2XF4A

Crystal structure of salmonella enterica serovar typhimurium ycbl
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Salmonella Enterica Serovar Typhimurium Ycbl: An Unusual Type II Glyoxalase
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Hydrolase
molecule keywords HYDROXYACYLGLUTATHIONE HYDROLASE
total genus 65
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2xf4A00
3KNSA 4D1UA 2GFKA 1M2XA 5EH9A 4RL0A 5HIOA 5A5ZA 2QEDA 2ZNBA 4P62A 4YSLA 5KILA 4F6HA 2CBNA 5ACQA 2QDSA 2A7MA 5EVBA 4NQ2A 3I15A 2GFJA 5K4KA 5EV8A 3DHBA 4D1TA 4GCWA 4O98A 4J5FA 4V0HA 3IEMA 4BZ3A 5KIKA 1L9YA 4UWRB 3ZNBA 2FU7A 2WRSA 1WRAA 3KNRA 5K4MA 5EV6A 4DIKA 5ACPA 2VW8A 4EYBA 4RAWA 4EYFA 5ACUA 3RPCA 2BFZA 4Z6XA 3I11A 1Y44A 4RAMA 3P2UA 4RM5A 4FSBA 4PVTA 2BG8B 5LS3A 2H6AA 1A7TA 3BK1A 2E7YA 4TZFA 5A87A 2YZ3A 1X8IA 5HH5A 5AXRA 2Q0JA 3ADRA 3TP9A 4YSBA 2YNTB 2XF4A 1X8HA 2OHIA 4Z5YA 2BIBA 3T3OA 5LCHA 4WD6A 5A0TA 4C1DA 2BC2A 2FU8A 2I7TA 5EVKA 1KO3A 5FQBA 3SBLA 3T9MA 3A4YA 1KO2A 4C1CA 5LSCA 1WUPA 2YNWA 2I7VA 3H3EA 3IELA 4Z67A 4DILA 4H0DA 2BGAA 3BK2A 1ZNBA 2Q0IA 2YNTA 4D02A 3I13A 5K4NA 1BVTA 4D1WA 2AZ4A 5LCAA 2ZZIA 2Q42A 3IE0A 4NQ6A 1QH5A 3X30A 4B87A 5ACSA 1A8TA 5ACRA 2WYMC 2UYXA 2ZWRA 1DD6A 5AHRA 3X2XA 4UWPB 5K0WA 2BFLA 1SMLA 4AX1B 2M5DA 1HLKA 5IQKA 4NQ5A 3PG4A 4KEQA 4EXYA 2WYLA 3IOGA 3X2YA 1JJEA 3X2ZA 5HH4A 3IDZA 2Q9UA 4FR7A 2Y8BA 3VPEA 4YSKA 5AYAA 5LCFA 4EFZA 2BFZB 2GMNA 1VJNA 5AXOA 2FK6A 4BP0A 5LE1A 3SD9A 1YCGA 1DDKA 2OHJA 5FQCA 5AEBA 2FHXB 4RBSA 4AD9A 1VMEA 2P18A 3G1PA 4U4LA 2FM6A 4RL2A 1DXKA 5LLDA 5HISA 5A0VA 1ZKPA 2P4ZA 4Z60A 4C09A 3RKJA 4XWWA 4HKYA 4UWSB 2BMIA 3AF6A 1XM8A 5EW0A 4HL2A 2NYPA 2FHXA 2GKLA 3PY6A 3T3NA 2QJSA 3RKKA 4UA4A 5ACTA 3DH8A 4ZEJA 2FU6A 4D1VA 2DOOA 3MD7A 4UWOB 3IEKA 4TZBA 3QH8A 1VGNA 4C1FA 4ZO3A 2NXAA 4NQ4A 1WW1A 2YNVB 3WXCA 3BV6A 2DKFA 3L6NA 2I7XA 3LVZA 2BG6A 4F6ZA 1JT1A 5FQAA 3Q6VA 3ESHA 2Y87A 4TYFA 5ACVA 4KEPA 4HL1A 1X8GA 3SRXA 3I0VA 4C1EA 5HH6A 2WHGA 1KR3A 2Y8AA 2QINA 2BG2A 5HIQA 3ZWFA 2FU9A 2OHHA 2GCUA 3PY5A 4AWYB 3R2UA 1P9EA 3F9OA 2P97A 4ZNBA 3IE1A 4XUKA 3DHCA 3FAIA 5DPXA 2NZFA 2YNUA 5B3RA 1E5DA 3I14A 2BG7A 3IOFA 3S0ZA 4EYLA 3ZQ4A 1K07A 3KL7A 5AHOA 4Z7RA 2XR1A 4UBQA 5LM6A 2ZO4A 4XWTA 2R2DA 4AX0B 2M5CA 3JXPA 5B15A 4Z5ZA 4PVOA 1ZTCA 1QH3A 4J5HA 4TZEA 4GYQA 4AWZA 5B1UA 1WUOA 5ACXA 2NZEA 1BC2A 3BC2A 5EHTA 2YCBA 4TZ9A 4C1HA 4ZO2A 3SW3A 3AF5A 2YNVA 3SFPA 4C1GA 2BG8A 1JJTA 4EXSA 2BR6A 2BFKA 4UAMA 5LMCA 2BTNA 3DHAA 2WYMA 1YCFA 3ZR9A 5HIPA 3VQZA 2AIOA 1XTOA 2HB9A 4LE6A 1MQOA 2P1EA 5ACWA 4FEKA 2QDTA 1BMCA 3AJ3A 3FCZA 3IE2A 4CHLA 3SPUA 1YCHA 4JO0A 4GYUA 4TYTA 4EY2A 5EVDA 5EWAA
chains in the Genus database with same CATH superfamily
3KNSA 4D1UA 2GFKA 1M2XA 5EH9A 4RL0A 5HIOA 5A5ZA 2QEDA 2ZNBA 4P62A 4YSLA 5KILA 4F6HA 2CBNA 5ACQA 2QDSA 2A7MA 5EVBA 4NQ2A 3I15A 2GFJA 5K4KA 5EV8A 3DHBA 4D1TA 4GCWA 4O98A 4J5FA 4V0HA 3IEMA 4BZ3A 5KIKA 1L9YA 4NURA 4UWRB 3ZNBA 2FU7A 2WRSA 1WRAA 3KNRA 5K4MA 5EV6A 4DIKA 5ACPA 2VW8A 4EYBA 4RAWA 4EYFA 5ACUA 3RPCA 2BFZA 4Z6XA 3I11A 1Y44A 4RAMA 3P2UA 4RM5A 4FSBA 4PVTA 2BG8B 5LS3A 2H6AA 1A7TA 3BK1A 2E7YA 4TZFA 5A87A 2YZ3A 1X8IA 5HH5A 5AXRA 2Q0JA 3ADRA 3TP9A 4YSBA 2YNTB 2XF4A 1X8HA 2OHIA 4Z5YA 2BIBA 3T3OA 5LCHA 4WD6A 5A0TA 4C1DA 2BC2A 2FU8A 2I7TA 5EVKA 1KO3A 5FQBA 3SBLA 3T9MA 3A4YA 1KO2A 4C1CA 5LSCA 1WUPA 2CFZA 2YNWA 2I7VA 3H3EA 3IELA 4Z67A 4DILA 4H0DA 2BGAA 3BK2A 1ZNBA 2Q0IA 2YNTA 4D02A 3I13A 5K4NA 1BVTA 4D1WA 2AZ4A 5LCAA 2ZZIA 2Q42A 3IE0A 4NQ6A 1QH5A 3X30A 4B87A 5ACSA 1A8TA 5ACRA 2WYMC 2UYXA 2ZWRA 1DD6A 5AHRA 3X2XA 4UWPB 5K0WA 2BFLA 1SMLA 4AX1B 2M5DA 1HLKA 5IQKA 4NQ5A 3PG4A 4KEQA 4EXYA 2WYLA 3IOGA 3X2YA 1JJEA 3X2ZA 5HH4A 3IDZA 2Q9UA 4FR7A 5A23A 2Y8BA 3VPEA 4YSKA 5AYAA 5LCFA 4EFZA 2BFZB 2GMNA 1VJNA 5AXOA 2FK6A 4BP0A 5LE1A 3SD9A 1YCGA 1DDKA 4AV7A 2OHJA 5FQCA 5AEBA 2CG3A 2FHXB 4RBSA 4AD9A 1VMEA 2P18A 3G1PA 4U4LA 2FM6A 4RL2A 1DXKA 5LLDA 5HISA 5A0VA 1ZKPA 2P4ZA 4Z60A 4C09A 3RKJA 4XWWA 4HKYA 4UWSB 2BMIA 3AF6A 2YHEA 4AXHA 1XM8A 5EW0A 4HL2A 2NYPA 2FHXA 2GKLA 3PY6A 3T3NA 2QJSA 3RKKA 4UA4A 5ACTA 3DH8A 4ZEJA 2FU6A 4D1VA 2DOOA 3MD7A 4UWOB 3IEKA 4TZBA 3QH8A 1VGNA 4C1FA 4ZO3A 2NXAA 4NQ4A 1WW1A 2YNVB 3WXCA 3BV6A 2DKFA 3L6NA 2I7XA 3LVZA 2BG6A 4F6ZA 1JT1A 5AIJA 5FQAA 3Q6VA 3ESHA 2Y87A 4TYFA 5ACVA 4KEPA 4HL1A 1X8GA 3SRXA 3I0VA 4C1EA 5HH6A 2WHGA 1KR3A 2Y8AA 2QINA 2BG2A 5HIQA 4PDXA 3ZWFA 2FU9A 2OHHA 2GCUA 3PY5A 4AWYB 3R2UA 1P9EA 3F9OA 2P97A 4ZNBA 3IE1A 4XUKA 3DHCA 3FAIA 5DPXA 2NZFA 2YNUA 2CG2A 5B3RA 1E5DA 3I14A 2BG7A 3IOFA 3S0ZA 4EYLA 3ZQ4A 1K07A 3KL7A 5AHOA 4Z7RA 2XR1A 4UBQA 5LM6A 2ZO4A 4XWTA 2R2DA 4AX0B 2M5CA 3JXPA 5B15A 4Z5ZA 4PVOA 1ZTCA 1QH3A 4J5HA 4TZEA 4GYQA 4AWZA 5B1UA 1WUOA 5ACXA 2CFUA 2NZEA 1BC2A 3BC2A 5EHTA 2YCBA 4TZ9A 4C1HA 4ZO2A 3SW3A 3AF5A 2YNVA 3SFPA 4C1GA 2BG8A 1JJTA 4EXSA 2BR6A 2BFKA 4UAMA 5LMCA 2BTNA 3DHAA 2WYMA 1YCFA 3ZR9A 5HIPA 3VQZA 2AIOA 5AJLA 1XTOA 2HB9A 4LE6A 1MQOA 2P1EA 5ACWA 4FEKA 2QDTA 1BMCA 3AJ3A 3FCZA 3IE2A 4CHLA 3SPUA 1YCHA 4JO0A 4GYUA 4TYTA 4EY2A 5EVDA 5EWAA
chains in the Genus database with same CATH topology
3KNSA 4D1UA 2GFKA 1M2XA 5EH9A 4RL0A 5HIOA 5A5ZA 2QEDA 2ZNBA 4P62A 4YSLA 5KILA 4F6HA 2CBNA 5ACQA 2QDSA 2A7MA 5EVBA 4NQ2A 3I15A 2GFJA 5K4KA 5EV8A 3DHBA 4D1TA 4GCWA 4O98A 4J5FA 4V0HA 3IEMA 4BZ3A 5KIKA 1L9YA 4UWRB 3ZNBA 2FU7A 2WRSA 1WRAA 3KNRA 5K4MA 5EV6A 4DIKA 5ACPA 2VW8A 4EYBA 4RAWA 4EYFA 5ACUA 3RPCA 2BFZA 4Z6XA 3I11A 1Y44A 4RAMA 3P2UA 4RM5A 4FSBA 4PVTA 2BG8B 5LS3A 2H6AA 1A7TA 3BK1A 2E7YA 4TZFA 5A87A 2YZ3A 1X8IA 5HH5A 5AXRA 2Q0JA 3ADRA 3TP9A 4YSBA 2YNTB 2XF4A 1X8HA 2OHIA 4Z5YA 2BIBA 3T3OA 5LCHA 4WD6A 5A0TA 4C1DA 2BC2A 2FU8A 2I7TA 5EVKA 1KO3A 5FQBA 3SBLA 3T9MA 3A4YA 1KO2A 4C1CA 5LSCA 1WUPA 2YNWA 2I7VA 3H3EA 3IELA 4Z67A 4DILA 4H0DA 2BGAA 3BK2A 1ZNBA 2Q0IA 2YNTA 4D02A 3I13A 5K4NA 1BVTA 4D1WA 2AZ4A 5LCAA 2ZZIA 2Q42A 3IE0A 4NQ6A 1QH5A 3X30A 4B87A 5ACSA 1A8TA 5ACRA 2WYMC 2UYXA 2ZWRA 1DD6A 5AHRA 3X2XA 4UWPB 5K0WA 2BFLA 1SMLA 4AX1B 2M5DA 1HLKA 5IQKA 4NQ5A 3PG4A 4KEQA 4EXYA 2WYLA 3IOGA 3X2YA 1JJEA 3X2ZA 5HH4A 3IDZA 2Q9UA 4FR7A 2Y8BA 3VPEA 4YSKA 5AYAA 5LCFA 4EFZA 2BFZB 2GMNA 1VJNA 5AXOA 2FK6A 4BP0A 5LE1A 3SD9A 1YCGA 1DDKA 2OHJA 5FQCA 5AEBA 2FHXB 4RBSA 4AD9A 1VMEA 2P18A 3G1PA 4U4LA 2FM6A 4RL2A 1DXKA 5LLDA 5HISA 5A0VA 1ZKPA 2P4ZA 4Z60A 4C09A 3RKJA 4XWWA 4HKYA 4UWSB 2BMIA 3AF6A 1XM8A 5EW0A 4HL2A 2NYPA 2FHXA 2GKLA 3PY6A 3T3NA 2QJSA 3RKKA 4UA4A 5ACTA 3DH8A 4ZEJA 2FU6A 4D1VA 2DOOA 3MD7A 4UWOB 3IEKA 4TZBA 3QH8A 1VGNA 4C1FA 4ZO3A 2NXAA 4NQ4A 1WW1A 2YNVB 3WXCA 3BV6A 2DKFA 3L6NA 2I7XA 3LVZA 2BG6A 4F6ZA 1JT1A 5FQAA 3Q6VA 3ESHA 2Y87A 4TYFA 5ACVA 4KEPA 4HL1A 1X8GA 3SRXA 3I0VA 4C1EA 5HH6A 2WHGA 1KR3A 2Y8AA 2QINA 2BG2A 5HIQA 3ZWFA 2FU9A 2OHHA 2GCUA 3PY5A 4AWYB 3R2UA 1P9EA 3F9OA 2P97A 4ZNBA 3IE1A 4XUKA 3DHCA 3FAIA 5DPXA 2NZFA 2YNUA 5B3RA 1E5DA 3I14A 2BG7A 3IOFA 3S0ZA 4EYLA 3ZQ4A 1K07A 3KL7A 5AHOA 4Z7RA 2XR1A 4UBQA 5LM6A 2ZO4A 4XWTA 2R2DA 4AX0B 2M5CA 3JXPA 5B15A 4Z5ZA 4PVOA 1ZTCA 1QH3A 4J5HA 4TZEA 4GYQA 4AWZA 5B1UA 1WUOA 5ACXA 2NZEA 1BC2A 3BC2A 5EHTA 2YCBA 4TZ9A 4C1HA 4ZO2A 3SW3A 3AF5A 2YNVA 3SFPA 4C1GA 2BG8A 1JJTA 4EXSA 2BR6A 2BFKA 4UAMA 5LMCA 2BTNA 3DHAA 2WYMA 1YCFA 3ZR9A 5HIPA 3VQZA 2AIOA 1XTOA 2HB9A 4LE6A 1MQOA 2P1EA 5ACWA 4FEKA 2QDTA 1BMCA 3AJ3A 3FCZA 3IE2A 4CHLA 3SPUA 1YCHA 4JO0A 4GYUA 4TYTA 4EY2A 5EVDA 5EWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KNS A;  4D1U A;  2GFK A;  1M2X A;  5EH9 A;  4RL0 A;  5HIO A;  5A5Z A;  2QED A;  2ZNB A;  4P62 A;  4YSL A;  5KIL A;  4F6H A;  2CBN A;  5ACQ A;  2QDS A;  2A7M A;  5EVB A;  4NQ2 A;  3I15 A;  2GFJ A;  5K4K A;  5EV8 A;  3DHB A;  4D1T A;  4GCW A;  4O98 A;  4J5F A;  4V0H A;  3IEM A;  4BZ3 A;  5KIK A;  1L9Y A;  4UWR B;  3ZNB A;  2FU7 A;  2WRS A;  1WRA A;  3KNR A;  5K4M A;  5EV6 A;  4DIK A;  5ACP A;  2VW8 A;  4EYB A;  4RAW A;  4EYF A;  5ACU A;  3RPC A;  2BFZ A;  4Z6X A;  3I11 A;  1Y44 A;  4RAM A;  3P2U A;  4RM5 A;  4FSB A;  4PVT A;  2BG8 B;  5LS3 A;  2H6A A;  1A7T A;  3BK1 A;  2E7Y A;  4TZF A;  5A87 A;  2YZ3 A;  1X8I A;  5HH5 A;  5AXR A;  2Q0J A;  3ADR A;  3TP9 A;  4YSB A;  2YNT B;  2XF4 A;  1X8H A;  2OHI A;  4Z5Y A;  2BIB A;  3T3O A;  5LCH A;  4WD6 A;  5A0T A;  4C1D A;  2BC2 A;  2FU8 A;  2I7T A;  5EVK A;  1KO3 A;  5FQB A;  3SBL A;  3T9M A;  3A4Y A;  1KO2 A;  4C1C A;  5LSC A;  1WUP A;  2YNW A;  2I7V A;  3H3E A;  3IEL A;  4Z67 A;  4DIL A;  4H0D A;  2BGA A;  3BK2 A;  1ZNB A;  2Q0I A;  2YNT A;  4D02 A;  3I13 A;  5K4N A;  1BVT A;  4D1W A;  2AZ4 A;  5LCA A;  2ZZI A;  2Q42 A;  3IE0 A;  4NQ6 A;  1QH5 A;  3X30 A;  4B87 A;  5ACS A;  1A8T A;  5ACR A;  2WYM C;  2UYX A;  2ZWR A;  1DD6 A;  5AHR A;  3X2X A;  4UWP B;  5K0W A;  2BFL A;  1SML A;  4AX1 B;  2M5D A;  1HLK A;  5IQK A;  4NQ5 A;  3PG4 A;  4KEQ A;  4EXY A;  2WYL A;  3IOG A;  3X2Y A;  1JJE A;  3X2Z A;  5HH4 A;  3IDZ A;  2Q9U A;  4FR7 A;  2Y8B A;  3VPE A;  4YSK A;  5AYA A;  5LCF A;  4EFZ A;  2BFZ B;  2GMN A;  1VJN A;  5AXO A;  2FK6 A;  4BP0 A;  5LE1 A;  3SD9 A;  1YCG A;  1DDK A;  2OHJ A;  5FQC A;  5AEB A;  2FHX B;  4RBS A;  4AD9 A;  1VME A;  2P18 A;  3G1P A;  4U4L A;  2FM6 A;  4RL2 A;  1DXK A;  5LLD A;  5HIS A;  5A0V A;  1ZKP A;  2P4Z A;  4Z60 A;  4C09 A;  3RKJ A;  4XWW A;  4HKY A;  4UWS B;  2BMI A;  3AF6 A;  1XM8 A;  5EW0 A;  4HL2 A;  2NYP A;  2FHX A;  2GKL A;  3PY6 A;  3T3N A;  2QJS A;  3RKK A;  4UA4 A;  5ACT A;  3DH8 A;  4ZEJ A;  2FU6 A;  4D1V A;  2DOO A;  3MD7 A;  4UWO B;  3IEK A;  4TZB A;  3QH8 A;  1VGN A;  4C1F A;  4ZO3 A;  2NXA A;  4NQ4 A;  1WW1 A;  2YNV B;  3WXC A;  3BV6 A;  2DKF A;  3L6N A;  2I7X A;  3LVZ A;  2BG6 A;  4F6Z A;  1JT1 A;  5FQA A;  3Q6V A;  3ESH A;  2Y87 A;  4TYF A;  5ACV A;  4KEP A;  4HL1 A;  1X8G A;  3SRX A;  3I0V A;  4C1E A;  5HH6 A;  2WHG A;  1KR3 A;  2Y8A A;  2QIN A;  2BG2 A;  5HIQ A;  3ZWF A;  2FU9 A;  2OHH A;  2GCU A;  3PY5 A;  4AWY B;  3R2U A;  1P9E A;  3F9O A;  2P97 A;  4ZNB A;  3IE1 A;  4XUK A;  3DHC A;  3FAI A;  5DPX A;  2NZF A;  2YNU A;  5B3R A;  1E5D A;  3I14 A;  2BG7 A;  3IOF A;  3S0Z A;  4EYL A;  3ZQ4 A;  1K07 A;  3KL7 A;  5AHO A;  4Z7R A;  2XR1 A;  4UBQ A;  5LM6 A;  2ZO4 A;  4XWT A;  2R2D A;  4AX0 B;  2M5C A;  3JXP A;  5B15 A;  4Z5Z A;  4PVO A;  1ZTC A;  1QH3 A;  4J5H A;  4TZE A;  4GYQ A;  4AWZ A;  5B1U A;  1WUO A;  5ACX A;  2NZE A;  1BC2 A;  3BC2 A;  5EHT A;  2YCB A;  4TZ9 A;  4C1H A;  4ZO2 A;  3SW3 A;  3AF5 A;  2YNV A;  3SFP A;  4C1G A;  2BG8 A;  1JJT A;  4EXS A;  2BR6 A;  2BFK A;  4UAM A;  5LMC A;  2BTN A;  3DHA A;  2WYM A;  1YCF A;  3ZR9 A;  5HIP A;  3VQZ A;  2AIO A;  1XTO A;  2HB9 A;  4LE6 A;  1MQO A;  2P1E A;  5ACW A;  4FEK A;  2QDT A;  1BMC A;  3AJ3 A;  3FCZ A;  3IE2 A;  4CHL A;  3SPU A;  1YCH A;  4JO0 A;  4GYU A;  4TYT A;  4EY2 A;  5EVD A;  5EWA A; 
#chains in the Genus database with same CATH topology
 3KNS A;  4D1U A;  2GFK A;  1M2X A;  5EH9 A;  4RL0 A;  5HIO A;  5A5Z A;  2QED A;  2ZNB A;  4P62 A;  4YSL A;  5KIL A;  4F6H A;  2CBN A;  5ACQ A;  2QDS A;  2A7M A;  5EVB A;  4NQ2 A;  3I15 A;  2GFJ A;  5K4K A;  5EV8 A;  3DHB A;  4D1T A;  4GCW A;  4O98 A;  4J5F A;  4V0H A;  3IEM A;  4BZ3 A;  5KIK A;  1L9Y A;  4NUR A;  4UWR B;  3ZNB A;  2FU7 A;  2WRS A;  1WRA A;  3KNR A;  5K4M A;  5EV6 A;  4DIK A;  5ACP A;  2VW8 A;  4EYB A;  4RAW A;  4EYF A;  5ACU A;  3RPC A;  2BFZ A;  4Z6X A;  3I11 A;  1Y44 A;  4RAM A;  3P2U A;  4RM5 A;  4FSB A;  4PVT A;  2BG8 B;  5LS3 A;  2H6A A;  1A7T A;  3BK1 A;  2E7Y A;  4TZF A;  5A87 A;  2YZ3 A;  1X8I A;  5HH5 A;  5AXR A;  2Q0J A;  3ADR A;  3TP9 A;  4YSB A;  2YNT B;  2XF4 A;  1X8H A;  2OHI A;  4Z5Y A;  2BIB A;  3T3O A;  5LCH A;  4WD6 A;  5A0T A;  4C1D A;  2BC2 A;  2FU8 A;  2I7T A;  5EVK A;  1KO3 A;  5FQB A;  3SBL A;  3T9M A;  3A4Y A;  1KO2 A;  4C1C A;  5LSC A;  1WUP A;  2CFZ A;  2YNW A;  2I7V A;  3H3E A;  3IEL A;  4Z67 A;  4DIL A;  4H0D A;  2BGA A;  3BK2 A;  1ZNB A;  2Q0I A;  2YNT A;  4D02 A;  3I13 A;  5K4N A;  1BVT A;  4D1W A;  2AZ4 A;  5LCA A;  2ZZI A;  2Q42 A;  3IE0 A;  4NQ6 A;  1QH5 A;  3X30 A;  4B87 A;  5ACS A;  1A8T A;  5ACR A;  2WYM C;  2UYX A;  2ZWR A;  1DD6 A;  5AHR A;  3X2X A;  4UWP B;  5K0W A;  2BFL A;  1SML A;  4AX1 B;  2M5D A;  1HLK A;  5IQK A;  4NQ5 A;  3PG4 A;  4KEQ A;  4EXY A;  2WYL A;  3IOG A;  3X2Y A;  1JJE A;  3X2Z A;  5HH4 A;  3IDZ A;  2Q9U A;  4FR7 A;  5A23 A;  2Y8B A;  3VPE A;  4YSK A;  5AYA A;  5LCF A;  4EFZ A;  2BFZ B;  2GMN A;  1VJN A;  5AXO A;  2FK6 A;  4BP0 A;  5LE1 A;  3SD9 A;  1YCG A;  1DDK A;  4AV7 A;  2OHJ A;  5FQC A;  5AEB A;  2CG3 A;  2FHX B;  4RBS A;  4AD9 A;  1VME A;  2P18 A;  3G1P A;  4U4L A;  2FM6 A;  4RL2 A;  1DXK A;  5LLD A;  5HIS A;  5A0V A;  1ZKP A;  2P4Z A;  4Z60 A;  4C09 A;  3RKJ A;  4XWW A;  4HKY A;  4UWS B;  2BMI A;  3AF6 A;  2YHE A;  4AXH A;  1XM8 A;  5EW0 A;  4HL2 A;  2NYP A;  2FHX A;  2GKL A;  3PY6 A;  3T3N A;  2QJS A;  3RKK A;  4UA4 A;  5ACT A;  3DH8 A;  4ZEJ A;  2FU6 A;  4D1V A;  2DOO A;  3MD7 A;  4UWO B;  3IEK A;  4TZB A;  3QH8 A;  1VGN A;  4C1F A;  4ZO3 A;  2NXA A;  4NQ4 A;  1WW1 A;  2YNV B;  3WXC A;  3BV6 A;  2DKF A;  3L6N A;  2I7X A;  3LVZ A;  2BG6 A;  4F6Z A;  1JT1 A;  5AIJ A;  5FQA A;  3Q6V A;  3ESH A;  2Y87 A;  4TYF A;  5ACV A;  4KEP A;  4HL1 A;  1X8G A;  3SRX A;  3I0V A;  4C1E A;  5HH6 A;  2WHG A;  1KR3 A;  2Y8A A;  2QIN A;  2BG2 A;  5HIQ A;  4PDX A;  3ZWF A;  2FU9 A;  2OHH A;  2GCU A;  3PY5 A;  4AWY B;  3R2U A;  1P9E A;  3F9O A;  2P97 A;  4ZNB A;  3IE1 A;  4XUK A;  3DHC A;  3FAI A;  5DPX A;  2NZF A;  2YNU A;  2CG2 A;  5B3R A;  1E5D A;  3I14 A;  2BG7 A;  3IOF A;  3S0Z A;  4EYL A;  3ZQ4 A;  1K07 A;  3KL7 A;  5AHO A;  4Z7R A;  2XR1 A;  4UBQ A;  5LM6 A;  2ZO4 A;  4XWT A;  2R2D A;  4AX0 B;  2M5C A;  3JXP A;  5B15 A;  4Z5Z A;  4PVO A;  1ZTC A;  1QH3 A;  4J5H A;  4TZE A;  4GYQ A;  4AWZ A;  5B1U A;  1WUO A;  5ACX A;  2CFU A;  2NZE A;  1BC2 A;  3BC2 A;  5EHT A;  2YCB A;  4TZ9 A;  4C1H A;  4ZO2 A;  3SW3 A;  3AF5 A;  2YNV A;  3SFP A;  4C1G A;  2BG8 A;  1JJT A;  4EXS A;  2BR6 A;  2BFK A;  4UAM A;  5LMC A;  2BTN A;  3DHA A;  2WYM A;  1YCF A;  3ZR9 A;  5HIP A;  3VQZ A;  2AIO A;  5AJL A;  1XTO A;  2HB9 A;  4LE6 A;  1MQO A;  2P1E A;  5ACW A;  4FEK A;  2QDT A;  1BMC A;  3AJ3 A;  3FCZ A;  3IE2 A;  4CHL A;  3SPU A;  1YCH A;  4JO0 A;  4GYU A;  4TYT A;  4EY2 A;  5EVD A;  5EWA A; 
#chains in the Genus database with same CATH homology
 3KNS A;  4D1U A;  2GFK A;  1M2X A;  5EH9 A;  4RL0 A;  5HIO A;  5A5Z A;  2QED A;  2ZNB A;  4P62 A;  4YSL A;  5KIL A;  4F6H A;  2CBN A;  5ACQ A;  2QDS A;  2A7M A;  5EVB A;  4NQ2 A;  3I15 A;  2GFJ A;  5K4K A;  5EV8 A;  3DHB A;  4D1T A;  4GCW A;  4O98 A;  4J5F A;  4V0H A;  3IEM A;  4BZ3 A;  5KIK A;  1L9Y A;  4UWR B;  3ZNB A;  2FU7 A;  2WRS A;  1WRA A;  3KNR A;  5K4M A;  5EV6 A;  4DIK A;  5ACP A;  2VW8 A;  4EYB A;  4RAW A;  4EYF A;  5ACU A;  3RPC A;  2BFZ A;  4Z6X A;  3I11 A;  1Y44 A;  4RAM A;  3P2U A;  4RM5 A;  4FSB A;  4PVT A;  2BG8 B;  5LS3 A;  2H6A A;  1A7T A;  3BK1 A;  2E7Y A;  4TZF A;  5A87 A;  2YZ3 A;  1X8I A;  5HH5 A;  5AXR A;  2Q0J A;  3ADR A;  3TP9 A;  4YSB A;  2YNT B;  2XF4 A;  1X8H A;  2OHI A;  4Z5Y A;  2BIB A;  3T3O A;  5LCH A;  4WD6 A;  5A0T A;  4C1D A;  2BC2 A;  2FU8 A;  2I7T A;  5EVK A;  1KO3 A;  5FQB A;  3SBL A;  3T9M A;  3A4Y A;  1KO2 A;  4C1C A;  5LSC A;  1WUP A;  2YNW A;  2I7V A;  3H3E A;  3IEL A;  4Z67 A;  4DIL A;  4H0D A;  2BGA A;  3BK2 A;  1ZNB A;  2Q0I A;  2YNT A;  4D02 A;  3I13 A;  5K4N A;  1BVT A;  4D1W A;  2AZ4 A;  5LCA A;  2ZZI A;  2Q42 A;  3IE0 A;  4NQ6 A;  1QH5 A;  3X30 A;  4B87 A;  5ACS A;  1A8T A;  5ACR A;  2WYM C;  2UYX A;  2ZWR A;  1DD6 A;  5AHR A;  3X2X A;  4UWP B;  5K0W A;  2BFL A;  1SML A;  4AX1 B;  2M5D A;  1HLK A;  5IQK A;  4NQ5 A;  3PG4 A;  4KEQ A;  4EXY A;  2WYL A;  3IOG A;  3X2Y A;  1JJE A;  3X2Z A;  5HH4 A;  3IDZ A;  2Q9U A;  4FR7 A;  2Y8B A;  3VPE A;  4YSK A;  5AYA A;  5LCF A;  4EFZ A;  2BFZ B;  2GMN A;  1VJN A;  5AXO A;  2FK6 A;  4BP0 A;  5LE1 A;  3SD9 A;  1YCG A;  1DDK A;  2OHJ A;  5FQC A;  5AEB A;  2FHX B;  4RBS A;  4AD9 A;  1VME A;  2P18 A;  3G1P A;  4U4L A;  2FM6 A;  4RL2 A;  1DXK A;  5LLD A;  5HIS A;  5A0V A;  1ZKP A;  2P4Z A;  4Z60 A;  4C09 A;  3RKJ A;  4XWW A;  4HKY A;  4UWS B;  2BMI A;  3AF6 A;  1XM8 A;  5EW0 A;  4HL2 A;  2NYP A;  2FHX A;  2GKL A;  3PY6 A;  3T3N A;  2QJS A;  3RKK A;  4UA4 A;  5ACT A;  3DH8 A;  4ZEJ A;  2FU6 A;  4D1V A;  2DOO A;  3MD7 A;  4UWO B;  3IEK A;  4TZB A;  3QH8 A;  1VGN A;  4C1F A;  4ZO3 A;  2NXA A;  4NQ4 A;  1WW1 A;  2YNV B;  3WXC A;  3BV6 A;  2DKF A;  3L6N A;  2I7X A;  3LVZ A;  2BG6 A;  4F6Z A;  1JT1 A;  5FQA A;  3Q6V A;  3ESH A;  2Y87 A;  4TYF A;  5ACV A;  4KEP A;  4HL1 A;  1X8G A;  3SRX A;  3I0V A;  4C1E A;  5HH6 A;  2WHG A;  1KR3 A;  2Y8A A;  2QIN A;  2BG2 A;  5HIQ A;  3ZWF A;  2FU9 A;  2OHH A;  2GCU A;  3PY5 A;  4AWY B;  3R2U A;  1P9E A;  3F9O A;  2P97 A;  4ZNB A;  3IE1 A;  4XUK A;  3DHC A;  3FAI A;  5DPX A;  2NZF A;  2YNU A;  5B3R A;  1E5D A;  3I14 A;  2BG7 A;  3IOF A;  3S0Z A;  4EYL A;  3ZQ4 A;  1K07 A;  3KL7 A;  5AHO A;  4Z7R A;  2XR1 A;  4UBQ A;  5LM6 A;  2ZO4 A;  4XWT A;  2R2D A;  4AX0 B;  2M5C A;  3JXP A;  5B15 A;  4Z5Z A;  4PVO A;  1ZTC A;  1QH3 A;  4J5H A;  4TZE A;  4GYQ A;  4AWZ A;  5B1U A;  1WUO A;  5ACX A;  2NZE A;  1BC2 A;  3BC2 A;  5EHT A;  2YCB A;  4TZ9 A;  4C1H A;  4ZO2 A;  3SW3 A;  3AF5 A;  2YNV A;  3SFP A;  4C1G A;  2BG8 A;  1JJT A;  4EXS A;  2BR6 A;  2BFK A;  4UAM A;  5LMC A;  2BTN A;  3DHA A;  2WYM A;  1YCF A;  3ZR9 A;  5HIP A;  3VQZ A;  2AIO A;  1XTO A;  2HB9 A;  4LE6 A;  1MQO A;  2P1E A;  5ACW A;  4FEK A;  2QDT A;  1BMC A;  3AJ3 A;  3FCZ A;  3IE2 A;  4CHL A;  3SPU A;  1YCH A;  4JO0 A;  4GYU A;  4TYT A;  4EY2 A;  5EVD A;  5EWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...