2XF4A

Crystal structure of salmonella enterica serovar typhimurium ycbl
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
210
Chain Sequence
MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLDHVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVGNVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLLPLGDDVTFIPGHGPLSTLGYERLHNPFLQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYACYLGLUTATHIONE HYDROLASE
publication title Structural and Functional Characterization of Salmonella Enterica Serovar Typhimurium Ycbl: An Unusual Type II Glyoxalase
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Hydrolase
total genus 65
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2010-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2xf4A00
4B87A 2YNTA 2QJSA 4XWWA 1WRAA 3AF5A 5K4MA 4XWTA 5ACSA 5AYAA 3RKKA 2BFZB 4GCWA 3SBLA 2WRSA 1JT1A 2DKFA 2E7YA 5FQAA 5LCHA 1BMCA 4LE6A 2P4ZA 5ACVA 3AF6A 4EYBA 2NZEA 2FU6A 4AWZA 3R2UA 5LSCA 5LLDA 3IE2A 2FU8A 2XR1A 1ZTCA 3AJ3A 1L9YA 2BIBA 3ESHA 3IE1A 3IEKA 2QDTA 3MD7A 4Z60A 4AX0B 3RPCA 2BFKA 2QDSA 4GYQA 3T3NA 4KEPA 2M5CA 5EVKA 1QH5A 4UWOB 4EXSA 1X8IA 2WYMA 2WYMC 2NYPA 3ADRA 3X30A 3WXCA 2VW8A 3BV6A 2I7XA 4HL2A 2P1EA 5ACXA 3ZR9A 2BTNA 2FU9A 4D1VA 1ZKPA 3G1PA 4V0HA 4H0DA 2YZ3A 3IOFA 2QEDA 3ZQ4A 3SPUA 5EV6A 1M2XA 1KR3A 3H3EA 5K4KA 3I0VA 5LS3A 1VGNA 5KIKA 2HB9A 3IE0A 2OHHA 5AXRA 4C1GA 4KEQA 1JJEA 2YNUA 2BC2A 4F6ZA 1XM8A 3PY5A 4D1TA 2BGAA 2M5DA 3TP9A 3KL7A 1YCHA 2BG7A 5A0VA 5AHRA 2Q0IA 3L6NA 2YNWA 1ZNBA 3SRXA 4BZ3A 3IDZA 1DXKA 2BFZA 5EVBA 4YSKA 3KNSA 5HISA 2XF4A 3SD9A 2BR6A 4BP0A 1WW1A 2ZNBA 2AIOA 5ACTA 5AXOA 5AEBA 2I7VA 4CHLA 2YCBA 2WHGA 4F6HA 3PG4A 3PY6A 5A87A 2BFLA 4JO0A 4EYLA 1MQOA 4UA4A 4DIKA 2Q0JA 4ZEJA 5B1UA 4GYUA 4ZO2A 5B15A 2UYXA 4EXYA 5ACWA 4Z67A 5HIPA 4TZ9A 2FM6A 4TYFA 5LMCA 1WUOA 3I15A 2OHIA 5DPXA 3A4YA 4RAWA 1DD6A 4C1DA 3ZNBA 2FHXB 2H6AA 4FSBA 5LE1A 2BG2A 3DH8A 4D1WA 4UWRB 4D02A 2YNVB 2FK6A 4NQ4A 4EY2A 1A8TA 5HIOA 5EW0A 1XTOA 3I13A 4C1FA 5FQCA 5EWAA 3DHCA 4AD9A 4P62A 4C1CA 1VJNA 4UWPB 2BMIA 4C09A 4YSBA 2ZZIA 3VQZA 4ZNBA 2R2DA 1QH3A 2BG8B 4UWSB 4WD6A 1KO3A 4YSLA 3X2ZA 2GMNA 2NZFA 1YCGA 2AZ4A 1WUPA 4O98A 3SFPA 3BC2A 4Z5ZA 1E5DA 2Q9UA 3F9OA 3DHAA 5HH4A 2I7TA 2P97A 2DOOA 1Y44A 2Y8BA 2ZO4A 2ZWRA 3BK2A 4TZEA 4D1UA 2YNTB 4RAMA 4RBSA 5EHTA 1BVTA 4U4LA 4XUKA 5KILA 3QH8A 1X8GA 5HIQA 3SW3A 4AWYB 3RKJA 4NQ5A 5AHOA 2GFKA 3LVZA 2Y8AA 2FU7A 3FCZA 4HL1A 4EFZA 4RL2A 5ACPA 3KNRA 4C1EA 2CBNA 3BK1A 1K07A 4RL0A 1DDKA 4PVOA 4ZO3A 2OHJA 5ACQA 5K4NA 5FQBA 2BG6A 3I14A 5HH5A 1P9EA 5HH6A 3IEMA 1BC2A 5EH9A 1VMEA 5B3RA 2GFJA 5IQKA 4NQ6A 4TZFA 3IELA 2FHXA 2QINA 1YCFA 5ACUA 5EV8A 4C1HA 5A0TA 1X8HA 4FR7A 4RM5A 1JJTA 3S0ZA 2YNVA 2GKLA 4TYTA 4UBQA 4NQ2A 3FAIA 3IOGA 4HKYA 3DHBA 4Z6XA 3VPEA 4J5HA 3X2YA 5ACRA 5LCAA 5LCFA 2A7MA 5K0WA 3X2XA 4TZBA 4FEKA 5LM6A 2WYLA 1HLKA 2Q42A 4Z7RA 4PVTA 1SMLA 4DILA 2BG8A 3Q6VA 3T9MA 4J5FA 4EYFA 4Z5YA 2Y87A 3T3OA 2GCUA 5EVDA 3I11A 3ZWFA 3JXPA 4UAMA 3P2UA 2NXAA 4AX1B 5A5ZA 1A7TA 1KO2A 2P18A
chains in the Genus database with same CATH superfamily
4B87A 2YNTA 2QJSA 4XWWA 1WRAA 3AF5A 5K4MA 4XWTA 5ACSA 5AYAA 3RKKA 2BFZB 4GCWA 3SBLA 2WRSA 1JT1A 2DKFA 2E7YA 5FQAA 5LCHA 1BMCA 4LE6A 2P4ZA 5ACVA 3AF6A 4EYBA 2NZEA 2FU6A 4AWZA 3R2UA 5LSCA 5LLDA 3IE2A 2FU8A 4PDXA 2XR1A 1ZTCA 3AJ3A 1L9YA 2BIBA 3ESHA 3IE1A 3IEKA 2QDTA 3MD7A 4Z60A 4AX0B 3RPCA 2BFKA 2QDSA 4GYQA 3T3NA 4KEPA 2M5CA 5EVKA 1QH5A 4UWOB 4EXSA 4NURA 1X8IA 2WYMA 2CFUA 2WYMC 2NYPA 3ADRA 3X30A 3WXCA 2VW8A 3BV6A 2I7XA 4HL2A 2P1EA 5ACXA 3ZR9A 2BTNA 2FU9A 4D1VA 1ZKPA 3G1PA 4V0HA 4H0DA 2YZ3A 3IOFA 2QEDA 3ZQ4A 3SPUA 5EV6A 1M2XA 1KR3A 3H3EA 5K4KA 3I0VA 5LS3A 1VGNA 5KIKA 2HB9A 3IE0A 2OHHA 5AXRA 4C1GA 4KEQA 1JJEA 2YNUA 2BC2A 4F6ZA 1XM8A 3PY5A 4D1TA 2BGAA 2M5DA 3TP9A 3KL7A 1YCHA 2BG7A 5A0VA 5AHRA 2Q0IA 3L6NA 2YNWA 2YHEA 1ZNBA 3SRXA 4BZ3A 3IDZA 1DXKA 2BFZA 5EVBA 4YSKA 2CG2A 3KNSA 5HISA 2XF4A 3SD9A 2BR6A 4BP0A 1WW1A 2ZNBA 2AIOA 5ACTA 4AV7A 5AXOA 5AEBA 2I7VA 4CHLA 2YCBA 2WHGA 4F6HA 3PG4A 3PY6A 5A23A 5A87A 2BFLA 4JO0A 4EYLA 1MQOA 4UA4A 4DIKA 2Q0JA 4ZEJA 5B1UA 4GYUA 4ZO2A 5B15A 2UYXA 4EXYA 5ACWA 4Z67A 5HIPA 4TZ9A 2FM6A 4TYFA 5LMCA 1WUOA 3I15A 2OHIA 5DPXA 3A4YA 4RAWA 1DD6A 4C1DA 3ZNBA 2FHXB 2H6AA 4FSBA 5LE1A 2BG2A 3DH8A 4D1WA 4UWRB 4D02A 2YNVB 2FK6A 4NQ4A 4EY2A 1A8TA 5HIOA 5EW0A 1XTOA 3I13A 4C1FA 5FQCA 5EWAA 3DHCA 4AD9A 4P62A 4C1CA 1VJNA 4UWPB 2BMIA 4C09A 4YSBA 2ZZIA 5AJLA 3VQZA 4ZNBA 2R2DA 1QH3A 2BG8B 4UWSB 4WD6A 1KO3A 4YSLA 3X2ZA 2GMNA 2NZFA 1YCGA 2AZ4A 1WUPA 4O98A 3SFPA 3BC2A 4Z5ZA 1E5DA 2Q9UA 3F9OA 3DHAA 5HH4A 2I7TA 2P97A 2DOOA 1Y44A 2CG3A 2Y8BA 2ZO4A 2ZWRA 3BK2A 4TZEA 4D1UA 2YNTB 4RAMA 4AXHA 4RBSA 5EHTA 1BVTA 4U4LA 4XUKA 5KILA 3QH8A 1X8GA 5HIQA 3SW3A 4AWYB 3RKJA 4NQ5A 5AHOA 2GFKA 3LVZA 2Y8AA 2FU7A 3FCZA 4HL1A 4EFZA 4RL2A 5ACPA 3KNRA 4C1EA 2CBNA 3BK1A 1K07A 4RL0A 1DDKA 4PVOA 4ZO3A 2OHJA 5ACQA 5K4NA 5FQBA 2BG6A 3I14A 5HH5A 1P9EA 5HH6A 3IEMA 2CFZA 1BC2A 5EH9A 1VMEA 5B3RA 2GFJA 5IQKA 4NQ6A 4TZFA 3IELA 2FHXA 2QINA 1YCFA 5ACUA 5EV8A 4C1HA 5A0TA 1X8HA 4FR7A 4RM5A 1JJTA 3S0ZA 2YNVA 2GKLA 4TYTA 4UBQA 4NQ2A 3FAIA 3IOGA 4HKYA 3DHBA 4Z6XA 3VPEA 4J5HA 3X2YA 5ACRA 5LCAA 5LCFA 2A7MA 5K0WA 3X2XA 4TZBA 4FEKA 5LM6A 2WYLA 1HLKA 2Q42A 4Z7RA 4PVTA 1SMLA 4DILA 2BG8A 3Q6VA 3T9MA 4J5FA 4EYFA 4Z5YA 2Y87A 3T3OA 2GCUA 5EVDA 3I11A 5AIJA 3ZWFA 3JXPA 4UAMA 3P2UA 2NXAA 4AX1B 5A5ZA 1A7TA 1KO2A 2P18A
chains in the Genus database with same CATH topology
4B87A 2YNTA 2QJSA 4XWWA 1WRAA 3AF5A 5K4MA 4XWTA 5ACSA 5AYAA 3RKKA 2BFZB 4GCWA 3SBLA 2WRSA 1JT1A 2DKFA 2E7YA 5FQAA 5LCHA 1BMCA 4LE6A 2P4ZA 5ACVA 3AF6A 4EYBA 2NZEA 2FU6A 4AWZA 3R2UA 5LSCA 5LLDA 3IE2A 2FU8A 2XR1A 1ZTCA 3AJ3A 1L9YA 2BIBA 3ESHA 3IE1A 3IEKA 2QDTA 3MD7A 4Z60A 4AX0B 3RPCA 2BFKA 2QDSA 4GYQA 3T3NA 4KEPA 2M5CA 5EVKA 1QH5A 4UWOB 4EXSA 1X8IA 2WYMA 2WYMC 2NYPA 3ADRA 3X30A 3WXCA 2VW8A 3BV6A 2I7XA 4HL2A 2P1EA 5ACXA 3ZR9A 2BTNA 2FU9A 4D1VA 1ZKPA 3G1PA 4V0HA 4H0DA 2YZ3A 3IOFA 2QEDA 3ZQ4A 3SPUA 5EV6A 1M2XA 1KR3A 3H3EA 5K4KA 3I0VA 5LS3A 1VGNA 5KIKA 2HB9A 3IE0A 2OHHA 5AXRA 4C1GA 4KEQA 1JJEA 2YNUA 2BC2A 4F6ZA 1XM8A 3PY5A 4D1TA 2BGAA 2M5DA 3TP9A 3KL7A 1YCHA 2BG7A 5A0VA 5AHRA 2Q0IA 3L6NA 2YNWA 1ZNBA 3SRXA 4BZ3A 3IDZA 1DXKA 2BFZA 5EVBA 4YSKA 3KNSA 5HISA 2XF4A 3SD9A 2BR6A 4BP0A 1WW1A 2ZNBA 2AIOA 5ACTA 5AXOA 5AEBA 2I7VA 4CHLA 2YCBA 2WHGA 4F6HA 3PG4A 3PY6A 5A87A 2BFLA 4JO0A 4EYLA 1MQOA 4UA4A 4DIKA 2Q0JA 4ZEJA 5B1UA 4GYUA 4ZO2A 5B15A 2UYXA 4EXYA 5ACWA 4Z67A 5HIPA 4TZ9A 2FM6A 4TYFA 5LMCA 1WUOA 3I15A 2OHIA 5DPXA 3A4YA 4RAWA 1DD6A 4C1DA 3ZNBA 2FHXB 2H6AA 4FSBA 5LE1A 2BG2A 3DH8A 4D1WA 4UWRB 4D02A 2YNVB 2FK6A 4NQ4A 4EY2A 1A8TA 5HIOA 5EW0A 1XTOA 3I13A 4C1FA 5FQCA 5EWAA 3DHCA 4AD9A 4P62A 4C1CA 1VJNA 4UWPB 2BMIA 4C09A 4YSBA 2ZZIA 3VQZA 4ZNBA 2R2DA 1QH3A 2BG8B 4UWSB 4WD6A 1KO3A 4YSLA 3X2ZA 2GMNA 2NZFA 1YCGA 2AZ4A 1WUPA 4O98A 3SFPA 3BC2A 4Z5ZA 1E5DA 2Q9UA 3F9OA 3DHAA 5HH4A 2I7TA 2P97A 2DOOA 1Y44A 2Y8BA 2ZO4A 2ZWRA 3BK2A 4TZEA 4D1UA 2YNTB 4RAMA 4RBSA 5EHTA 1BVTA 4U4LA 4XUKA 5KILA 3QH8A 1X8GA 5HIQA 3SW3A 4AWYB 3RKJA 4NQ5A 5AHOA 2GFKA 3LVZA 2Y8AA 2FU7A 3FCZA 4HL1A 4EFZA 4RL2A 5ACPA 3KNRA 4C1EA 2CBNA 3BK1A 1K07A 4RL0A 1DDKA 4PVOA 4ZO3A 2OHJA 5ACQA 5K4NA 5FQBA 2BG6A 3I14A 5HH5A 1P9EA 5HH6A 3IEMA 1BC2A 5EH9A 1VMEA 5B3RA 2GFJA 5IQKA 4NQ6A 4TZFA 3IELA 2FHXA 2QINA 1YCFA 5ACUA 5EV8A 4C1HA 5A0TA 1X8HA 4FR7A 4RM5A 1JJTA 3S0ZA 2YNVA 2GKLA 4TYTA 4UBQA 4NQ2A 3FAIA 3IOGA 4HKYA 3DHBA 4Z6XA 3VPEA 4J5HA 3X2YA 5ACRA 5LCAA 5LCFA 2A7MA 5K0WA 3X2XA 4TZBA 4FEKA 5LM6A 2WYLA 1HLKA 2Q42A 4Z7RA 4PVTA 1SMLA 4DILA 2BG8A 3Q6VA 3T9MA 4J5FA 4EYFA 4Z5YA 2Y87A 3T3OA 2GCUA 5EVDA 3I11A 3ZWFA 3JXPA 4UAMA 3P2UA 2NXAA 4AX1B 5A5ZA 1A7TA 1KO2A 2P18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B87 A;  2YNT A;  2QJS A;  4XWW A;  1WRA A;  3AF5 A;  5K4M A;  4XWT A;  5ACS A;  5AYA A;  3RKK A;  2BFZ B;  4GCW A;  3SBL A;  2WRS A;  1JT1 A;  2DKF A;  2E7Y A;  5FQA A;  5LCH A;  1BMC A;  4LE6 A;  2P4Z A;  5ACV A;  3AF6 A;  4EYB A;  2NZE A;  2FU6 A;  4AWZ A;  3R2U A;  5LSC A;  5LLD A;  3IE2 A;  2FU8 A;  2XR1 A;  1ZTC A;  3AJ3 A;  1L9Y A;  2BIB A;  3ESH A;  3IE1 A;  3IEK A;  2QDT A;  3MD7 A;  4Z60 A;  4AX0 B;  3RPC A;  2BFK A;  2QDS A;  4GYQ A;  3T3N A;  4KEP A;  2M5C A;  5EVK A;  1QH5 A;  4UWO B;  4EXS A;  1X8I A;  2WYM A;  2WYM C;  2NYP A;  3ADR A;  3X30 A;  3WXC A;  2VW8 A;  3BV6 A;  2I7X A;  4HL2 A;  2P1E A;  5ACX A;  3ZR9 A;  2BTN A;  2FU9 A;  4D1V A;  1ZKP A;  3G1P A;  4V0H A;  4H0D A;  2YZ3 A;  3IOF A;  2QED A;  3ZQ4 A;  3SPU A;  5EV6 A;  1M2X A;  1KR3 A;  3H3E A;  5K4K A;  3I0V A;  5LS3 A;  1VGN A;  5KIK A;  2HB9 A;  3IE0 A;  2OHH A;  5AXR A;  4C1G A;  4KEQ A;  1JJE A;  2YNU A;  2BC2 A;  4F6Z A;  1XM8 A;  3PY5 A;  4D1T A;  2BGA A;  2M5D A;  3TP9 A;  3KL7 A;  1YCH A;  2BG7 A;  5A0V A;  5AHR A;  2Q0I A;  3L6N A;  2YNW A;  1ZNB A;  3SRX A;  4BZ3 A;  3IDZ A;  1DXK A;  2BFZ A;  5EVB A;  4YSK A;  3KNS A;  5HIS A;  2XF4 A;  3SD9 A;  2BR6 A;  4BP0 A;  1WW1 A;  2ZNB A;  2AIO A;  5ACT A;  5AXO A;  5AEB A;  2I7V A;  4CHL A;  2YCB A;  2WHG A;  4F6H A;  3PG4 A;  3PY6 A;  5A87 A;  2BFL A;  4JO0 A;  4EYL A;  1MQO A;  4UA4 A;  4DIK A;  2Q0J A;  4ZEJ A;  5B1U A;  4GYU A;  4ZO2 A;  5B15 A;  2UYX A;  4EXY A;  5ACW A;  4Z67 A;  5HIP A;  4TZ9 A;  2FM6 A;  4TYF A;  5LMC A;  1WUO A;  3I15 A;  2OHI A;  5DPX A;  3A4Y A;  4RAW A;  1DD6 A;  4C1D A;  3ZNB A;  2FHX B;  2H6A A;  4FSB A;  5LE1 A;  2BG2 A;  3DH8 A;  4D1W A;  4UWR B;  4D02 A;  2YNV B;  2FK6 A;  4NQ4 A;  4EY2 A;  1A8T A;  5HIO A;  5EW0 A;  1XTO A;  3I13 A;  4C1F A;  5FQC A;  5EWA A;  3DHC A;  4AD9 A;  4P62 A;  4C1C A;  1VJN A;  4UWP B;  2BMI A;  4C09 A;  4YSB A;  2ZZI A;  3VQZ A;  4ZNB A;  2R2D A;  1QH3 A;  2BG8 B;  4UWS B;  4WD6 A;  1KO3 A;  4YSL A;  3X2Z A;  2GMN A;  2NZF A;  1YCG A;  2AZ4 A;  1WUP A;  4O98 A;  3SFP A;  3BC2 A;  4Z5Z A;  1E5D A;  2Q9U A;  3F9O A;  3DHA A;  5HH4 A;  2I7T A;  2P97 A;  2DOO A;  1Y44 A;  2Y8B A;  2ZO4 A;  2ZWR A;  3BK2 A;  4TZE A;  4D1U A;  2YNT B;  4RAM A;  4RBS A;  5EHT A;  1BVT A;  4U4L A;  4XUK A;  5KIL A;  3QH8 A;  1X8G A;  5HIQ A;  3SW3 A;  4AWY B;  3RKJ A;  4NQ5 A;  5AHO A;  2GFK A;  3LVZ A;  2Y8A A;  2FU7 A;  3FCZ A;  4HL1 A;  4EFZ A;  4RL2 A;  5ACP A;  3KNR A;  4C1E A;  2CBN A;  3BK1 A;  1K07 A;  4RL0 A;  1DDK A;  4PVO A;  4ZO3 A;  2OHJ A;  5ACQ A;  5K4N A;  5FQB A;  2BG6 A;  3I14 A;  5HH5 A;  1P9E A;  5HH6 A;  3IEM A;  1BC2 A;  5EH9 A;  1VME A;  5B3R A;  2GFJ A;  5IQK A;  4NQ6 A;  4TZF A;  3IEL A;  2FHX A;  2QIN A;  1YCF A;  5ACU A;  5EV8 A;  4C1H A;  5A0T A;  1X8H A;  4FR7 A;  4RM5 A;  1JJT A;  3S0Z A;  2YNV A;  2GKL A;  4TYT A;  4UBQ A;  4NQ2 A;  3FAI A;  3IOG A;  4HKY A;  3DHB A;  4Z6X A;  3VPE A;  4J5H A;  3X2Y A;  5ACR A;  5LCA A;  5LCF A;  2A7M A;  5K0W A;  3X2X A;  4TZB A;  4FEK A;  5LM6 A;  2WYL A;  1HLK A;  2Q42 A;  4Z7R A;  4PVT A;  1SML A;  4DIL A;  2BG8 A;  3Q6V A;  3T9M A;  4J5F A;  4EYF A;  4Z5Y A;  2Y87 A;  3T3O A;  2GCU A;  5EVD A;  3I11 A;  3ZWF A;  3JXP A;  4UAM A;  3P2U A;  2NXA A;  4AX1 B;  5A5Z A;  1A7T A;  1KO2 A;  2P18 A; 
#chains in the Genus database with same CATH topology
 4B87 A;  2YNT A;  2QJS A;  4XWW A;  1WRA A;  3AF5 A;  5K4M A;  4XWT A;  5ACS A;  5AYA A;  3RKK A;  2BFZ B;  4GCW A;  3SBL A;  2WRS A;  1JT1 A;  2DKF A;  2E7Y A;  5FQA A;  5LCH A;  1BMC A;  4LE6 A;  2P4Z A;  5ACV A;  3AF6 A;  4EYB A;  2NZE A;  2FU6 A;  4AWZ A;  3R2U A;  5LSC A;  5LLD A;  3IE2 A;  2FU8 A;  4PDX A;  2XR1 A;  1ZTC A;  3AJ3 A;  1L9Y A;  2BIB A;  3ESH A;  3IE1 A;  3IEK A;  2QDT A;  3MD7 A;  4Z60 A;  4AX0 B;  3RPC A;  2BFK A;  2QDS A;  4GYQ A;  3T3N A;  4KEP A;  2M5C A;  5EVK A;  1QH5 A;  4UWO B;  4EXS A;  4NUR A;  1X8I A;  2WYM A;  2CFU A;  2WYM C;  2NYP A;  3ADR A;  3X30 A;  3WXC A;  2VW8 A;  3BV6 A;  2I7X A;  4HL2 A;  2P1E A;  5ACX A;  3ZR9 A;  2BTN A;  2FU9 A;  4D1V A;  1ZKP A;  3G1P A;  4V0H A;  4H0D A;  2YZ3 A;  3IOF A;  2QED A;  3ZQ4 A;  3SPU A;  5EV6 A;  1M2X A;  1KR3 A;  3H3E A;  5K4K A;  3I0V A;  5LS3 A;  1VGN A;  5KIK A;  2HB9 A;  3IE0 A;  2OHH A;  5AXR A;  4C1G A;  4KEQ A;  1JJE A;  2YNU A;  2BC2 A;  4F6Z A;  1XM8 A;  3PY5 A;  4D1T A;  2BGA A;  2M5D A;  3TP9 A;  3KL7 A;  1YCH A;  2BG7 A;  5A0V A;  5AHR A;  2Q0I A;  3L6N A;  2YNW A;  2YHE A;  1ZNB A;  3SRX A;  4BZ3 A;  3IDZ A;  1DXK A;  2BFZ A;  5EVB A;  4YSK A;  2CG2 A;  3KNS A;  5HIS A;  2XF4 A;  3SD9 A;  2BR6 A;  4BP0 A;  1WW1 A;  2ZNB A;  2AIO A;  5ACT A;  4AV7 A;  5AXO A;  5AEB A;  2I7V A;  4CHL A;  2YCB A;  2WHG A;  4F6H A;  3PG4 A;  3PY6 A;  5A23 A;  5A87 A;  2BFL A;  4JO0 A;  4EYL A;  1MQO A;  4UA4 A;  4DIK A;  2Q0J A;  4ZEJ A;  5B1U A;  4GYU A;  4ZO2 A;  5B15 A;  2UYX A;  4EXY A;  5ACW A;  4Z67 A;  5HIP A;  4TZ9 A;  2FM6 A;  4TYF A;  5LMC A;  1WUO A;  3I15 A;  2OHI A;  5DPX A;  3A4Y A;  4RAW A;  1DD6 A;  4C1D A;  3ZNB A;  2FHX B;  2H6A A;  4FSB A;  5LE1 A;  2BG2 A;  3DH8 A;  4D1W A;  4UWR B;  4D02 A;  2YNV B;  2FK6 A;  4NQ4 A;  4EY2 A;  1A8T A;  5HIO A;  5EW0 A;  1XTO A;  3I13 A;  4C1F A;  5FQC A;  5EWA A;  3DHC A;  4AD9 A;  4P62 A;  4C1C A;  1VJN A;  4UWP B;  2BMI A;  4C09 A;  4YSB A;  2ZZI A;  5AJL A;  3VQZ A;  4ZNB A;  2R2D A;  1QH3 A;  2BG8 B;  4UWS B;  4WD6 A;  1KO3 A;  4YSL A;  3X2Z A;  2GMN A;  2NZF A;  1YCG A;  2AZ4 A;  1WUP A;  4O98 A;  3SFP A;  3BC2 A;  4Z5Z A;  1E5D A;  2Q9U A;  3F9O A;  3DHA A;  5HH4 A;  2I7T A;  2P97 A;  2DOO A;  1Y44 A;  2CG3 A;  2Y8B A;  2ZO4 A;  2ZWR A;  3BK2 A;  4TZE A;  4D1U A;  2YNT B;  4RAM A;  4AXH A;  4RBS A;  5EHT A;  1BVT A;  4U4L A;  4XUK A;  5KIL A;  3QH8 A;  1X8G A;  5HIQ A;  3SW3 A;  4AWY B;  3RKJ A;  4NQ5 A;  5AHO A;  2GFK A;  3LVZ A;  2Y8A A;  2FU7 A;  3FCZ A;  4HL1 A;  4EFZ A;  4RL2 A;  5ACP A;  3KNR A;  4C1E A;  2CBN A;  3BK1 A;  1K07 A;  4RL0 A;  1DDK A;  4PVO A;  4ZO3 A;  2OHJ A;  5ACQ A;  5K4N A;  5FQB A;  2BG6 A;  3I14 A;  5HH5 A;  1P9E A;  5HH6 A;  3IEM A;  2CFZ A;  1BC2 A;  5EH9 A;  1VME A;  5B3R A;  2GFJ A;  5IQK A;  4NQ6 A;  4TZF A;  3IEL A;  2FHX A;  2QIN A;  1YCF A;  5ACU A;  5EV8 A;  4C1H A;  5A0T A;  1X8H A;  4FR7 A;  4RM5 A;  1JJT A;  3S0Z A;  2YNV A;  2GKL A;  4TYT A;  4UBQ A;  4NQ2 A;  3FAI A;  3IOG A;  4HKY A;  3DHB A;  4Z6X A;  3VPE A;  4J5H A;  3X2Y A;  5ACR A;  5LCA A;  5LCF A;  2A7M A;  5K0W A;  3X2X A;  4TZB A;  4FEK A;  5LM6 A;  2WYL A;  1HLK A;  2Q42 A;  4Z7R A;  4PVT A;  1SML A;  4DIL A;  2BG8 A;  3Q6V A;  3T9M A;  4J5F A;  4EYF A;  4Z5Y A;  2Y87 A;  3T3O A;  2GCU A;  5EVD A;  3I11 A;  5AIJ A;  3ZWF A;  3JXP A;  4UAM A;  3P2U A;  2NXA A;  4AX1 B;  5A5Z A;  1A7T A;  1KO2 A;  2P18 A; 
#chains in the Genus database with same CATH homology
 4B87 A;  2YNT A;  2QJS A;  4XWW A;  1WRA A;  3AF5 A;  5K4M A;  4XWT A;  5ACS A;  5AYA A;  3RKK A;  2BFZ B;  4GCW A;  3SBL A;  2WRS A;  1JT1 A;  2DKF A;  2E7Y A;  5FQA A;  5LCH A;  1BMC A;  4LE6 A;  2P4Z A;  5ACV A;  3AF6 A;  4EYB A;  2NZE A;  2FU6 A;  4AWZ A;  3R2U A;  5LSC A;  5LLD A;  3IE2 A;  2FU8 A;  2XR1 A;  1ZTC A;  3AJ3 A;  1L9Y A;  2BIB A;  3ESH A;  3IE1 A;  3IEK A;  2QDT A;  3MD7 A;  4Z60 A;  4AX0 B;  3RPC A;  2BFK A;  2QDS A;  4GYQ A;  3T3N A;  4KEP A;  2M5C A;  5EVK A;  1QH5 A;  4UWO B;  4EXS A;  1X8I A;  2WYM A;  2WYM C;  2NYP A;  3ADR A;  3X30 A;  3WXC A;  2VW8 A;  3BV6 A;  2I7X A;  4HL2 A;  2P1E A;  5ACX A;  3ZR9 A;  2BTN A;  2FU9 A;  4D1V A;  1ZKP A;  3G1P A;  4V0H A;  4H0D A;  2YZ3 A;  3IOF A;  2QED A;  3ZQ4 A;  3SPU A;  5EV6 A;  1M2X A;  1KR3 A;  3H3E A;  5K4K A;  3I0V A;  5LS3 A;  1VGN A;  5KIK A;  2HB9 A;  3IE0 A;  2OHH A;  5AXR A;  4C1G A;  4KEQ A;  1JJE A;  2YNU A;  2BC2 A;  4F6Z A;  1XM8 A;  3PY5 A;  4D1T A;  2BGA A;  2M5D A;  3TP9 A;  3KL7 A;  1YCH A;  2BG7 A;  5A0V A;  5AHR A;  2Q0I A;  3L6N A;  2YNW A;  1ZNB A;  3SRX A;  4BZ3 A;  3IDZ A;  1DXK A;  2BFZ A;  5EVB A;  4YSK A;  3KNS A;  5HIS A;  2XF4 A;  3SD9 A;  2BR6 A;  4BP0 A;  1WW1 A;  2ZNB A;  2AIO A;  5ACT A;  5AXO A;  5AEB A;  2I7V A;  4CHL A;  2YCB A;  2WHG A;  4F6H A;  3PG4 A;  3PY6 A;  5A87 A;  2BFL A;  4JO0 A;  4EYL A;  1MQO A;  4UA4 A;  4DIK A;  2Q0J A;  4ZEJ A;  5B1U A;  4GYU A;  4ZO2 A;  5B15 A;  2UYX A;  4EXY A;  5ACW A;  4Z67 A;  5HIP A;  4TZ9 A;  2FM6 A;  4TYF A;  5LMC A;  1WUO A;  3I15 A;  2OHI A;  5DPX A;  3A4Y A;  4RAW A;  1DD6 A;  4C1D A;  3ZNB A;  2FHX B;  2H6A A;  4FSB A;  5LE1 A;  2BG2 A;  3DH8 A;  4D1W A;  4UWR B;  4D02 A;  2YNV B;  2FK6 A;  4NQ4 A;  4EY2 A;  1A8T A;  5HIO A;  5EW0 A;  1XTO A;  3I13 A;  4C1F A;  5FQC A;  5EWA A;  3DHC A;  4AD9 A;  4P62 A;  4C1C A;  1VJN A;  4UWP B;  2BMI A;  4C09 A;  4YSB A;  2ZZI A;  3VQZ A;  4ZNB A;  2R2D A;  1QH3 A;  2BG8 B;  4UWS B;  4WD6 A;  1KO3 A;  4YSL A;  3X2Z A;  2GMN A;  2NZF A;  1YCG A;  2AZ4 A;  1WUP A;  4O98 A;  3SFP A;  3BC2 A;  4Z5Z A;  1E5D A;  2Q9U A;  3F9O A;  3DHA A;  5HH4 A;  2I7T A;  2P97 A;  2DOO A;  1Y44 A;  2Y8B A;  2ZO4 A;  2ZWR A;  3BK2 A;  4TZE A;  4D1U A;  2YNT B;  4RAM A;  4RBS A;  5EHT A;  1BVT A;  4U4L A;  4XUK A;  5KIL A;  3QH8 A;  1X8G A;  5HIQ A;  3SW3 A;  4AWY B;  3RKJ A;  4NQ5 A;  5AHO A;  2GFK A;  3LVZ A;  2Y8A A;  2FU7 A;  3FCZ A;  4HL1 A;  4EFZ A;  4RL2 A;  5ACP A;  3KNR A;  4C1E A;  2CBN A;  3BK1 A;  1K07 A;  4RL0 A;  1DDK A;  4PVO A;  4ZO3 A;  2OHJ A;  5ACQ A;  5K4N A;  5FQB A;  2BG6 A;  3I14 A;  5HH5 A;  1P9E A;  5HH6 A;  3IEM A;  1BC2 A;  5EH9 A;  1VME A;  5B3R A;  2GFJ A;  5IQK A;  4NQ6 A;  4TZF A;  3IEL A;  2FHX A;  2QIN A;  1YCF A;  5ACU A;  5EV8 A;  4C1H A;  5A0T A;  1X8H A;  4FR7 A;  4RM5 A;  1JJT A;  3S0Z A;  2YNV A;  2GKL A;  4TYT A;  4UBQ A;  4NQ2 A;  3FAI A;  3IOG A;  4HKY A;  3DHB A;  4Z6X A;  3VPE A;  4J5H A;  3X2Y A;  5ACR A;  5LCA A;  5LCF A;  2A7M A;  5K0W A;  3X2X A;  4TZB A;  4FEK A;  5LM6 A;  2WYL A;  1HLK A;  2Q42 A;  4Z7R A;  4PVT A;  1SML A;  4DIL A;  2BG8 A;  3Q6V A;  3T9M A;  4J5F A;  4EYF A;  4Z5Y A;  2Y87 A;  3T3O A;  2GCU A;  5EVD A;  3I11 A;  3ZWF A;  3JXP A;  4UAM A;  3P2U A;  2NXA A;  4AX1 B;  5A5Z A;  1A7T A;  1KO2 A;  2P18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...