2XEVA

Crystal structure of the tpr domain of xanthomonas campestris ybgf
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
121
structure length
121
Chain Sequence
RTAYNVAFDALKNGKYDDASQLFLSFLELYPNGVYTPNALYWLGESYYATRNFQLAEAQFRDLVSRYPTHDKAAGGLLKLGLSQYGEGKNTEAQQTLQQVATQYPGSDAARVAQERLQSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tola Modulates the Oligomeric Status of Ybgf in the Bacterial Periplasm.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Metal binding
molecule keywords YBGF
total genus 51
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xevA00
3CVLA 4KYOB 3PE3A 4XI9A 3HYMB 4A1SA 2VSYA 4BTBA 5A6CA 5DIZA 4GZ6A 1ELRA 3ASGA 4GA0A 4UQXA 3GYZA 1ELWA 5A7DB 2HYZA 3UQ3A 5D0OD 3MA5A 4BWRA 3ZHEB 4HOSA 3UPVA 2VQ2A 4GPKA 3ESKA 3QOUA 2DBAA 4I2WA 3CVPA 4N5CA 3LY8A 4CGVA 4YVOA 3TGOA 3U3WA 4N2SA 2PL2A 1IYGA 1NZNA 2LSUA 2Y4UA 4ABNA 4ME2A 3AS5A 3S7FA 5LCWC 4GZ3A 4HORA 5HQ8A 2HR2A 5CHEE 4G1TA 2VSNA 1OUVA 2KCKA 5G04J 3CVQA 2KC7A 5ARFA 4EQFA 4N3BA 2IF4A 2VGXB 2PZIA 3CK9A 3LCAA 3CVNA 3CV0A 3LYAA 3LY7A 2LNIA 5HI7A 5BW8C 3GW4A 1HZ4A 4JL0A 4XIFA 4O6FA 2MHKA 3FWVA 4APOA 4CDRA 4G25A 1PC2A 3AS4A 2I6HA 3MKRA 3OXGA 4I9CA 3QWVA 2WQHA 4NQ0A 4XI0A 4JA9A 5EX3A 4BTAA 4G23A 4WNEA 2Q7FA 3CKBA 3PE4A 4H7XA 4I17A 1QQEA 4LEUA 2P58C 5FT9A 3ASFA 3SZ7A 4N3CA 5JJTA 4AY6A 1KLXA 1TJCA 3ASDA 4GZ5A 5DBKA 1NA0A 2VGXA 2ONDA 3Q5MA 3ZGQA 4AM9A 5CCLA 2C0LA 5FZSA 2J9QA 5JJ6A 2C0MA 3CK7A 2C2LA 2WPVA 3Q15A 4UQYA 5FJYA 3RU0A 2XGMA 3ZN3A 3N71A 2FI7A 4RG9A 3QDNA 4GYYA 4H7YA 2E2EA 2XPIA 3OXFA 2PQRA 4HOUA 3JYSA 4U07A 1W3BA 4GCOA 4UI9J 4Y6WA 3VTXA 3CK8A 2UY1A 4HOQA 4U0SA 3TAXA 2GW1A 3LY9A 5FTPA 3ZHEA 5C1DA 3Q47B 3QWWA 5KJKA 4U04A 4WUYA 5M72A 4KXKB 4NRHB 1IHGA 1B89A 1KT0A 1ZBPA 3E4BA 3SF4A 3ULQA 2NC9A 2Y4TA 3AS8A 4RG6A 2FO7A 3S7DA 3Q4AB 2V5FA 5G04C 4J8FA 2KATA 5BT1A 3RO3A 4CGWA 5D0QD 5KJMA 2KCLA 3GZ1A 4U0UA 1E96B 4J8EA 5KJLA 3U4TA 2KCVA 4J0UA 4GA2A 3NF1A 4AIFA 4UI9K 2JLBA 3GZ2A 5FZRA 3BEEA 4JHRA 3S7JA 4BT9A 4F3VA 3Q49B 1QZ2A 3S7BA 3QKYA 1KT1A 3RKVA 5LCWJ 4HOTA 1FCHA 3KD7A 2VYIA 3LPZA 4UI9C 2UWJG 2UY1B 3IEGA 2FF4A 2L6JA 2LSVA 2IFUA 3ASHA 3K9IA 4YVQC 3R9AB 4WNFA 1WM5A 4G24A 4GYWA 4N3AA 3LKUA 4WNGA 1NA3A 5G05C 5JJ7A 2BUGA 1P5QA 3CEQA 5KJNA 3FP3A 2QFCA 2XCCA 1Y8MA 4G2VA 4U0ZA 2FBNA 3TG4A 4BT8A 4GA1A 3QWPA 2XGOA 2AVPA 2R5SA 3MEKA 4I1AA 5EX0A 1ZU2A 5FZQA 1A17A 4G26A 1HH8A 4WNDA 4W9RA 4I9EA 5ARGA 3RJVA 4I2ZA 3URZA 4KBQA 5AYWD 3WXXA 2XGSA 3ZFWA 4J8DA 1WAO1 4N39A 3ZPJA 5G05J 5BNWA 3CKCA 2XCBA 2VGYA 3UUXA 5EKQD 3VTYA 4JA7A 2PQNA 3KAEA 3RO2A 1XNFA 3TG5A 2YQ8A 5CCMA 4UQZA 1HXIA 3MV3B 4IN3B 3FFLA 4N2QA 2XEVA 3PDNA 4YNDA 3EDTB 2FEZA 2HO1A 3KS2A 3MV2B 4GYOA 4B94A 4AY5A 3OXLA 3RIBA 2OOEA 3O48A 4Y6CA 1YA0A 2YHCA 4GCNA
chains in the Genus database with same CATH superfamily
4FULA 1JUQA 4I1MA 5A6CA 4MLPA 2OEVA 1O1TA 3LXUX 2AWIA 3VLEA 3APCA 5C2YA 4XKCA 2J4DA 1NZNA 3ZKJA 1UOHA 2LSUA 4UWFA 3AS5A 4UUCA 4EBAA 2PZIA 2V4HC 2VGXB 3CK9A 4BESA 2GRMA 2B0OE 1U3CA 5EX3A 4JA9A 5HKPA 2WXFA 3SFYA 3FTYA 2WXHA 3EHQA 4N3CA 1KLXA 3PZ2A 1BI7B 1QNFA 2WPVA 2J8SD 4AJWA 1N11A 4Y6WA 3U64A 3Q47B 2GRNB 4TV3A 2F37A 2V5FA 1O1SA 2GGFA 4WWPA 3NBNB 1YYHA 3CHRA 4LRZA 2VTBB 3UXGA 2QY7A 4UI9C 4C0MA 4YVQC 4GYWA 4WNGA 5ENQD 3ZRHA 2NXPA 3Q73A 4Q96A 4XKBA 3T8KA 3D9LA 4J8YA 3D9PA 4JA7A 1S0PA 2YQ8A 4NACA 3GZSA 3ISMC 3QB2A 2WB2A 4DK5A 3FUFA 2WQ7A 2I2OA 1UN8A 3GYZA 4HOSA 5D0OD 2AW6A 3TGOA 3ZIMA 3DXMG 3I3NA 1PAQA 5T4YA 2VSNA 5G04J 4F1PA 3B7UX 4HBDA 2FO1E 5BW8C 2WMOA 4U96D 2ETAA 4G23A 3ZNGA 4AY6A 5KWDA 1TJCA 1MHQA 5AJDA 4DLOA 2I9CA 3TXMA 4CDNA 2XPIA 1TNYA 4HOQA 3ZHEA 2AJAA 5AJLA 3P1UA 4J8FA 2WXLA 2XHEA 3RO3A 4GTPA 4OAUC 3BU8A 2VSXE 1V54E 3CQCB 1H0AA 4JHRA 2P9PG 3Q49B 5E75A 3B7BA 3AG3E 4BSZB 1PY1A 3LPZA 2UY1B 2LSVA 5A23A 3UIOC 5EX0A 3D3MA 1TR4A 3G2SA 4IYPA 3FH7A 4B8AA 2R03A 2CFUA 3CQGB 2XEEA 1N0RA 4PH4B 4GYOA 5ANRA 4HB5A 4BTBA 1NP7A 1ELWA 5H7PA 3ZUVB 3UPVA 1H2VC 1UW4B 4J7WA 5D2MC 4F7AA 2X3MA 2V0PA 1U2VG 4ATGA 5LX8A 4XE0A 3FWVA 3AS4A 1UN9A 2Q7FA 4H7XA 4LEUA 2RD0A 1MZCA 4PS8A 4ILHB 4GZDA 3UIPC 3RK6A 4UWHA 1OWLA 1KZOA 1V55E 3PZ1A 3V30A 3BUAA 3T8MA 2RG8A 4I6EA 2OV8A 2IQCA 4J8EA 3TWXA 5T8IA 4C48B 1HO8A 4GTMA 5ITZF 2P9IG 3ASHA 4FHJA 4I43A 5KJNA 1HG2A 3F6QA 3QARA 4O1PA 4I9EA 3LEWA 5E76A 3MX3A 1OCCE 4DJAA 3R9MA 3RAUA 5BPPA 4FJZA 4WAFA 1RW2A 1YA0A 3EHMA 4EZLA 4PS3A 4GA0A 3MA5A 3ONKA 2DBAA 3CVPA 1WG0A 4JEUA 5HQ8A 4A55A 4EQFA 5KNHD 5JMND 4HLEA 3VLFA 3E30A 2NSZA 4CDRA 1MX4A 4AOFA 5CBNA 3MKRA 2A5EA 3CSFA 3HVEA 4I17A 2VGXA 4KVMA 2ONDA 3ZGQA 2C0LA 5HS0A 3MKQB 4ANVA 3O4ZA 4GMRA 2MYOA 4FADA 1TNZA 2E2EA 3U66A 3PUKA 2UY1A 5CERB 3TAXA 1HS6A 1IHGA 3SF4A 4RG6A 1TN8A 5B3SE 4ACLA 5KJMA 4EBAG 4AXHA 1O1RA 4DX2A 4HVBA 3ZEFA 1E8XA 4BX9A 2KM4A 2UWJG 2VTBA 1D9SA 2BKGA 3R7QA 4HS2A 5KBAA 1E8WA 5EILA 4JPSA 3CVUA 4I1AA 1QBQA 4DLQA 2R05A 4UWLA 3L13A 4KVOA 3DEPA 2QZAA 4ANUA 4IRUA 1EYHA 3KEAA 2Y69E 2YINA 1K3ZD 1BU9A 2ETBA 3ZXSA 2H6IA 3UQ3A 4URKA 3Q75A 1TN7A 3EU5A 1VDYA 4B93B 2J09A 3FTVA 2WXPA 4FP7A 2IF4A 1FT1A 3LY7A 4DX7D 2LXMA 4JL0A 4HXIA 4I9CA 1KPSB 1YCSB 4HRLA 4NURA 2Y0BG 3CKBA 1KZPA 4ANXA 2J07A 3Q5MA 5CCLA 2ZGDA 3NZUA 2C0MA 2DZNA 3TWTA 2FI7A 4RG9A 3CVVA 3HRAA 3PNLB 4JXTA 2XENA 3SFZA 2Y1LE 2KXPC 3AS8A 2FO7A 3FUDA 5JHAA 3U4TA 4M7CA 2IU1A 3CVXA 1QZ2A 1H2UA 4O60A 1KT1A 3FTWA 1FCHA 1P5QA 4YDEA 1Y8MA 1K1AA 3IV0A 4Z68A 1EPUA 3TWVA 3DSWA 1H19A 1QYMA 4N39A 1WDYA 2EQXA 3G2UA 1LD8A 1IKND 2L0TB 4LCTA 4A1GA 4YNDA 3KS2A 4K5AB 4AY5A 2YHCA 2DYSE 1OCZE 2WM9A 4A1SA 5AENA 1Y6IA 4DI4A 5G55A 3MYVA 2PL2A 3SO8A 3FUIA 3S7FA 5J08A 4Q69A 1AWCB 3UI2A 3CV0A 3GW4A 1HZ4A 3CSTA 2CHWA 4CYMD 3D9MA 1BPOA 1S63A 3HXCA 1S64A 5FJYA 3AU4A 2IJGX 4LERA 3HHMA 2XPYA 3QWWA 4NRHB 3ULQA 1B89A 1IQUA 2P9NG 4C0EA 5FZRA 5LP0A 1SA4A 1G3NB 1MX2A 3MCXA 3PREA 4RLYA 2LO6A 2BF0X 4EZKA 4HOTA 5LCWJ 5LFAA 2L6JA 4U8VD 2IFUA 4WNFA 2R17C 2EILE 2J08A 2XCCA 4A63B 3SNXA 3QWPA 2AVPA 3SI5A 1A17A 4BFRA 5JHBA 4GTQA 3ZFWA 2XGSA 5BNWA 3UUXA 3DPDA 4ILIA 3CHOA 4LNBA 3PRZA 1FVHA 4L2YA 5AQAA 5EDSA 3CVWA 4GPKA 5AQBA 5A7DB 3D9NA 3ONLA 3B7SA 3FHEA 3B95A 4U63A 3ZU7B 4DX1A 2RFMA 4UWGA 4E85A 1L5JA 3HXFA 3W9GA 1JCSA 2LNIA 2WXGA 3B7RL 1K1BA 3SD5A 3UT8A 3V2OA 4JZYA 3UM1A 2WMNA 2CFZA 1OY3D 4IULA 1O5MA 4BY6A 3E4BA 3B7TA 3G2VA 1JCQA 2XRZA 2IEJA 2F8XK 4DPRA 3VLDA 1E96B 5KJLA 4CEMA 3PNTB 3TWWA 3W9FA 4G8LA 1TNBA 3R9AB 1JWGA 4CT0A 1FPPA 2IY0C 1X81A 4YDWA 4FC8A 5FZQA 5CEAA 4I1OB 4TRQA 3I5PA 1DCQA 3UKRG 2A5UA 4LG6A 3FFLA 2XEVA 2HO1A 4EPZA 4Y6CA 3TWRA 2M63A 2L0IA 3FUMA 3RRUA 3KEZA 3PE3A 5AIJA 1HE8A 3CVYA 3MGBA 2IO2C 5FIOA 3ZHEB 5LOZA 3IXEA 4GZCA 2HR2A 3NOCD 3J5PA 2P9UG 5ARFA 2WXOA 5ENPD 4PUCA 1Z3YA 5B1BE 3TWUA 1PC2A 2LAHA 4LUNU 4B0ZA 4JVSA 3SY2A 3FUJA 4AM9A 1DCEA 4G8KA 4UQYA 3ZN3A 3PH0C 3AAAC 3TXNA 4KZ0A 2GW1A 5KJKA 2FULA 1HU3A 3CLJA 5BV1A 2J4BA 4JB8P 3EUVA 3AU5A 2ZXWE 2QYUA 3WG7E 3UT4A 4F3VA 3EIJA 4HRNA 1HFAA 1RZ4A 1JPLA 3UMVA 3IEGA 5CRUA 3T5XA 1TNUA 3JUIA 4L9PA 4F6RD 5JJ7A 4G2VA 2FBNA 3TG4A 4GA1A 4HI9A 5KNGA 1DVPA 5T3RA 3RJVA 2F8YA 3FEYA 3DSVA 3VTYA 1XNFA 2F0YA 4GTSA 4YDYA 3FU0A 4JHKA 4NIKA 2CG2A 3L16A 5KCMA 2KZTA 2P2CP 1AP7A 1TJFA 3AG1E 4BWRA 3FUHA 3DSUA 3IBEA 5BUZA 4CGVA 4TXPA 2KZTB 5CMYA 1INZA 3BQOA 3EU9A 2CHZA 3QWVA 4BTAA 4N5QA 3CHQA 1MQSA 3ASDA 3EHRA 2R2LA 3SBSA 4A3TA 3RU0A 4DUIA 3QDNA 2KBXA 5M72A 2PQRA 3JYSA 3VTXA 3NOGD 3QJZA 4UI9J 4U0SA 2MRIA 3X2QE 1ZBPA 3CGHA 3ZVVA 1E7VA 4AIFA 4UI9K 4WWNA 5EIBE 5EN5D 4L7TA 2GRLA 2Y3AA 4ILGA 4J6IA 3K9IA 5FINA 4G24A 2WXMA 3FU6A 4DI3A 4R7LA 4YDOA 1HH8A 3AG2E 3APDA 4MKTA 4PDXA 5CBOA 3PZ3A 3V2XA 1HXIA 5BXOA 2ILRA 2WXRA 3MZLB 3J5QB 1SQMA 4PS7A 3MKQA 2BTDA 4HLLA 1D8DA 4FLHA 1WY6A 3HXBA 4ANWA 1E8YA 3SBTB 5G2NA 2EIME 1D8EA 3U3WA 2Y4UA 3DBSA 2OEWA 2E0IA 4GPMA 3E33A 2BEDA 3RRMB 3JUEA 2ETCA 4G25A 4DX5D 1QQEA 2VJ8A 1N54A 4AEZC 2V5QC 1NA0A 4GTOA 5FZSA 1SW6A 3BG1B 2DWZA 2WXIA 4QQIA 1IHBA 5ENTD 1OCOE 2X38A 1N4RA 5D66A 2JABA 3LY9A 5C1DA 3ESLA 1KT0A 4MS6A 1MYOA 4OYSA 1DNPA 3AJIA 2X6KA 1N9AA 4BT9A 3S7JA 3ZW3A 3UM3A 3L6AA 2YHEA 3FUNA 1H6PA 3KD7A 2VSOE 4B89A 3ML8A 3C98A 4AV7A 2DVWA 4RQIA 4ZHBA 1MX6A 4W9RA 5AQ9A 3TL5A 4L23A 2XCBA 2J49A 5JA4D 4EECA 1TYQG 3ABKE 1BLXB 3RIBA 3HG0D 3FTZA 3OAWA 1LTXA 3CVLA 2VSYA 3D9IA 4RSYA 3ULYA 1OWMA 4BSXA 2OVFA 3FDHA 4V3IA 4GZ3A 1SZ9A 2KC7A 1Z3XA 4XIFA 4APOA 3FULA 3EHNA 4XI0A 3HVEB 3UKUG 2WQHA 4GMJA 1UJJA 2P58C 3ASFA 4JHJA 3MJWA 1TEZA 3CK7A 4EHMA 2XGMA 4Q94A 4QFVA 3NB2A 1SVXA 2XZDG 3ABLE 3L9TA 3OXFA 3CK8A 1NI1A 2ZISA 1N4QA 2GRPB 2CHXA 2KATA 4CGWA 2RKKA 4J0UA 3NF1A 3JQ1A 4BEPA 3TWQA 4JW1A 1FT2A 2VYIA 5BV0A 4N3AA 2LAIA 1EDUA 4D10C 4RVBA 1N52A 1BI8B 4BT8A 3MEKA 3FTXA 1UJKA 4KBQA 4DRXE 1WAO1 3V31A 3CKCA 3HXDA 2PQNA 4UQZA 1ZB1A 2QYJA 1X5BA 2AXUA 2FEZA 4B94A 2OOEA 3O48A 4XZ4A 1S70B 4KYOB 3HYMB 3E32A 4F53A 4ZFHA 5DIZA 1ELKA 2WXJA 3QOUA 4JEHA 4I2WA 3LY8A 4N2SA 4YVOA 2H6GA 3G2TA 2EINE 3LCAA 5ENSD 3PUJA 5HI7A 3IHYA 3BG0B 3CR3A 2GRQB 4WNEA 4KZCA 3L54A 3D9KA 4A3VA 4GZ5A 5JJ6A 4CDMA 3Q79A 2X6IA 3NZSA 3Q15A 5CMWA 3LJNA 4FLBA 2HM8A 3UM2A 4GYYA 4H7YA 5ANLA 4HOUA 2PM6A 5LCWC 3T5VA 5FTPA 4JC8A 3ASNE 5G04C 1TN6A 4K5BA 4GTVA 2KCLA 1LD7A 4GA2A 5HRYA 2XPZA 2JLBA 3IHVA 5FQ8A 4HFGA 5AQ7A 2V8SE 1DC2A 1NFIE 3D9JA 5G05C 2BUGA 2QFCA 3R7RA 3SGHA 4G26A 2R59A 4WWOA 4E6HA 3TG5A 3U9WA 4IN3B 4U8YD 3PDNA 2P9SG 3EDTB 5ENRD 2IOLA 3FTUA 3UM0A 1GW6A 5J90A 3FY4A 3E37A 4HI8A 1N0QA 3FU5A 3L08A 1K8KG 3LVQE 4U7EB 4GZ6A 4UQXA 2MOWA 1OT8A 4BX8A 2BKKB 4K5CA 5ENOD 4GTRA 3RRNB 3UINC 3D9OA 4N5CA 1IYGA 2ZIRA 3T9KA 5CHEE 4G1TA 1E8ZA 3LYAA 4BETA 1UG3A 2PM7A 3PZ4A 1YMPA 2JEKA 3DRAA 3JCKC 4NQ0A 5FWQA 3UT7A 2YNQA 3PS6A 4X8QA 2H6HA 2X6HA 1H6KA 4GU5A 3Q7FA 2ZGGA 4U04A 4KXKB 3C5RA 2NYJA 2X6JA 2L6BA 4ATZD 1Z5SC 3LJ3A 3FTSA 3NQPA 3HXEA 2DZOA 3FUEA 3BEEA 1EF1C 4GB9A 2IO3C 1HG5A 4M3OA 3LKUA 2XZTG 3KSQA 3Q7AA 2XGOA 3FH8A 3C3QA 4CT4A 4TXQA 3FUKA 4B8CB 3ABME 5ARGA 3URZA 5AYWD 1NL4A 4FJYA 4J8DA 2VGYA 5CCMA 3MV3B 4N2QA 3HIZA 4TUMA 5FQ4A 4OVVA 3ULEG 1N4PA 4U95D 4GCNA 4J8SA 4XI9A 1JWFA 4XX5A 2AXVA 4K0RA 1ELRA 3ASGA 2DCPA 3FH5A 5BXUA 2XS8A 4TUUA 3DSSA 1SA5A 5IY5E 5AN8A 2XS1A 4ABNA 4ME2A 4EZJA 1OCRE 4HORA 1OUVA 2KCKA 2LUHA 5CECB 5EIDA 3FEXA 1JCRA 4FHKA 1TNOA 2XEHA 3ASOE 2WXNA 3C3OA 4OVUA 5JJTA 3JQ0A 5CRVA 3IKOB 2LXLA 2PNNA 4K03A 4CCAA 1W3BA 1N94A 2GRRB 3L22A 3HDXA 2I1JA 2VGEA 3JXIA 3L17A 3APFA 1SZAA 3GZ1A 4U0UA 3SQVA 3CHMA 3UTMA 3ML9A 3LVRE 5FQ6A 3QK0A 3RSEG 1A5EA 2WXKA 4TXRA 4APFA 1NA3A 2WVIA 2B6CA 4U0ZA 4AVXA 3ZYKA 1OWOA 1ZU2A 4WNDA 5AARA 4I2ZA 4I6GA 3ZPJA 3KAEA 4HRMB 1IXVA 3PEUB 4HQDA 3I4GA 3OXLA 4MBGA 3PZDA 2X6FA 3RO2A 3NAWA 4XEIG 1N95A 4UWKA 4FU3A 5AAOA 3ESKA 3Q9UC 2DIWA 3PVLA 4ACKA 3QC1A 3CVQA 4N3BA 1N4SA 2MHKA 1Q2ZA 5EYPF 2WQ6A 1H2TC 3PE4A 2XQ0A 3OTNA 2DYRE 5DBKA 3Q78A 4G11A 3C3RA 2C2LA 4JD2G 3EJNA 3DXKG 1Z6TA 4U07A 3QNKA 3L82A 4GCOA 2L9BA 4LSZE 3ZXPA 1OWNA 4CRWA 2NC9A 3CIAA 3Q4AB 4P29A 2CG3A 1LF8A 3QKYA 3CHPA 2OVBA 3JXJA 3S2AA 3RKVA 3ZYQA 2FF4A 4HNAD 3ENEA 3SFXA 3EIQC 2H6FA 1E7UA 4GAAA 3AG4E 1BD8A 2A4ZA 1OXJA 2IOSA 2XRYA 4BERA 3CHSA 3TWSA 3DEOA 1HX8A 2ZU6B 4I6JA 4U8HA 1HF8A 3MV2B 4L2LA 4LNUD 5ENNA 3LDZA 2WXQA 2HYZA 4GTTA 3D9HA 2VQ2A 3I4RB 4F1SA 3E34A 3B13A 3SHFA 4L1BA 4DX6D 3DPYA 3P2BA 3CVNA 1H6OA 2GROB 4O6FA 4O1OA 3KSLA 2I6HA 1FVFA 3OXGA 5FT9A 3SZ7A 1MJ0A 2RFAA 3LS8A 1IQRA 2J9QA 2P9KG 4LNGA 3N71A 3ZYMA 3PEVB 3G2WA 4CZ2D 4WUYA 5FQ7A 2Y4TA 3S7DA 1XGWA 2HE0A 5BT1A 5D0QD 4C9BB 2QC9A 2KCVA 3UX4A 2V4LA 2OCCE 3GZ2A 5CEDB 1U3DA 4KMOA 3V79K 4AP2A 1E90A 3C72A 3S7BA 3DSTA 2EIKE 1WM5A 3DSXA 2P9LG 3CEQA 3FP3A 2R02A 2EIJE 2R5SA 2IONA 4OAVB 3Q9NC 2I1KA 3WXXA 4MRUA 3TJPA 5B1AE 1OWPA 5G05J 2AXZA 4FA6A 4KT6B 3DWLG 5EKQD 5EYLA 4GMLA 3ZYLA 3FU3A 3QAQA
chains in the Genus database with same CATH topology
5KCMA 4FULA 2KZTA 1JUQA 3FU5A 4I1MA 1TJFA 3L08A 5A6CA 3LVQE 4GZ6A 4MLPA 4UQXA 3ZXSA 2MOWA 3LXUX 3UQ3A 4BWRA 4BX8A 2AWIA 3FUHA 3IBEA 5BUZA 3RRNB 4URKA 3D9OA 3VLEA 3APCA 4N5CA 5C2YA 4XKCA 4CGVA 1IYGA 2J4DA 1NZNA 1VDYA 2LSUA 4UWFA 3AS5A 2KZTB 2J09A 5CMYA 4HOTA 5CHEE 3FTVA 4G1TA 2WXPA 4FP7A 1E8ZA 1INZA 2IF4A 2VGXB 2PZIA 3CK9A 3LYAA 4EBAA 3LY7A 2GRMA 1UG3A 4JL0A 2CHZA 2PM7A 4HXIA 2JEKA 1U3CA 3JCKC 4I9CA 4NQ0A 3QWVA 4BTAA 5EX3A 4JA9A 2WXFA 3CHQA 4NURA 1MQSA 3CKBA 3FTYA 2WXHA 5FWQA 4N3CA 1KLXA 4ANXA 3UT7A 2YNQA 2J07A 3ASDA 3SBSA 3PS6A 3Q5MA 4A3TA 5CCLA 3NZUA 2C0MA 1QNFA 2WPVA 3RU0A 4AJWA 2FI7A 4RG9A 3QDNA 3CVVA 5M72A 4Y6WA 2PQRA 2X6HA 3JYSA 3VTXA 1H6KA 3PNLB 3QJZA 4GU5A 4UI9J 4U0SA 4JXTA 2MRIA 3U64A 3Q47B 3SFZA 4U04A 4KXKB 1ZBPA 3AS8A 2FO7A 4TV3A 3FUDA 2X6JA 5JHAA 2V5FA 2GGFA 3CGHA 4WWPA 3LJ3A 3FTSA 3NQPA 3U4TA 3ZVVA 3FUEA 1E7VA 4AIFA 4UI9K 4WWNA 2IU1A 3BEEA 3CVXA 4L7TA 1QZ2A 1H2UA 3CHRA 2GRLA 1KT1A 4LRZA 1EF1C 2VTBB 2Y3AA 4GB9A 3FTWA 4ILGA 1FCHA 2QY7A 4UI9C 4C0MA 1HG5A 4J6IA 4YVQC 3K9IA 4GYWA 4G24A 4M3OA 4WNGA 3LKUA 2WXMA 3FU6A 1P5QA 3ZRHA 1Y8MA 2NXPA 4DI3A 3IV0A 1EPUA 2XGOA 3FH8A 4CT4A 4R7LA 4Q96A 3FUKA 1HH8A 4B8CB 5ARGA 3URZA 5AYWD 4XKBA 1H19A 3APDA 4FJYA 4J8DA 3D9LA 4N39A 4MKTA 2EQXA 3D9PA 4PDXA 3G2UA 2VGYA 4JA7A 1S0PA 5CCMA 2L0TB 2YQ8A 1HXIA 3MV3B 2ILRA 4N2QA 4NACA 3HIZA 2WXRA 3MZLB 4LCTA 4A1GA 5FQ4A 3GZSA 4YNDA 3KS2A 4OVVA 4AY5A 1SQMA 3QB2A 2YHCA 4PS7A 4GCNA 2WB2A 4J8SA 3MKQA 2BTDA 2WM9A 3FUFA 4XI9A 1JWFA 4A1SA 4XX5A 4DK5A 4FLHA 2AXVA 2I2OA 2WQ7A 5AENA 4K0RA 1Y6IA 1ELRA 1WY6A 3ASGA 1UN8A 2DCPA 4ANWA 3GYZA 4DI4A 1E8YA 4HOSA 3FH5A 5D0OD 5G55A 3SBTB 5G2NA 4TUUA 2AW6A 3MYVA 3TGOA 3ZIMA 3U3WA 2PL2A 3FUIA 2Y4UA 4ABNA 3DBSA 4ME2A 3S7FA 4EZJA 2E0IA 3I3NA 4HORA 1PAQA 5T4YA 5J08A 2VSNA 1OUVA 2KCKA 5G04J 4Q69A 3B7UX 3RRMB 3CV0A 3FEXA 5BW8C 3GW4A 1HZ4A 4FHKA 2WMOA 4G25A 4G23A 3CSTA 1QQEA 2WXNA 4OVUA 2VJ8A 2CHWA 5JJTA 1N54A 3D9MA 4AEZC 1BPOA 1TJCA 4AY6A 1MHQA 1NA0A 5AJDA 5FZSA 3JQ0A 3BG1B 5FJYA 2WXIA 3AU4A 2X38A 3IKOB 2IJGX 4DLOA 2I9CA 3TXMA 4CDNA 4K03A 2XPIA 4CCAA 1W3BA 4HOQA 4LERA 3HHMA 3LY9A 3ZHEA 5C1DA 2XPYA 3ESLA 3QWWA 4NRHB 3L22A 3ULQA 1B89A 1KT0A 3HDXA 2I1JA 4MS6A 5AJLA 4OYSA 3L17A 3APFA 3P1UA 4J8FA 1SZAA 2WXLA 2XHEA 3RO3A 1IQUA 3GZ1A 4U0UA 1DNPA 2X6KA 2VSXE 3CQCB 1H0AA 4C0EA 5FZRA 4JHRA 3CHMA 3S7JA 4BT9A 3ZW3A 5LP0A 3Q49B 3L6AA 2YHEA 5E75A 3ML9A 3LVRE 5FQ6A 3QK0A 3MCXA 3PREA 2LO6A 3FUNA 2BF0X 4EZKA 3KD7A 1PY1A 3LPZA 5LCWJ 2WXKA 2UY1B 2VSOE 2L6JA 5LFAA 2LSVA 2IFUA 4B89A 4WNFA 4APFA 1NA3A 2R17C 3C98A 2WVIA 3ML8A 4AV7A 5A23A 2J08A 2XCCA 4U0ZA 4AVXA 3ZYKA 3SNXA 3QWPA 2AVPA 1OWOA 5EX0A 1ZU2A 3SI5A 1A17A 3D3MA 3G2SA 4BFRA 4IYPA 4WNDA 4W9RA 5JHBA 4I2ZA 3FH7A 4B8AA 3ZFWA 2XGSA 2CFUA 3CQGB 4I6GA 3ZPJA 3TL5A 5BNWA 4L23A 2XCBA 3UUXA 2J49A 3DPDA 3CHOA 4ILIA 3KAEA 4EECA 3PRZA 1FVHA 3PEUB 4L2YA 4PH4B 5EDSA 3CVWA 4GYOA 5ANRA 3I4GA 3OXLA 3RIBA 4GPKA 3PZDA 2X6FA 3RO2A 3FTZA 3OAWA 3CVLA 2VSYA 4BTBA 3D9IA 1NP7A 1ELWA 5A7DB 4RSYA 4UWKA 4FU3A 3D9NA 3ONLA 3UPVA 1H2VC 1OWMA 1UW4B 4F7AA 3ESKA 3B7SA 4BSXA 2DIWA 2OVFA 3PVLA 3FDHA 4ACKA 2X3MA 3FHEA 4U63A 4V3IA 3QC1A 2V0PA 4ATGA 4GZ3A 1SZ9A 5LX8A 3CVQA 2KC7A 4UWGA 4N3BA 4E85A 1L5JA 2LNIA 2WXGA 1Z3XA 4XIFA 3B7RL 4XE0A 2MHKA 3FWVA 3FULA 4APOA 3EHNA 3AS4A 4XI0A 3HVEB 2WQ6A 1UN9A 2WQHA 3SD5A 3UT8A 4GMJA 1H2TC 1UJJA 2Q7FA 3PE4A 4H7XA 4LEUA 2RD0A 2P58C 2XQ0A 3OTNA 3ASFA 4JZYA 4PS8A 5DBKA 4JHJA 4ILHB 4GZDA 4G11A 3MJWA 1TEZA 3CK7A 2C2LA 3RK6A 2WMNA 2CFZA 4UWHA 2XGMA 4Q94A 4QFVA 3EJNA 4IULA 1OWLA 1Z6TA 3OXFA 3QNKA 4U07A 4GCOA 3CK8A 2L9BA 1OWNA 4CRWA 4BY6A 3E4BA 3B7TA 2NC9A 3T8MA 3CIAA 3G2VA 3Q4AB 2CHXA 2RG8A 4P29A 2XRZA 4I6EA 4DPRA 3VLDA 2KATA 2OV8A 4CGWA 2CG3A 1E96B 2IQCA 4J8EA 5KJLA 4J0UA 3NF1A 4CEMA 3JQ1A 3PNTB 5T8IA 1LF8A 1HO8A 3QKYA 3CHPA 2OVBA 4JW1A 3S2AA 3RKVA 3ZYQA 2VYIA 3R9AB 1JWGA 4CT0A 2FF4A 3ASHA 4FHJA 3ENEA 5BV0A 4N3AA 4I43A 2LAIA 3EIQC 1EDUA 4D10C 5KJNA 1E7UA 1HG2A 4RVBA 1N52A 4GAAA 4BT8A 3QARA 4FC8A 2A4ZA 3MEKA 5FZQA 4I1OB 4TRQA 4I9EA 2IOSA 3FTXA 2XRYA 3LEWA 1UJKA 3I5PA 4KBQA 3CHSA 1WAO1 5E76A 2A5UA 3CKCA 3MX3A 1HX8A 2ZU6B 2PQNA 4DJAA 4I6JA 4UQZA 4U8HA 3FFLA 5BPPA 1X5BA 1HF8A 2XEVA 4FJZA 2AXUA 4WAFA 2FEZA 2HO1A 3MV2B 4B94A 4L2LA 2OOEA 3O48A 4XZ4A 4Y6CA 1YA0A 3EHMA 2M63A 4EPZA 2L0IA 3FUMA 3RRUA 3KEZA 4KYOB 3PE3A 3HYMB 5ENNA 5AIJA 4F53A 4EZLA 1HE8A 3LDZA 3MGBA 3CVYA 4PS3A 5DIZA 4GA0A 2WXQA 2HYZA 3MA5A 1ELKA 3ZHEB 2WXJA 2VQ2A 3I4RB 3ONKA 3QOUA 4F1SA 2DBAA 4JEHA 4I2WA 3CVPA 5LOZA 3LY8A 3B13A 4YVOA 4N2SA 3SHFA 4GZCA 3G2TA 4L1BA 4JEUA 5HQ8A 2HR2A 4A55A 4EQFA 4HLEA 5ARFA 3VLFA 3P2BA 2WXOA 3LCAA 3CVNA 5HI7A 3PUJA 4PUCA 2NSZA 1Z3YA 3IHYA 4O6FA 4CDRA 3BG0B 3CR3A 1PC2A 2LAHA 2I6HA 4LUNU 3MKRA 1FVFA 3OXGA 4AOFA 3CSFA 3HVEA 4WNEA 4KZCA 4I17A 5FT9A 3SZ7A 4B0ZA 3L54A 3LS8A 3D9KA 4JVSA 4GZ5A 4A3VA 1IQRA 2VGXA 4KVMA 2ONDA 3FUJA 3ZGQA 4AM9A 2C0LA 2J9QA 5JJ6A 4CDMA 2X6IA 3NZSA 3Q15A 4UQYA 3MKQB 4ANVA 3O4ZA 5CMWA 3ZN3A 3N71A 3PH0C 3ZYMA 3PEVB 4FLBA 2HM8A 4FADA 4GYYA 3G2WA 4H7YA 2E2EA 5ANLA 4HOUA 3U66A 3PUKA 3TXNA 2PM6A 5LCWC 2UY1A 4KZ0A 3TAXA 2GW1A 3T5VA 1HS6A 5FTPA 4JC8A 5KJKA 4WUYA 2FULA 1HU3A 1IHGA 3SF4A 3CLJA 2Y4TA 5FQ7A 4RG6A 5BV1A 3S7DA 1XGWA 5G04C 2J4BA 4ACLA 5BT1A 5D0QD 3AU5A 5KJMA 2KCLA 4C9BB 2KCVA 4GA2A 3UX4A 4EBAG 2V4LA 2XPZA 2JLBA 3GZ2A 3IHVA 4AXHA 1U3DA 3UT4A 3EIJA 5FQ8A 4KMOA 4F3VA 4AP2A 1E90A 3S7BA 4HFGA 4HVBA 1HFAA 1JPLA 3ZEFA 2V8SE 1E8XA 3UMVA 4BX9A 2KM4A 2UWJG 3IEGA 3T5XA 2VTBA 3JUIA 1WM5A 3D9JA 5JJ7A 5G05C 3R7QA 3CEQA 2BUGA 4HS2A 3FP3A 2QFCA 4G2VA 1E8WA 2FBNA 4JPSA 3R7RA 3TG4A 4GA1A 3CVUA 4I1AA 2R5SA 2IONA 2I1KA 4G26A 3SGHA 1DVPA 5T3RA 2R59A 3RJVA 4DLQA 3WXXA 4MRUA 3FEYA 4UWLA 3TJPA 1OWPA 3L13A 4WWOA 5G05J 2AXZA 4FA6A 4KT6B 4KVOA 5EKQD 3VTYA 4E6HA 3TG5A 1XNFA 4GMLA 3U9WA 3ZYLA 4IN3B 3FU3A 3FU0A 4ANUA 3PDNA 4JHKA 4IRUA 3EDTB 2IOLA 3FTUA 2CG2A 3L16A 1EYHA 1GW6A 3QAQA 5J90A 3FY4A 2YINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVL A;  4KYO B;  3PE3 A;  4XI9 A;  3HYM B;  4A1S A;  2VSY A;  4BTB A;  5A6C A;  5DIZ A;  4GZ6 A;  1ELR A;  3ASG A;  4GA0 A;  4UQX A;  3GYZ A;  1ELW A;  5A7D B;  2HYZ A;  3UQ3 A;  5D0O D;  3MA5 A;  4BWR A;  3ZHE B;  4HOS A;  3UPV A;  2VQ2 A;  4GPK A;  3ESK A;  3QOU A;  2DBA A;  4I2W A;  3CVP A;  4N5C A;  3LY8 A;  4CGV A;  4YVO A;  3TGO A;  3U3W A;  4N2S A;  2PL2 A;  1IYG A;  1NZN A;  2LSU A;  2Y4U A;  4ABN A;  4ME2 A;  3AS5 A;  3S7F A;  5LCW C;  4GZ3 A;  4HOR A;  5HQ8 A;  2HR2 A;  5CHE E;  4G1T A;  2VSN A;  1OUV A;  2KCK A;  5G04 J;  3CVQ A;  2KC7 A;  5ARF A;  4EQF A;  4N3B A;  2IF4 A;  2VGX B;  2PZI A;  3CK9 A;  3LCA A;  3CVN A;  3CV0 A;  3LYA A;  3LY7 A;  2LNI A;  5HI7 A;  5BW8 C;  3GW4 A;  1HZ4 A;  4JL0 A;  4XIF A;  4O6F A;  2MHK A;  3FWV A;  4APO A;  4CDR A;  4G25 A;  1PC2 A;  3AS4 A;  2I6H A;  3MKR A;  3OXG A;  4I9C A;  3QWV A;  2WQH A;  4NQ0 A;  4XI0 A;  4JA9 A;  5EX3 A;  4BTA A;  4G23 A;  4WNE A;  2Q7F A;  3CKB A;  3PE4 A;  4H7X A;  4I17 A;  1QQE A;  4LEU A;  2P58 C;  5FT9 A;  3ASF A;  3SZ7 A;  4N3C A;  5JJT A;  4AY6 A;  1KLX A;  1TJC A;  3ASD A;  4GZ5 A;  5DBK A;  1NA0 A;  2VGX A;  2OND A;  3Q5M A;  3ZGQ A;  4AM9 A;  5CCL A;  2C0L A;  5FZS A;  2J9Q A;  5JJ6 A;  2C0M A;  3CK7 A;  2C2L A;  2WPV A;  3Q15 A;  4UQY A;  5FJY A;  3RU0 A;  2XGM A;  3ZN3 A;  3N71 A;  2FI7 A;  4RG9 A;  3QDN A;  4GYY A;  4H7Y A;  2E2E A;  2XPI A;  3OXF A;  2PQR A;  4HOU A;  3JYS A;  4U07 A;  1W3B A;  4GCO A;  4UI9 J;  4Y6W A;  3VTX A;  3CK8 A;  2UY1 A;  4HOQ A;  4U0S A;  3TAX A;  2GW1 A;  3LY9 A;  5FTP A;  3ZHE A;  5C1D A;  3Q47 B;  3QWW A;  5KJK A;  4U04 A;  4WUY A;  5M72 A;  4KXK B;  4NRH B;  1IHG A;  1B89 A;  1KT0 A;  1ZBP A;  3E4B A;  3SF4 A;  3ULQ A;  2NC9 A;  2Y4T A;  3AS8 A;  4RG6 A;  2FO7 A;  3S7D A;  3Q4A B;  2V5F A;  5G04 C;  4J8F A;  2KAT A;  5BT1 A;  3RO3 A;  4CGW A;  5D0Q D;  5KJM A;  2KCL A;  3GZ1 A;  4U0U A;  1E96 B;  4J8E A;  5KJL A;  3U4T A;  2KCV A;  4J0U A;  4GA2 A;  3NF1 A;  4AIF A;  4UI9 K;  2JLB A;  3GZ2 A;  5FZR A;  3BEE A;  4JHR A;  3S7J A;  4BT9 A;  4F3V A;  3Q49 B;  1QZ2 A;  3S7B A;  3QKY A;  1KT1 A;  3RKV A;  5LCW J;  4HOT A;  1FCH A;  3KD7 A;  2VYI A;  3LPZ A;  4UI9 C;  2UWJ G;  2UY1 B;  3IEG A;  2FF4 A;  2L6J A;  2LSV A;  2IFU A;  3ASH A;  3K9I A;  4YVQ C;  3R9A B;  4WNF A;  1WM5 A;  4G24 A;  4GYW A;  4N3A A;  3LKU A;  4WNG A;  1NA3 A;  5G05 C;  5JJ7 A;  2BUG A;  1P5Q A;  3CEQ A;  5KJN A;  3FP3 A;  2QFC A;  2XCC A;  1Y8M A;  4G2V A;  4U0Z A;  2FBN A;  3TG4 A;  4BT8 A;  4GA1 A;  3QWP A;  2XGO A;  2AVP A;  2R5S A;  3MEK A;  4I1A A;  5EX0 A;  1ZU2 A;  5FZQ A;  1A17 A;  4G26 A;  1HH8 A;  4WND A;  4W9R A;  4I9E A;  5ARG A;  3RJV A;  4I2Z A;  3URZ A;  4KBQ A;  5AYW D;  3WXX A;  2XGS A;  3ZFW A;  4J8D A;  1WAO 1;  4N39 A;  3ZPJ A;  5G05 J;  5BNW A;  3CKC A;  2XCB A;  2VGY A;  3UUX A;  5EKQ D;  3VTY A;  4JA7 A;  2PQN A;  3KAE A;  3RO2 A;  1XNF A;  3TG5 A;  2YQ8 A;  5CCM A;  4UQZ A;  1HXI A;  3MV3 B;  4IN3 B;  3FFL A;  4N2Q A;  2XEV A;  3PDN A;  4YND A;  3EDT B;  2FEZ A;  2HO1 A;  3KS2 A;  3MV2 B;  4GYO A;  4B94 A;  4AY5 A;  3OXL A;  3RIB A;  2OOE A;  3O48 A;  4Y6C A;  1YA0 A;  2YHC A;  4GCN A; 
#chains in the Genus database with same CATH topology
 4FUL A;  1JUQ A;  4I1M A;  5A6C A;  4MLP A;  2OEV A;  1O1T A;  3LXU X;  2AWI A;  3VLE A;  3APC A;  5C2Y A;  4XKC A;  2J4D A;  1NZN A;  3ZKJ A;  1UOH A;  2LSU A;  4UWF A;  3AS5 A;  4UUC A;  4EBA A;  2PZI A;  2V4H C;  2VGX B;  3CK9 A;  4BES A;  2GRM A;  2B0O E;  1U3C A;  5EX3 A;  4JA9 A;  5HKP A;  2WXF A;  3SFY A;  3FTY A;  2WXH A;  3EHQ A;  4N3C A;  1KLX A;  3PZ2 A;  1BI7 B;  1QNF A;  2WPV A;  2J8S D;  4AJW A;  1N11 A;  4Y6W A;  3U64 A;  3Q47 B;  2GRN B;  4TV3 A;  2F37 A;  2V5F A;  1O1S A;  2GGF A;  4WWP A;  3NBN B;  1YYH A;  3CHR A;  4LRZ A;  2VTB B;  3UXG A;  2QY7 A;  4UI9 C;  4C0M A;  4YVQ C;  4GYW A;  4WNG A;  5ENQ D;  3ZRH A;  2NXP A;  3Q73 A;  4Q96 A;  4XKB A;  3T8K A;  3D9L A;  4J8Y A;  3D9P A;  4JA7 A;  1S0P A;  2YQ8 A;  4NAC A;  3GZS A;  3ISM C;  3QB2 A;  2WB2 A;  4DK5 A;  3FUF A;  2WQ7 A;  2I2O A;  1UN8 A;  3GYZ A;  4HOS A;  5D0O D;  2AW6 A;  3TGO A;  3ZIM A;  3DXM G;  3I3N A;  1PAQ A;  5T4Y A;  2VSN A;  5G04 J;  4F1P A;  3B7U X;  4HBD A;  2FO1 E;  5BW8 C;  2WMO A;  4U96 D;  2ETA A;  4G23 A;  3ZNG A;  4AY6 A;  5KWD A;  1TJC A;  1MHQ A;  5AJD A;  4DLO A;  2I9C A;  3TXM A;  4CDN A;  2XPI A;  1TNY A;  4HOQ A;  3ZHE A;  2AJA A;  5AJL A;  3P1U A;  4J8F A;  2WXL A;  2XHE A;  3RO3 A;  4GTP A;  4OAU C;  3BU8 A;  2VSX E;  1V54 E;  3CQC B;  1H0A A;  4JHR A;  2P9P G;  3Q49 B;  5E75 A;  3B7B A;  3AG3 E;  4BSZ B;  1PY1 A;  3LPZ A;  2UY1 B;  2LSV A;  5A23 A;  3UIO C;  5EX0 A;  3D3M A;  1TR4 A;  3G2S A;  4IYP A;  3FH7 A;  4B8A A;  2R03 A;  2CFU A;  3CQG B;  2XEE A;  1N0R A;  4PH4 B;  4GYO A;  5ANR A;  4HB5 A;  4BTB A;  1NP7 A;  1ELW A;  5H7P A;  3ZUV B;  3UPV A;  1H2V C;  1UW4 B;  4J7W A;  5D2M C;  4F7A A;  2X3M A;  2V0P A;  1U2V G;  4ATG A;  5LX8 A;  4XE0 A;  3FWV A;  3AS4 A;  1UN9 A;  2Q7F A;  4H7X A;  4LEU A;  2RD0 A;  1MZC A;  4PS8 A;  4ILH B;  4GZD A;  3UIP C;  3RK6 A;  4UWH A;  1OWL A;  1KZO A;  1V55 E;  3PZ1 A;  3V30 A;  3BUA A;  3T8M A;  2RG8 A;  4I6E A;  2OV8 A;  2IQC A;  4J8E A;  3TWX A;  5T8I A;  4C48 B;  1HO8 A;  4GTM A;  5ITZ F;  2P9I G;  3ASH A;  4FHJ A;  4I43 A;  5KJN A;  1HG2 A;  3F6Q A;  3QAR A;  4O1P A;  4I9E A;  3LEW A;  5E76 A;  3MX3 A;  1OCC E;  4DJA A;  3R9M A;  3RAU A;  5BPP A;  4FJZ A;  4WAF A;  1RW2 A;  1YA0 A;  3EHM A;  4EZL A;  4PS3 A;  4GA0 A;  3MA5 A;  3ONK A;  2DBA A;  3CVP A;  1WG0 A;  4JEU A;  5HQ8 A;  4A55 A;  4EQF A;  5KNH D;  5JMN D;  4HLE A;  3VLF A;  3E30 A;  2NSZ A;  4CDR A;  1MX4 A;  4AOF A;  5CBN A;  3MKR A;  2A5E A;  3CSF A;  3HVE A;  4I17 A;  2VGX A;  4KVM A;  2OND A;  3ZGQ A;  2C0L A;  5HS0 A;  3MKQ B;  4ANV A;  3O4Z A;  4GMR A;  2MYO A;  4FAD A;  1TNZ A;  2E2E A;  3U66 A;  3PUK A;  2UY1 A;  5CER B;  3TAX A;  1HS6 A;  1IHG A;  3SF4 A;  4RG6 A;  1TN8 A;  5B3S E;  4ACL A;  5KJM A;  4EBA G;  4AXH A;  1O1R A;  4DX2 A;  4HVB A;  3ZEF A;  1E8X A;  4BX9 A;  2KM4 A;  2UWJ G;  2VTB A;  1D9S A;  2BKG A;  3R7Q A;  4HS2 A;  5KBA A;  1E8W A;  5EIL A;  4JPS A;  3CVU A;  4I1A A;  1QBQ A;  4DLQ A;  2R05 A;  4UWL A;  3L13 A;  4KVO A;  3DEP A;  2QZA A;  4ANU A;  4IRU A;  1EYH A;  3KEA A;  2Y69 E;  2YIN A;  1K3Z D;  1BU9 A;  2ETB A;  3ZXS A;  2H6I A;  3UQ3 A;  4URK A;  3Q75 A;  1TN7 A;  3EU5 A;  1VDY A;  4B93 B;  2J09 A;  3FTV A;  2WXP A;  4FP7 A;  2IF4 A;  1FT1 A;  3LY7 A;  4DX7 D;  2LXM A;  4JL0 A;  4HXI A;  4I9C A;  1KPS B;  1YCS B;  4HRL A;  4NUR A;  2Y0B G;  3CKB A;  1KZP A;  4ANX A;  2J07 A;  3Q5M A;  5CCL A;  2ZGD A;  3NZU A;  2C0M A;  2DZN A;  3TWT A;  2FI7 A;  4RG9 A;  3CVV A;  3HRA A;  3PNL B;  4JXT A;  2XEN A;  3SFZ A;  2Y1L E;  2KXP C;  3AS8 A;  2FO7 A;  3FUD A;  5JHA A;  3U4T A;  4M7C A;  2IU1 A;  3CVX A;  1QZ2 A;  1H2U A;  4O60 A;  1KT1 A;  3FTW A;  1FCH A;  1P5Q A;  4YDE A;  1Y8M A;  1K1A A;  3IV0 A;  4Z68 A;  1EPU A;  3TWV A;  3DSW A;  1H19 A;  1QYM A;  4N39 A;  1WDY A;  2EQX A;  3G2U A;  1LD8 A;  1IKN D;  2L0T B;  4LCT A;  4A1G A;  4YND A;  3KS2 A;  4K5A B;  4AY5 A;  2YHC A;  2DYS E;  1OCZ E;  2WM9 A;  4A1S A;  5AEN A;  1Y6I A;  4DI4 A;  5G55 A;  3MYV A;  2PL2 A;  3SO8 A;  3FUI A;  3S7F A;  5J08 A;  4Q69 A;  1AWC B;  3UI2 A;  3CV0 A;  3GW4 A;  1HZ4 A;  3CST A;  2CHW A;  4CYM D;  3D9M A;  1BPO A;  1S63 A;  3HXC A;  1S64 A;  5FJY A;  3AU4 A;  2IJG X;  4LER A;  3HHM A;  2XPY A;  3QWW A;  4NRH B;  3ULQ A;  1B89 A;  1IQU A;  2P9N G;  4C0E A;  5FZR A;  5LP0 A;  1SA4 A;  1G3N B;  1MX2 A;  3MCX A;  3PRE A;  4RLY A;  2LO6 A;  2BF0 X;  4EZK A;  4HOT A;  5LCW J;  5LFA A;  2L6J A;  4U8V D;  2IFU A;  4WNF A;  2R17 C;  2EIL E;  2J08 A;  2XCC A;  4A63 B;  3SNX A;  3QWP A;  2AVP A;  3SI5 A;  1A17 A;  4BFR A;  5JHB A;  4GTQ A;  3ZFW A;  2XGS A;  5BNW A;  3UUX A;  3DPD A;  4ILI A;  3CHO A;  4LNB A;  3PRZ A;  1FVH A;  4L2Y A;  5AQA A;  5EDS A;  3CVW A;  4GPK A;  5AQB A;  5A7D B;  3D9N A;  3ONL A;  3B7S A;  3FHE A;  3B95 A;  4U63 A;  3ZU7 B;  4DX1 A;  2RFM A;  4UWG A;  4E85 A;  1L5J A;  3HXF A;  3W9G A;  1JCS A;  2LNI A;  2WXG A;  3B7R L;  1K1B A;  3SD5 A;  3UT8 A;  3V2O A;  4JZY A;  3UM1 A;  2WMN A;  2CFZ A;  1OY3 D;  4IUL A;  1O5M A;  4BY6 A;  3E4B A;  3B7T A;  3G2V A;  1JCQ A;  2XRZ A;  2IEJ A;  2F8X K;  4DPR A;  3VLD A;  1E96 B;  5KJL A;  4CEM A;  3PNT B;  3TWW A;  3W9F A;  4G8L A;  1TNB A;  3R9A B;  1JWG A;  4CT0 A;  1FPP A;  2IY0 C;  1X81 A;  4YDW A;  4FC8 A;  5FZQ A;  5CEA A;  4I1O B;  4TRQ A;  3I5P A;  1DCQ A;  3UKR G;  2A5U A;  4LG6 A;  3FFL A;  2XEV A;  2HO1 A;  4EPZ A;  4Y6C A;  3TWR A;  2M63 A;  2L0I A;  3FUM A;  3RRU A;  3KEZ A;  3PE3 A;  5AIJ A;  1HE8 A;  3CVY A;  3MGB A;  2IO2 C;  5FIO A;  3ZHE B;  5LOZ A;  3IXE A;  4GZC A;  2HR2 A;  3NOC D;  3J5P A;  2P9U G;  5ARF A;  2WXO A;  5ENP D;  4PUC A;  1Z3Y A;  5B1B E;  3TWU A;  1PC2 A;  2LAH A;  4LUN U;  4B0Z A;  4JVS A;  3SY2 A;  3FUJ A;  4AM9 A;  1DCE A;  4G8K A;  4UQY A;  3ZN3 A;  3PH0 C;  3AAA C;  3TXN A;  4KZ0 A;  2GW1 A;  5KJK A;  2FUL A;  1HU3 A;  3CLJ A;  5BV1 A;  2J4B A;  4JB8 P;  3EUV A;  3AU5 A;  2ZXW E;  2QYU A;  3WG7 E;  3UT4 A;  4F3V A;  3EIJ A;  4HRN A;  1HFA A;  1RZ4 A;  1JPL A;  3UMV A;  3IEG A;  5CRU A;  3T5X A;  1TNU A;  3JUI A;  4L9P A;  4F6R D;  5JJ7 A;  4G2V A;  2FBN A;  3TG4 A;  4GA1 A;  4HI9 A;  5KNG A;  1DVP A;  5T3R A;  3RJV A;  2F8Y A;  3FEY A;  3DSV A;  3VTY A;  1XNF A;  2F0Y A;  4GTS A;  4YDY A;  3FU0 A;  4JHK A;  4NIK A;  2CG2 A;  3L16 A;  5KCM A;  2KZT A;  2P2C P;  1AP7 A;  1TJF A;  3AG1 E;  4BWR A;  3FUH A;  3DSU A;  3IBE A;  5BUZ A;  4CGV A;  4TXP A;  2KZT B;  5CMY A;  1INZ A;  3BQO A;  3EU9 A;  2CHZ A;  3QWV A;  4BTA A;  4N5Q A;  3CHQ A;  1MQS A;  3ASD A;  3EHR A;  2R2L A;  3SBS A;  4A3T A;  3RU0 A;  4DUI A;  3QDN A;  2KBX A;  5M72 A;  2PQR A;  3JYS A;  3VTX A;  3NOG D;  3QJZ A;  4UI9 J;  4U0S A;  2MRI A;  3X2Q E;  1ZBP A;  3CGH A;  3ZVV A;  1E7V A;  4AIF A;  4UI9 K;  4WWN A;  5EIB E;  5EN5 D;  4L7T A;  2GRL A;  2Y3A A;  4ILG A;  4J6I A;  3K9I A;  5FIN A;  4G24 A;  2WXM A;  3FU6 A;  4DI3 A;  4R7L A;  4YDO A;  1HH8 A;  3AG2 E;  3APD A;  4MKT A;  4PDX A;  5CBO A;  3PZ3 A;  3V2X A;  1HXI A;  5BXO A;  2ILR A;  2WXR A;  3MZL B;  3J5Q B;  1SQM A;  4PS7 A;  3MKQ A;  2BTD A;  4HLL A;  1D8D A;  4FLH A;  1WY6 A;  3HXB A;  4ANW A;  1E8Y A;  3SBT B;  5G2N A;  2EIM E;  1D8E A;  3U3W A;  2Y4U A;  3DBS A;  2OEW A;  2E0I A;  4GPM A;  3E33 A;  2BED A;  3RRM B;  3JUE A;  2ETC A;  4G25 A;  4DX5 D;  1QQE A;  2VJ8 A;  1N54 A;  4AEZ C;  2V5Q C;  1NA0 A;  4GTO A;  5FZS A;  1SW6 A;  3BG1 B;  2DWZ A;  2WXI A;  4QQI A;  1IHB A;  5ENT D;  1OCO E;  2X38 A;  1N4R A;  5D66 A;  2JAB A;  3LY9 A;  5C1D A;  3ESL A;  1KT0 A;  4MS6 A;  1MYO A;  4OYS A;  1DNP A;  3AJI A;  2X6K A;  1N9A A;  4BT9 A;  3S7J A;  3ZW3 A;  3UM3 A;  3L6A A;  2YHE A;  3FUN A;  1H6P A;  3KD7 A;  2VSO E;  4B89 A;  3ML8 A;  3C98 A;  4AV7 A;  2DVW A;  4RQI A;  4ZHB A;  1MX6 A;  4W9R A;  5AQ9 A;  3TL5 A;  4L23 A;  2XCB A;  2J49 A;  5JA4 D;  4EEC A;  1TYQ G;  3ABK E;  1BLX B;  3RIB A;  3HG0 D;  3FTZ A;  3OAW A;  1LTX A;  3CVL A;  2VSY A;  3D9I A;  4RSY A;  3ULY A;  1OWM A;  4BSX A;  2OVF A;  3FDH A;  4V3I A;  4GZ3 A;  1SZ9 A;  2KC7 A;  1Z3X A;  4XIF A;  4APO A;  3FUL A;  3EHN A;  4XI0 A;  3HVE B;  3UKU G;  2WQH A;  4GMJ A;  1UJJ A;  2P58 C;  3ASF A;  4JHJ A;  3MJW A;  1TEZ A;  3CK7 A;  4EHM A;  2XGM A;  4Q94 A;  4QFV A;  3NB2 A;  1SVX A;  2XZD G;  3ABL E;  3L9T A;  3OXF A;  3CK8 A;  1NI1 A;  2ZIS A;  1N4Q A;  2GRP B;  2CHX A;  2KAT A;  4CGW A;  2RKK A;  4J0U A;  3NF1 A;  3JQ1 A;  4BEP A;  3TWQ A;  4JW1 A;  1FT2 A;  2VYI A;  5BV0 A;  4N3A A;  2LAI A;  1EDU A;  4D10 C;  4RVB A;  1N52 A;  1BI8 B;  4BT8 A;  3MEK A;  3FTX A;  1UJK A;  4KBQ A;  4DRX E;  1WAO 1;  3V31 A;  3CKC A;  3HXD A;  2PQN A;  4UQZ A;  1ZB1 A;  2QYJ A;  1X5B A;  2AXU A;  2FEZ A;  4B94 A;  2OOE A;  3O48 A;  4XZ4 A;  1S70 B;  4KYO B;  3HYM B;  3E32 A;  4F53 A;  4ZFH A;  5DIZ A;  1ELK A;  2WXJ A;  3QOU A;  4JEH A;  4I2W A;  3LY8 A;  4N2S A;  4YVO A;  2H6G A;  3G2T A;  2EIN E;  3LCA A;  5ENS D;  3PUJ A;  5HI7 A;  3IHY A;  3BG0 B;  3CR3 A;  2GRQ B;  4WNE A;  4KZC A;  3L54 A;  3D9K A;  4A3V A;  4GZ5 A;  5JJ6 A;  4CDM A;  3Q79 A;  2X6I A;  3NZS A;  3Q15 A;  5CMW A;  3LJN A;  4FLB A;  2HM8 A;  3UM2 A;  4GYY A;  4H7Y A;  5ANL A;  4HOU A;  2PM6 A;  5LCW C;  3T5V A;  5FTP A;  4JC8 A;  3ASN E;  5G04 C;  1TN6 A;  4K5B A;  4GTV A;  2KCL A;  1LD7 A;  4GA2 A;  5HRY A;  2XPZ A;  2JLB A;  3IHV A;  5FQ8 A;  4HFG A;  5AQ7 A;  2V8S E;  1DC2 A;  1NFI E;  3D9J A;  5G05 C;  2BUG A;  2QFC A;  3R7R A;  3SGH A;  4G26 A;  2R59 A;  4WWO A;  4E6H A;  3TG5 A;  3U9W A;  4IN3 B;  4U8Y D;  3PDN A;  2P9S G;  3EDT B;  5ENR D;  2IOL A;  3FTU A;  3UM0 A;  1GW6 A;  5J90 A;  3FY4 A;  3E37 A;  4HI8 A;  1N0Q A;  3FU5 A;  3L08 A;  1K8K G;  3LVQ E;  4U7E B;  4GZ6 A;  4UQX A;  2MOW A;  1OT8 A;  4BX8 A;  2BKK B;  4K5C A;  5ENO D;  4GTR A;  3RRN B;  3UIN C;  3D9O A;  4N5C A;  1IYG A;  2ZIR A;  3T9K A;  5CHE E;  4G1T A;  1E8Z A;  3LYA A;  4BET A;  1UG3 A;  2PM7 A;  3PZ4 A;  1YMP A;  2JEK A;  3DRA A;  3JCK C;  4NQ0 A;  5FWQ A;  3UT7 A;  2YNQ A;  3PS6 A;  4X8Q A;  2H6H A;  2X6H A;  1H6K A;  4GU5 A;  3Q7F A;  2ZGG A;  4U04 A;  4KXK B;  3C5R A;  2NYJ A;  2X6J A;  2L6B A;  4ATZ D;  1Z5S C;  3LJ3 A;  3FTS A;  3NQP A;  3HXE A;  2DZO A;  3FUE A;  3BEE A;  1EF1 C;  4GB9 A;  2IO3 C;  1HG5 A;  4M3O A;  3LKU A;  2XZT G;  3KSQ A;  3Q7A A;  2XGO A;  3FH8 A;  3C3Q A;  4CT4 A;  4TXQ A;  3FUK A;  4B8C B;  3ABM E;  5ARG A;  3URZ A;  5AYW D;  1NL4 A;  4FJY A;  4J8D A;  2VGY A;  5CCM A;  3MV3 B;  4N2Q A;  3HIZ A;  4TUM A;  5FQ4 A;  4OVV A;  3ULE G;  1N4P A;  4U95 D;  4GCN A;  4J8S A;  4XI9 A;  1JWF A;  4XX5 A;  2AXV A;  4K0R A;  1ELR A;  3ASG A;  2DCP A;  3FH5 A;  5BXU A;  2XS8 A;  4TUU A;  3DSS A;  1SA5 A;  5IY5 E;  5AN8 A;  2XS1 A;  4ABN A;  4ME2 A;  4EZJ A;  1OCR E;  4HOR A;  1OUV A;  2KCK A;  2LUH A;  5CEC B;  5EID A;  3FEX A;  1JCR A;  4FHK A;  1TNO A;  2XEH A;  3ASO E;  2WXN A;  3C3O A;  4OVU A;  5JJT A;  3JQ0 A;  5CRV A;  3IKO B;  2LXL A;  2PNN A;  4K03 A;  4CCA A;  1W3B A;  1N94 A;  2GRR B;  3L22 A;  3HDX A;  2I1J A;  2VGE A;  3JXI A;  3L17 A;  3APF A;  1SZA A;  3GZ1 A;  4U0U A;  3SQV A;  3CHM A;  3UTM A;  3ML9 A;  3LVR E;  5FQ6 A;  3QK0 A;  3RSE G;  1A5E A;  2WXK A;  4TXR A;  4APF A;  1NA3 A;  2WVI A;  2B6C A;  4U0Z A;  4AVX A;  3ZYK A;  1OWO A;  1ZU2 A;  4WND A;  5AAR A;  4I2Z A;  4I6G A;  3ZPJ A;  3KAE A;  4HRM B;  1IXV A;  3PEU B;  4HQD A;  3I4G A;  3OXL A;  4MBG A;  3PZD A;  2X6F A;  3RO2 A;  3NAW A;  4XEI G;  1N95 A;  4UWK A;  4FU3 A;  5AAO A;  3ESK A;  3Q9U C;  2DIW A;  3PVL A;  4ACK A;  3QC1 A;  3CVQ A;  4N3B A;  1N4S A;  2MHK A;  1Q2Z A;  5EYP F;  2WQ6 A;  1H2T C;  3PE4 A;  2XQ0 A;  3OTN A;  2DYR E;  5DBK A;  3Q78 A;  4G11 A;  3C3R A;  2C2L A;  4JD2 G;  3EJN A;  3DXK G;  1Z6T A;  4U07 A;  3QNK A;  3L82 A;  4GCO A;  2L9B A;  4LSZ E;  3ZXP A;  1OWN A;  4CRW A;  2NC9 A;  3CIA A;  3Q4A B;  4P29 A;  2CG3 A;  1LF8 A;  3QKY A;  3CHP A;  2OVB A;  3JXJ A;  3S2A A;  3RKV A;  3ZYQ A;  2FF4 A;  4HNA D;  3ENE A;  3SFX A;  3EIQ C;  2H6F A;  1E7U A;  4GAA A;  3AG4 E;  1BD8 A;  2A4Z A;  1OXJ A;  2IOS A;  2XRY A;  4BER A;  3CHS A;  3TWS A;  3DEO A;  1HX8 A;  2ZU6 B;  4I6J A;  4U8H A;  1HF8 A;  3MV2 B;  4L2L A;  4LNU D;  5ENN A;  3LDZ A;  2WXQ A;  2HYZ A;  4GTT A;  3D9H A;  2VQ2 A;  3I4R B;  4F1S A;  3E34 A;  3B13 A;  3SHF A;  4L1B A;  4DX6 D;  3DPY A;  3P2B A;  3CVN A;  1H6O A;  2GRO B;  4O6F A;  4O1O A;  3KSL A;  2I6H A;  1FVF A;  3OXG A;  5FT9 A;  3SZ7 A;  1MJ0 A;  2RFA A;  3LS8 A;  1IQR A;  2J9Q A;  2P9K G;  4LNG A;  3N71 A;  3ZYM A;  3PEV B;  3G2W A;  4CZ2 D;  4WUY A;  5FQ7 A;  2Y4T A;  3S7D A;  1XGW A;  2HE0 A;  5BT1 A;  5D0Q D;  4C9B B;  2QC9 A;  2KCV A;  3UX4 A;  2V4L A;  2OCC E;  3GZ2 A;  5CED B;  1U3D A;  4KMO A;  3V79 K;  4AP2 A;  1E90 A;  3C72 A;  3S7B A;  3DST A;  2EIK E;  1WM5 A;  3DSX A;  2P9L G;  3CEQ A;  3FP3 A;  2R02 A;  2EIJ E;  2R5S A;  2ION A;  4OAV B;  3Q9N C;  2I1K A;  3WXX A;  4MRU A;  3TJP A;  5B1A E;  1OWP A;  5G05 J;  2AXZ A;  4FA6 A;  4KT6 B;  3DWL G;  5EKQ D;  5EYL A;  4GML A;  3ZYL A;  3FU3 A;  3QAQ A; 
#chains in the Genus database with same CATH homology
 5KCM A;  4FUL A;  2KZT A;  1JUQ A;  3FU5 A;  4I1M A;  1TJF A;  3L08 A;  5A6C A;  3LVQ E;  4GZ6 A;  4MLP A;  4UQX A;  3ZXS A;  2MOW A;  3LXU X;  3UQ3 A;  4BWR A;  4BX8 A;  2AWI A;  3FUH A;  3IBE A;  5BUZ A;  3RRN B;  4URK A;  3D9O A;  3VLE A;  3APC A;  4N5C A;  5C2Y A;  4XKC A;  4CGV A;  1IYG A;  2J4D A;  1NZN A;  1VDY A;  2LSU A;  4UWF A;  3AS5 A;  2KZT B;  2J09 A;  5CMY A;  4HOT A;  5CHE E;  3FTV A;  4G1T A;  2WXP A;  4FP7 A;  1E8Z A;  1INZ A;  2IF4 A;  2VGX B;  2PZI A;  3CK9 A;  3LYA A;  4EBA A;  3LY7 A;  2GRM A;  1UG3 A;  4JL0 A;  2CHZ A;  2PM7 A;  4HXI A;  2JEK A;  1U3C A;  3JCK C;  4I9C A;  4NQ0 A;  3QWV A;  4BTA A;  5EX3 A;  4JA9 A;  2WXF A;  3CHQ A;  4NUR A;  1MQS A;  3CKB A;  3FTY A;  2WXH A;  5FWQ A;  4N3C A;  1KLX A;  4ANX A;  3UT7 A;  2YNQ A;  2J07 A;  3ASD A;  3SBS A;  3PS6 A;  3Q5M A;  4A3T A;  5CCL A;  3NZU A;  2C0M A;  1QNF A;  2WPV A;  3RU0 A;  4AJW A;  2FI7 A;  4RG9 A;  3QDN A;  3CVV A;  5M72 A;  4Y6W A;  2PQR A;  2X6H A;  3JYS A;  3VTX A;  1H6K A;  3PNL B;  3QJZ A;  4GU5 A;  4UI9 J;  4U0S A;  4JXT A;  2MRI A;  3U64 A;  3Q47 B;  3SFZ A;  4U04 A;  4KXK B;  1ZBP A;  3AS8 A;  2FO7 A;  4TV3 A;  3FUD A;  2X6J A;  5JHA A;  2V5F A;  2GGF A;  3CGH A;  4WWP A;  3LJ3 A;  3FTS A;  3NQP A;  3U4T A;  3ZVV A;  3FUE A;  1E7V A;  4AIF A;  4UI9 K;  4WWN A;  2IU1 A;  3BEE A;  3CVX A;  4L7T A;  1QZ2 A;  1H2U A;  3CHR A;  2GRL A;  1KT1 A;  4LRZ A;  1EF1 C;  2VTB B;  2Y3A A;  4GB9 A;  3FTW A;  4ILG A;  1FCH A;  2QY7 A;  4UI9 C;  4C0M A;  1HG5 A;  4J6I A;  4YVQ C;  3K9I A;  4GYW A;  4G24 A;  4M3O A;  4WNG A;  3LKU A;  2WXM A;  3FU6 A;  1P5Q A;  3ZRH A;  1Y8M A;  2NXP A;  4DI3 A;  3IV0 A;  1EPU A;  2XGO A;  3FH8 A;  4CT4 A;  4R7L A;  4Q96 A;  3FUK A;  1HH8 A;  4B8C B;  5ARG A;  3URZ A;  5AYW D;  4XKB A;  1H19 A;  3APD A;  4FJY A;  4J8D A;  3D9L A;  4N39 A;  4MKT A;  2EQX A;  3D9P A;  4PDX A;  3G2U A;  2VGY A;  4JA7 A;  1S0P A;  5CCM A;  2L0T B;  2YQ8 A;  1HXI A;  3MV3 B;  2ILR A;  4N2Q A;  4NAC A;  3HIZ A;  2WXR A;  3MZL B;  4LCT A;  4A1G A;  5FQ4 A;  3GZS A;  4YND A;  3KS2 A;  4OVV A;  4AY5 A;  1SQM A;  3QB2 A;  2YHC A;  4PS7 A;  4GCN A;  2WB2 A;  4J8S A;  3MKQ A;  2BTD A;  2WM9 A;  3FUF A;  4XI9 A;  1JWF A;  4A1S A;  4XX5 A;  4DK5 A;  4FLH A;  2AXV A;  2I2O A;  2WQ7 A;  5AEN A;  4K0R A;  1Y6I A;  1ELR A;  1WY6 A;  3ASG A;  1UN8 A;  2DCP A;  4ANW A;  3GYZ A;  4DI4 A;  1E8Y A;  4HOS A;  3FH5 A;  5D0O D;  5G55 A;  3SBT B;  5G2N A;  4TUU A;  2AW6 A;  3MYV A;  3TGO A;  3ZIM A;  3U3W A;  2PL2 A;  3FUI A;  2Y4U A;  4ABN A;  3DBS A;  4ME2 A;  3S7F A;  4EZJ A;  2E0I A;  3I3N A;  4HOR A;  1PAQ A;  5T4Y A;  5J08 A;  2VSN A;  1OUV A;  2KCK A;  5G04 J;  4Q69 A;  3B7U X;  3RRM B;  3CV0 A;  3FEX A;  5BW8 C;  3GW4 A;  1HZ4 A;  4FHK A;  2WMO A;  4G25 A;  4G23 A;  3CST A;  1QQE A;  2WXN A;  4OVU A;  2VJ8 A;  2CHW A;  5JJT A;  1N54 A;  3D9M A;  4AEZ C;  1BPO A;  1TJC A;  4AY6 A;  1MHQ A;  1NA0 A;  5AJD A;  5FZS A;  3JQ0 A;  3BG1 B;  5FJY A;  2WXI A;  3AU4 A;  2X38 A;  3IKO B;  2IJG X;  4DLO A;  2I9C A;  3TXM A;  4CDN A;  4K03 A;  2XPI A;  4CCA A;  1W3B A;  4HOQ A;  4LER A;  3HHM A;  3LY9 A;  3ZHE A;  5C1D A;  2XPY A;  3ESL A;  3QWW A;  4NRH B;  3L22 A;  3ULQ A;  1B89 A;  1KT0 A;  3HDX A;  2I1J A;  4MS6 A;  5AJL A;  4OYS A;  3L17 A;  3APF A;  3P1U A;  4J8F A;  1SZA A;  2WXL A;  2XHE A;  3RO3 A;  1IQU A;  3GZ1 A;  4U0U A;  1DNP A;  2X6K A;  2VSX E;  3CQC B;  1H0A A;  4C0E A;  5FZR A;  4JHR A;  3CHM A;  3S7J A;  4BT9 A;  3ZW3 A;  5LP0 A;  3Q49 B;  3L6A A;  2YHE A;  5E75 A;  3ML9 A;  3LVR E;  5FQ6 A;  3QK0 A;  3MCX A;  3PRE A;  2LO6 A;  3FUN A;  2BF0 X;  4EZK A;  3KD7 A;  1PY1 A;  3LPZ A;  5LCW J;  2WXK A;  2UY1 B;  2VSO E;  2L6J A;  5LFA A;  2LSV A;  2IFU A;  4B89 A;  4WNF A;  4APF A;  1NA3 A;  2R17 C;  3C98 A;  2WVI A;  3ML8 A;  4AV7 A;  5A23 A;  2J08 A;  2XCC A;  4U0Z A;  4AVX A;  3ZYK A;  3SNX A;  3QWP A;  2AVP A;  1OWO A;  5EX0 A;  1ZU2 A;  3SI5 A;  1A17 A;  3D3M A;  3G2S A;  4BFR A;  4IYP A;  4WND A;  4W9R A;  5JHB A;  4I2Z A;  3FH7 A;  4B8A A;  3ZFW A;  2XGS A;  2CFU A;  3CQG B;  4I6G A;  3ZPJ A;  3TL5 A;  5BNW A;  4L23 A;  2XCB A;  3UUX A;  2J49 A;  3DPD A;  3CHO A;  4ILI A;  3KAE A;  4EEC A;  3PRZ A;  1FVH A;  3PEU B;  4L2Y A;  4PH4 B;  5EDS A;  3CVW A;  4GYO A;  5ANR A;  3I4G A;  3OXL A;  3RIB A;  4GPK A;  3PZD A;  2X6F A;  3RO2 A;  3FTZ A;  3OAW A;  3CVL A;  2VSY A;  4BTB A;  3D9I A;  1NP7 A;  1ELW A;  5A7D B;  4RSY A;  4UWK A;  4FU3 A;  3D9N A;  3ONL A;  3UPV A;  1H2V C;  1OWM A;  1UW4 B;  4F7A A;  3ESK A;  3B7S A;  4BSX A;  2DIW A;  2OVF A;  3PVL A;  3FDH A;  4ACK A;  2X3M A;  3FHE A;  4U63 A;  4V3I A;  3QC1 A;  2V0P A;  4ATG A;  4GZ3 A;  1SZ9 A;  5LX8 A;  3CVQ A;  2KC7 A;  4UWG A;  4N3B A;  4E85 A;  1L5J A;  2LNI A;  2WXG A;  1Z3X A;  4XIF A;  3B7R L;  4XE0 A;  2MHK A;  3FWV A;  3FUL A;  4APO A;  3EHN A;  3AS4 A;  4XI0 A;  3HVE B;  2WQ6 A;  1UN9 A;  2WQH A;  3SD5 A;  3UT8 A;  4GMJ A;  1H2T C;  1UJJ A;  2Q7F A;  3PE4 A;  4H7X A;  4LEU A;  2RD0 A;  2P58 C;  2XQ0 A;  3OTN A;  3ASF A;  4JZY A;  4PS8 A;  5DBK A;  4JHJ A;  4ILH B;  4GZD A;  4G11 A;  3MJW A;  1TEZ A;  3CK7 A;  2C2L A;  3RK6 A;  2WMN A;  2CFZ A;  4UWH A;  2XGM A;  4Q94 A;  4QFV A;  3EJN A;  4IUL A;  1OWL A;  1Z6T A;  3OXF A;  3QNK A;  4U07 A;  4GCO A;  3CK8 A;  2L9B A;  1OWN A;  4CRW A;  4BY6 A;  3E4B A;  3B7T A;  2NC9 A;  3T8M A;  3CIA A;  3G2V A;  3Q4A B;  2CHX A;  2RG8 A;  4P29 A;  2XRZ A;  4I6E A;  4DPR A;  3VLD A;  2KAT A;  2OV8 A;  4CGW A;  2CG3 A;  1E96 B;  2IQC A;  4J8E A;  5KJL A;  4J0U A;  3NF1 A;  4CEM A;  3JQ1 A;  3PNT B;  5T8I A;  1LF8 A;  1HO8 A;  3QKY A;  3CHP A;  2OVB A;  4JW1 A;  3S2A A;  3RKV A;  3ZYQ A;  2VYI A;  3R9A B;  1JWG A;  4CT0 A;  2FF4 A;  3ASH A;  4FHJ A;  3ENE A;  5BV0 A;  4N3A A;  4I43 A;  2LAI A;  3EIQ C;  1EDU A;  4D10 C;  5KJN A;  1E7U A;  1HG2 A;  4RVB A;  1N52 A;  4GAA A;  4BT8 A;  3QAR A;  4FC8 A;  2A4Z A;  3MEK A;  5FZQ A;  4I1O B;  4TRQ A;  4I9E A;  2IOS A;  3FTX A;  2XRY A;  3LEW A;  1UJK A;  3I5P A;  4KBQ A;  3CHS A;  1WAO 1;  5E76 A;  2A5U A;  3CKC A;  3MX3 A;  1HX8 A;  2ZU6 B;  2PQN A;  4DJA A;  4I6J A;  4UQZ A;  4U8H A;  3FFL A;  5BPP A;  1X5B A;  1HF8 A;  2XEV A;  4FJZ A;  2AXU A;  4WAF A;  2FEZ A;  2HO1 A;  3MV2 B;  4B94 A;  4L2L A;  2OOE A;  3O48 A;  4XZ4 A;  4Y6C A;  1YA0 A;  3EHM A;  2M63 A;  4EPZ A;  2L0I A;  3FUM A;  3RRU A;  3KEZ A;  4KYO B;  3PE3 A;  3HYM B;  5ENN A;  5AIJ A;  4F53 A;  4EZL A;  1HE8 A;  3LDZ A;  3MGB A;  3CVY A;  4PS3 A;  5DIZ A;  4GA0 A;  2WXQ A;  2HYZ A;  3MA5 A;  1ELK A;  3ZHE B;  2WXJ A;  2VQ2 A;  3I4R B;  3ONK A;  3QOU A;  4F1S A;  2DBA A;  4JEH A;  4I2W A;  3CVP A;  5LOZ A;  3LY8 A;  3B13 A;  4YVO A;  4N2S A;  3SHF A;  4GZC A;  3G2T A;  4L1B A;  4JEU A;  5HQ8 A;  2HR2 A;  4A55 A;  4EQF A;  4HLE A;  5ARF A;  3VLF A;  3P2B A;  2WXO A;  3LCA A;  3CVN A;  5HI7 A;  3PUJ A;  4PUC A;  2NSZ A;  1Z3Y A;  3IHY A;  4O6F A;  4CDR A;  3BG0 B;  3CR3 A;  1PC2 A;  2LAH A;  2I6H A;  4LUN U;  3MKR A;  1FVF A;  3OXG A;  4AOF A;  3CSF A;  3HVE A;  4WNE A;  4KZC A;  4I17 A;  5FT9 A;  3SZ7 A;  4B0Z A;  3L54 A;  3LS8 A;  3D9K A;  4JVS A;  4GZ5 A;  4A3V A;  1IQR A;  2VGX A;  4KVM A;  2OND A;  3FUJ A;  3ZGQ A;  4AM9 A;  2C0L A;  2J9Q A;  5JJ6 A;  4CDM A;  2X6I A;  3NZS A;  3Q15 A;  4UQY A;  3MKQ B;  4ANV A;  3O4Z A;  5CMW A;  3ZN3 A;  3N71 A;  3PH0 C;  3ZYM A;  3PEV B;  4FLB A;  2HM8 A;  4FAD A;  4GYY A;  3G2W A;  4H7Y A;  2E2E A;  5ANL A;  4HOU A;  3U66 A;  3PUK A;  3TXN A;  2PM6 A;  5LCW C;  2UY1 A;  4KZ0 A;  3TAX A;  2GW1 A;  3T5V A;  1HS6 A;  5FTP A;  4JC8 A;  5KJK A;  4WUY A;  2FUL A;  1HU3 A;  1IHG A;  3SF4 A;  3CLJ A;  2Y4T A;  5FQ7 A;  4RG6 A;  5BV1 A;  3S7D A;  1XGW A;  5G04 C;  2J4B A;  4ACL A;  5BT1 A;  5D0Q D;  3AU5 A;  5KJM A;  2KCL A;  4C9B B;  2KCV A;  4GA2 A;  3UX4 A;  4EBA G;  2V4L A;  2XPZ A;  2JLB A;  3GZ2 A;  3IHV A;  4AXH A;  1U3D A;  3UT4 A;  3EIJ A;  5FQ8 A;  4KMO A;  4F3V A;  4AP2 A;  1E90 A;  3S7B A;  4HFG A;  4HVB A;  1HFA A;  1JPL A;  3ZEF A;  2V8S E;  1E8X A;  3UMV A;  4BX9 A;  2KM4 A;  2UWJ G;  3IEG A;  3T5X A;  2VTB A;  3JUI A;  1WM5 A;  3D9J A;  5JJ7 A;  5G05 C;  3R7Q A;  3CEQ A;  2BUG A;  4HS2 A;  3FP3 A;  2QFC A;  4G2V A;  1E8W A;  2FBN A;  4JPS A;  3R7R A;  3TG4 A;  4GA1 A;  3CVU A;  4I1A A;  2R5S A;  2ION A;  2I1K A;  4G26 A;  3SGH A;  1DVP A;  5T3R A;  2R59 A;  3RJV A;  4DLQ A;  3WXX A;  4MRU A;  3FEY A;  4UWL A;  3TJP A;  1OWP A;  3L13 A;  4WWO A;  5G05 J;  2AXZ A;  4FA6 A;  4KT6 B;  4KVO A;  5EKQ D;  3VTY A;  4E6H A;  3TG5 A;  1XNF A;  4GML A;  3U9W A;  3ZYL A;  4IN3 B;  3FU3 A;  3FU0 A;  4ANU A;  3PDN A;  4JHK A;  4IRU A;  3EDT B;  2IOL A;  3FTU A;  2CG2 A;  3L16 A;  1EYH A;  1GW6 A;  3QAQ A;  5J90 A;  3FY4 A;  2YIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...