2XFGB

Reassembly and co-crystallization of a family 9 processive endoglucanase from separately expressed gh9 and cbm3c modules
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
172
structure length
172
Chain Sequence
GSPDPKFNGIEEVPEDEIFVEAGVNASGNNFIEIKAIVNNKSGWPARVCENLSFRYFINIEEIVNAGKSASDLQVSSSYNQGAKLSDVKHYKDNIYYVEVDLSGTKIYPGGQSAYKKEVQFRISAPEGTVFNPENDYSYQGLSAGTVVKSEYIPVYDAGVLVFGREPLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reassembly and Co-Crystallization of a Family 9 Processive Endoglucanase from its Component Parts: Structural and Functional Significance of Intermodular Linker
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/sugar binding protein
molecule keywords ENDOGLUCANASE 1
total genus 36
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2xfgB01
4C8XA 4B9FA 2XBTA 3TF4A 1TF4A 3ZU8A 1GA2A 2WO4A 2L8AA 2WOBA 1K72A 2YLKA 4B9CA 2XFGB 4B9PA 1NBCA 1JS4A 1G87A 1G43A 3ZQXA 4B97A 4TF4A 4B96A 4JO5A 2WNXA 1KFGA 3ZQWA 3ZUCA
chains in the Genus database with same CATH superfamily
2ADJB 4JQXC 3QIWC 1WBYB 2IH9A 2F8OA 4PJEA 1FSKC 4GAAA 5DHEA 3SIKA 3ZO0A 3QCTH 3V5DB 1S2EA 1PD6A 3KAAA 2JB5L 1A4KA 4LCVA 1YC8A 8FABB 4MNQD 4PJAA 4M5YH 2HP4A 4GBXC 4CDHA 5FGSA 4ZK8A 4TSAH 4UT9A 2D4FA 3H9SD 2C3XA 4P23A 1J1OL 2YN3A 3FONB 5FA4B 2NQCA 3P9LA 4XOAA 3QQ4A 3WSQL 1OSPH 4NNXA 5DJ0A 1I3RB 4G6AD 2CDGA 3WEAA 1PQZB 3FQXA 3I6KA 3BEWB 2WXMA 3IDYB 2X6CA 1T1ZB 3EFDH 1AMXA 3JWDC 3O0LA 5I0WA 3DVIA 4N86A 5C0FA 6FABL 3Q05A 3VNZA 1XGYH 1XGQB 1KCBA 3EUUA 5IIEA 1ANUA 2N0MA 3OLIA 5LBSA 1FPTH 2VDOH 3LOWA 4RRPG 3D18B 4Y5VC 3VGDA 2CMRH 3TN0D 1MLBA 1XBRA 5D1ZC 5SWSA 5J57B 3RDTB 3W9DA 4AGLA 3DOIA 3IN0A 3WAKA 3FOMA 4BD4A 1I9EA 1KIRB 1C12B 1FN4B 1UKSA 2DKUA 3O8XC 1CF8L 1CZ8H 3BWAA 1EFQA 4F91B 2YARA 3EHBB 3M1BA 1KCVL 1U21A 1YJDC 4JPVH 4R96A 2Q6WA 5D8JL 3SE9L 3SE8L 1USZA 3TX4A 3X13B 4F33A 4KK9C 1BHGA 3AUWB 2A9NH 3LN9A 2JJWA 3HC4L 2BVYA 1OAXH 2YMTA 5HYQB 1FVCA 1MZZA 3NTCL 2BS8A 4GPVA 4JX0A 5DEGB 5F2FA 2XTJB 5IB1A 1BV8A 4LP4A 1S7VB 5D1QC 1JVLA 1NGWB 3IKKA 3QCVH 4JE0A 4LSSL 1CFVH 1QTPA 3NA4A 4WGVB 3RTQA 2WUBH 1NLBH 2VDQH 3CE1A 3K2KA 5IQOA 2DYPD 3VQ1C 2NY2C 3I2CH 2ZCLH 2ADFL 4JKPL 2QMKA 2Y5TB 4GRLC 2MOQA 4XMWA 5I5MA 4M8QB 2X89D 4ZFQA 2X6BA 2ZF8A 1AH1A 2V3FA 3JWOC 4RMRA 5IG7A 5KSBB 3PWPD 5J9PA 3ET9F 2A1WL 4I0PD 4JFFB 4YDLB 2D0FA 1E3FA 4HLZG 3LZOA 3IPEA 3OKKB 1RHHB 4OIIL 4N2NA 1DVFA 3GYRA 4FYRA 4OI9A 5EZOL 2QSCH 4XMKH 2Z91A 3QXDB 2H9GA 4DKTA 4HZAA 1JD7A 5SX4H 4F27A 3W5MA 1G9EA 1ZKAA 1KT2A 1KFAL 2XG5A 1DFBL 3AQYA 3QPXL 3A4FA 4JJ5B 2E7LC 5ISZA 5FA3A 3ZTDC 3SCMD 2W38A 4KMLB 3R06B 1A3RH 5TQ0L 5D1XC 5IMLA 1HN1A 2QL1A 2Z9TA 5BUAA 4G42A 2NUTA 4OQTH 3SKJL 3CZKA 1DN0B 2W9DH 3QBTB 4UOJA 4MVBD 3R06A 4O02B 1BQKA 1OHZA 2JI1A 2AV1B 2NNFA 4JM0A 5EHFA 5F9DC 3HZMB 1AI1H 4NUJB 3UTTD 2AJ3A 5J89A 1I8IB 4YDJB 2WBJC 5D6CB 2CM5A 2VR3A 1MCFA 2BVPA 3S35H 2DJ4A 3L6FB 3N85H 2OMTA 2J1YA 4RNRB 4R2GD 2BNUB 2DMHA 2NUPB 3INUL 3CFDA 3ULVH 3VUAA 4J2QA 3VI3B 4D0DA 1HEJC 1UB6A 4JY4B 3OWEA 1XF5A 4BZ2H 1YUHA 4P05A 1LE5A 4J3OD 1KSRA 4PJBB 3JBG7 2Z31A 5HGHB 4IIZA 2GBAA 2DEYX 4FS0A 1XCQA 3IETA 5AQ0A 3GK8H 5FO8A 1KPVB 4JRFA 4TLSA 2OYPA 4P3DA 3VFUB 4HX1B 1IZJA 2MWCA 3KPLA 1BAFH 1G7HA 5DZAA 3DDGA 3SDAA 2Z34A 3L3HA 4K71C 4NC1E 3S36H 2IDTA 4CGTA 3LXAA 4MMXA 5IESH 1UXWA 3MAWA 5HGBA 2HB0A 4OVUA 5B8CA 5J1AB 2WLLB 3QNZB 1AIZA 3GDBA 3DX7A 4PV1C 2EYRA 3F05A 3V6OA 3PHQA 1OCRB 1CGSH 5DSCB 1E6OH 4FFVD 2P7TA 1GVIA 4S1DD 3QJFB 3V4UL 1W9XA 5D4JA 3K6OA 3O0RL 2D0HA 2XZAL 2DICA 3QC6X 1CR9L 4KHTH 4PJ7A 1FG2B 2Y07L 1SJVA 1OPGL 1U95B 4IOIB 3ARDD 3ZDXB 4KNSA 2E5EA 4G71B 5HPMB 4P3CH 2XWTB 4HUWA 1VZHA 4Z7VA 2VCOA 4GB9A 4F8NA 1W6WA 5KSAD 4Y4HB 3RIAF 5HYEA 2WIIA 2EICA 3W57A 1C8PA 2A73B 2EIDA 2BVOB 2NYYD 4XXCA 2G4EA 1IVLA 3QPQC 3M17B 2ITEA 2OMXA 4N2BA 5C3LD 5MENB 3BD5A 3HVDA 5DWPA 4PJ7E 1OXYA 2D3JA 4BFEA 4BSJA 4E9LA 4F7CB 1F41A 3MV7B 4M61B 3LEXB 1RP8A 2JIXB 3BEWA 3ZZSA 4XMTA 1HEZB 1I3GL 2VISB 3L4ZA 1W6LA 1GGBH 2JJSC 1ND0A 2EXTA 4PRNA 5E8DH 1AQKL 4XRCA 4WU5A 3GIVA 4XCYA 3K4ZA 2MFNA 3FAWA 1AGEB 3WIIL 3EOTH 4KC3B 5J1AA 1EHXA 3O41A 3OAUL 3QZWB 2NY4B 3JWNC 2Y0SA 4AI7A 5L2KA 2AQSA 4HC1H 1BLNA 1A7NL 2NY0B 5JQIB 4MYWB 4AH2A 4UNIA 3AY2A 4L8DA 4Z7QE 1IBZA 2A9NL 3D85B 1PZCA 4L4TB 3SQRA 3V6ZB 1CGUA 4XHJD 3WFHA 3B9AA 5CKGA 1A7QH 4HPHA 5IMKB 4EO5A 4WEBH 4JCMA 3CJJA 1E30A 4ZPVA 2R51A 3GXTA 3DV4A 3FQNA 3QDMB 5C07D 4X5XA 3RFRA 4TNFA 5D1XD 2ICWA 1QWUA 3B2VH 1E4WL 3MCLL 3VSUA 5MEQB 4HEPA 4HS3B 4PJFE 1JZHA 5CHNB 1IT9H 4P46A 1NDTA 2V2XA 5T3ZE 3WIHA 2F53A 2HLAB 3S5YA 4B53A 2OXGB 2C1PB 2I26N 4MD5B 2J4WH 5DZVA 4FLHA 4N6RB 5HI5D 2OTUA 4ODVL 3WHE0 1F56A 1MHCA 4DTGL 4TQIA 3GSRA 4NJAH 4BXVA 2CLRB 2R4SL 2VAAA 5EBMB 1Z9SA 4EUPB 1HL5A 3HR5B 4E42A 4R2GC 5A43C 2I7OA 5I30H 4U1JB 3NPSB 1J9QA 3LXUX 3HNTL 4U0RC 4YZFE 1SXCA 1JRHI 3CFDB 4RGND 1KCLA 4Y4KC 1XB8A 1IC4L 1KCRL 3ECVA 1LTXA 1NFAA 4O4YH 3NUKA 1BQLL 2W9LA 3VD7A 4W9GC 4ZS6D 3CLEH 1KJMA 3O81A 2AAVA 1ADQA 1E67A 2GQHA 3PNWB 1PPIA 3B9KB 1K8IA 4K3DH 2J88L 3I9PA 1ES0B 4IU2B 5ITFB 2BNQA 3VG0L 2QQNH 3ZRFC 4BYHA 4S1QL 5C8JA 2NXYB 2DQUL 4XXWA 1T7WA 1ECYA 4DVBA 2QJDA 4GAGL 4CILA 2DQDH 3GWJA 1VZIA 5AW2B 4PJDE 5FOBB 5CKAA 3IBEA 4F2ME 4KNQA 5LXGH 4YDMA 5LNGA 4PJ7F 4HGWB 1FA4A 1YEDB 3OKMA 3QUZC 2QVMA 2ZOKA 5JOPD 3UL4A 1ZLSL 2FT8A 3UBFA 5E94B 1L9OA 1KDIA 2I25N 2EUWA 3S34L 1NSNH 4PJFB 3ALXA 5TK4A 4K94H 1U8CB 4X4YB 3TT1H 5DXWA 4M5ZH 2XWBB 4NQQA 5FX3A 4TULH 1YNTB 3LMJH 4QLRA 1BOGB 3DTDA 2OMUA 3ZE2F 5EO1B 3VDBA 3B2UD 2MCG1 4F3FA 3MOQA 3K3QA 2X0VA 3VRJA 3MUY1 2PCFB 2WGNB 3P0YH 3WNPA 5I1JH 5E8OA 3GMQA 3QCVL 4LL1A 1U3JA 5BVPL 4IRJC 1AZUA 5L88L 1BGXH 1E43A 3L3JA 2QKIB 2FB4H 3DRQB 3OKOA 5KBDA 1HNGA 1KJ2A 1WPCA 1D5MB 1JYNA 3THML 3DOSB 4PV8A 4L3EA 1RK1B 3GSNA 4TUJA 1T3FB 1L0QA 1OE3A 2A38A 3ECBA 3L3JB 3BFQG 1LQSR 2DH2A 4YX2H 1RFDL 1SOSA 5L4IA 5LG6A 2X6AA 4PLKD 5DHYA 5C92A 3B4NA 4QRRA 2XZAH 1MPAL 4Y1AD 3S88L 3VXMD 5IJBC 3QULA 2H2PD 1L6PA 3MRBA 1S9WA 4LHUA 4LIQL 1G7MB 3WHE1 2P5EA 2NLJA 2VN6A 4NQCD 4CADA 5BJTB 4JG0H 1BBJA 1UWGL 5LGYA 5SWZD 3V0WH 4RQQA 5CCKH 2TAAA 2YWZA 2GI0A 2JK5A 4W81A 5F9OH 2ARWA 2DLIA 2V5RA 5KYWA 1JXGA 3TCXA 4GUQA 4KZDL 3AG4B 1PJWA 2O5NA 2YC1B 1SVCP 3TN0B 4J6IA 1NIBA 2YD7A 4G6MH 2YPLD 2Z0UA 3EG9A 4DFHA 3H3KA 2E9BA 3IWVA 3SPCA 3WIHL 5CBAA 4R90L 5CJBA 4A7QA 2HRPL 1SVBA 4ETQA 4TNVK 3C6LB 5T3XL 3HR6A 1PFOA 2VKWA 3GIVB 1CL7L 1ND0B 1Y07A 5DVKA 3KJ6L 4TMPA 1QFWL 4DP9X 1OF2B 4ABWA 5KUMA 3BWAB 5HI5C 1IO4C 4NM4L 3X3FH 1FNEB 1QFOA 5GS1B 3KPRE 1ORQB 3MVSA 3AABA 5DQDH 3T6QC 2AKRA 2X1PA 3UPAA 4A6YA 1IARB 4OM0H 4L0ZA 3VB8A 5FKAB 3GSWB 1C16A 4UV4H 1X6LA 4UTCA 1GGCH 2JXMB 1JCKA 3F12B 4NJAL 1YNKH 4LP8A 3FU6A 4FYTA 3WKYA 3R1GL 1Z9OA 1OP5K 2J6EH 4AITA 1RUAH 3V10A 2D0GA 3PWJB 2NY3B 4HISA 5DRZA 4PPTA 3HPJA 3QNYA 1B9ZA 3DARA 3ULUD 2XXCB 1EBAA 2R0LL 3B2DC 5C08D 4JFXA 1KGIA 1HI6A 4KJWC 4U7SA 2X3BA 5D96C 1HHHB 3AM8C 3JSSA 3FH5A 3BZFB 3LQAL 4OZIB 2H8PB 3S5ZA 2J55A 1EA9C 4WKZB 3ATDA 2JKSA 3KWTA 1A22B 1CLZL 3IJ8A 2C1PA 2WCPA 4G6KL 4G72B 3L6FA 3QQNA 3VX0A 3TS8A 5GSVB 3CXHK 3QUZD 1KNOA 4P5MA 1UH3A 1H8LA 2V7NA 3MRDB 2CNZA 3BPNC 3N0AA 3P4NA 4UM8B 4V2CB 4IRSB 3BRDA 3SCMB 4HWBA 5ITBL 1JD9A 2AJXH 4OSUL 2WWNA 4HBCH 3X12B 1FAKT 4FXGC 1X5ZA 1MFBH 3FQUB 4OCYH 4PBXA 3RX5A 1S5HB 2XICA 4DVRH 3QDGA 5DWUL 3VD9A 4LFHG 3VMPA 3LRGA 4NC0B 4X9GA 5ECJE 5CN2A 1MIML 3DSFL 4M5ZL 4WNSA 5FCUL 2DL2A 3VXNB 1JYWA 3DX3A 3ZQWA 3G9AB 3DX9A 3ZT6A 1N0LB 2FYVA 4PJ8A 4X9FA 5IHZB 5J4MA 4FQJL 2BRRL 1T04A 2VDMH 3L4VA 5I5RA 3HG1D 1ED3B 4NFBA 4WU7A 3W82A 3MNDA 1QSFA 2GSGB 3WTSA 5IQLA 4TLTA 3J7HA 2ZUTA 4U2ZA 5KBNC 2DJUA 2G3ZA 3CFBB 4B9GA 5BRZE 3KPOB 3D9AH 3FTGA 4RDQG 5HYSB 4GXUM 1S7TA 2DLHA 3BZ4A 3K80A 5E08L 4AJVA 2XLLA 1DANU 1L9RA 1RIHL 4L1BA 4OT1L 1DUZA 3D0LB 2WVVA 5DD3H 3SKOB 1UD4A 2A73A 2DF3A 4KJQC 3NZHH 2ZD0A 2QTEA 1K6QL 3X1GA 4GQZA 2X05A 4XN9A 2VLKA 1R24A 2EDYA 1MCIA 3FCSA 1U8OA 2X6UA 5A2LH 3ARXA 4QTFA 5DA4A 3T5WA 5IB2A 4D7BA 3H56A 4Q56A 4HAGA 2WANA 2FH6A 2D31A 4PB9H 4LCUB 4XBPA 5I18H 2AQPA 2CD0A 4RZKA 5H35A 3GJFK 5D7IE 2O1AA 3DTUB 4BZYA 1AHMA 5AEAA 3BPLB 3L5JA 3KL3A 1HSAA 2LABA 4KZEH 4AVIA 3O3UN 3QZBA 4J3TA 4U4IA 4AUJA 2XG4A 2ITDB 4IHBA 2XN2A 1RIVL 3K5SA 1QLRB 1ZV2A 3FUFA 3KH3A 4C55A 3FNKA 1NDGB 2NZ1A 2Q3AA 4U1NA 3OKYA 5JPNC 4NI3A 2APWA 4C59B 2VDLB 4MJ6A 2F2HA 3U0TB 3FN0H 2E46A 1THCA 3KPRA 1HNFA 3TZVC 5CJ5A 4KUZL 1HOCB 4Y19E 3QEGH 5SV3A 1YJDH 2WLMA 3BUYA 4IIQB 4LF3A 5C0CB 1D9KB 4H2CA 4JO1L 3VFGL 2O4EA 1CDGA 3DX6B 5FYKD 5JIIA 3RIAK 5BV7C 3P30H 2GTWA 4G82A 1DQJB 5C1MB 3HS0A 4QHMB 2UX7A 3DMMA 3GXDA 3APFA 4JE4B 3RWEA 4DP5X 4Z7IA 5DZNA 1OTSD 1N7MH 4MASA 3NA9H 3CSTA 5ICZA 3LSOA 3NSXA 1WE5A 1R0AH 3OKLB 1FGVH 3QZNA 4U1MA 4IM8A 3TO4C 2GFBA 1N5YH 2IF7A 3US9A 2XV6B 1R3KA 4KPHL 1CLOH 4D2NA 3OAUH 4JFWA 3SJVE 1JV5A 1XIWC 2D7NA 3E38A 2OL3L 3C6LA 5I1DA 4U1MB 1W91A 3QDAA 2JB6A 1KJ2H 3VXOA 3ZKND 1ZT7B 4RA3A 2W0PA 5GGQH 2NW3B 2W5PA 1F1AA 2IDFA 5JYMA 1XX9C 1BQHB 3A67H 1WAAA 3E0GA 4EVNA 1D5ZB 4M5YL 1SY6H 1B2WL 4S0SD 4C58B 1RV6X 5FC9A 4GG8B 1JHKL 4PTUB 2HG5B 4FHJA 1EGJH 1BCIA 1RZPA 2IPUG 5LGHH 1OTTD 4BUQA 4AKOA 1TU2B 2BDNL 3I75A 3N2JA 4QHLA 2HJKB 3ZDYB 2WMPB 5L7XL 2J8UE 4GFXA 4P2OA 3AREA 4NQXA 4YFEA 2C9AA 3GMPA 5F9WB 4OUUA 1J05A 2LLNA 4GP4B 3ULUE 4JRYD 5EWIL 3PAVA 2IDUA 3VXPA 2KQMA 1EAJA 4I9XA 4MMZC 3M88A 3A22A 1E4KC 3R8BB 2JI3A 4CL7A 3MOBL 2DOCA 5I19H 3PS6A 5B3NA 1T7YA 4PJ8B 3WJLA 1TQBB 4MNGB 3Q0HA 2VIRA 1L9PA 1VERA 3TASA 5IBLD 1ZT1A 3ARBD 1GC1H 3PQYA 4LSQL 3BDBA 4NQED 5DD0L 3CBKB 2FEJA 1MDAA 1NINA 4OIAA 5F0PB 1NBZA 3C60C 3GS0A 1ACYH 1IEHA 3NDZE 5K39B 5D4QA 1OOAA 3V6OC 2E76C 5KS9E 1UWYA 5JZ7D 2YLHA 4NGHH 2HUEA 1QSVA 4S1QH 2RQ8A 4X6DB 4YHNA 3MUZ1 4ZTOH 5D2LB 3IXTA 4YHOL 2AABH 1BPLB 1AIFB 3LVEA 4Q8BA 3HBGA 5EU6B 3SGKA 3ZTJH 4AK2A 4J4PC 3VXNA 2YAMA 3KR3L 4NXKA 2VB5A 3KBFA 4Q0XL 2FBRA 3MCKB 1J0IA 3HIZA 5FM5M 3E6FA 3E2HB 3KYNB 5GGVL 4N3TA 4EI5C 5JW4M 5IBUB 3NJMA 5I74C 2PTTB 3IU3A 4F7TA 3NMEA 4M7KL 2MQGA 4NPYB 1HHGA 5JPMB 5LQBL 4MAYC 1WFTA 5FEBA 2NR6C 1TTRA 2YXMA 1WAPA 1NCAH 1L0XA 1TSRA 1KV3A 2EXYC 2IH8A 3SEPA 1BIIB 5F44A 3T0AA 1NLDL 2XWBA 3WXWL 5F89A 1BZQK 3S97C 1ID2A 4LQ1A 4CRPA 1KGCD 4OFPA 3T2NL 2WXGA 2NTFB 1XGRB 3LTVA 2Y7QA 3B7RL 1LD9A 4Z76B 4U1IA 4PLNC 4LPCA 3L5XL 1XWVA 2A2QT 4CMMA 4FTDA 3ATAA 1PVHA 2F7OA 3IJYA 2E86A 4OLWH 1SPDA 2X70B 3BN9D 4M62H 5A2FA 4X6CF 1I3UA 4DKDC 1MCPL 5I1LA 4UZSA 4Y9BA 1QVOA 4HOZA 3MV9B 3QG7L 4MDJA 4V11A 4I1NB 4NWTH 3QXVA 3MLVH 1J8KA 1N8ZB 4K3DL 4DP4X 3FQTA 4IBQA 3U83A 5I0DA 1GOHA 3GBNH 4QI3A 4A1RA 4HV8B 3LB6C 1T7VA 1BD2E 3KYMB 3TA3A 4MNQB 4WI6A 1CLYH 3FHQA 4U3SB 2J20A 5CU5A 4A6YB 1VRSA 1ZHKA 2W91A 5I17A 3TTYA 2ENJA 4MQTB 2E8YA 4I88A 4LCYA 4FQ1H 4N2CA 4PBVC 1J12A 1NMCC 1BP3B 3QDJE 1P6WA 3U2SB 4RFOH 1PIFA 4QHKI 4JFHD 1A64A 5IR1B 1H6FA 1LHZA 1GH7A 2VKXA 3ARUA 5EDSA 4BSVA 3MNVB 1IAOB 1D5RA 1AQMA 3SGJC 1UA7A 5EZPA 4YN3A 1A14L 4O51B 3I85A 1A1NA 5B3JF 2RIKA 3KLLA 1DLHA 1MIEH 2BRQA 1LE9A 4U49A 4LASL 4AEHL 5JIMA 5CGBA 3KLHC 2XKUA 4Y4KA 2ADYA 2AK4A 2B1HL 2CCLA 1DCLA 3QIUD 2BIPA 3VYPA 4X5XB 1WQVT 4GIPD 1DBBL 3SDCB 1YEEH 4WEBL 1JG9A 2MIZA 1PZUB 3DGDA 1AMYA 1LK2B 3JV4B 3KYOB 1NEPA 4E42B 3EG9B 1I7ZB 2M8XA 4F92B 3ARBC 3OPZL 4KGLA 5EC1A 1ZTXH 1UEMA 4JPWH 3FDWA 5I26A 5GGQL 5IHLB 2YK1L 4FG4A 1PNDA 4CC4C 1RZ8B 3E80A 4EPSA 1NGQL 2GJ6E 4YGAB 5CFHA 1D6EB 4BCYA 1QNZL 1SOKA 4FX5A 1LK3L 4Y9FA 2FEDD 2NY5H 3HE6C 1V3KA 3NJVA 4H1LB 3L1OL 4HJJH 2CUMA 2FNWA 1FNAA 4WY7L 1FWXA 5E6ID 3GSOA 3U7WL 3DIFB 2APVA 1C5DA 1RURL 3C08H 3FSZA 1WUNT 2VQUA 3D0AA 3VFRB 3OC5A 3KCPA 5E4OA 3C09B 1FH5L 4TSAL 4HJSA 4KI5F 2EH8L 5AVXB 1BVZA 2MJWA 4LCWA 1F4YL 4QRTA 1LQBC 1J9CT 3UERA 4J4PD 4C57C 2XV0A 4PRHD 3GRWH 4ONGH 1OP3H 1J0YA 4AQOA 2DEWX 3RBSA 3OR6B 3FL7A 1F3DH 2CNYA 4PRAB 3K71B 4EI5D 4DN3L 2NCEA 1ES0A 4IU2A 4H8HA 4IGBD 3FUIA 1IC5L 2NR6D 2VMEA 3NP3A 1WK0A 1YN7B 1QR4A 3EJQA 4XBGB 5EOTA 1CL7I 3C5ZA 1QZNA 2IAMC 4PVMA 4ODUA 1NFDE 5C2BH 1A4JB 4K7PX 3QQ9C 4JDTH 4QO1B 4KQ4L 4G8GB 4RESB 4X8XA 2PCFA 3NZHL 2Z31B 2PXYA 4Y2DA 2YR3A 5DO8A 2GEEA 4P4KD 2ITFA 3CH1B 2ZCKL 3HN5A 4ZXBB 5E03A 4R5VA 3O6KH 3X3GH 2CGRL 4G2AA 4Z7WB 4LLQA 3QUMA 4KXZH 3R1GH 5F8QC 1BVKA 3ZZLA 5BV7H 5DUJA 2GAZA 4KZ0A 3F84A 3I3EA 1UXSA 2J25A 4WTWA 1ZTXL 4OLWL 4EJ1C 5FS5A 3NZSA 1XDTT 5HDBB 3ML9A 1LYQA 1X44A 2FD6L 4O5LH 5LAXB 3MNWA 3P0YL 5I1JL 4PJIA 1KELL 2HJFB 1G7MA 2R15A 3S3JA 2YGPA 4AIZB 1QG3A 4LOUD 3H54A 1YUHB 1LE5B 5F0JB 2UXVA 3B6SB 1Z3GL 2BWQA 4HKJA 4M56A 4ZYKB 3BIKB 4S0TD 1LLAA 1S7XB 3NFPB 4JUTA 2YD8A 1GMIA 5CF3A 5KN5B 1LEIB 2E6PA 3GXFA 4NZTL 5D2NB 2DLEA 3MRNA 4NENB 2BP0B 4OGXL 2AJSL 3JWNE 4OLXL 4GT7A 4Y1AE 5FYLL 3TCLA 4GFTB 4JZOA 1NIDA 1JNJA 1WP6A 4KVCH 3NIFF 3QW9A 3JWOL 2Z7YA 4QCIB 4UYPA 1QA9A 1BFSA 3AG3B 4BZ1A 4KKBC 5EEZA 4UNVA 3G04A 3IJSA 3V0WL 4JW3A 5CILL 5IJCC 2WIMA 2AGJL 1FFPA 3QFJA 2WCGA 3GSQB 3RY5A 1R6VA 4O2EB 4FQQB 3VXRD 2PYEA 3NIGF 1KYFA 4H8WL 5F7UA 4H0HB 3DJTA 1RIUL 4NRZB 3MV7E 2OULB 1G9ML 1WFNA 4KITB 4NZ8A 1EFXB 2Z7UA 3QORA 4RGMC 4LSTL 4HOMA 1SOQA 4F15C 3O41B 1A9VA 3EGXA 4JPQA 4YLBA 5DD0H 2KDGA 4UNUA 2FEDC 5DHYB 1NEZA 1RUKL 3HLKA 4J3UA 3MRQA 3WHXB 3AG1B 4NLHA 2XIDA 3LHAA 4UDUA 4IRJB 3WTUA 5E6IC 3VQMA 3QIWA 1D5IH 3MLYL 1F58L 4FULA 4UT9H 2CUAA 2NXZD 1KGYE 3MRNB 4NENA 4XE5B 4JFSA 4NP4H 5EEVA 1T21A 1N18A 1Q8MA 1AFVH 4PWFA 3NAAL 4UU9B 4DETA 2B7DT 4M8QA 3RWFB 5DZLA 5C0IA 1N0XH 4IMLA 4FQLH 4OIBA 3VXUA 5CJXA 2VXQH 3GLAA 4QEGA 4JGMA 2XN9E 4U0RB 1ZDSA 4PY7A 1T1YA 3LH2H 4G6AC 1J87A 1KELH 4M3KB 5KBMA 1OCOB 5I1EH 4HLZH 2IFGA 3Q3GA 2CO6B 4HXAL 1J1XH 3HHSA 4JVWA 3QYNA 1BXUA 5ANMB 4U4BA 1WO2A 4B9IA 2VDKB 1NMBH 3VXUE 4ZFOB 2ROYA 3IRZA 3MA9H 2R29A 1Q9OB 4YHMH 4GP5B 4R83A 4X4ZA 3QQ9D 4X0KA 4IGBB 3TN0C 4ENZA 5AG8A 2R2BA 4OBRA 3FOMB 3TLRA 2VSMB 2JKWA 1UACH 3FFCD 4ELDA 2YXFA 3FQWA 5IY5B 1ZVHA 1UHVA 3QUZB 3O3BA 1BX2A 5DJCA 1T03L 4Y2DB 1JWMB 4FFWC 4AEIH 3LEVH 3SDDD 3P9MA 4A2DA 2BVQA 1ET5A 2ZG2A 3DJZA 2V0AA 4QAMB 4AQZA 3M7OA 3EGSA 4Z5RB 2WVUA 1X5XA 2BNQB 3CC1A 2WLLA 3QNZA 2A9BA 3LKSB 3OR6A 4EUPH 3P9MB 3B34A 4YL4A 1UXSB 1JYVA 1B0RB 5J11B 1AD0B 1AO7A 4H8VA 4Y16B 2AQ1A 4JFDD 4H5SA 3VFOB 3DIDA 5D7SH 3ILEA 1GCFA 1KG0B 1Y7VA 3F7PC 1P6AB 2Y7QB 4YDIL 4RZCB 2Q87A 1NFDA 1HKFA 4WW2F 4WEEA 4UNTA 2HFFB 2EUVA 1AYRA 2OR9H 1J11A 1QSED 4B27A 3ZDYE 4F37K 4LKXA 8CGTA 3MJ9A 4P3DB 4TULL 1SMOA 2RJMA 4OZGE 1WWCA 5AW4B 5DD6A 3GLDA 2OI9B 3KYKH 1HQRB 3VXRE 1DP0A 1I4FB 4HC1L 3WMSA 4DZBA 4KK8D 4JPSA 2GT9A 2GHWB 2X0WA 2QT6A 4MJIE 4X7DC 5B1BB 3P0VH 1A7QL 1AYOA 1IAIM 3QA3A 3SKOA 2Y3AA 3FMGL 5TDOB 2ILLA 2RALA 4RMTA 1KGJA 1RZIB 1ZAGA 4AYEC 3CVCA 1NAMA 5I1KH 2VLLB 4YSAA 4N5UA 4BH7A 5BQ7B 4IRSC 3SCMC 3IDNB 1BD2D 1PZSA 4NBYB 2ZAIA 3QUYC 3ME0B 2IALB 2O61B 1N64L 5AAMC 3WGVB 1T89A 4F9PC 1CFNA 2VL4A 2N7AA 3N40P 5IJKA 3B9DA 4KKPA 4EUPG 2G30A 1RFDH 5C0JB 3MA9L 2Y2WA 1GZPA 1NBVH 1ILSA 1DVZA 1KTLA 1MFUA 5DGQA 4TNEA 3OPZH 5KVGL 3DYPA 3AUVA 4X50A 4PMFA 3QI9D 2IDQA 1J7VR 5IOPB 2IANA 3BVWA 3NABH 4TTGA 1HE7A 2NPLX 3FTYA 4XBMA 5DMKA 3CTTA 5AALA 4I1RA 3T1FA 1OL0A 1BYNA 2VN5A 4M4PA 3QG6B 4JCLA 5FO2A 3FRPA 1J9RA 5T1LA 3EAKA 1LEGB 2FVNA 3I02A 3DGGA 5HVGB 4E5XB 3S9DB 2WPGA 1MRCL 3MLUH 2VT0A 1ONQB 1VGEL 4QNPE 3LZQA 1PZ5B 3HEIB 3DIVA 5GS0D 1UWXH 2EIZB 3GZQA 2WZ6A 2BHYA 4MSWB 4ZNCD 4NP4L 3M17A 3IGAB 1HH9B 4HUXA 1EK3A 5EG6C 2B4CC 4M1CD 1PSKL 5C09A 1SEBA 2B59B 3D06A 1FGVL 1NCJA 1KXTB 4FFYH 3RZCA 1DCEA 1TTFA 1SZNA 3X1BA 4FI8A 1G9NH 3PGDA 3LRHA 1JMXA 3D3VD 4NQDB 5FECA 25C8L 4EN3B 4Y4FA 1K6QH 2PP7A 3W37A 3T0EE 1TTCA 3M1BB 3PDDA 1ASPA 3JXAA 3L08A 3LJ3A 4XN7A 3ZHFA 1YQVH 1RLWA 2ICWB 2ORBL 1YEKH 3FB6B 5IVXF 1BREA 2BOLA 1MFDH 2B20A 4AGNA 1PDKB 3ARDC 5FIEA 4OFYD 3UTZB 1M05B 5I1GL 3LS4L 5BRPA 4V1DD 2F58L 1K9TA 3SDXF 1WC7A 4K7PY 4ZS7L 2YA0A 4DOHB 1HHKB 3PV6B 3VXUB 3SZKC 3POHA 5FW8A 4A7GF 3MBED 4JZJA 2XVBA 1J8RA 1ECZA 1W72A 4YH6A 1X9UA 4IMKC 3IJEA 2C9QA 4J3OH 2PTVA 5FDWB 5LAPA 5SWSE 3BUBA 3QS3A 3G5YB 1U0QA 5FUOL 2W8CA 4Z7QB 5JQHC 4QO1A 4AV5A 3TJEH 2CO7A 5D1QB 5AOIA 5D4IA 1QRND 1EXUB 2J8OA 3IF1A 3F7YA 5DZPA 2HTLC 4QY8A 4XNXH 4LU5H 4BKTC 1NANH 5EU6A 1JHTB 3ATFA 4PRHB 4A39A 3Q8BA 4H20L 3US0A 4Z3TA 4GIOA 2K7PA 3CVBA 2KPNA 3EO0A 3ILQD 1FH2A 4DCQB 1TQVA 3JUZA 3TC9A 1D7BA 1NFKA 2XX0A 3IMUA 1F42A 4L37B 3FBQA 2X3CA 4L8SA 4PRAA 3G6DH 1TYRA 4FMFA 2J5LC 4Q6IB 3PL6B 3KZ8A 2QVIA 4IHOB 2BNRE 3JVGC 3VXPB 2ALAA 4IRSD 4YUEH 4L4VD 1ED3A 1IQWL 2J21A 4OD3H 1CN4A 1U91B 5CN3A 5MENE 2K0RA 1HL9A 4PJHE 1JVKA 4PJCA 4YBQD 4XODA 4ETYA 4XP6L 1G9MC 2QPDB 1R3HA 1X5FA 3LH9A 4B5EA 4HKZB 4XB8A 1Z9MA 4U6TA 3ISRA 5IT2L 5CEXA 2P8MB 3K6IA 3TA3C 5KJ7E 5DFAA 1PKQE 2HN7B 3F7VA 4PUBL 4UDTB 1AAJA 4YHYC 4LDCA 4OJDH 5C0ND 1GGBL 4Z3EA 2RFXA 4MQ7A 1N5AA 5AW3B 3UFIA 4OJEH 1E28A 2FO4B 2WLIB 3HNSH 4XH2B 5DVLA 4ACTA 1M1XA 1MFMA 4BZ2A 4BFFA 4G1MA 3V9EA 1UA3A 3G5VB 5K9JL 2LU7A 3OKEB 1TJHL 4ALAL 2H47C 5DO2D 3T09A 2G3MA 4BUGA 3FF7A 1FIGH 4B9FA 4GKNB 4U31A 3OPUA 3RPKA 3ZTEA 2EEBA 4R0LA 1JZDC 1NMAH 3BXNB 2Q3ZA 3LQAH 4HW6A 2A83B 5EZJB 1G6RB 5MEND 2FHFA 3EJZC 1UYWL 2YD3A 1OW0C 3FTXA 4JFOA 1TQWA 2CLVB 4NYLA 5DI8A 1UD8A 4OTXH 2F5BL 3VSVA 4N25A 2R1XA 4G6FB 1BFTA 3P77A 2HKAA 12E8H 4G8IA 2AI0L 5EIQA 2F18A 3QQXA 3WFEL 1SEQH 4B9JA 4ZW3A 3NYKA 3QRLA 1PLAA 3T0WA 1MI5B 1NC2A 3PJNA 5GGSB 5ICXB 3TOPA 3MLTA 1O6VA 4XVJL 5HYFA 3FSWA 4DGUA 3DUSA 5I66B 5DT1H 2ZXDA 3T3MB 3TFKD 3FUKA 3FQ2A 5IIEB 2A4ZA 5B22A 3E8UL 4X83A 2FO4A 3CX5K 1G9NC 5INDB 1FBIL 4F8QA 3BUPA 3IDGB 4E9RA 1RZKH 3H3PL 1OSZA 1TETH 2ZWSA 3TPKA 1PZAA 1HH9A 2H5UA 1A14H 2VERA 5JHDA 1QLRA 5JNYB 2EDRA 5DHVA 1S7RB 3U7YH 1YJDL 5ANHA 5C07B 1VENA 1G0XA 1RJZA 2LT9A 4KI1A 1JMZA 1O75A 4E41D 1QFPA 3LNEA 2Y06H 3CLEL 3PREA 1TVHB 2BIOA 1QATA 4Q97A 5JORB 2CK0L 2ZYSA 4I8DA 2W1NA 1TLKA 1FL6A 4DJMA 5F7MC 1XZWA 5IESL 1FNEA 4JKPH 4EKXA 5GS1A 3O45B 1TPXC 3V7MA 3ABKB 3T1WA 1N9PA 3CDYA 3UGXA 3BT2L 4X8GA 3R18A 1QD0A 4TRPL 2FJSA 1R46A 1X5HA 3QG7H 3W0WD 1ZLSH 1DTUA 4M9PA 1TTUA 1IM9B 1MXDA 4ZFGH 1JPFA 2NY4C 1K2DB 3KDMB 5C09E 5T1KB 4K3GA 2WXNA 4HJGA 2XV3A 3SD2A 2RB8A 1A7OL 2AP2A 1CURA 2C1OA 4JFZL 1OAJA 3VXQA 2BSRA 4ETQB 2JFCA 4FRWA 2X12A 4GUPA 3V6FB 2FGWL 2AQRA 3BP5B 5JNYA 1H3WM 1A9BA 3N43B 1EXUA 4FG2A 1KXQE 2YEZA 4JM2F 2ZAHA 4N0CC 5JPMC 2B16A 1KBBA 4FERA 4E5XG 2JKLA 4N85A 4H44C 1WZAA 1WHOA 3KGSA 1X4ZA 5A2KH 1PYWB 2E4TA 5HHNB 3D4CA 1IJNA 3UTQA 5A16B 3BVNB 5ESVB 3S34H 1MAMH 3GMNB 3AT8A 3NRFA 1DJYA 4PCTA 2J7LA 2WBJA 3CSFA 4JRXE 1PNCA 5D72H 3REWA 4YMPA 3ULVF 5FW7A 2XCMC 1TFHA 1L6XA 2VGLM 2PR4L 1NFIA 4MGXA 4BDVA 5E2WL 1L3NA 3VACA 2ERJC 3D08A 4QXTA 5HHOA 1JZ6A 4GG6A 2RD0A 1NCUA 4AXWA 1B88A 4IHOA 1UFUA 2YQBA 3E6HA 1B4LA 4YDIH 4G11A 5JHMA 2CKBL 3NEOA 2GYSA 4IKLA 4L4VE 5DEFA 2IQAA 5L8KB 1DYZA 1BJ1J 2PPAA 5HHOB 2QKIA 3CWGA 3B2MA 4KWUA 1OP4A 2VRKA 3RIKA 1YA5A 4AIOA 2O26U 1SJHA 5F6IC 4Y9EA 2H3NB 2NTFA 1D2PA 3NCXA 5CMAA 3TV3L 2WVSA 2GTWB 3FYEB 3HPLA 3DV6A 1HQRA 4MKTA 3OMZA 3CSBA 4OZGA 1QHOA 3QDJA 1KIQA 1G5GA 4DNLA 4PJ9A 3ZDWA 5FF6A 3GJEB 1M6UA 3ZL1A 4MQ7B 5J7CC 1DJZA 5DMJB 1LP9E 5FM8A 2W0FA 2FLBT 4OR1A 5B38B 2X4OA 1N64H 4B60A 2HKFH 1DQQB 1KPRA 4XB7A 1NMCB 3X11B 4R84A 4FFZL 1P84J 5DQDL 4NOFA 3RIFK 2ITDA 3GMLA 1HAWA 3VGHA 1OLLA 3ETTA 3FCSB 4LCCB 4OB5L 5IQNA 2J8UF 4PJHA 5EA0L 1IKNA 2DM2A 1WDAA 3OKDB 2XVGA 3GKZA 3KPMB 4G7YH 2Z31C 3H9SA 4FNPA 4P23D 1OSPL 4B50A 4Z7NF 5I73C 2X4SA 1URIA 3MZGB 1TQSA 3TNMB 3QARA 5FKPA 3ZY7A 1OGTB 4N2MA 2ISDA 5JYLA 2OZ4L 5D5MF 1BWWA 1NCTA 1RMFL 4PJCF 4NN7C 1JERA 4ZMWA 4Y89A 1JTPA 2MH4A 3TBVB 2IH3A 2FIKB 3SDCC 5J6HA 3KVQA 5E95B 5F8RC 4JKKA 2W0KA 4WI2A 4BBWA 4B7IA 2VXSL 1AE6L 3FT1A 1MHPL 2CGRH 3VSQA 2HKHH 3HJ0A 2AJYL 2IMNA 4I18B 4RETB 4RQQB 4G9DB 5CJOL 2AZAA 4YSUA 4YSRA 4XN1A 4PBWD 2RCSH 4JGJA 1GZQA 3TN0A 2CO1A 2LU5A 3QJZA 4ZTPH 4RFNB 1GYCA 3BJLA 2GTZA 1T7XA 1KYAA 1TZIA 3V0VB 3U79A 1S9XA 5JHDE 3VI4B 1JP5A 4YHIA 3RWJB 2XRAL 2EDQA 2DLFL 1KLFA 2WJ7A 5HDQH 2WXIA 3MV8D 3NCFB 4F1ZA 3SGDI 1FI8C 4K9EL 1NGPL 2BVTA 1V7MH 2XWZA 5INCA 2VLKE 2R39A 4AUYA 1G84A 2CDFA 4G6JH 5D7JD 4MA3B 5AW7B 5SWQA 3S96A 4OUOA 2CCVA 2CK0H 2OR8A 2P28B 5A2BA 2CR6A 5TH2A 4N0CD 5F0LB 2YKLH 4U7MA 3VDAA 2JVUA 1BQHA 1KCKA 3SPJA 2QPFA 3GQFA 4I5BA 4GEIA 2VSDA 2JJSA 4Z5RA 1OPGH 1KENL 4LRIC 3DO3A 3JTTA 3TT1L 3CDZA 1JHKH 2V5SA 4FAAB 4N90D 4UOW0 3I9IA 3ZLQC 5CIPA 4I0PA 3NCWA 3GRWL 3IAPA 5FWQA 2FATH 1L7IL 4QOKE 2EXSA 5LGJA 1DVFD 2I60H 3VGBA 3T3PB 3CZSA 4FA8A 4WKZA 1OTSC 3UC0H 1MCPH 3KYAA 1Z9NA 1LP9B 1VGEH 4NUPA 4Z23A 2VR9A 3SDDB 4ZW8A 5IJVB 3BKJL 4XNZC 4ATTA 2D2OA 1P2CA 3B8SA 3D09A 1OAYL 1T0NB 5HGDA 2VZTA 3QWNA 3L9RB 3F7YB 1D3CA 2DWYA 2P80D 3HUJE 1AXSA 1M4KA 5DYOB 2W0LA 4PRIA 3F65A 2PWDA 3LD8C 3CZUB 2JB6B 3VXOB 3SCMA 4HHWA 3MYZA 2QKIC 3GI9H 1IGTB 4QTIL 2LU4A 3EJCA 4IDLA 12E8L 3GZKA 3MKGA 4ZFOA 4HJEA 4Z7NE 1KJMB 4JN1L 1KEMH 4RZCA 2DQDL 4ZFOL 3N42F 1FNLA 1I9IH 2A6JA 4M1DH 4D9RD 3CZFA 4S2SA 4GKOA 4P5SA 4KO6A 3UZQB 4L4VB 3QUHA 1F8TH 4NX0A 3MTXA 4EMZA 3WMPA 3KLAB 5DQJA 4ZFFB 5K9QI 5AAPA 2G9KA 2KZ1B 2JKIS 4LASH 2B08A 1NCHA 4JM2D 1U8HB 2CO3A 4ZPTA 3CVHH 2DPKA 5IK3A 2ZXBA 2ADJA 3JTSA 3WXVH 3RL1B 3AREC 5CINL 3U36A 2Z31D 2PKDA 4P23C 5EH1A 2OZ4A 5F88A 4G6JL 1N10A 3FRUB 1HFUA 4L29B 3KH4A 4TV3A 5KYYB 1AXTL 1F1GA 2F1BA 2ODIA 1BEXA 1MCQA 1YEGH 5IW1A 3ZHDA 5IKCA 3BAKA 2EDMA 4GRWB 5C97A 3D4ZA 5FO7B 1ODUA 1HILB 3ARPA 2ZG3A 5E9DA 5DTFB 4GRMA 4MRCA 5IZ7A 4UTBH 4XNUH 3DKHA 3DRTA 5CJ8A 2DMBA 5AOZA 3HKFA 3N55A 1TQUA 5LWYL 2WZAA 4XP9L 1JV2B 4AYSA 4XRCB 5FYKU 4WY7H 3U7WH 1PU0A 4WKXA 2ICEA 3LKPA 1MQKL 1E65A 3ARFC 4DN4H 3BDYH 5I1CH 4IDJL 4G7RB 1GHFL 3HC2A 5CAYB 3ULAB 4Y4HD 3SPGA 4M62L 4ZMZA 1YG9A 5IMOB 2VAJA 5EO0B 4ZO6A 1Q72H 4L3FA 4BQ9A 1F6AA 2PYEB 1RZ8A 2Q7YA 2XTJC 4FEIA 3BP7A 3GRBA 1BZ7A 3WLWD 3S8WA 4OCXH 4HETA 3HFML 2BDNH 5AL0A 5AVWB 5DFWH 2JIXD 3HCVA 4OM0L 5CN1A 4YC2B 3LRSB 2ZWLT 1OCCB 4BKLA 3EOTL 1X5JA 4BSVB 4HJIA 3MRQB 5C0JA 3HN3A 1U8MA 3QWOB 3MJGX 1ZGLP 4KMTH 4RGNE 2B1OA 1QAWA 1BLIA 1UOWA 2EVJA 2XXFA 2X4UB 5DJXB 4NQDA 1E9OB 1D5IL 3MLYH 5EU3A 3VRLF 4APQC 1CD1A 1XL6A 3QUYB 4RWHA 5M95B 1QBLL 4MMYA 1WFMA 2OCFD 1D5BB 4XBEL 1FJ1A 5IUSA 3CFUA 3QCUH 2QHLA 2Q9OA 4HFWB 1KTKE 3GSQA 1IUZA 5EU3B 3ZRCC 2A6DA 4JDZA 4QRSB 3CQQA 3NJFA 1AR1C 3VMNA 3SDYL 1MCDA 1CPUA 3B1UA 2A9ML 3D85D 2WKOA 3IFOB 1MHEA 1SXZA 3PIQA 4L4TD 4N8CH 4NO0B 4YWGL 1K5NA 4IBUA 2XTLA 3BE1H 3UTSE 4YSCA 3O3AB 5BZDA 1A7PH 4Z7VE 4OD1L 3QDMD 3H6JA 2BZDA 1WD9A 4GINA 4IYKA 5PAZA 3LS5L 2KZKA 4LDOB 5FK9B 1MI5E 5I8KL 5HDWA 3EH1A 5F72S 3KGRA 1NTDA 2OTUB 3FO1B 3HZVB 1X9RA 4ZDHA 2ZKXA 2YA1A 3OQRA 4W4NA 5HJBA 2CKBB 4YDKH 1FVCB 3PXLA 2PTUA 3VWJD 4AZ8A 2ESVB 1DQLL 2P48B 4W4OC 3HR5A 4X5WB 4PWKA 4NB7A 5ESQB 2F53D 4R3SA 3X14B 3F58H 2Y5EA 4OLXH 2V37A 1H3VA 1YDPB 4YSSA 3US1A 1WBZA 2AEPL 3EGSB 1YYML 4AW7A 3TP4A 1S5IH 5A1AA 3D87B 3KEDA 2MTAA 4XB3A 4ZPVB 4F80A 5JR1H 3HAEH 4Q9RH 3RYMA 3T2NH 2W60A 5L8JB 4I7ZC 5BMFH 3GPEA 3IDJA 1GGIH 1MEXL 1OT2A 4WWNA 5MHSD 4CC0A 1A6VH 4HS3A 4YDJA 3E6FB 1B4JL 1QBBA 3BH8B 4NUJA 1U3HA 3RFZB 2C8NA 3QDME 5TPWH 2HRPH 3B5GA 1BM3L 4QRUB 5CCHE 1KEGH 1NAML 4UT7L 4UB0L 4ODXB 4TUKH 2F7IA 5CSBA 1LO0H 1HWHB 2ZG1A 2XG5B 5JPNA 1XR9B 3NACH 4HKXA 3EOAA 2PWFA 4Q52A 3W3BA 3RVTD 4TVPD 1E4HA 5F7BA 1D6EA 5E99L 3K81A 4J12A 1QABA 1Q94B 2P26A 4KI5D 2VQ4A 4DERA 5KTEH 4LEXH 5LKNA 5IB4B 3G5WA 1CD8A 2HFTA 4P2CG 2WUCH 4HC1A 2ESVA 4A2EA 3M45A 4DKFH 1BBDL 4WNJA 2XUWA 1QNIA 3O2WH 4XPGL 3TZVB 1BMZA 1P1ZA 2HYMA 1Z5HA 4QRPA 5H4ZA 3NRPA 1WGOA 4O2EA 2XZQH 3EBIA 4HKBB 3LIZH 4K8RL 2WYHA 2YAQA 1U33A 3HE7D 1U8LB 1TJXA 4R4BB 3VQLA 3ZRSA 2GPZA 3DXAB 3IU3B 2R0WL 2GKIA 2EEAA 3JTSB 4FQLL 2IIJA 4Z77B 3IRPX 4D8PA 5HDBE 3IDIB 5L88H 3QRGL 2OYLA 3MV9D 2YJQA 2BFVL 4XPFH 2BOBA 3K0WA 2A99A 3P4MA 4OCWL 4ZUWA 4OZHB 1EIBA 4B9YA 5K59E 3DPDA 3VD5A 4NKDA 1P7QA 4HUWB 4XNMA 4Z7VB 5IW1B 4E2OA 1MRDH 5LNDA 3F85A 1ML0A 1SVZA 3CDGB 5EMYA 3B6SA 1KPRB 2H2SC 2GJZA 3C8KB 3ESPA 4A6YL 5A6MA 4APQD 1NOLA 1FAIH 1P53A 2ZKWA 3GZPA 4IK6A 4N5EC 4OLYH 1F00I 1L3WA 3HBPA 5K9OB 1E3ZA 4NM8L 2EYTB 4CVUA 1MI5D 4JFPA 3CQFA 5SX5K 4PP1C 3WFDH 4F7CA 2WXJA 1PLGH 2E27H 4H25B 4K94C 2DLGA 4ANKA 3ZZ1A 4HDIA 1I8AA 4HXBH 3VXMA 5F7HA 5IHBA 4KQ0A 3STBA 4LHUD 3AWEA 1INEH 4LAJH 3TA3B 2JJTA 4NQCA 1CZ8L 3G6JF 3BP7B 4UYQA 4XPBL 2CO2A 4HUKB 5SWZA 2R0KL 4LSVL 1QWHA 5AYTA 1C08A 6FABH 2CDEA 4K8RD 1XGYL 1TDQA 1OP5H 1M2VB 2HT3D 4ELMF 5B4MC 3S8GB 2DYSB 4EF3A 3FUHA 3HS0B 4QHMA 2R1WB 3U2SA 2YPLA 1SHMA 5FUCE 3BVDB 3WEXA 1KCWA 2OSLB 1N6VA 4QTIH 1CD0A 3WIFB 4HS8H 3VWJC 5ICZB 4A7TA 1CICA 2BPBA 4I3GA 3I50L 5JIPA 2VUYA 4Z7VF 5E8DL 3EJJX 1HCVA 1FNHA 5MEPB 2H32H 4NUGH 1T4KA 3KYKL 3IPFA 1IE5A 3QGVA 5CZRA 5MI0C 3ASNB 3NJIA 1XD1A 2ENSA 1IZKA 4HMEA 2WN3A 4ILDA 3F6IA 4UU9A 4WK4B 1SY6A 3BAIA 1AFVL 1KB9J 5TFSH 1FZKA 3LPGA 4ONHA 4YIQA 3NIDB 2D4DA 4JDVB 4KO5A 1QR1B 1DEEA 2DM3A 4RSVA 3GSRB 2WYZA 1IM9D 4OCWH 2UY6A 4H88H 1KXVA 1UB6B 4JY4A 1EGJL 2OP4L 3VVWA 1GYAA 1S9YA 4NKIL 4G80A 4BH8B 2Z35A 1YY9D 1SQMA 1U8NB 4H0IA 4JHBA 5IREA 2DMCA 3OGCA 3U25A 3RVTC 2EYSB 3EF4A 4MXQD 4MWFA 4JRXA 1RZ7H 2IOMA 2NNAB 3ZHNA 1VPOL 4XMUA 1YEGL 5ACZB 4BHUA 5K59F 1XF2A 3ARBB 3Q6FA 5CLZA 2CA3A 3HB3D 3SKMB 4A7VA 4POZD 1KXQA 4DEPC 2R2CA 3IM1A 4LCWB 3PP4H 3ROOA 3GSUB 2NXZC 5DD5H 2XN9A 2MQ3A 4JL2A 1AQ8A 3OLGA 3TEXA 2EE3A 5F97E 5F1NA 2K3TA 3HE7C 5BZWB 5CMAB 2ZPKL 1TNNA 1KBGL 3LKRA 5F88B 4CKQA 4H40A 5I8CB 2EC9U 1F0LA 3FT9A 5A2CA 1KEGL 3MKKA 2K3HA 3MRLB 4F2EA 3HBZA 2DLFH 5TGBB 3UPCA 5IB5B 3FCGA 4MMZA 4NRYA 2Y4SA 4TVPE 4M5SA 5IW6B 2NRDA 3A67L 5C2UB 4B9PA 4DK6A 2X44D 4G8GA 3Q7JA 4KMTL 5DFVC 1CYWA 1NC4D 4L8SB 3V4VA 5IFAL 3G5XA 4OW6A 5E24E 5MP6L 4LCCA 5DLLA 4HMDA 3SO3B 7PCYA 4U33A 2QQLH 4KKQA 1NCWH 1EEYA 2IWKA 2YK1H 4HWNA 1OGSA 1VCBC 2C34A 4W9IC 5A2AA 3FAXA 1UT2A 3OAZH 3REWB 4LVOB 4ZODA 2H1PH 4FNTA 1B4TA 1IE4A 3OQ3B 5AB0A 3V4PA 4UAOB 3ZX1A 1YEJL 2VNCA 4PG9A 4MZIA 4N26A 1GMEA 2VXTL 4M7JH 4MJJA 5KSVB 4JY5H 3FCBA 4OZHE 1QOKA 4G5ZH 1XAUA 1ZLVK 3ZTCC 5T3XE 4PJ7B 4PM1A 2WWKT 3L3IA 3QHZL 5IOKA 4R8WL 1BW8A 2VLKD 5GJTH 4K8RC 2HSIA 2VC2B 2Z8WC 1Z9LA 4FLSA 4A63A 1DO5A 2YAFA 3BMVA 4XPBH 2BXYA 3RDTA 4NKDB 4XNMB 3CMGA 4J3OF 2WB7A 1UQSB 5HHPA 2A9CA 4PCYA 3BVXA 4DQOL 1JUFB 3WY1A 2R4SH 2FK9A 3HE6A 1YMHB 4B5ZA 5AZ2L 1G1OA 2A74B 2HUHA 1PD1A 3OZ9L 2F8IA 4XNXL 1IC5H 3A24A 1AGBB 4F37F 1JZ5A 2YGQA 2Y23A 3UAFA 4Q9QH 4M6NL 3HNTH 4GUCA 3MRRA 5I9QC 3P2BA 3ZBMA 1CQKA 2IG2H 4MJIA 2WBKA 3LRLA 4OQ1A 1U3NA 4RX4A 2ZUQB 4LOVA 3RWJA 4IRZL 1R3IL 2D7MA 1PQZA 3EJPA 4ACPA 2J6WA 2J1ZA 4KK8C 4ABVA 4Z7UF 2X70A 2BZ7A 4BFIB 5DC0A 4XCCH 2GABA 1EZLA 2LU3A 3OKLA 1BDYA 3P0GB 4I3SL 5FYLD 1HSAB 4MQXD 3ULUF 1TEFA 3CSGA 3OKDA 4NHCH 1TVHA 4DPBX 3PPEA 4Z7OF 2I85A 1JGEB 1QFWM 1JPSH 4WNQA 4R97C 3GKWL 2UY6B 3DX8B 4H4NA 4LEBA 5FLVA 3IEAA 1R5WA 5HY9B 5ILTL 3DWTA 2BRRH 2VDKH 1FDLH 1KXVC 3GMPB 5AZUA 2X42A 3ZYOA 3QPKA 1JGEA 4BRVA 4JFFD 2FIKA 2IAAC 4IJ3B 4J28A 5J6HB 5KBPA 2YC1A 3FSOA 3QIBA 4JFVA 4YHLH 4LCYB 4DGIH 5E99H 1M7IA 3C6LD 4XMPL 5IROD 4P49A 4BKSC 3MNZB 4PLJD 5I15L 4GO8A 3OZKA 1GZHA 1CFMA 3HNSL 5KWYC 1YEHL 2XX1A 5J13C 3IDJB 4MS8C 1BG1A 4HJGB 1SUJA 4NQVB 4L2LA 2HH0H 2L7UA 2P5WD 5T1KA 5BO1H 3AB0B 3FQ4A 1TYEB 1WWWX 5HJ3A 4AQ1B 2CLZA 4HCRL 2BY1A 2V9UA 2KPWA 2Y7LA 2DTMH 2CGYA 5TF1H 3RTQC 1V27A 3AT9A 2ZT9C 3FW6A 4NN5B 2FRGP 1KNOB 3KM2A 1DEEB 3OKKA 1EH9A 2B3RA 2JI2A 3BT2H 4YGVB 1RUPH 5EN2B 1RP9A 5AZ2H 1FORH 3IJEB 2OMWA 4NS0A 4YPJA 4EI0A 2O6EA 2NY3D 4G80B 4RCAA 1AGCA 1CIUA 1FFOA 4PTTB 4AIXA 3QRGH 1DZ0A 4JRYA 3W0WB 4N1CA 5HDBF 1G9HA 4XI5D 3WUWB 5DCCA 3FTWA 2UVFA 1P7HL 5DURB 3BVNA 4PV9B 3UTPE 4I77H 2ED7A 3CX2A 4WIQA 1CGSL 4LSTH 1HIML 1MFEL 3WCYA 3PQYD 2FWUA 3D2UB 1FF5A 3MV11 3H2QA 1JXKA 1ADWA 4M29A 1P7BA 3NN8A 1XD0A 4HWUA 43C9A 3T0EB 3GSNB 3Q1EA 2FQEA 2VERN 1HINH 2PXYC 3LRKA 1DBKH 3VGFA 4BA8A 1WZMA 5AFAA 1FBIH 2J6EL 5C8JB 3PU7A 5IHUH 5KANI 2ICEC 1BJ1H 5IB3B 4Z76A 3EYFA 4G7VL 4XAWH 2UXGA 1G7JA 2CM6A 1D6VH 4S0HA 5C0GB 1HXYB 1PYWA 2XWCA 3FSAA 3QISA 4K0OA 4NZTH 5HHNA 5C0CE 5EDXA 2WZPA 2YXWA 5BXFA 1WA2X 1KCSL 4XR8C 1PKQB 1U93A 2D7PA 4HLEA 4MJ2A 4PJBF 1SOXA 4WHCA 3VQ2C 4NN7B 4PRPA 3EHBC 4DUWA 3IN2A 4MD0B 4FFZH 1S78C 2G60L 1DQIA 2P24A 1D9KC 1N59A 2H0PA 3HUJA 2DAVA 4XH2A 4E9VA 5CEYA 3N06B 4JO3H 5H35B 4PJDA 2PWGA 1RUPL 1CWVA 4QD2E 4DPAX 1EVTC 3PWUA 1K72A 4BGLA 1GGYA 2FBJH 3QWOA 4LFHD 5E8NB 4BCXA 5BUPA 4FTVA 2KUTA 1V5JA 4MQXC 4RFNC 4Y8AA 2Z8SA 1U3YA 2IDCA 1ZE3C 4WJG3 4MNGE 1CGXA 4AW4A 1A6UL 4UWQB 2BS71 4M7LH 1A3LL 3IFLL 4X4XB 1CE1L 4NZJA 2O6FA 1RJYA 4IBTA 1N70A 4P9HL 4HK0A 1QEWA 3I6LE 3N50A 4U0QB 5AOLA 2VL5A 2EIBA 3JWNH 1B0GB 2X2HA 2ZAGA 1T21B 4PRDB 4ANUA 1GC1L 2A74A 2R69A 1RZ7L 2G2NA 3L54A 3ZDZF 5EZIL 3CIQA 3TA3D 1AHKA 4XBPB 3MLTB 3WNOA 3OJVC 5IROC 3RVWC 1UKQA 4JHAL 3ZE0E 1FE8L 1FFQA 1PMYA 4AGQA 1EVUA 1AZVA 3CFIC 4WQOA 3N1FC 4YDZA 4KK6C 4RAUB 4QOKB 4XTRC 1GGTA 1ZJBA 4LSPH 5CCGE 2N59A 4XGZB 2HPOA 3VRIB 3ARGD 3L1GA 2APTA 3GMOB 2PPFA 5ERWA 2W94A 5KVEH 3RNKB 4NC1C 4AJYV 1TLMA 4DO4A 2B5IB 5DO2C 4NAMA 1WCBB 3MRKA 1YMMD 1QYGL 3CLFL 1KJ3H 1ORSA 1RZGB 2A83A 2P43B 3A3YB 1RSFA 4TUOA 4HS8L 3DROA 3NSFA 1S7RA 2ZWYA 3CSYB 1DBAH 1RAMA 2VMDA 5CJXC 5E8EB 1WH0A 3VXTB 2EVGA 1TQBC 4DGWC 1ILUA 1KACB 4N9GA 4BWTA 1FVEB 4KOCA 4ODVH 1RZFL 5GZOC 2HLEB 3D39D 4DGIL 4OFKA 5LXGL 2A9AA 3C5JA 1KOAA 1GPOL 1JK8B 2L7QA 3D2TA 4PGDA 2YS4A 1TJIL 3U1PA 3PWPB 1NBVL 4PP2B 4JG9A 1CI3M 1JHLH 1L0PA 3NEEA 4MX7A 4WWID 1KB5A 1VEMA 5HTSA 1QSZA 4JO8A 4UIMB 2PUQT 4ISVA 4RA0C 3ZE2E 5LGJB 1JPST 3BZEA 1AY1L 4GI8A 3TWCL 4PP2A 4OV5B 32C2B 1DQTA 1GGUA 3NRQA 3L7FB 4X98A 4MHHG 3NSYA 4NQTA 3U7AA 2MNWA 3LZRA 4P2QA 2I5YH 3X12A 1MHCB 1IGML 4N8PA 2ZX8A 3TF7C 2FO8A 2WWOA 4M7JL 4C8XA 5DYOA 4P5TB 5CIPH 4JEGB 4R4NC 5EOTB 1FP5A 3O4LD 1XV8A 4HJ0C 1BX2B 5DJCB 4JKMA 1MCEA 3K8LA 4Q6KA 5FCUH 4WJKB 3ZYIA 2DQTL 3IVKB 2MMXA 4EOWL 5GISH 4EI5A 4H7VA 5EEYA 3N41B 4GAFB 3IKCA 3L4TA 3RKDD 4CW1A 3EDFA 4AK1A 4IGBA 1D7FA 3GSUA 5HJGA 4JB9L 4Y19A 2IJ0C 5EUOA 4Z0XB 4Z8FH 4J6RL 2DQFA 1NGXB 1WD8A 2ED6A 2NY1D 3N43F 4J8RB 4KVPA 1BZOA 5F93C 1O9WA 3HPJB 3QNYB 3PAYA 2IV8A 3H6AA 3GF8A 4NKMA 3KS0J 5TE4H 4P3WA 1R5IA 3TIDB 1JWSB 5CZVL 5TJWK 1S9KC 4TUUA 4UIKL 3EO1B 1QTYT 1ZANH 3IU4H 1UWFA 3OF6D 5KVFH 1BBDH 4GSXA 3UTSA 1XF4B 3V6BR 3PYCA 1KEML 1Q1JL 4HGKC 1NKRA 5EF3A 1IM3D 5D2NA 4L23A 4JPVL 1AZNA 1JK9A 5DD3L 2E4FA 2G75B 5E1AB 5JUEH 3EDEA 5E23A 1K4CB 4MBRA 2Y36H 2BSDA 5F1NB 3IMSA 5C0AE 1HXMA 3SBWA 2AV1A 4QT5B 4ZAKD 3CFKA 4YR6B 4PY8J 1NCGA 1XR9A 4HKXB 4WFEE 4FOMA 4RBPH 2GT9B 3BSZH 1QKZH 1TJIH 5F6HI 2FBOJ 1YEEL 3IJSB 2DLTA 2OSYA 4HD5A 2AVFA 2BSEA 1YPZF 3VD3A 1A8JH 2ZOUA 5BRZD 5AOJA 4YFLF 5FUOH 6CGTA 4IEFB 5JHLA 4NRXB 3R7RA 4XVTH 4GSDH 4JZOB 3TBYA 5ADOH 3IMTA 3RVWD 3ME0A 1KV7A 4WI7A 3BWSA 5EC2A 2DM4A 1P5UC 1CTOA 2XYCA 1MWAB 3BD3A 3GXUB 2CDEB 3WN5A 3RPIB 4G70B 5J1TC 1FL3B 1KTDB 1DUYA 2H0JA 4LHUG 2NSQA 2KC0A 1KXTA 5TDOA 1A7RL 4F2MB 2F74A 3D7PA 1THAA 2QKSA 2YPLB 1A4CA 4F7EB 3N1QC 3D39E 5ALBH 2FX7L 3QXAA 3VFWB 1S6NA 1T2QH 3VNYA 5C0AD 1YPZB 5CD5D 2UY7A 3ZE0F 3PAZA 4FQXA 3T2LA 4AENB 4ZMXA 4DW2L 1E5YA 3ULSA 3BKYL 4TYUA 3WS6C 3DHJA 1AGBA 5I24A 2CBTA 3ISWA 3HNVL 3HC3H 1UUNA 4BFRA 3I02B 4E5XA 5BOPA 3A6CH 4M4RA 1OZUA 4ZX5A 1M05A 5C6PB 1JPEA 4G6KH 4PG2A 4WV1B 4IOIA 1QVOB 1Z7JA 2MPAH 3MUGA 3OXRB 4I77L 2GIYA 4R5TA 5LGKA 1ET8A 1UA6H 3JWDL 4DF9A 4YE4L 2W0FB 3IAGC 1A6AA 5C9JB 1SGKA 2VXUH 3CZJA 1Q9WA 2HWZH 5DRWB 1LEKA 3SOTA 4ODWB 5B1JA 1AXSB 1MWAA 3RB5A 2AC0A 2E7CA 5LCVH 2EVHA 5GRXG 1H0DA 4HPYH 1SN2A 3RP1A 1VFAA 3HKZA 3KDPB 4JAMA 3FYIB 2F74B 4M7ZC 3CSYA 3FQWB 2R2HA 3BYTA 3WKML 3Q3GB 4WI3A 2AKRB 3DK0A 3GT6A 1J48A 2ADGB 1E2VA 1YPZA 1IAKA 2UV3A 1FYTB 2Y2TA 3K8KA 4FQJH 4C56B 2Q76A 3QC5X 4I0PB 1D6VL 2NUTB 3H0TB 2A1WH 2TSBA 3DGCR 4TM9A 4UDUB 1U58A 4WHDA 4JDEA 5ETUA 3SDCD 1KCSH 2YD9A 2BP8A 2X2IA 3FU7B 4WLCA 2OX5A 4L8BB 3BQUA 1E2ZA 3MJ9L 3KE0A 3WNMA 5ISZB 1XGUB 2MHAB 2Z8VC 2GVYA 1XF1A 2HLAA 5C08E 5G5DA 4OZ4A 4OCYL 5I8CA 1KFAH 5A3ID 4R7LA 3UBXB 2UXFA 4D9QE 3LHPL 2AERT 4J8QA 3T8XA 1BA9A 3B43A 4NKMB 1TPXB 3BH8A 4NWTL 5KYYA 1IAIL 3PUCA 1S3KL 2O5ZL 4OI8A 5K39A 3UC2A 4DEUA 3O11A 1B0RA 4RFEB 5DURD 4AE1A 1OW0A 5DJZA 4IBZA 4LKCB 5GGUB 1WS8A 1IC4H 1KCRH 2IH1A 3DETC 1OVZA 4NI6A 4PJ5B 5EZOH 1JZFA 4N6RA 3HS8A 2EIEA 2ZOTA 5TQ2L 3T3ME 1Q9KB 1L5GA 1U30A 3ZVVA 1A3LH 1NLBL 5D7JC 3SYCA 4YE4H 3GXMA 2J1XA 1Z0NA 5HYSG 3QUMB 2H1LM 4W68A 5AAWC 1HZHH 3IKCB 3DSNB 4EAEA 4JFDA 2Y22A 4P9MH 5I2IA 3CFCH 4ZSOA 1FLRL 4ZOEA 2VLME 4NQXB 4PJGB 5GRZA 4MHHI 3EFOA 5EBLA 1KCVH 5IM7B 4ZX3A 2BP5M 3K74B 5F7KC 3ZJAA 4ZFFA 1RPQA 4K23L 1YEHH 2JLPA 3FSVA 4XXCC 1OAXL 3KPSE 3NZUA 5HGBB 1E27A 5FR3A 4WTXA 5CEZD 1RJYB 3S98A 4KRMB 3T77B 1BD2B 4YL9A 5GGSA 1Z1WA 5KN5A 1LEIA 1IAOA 3RI5K 2ZOWA 4FQHA 1WS7A 3CCHB 3CK0L 4FQXC 1FLTX 4L3AA 4ZRGA 2VZ1A 3AY4A 3N40F 2AEWA 3KVDD 1RH8A 2VZVA 2V2WA 4HIHA 3PRZA 2EC8A 2VISA 3OAYH 5GRYA 4F24A 3QQ4B 4OZIE 2XNAA 2I9LA 5ID1B 3P11L 2QSCL 2ATKA 3DVGB 4XMKL 1OV8A 4X5LA 3V55A 3V0HA 4NOBA 3UDWA 3UZEC 4JPIB 1JXFA 1SF3A 5JW3L 3HRZB 1E9QA 4HIXL 2ROXA 3APNA 1EDQA 4HH8A 5D93C 4HPOH 2K78A 3KHOA 1BEYL 4FF9A 3VGGA 2C7FA 2GC7C 3KPSD 1YEFH 5SX4I 3H4HA 4HUUB 5DHMC 5FHAH 3Q44A 3MSPA 1LEKB 5I1DB 3ZOAA 4HJUA 1GGIL 1MEXH 2VDLL 3K4DA 2Q8AH 3U0TA 3KVPA 1W72L 3MV8E 2N1KA 1ID5I 1OE2A 2FJUB 3K2UH 4JZNB 3OL2A 1ZLWK 4R96B 4LDEB 2QHRL 2DYPA 3IDMA 4PRDA 4OLZL 5DK0B 2Z7WA 4LVOC 4MDIB 5HGGS 2FD6H 4GIAA 4KMQA 3MREB 2DB8A 2X89A 5AW5B 4QWWC 4AQEA 2YAEA 3WJJC 3VD4A 1QLEH 1C1EH 3PWPA 5DTFA 3K0YA 5EN3A 4PUBH 1HNYA 2WQ8A 4P59L 3D3VB 4RBPK 4J3BA 4ZFZB 3RZCD 3KBPA 3MNVA 1IC1A 5GIRB 1YEIL 4XHQA 4AC4A 1DVXA 1MCOL 3BT0A 2MKWA 4L0PB 4XPGH 4P8QA 4ELKA 1JGVH 3GHEH 5F1IB 4Y4FD 3VI4A 3VXSD 2CHZA 3EJUA 4FCAA 4AG4H 5ISZD 5KVDH 5EUOE 2V2TB 4AGPA 2J73A 1FVDB 3G5ZA 5HHXL 4I18C 1NIAA 1TENA 1QMUA 3GDCA 4YFDB 3RGVB 5C0EB 2OV0A 3ARFA 3AADB 1SQ2N 2VDNH 3MBWA 3DIFA 5E00B 2NXZB 4FNUA 4U6YB 2BMKB 3Q2WA 3FXIC 4NPJA 4JANA 3CK0H 3CC5B 3DPBB 3NCBB 4LLVB 2YHGA 2EDNA 1K4DA 5J06A 1QNZH 3MBEA 1H3TA 2V9TA 4LCIH 1JXDA 1I53A 4D0CB 4OGQC 5F6IB 4ZQTA 1CXIA 1NGXA 4CJ0A 4WW2B 1NL0L 4XMVA 4J6RH 5IJDC 1KIUB 4WK0B 3EOBB 4HXAH 1MLCA 3AGVA 1RMFH 4N0FA 5D7KE 1A1NB 2YUVA 4RGNB 1AGFA 4R26L 3PDOA 4Y2NA 4GJTB 1G6RH 4ES8A 4R97B 2VIRB 3SO3C 5EU6D 1TZGH 1F3DJ 3VTTA 1CDHA 2WXHA 4PJFF 2PYFB 1MCKA 3UACA 1KN4H 1V7NH 1F3JA 2J1KA 3JYCA 3NJLA 4P57B 4AMWA 5F7DA 3RU8L 4FQ1L 1HSBB 2CIIB 1VESA 2H3XC 2H9GB 4DEWA 4LSVH 4DKAA 4K5MA 4BQ6A 3QFDA 4OZFG 3G5YA 3P4OA 1UG9A 3WKPA 5EB9A 4Z7AA 5ES4B 3QEUB 4I4WB 4XPTL 3WS3B 4PJBA 5JMRA 3C6SB 5TQ0H 3GJEA 2BHUA 1MW0A 3V5HB 2HFEA 3D50A 4ONOA 3INOA 5F1SA 1YEWA 3HZYB 4FQ2L 4L4VA 5C6TH 1WIPA 4JDTL 1JSYA 3E3QE 4BEIA 3LQMA 3QQ3B 3ZN6A 1AIFA 4GG6F 3H1ZA 1G7HB 2ATPA 4L3CA 4P2RA 4N68A 3HZMA 3O2DH 2QLYA 5D1ZD 4KKAC 1A9EB 3ARDA 1KPUA 4X80H 2P5EE 4TNWF 2LE9A 4JK0D 1WBYA 5B3JE 4G3YL 3ZTJG 4Z7UB 3O2WL 4WO4D 5KSAA 2V7HB 3VCLA 3QNXA 3ZSTA 4LARH 4MD4B 3QUKB 2APBA 4AT6A 5TFSL 3W1ZA 2IVFC 2VRQA 1G6RA 1PAZA 1ZRUA 4LSUH 5IB3A 3IAQA 3FONA 5FA4A 1I1CA 1T6WA 2R0WH 3BO8A 4LBAA 3WIFA 5AD0A 1RURH 3N9GH 4GO6B 1AANA 5I5IA 2I9TB 1XGPB 4K94L 3DMMB 1SM3L 3PP3K 4LGRB 3CN4A 4IBLT 2PCPB 3QQDB 1ZA6B 2WQSA 4F93B 4KOBA 4EIGB 2QVFB 1FO0A 4ADIA 2D73A 3V4PB 3UTOA 1WTGT 2GY7B 4KI5C 1CLCA 1LM8V 4TPRH 3GI9L 3JV6A 4XNYL 4AQ8A 5L2KD 1BJ8A 4WI5A 1O9VA 3ALWA 5HHMD 3UROR 2P24B 3HUJB 3DROB 5T3ZH 1UOLA 1PZ3A 2X4PA 4OZFH 3OKNA 2EDOA 3PP4L 4JFPB 1CR9H 1EAQA 5JORA 3MI6A 3VFPB 3OLEA 3AS0A 3QJVB 2V3DA 2WXLA 5KSAB 5C9KA 3JV4A 4PJHB 1GAFL 1DSFL 4HXBL 1ADQH 5C07A 1ZA3A 2VN4A 2WZ5A 1YMME 1L9NA 2BHFA 5D1XA 5HSFA 2JKTM 2ZCKH 2BWIA 2K70A 3FTZA 3ARYA 3GM8A 4M7KH 2BNRA 4U6XA 1NAKH 4OV6F 4IKIA 4PGEA 5CR8A 4ZUUB 5TDPB 1H5BB 3VTAA 4DGVH 5BVJB 1IKNC 2WC7A 3UP1A 5B3SB 4O51A 4JGNA 2H8PA 3TURA 2YAHA 2BIIA 4MVBC 1G87A 1WITA 5HI4C 4BFIA 3LEYL 4D0BA 3SE6A 5I71B 4W70A 1GYUA 1EQWA 4X2UA 2JJVA 4D9QD 3CGTA 3S3PA 1UFGA 1UADC 3ZUCA 2FWOB 4P99A 5CUSL 4O9HL 3BGAA 3MLPA 4P5TA 2Y7OA 3ZDXF 3UCQA 5C0FB 1XCTB 1IGYA 2OXHA 3ESMA 5FYJL 4CMHB 3CFJB 5JHDB 1LO2L 4N87A 4UMGA 3LZFH 2YZ1A 5FFOA 3PL6C 2X7LA 3S4SA 4L0YA 3UABA 3K7UA 3SODB 3EH4B 1AG0A 5C0BB 3GPSA 1WZ1L 4FMVA 3PY9A 8PAZA 3W0WA 5F9OL 1AGCB 1FFOB 4JRYE 3V79C 3MYJA 3WY3A 4WHTA 1I8KA 4FABL 4LLWB 1KBPA 5IQ7L 2R1WA 1NUFA 2DQGH 1T7ZA 2RH0A 1AS7A 3SBWC 3NJHA 1ZHLA 4BWUA 3MBEB 2Z65C 2ADGA 3AT0A 5DJDB 3VG9B 5CGYD 5EV7A 4YX2L 4XP1L 4FD0A 2F54E 4XNYH 2I69A 4N0UA 3WFEH 3FB7B 1IC7H 3BPCB 1YAZA 4KJPC 5JQ6L 4M48H 4FFVC 3DUHA 4IRZA 4JG5A 4KKAD 4ODTH 1Y6NR 1WHPA 1CICC 3L1FA 3MRLA 2EDXA 1N12A 4G9FE 2PP8A 3OKMB 1HAUA 2C3WA 1MCNA 3ZHLA 4ZMPA 1Q0YL 5I30L 2ZICA 3VI3E 2WTPA 1NCCL 3EYUH 5EUKB 3IMRA 4HZ1A 5J6SA 3Q1SH 4NHCL 4DWHA 4KFZC 2WKGA 1MOEA 1I1AC 2FT6A 4AM0A 3A4EA 1HCZA 3P4OB 2XN0A 3ILPA 4X6DA 2Q8AL 2VM4A 4XZUA 5T5FL 4FQHB 4YHNB 3WFDL 3LZLA 3B3IB 5JXAL 1IBDA 5ENWB 2Q2LA 3PHOA 5DRXA 5HHOD 2EO1A 1IKFL 1N68A 3KXFB 5CGTA 2EYSA 5K9KB 4L3ED 5F3HB 5EBWA 4WZ9A 1HK6A 1XGTA 1UZ8A 3CNKA 4XP9H 3U0PB 3UTQB 4ELMB 3LEYH 2F5AL 5GS2H 4MSWA 4QRPB 2X87A 5KVEE 5DQ9B 3G5XB 4QRRD 3O2DA 4Y1AA 4JR9H 4XCNB 4X8CA 3DTXB 2P49B 3QXAB 3VFNA 1QRKA 3VFWA 1M71A 2XOTA 4HIXH 4APQB 4N20A 1RL1A 2P5ED 1FZJA 3D1MC 1F5WA 3FZUD 3HB3C 1LO5A 3P73A 1X9QA 4ZT1A 3IT8D 4M93B 3UJJH 4TQ8A 4HCFA 4YPGB 1BQSA 5C7XL 3TYGL 1FZOA 3E8VA 5L2KB 4IOSD 1QI3A 2UZPA 3VVVA 1WAAF 3HI1A 5CILH 4LCWE 3TO4A 4TNVF 3UP6A 1COBA 1AR2A 3P3SA 1S3KH 2HT4D 4G5ZL 4ZUWB 1RIVH 1EMTL 4H8WH 2Y7MA 1JAEA 1ZJAA 2Y1YA 4OIFA 4MA8L 1X6NA 4WENB 1FORL 1OK8A 2EABA 4L1DA 5D70L 1IGIH 1ZGLA 4W4OA 2YD6A 3L3DA 2ICCA 3W11D 5INDA 1T66C 3FFDB 1DBJL 2IOIA 4AYBA 5B7FA 1IX2A 1AI1L 4KX8A 5IVXA 4Y0GA 1F6LL 1BVOA 4KU1A 1U8KB 3BIAX 1JF1B 1HZHL 3NJXA 4IS6A 3IJ7A 5T1MB 2P4AB 3B56A 4GYBA 5JXED 3HZ3A 1F58H 4MAUH 1EO5A 4KI5E 5DI8B 3QZWA 5KVEL 3C09C 4XVSH 3VXMB 1VIWA 2KH2B 3BGMB 5JR1L 3QJSB 2JSFA 4F7KA 5C0EA 3IDXL 3GIZL 4Y5XC 2H0FA 5M94B 2EKSA 4MDIA 4W9DC 2MCPL 1U8JB 3T0XA 1J10A 3GSXA 4Y7MA 3HG2A 3WGUB 1UTDA 2P7TB 4HT1H 4HQQL 3ULUL 1A02N 1BM7A 3QVAA 5I1GH 4ZS6C 3LS4H 3RWIB 3BSZA 1NBQA 3RFZC 2WYIA 2F5AH 3MGOA 4RISL 4JO1H 3VFGH 4UT6L 2VDPB 1C5CL 1T20A 1HHKA 3PV6A 3QEQB 4OIIH 3F7QA 3REVB 3P4LA 4QKXB 2X6VA 5ID0A 4Y4FB 1DJXA 4QRSA 3DO4A 3S36X 2IPTL 3QUXA 4FN0A 3QYCA 1EANA 3D30A 5KTEL 2CJSA 1S7SB 3NQIA 3WAJA 2P3YA 2YAPA 5DJ8B 4JFUA 1HHHA 4HGWA 4HIIB 1F3JB 1JFQL 2XFXA 3B2PA 4OF3A 4S1RH 1V7NL 3SKNA 3W38A 4X98B 3BFOA 4NO5A 2QELA 4HFWA 2GJ6A 4ZUVB 4UV4L 1OARL 1ZLEA 1BM3H 4X80L 2DM7A 1PD0A 4ZDHB 1OQOA 4AQ1A 5JO5B 1Q9OA 3G9VA 4PJ8D 1E50A 1X4YA 5E70A 5L2JA 1HU8A 4G8EA 1E5CA 3HG1A 1WT5A 3NJGA 2YGNA 1QSFD 4U1LA 3IXAB 4M5TA 4MQSB 3WNJA 1MW2A 5I6PA 2VDRB 1MSPA 5LB1A 3X3FL 3HW7A 1X7TA 3H0TA 3NCJH 2GY5A 5FYJE 5HGHA 3SB3A 3GUTA 1NGZA 4N4YB 4W6YB 5KYXB 1ACYL 1J0JA 1I4FA 3DHPA 1Q9LB 1EXGA 2AXGB 3ABGA 4YJZL 5LDSA 5T5NF 3D12B 4PRID 4Q4EA 3RY6A 3WTWA 2WXOA 4Q14A 2BW4A 1YNKL 3WFCL 1T04B 3EH3B 1MCJA 1T3FA 3EFDL 4RMUA 4MZ3A 5IQMA 3UYPB 3FZUC 2OMVB 1GYWA 1XF4A 3IDNA 4KO9A 5BZWA 1VA9A 3P4MB 3T6XA 4CBPA 1JGVL 2ENPA 1R34A 4QRFA 3MR9A 1HYSD 3MNMA 4H5SB 5B39G 5ANME 2DBLL 3QH3A 4YPGA 3QJOA 4PGZA 1AKJB 1DQML 3KXFE 1QYGH 3CLFH 1ZE3H 4TVSa 2Z3FA 5DJZB 4WCYH 3TFBA 5L7XH 5K93A 1ACZA 3ASOB 1FC2D 5I73B 2R0ZH 5AOMA 3B2VL 4OJFH 3L4CA 3HG1B 1R3JB 2VE6A 4GAYB 5CSGA 4L3CB 3U82B 3UADA 1MCSA 1J5CA 1G7QB 2ADIB 4GT0A 5EBWB 4DCQA 2Z7ZA 4CVXA 3H7LA 2F19L 3LQZA 5L2KE 4YSTA 5A7BA 4HDIB 3ARQA 1PEZA 3WJLC 3CXDH 5EO1A 5E9DE 3TJPA 1CFSA 1ZMYA 1W15A 3TVMC 5I23A 4HEMA 3CVHB 1JRHL 1E4XL 4GKLA 5I1LB 1U8HA 4KKCC 5E8OB 2Z8RA 3KHQA 5DUBA 4LNVA 4GSUA 3DMMD 4K3EH 1GJIA 3P3TA 4BK8A 2ZUVA 3UH8A 4JPIA 3TWCH 4G43A 2XZCH 3NJJA 2N4IA 4AEEA 1YC7A 4OD2A 1NIFA 1WA0X 1JOIA 2I5YL 4N2LA 4R7DB 1ZD6A 5F9AC 3PJLA 1Z5YD 3QUYA 1HKLL 3GXNA 4HA1A 3GMMA 3T77A 2EE2A 3H3BC 1UH2A 5EEUA 5I75B 3O9WD 2BSBA 2DV6A 3T8VA 4Y4HA 4LPUA 4WRLA 5D7HA 2WN2A 4FABH 4KJWD 1A3ZA 1YECH 3K4AA 2IPKB 4M7ZB 4PYHA 1ACCA 4RMQA 5KS9B 3CN3A 2AEQL 1DEDA 1JPTL 5B1AB 1A6AB 4JQXA 4PY7B 3KJ6H 4Y7OC 2R56L 2GJZB 1O5DT 5C07E 1OTUD 4Q9CA 2DWXA 2OM5A 2GBUA 4DP2X 3I9AA 3D25B 1SJXA 1AQKH 4EIUA 2YD1A 1XF3B 1ZOXA 3SGJA 3OAYK 4GKNA 1NSNL 1MW3A 2V2XB 3KG5A 1SEBB 3FS9A 1MY5A 1D5MA 5ERWB 1FGNH 3WO4C 5DFTA 5I9QB 4XP5H 5ALCL 3QIUB 5HI3D 3U4AA 3WKMH 2HPTA 5CEZL 2HVKA 2MQCA 3BN3B 3U9UA 4PJHF 3FUDA 1SJEA 5J11C 1M2OA 3EH5B 3HA0A 3SZ6A 3CSPA 3O6ML 2Q76B 4XO4A 2LGNA 4ZFGL 2CJ3A 2L0DA 3D85A 4L4TA 4NWUL 3ARBA 2H32B 4DKEH 2MSPA 3GHPA 3OLDA 4XC3L 5CBEA 2EILB 2W59A 3FUMA 5E6YA 3QDMA 1HE8A 2XTSA 3MCYA 4LAQH 3QDHA 1IL1A 4PGEB 4FQIH 4OAWA 5E2TH 4OJCA 3UBXA 4EI6B 4NZFA 4PRBB 4HBQA 1S9XB 5G5DB 4AYFB 3UTSB 4WFHD 5KVMC 4I3RL 1VJSA 5KS9F 2NTSP 3O8XA 2GUYA 3C2AL 5D7JB 5KOMC 2Y9RT 2AVGA 2GJ6B 2WHVA 5DMGC 4BK4A 5KEZA 1WZKA 1WEJH 5F9JB 1UM4L 4B3EA 4JHVA 3FT2B 4KKZA 1VB9A 1NFDB 2XU9A 4AUUA 1Q4NX 4OV5A 2FYYB 4PH8A 2EE9A 4O58H 5BS0B 1FYTA 4C56A 4RDBA 3EF7A 5CJQH 3RUGA 2AMGA 1I8MA 2G9HB 1TCMA 5FA3B 4ZUTA 4HSQA 2BX5A 3JWOH 4FMKA 3WUWG 3SN6N 1U58B 5ACLA 3P3UA 4F8TA 4GRLA 3FUEA 3TBYB 2AK1H 2YRBA 3L3GA 3BKYH 3NSCA 3V5KB 3RVUC 2AEQH 1MAJA 4QGTA 1UYWH 4N8VB 3GMLB 1R5IB 2ZCHH 4QIRA 4Y16D 4QRRE 2FGZA 4F7MB 1H8OA 4LVHB 2OAAA 2CRMA 3RAJH 2A6IB 1CJYA 5AZEL 1BQ5A 4JL1A 3RJQB 3T2OA 2OJZH 1F13A 4Y19B 5DEZA 1X7QA 5GSRA 1PFCA 4XN2A 1GA2A 4EE2A 4OGYH 3TYGH 1L9TA 3ATBA 4HKJB 4G8FB 3O6KL 4CC4A 1AVAA 4DQAA 4AV0A 4ZYKA 1YEDA 1PBYA 1OCWH 1H6UA 4L29A 5CCJA 3NK3A 3TBTA 1NCIA 1UJ3C 2WW8A 2C4FU 2EACA 2IH3B 1DL7L 4TQEH 2V7HA 5IWLA 4LPVA 1CU4H 2JKNA 3K1DA 3BP4B 4YO0B 3DX6A 3OJMB 2AJ3B 1OK0A