2XF4A

Crystal structure of salmonella enterica serovar typhimurium ycbl
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
b'MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYACYLGLUTATHIONE HYDROLASE
publication title Structural and Functional Characterization of Salmonella Enterica Serovar Typhimurium Ycbl: An Unusual Type II Glyoxalase
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Hydrolase
total genus 65
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2xf4A00
2QINA 3PG4A 4EY2A 2CBNA 4GCWA 5K4MA 3X30A 5B3RA 4H0DA 3WXCA 3T9MA 1VGNA 5FQAA 2WYMA 4YSLA 5ACPA 2M5CA 1KO2A 4Z5ZA 4UWSB 2AZ4A 3VPEA 1QH3A 3DHCA 3SPUA 5HIOA 2OHIA 4C1EA 2OHJA 4NQ6A 3ESHA 5B15A 4FEKA 3F9OA 5ACWA 3H3EA 2GKLA 4YSBA 4D1TA 3IE1A 1A7TA 2BMIA 3L6NA 2Y87A 4KEQA 1BVTA 5K4KA 3Q6VA 2NXAA 4XWWA 2Q9UA 2Y8BA 3RKJA 2BG6A 1JJTA 1YCHA 2ZWRA 5LM6A 3SRXA 4J5HA 5K0WA 1E5DA 3QH8A 3ZNBA 4HKYA 5HH4A 4RM5A 2FHXA 4ZO3A 3X2XA 5EV8A 4TZ9A 2ZNBA 5LMCA 2GFJA 4AWZA 4RAMA 1HLKA 4U4LA 2R2DA 2YNVA 5EH9A 1ZNBA 2BFLA 1BMCA 3A4YA 4XWTA 3IE2A 4D02A 4V0HA 5EWAA 3KL7A 5AHRA 1DD6A 4XUKA 2NZEA 2NYPA 1QH5A 2H6AA 4EXYA 5EV6A 2E7YA 1WW1A 1ZKPA 4UWRB 2FHXB 2XF4A 4RBSA 2HB9A 2QDTA 5EVBA 4F6HA 3IEMA 3PY6A 4ZNBA 2AIOA 4D1WA 4J5FA 2WYMC 2BTNA 3AF6A 4GYUA 4FSBA 2BC2A 2YNVB 4UWOB 5A0VA 5AHOA 1XTOA 1MQOA 2BGAA 4C1CA 4CHLA 1DXKA 5A0TA 4TZEA 2YNTA 1KR3A 5LCFA 2OHHA 5EW0A 2BFZB 2I7XA 4D1VA 4EYFA 4Z7RA 3ZWFA 2DOOA 4HL1A 3P2UA 1VJNA 5HIQA 2VW8A 5AXRA 3ADRA 4LE6A 4D1UA 1ZTCA 2I7VA 4Z67A 3IEKA 4P62A 2GMNA 3I11A 5AEBA 5ACVA 5LCAA 4ZEJA 3KNRA 4NQ5A 2YNTB 3X2ZA 5AXOA 4EYLA 1WRAA 2WHGA 3AJ3A 1X8GA 4B87A 2DKFA 4DILA 5LS3A 5A87A 4BZ3A 4YSKA 2M5DA 3RKKA 1JT1A 2XR1A 3X2YA 2QEDA 2QJSA 4HL2A 2QDSA 1X8HA 4JO0A 4O98A 2YZ3A 3FCZA 4RL0A 5LE1A 2YCBA 3PY5A 4EXSA 2BFZA 4UAMA 1KO3A 3IOGA 4EYBA 1YCFA 2GFKA 5HIPA 3T3NA 4C1HA 5IQKA 2Q0JA 5A5ZA 5EVDA 2ZO4A 4TZBA 2FK6A 4C09A 4Z6XA 2FU6A 2BG2A 4ZO2A 4PVTA 3DH8A 4RL2A 3S0ZA 5ACQA 3G1PA 3T3OA 2BG8A 4UWPB 1VMEA 5AYAA 5HISA 3LVZA 1DDKA 5FQBA 4GYQA 3IDZA 1SMLA 4NQ2A 5HH6A 2I7TA 1M2XA 1A8TA 1P9EA 2YNUA 2BFKA 2P18A 1WUOA 4Z60A 3BK2A 3IOFA 4BP0A 4DIKA 3I15A 2WRSA 5HH5A 4EFZA 3I13A 1XM8A 3BC2A 3TP9A 5EHTA 4WD6A 2BG8B 2Q0IA 5DPXA 5LLDA 3MD7A 2FU8A 1Y44A 1X8IA 4C1FA 1K07A 2Q42A 5ACTA 4AX0B 3ZR9A 3IE0A 5ACXA 5EVKA 3SFPA 3SBLA 2BG7A 4F6ZA 2P97A 4UA4A 4C1DA 5LSCA 4Z5YA 5KIKA 3SD9A 3SW3A 2BIBA 5ACSA 1JJEA 4NQ4A 5ACRA 3DHAA 2ZZIA 4TYTA 1WUPA 3ZQ4A 3I0VA 4AWYB 3JXPA 5LCHA 1L9YA 2GCUA 4FR7A 4KEPA 2P1EA 4TZFA 5FQCA 2FM6A 1BC2A 2A7MA 4RAWA 3RPCA 5ACUA 3AF5A 5KILA 1YCGA 3DHBA 2BR6A 2P4ZA 2WYLA 4AX1B 4TYFA 3BK1A 3I14A 2NZFA 5K4NA 4AD9A 3R2UA 2FU7A 2UYXA 2Y8AA 4PVOA 4UBQA 5B1UA 2YNWA 3BV6A 3FAIA 2FU9A 4C1GA 3IELA 3VQZA 3KNSA
chains in the Genus database with same CATH superfamily
2QINA 3PG4A 4EY2A 2CBNA 4GCWA 5K4MA 3X30A 5B3RA 2CG2A 4H0DA 3WXCA 3T9MA 1VGNA 5FQAA 2WYMA 4YSLA 5ACPA 2M5CA 1KO2A 4Z5ZA 4UWSB 2AZ4A 3VPEA 1QH3A 3DHCA 3SPUA 5HIOA 2OHIA 4C1EA 2OHJA 4NQ6A 3ESHA 2CFZA 5B15A 4FEKA 3F9OA 5ACWA 3H3EA 4AV7A 2GKLA 4YSBA 4D1TA 3IE1A 1A7TA 2BMIA 3L6NA 2Y87A 4KEQA 1BVTA 5K4KA 3Q6VA 2NXAA 4XWWA 2Q9UA 2Y8BA 3RKJA 2BG6A 1JJTA 1YCHA 2ZWRA 4PDXA 5LM6A 3SRXA 4J5HA 5K0WA 1E5DA 3QH8A 3ZNBA 4HKYA 5HH4A 4RM5A 2FHXA 4ZO3A 3X2XA 5EV8A 4TZ9A 2ZNBA 5LMCA 2YHEA 2GFJA 4AWZA 4RAMA 1HLKA 4U4LA 2R2DA 2YNVA 5EH9A 1ZNBA 2BFLA 1BMCA 3A4YA 4XWTA 3IE2A 4D02A 4V0HA 5EWAA 3KL7A 5AHRA 1DD6A 4XUKA 2NZEA 2NYPA 1QH5A 2H6AA 4EXYA 5EV6A 2E7YA 1WW1A 1ZKPA 4UWRB 2FHXB 2XF4A 4RBSA 2HB9A 2QDTA 5EVBA 2CG3A 4F6HA 3IEMA 3PY6A 4ZNBA 2AIOA 4D1WA 4J5FA 2WYMC 2BTNA 3AF6A 4GYUA 4FSBA 2BC2A 2YNVB 4UWOB 5A0VA 5AHOA 1XTOA 1MQOA 2BGAA 4C1CA 4CHLA 1DXKA 5A0TA 4TZEA 2YNTA 1KR3A 5LCFA 2OHHA 5EW0A 2BFZB 2I7XA 4D1VA 4EYFA 4Z7RA 3ZWFA 2DOOA 4HL1A 3P2UA 1VJNA 5HIQA 2VW8A 2CFUA 5AXRA 3ADRA 4LE6A 4D1UA 1ZTCA 2I7VA 4Z67A 3IEKA 4P62A 2GMNA 3I11A 5AEBA 5ACVA 5LCAA 4ZEJA 3KNRA 4NQ5A 2YNTB 3X2ZA 5AXOA 4EYLA 1WRAA 2WHGA 3AJ3A 1X8GA 4B87A 2DKFA 4DILA 5LS3A 5A87A 4BZ3A 4YSKA 2M5DA 3RKKA 1JT1A 2XR1A 3X2YA 2QEDA 5AJLA 2QJSA 4HL2A 2QDSA 1X8HA 4JO0A 4O98A 2YZ3A 4AXHA 3FCZA 4RL0A 5LE1A 2YCBA 3PY5A 4EXSA 2BFZA 4UAMA 1KO3A 3IOGA 4EYBA 1YCFA 2GFKA 5HIPA 3T3NA 4C1HA 5IQKA 2Q0JA 5A5ZA 5EVDA 2ZO4A 4TZBA 2FK6A 4C09A 4Z6XA 2FU6A 2BG2A 4ZO2A 4PVTA 3DH8A 4RL2A 3S0ZA 5ACQA 3G1PA 3T3OA 2BG8A 4NURA 4UWPB 1VMEA 5AYAA 5HISA 3LVZA 1DDKA 5FQBA 4GYQA 3IDZA 1SMLA 4NQ2A 5HH6A 2I7TA 1M2XA 1A8TA 1P9EA 2YNUA 2BFKA 2P18A 1WUOA 4Z60A 3BK2A 3IOFA 4BP0A 4DIKA 3I15A 2WRSA 5HH5A 4EFZA 3I13A 1XM8A 3BC2A 3TP9A 5EHTA 4WD6A 2BG8B 2Q0IA 5DPXA 5LLDA 3MD7A 2FU8A 1Y44A 1X8IA 4C1FA 1K07A 2Q42A 5ACTA 4AX0B 3ZR9A 3IE0A 5ACXA 5EVKA 3SFPA 3SBLA 2BG7A 4F6ZA 2P97A 4UA4A 4C1DA 5LSCA 4Z5YA 5KIKA 3SD9A 3SW3A 2BIBA 5ACSA 1JJEA 4NQ4A 5ACRA 3DHAA 2ZZIA 4TYTA 1WUPA 3ZQ4A 3I0VA 4AWYB 3JXPA 5LCHA 1L9YA 2GCUA 4FR7A 4KEPA 2P1EA 4TZFA 5FQCA 2FM6A 1BC2A 2A7MA 4RAWA 3RPCA 5ACUA 3AF5A 5KILA 1YCGA 3DHBA 2BR6A 5AIJA 2P4ZA 2WYLA 4AX1B 4TYFA 3BK1A 3I14A 2NZFA 5K4NA 4AD9A 3R2UA 2FU7A 2UYXA 2Y8AA 4PVOA 5A23A 4UBQA 5B1UA 2YNWA 3BV6A 3FAIA 2FU9A 4C1GA 3IELA 3VQZA 3KNSA
chains in the Genus database with same CATH topology
2QINA 3PG4A 4EY2A 2CBNA 4GCWA 5K4MA 3X30A 5B3RA 4H0DA 3WXCA 3T9MA 1VGNA 5FQAA 2WYMA 4YSLA 5ACPA 2M5CA 1KO2A 4Z5ZA 4UWSB 2AZ4A 3VPEA 1QH3A 3DHCA 3SPUA 5HIOA 2OHIA 4C1EA 2OHJA 4NQ6A 3ESHA 5B15A 4FEKA 3F9OA 5ACWA 3H3EA 2GKLA 4YSBA 4D1TA 3IE1A 1A7TA 2BMIA 3L6NA 2Y87A 4KEQA 1BVTA 5K4KA 3Q6VA 2NXAA 4XWWA 2Q9UA 2Y8BA 3RKJA 2BG6A 1JJTA 1YCHA 2ZWRA 5LM6A 3SRXA 4J5HA 5K0WA 1E5DA 3QH8A 3ZNBA 4HKYA 5HH4A 4RM5A 2FHXA 4ZO3A 3X2XA 5EV8A 4TZ9A 2ZNBA 5LMCA 2GFJA 4AWZA 4RAMA 1HLKA 4U4LA 2R2DA 2YNVA 5EH9A 1ZNBA 2BFLA 1BMCA 3A4YA 4XWTA 3IE2A 4D02A 4V0HA 5EWAA 3KL7A 5AHRA 1DD6A 4XUKA 2NZEA 2NYPA 1QH5A 2H6AA 4EXYA 5EV6A 2E7YA 1WW1A 1ZKPA 4UWRB 2FHXB 2XF4A 4RBSA 2HB9A 2QDTA 5EVBA 4F6HA 3IEMA 3PY6A 4ZNBA 2AIOA 4D1WA 4J5FA 2WYMC 2BTNA 3AF6A 4GYUA 4FSBA 2BC2A 2YNVB 4UWOB 5A0VA 5AHOA 1XTOA 1MQOA 2BGAA 4C1CA 4CHLA 1DXKA 5A0TA 4TZEA 2YNTA 1KR3A 5LCFA 2OHHA 5EW0A 2BFZB 2I7XA 4D1VA 4EYFA 4Z7RA 3ZWFA 2DOOA 4HL1A 3P2UA 1VJNA 5HIQA 2VW8A 5AXRA 3ADRA 4LE6A 4D1UA 1ZTCA 2I7VA 4Z67A 3IEKA 4P62A 2GMNA 3I11A 5AEBA 5ACVA 5LCAA 4ZEJA 3KNRA 4NQ5A 2YNTB 3X2ZA 5AXOA 4EYLA 1WRAA 2WHGA 3AJ3A 1X8GA 4B87A 2DKFA 4DILA 5LS3A 5A87A 4BZ3A 4YSKA 2M5DA 3RKKA 1JT1A 2XR1A 3X2YA 2QEDA 2QJSA 4HL2A 2QDSA 1X8HA 4JO0A 4O98A 2YZ3A 3FCZA 4RL0A 5LE1A 2YCBA 3PY5A 4EXSA 2BFZA 4UAMA 1KO3A 3IOGA 4EYBA 1YCFA 2GFKA 5HIPA 3T3NA 4C1HA 5IQKA 2Q0JA 5A5ZA 5EVDA 2ZO4A 4TZBA 2FK6A 4C09A 4Z6XA 2FU6A 2BG2A 4ZO2A 4PVTA 3DH8A 4RL2A 3S0ZA 5ACQA 3G1PA 3T3OA 2BG8A 4UWPB 1VMEA 5AYAA 5HISA 3LVZA 1DDKA 5FQBA 4GYQA 3IDZA 1SMLA 4NQ2A 5HH6A 2I7TA 1M2XA 1A8TA 1P9EA 2YNUA 2BFKA 2P18A 1WUOA 4Z60A 3BK2A 3IOFA 4BP0A 4DIKA 3I15A 2WRSA 5HH5A 4EFZA 3I13A 1XM8A 3BC2A 3TP9A 5EHTA 4WD6A 2BG8B 2Q0IA 5DPXA 5LLDA 3MD7A 2FU8A 1Y44A 1X8IA 4C1FA 1K07A 2Q42A 5ACTA 4AX0B 3ZR9A 3IE0A 5ACXA 5EVKA 3SFPA 3SBLA 2BG7A 4F6ZA 2P97A 4UA4A 4C1DA 5LSCA 4Z5YA 5KIKA 3SD9A 3SW3A 2BIBA 5ACSA 1JJEA 4NQ4A 5ACRA 3DHAA 2ZZIA 4TYTA 1WUPA 3ZQ4A 3I0VA 4AWYB 3JXPA 5LCHA 1L9YA 2GCUA 4FR7A 4KEPA 2P1EA 4TZFA 5FQCA 2FM6A 1BC2A 2A7MA 4RAWA 3RPCA 5ACUA 3AF5A 5KILA 1YCGA 3DHBA 2BR6A 2P4ZA 2WYLA 4AX1B 4TYFA 3BK1A 3I14A 2NZFA 5K4NA 4AD9A 3R2UA 2FU7A 2UYXA 2Y8AA 4PVOA 4UBQA 5B1UA 2YNWA 3BV6A 3FAIA 2FU9A 4C1GA 3IELA 3VQZA 3KNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIN A;  3PG4 A;  4EY2 A;  2CBN A;  4GCW A;  5K4M A;  3X30 A;  5B3R A;  4H0D A;  3WXC A;  3T9M A;  1VGN A;  5FQA A;  2WYM A;  4YSL A;  5ACP A;  2M5C A;  1KO2 A;  4Z5Z A;  4UWS B;  2AZ4 A;  3VPE A;  1QH3 A;  3DHC A;  3SPU A;  5HIO A;  2OHI A;  4C1E A;  2OHJ A;  4NQ6 A;  3ESH A;  5B15 A;  4FEK A;  3F9O A;  5ACW A;  3H3E A;  2GKL A;  4YSB A;  4D1T A;  3IE1 A;  1A7T A;  2BMI A;  3L6N A;  2Y87 A;  4KEQ A;  1BVT A;  5K4K A;  3Q6V A;  2NXA A;  4XWW A;  2Q9U A;  2Y8B A;  3RKJ A;  2BG6 A;  1JJT A;  1YCH A;  2ZWR A;  5LM6 A;  3SRX A;  4J5H A;  5K0W A;  1E5D A;  3QH8 A;  3ZNB A;  4HKY A;  5HH4 A;  4RM5 A;  2FHX A;  4ZO3 A;  3X2X A;  5EV8 A;  4TZ9 A;  2ZNB A;  5LMC A;  2GFJ A;  4AWZ A;  4RAM A;  1HLK A;  4U4L A;  2R2D A;  2YNV A;  5EH9 A;  1ZNB A;  2BFL A;  1BMC A;  3A4Y A;  4XWT A;  3IE2 A;  4D02 A;  4V0H A;  5EWA A;  3KL7 A;  5AHR A;  1DD6 A;  4XUK A;  2NZE A;  2NYP A;  1QH5 A;  2H6A A;  4EXY A;  5EV6 A;  2E7Y A;  1WW1 A;  1ZKP A;  4UWR B;  2FHX B;  2XF4 A;  4RBS A;  2HB9 A;  2QDT A;  5EVB A;  4F6H A;  3IEM A;  3PY6 A;  4ZNB A;  2AIO A;  4D1W A;  4J5F A;  2WYM C;  2BTN A;  3AF6 A;  4GYU A;  4FSB A;  2BC2 A;  2YNV B;  4UWO B;  5A0V A;  5AHO A;  1XTO A;  1MQO A;  2BGA A;  4C1C A;  4CHL A;  1DXK A;  5A0T A;  4TZE A;  2YNT A;  1KR3 A;  5LCF A;  2OHH A;  5EW0 A;  2BFZ B;  2I7X A;  4D1V A;  4EYF A;  4Z7R A;  3ZWF A;  2DOO A;  4HL1 A;  3P2U A;  1VJN A;  5HIQ A;  2VW8 A;  5AXR A;  3ADR A;  4LE6 A;  4D1U A;  1ZTC A;  2I7V A;  4Z67 A;  3IEK A;  4P62 A;  2GMN A;  3I11 A;  5AEB A;  5ACV A;  5LCA A;  4ZEJ A;  3KNR A;  4NQ5 A;  2YNT B;  3X2Z A;  5AXO A;  4EYL A;  1WRA A;  2WHG A;  3AJ3 A;  1X8G A;  4B87 A;  2DKF A;  4DIL A;  5LS3 A;  5A87 A;  4BZ3 A;  4YSK A;  2M5D A;  3RKK A;  1JT1 A;  2XR1 A;  3X2Y A;  2QED A;  2QJS A;  4HL2 A;  2QDS A;  1X8H A;  4JO0 A;  4O98 A;  2YZ3 A;  3FCZ A;  4RL0 A;  5LE1 A;  2YCB A;  3PY5 A;  4EXS A;  2BFZ A;  4UAM A;  1KO3 A;  3IOG A;  4EYB A;  1YCF A;  2GFK A;  5HIP A;  3T3N A;  4C1H A;  5IQK A;  2Q0J A;  5A5Z A;  5EVD A;  2ZO4 A;  4TZB A;  2FK6 A;  4C09 A;  4Z6X A;  2FU6 A;  2BG2 A;  4ZO2 A;  4PVT A;  3DH8 A;  4RL2 A;  3S0Z A;  5ACQ A;  3G1P A;  3T3O A;  2BG8 A;  4UWP B;  1VME A;  5AYA A;  5HIS A;  3LVZ A;  1DDK A;  5FQB A;  4GYQ A;  3IDZ A;  1SML A;  4NQ2 A;  5HH6 A;  2I7T A;  1M2X A;  1A8T A;  1P9E A;  2YNU A;  2BFK A;  2P18 A;  1WUO A;  4Z60 A;  3BK2 A;  3IOF A;  4BP0 A;  4DIK A;  3I15 A;  2WRS A;  5HH5 A;  4EFZ A;  3I13 A;  1XM8 A;  3BC2 A;  3TP9 A;  5EHT A;  4WD6 A;  2BG8 B;  2Q0I A;  5DPX A;  5LLD A;  3MD7 A;  2FU8 A;  1Y44 A;  1X8I A;  4C1F A;  1K07 A;  2Q42 A;  5ACT A;  4AX0 B;  3ZR9 A;  3IE0 A;  5ACX A;  5EVK A;  3SFP A;  3SBL A;  2BG7 A;  4F6Z A;  2P97 A;  4UA4 A;  4C1D A;  5LSC A;  4Z5Y A;  5KIK A;  3SD9 A;  3SW3 A;  2BIB A;  5ACS A;  1JJE A;  4NQ4 A;  5ACR A;  3DHA A;  2ZZI A;  4TYT A;  1WUP A;  3ZQ4 A;  3I0V A;  4AWY B;  3JXP A;  5LCH A;  1L9Y A;  2GCU A;  4FR7 A;  4KEP A;  2P1E A;  4TZF A;  5FQC A;  2FM6 A;  1BC2 A;  2A7M A;  4RAW A;  3RPC A;  5ACU A;  3AF5 A;  5KIL A;  1YCG A;  3DHB A;  2BR6 A;  2P4Z A;  2WYL A;  4AX1 B;  4TYF A;  3BK1 A;  3I14 A;  2NZF A;  5K4N A;  4AD9 A;  3R2U A;  2FU7 A;  2UYX A;  2Y8A A;  4PVO A;  4UBQ A;  5B1U A;  2YNW A;  3BV6 A;  3FAI A;  2FU9 A;  4C1G A;  3IEL A;  3VQZ A;  3KNS A; 
#chains in the Genus database with same CATH topology
 2QIN A;  3PG4 A;  4EY2 A;  2CBN A;  4GCW A;  5K4M A;  3X30 A;  5B3R A;  2CG2 A;  4H0D A;  3WXC A;  3T9M A;  1VGN A;  5FQA A;  2WYM A;  4YSL A;  5ACP A;  2M5C A;  1KO2 A;  4Z5Z A;  4UWS B;  2AZ4 A;  3VPE A;  1QH3 A;  3DHC A;  3SPU A;  5HIO A;  2OHI A;  4C1E A;  2OHJ A;  4NQ6 A;  3ESH A;  2CFZ A;  5B15 A;  4FEK A;  3F9O A;  5ACW A;  3H3E A;  4AV7 A;  2GKL A;  4YSB A;  4D1T A;  3IE1 A;  1A7T A;  2BMI A;  3L6N A;  2Y87 A;  4KEQ A;  1BVT A;  5K4K A;  3Q6V A;  2NXA A;  4XWW A;  2Q9U A;  2Y8B A;  3RKJ A;  2BG6 A;  1JJT A;  1YCH A;  2ZWR A;  4PDX A;  5LM6 A;  3SRX A;  4J5H A;  5K0W A;  1E5D A;  3QH8 A;  3ZNB A;  4HKY A;  5HH4 A;  4RM5 A;  2FHX A;  4ZO3 A;  3X2X A;  5EV8 A;  4TZ9 A;  2ZNB A;  5LMC A;  2YHE A;  2GFJ A;  4AWZ A;  4RAM A;  1HLK A;  4U4L A;  2R2D A;  2YNV A;  5EH9 A;  1ZNB A;  2BFL A;  1BMC A;  3A4Y A;  4XWT A;  3IE2 A;  4D02 A;  4V0H A;  5EWA A;  3KL7 A;  5AHR A;  1DD6 A;  4XUK A;  2NZE A;  2NYP A;  1QH5 A;  2H6A A;  4EXY A;  5EV6 A;  2E7Y A;  1WW1 A;  1ZKP A;  4UWR B;  2FHX B;  2XF4 A;  4RBS A;  2HB9 A;  2QDT A;  5EVB A;  2CG3 A;  4F6H A;  3IEM A;  3PY6 A;  4ZNB A;  2AIO A;  4D1W A;  4J5F A;  2WYM C;  2BTN A;  3AF6 A;  4GYU A;  4FSB A;  2BC2 A;  2YNV B;  4UWO B;  5A0V A;  5AHO A;  1XTO A;  1MQO A;  2BGA A;  4C1C A;  4CHL A;  1DXK A;  5A0T A;  4TZE A;  2YNT A;  1KR3 A;  5LCF A;  2OHH A;  5EW0 A;  2BFZ B;  2I7X A;  4D1V A;  4EYF A;  4Z7R A;  3ZWF A;  2DOO A;  4HL1 A;  3P2U A;  1VJN A;  5HIQ A;  2VW8 A;  2CFU A;  5AXR A;  3ADR A;  4LE6 A;  4D1U A;  1ZTC A;  2I7V A;  4Z67 A;  3IEK A;  4P62 A;  2GMN A;  3I11 A;  5AEB A;  5ACV A;  5LCA A;  4ZEJ A;  3KNR A;  4NQ5 A;  2YNT B;  3X2Z A;  5AXO A;  4EYL A;  1WRA A;  2WHG A;  3AJ3 A;  1X8G A;  4B87 A;  2DKF A;  4DIL A;  5LS3 A;  5A87 A;  4BZ3 A;  4YSK A;  2M5D A;  3RKK A;  1JT1 A;  2XR1 A;  3X2Y A;  2QED A;  5AJL A;  2QJS A;  4HL2 A;  2QDS A;  1X8H A;  4JO0 A;  4O98 A;  2YZ3 A;  4AXH A;  3FCZ A;  4RL0 A;  5LE1 A;  2YCB A;  3PY5 A;  4EXS A;  2BFZ A;  4UAM A;  1KO3 A;  3IOG A;  4EYB A;  1YCF A;  2GFK A;  5HIP A;  3T3N A;  4C1H A;  5IQK A;  2Q0J A;  5A5Z A;  5EVD A;  2ZO4 A;  4TZB A;  2FK6 A;  4C09 A;  4Z6X A;  2FU6 A;  2BG2 A;  4ZO2 A;  4PVT A;  3DH8 A;  4RL2 A;  3S0Z A;  5ACQ A;  3G1P A;  3T3O A;  2BG8 A;  4NUR A;  4UWP B;  1VME A;  5AYA A;  5HIS A;  3LVZ A;  1DDK A;  5FQB A;  4GYQ A;  3IDZ A;  1SML A;  4NQ2 A;  5HH6 A;  2I7T A;  1M2X A;  1A8T A;  1P9E A;  2YNU A;  2BFK A;  2P18 A;  1WUO A;  4Z60 A;  3BK2 A;  3IOF A;  4BP0 A;  4DIK A;  3I15 A;  2WRS A;  5HH5 A;  4EFZ A;  3I13 A;  1XM8 A;  3BC2 A;  3TP9 A;  5EHT A;  4WD6 A;  2BG8 B;  2Q0I A;  5DPX A;  5LLD A;  3MD7 A;  2FU8 A;  1Y44 A;  1X8I A;  4C1F A;  1K07 A;  2Q42 A;  5ACT A;  4AX0 B;  3ZR9 A;  3IE0 A;  5ACX A;  5EVK A;  3SFP A;  3SBL A;  2BG7 A;  4F6Z A;  2P97 A;  4UA4 A;  4C1D A;  5LSC A;  4Z5Y A;  5KIK A;  3SD9 A;  3SW3 A;  2BIB A;  5ACS A;  1JJE A;  4NQ4 A;  5ACR A;  3DHA A;  2ZZI A;  4TYT A;  1WUP A;  3ZQ4 A;  3I0V A;  4AWY B;  3JXP A;  5LCH A;  1L9Y A;  2GCU A;  4FR7 A;  4KEP A;  2P1E A;  4TZF A;  5FQC A;  2FM6 A;  1BC2 A;  2A7M A;  4RAW A;  3RPC A;  5ACU A;  3AF5 A;  5KIL A;  1YCG A;  3DHB A;  2BR6 A;  5AIJ A;  2P4Z A;  2WYL A;  4AX1 B;  4TYF A;  3BK1 A;  3I14 A;  2NZF A;  5K4N A;  4AD9 A;  3R2U A;  2FU7 A;  2UYX A;  2Y8A A;  4PVO A;  5A23 A;  4UBQ A;  5B1U A;  2YNW A;  3BV6 A;  3FAI A;  2FU9 A;  4C1G A;  3IEL A;  3VQZ A;  3KNS A; 
#chains in the Genus database with same CATH homology
 2QIN A;  3PG4 A;  4EY2 A;  2CBN A;  4GCW A;  5K4M A;  3X30 A;  5B3R A;  4H0D A;  3WXC A;  3T9M A;  1VGN A;  5FQA A;  2WYM A;  4YSL A;  5ACP A;  2M5C A;  1KO2 A;  4Z5Z A;  4UWS B;  2AZ4 A;  3VPE A;  1QH3 A;  3DHC A;  3SPU A;  5HIO A;  2OHI A;  4C1E A;  2OHJ A;  4NQ6 A;  3ESH A;  5B15 A;  4FEK A;  3F9O A;  5ACW A;  3H3E A;  2GKL A;  4YSB A;  4D1T A;  3IE1 A;  1A7T A;  2BMI A;  3L6N A;  2Y87 A;  4KEQ A;  1BVT A;  5K4K A;  3Q6V A;  2NXA A;  4XWW A;  2Q9U A;  2Y8B A;  3RKJ A;  2BG6 A;  1JJT A;  1YCH A;  2ZWR A;  5LM6 A;  3SRX A;  4J5H A;  5K0W A;  1E5D A;  3QH8 A;  3ZNB A;  4HKY A;  5HH4 A;  4RM5 A;  2FHX A;  4ZO3 A;  3X2X A;  5EV8 A;  4TZ9 A;  2ZNB A;  5LMC A;  2GFJ A;  4AWZ A;  4RAM A;  1HLK A;  4U4L A;  2R2D A;  2YNV A;  5EH9 A;  1ZNB A;  2BFL A;  1BMC A;  3A4Y A;  4XWT A;  3IE2 A;  4D02 A;  4V0H A;  5EWA A;  3KL7 A;  5AHR A;  1DD6 A;  4XUK A;  2NZE A;  2NYP A;  1QH5 A;  2H6A A;  4EXY A;  5EV6 A;  2E7Y A;  1WW1 A;  1ZKP A;  4UWR B;  2FHX B;  2XF4 A;  4RBS A;  2HB9 A;  2QDT A;  5EVB A;  4F6H A;  3IEM A;  3PY6 A;  4ZNB A;  2AIO A;  4D1W A;  4J5F A;  2WYM C;  2BTN A;  3AF6 A;  4GYU A;  4FSB A;  2BC2 A;  2YNV B;  4UWO B;  5A0V A;  5AHO A;  1XTO A;  1MQO A;  2BGA A;  4C1C A;  4CHL A;  1DXK A;  5A0T A;  4TZE A;  2YNT A;  1KR3 A;  5LCF A;  2OHH A;  5EW0 A;  2BFZ B;  2I7X A;  4D1V A;  4EYF A;  4Z7R A;  3ZWF A;  2DOO A;  4HL1 A;  3P2U A;  1VJN A;  5HIQ A;  2VW8 A;  5AXR A;  3ADR A;  4LE6 A;  4D1U A;  1ZTC A;  2I7V A;  4Z67 A;  3IEK A;  4P62 A;  2GMN A;  3I11 A;  5AEB A;  5ACV A;  5LCA A;  4ZEJ A;  3KNR A;  4NQ5 A;  2YNT B;  3X2Z A;  5AXO A;  4EYL A;  1WRA A;  2WHG A;  3AJ3 A;  1X8G A;  4B87 A;  2DKF A;  4DIL A;  5LS3 A;  5A87 A;  4BZ3 A;  4YSK A;  2M5D A;  3RKK A;  1JT1 A;  2XR1 A;  3X2Y A;  2QED A;  2QJS A;  4HL2 A;  2QDS A;  1X8H A;  4JO0 A;  4O98 A;  2YZ3 A;  3FCZ A;  4RL0 A;  5LE1 A;  2YCB A;  3PY5 A;  4EXS A;  2BFZ A;  4UAM A;  1KO3 A;  3IOG A;  4EYB A;  1YCF A;  2GFK A;  5HIP A;  3T3N A;  4C1H A;  5IQK A;  2Q0J A;  5A5Z A;  5EVD A;  2ZO4 A;  4TZB A;  2FK6 A;  4C09 A;  4Z6X A;  2FU6 A;  2BG2 A;  4ZO2 A;  4PVT A;  3DH8 A;  4RL2 A;  3S0Z A;  5ACQ A;  3G1P A;  3T3O A;  2BG8 A;  4UWP B;  1VME A;  5AYA A;  5HIS A;  3LVZ A;  1DDK A;  5FQB A;  4GYQ A;  3IDZ A;  1SML A;  4NQ2 A;  5HH6 A;  2I7T A;  1M2X A;  1A8T A;  1P9E A;  2YNU A;  2BFK A;  2P18 A;  1WUO A;  4Z60 A;  3BK2 A;  3IOF A;  4BP0 A;  4DIK A;  3I15 A;  2WRS A;  5HH5 A;  4EFZ A;  3I13 A;  1XM8 A;  3BC2 A;  3TP9 A;  5EHT A;  4WD6 A;  2BG8 B;  2Q0I A;  5DPX A;  5LLD A;  3MD7 A;  2FU8 A;  1Y44 A;  1X8I A;  4C1F A;  1K07 A;  2Q42 A;  5ACT A;  4AX0 B;  3ZR9 A;  3IE0 A;  5ACX A;  5EVK A;  3SFP A;  3SBL A;  2BG7 A;  4F6Z A;  2P97 A;  4UA4 A;  4C1D A;  5LSC A;  4Z5Y A;  5KIK A;  3SD9 A;  3SW3 A;  2BIB A;  5ACS A;  1JJE A;  4NQ4 A;  5ACR A;  3DHA A;  2ZZI A;  4TYT A;  1WUP A;  3ZQ4 A;  3I0V A;  4AWY B;  3JXP A;  5LCH A;  1L9Y A;  2GCU A;  4FR7 A;  4KEP A;  2P1E A;  4TZF A;  5FQC A;  2FM6 A;  1BC2 A;  2A7M A;  4RAW A;  3RPC A;  5ACU A;  3AF5 A;  5KIL A;  1YCG A;  3DHB A;  2BR6 A;  2P4Z A;  2WYL A;  4AX1 B;  4TYF A;  3BK1 A;  3I14 A;  2NZF A;  5K4N A;  4AD9 A;  3R2U A;  2FU7 A;  2UYX A;  2Y8A A;  4PVO A;  4UBQ A;  5B1U A;  2YNW A;  3BV6 A;  3FAI A;  2FU9 A;  4C1G A;  3IEL A;  3VQZ A;  3KNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...