT B;  4JEU A;  1FT2 A;  3AU5 A;  4I1M A;  3EIQ C;  3Q9N C;  3TWV A;  2Y4T A;  3UIO C;  3D9L A;  2L0T B;  4F1P A;  1WM5 A;  2JAB A;  2NYJ A;  3ESL A;  4TUM A;  4HOS A;  4HQD A;  4LG6 A;  4YDO A;  5LP0 A;  3FTX A;  2A4Z A;  4PS7 A;  3B7R L;  3PZ2 A;  2R17 C;  2FI7 A;  2IU1 A;  2J08 A;  2J4B A;  1UW4 B;  2GGF A;  5LFA A;  4U8Y D;  3UIP C;  2WXN A;  2P9U G;  1JCS A;  4KT6 B;  3JXI A;  4UUC A;  4TRQ A;  2QY7 A;  2Y1L E;  5JJ6 A;  4B93 B;  3MKQ B;  1XGW A;  1B89 A;  2CFU A;  4EZK A;  3FU6 A;  4G11 A;  4BER A;  3SI5 A;  3CGH A;  4YDY A;  2ION A;  4GML A;  3NOC D;  3QJZ A;  5JJ7 A;  5FZS A;  5ENR D;  4GTS A;  4NRH B;  3PZ3 A;  1TR4 A;  1TJC A;  2P9I G;  4HOR A;  2AJA A;  4J6I A;  2Q7F A;  1N4P A;  2NC9 A;  4KMO A;  4WNE A;  2XPI A;  4GZ3 A;  3BG1 B;  2CG3 A;  2DVW A;  5B1B E;  2PM7 A;  3TG4 A;  1E7V A;  2I2O A;  1BLX B;  3Q79 A;  4GZC A;  1OWM A;  5KJN A;  3MEK A;  3L08 A;  3CHS A;  1H2U A;  4K5B A;  3PEV B;  3GZS A;  5BNW A;  3QC1 A;  1MYO A;  4HNA D;  3ASH A;  3HIZ A;  3TWT A;  3TWS A;  3CK8 A;  3VLF A;  4N5Q A;  3NF1 A;  4XKB A;  4AP2 A;  4O60 A;  4DUI A;  3UM2 A;  5CCL A;  1PY1 A;  3B7B A;  4DI4 A;  4DX7 D;  2HR2 A;  4WND A;  5CCM A;  1ZBP A;  4EPZ A;  1SW6 A;  3R7R A;  4P29 A;  3CK9 A;  3LVR E;  1N4R A;  2XEN A;  3LY8 A;  4AXH A;  3S7D A;  1Z6T A;  2FEZ A;  2VSN A;  4XIF A;  3ZFW A;  1E96 B;  2X6J A;  1Z3X A;  3EU9 A;  5BUZ A;  3Q75 A;  3CST A;  2ETC A;  2PQN A;  3E34 A;  3B7S A;  1JCR A;  2RD0 A;  1X5B A;  3CSF A;  4GZ6 A;  5EDS A;  5T4Y A;  1HX8 A;  3ABK E;  5JJT A;  4G2V A;  2VYI A;  3LCA A;  2X6F A;  2LXM A;  3U64 A;  3U3W A;  3VTY A;  1QBQ A;  5CHE E;  3EHN A;  4U8H A;  3RO3 A;  3EHM A;  2F8Y A;  3NZS A;  1EPU A;  1HS6 A;  3HXD A;  1YMP A;  3L17 A;  1JWF A;  4URK A;  4N3B A;  4B89 A;  3FTS A;  3HXB A;  1OY3 D;  3CKC A;  3ONK A;  3QKY A;  4UI9 K;  4I6G A;  3G2T A;  1MZC A;  1TNY A;  4UQX A;  4Y6C A;  3B7T A;  2DIW A;  4DPR A;  3FU3 A;  2WXH A;  1UN8 A;  4LEU A;  5FWQ A;  3AS8 A;  4A3V A;  4I17 A;  3PE3 A;  4JEH A;  3HVE A;  2DBA A;  4U0S A;  2YQ8 A;  4RQI A;  2JLB A;  2RFM A;  4F7A A;  2VSY A;  4IUL A;  2EIM E;  3DST A;  3DRA A;  3ABM E;  5FT9 A;  1BPO A;  5HRY A;  4WAF A;  4K5A B;  3UUX A;  1A17 A;  5ARF A;  1MX2 A;  5EYP F;  4GB9 A;  2QC9 A;  2X38 A;  2EIK E;  5A23 A;  3CKB A;  3EUV A;  2M63 A;  1N95 A;  3TWX A;  1AP7 A;  2KAT A;  3UMV A;  4GCN A;  5CMW A;  2RKK A;  3PZ1 A;  3GW4 A;  3ZYM A;  5KJM A;  1IYG A;  1NP7 A;  2LNI A;  4I43 A;  3R7Q A;  4DJA A;  3CVX A;  3D9O A;  3L6A A;  3GZ2 A;  3RSE G;  1IXV A;  4NQ0 A;  3CHQ A;  3ULY A;  4FHK A;  5CRV A;  2DZN A;  3C3Q A;  5C1D A;  5FIO A;  4FJZ A;  4CDR A;  3ZPJ A;  1MHQ A;  4G25 A;  4K03 A;  3T5V A;  4UWL A;  5HQ8 A;  5AQA A;  5EX3 A;  1SZ9 A;  3B7U X;  4HBD A;  3BUA A;  4APF A;  1JPL A;  4HOQ A;  2WMN A;  4HRN A;  1INZ A;  3SNX A;  4JPS A;  1SQM A;  3FH5 A;  5KNG A;  2HO1 A;  3FTV A;  4A3T A;  2XHE A;  1FT1 A;  4M7C A;  4JD2 G;  2VGE A;  3IKO B;  2LUH A;  3PNL B;  2Y3A A;  5BPP A;  3CHM A;  3I5P A;  2GRL A;  3SO8 A;  3FUJ A;  2KCK A;  1WDY A;  3TWQ A;  5ENT D;  3UXG A;  4A63 B;  4G23 A;  4CRW A;  2ETA A;  3QK0 A;  1FVF A;  1NZN A;  2WXF A;  3PRZ A;  5CBO A;  3S2A A;  4ABN A;  1WG0 A;  3SD5 A;  2I6H A;  4FLB A;  3FP3 A;  5FZQ A;  4L23 A;  3HHM A;  1HG5 A;  3FTW A;  4YND A;  1IQU A;  2MRI A;  4RG9 A;  3ZIM A;  4HRL A;  5FJY A;  3MCX A;  1UOH A;  3TAX A;  3TWR A;  4F6R D;  3DSW A;  4EQF A;  5D0O D;  3MZL B;  1QZ2 A;  5AJD A;  1X81 A;  4N3C A;  1SA5 A;  1Y6I A;  3APD A;  4TUU A;  4R7L A;  4JZY A;  4C48 B;  3C72 A;  3JUI A;  3EDT B;  1TN8 A;  3V2X A;  5J90 A;  2QYJ A;  3HVE B;  2A5U A;  3NOG D;  1LD8 A;  3U66 A;  3J5Q B;  4BTA A;  4UI9 C;  3ZNG A;  4AIF A;  1N4S A;  3FTZ A;  3LVQ E;  2IFU A;  4GYY A;  3UKR G;  4L2L A;  4XE0 A;  3DXM G;  2RG8 A;  1Z3Y A;  2DZO A;  3PUJ A;  3ASN E;  3NBN B;  5D66 A;  1U3D A;  4I9E A;  4E6H A;  3D9K A;  4ANU A;  4GMJ A;  2QFC A;  3DEO A;  2OEV A;  4FP7 A;  4UI9 J;  1HF8 A;  3RU0 A;  2DCP A;  2WXJ A;  5ANR A;  1QYM A;  2P58 C;  1SZA A;  4BWR A;  1TJF A;  4JA7 A;  5EKQ D;  2KCL A;  3ULE G;  4YVQ C;  3DWL G;  3KEZ A;  2E0I A;  4DX6 D;  3ZYQ A;  1O1S A;  1ZU2 A;  5CEA A;  2XS1 A;  4AOF A;  3AS5 A;  1UJJ A;  3DSU A;  3X2Q E;  4KYO B;  3EHQ A;  4X8Q A;  3D9P A;  2WB2 A;  3I4R B;  2ZXW E;  2L9B A;  3KSQ A;  4MLP A;  4J7W A;  4UWF A;  3VLD A;  5JHB A;  4U7E B;  2F0Y A;  3PVL A;  4J0U A;  3E30 A;  1OCZ E;  5FQ6 A;  3FEX A;  4CT4 A;  4CEM A;  1QNF A;  4GPK A;  2V4L A;  3WXX A;  5AQ9 A;  3D9H A;  4J8S A;  3PH0 C;  5AYW D;  1GW6 A;  4GYW A;  4WWN A;  5AQ7 A;  1QQE A;  3JQ0 A;  5AQB A;  1IHG A;  5BV0 A;  2GRN B;  3FWV A;  4MRU A;  5G05 C;  3DSS A;  3FU0 A;  5LX8 A;  1DC2 A;  3HG0 D;  3UT4 A;  1OCR E;  1OUV A;  3PUK A;  1UJK A;  4CDN A;  2X6K A;  5CED B;  3RRU A;  5AEN A;  1YCS B;  2OV8 A;  3FDH A;  1S63 A;  4E85 A;  2XRY A;  1D9S A;  1ZB1 A;  4H7Y A;  4HVB A;  5FQ4 A;  4CYM D;  3CK7 A;  4HOT A;  2Y69 E;  4A1S A;  4J8Y A;  3UI2 A;  4GZ5 A;  4UQZ A;  2F37 A;  2ZU6 B;  4WUY A;  4KZ0 A;  3LYA A;  3HXC A;  4FU3 A;  5ENP D;  3K9I A;  3APF A;  1ELR A;  4GA0 A;  4TV3 A;  3C98 A;  3IBE A;  3T9K A;  2EIJ E;  4BET A;  2OVB A;  2X3M A;  1N54 A;  3T5X A;  4Z68 A;  3DPD A;  2WXO A;  4OAU C;  1IQR A;  2DWZ A;  4WWP A;  4Q94 A;  3LY7 A;  2CG2 A;  3ZKJ A;  2I1J A;  1N9A A;  3FU5 A;  3NQP A;  3SZ7 A;  5HKP A;  3PRE A;  4U63 A;  5KJL A;  3ASD A;  5FZR A;  1EDU A;  3NAW A;  1ELK A;  4U07 A;  4C0M A;  2V0P A;  4N39 A;  2ETB A;  4GTM A;  4PUC A;  3L54 A;  3D9J A;  3SY2 A;  4PS3 A;  3EIJ A;  4G8L A;  4YDW A;  1E8Z A;  4OVU A;  4Q96 A;  5KBA A;  4JHR A;  4O1P A;  2IOL A;  4BX9 A;  2Y4U A;  3RK6 A;  5C2Y A;  5T8I A;  2WXK A;  2E2E A;  2WVI A;  4B8A A;  3RJV A;  4LSZ E;  3SBS A;  3GYZ A;  4DX2 A;  4JA9 A;  4GA1 A;  4BEP A;  3TGO A;  2IO3 C;  4GTP A;  2BF0 X;  4NUR A;  1PAQ A;  2L6J A;  4ZFH A;  4DLQ A;  4XEI G;  3RO2 A;  4APO A;  3Q4A B;  2QYU A;  3B95 A;  3ESK A;  4Q69 A;  1KZP A;  2J4D A;  4I2Z A;  2XQ0 A;  4GU5 A;  3N71 A;  4J8F A;  3MV2 B;  3LXU X;  3G2U A;  2ZGG A;  2XGS A;  1U2V G;  4EZL A;  4N5C A;  5FQ8 A;  3G2W A;  1JCQ A;  3L13 A;  1ELW A;  3ENE A;  2KZT A;  4JHJ A;  1H2V C;  2HYZ A;  3FUL A;  1E8W A;  2VSO E;  4JVS A;  1OXJ A;  4CZ2 D;  5BT1 A;  4NIK A;  3PE4 A;  4L2Y A;  3TJP A;  3KS2 A;  1JWG A;  4KBQ A;  4FA6 A;  2H6H A;  3AS4 A;  4GA2 A;  3SF4 A;  5BXU A;  3UX4 A;  3B13 A;  1RZ4 A;  1HU3 A;  3AJI A;  3IHV A;  3Q7A A;  3P1U A;  4N3A A;  1DCQ A;  3SFX A;  3OXL A;  2OOE A;  3C5R A;  2C0M A;  4MBG A;  4XX5 A;  1MQS A;  1UG3 A;  3QAR A;  1OWO A;  2R02 A;  5CBN A;  1O1R A;  3J5P A;  2YHC A;  4YDE A;  4I9C A;  2UY1 A;  5ANL A;  4UWK A;  5T3R A;  5ENQ D;  4LER A;  3V2O A;  4AVX A;  5AIJ A;  4U8V D;  1OCO E;  5FQ7 A;  3ULQ A;  5E75 A;  3NB2 A;  4BSZ B;  2FO1 E;  2OEW A;  2A5E A;  4U96 D;  4RLY A;  1N11 A;  3LEW A;  2PM6 A;  2XZT G;  2EIL E;  3AAA C;  1YYH A;  4RG6 A;  1N0R A;  3O48 A;  4I2W A;  4OYS A;  2VGX A;  5E76 A;  4ILH B;  2PQR A;  3ZGQ A;  2AXZ A;  3CVU A;  4AV7 A;  4BT9 A;  3P2B A;  1KT0 A;  2VTB A;  3DEP A;  3I3N A;  2LSU A;  3E32 A;  3URZ A;  4CGV A;  2CHX A;  1Z5S C;  1RW2 A;  5KJK A;  4WWO A;  4AJW A;  3U9W A;  1NL4 A;  5ENS D;  2WQH A;  4KVM A;  4HI8 A;  3NZU A;  1TN7 A;  1D8E A;  1W3B A;  2GW1 A;  2B0O E;  5LCW C;  4CT0 A;  5DIZ A;  4RSY A;  2VGY A;  2MHK A;  3ASF A;  5AAR A;  4BT8 A;  4BSX A;  2IJG X;  2BKK B;  2XEV A;  2I1K A;  4BX8 A;  3D9I A;  3UM0 A;  2XRZ A;  4HB5 A;  1UN9 A;  2XCB A;  3OAW A;  3MKQ A;  1H2T C;  4F53 A;  1S0P A;  3S7B A;  3ZUV B;  5EIB E;  2GRP B;  3CHR A;  3UM3 A;  1N0Q A;  3RIB A;  2HM8 A;  3S7J A;  1IHB A;  3KEA A;  3SBT B;  2XPZ A;  3FEY A;  3MJW A;  2WXQ A;  4CCA A;  2L0I A;  1L5J A;  4UQY A;  2I9C A;  1O1T A;  1LF8 A;  4I6E A;  2UWJ G;  5BXO A;  3JYS A;  3RAU A;  4U04 A;  1N94 A;  3R9A B;  1K3Z D;  3D9M A;  2FUL A;  2XGO A;  5BV1 A;  5FIN A;  3ZVV A;  5H7P A;  3FUK A;  2XS8 A;  4OVV A;  3LS8 A;  4UWH A;  3V79 K;  2P9S G;  2V5F A;  1H19 A;  2DYS E;  4LNU D;  3UM1 A;  3UIN C;  4LCT A;  5B1A E;  3RRM B;  4GTO A;  2XEE A;  5G55 A;  1FVH A;  4HLE A;  4K0R A;  3ASO E;  3UT7 A;  5HS0 A;  4A1G A;  3V30 A;  4N2Q A;  5G04 C;  2OND A;  3DSX A;  3LDZ A;  3Q47 B;  4GTT A;  3ASG A;  4HLL A;  1KPS B;  3E37 A;  3DPY A;  2IEJ A;  2F8X K;  4ATZ D;  3BG0 B;  1HO8 A;  4H7X A;  2P2C P;  3ZHE A;  2HE0 A;  5G04 J;  5BW8 C;  4GTR A;  5M72 A;  3BQO A;  2KBX A;  5KCM A;  3Q7F A;  4PS8 A;  2Y0B G;  3TXM A;  1KT1 A;  5CER B;  1K1A A;  4C9B B;  1IKN D;  4G8K A;  5JMN D;  2XCC A;  5AN8 A;  4JC8 A;  1NA0 A;  5ITZ F;  2EQX A;  3FUH A;  2OCC E;  2WXL A;  4AEZ C;  2RFA A;  5EID A;  5HI7 A;  3L16 A;  1N4Q A;  2KCV A;  4MS6 A;  3AG3 E;  4GTQ A;  4M3O A;  2WQ7 A;  2BUG A;  1BD8 A;  1WAO 1;  1NI1 A;  2BED A;  4FUL A;  3SFY A;  2DYR E;  4TXQ A;  4XI9 A;  3OTN A;  3WG7 E;  2JEK A;  5CMY A;  3U4T A;  1Y8M A;  2ZIR A;  3TWU A;  3JCK C;  4HRM B;  4RVB A;  4GTV A;  5JA4 D;  3DBS A;  2PZI A;  4DK5 A;  4JW1 A;  3CHO A;  4W9R A;  5AAO A;  3UQ3 A;  2XGM A;  3DSV A;  3G2V A;  2GRR B;  4U95 D;  1HFA A;  5G05 J;  4JL0 A;  3E33 A;  3CEQ A;  1H6K A;  2GRO B;  3F6Q A;  4DLO A;  4PDX A;  2XZD G;  2C2L A;  1O5M A;  1DVP A;  1SA4 A;  3CVQ A;  3LPZ A;  4ZHB A;  2YHE A;  3Q5M A;  4ANV A;  2NXP A;  3VLE A;  3ZN3 A;  1DCE A;  4BTB A;  2B6C A;  4AY5 A;  4HOU A;  4YVO A;  1YA0 A;  1FCH A;  4B94 A;  3AG4 E;  4B8C B;  5G2N A;  2QZA A;  3S7F A;  1A5E A;  3PS6 A;  2FF4 A;  3I4G A;  4HI9 A;  2XEH A;  3CVN A;  2V8S E;  2WM9 A;  1P5Q A;  4B0Z A;  3Q49 B;  3OXG A;  3V31 A;  4IN3 B;  3T8K A;  4KXK B;  4DI3 A;  3ZRH A;  5CRU A;  3PEU B;  1S70 B;  2R03 A;  3ZXP A;  3MV3 B;  2CFZ A;  2J8S D;  4JB8 P;  2MYO A;  4ME2 A;  2L6B A;  4CGW A;  2KXP C;  3EU5 A;  3PZD A;  4XZ4 A;  1JUQ A;  3FH7 A;  4I1O B;  3HYM B;  3LKU A;  4IRU A;  2P9P G;  1VDY A;  3UTM A;  4LUN U;  2WMO A;  3Q73 A;  4QFV A;  4L1B A;  2BKG A;  1H6O A;  3MX3 A;  3ML9 A;  2YNQ A;  3W9G A;  4EBA G;  1HXI A;  1S64 A;  3D9N A;  4G26 A;  3CVY A;  5ARG A;  4EZJ A;  4IYP A;  2VSX E;  3ML8 A;  3ZHE B;  2AWI A;  4DX5 D;  3L22 A;  3QOU A;  5D2M C;  1KZO A;  3GZ1 A;  4AM9 A;  3SHF A;  3UKU G;  2WXM A;  2KM4 A;  4GMR A;  1HG2 A;  3T8M A;  4HFG A;  4FHJ A;  3TXN A;  2ILR A;  3LJN A;  2FBN A;  2WXI A;  3QDN A;  3FUD A;  4TXP A;  2LAH A;  1OCC E;  3RRN B;  3ZYL A;  4DX1 A;  1LD7 A;  2VJ8 A;  1TNU A;  5KWD A;  4WNF A;  4F3V A;  2C0L A;  1TNZ A;  2NSZ A;  2OVF A;  4ACL A;  1WY6 A;  4HXI A;  4ILG A;  1TNB A;  3HXF A;  4ILI A;  2R59 A;  2R05 A;  2AVP A;  4N2S A;  2LO6 A;  3L9T A;  3FUF A;  3QAQ A;  5AJL A;  4L7T A;  2CHW A;  4C0E A;  3IXE A;  2AW6 A;  3BU8 A;  3CQC B;  5ENO D;  1E8X A;  3CVV A;  3QWW A;  1TEZ A;  4XI0 A;  3QWP A;  1TN6 A;  1D8D A;  2V5Q C;  4JHK A;  3MGB A;  4TXR A;  1OWP A;  2WQ6 A;  3SFZ A;  1HH8 A;  1PC2 A;  4G24 A;  3C3R A;  3MA5 A;  2LSV A;  3MYV A;  5EX0 A;  4FJY A;  2P9N G;  3BEE A;  5J08 A;  1NFI E;  2ZIS A;  5ENN A;  3FUI A;  3IEG A;  3CLJ A;  3D3M A;  2AXV A;  3CHP A;  4GZD A;  4O6F A;  1LTX A;  3CR3 A;  2WXG A;  5JHA A;  3SGH A;  4I1A A;  4ATG A;  4PH4 B;  2J07 A;  1EF1 C;  4J8E A;  4MKT A;  1G3N B;  1MX4 A;  3JUE A;  3O4Z A;  1BI8 B;  1Q2Z A;  2VQ2 A;  4ACK A;  3FUM A;  5DBK A;  1V55 E;  3KSL A;  3PDN A;  3E4B A;  4FAD A;  4QQI A;  5EYL A;  3ABL E;  4BFR A;  2V4H C;  3OXF A;  3Q15 A;  2IO2 C;  4Y6W A;  4GAA A;  2PNN A;  4BY6 A;  2LXL A;  3CIA A;  4F1S A;  1BU9 A;  4D10 C;  1KLX A;  2IY0 C;  3QB2 A;  3AG2 E;  4KVO A;  2IOS A;  2R5S A;  4GYO A;  1TNO A;  4LRZ A;  3JXJ A;  3FTU A;  4I6J A;  3IHY A;  3FH8 A;  4KZC A;  1H6P A;  2LAI A;  4FC8 A;  2IQC A;  1MJ0 A;  2IF4 A;  3R9M A;  1E8Y A;  2J09 A;  4NAC A;  4CDM A;  2AXU A;  1NA3 A;  5IY5 E;  5A7D B;  3QNK A;  4ANW A;  2J49 A;  4BES A;  1EYH A;  3APC A;  1OWL A;  1OWN A;  2XPY A;  3ZU7 B;  3ONL A;  1U3C A;  3MKR A;  4GPM A;  3G2S A;  4EBA A;  5LCW J;  3LY9 A;  4EEC A;  1K8K G;  2EIN E;  3KAE A;  3ZW3 A;  3TG5 A;  3RKV A;  4XKC A;  1OT8 A;  3L82 A;  4WNG A;  2KZT B;  3CVP A;  1BI7 B;  3JQ1 A;  1HZ4 A;  3FHE A;  3FUE A;  1E7U A;  3HRA A;  3HDX A;  1AWC B;  2WPV A;  2H6I A;  2YIN A;  5B3S E;  3EHR A;  2H6G A;  1XNF A;  3CVL A;  4U0Z A;  2WXR A;  3Q78 A;  3TL5 A;  2H6F A;  4HS2 A;  3FFL A;  4UWG A;  2X6H A;  3CVW A;  2BTD A;  3FY4 A;  4U0U A;  4K5C A;  4O1O A;  3EJN A;  2CHZ A;  2J9Q A;  1K1B A;  5A6C A;  4ANX A;  4A55 A;  3PZ4 A;  4LNB A;  2R2L A;  4G1T A;  3HXE A;  1HE8 A;  3TWW A;  3ZEF A; 
#chains in the Genus database with same CATH homology
 4I2Z A;  4PDX A;  1N52 A;  2XQ0 A;  2C2L A;  4GU5 A;  2X6I A;  3N71 A;  1DVP A;  1JPL A;  1DNP A;  4J8F A;  4HOQ A;  2WMN A;  2UY1 B;  3MV2 B;  3G2U A;  3LXU X;  5LOZ A;  1H0A A;  1INZ A;  3CVQ A;  2XGS A;  3SNX A;  4JPS A;  3LPZ A;  2WXP A;  4EZL A;  1SQM A;  4GCO A;  4AY6 A;  2YHE A;  3Q5M A;  3FH5 A;  4N5C A;  2NXP A;  4V3I A;  5FQ8 A;  3VLE A;  2HO1 A;  3G2W A;  3FTV A;  3ZN3 A;  3ZYK A;  4A3T A;  4BTB A;  4AY5 A;  4JXT A;  2XHE A;  4HOU A;  4YVO A;  5D0Q D;  2FO7 A;  3L13 A;  1ELW A;  1YA0 A;  3KD7 A;  1FCH A;  3ENE A;  4B94 A;  2KZT A;  4JHJ A;  3IV0 A;  1H2V C;  3FUN A;  3IKO B;  2HYZ A;  3CQG B;  3FUL A;  3PNL B;  1E8W A;  2VSO E;  4B8C B;  2Y3A A;  5G2N A;  5BPP A;  4JVS A;  3CHM A;  3I5P A;  2GRL A;  3FTY A;  3VTX A;  3S7F A;  2GRM A;  3PS6 A;  5BT1 A;  2FF4 A;  3I4G A;  3PE4 A;  3FUJ A;  4L2Y A;  3TJP A;  3CVN A;  3CV0 A;  3ZXS A;  3LJ3 A;  1E90 A;  3KS2 A;  2V8S E;  1JWG A;  2WM9 A;  5FTP A;  1P5Q A;  2KCK A;  4B0Z A;  4KBQ A;  4FA6 A;  3Q49 B;  3AS4 A;  4GA2 A;  3OXG A;  3SF4 A;  2PL2 A;  4G23 A;  3UX4 A;  4IN3 B;  4CRW A;  4KXK B;  3B13 A;  3QK0 A;  1HU3 A;  3UPV A;  1FVF A;  1NZN A;  2WXF A;  2VGX B;  4DI3 A;  3PRZ A;  3ZRH A;  3S2A A;  4ABN A;  3IHV A;  3QWV A;  3PEU B;  2MOW A;  3SD5 A;  2KC7 A;  2VTB B;  2I6H A;  3MV3 B;  4FLB A;  3FP3 A;  5FZQ A;  3AU4 A;  2CFZ A;  3P1U A;  4L23 A;  4N3A A;  3OXL A;  3HHM A;  2OOE A;  4ME2 A;  4CGW A;  4J8D A;  2C0M A;  1HG5 A;  3FTW A;  4YND A;  1IQU A;  3UT8 A;  3PZD A;  4XX5 A;  1MQS A;  4XZ4 A;  1JUQ A;  4FLH A;  2MRI A;  1UG3 A;  3QAR A;  4RG9 A;  1OWO A;  3FH7 A;  3PNT B;  3ZIM A;  4JEU A;  3MCX A;  4I1O B;  5FJY A;  2YHC A;  3TAX A;  3AU5 A;  4I1M A;  3EIQ C;  4I9C A;  4EQF A;  5D0O D;  2UY1 A;  3HYM B;  1QZ2 A;  3MZL B;  5ANL A;  3LKU A;  4IRU A;  4UWK A;  5AJD A;  2Y4T A;  5T3R A;  3D9L A;  4N3C A;  1VDY A;  2L0T B;  1WM5 A;  1Y6I A;  4LER A;  4LUN U;  3ESL A;  2WMO A;  3APD A;  4QFV A;  4TUU A;  4L1B A;  4AVX A;  5AIJ A;  3MX3 A;  4JZY A;  4R7L A;  5FQ7 A;  3ML9 A;  3JUI A;  3ULQ A;  2YNQ A;  5E75 A;  4EBA G;  3EDT B;  4HOS A;  1HXI A;  5LP0 A;  3D9N A;  4G26 A;  3CVY A;  3FTX A;  5J90 A;  5ARG A;  4EZJ A;  2A4Z A;  3HVE B;  2A5U A;  4PS7 A;  4IYP A;  2VSX E;  3B7R L;  3ML8 A;  3ZHE B;  2AWI A;  2R17 C;  3LEW A;  2PM6 A;  2FI7 A;  2IU1 A;  3L22 A;  3U66 A;  2J08 A;  2J4B A;  4BTA A;  1UW4 B;  2GGF A;  5LFA A;  4UI9 C;  3QOU A;  4AIF A;  2WXN A;  3FTZ A;  3GZ1 A;  4AM9 A;  4KT6 B;  3LVQ E;  3SHF A;  4RG6 A;  2WXM A;  4TRQ A;  2QY7 A;  2IFU A;  2KM4 A;  5JJ6 A;  4GYY A;  3O48 A;  1HG2 A;  3MKQ B;  1XGW A;  4I2W A;  3T8M A;  4OYS A;  2VGX A;  5E76 A;  4HFG A;  4L2L A;  4ILH B;  2PQR A;  1B89 A;  4XE0 A;  2CFU A;  4FHJ A;  3TXN A;  2AXZ A;  2RG8 A;  3FU6 A;  2ILR A;  4G11 A;  3SI5 A;  3ZGQ A;  4AV7 A;  3P2B A;  1KT0 A;  3CGH A;  4BT9 A;  2FBN A;  2WXI A;  2VTB A;  3QDN A;  1Z3Y A;  3FUD A;  2LAH A;  2ION A;  3PUJ A;  3I3N A;  3RRN B;  3ZYL A;  2LSU A;  4GML A;  3QJZ A;  5JJ7 A;  2VJ8 A;  5FZS A;  1U3D A;  3URZ A;  4CGV A;  4I9E A;  4E6H A;  3D9K A;  2CHX A;  4ANU A;  4WNF A;  4F3V A;  2C0L A;  2NSZ A;  4GMJ A;  2OVF A;  4ACL A;  2QFC A;  4NRH B;  4ANV A;  1WY6 A;  5KJK A;  4FP7 A;  4UI9 J;  1TJC A;  4WWO A;  1HF8 A;  4HXI A;  4ILG A;  4HOR A;  3RU0 A;  4J6I A;  4ILI A;  2DCP A;  4AJW A;  2Q7F A;  2R59 A;  3U9W A;  2WXJ A;  2NC9 A;  2WQH A;  4KMO A;  4WNE A;  2P58 C;  2XPI A;  4KVM A;  2AVP A;  1SZA A;  5ANR A;  4N2S A;  2LO6 A;  4BWR A;  3FUF A;  4GZ3 A;  3BG1 B;  3QAQ A;  5AJL A;  2CG3 A;  3NZU A;  2CHW A;  4L7T A;  1TJF A;  4JA7 A;  2PM7 A;  4C0E A;  5EKQ D;  3TG4 A;  1E7V A;  2I2O A;  1W3B A;  2AW6 A;  2KCL A;  2GW1 A;  4YVQ C;  5LCW C;  3CQC B;  3KEZ A;  1E8X A;  4CT0 A;  5DIZ A;  2E0I A;  3CVV A;  3QWW A;  4GZC A;  4RSY A;  1TEZ A;  2VGY A;  1OWM A;  2MHK A;  3ASF A;  5KJN A;  4XI0 A;  3MEK A;  3L08 A;  3CHS A;  1H2U A;  3PEV B;  4BT8 A;  3QWP A;  3ZYQ A;  4BSX A;  1ZU2 A;  2IJG X;  3GZS A;  4AOF A;  5BNW A;  2XEV A;  4JHK A;  3AS5 A;  3MGB A;  1UJJ A;  2I1K A;  1OWP A;  3QC1 A;  4APF A;  4KYO B;  2WQ6 A;  3SFZ A;  4BX8 A;  1HH8 A;  3D9P A;  1PC2 A;  4G24 A;  2WB2 A;  3D9I A;  3ASH A;  3HIZ A;  3I4R B;  2XRZ A;  3MA5 A;  2L9B A;  2LSV A;  1UN9 A;  3CK8 A;  3VLF A;  3MYV A;  5EX0 A;  2XCB A;  3OAW A;  3NF1 A;  3MKQ A;  4MLP A;  4UWF A;  3VLD A;  4XKB A;  4AP2 A;  5JHB A;  1H2T C;  4FJY A;  4F53 A;  1S0P A;  3BEE A;  3PVL A;  5CCL A;  4J0U A;  5J08 A;  3S7B A;  1PY1 A;  3CHR A;  5FQ6 A;  3FEX A;  4CT4 A;  2HR2 A;  4WND A;  5ENN A;  4CEM A;  1QNF A;  4DI4 A;  3FUI A;  3IEG A;  4GPK A;  3CLJ A;  2V4L A;  2AXV A;  3D3M A;  3CHP A;  4GZD A;  3WXX A;  5CCM A;  1ZBP A;  3RIB A;  4EPZ A;  3R7R A;  2HM8 A;  4J8S A;  3S7J A;  4P29 A;  3CK9 A;  4O6F A;  3PH0 C;  3SBT B;  2XPZ A;  2WXG A;  3CR3 A;  3FEY A;  3LVR E;  3MJW A;  1GW6 A;  4GYW A;  4WWN A;  5AYW D;  3SGH A;  5JHA A;  4AXH A;  2WXQ A;  3LY8 A;  1QQE A;  3JQ0 A;  3S7D A;  1Z6T A;  4CCA A;  2L0I A;  4I1A A;  4ATG A;  2FEZ A;  1L5J A;  4UQY A;  2I9C A;  1LF8 A;  4PH4 B;  2J07 A;  4I6E A;  1EF1 C;  2UWJ G;  2VSN A;  4J8E A;  4XIF A;  4MKT A;  3ZFW A;  3JYS A;  1IHG A;  4U04 A;  5BV0 A;  3FWV A;  4MRU A;  5G05 C;  3FU0 A;  1E96 B;  3R9A B;  5LX8 A;  2X6J A;  1Z3X A;  3D9M A;  2FUL A;  2XGO A;  3O4Z A;  5BV1 A;  5BUZ A;  3UT4 A;  3ZVV A;  1OUV A;  3CST A;  3PUK A;  1UJK A;  4CDN A;  2X6K A;  3FUK A;  2VQ2 A;  4OVV A;  3RRU A;  2PQN A;  4ACK A;  3LS8 A;  3B7S A;  3FUM A;  5AEN A;  2RD0 A;  1X5B A;  3CSF A;  4GZ6 A;  5EDS A;  2OV8 A;  3FDH A;  4UWH A;  5DBK A;  5T4Y A;  4E85 A;  2XRY A;  2V5F A;  1HX8 A;  3PDN A;  4H7Y A;  1H19 A;  4HVB A;  3E4B A;  4FAD A;  5FQ4 A;  3CK7 A;  4HOT A;  5JJT A;  4BFR A;  4G2V A;  2VYI A;  3LCA A;  4LCT A;  3RRM B;  2X6F A;  3OXF A;  4A1S A;  3U64 A;  3Q15 A;  3U3W A;  4Y6W A;  4GAA A;  3VTY A;  4BY6 A;  5CHE E;  1FVH A;  5G55 A;  4HLE A;  3EHN A;  4K0R A;  3CIA A;  4GZ5 A;  4U8H A;  4F1S A;  4UQZ A;  2J4D A;  2ZU6 B;  3CVU A;  4WUY A;  4KZ0 A;  3UT7 A;  4D10 C;  1KLX A;  3RO3 A;  3LYA A;  3QB2 A;  4A1G A;  3EHM A;  3NZS A;  1EPU A;  4KVO A;  1HS6 A;  4N2Q A;  4FU3 A;  2IOS A;  2OND A;  2R5S A;  4GYO A;  4LRZ A;  3L17 A;  3K9I A;  1JWF A;  5G04 C;  4URK A;  4N3B A;  4B89 A;  3APF A;  3FTS A;  3FTU A;  1ELR A;  4GA0 A;  4I6J A;  4TV3 A;  3C98 A;  3IHY A;  3FH8 A;  3LDZ A;  4KZC A;  4FC8 A;  2LAI A;  2IQC A;  3CKC A;  3ONK A;  3QKY A;  3IBE A;  3Q47 B;  4UI9 K;  4I6G A;  3G2T A;  4UQX A;  3ASG A;  4Y6C A;  3B7T A;  2OVB A;  2DIW A;  2IF4 A;  2X3M A;  1N54 A;  3T5X A;  4DPR A;  1E8Y A;  3FU3 A;  2J09 A;  2WXH A;  3DPD A;  2WXO A;  1IQR A;  1UN8 A;  4WWP A;  4LEU A;  4NAC A;  5FWQ A;  4CDM A;  2AXU A;  1NA3 A;  3AS8 A;  4A3V A;  5A7D B;  3QNK A;  4ANW A;  2J49 A;  3BG0 B;  1HO8 A;  4I17 A;  3PE3 A;  4Q94 A;  4JEH A;  4H7X A;  3HVE A;  1EYH A;  2DBA A;  3APC A;  1OWL A;  4U0S A;  3ZHE A;  1OWN A;  2XPY A;  2YQ8 A;  3LY7 A;  2JLB A;  5G04 J;  2CG2 A;  5BW8 C;  4F7A A;  2VSY A;  3ONL A;  1U3C A;  3MKR A;  2I1J A;  4IUL A;  3FU5 A;  3NQP A;  3SZ7 A;  5M72 A;  3PRE A;  5FT9 A;  1BPO A;  4U63 A;  5KCM A;  3G2S A;  4WAF A;  4EBA A;  4PS8 A;  5KJL A;  3ASD A;  5FZR A;  3UUX A;  3TXM A;  1EDU A;  1ELK A;  1KT1 A;  1A17 A;  4U07 A;  4C9B B;  4C0M A;  5ARF A;  2V0P A;  5LCW J;  4N39 A;  4GB9 A;  3LY9 A;  4EEC A;  2XCC A;  2X38 A;  4JC8 A;  4PUC A;  3L54 A;  5A23 A;  1NA0 A;  3CKB A;  2EQX A;  3FUH A;  3D9J A;  3KAE A;  2WXL A;  3TG5 A;  2M63 A;  4PS3 A;  3EIJ A;  3RKV A;  4XKC A;  4AEZ C;  3ZW3 A;  5HI7 A;  2KAT A;  3UMV A;  4GCN A;  5CMW A;  3L16 A;  1E8Z A;  2KCV A;  4MS6 A;  4WNG A;  4EZK A;  2KZT B;  4M3O A;  3CVP A;  3GW4 A;  2WQ7 A;  2BUG A;  4OVU A;  3ZYM A;  5KJM A;  1WAO 1;  3JQ1 A;  1HZ4 A;  3FHE A;  4Q96 A;  3FUE A;  4FUL A;  1IYG A;  1NP7 A;  2LNI A;  1E7U A;  4I43 A;  3R7Q A;  3HDX A;  4DJA A;  2WPV A;  2YIN A;  4JHR A;  3CVX A;  2IOL A;  3D9O A;  3L6A A;  4XI9 A;  4BX9 A;  1XNF A;  2Y4U A;  3GZ2 A;  3OTN A;  3RK6 A;  2JEK A;  3CVL A;  4U0Z A;  5C2Y A;  2WXR A;  5CMY A;  5T8I A;  2WXK A;  2E2E A;  2WVI A;  3TL5 A;  4B8A A;  4HS2 A;  3FFL A;  4UWG A;  4NQ0 A;  3CHQ A;  3RJV A;  2X6H A;  3U4T A;  3SBS A;  3GYZ A;  4FHK A;  4JA9 A;  4GA1 A;  3CVW A;  2BTD A;  1Y8M A;  3FY4 A;  3JCK C;  4U0U A;  5C1D A;  4RVB A;  3EJN A;  3TGO A;  4FJZ A;  2BF0 X;  3DBS A;  2CHZ A;  2J9Q A;  2PZI A;  4NUR A;  4CDR A;  1PAQ A;  2L6J A;  4DLQ A;  3ZPJ A;  4DK5 A;  5A6C A;  4JW1 A;  4ANX A;  3CHO A;  4W9R A;  4A55 A;  3UQ3 A;  1MHQ A;  3RO2 A;  2XGM A;  3G2V A;  4APO A;  4G25 A;  4K03 A;  3T5V A;  3Q4A B;  4UWL A;  4G1T A;  1HFA A;  5HQ8 A;  5G05 J;  3ESK A;  4JL0 A;  4Q69 A;  3CEQ A;  5EX3 A;  1H6K A;  1HE8 A;  3ZEF A;  1SZ9 A;  3B7U X;  4DLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...