2XFGB

Reassembly and co-crystallization of a family 9 processive endoglucanase from separately expressed gh9 and cbm3c modules
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
172
structure length
172
Chain Sequence
b'GSPDPKFNGIEEVPEDEIFVEAGVNASGNNFIEIKAIVNNKSGWPARVCENLSFRYFINIEEIVNAGKSASDLQVSSSYNQGAKLSDVKHYKDNIYYVEVDLSGTKIYPGGQSAYKKEVQFRISAPEGTVFNPENDYSYQGLSAGTVVKSEYIPVYDAGVLVFGREPLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDOGLUCANASE 1
publication title Reassembly and Co-Crystallization of a Family 9 Processive Endoglucanase from its Component Parts: Structural and Functional Significance of Intermodular Linker
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/sugar binding protein
total genus 36
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2xfgB01
4JO5A 4B96A 2XBTA 4B9FA 1NBCA 1KFGA 3ZQXA 2YLKA 2WOBA 4B9PA 4B97A 1K72A 4B9CA 4TF4A 1G43A 2WO4A 3TF4A 2XFGB 1TF4A 1G87A 2L8AA 3ZUCA 1JS4A 3ZU8A 4C8XA 2WNXA 3ZQWA 1GA2A
chains in the Genus database with same CATH superfamily
1CJYA 1T3FA 1HH9B 4XP4L 2E75C 2WB1A 5BRZA 4GAJL 4LFHG 2CGYA 3F83A 2DMGA 4R0LC 3QIUB 1QHOA 2Z65C 5GS1B 3GSNL 1KB5A 5AENA 2FHFA 4IW4C 1ZLUK 3C8DA 4NM8L 4OLEA 4Z5RB 2WTRB 5C0DB 4PS4L 3QUYA 2EAEA 3VFVA 3H56A 3RTQC 3D9AH 1KFAL 3EYQC 5FO7A 3RGVC 1EMTL 5A16B 1B6DA 3GMQB 4RDBA 2WUBL 1TNNA 1T20A 2JKXA 3HMXL 4XGZB 2GJZA 1IE5A 2P7TA 3EW3B 5C1MB 1HQRB 5HHOD 1R5VB 4CBPA 1FNSH 1KIQA 2WBJD 2BZCA 3QPKA 2NY4C 3JXAA 3HNTH 5LXVA 1UUSA 2VN7A 1BZ7A 5I30H 2HXAA 3NMEA 4HUUA 5C07D 3UTSE 4CMMB 1T7VA 1XL6A 2Z4QA 3ZO0A 4N3TA 1G6RB 5EIQA 2X5PA 3V0GA 2HRPH 3CVIL 4JDZA 5E9NA 1GA2A 4KAQH 4ODSH 3VU2A 5IHUH 3ZHNA 5AW8B 4K94H 2XPZA 1R24A 3DETC 3O2WH 1GTFA 5HHXH 3H42H 3M46A 1ACYH 3BWSA 4XVUD 4N2CA 3NIGB 1S7UA 1ZANH 3EOYG 5DK0A 1KTBA 4JKNA 1AIFA 1WIOA 3K6SB 1P1ZB 2CR3A 2VLLA 2CM6A 3APFA 2GAZB 4NUJB 1OTUD 1HYRC 4XC1L 5AD0A 3K3QA 4HUMB 5DLLA 3UG5A 4RBPH 1L9MA 3BZFA 4K7FA 3L5JA 1NC2A 1VCAA 4R7XA 5ADOL 3HJEA 3OKOB 3D0AA 3BGAA 1SOQA 4M43H 5IHLB 3RKDC 4JG0H 3NACL 4NO2A 1YEFL 1KCUH 3FB6A 4LLUB 2IH3B 3HC0B 2J71A 2AZAA 4YDKH 1JXFA 3KR3L 5BZWA 3V0EA 5HJBA 4ELMA 3Q44A 4PJBA 5DVMA 5AL8A 1IBGH 3MLRL 4CVZA 2OXHA 5DVNA 4JFUA 2Z91A 2OXGA 4ZMWA 3OHXC 4G7VH 1GMIA 5ALCL 1HEJC 4OJAA 3RVXC 2AC0A 1NLBH 4J5VA 4OIAA 5T3ZH 3QI9D 3BIKA 3R4DA 3VDAA 1QNZH 2Q20A 3W11D 3GMMA 2EO1A 4TS6A 4JHBA 4UILH 4WKZA 2R0LL 4WWPA 3C5JB 5BNXD 2BDNH 4NN6C 4X4ZA 1U8HA 1TU2A 5HSFA 1HHJA 3GJEB 1PZDA 5L2KA 3EFFA 4OZHF 1I7RB 5I66B 1J8KA 4Z7WB 2WJ5A 4RGNC 5TDNA 4TSCL 4NSKA 4I3SH 4Q97A 2R2BB 2I7SA 1TEFA 4BDVA 2A7BA 3U0WL 3C5ZA 4LLVB 3UFIA 3VWJC 1DCLA 4E9LA 2KT6A 1DUZB 3PHQB 2R1WA 4HUCA 1CYWA 4OLXH 5I6PA 3CDFA 1MJ8L 3OWEA 5DS8B 2YAPA 3GSNB 4O5LH 2B2XH 3VXME 1NBZB 2UXFA 4JHWH 3NPZB 4ETQB 1Q38A 2ZOUA 1IAII 1QBML 2PN5A 1D2OA 1R33A 2PXYA 2RHEA 3QI9B 5BW7A 4KQ3H 4UDTB 1MAJA 1XGQB 4WQOA 1AC0A 4G43A 1G87A 4M5ZL 4XPGL 1FORL 3IGAA 5E5LA 1LEGA 5JHBA 3W0WA 1BPVA 5EF3A 1RMFH 2BSSA 2CGZA 4PG2A 2ARJQ 3O6LH 4C55A 4HLEA 5EU3B 1DN0B 3LKRA 5CNHA 2IOIA 3PPSA 4HSQA 3MV7D 1MFNA 3SJVA 3ARDD 1I53A 2X4OA 3VI3B 3N1FC 4QXWA 4MXVF 2FO4B 1E9QB 1HI6B 3FCBA 1CR9H 3BKJL 5PCYA 1PY0A 5DJ6B 1MUJB 4PUBH 5AYUH 2LGNA 3SD2A 3RBSA 4KROC 4X98A 1I1YA 2J21A 3U1SL 4TTDD 1OE3A 4QGYA 9CGTA 2CGRH 3DSNB 3QAZB 1S9VA 3CMGA 2IANE 3QUXC 1GY1A 3LEVL 4OZ4B 2D0GA 1RK0A 1HFUA 1C12A 3JSSA 2CRIA 1O7DE 4JPKL 5FDWB 4B7LA 4X80L 3WMPA 1E28B 2Y2YA 1H19A 4UM8B 4LKCA 1BVLB 4OIIH 5EN2A 2CNZA 2YPVL 3RBGA 5HYEA 1T89C 2OMZA 1RLWA 2XQBL 3IXAA 3OPZH 1F58H 2H8PB 4JB9H 3MV7B 2O6PA 4WEUD 3ARDB 1YRKA 5E2UL 4QUOA 2ZX8A 4M02A 5CN1A 1YQVL 2VDNL 4C56E 4P3CL 4TLSA 1NCAH 5CCGE 5LVEA 2B1OA 3QZOA 1A7QH 3OJDA 1QBLL 4GBXD 2JCCE 3TX4A 2CMRH 1XX9C 3N1GC 5FK9B 4KVPA 1U2YA 3RHWK 2C4XA 2ENJA 2JSFA 1VF5C 1BGXH 4PLJC 1IC7L 1MJUL 1OOWA 2AVFA 1BIIA 5HD8D 4JDEB 2FT7A 4J3UA 4DW2H 2W92A 3D2UD 1O6VA 1IQWL 2IVFC 5GSRB 4LSPL 5LG1A 2AKRA 1DBKL 1D5ZA 1P5VA 2GBAA 1PX4A 3GYRA 4HJ0D 4MASA 3UTTA 1DSFH 4LP4A 5EBLA 2NNXA 5BQ7A 2Y69B 5I6MA 5DO8A 4P2YA 3W39B 3CN0A 2JCWA 1LWRA 3K4DA 5IBLC 3U9PH 1Z9SB 3BHBB 3MRBA 5KG9A 1HE8A 3HIZA 4I1NB 1FL6A 2X6MA 3WEXA 3NCJH 1C7TA 4XNUL 3SYOA 3IJYB 1Q9LA 4AEEA 1RZQA 1OAUH 2E5EA 4U6XB 2BP5M 4PJDF 2NX5B 3SBPA 2ZX6A 5IFAL 2YD0A 5CN2A 1GKOA 2ZOWA 3ABGA 3APMA 3RDTC 3VRJA 4IHOB 4JFZL 2AANA 4PN6A 3MBEC 3CTTA 1QOKA 2ZOLB 1EH9A 3IRCA 5EMYA 4BSJA 1V54B 4CC0A 3D2UB 5JIMA 2LQRA 3PDDA 1ICTA 1CK0L 2J1XA 1FI8C 3OLEA 4MJ6A 4ZK8A 3V7AG 2OMBA 1NGQH 2G5RA 2XRAL 3K6DA 4RA3A 4Z78B 1INEH 5E6RB 1DBML 4ONGH 1KCVH 2XTLA 4YHNB 4GG6B 3FFOA 4QAWA 2MCAA 3U2SA 1H9VA 1NBQA 4ZW6A 3ULUL 3FU6A 4AC2A 3HI1B 5FHBH 3SO3C 1X5KA 5EZJA 5JPNA 4Q6IB 4DKEH 5F9JB 1JZ6A 4WTWA 3VD2A 35C8H 3HG0A 3QFJE 5F3FA 2ZPKL 2PWHA 4H1LA 5KOMC 3T4AB 2LABA 2XIDA 3X1NA 5HY9A 1UQSA 3K4ZA 1ZRUA 4WO4C 4EI6B 1PZAA 3LZFH 4N6RA 4TVPH 1NCHA 2IMNA 2Y1YA 4BZ1H 1FPTH 1EZLA 3R06B 4X83A 5GISH 5HHVL 1HOCA 4HC1H 4AV0A 1P7BA 3HG3A 5DUPH 5CP7A 3AU1A 4Y8AA 2CIIB 2D31B 1CFBA 1I8IA 1T21B 5I23A 4Z0BH 1CZ8H 4OLZL 4F15B 4ZMVA 1JGVH 1F18A 1OP3H 3V9CA 5IT2L 1SLVA 3DO4A 5D7KD 4C4UA 4ZX5A 2ITEA 5GZOA 3K71A 1NFDA 4L4TA 3OTTA 3IFLH 1WFOA 2FBJL 4L8DB 1LK3L 5I0YA 1DQLH 2EABA 1XDTT 2WZPA 3AS1A 1KJ2A 4YSPA 1YDPB 1AGEA 4X6EB 2VDNB 5D7SL 3TJPA 5IUCA 3KPRD 3FAXA 5IFJB 1CB4A 2QSQA 1ZS8B 3IFOA 4I0PA 3NUKA 5TH2A 3FB7B 4P5SA 1MH5A 1DHKA 2E86A 4GW1B 5BRPA 1S6NA 3DX6B 2NY1D 1N64L 4U1LB 3UH8A 2X0UA 3LIZL 1AJ7L 1AVAA 3OM3B 3G04B 1H6TA 1TO5A 3NN8A 4PJGE 5BO1L 3WS3B 4EDXA 1JSYA 5TK2A 5GRUH 2OL3H 4NZTL 1FGNL 1I3UA 2A6KB 5DMJB 4LVEA 4H20H 3W57A 3WE1A 5LDUA 2AV7A 3HPLA 1DEEA 4P9HH 1BEXA 2KLSA 5CP3A 5KZCB 3D18A 4BFNA 4X5XA 4H44C 4NM4H 1TCRB 4Q9QH 4PGEB 3JTTA 2K6ZA 1T1WA 3Q9QA 4YDLC 5I8KL 4QYOA 1KLUA 1SDDA 1YEJH 1IT9H 4FF9A 5I9QB 2O72A 3KPRB 5BVPL 2HG5B 3D48R 2VL5B 4R4BB 3STLB 3UTQB 1DJYA 1LL1A 4HLJA 2I5YH 3VU1A 2YIHA 3VA2C 1XB6A 2DI9A 3QE5A 5F8RC 1NCWL 5EF2A 3L45A 1BFTA 2EXYD 1NBVH 4TN9A 5DJ0B 2YSSB 5F9OL 1UM6L 1ZEAL 4ZFOA 5GS2H 3Q3GB 3ZE0E 5DJ2A 5I8EA 3NCFB 3CLFH 3T1WA 4WFFE 5HHPA 3VXTB 4I5BA 4HG4J 2JI1A 2YPKA 2QPSA 3LKPB 3V4UH 1MVYA 3LS5H 4NKDB 3D30A 4HS3B 2LU3A 5LXGL 4JO3L 4Z7VF 1MCBA 2B3RA 1IGCH 4L3EB 1I7ZA 1QP1A 4HWZB 4EI5A 1A4KA 2FJFA 5DJDB 2DQTL 2J73A 1OSPL 3FT2A 1IFGA 2H32A 2BZ7A 3SZKC 1H3XA 2G60L 4G9DB 3QWOB 4KXZH 4XN7A 4D0CA 3B9EA 4OM0H 3VFRA 1A6WL 3LZNA 4JDTL 3NAAL 5BV7H 2IDSA 2MPVA 2D0HA 3S6CA 4H8WH 3H3BC 3IPBA 4D94A 2WO2B 2DQEL 5F7EH 1EDHA 5EPMA 5C0EB 2XICA 2R4SL 2QLYA 3PGFL 1TQCB 3Q2WA 1VEOA 4LHUD 2UVEA 3JWNE 3SQOL 3QXWA 1R46A 1AACA 5I1AA 4POZD 4NN5B 3EF7A 1U3YA 3FU7A 3LSOB 4R96B 3VGDA 4F2MB 2FO1A 2PO6C 4RRPG 1TEYA 4P3WA 1N4XL 3Q2LA 1MXDA 5JHLL 1E3ZA 1OT2A 1H3PH 4LBEA 3UGUA 1KGCD 4OGAC 2OS7A 3CIAA 3BXNA 3OB0K 2H6PA 1A7NL 4UAOB 5DD0H 2XPGB 4FXKA 3ARYA 3S0PA 2WLIB 3IKCB 1BXUA 5HGDB 3NYKA 2XN0A 3MGTB 4RMBA 2ICWI 3VNYA 1DDHB 4HUKB 1E27B 1NPNA 5BVJA 5IIEB 1B2WL 5TJWK 2O5XL 3C8HA 2J43A 4NKMA 1JHTA 5IVXA 1J5OL 1BVNP 1EO5A 3MX0B 2Y7SA 3NIFE 1VKXB 5SX5K 4LHUB 3U7YL 1NCTA 3EO9H 1FGVH 3GI9L 1O9ZA 3EHBC 4EIBA 5IMMB 4DP1X 1X5FA 3JV0A 4I2XA 4MNGA 1JIBA 4HWBA 1TUPA 3M1BA 5IV2B 4ICWA 3UPAA 2O1AA 4JDVB 3NH7H 4IRZH 2NW3B 3V52L 2TSBA 4XBEH 2EICA 3UPRB 4ABVA 5EBMA 2V2XA 4ODVH 4ZFGL 5ETUA 2ZXQA 3VQ1C 4AUYA 4DAGL 3F7YB 5JW5B 1IEBA 3MNVB 3OKMA 4QF1B 3HHRB 1SMAA 2ZTBA 4RH4A 4KDVA 5DCCA 4TVUA 4LARL 1WAAF 4HZ1A 3WFHA 1NEZA 2L3BA 5C0BE 4KK6D 1EAQA 4UINL 3C12A 3D52A 1OAKH 4R4FL 3NDZE 2UY7B 5IKCB 4K3EL 3L1GA 4ODXA 4ISVA 4V2BA 3STZA 3MLSH 1FZJB 1ACCA 1JWSB 4Y4KC 4AM0B 5TTRA 3GD1C 1HZHH 1O6TA 5C0JB 1HWWA 3HJ0A 3MRIA 4QRUA 1EK3A 2Z4TA 3PXHA 4H25A 4WI4A 2Y36L 3ATFA 1G7MA 2PWEA 2VXVH 3AXHA 3WUWB 5CJ8A 5EZIL 1V7MH 3A3YB 3ENEA 2ATPA 3L5XH 4Y5VA 3T71A 3L4YA 2YA0A 3GXMA 3I6GB 4KK9D 1CFSA 4NN7B 4GUQA 5B21A 1NJ9A 4OH2A 1BOGB 1W8EA 2NXZD 4JQIA 4XZ4A 2DQ6A 1PKOA 1UJ3B 2WWMD 4JPWH 4NT6B 4GP4B 4FNTA 2H0PA 3T65A 5CEXB 1P9MA 4WWKC 4GFTB 4HKJB 3DVFA 1BBDL 4K3DL 3N85L 1AQKH 5IFHH 2NUPB 2MCMA 1QSZA 3IDIB 2NY3C 3KAAA 1NFIA 2BHFA 3F84A 2MKLC 3U4EB 2PYFA 1KLFA 3AMLA 1T5KA 2VLJE 1TTCA 1AZZC 1NPJA 4JO2H 5DHMC 2WQ8A 25C8H 2YGOA 5DEFA 4PRPD 5BQDA 4ATTA 1ADQH 4PJ8D 1IFRA 3P4OB 4MLIA 2UZIH 5I74B 2JKJA 2DF3A 3NSYA 3PJSB 5J3HC 2NXZB 1W72L 1DQQA 1UD6A 4HSCX 4RNRA 5IESL 3QXUA 2YQ3A 3QIBA 3T0VA 1VACB 3CZLA 1A6TA 5BO0D 2R4RL 3LNIA 3E6HA 4PJ6A 5F1IB 3MBWB 1SDAB 1R5WB 3WXWL 4JMXA 1UOKA 1JRHL 5CBAB 1CF1A 1UZ8A 4N0YL 2IF7A 4O2CA 4CU7A 1RSYA 3TEWA 3CVHL 3B83A 3KLAA 4FP8L 1FFOB 4UQ2B 1FE8L 3QO0B 4K55A 4UV7H 4RZCA 1RZKC 3P3SA 3N0PB 4G83A 5E8NA 3CZJA 2WVUA 2FATL 3RP1A 1Z1WA 4PRPB 5MENA 3HZYB 3D33A 5L2KE 1LM8V 1SGKA 5D2NB 3CDZB 4Y16A 5C0CE 3CD4A 5I5IA 4OAWB 3WNIA 2AFNA 2WXNA 4TUOA 4BA8A 1XMEB 3GXDA 2LR4A 1VB9A 3MA7A 2IPUG 1N12A 2EDYA 4CSPA 2EO7A 4APXB 1S9KC 3JV6A 2MRYA 3UIZA 1JWMB 3OKLA 4YSAA 1NCNA 2VZOA 3ESNA 2ZUSA 3KS0J 5AG9A 1FFNA 3VFGL 2RCSL 3TBTA 2W0LA 5DHDA 3HZKA 2AEPH 2PTTA 3P4MB 4LEOA 2OI9B 2QDVA 5AB9A 1A02N 3N50A 3WUZA 2ZICA 3G5XA 2BJMH 1DVQA 1S78D 5F3HB 1M57B 1CXEA 3NFNB 2FT6A 2YXWA 3OLIA 3MJ8A 3W0WE 1SYVA 3BWZA 3GF8A 5MEOB 1TTRA 2DPKA 1JV5A 5F7HA 3QORC 2E3VA 2DKMA 4QRBA 5IROD 5LCVH 5E2VL 4GMSL 2A9AA 1BSIA 2EC9U 4PLOB 3FOMA 5IJVA 4U7MA 2XFXB 4I4WA 5J6GA 3V5DA 4N2IA 1XH0A 4N68A 3THML 3C2AH 2J2ZA 1OAXL 4K9EH 4JCWA 4B50A 5E4AA 4ICXA 2VXSH 2BNRE 5B1CA 5GGTL 1ZLSL 5KSAA 1L3WA 1X5ZA 4W9GC 4JRLA 3CFJA 5F7DB 1JUFA 3GEFA 3DO7A 3VFTA 5DRWA 4M4PA 4UT6A 4MDIA 4CADA 1BQLH 3NCXA 4DFIA 1AY1H 1ET8A 3TCTA 1OVZA 2DRUA 2GTZA 4PJXA 3BPOB 1ZV5A 1ORSA 2EDWA 4NNYB 3UYPA 4PJCE 4KJPC 4NQCA 1AGDA 2J1YA 3A6CL 1PZBA 4WO0A 2WXOA 5HPMB 3TO4D 3O8XA 3MLXL 3MYJB 3V0WL 2VMDA 3ULVF 1XD1A 1NGPH 2DIAA 3PE9A 3QRLA 1R3LB 4BGLA 2NXYC 4WNJA 4X5WB 3PDGA 1IVTA 2PR4L 3K74B 4JMNA 4YSSA 2WSPA 3CHXA 3VG9C 3NJHA 2VDRL 4BFRA 4J4PA 3MCKB 1KFGA 1W72B 3BT0A 3W9EB 2LHAA 4X7FC 4CNIB 3FN3A 1YAIA 3RTLA 2AQSA 4N8VG 4OUUB 2BP0B 4YC2C 2R0WL 1CDJA 1H6FA 5D7JD 2FEEL 1QTPA 5JUEL 1HJBC 4XWGH 3VFWA 4G1MB 4JFPA 4GMTH 4HS6A 4HPYH 4OCMC 2XVGA 4QHKI 3GBDA 2BWIA 5HDQH 4EIZC 4JPIA 5TE7H 4DPAX 3NJXA 4QTHB 1JZEA 2Q6WA 3CVHB 1E0OB 2GITA 5FGCE 4PB9H 1QFWI 2WN3A 3TO4B 5ID0B 5AFAA 4OU3A 1KN4H 1GPOL 2H2PC 2NCEA 3MRHB 3RWGB 1BFSA 3EYFB 3DIVA 3TBYB 4XBPB 3FPXA 3JWDC 1GS8A 3KXFA 2XJLA 4UAHA 4MA1B 4X8GA 4BFIA 4J3WA 2GABA 3OR6A 3TVMC 1IFHH 4AYID 4Y4HD 2YBRA 5IJCC 1VFMA 1OGPA 4MAYB 3S3BB 1KNOA 2ZG1A 1QVOB 3VQLA 4EQ2A 1CN4A 4PJAA 2K1MA 4ZTOL 3MOBH 4HP5A 5DRNB 3L5IA 5JOFB 4HGKC 4Z7OB 1UXWB 1SMDA 3WTYA 2EDNA 5DT1H 2CAKA 5EZLB 4PV1C 3PWLB 3GXPA 1NAKH 4YHIA 5EF1A 3U7AA 4N90D 4LBAA 1IBFA 4Z7UF 4PD4J 1TJGL 2JQAA 1D7DA 2YAFA 3RIFK 4FA6A 5D7JB 1KTDB 1Q0YL 2HLAB 4JO5A 2ALAA 4J3SA 1U3ZA 3IBOA 3VXOA 3AM8A 3BH9B 3GI8H 1ORQA 3K6NA 2GTWA 2FL5B 4LE8A 4RWHA 4L8SB 3AQZA 1SJHB 3J07A 3UDWA 3MNZA 4JM2A 2UWEE 3FT4A 1NDGB 2JJUA 1MNUL 3N41B 4KY1L 4GQPH 4EUPA 4F7TA 1SBSH 3E9UA 2IALB 2AAAA 1IB5A 3MFGB 3UBFA 3UJJH 3GHBL 3UO8B 1AOZA 1WS8A 3WTXA 1LDPL 2IPKB 4GH7B 3HNSL 3WE6A 3QIUC 1U8PA 2H3KA 4Y4HB 3ILPA 4AG4H 3VGFA 1FFPA 5GS1C 5AB2A 1OO2A 2UYLB 2ALWA 3SE3C 1FNLA 4N86A 5IM7B 4MQSB 5I75C 3IDJB 1WCBB 4PG9B 2VMFA 3NIGF 5F71A 1U93B 1U8IB 3FQNA 1FL5A 2DJ4A 5DI8B 4UTAH 3RVTC 1WHPA 4M7ZC 4OCXL 1S7QB 2IBZY 2E47A 3D07A 4NRYB 5DC2A 3BAEH 2A73B 3L1EA 3QDMD 3EAKA 2FAUA 1CDUA 2NZ1A 1OTSD 2ICEA 3LMJL 5EWIH 1XBRA 4U1SA 3R8BB 1PZUB 1Q72L 4XMPL 2X1WL 1DLHA 1AYOA 1N0LA 4KUCD 3SGJC 2YAHA 1S7SB 1SEBB 1PLGL 4Q9RL 3DUSA 4ZI8A 1ZD6A 3QT2A 4OV5B 4BKSC 3TNMB 4NJAH 4ZX6A 1X5LA 3C09B 4ZDHA 3BGMB 1D7FA 1D3CA 2EKSB 3S4SB 5I1LB 1QRNA 5HYSA 3MREB 2LAGB 4MCMA 2VDRB 1BXVA 1UXLA 1CBJA 1I85C 1XAUA 3VWKB 3O2DH 1X9LA 4LSTL 4NC0B 1RVFL 4J3OF 1BF8A 1F4YH 1IGFL 2FLRT 4OGQC 3ME0B 4H8PA 3VGBA 1IGJA 2C3VB 1F0LA 1MCCA 2C9QA 2Q76B 1LEKB 1X4YA 2OMNA 4Q56A 5D8JL 5AVVB 1I8MB 3QDMB 2QDWA 2QQNL 1BFVH 2RFXA 3BDXA 3DVGA 3VH8B 2L04A 5DD6B 3W37A 1CGVA 2Z3FA 2XWCA 3BVNB 4KOBA 4X7SH 2GSGA 2NUTA 2PLTA 2DB8A 2AXFA 1JXDA 3U36A 5T5NF 5F0LB 1QD0A 2ADIB 3IRZA 3QFDB 2YAOA 2X3AA 3P1VA 4L1BA 3EOAB 4BK5A 4TSAH 4PH8A 2ZXWB 3G5YB 2YUXA 5CGYC 4FL4C 1AXSB 3FT3A 4AH2A 1LO3H 2VMEA 2X4QB 4TOYL 3GHPA 2BERA 3FT9A 1NMBL 3QJXA 5DJYB 4G6MH 5H94B 4CW1A 2APXA 3UJIL 3TURA 4F8QA 1YNTF 2MCPL 4YSQA 5C3IA 2YLKA 3N43F 1KXHA 1S7RB 4J3OC 3FUNA 2WC7A 1AG0A 2EYSA 1KJMA 3GMLB 2QGDA 3C5SB 3UGEA 1MCOH 2QQKL 2ZXCA 1I3RA 3MROA 4GP5B 3DOHA 3AWFA 2F54D 4HPOH 2EXWC 5I1EH 4QI3A 4GKSB 4PBVC 4EDWL 4N8PA 3ILQD 2CO6B 4ZPTA 4FDWA 2NTFA 4UQIM 5KW9H 4TPRL 5C3LD 4P5MA 2GKIA 2EACA 3DX7B 4DFHA 2QADD 5LWYH 3RWJA 4XP5L 1J87A 2APSA 3VQMA 2XLLA 4JZOA 4IYKA 3QJSB 3D08A 2CRYA 2PCPA 3V7AE 4XO9A 4JG5A 5E8PA 1P6FA 1AQDB 2JELH 4GRWB 3DV4B 4DCQB 1CGUA 1OPGL 4XVSL 4TM9A 2CUIA 2KL6A 5K39A 1U21A 2WINB 2X4PA 3OAZK 5CHNB 2IDUA 2EVFA 2G3MA 3QI9C 5TQ0H 2VMCA 3W11C 3J7HA 1CBVL 2CPUA 1RULH 2QBWA 1CD9B 3F3HA 3BWAA 2GI7A 1ODUA 2BVEA 12E8L 2XKNB 4NPKA 2FJHB 4KMQA 4MDRA 5TGBA 4LCCB 4GQ9L 1AHMA 4IU2B 3E6FB 1HCVA 4XZUA 5FOBB 3BP4B 1JOIA 4FQ2H 1FNGA 1XFPA 1LK2B 2QADB 3NOIA 2HTKD 3UZQA 4B9GA 3ZTNL 3CN3A 4MJID 5DQ9A 3HMWL 1FH2A 1OE2A 1DVFA 2KDGA 1QSEA 1XR8A 4HMCA 4OB5L 3TPKA 5KYXA 1KB3A 5C9JA 4K5LA 5GZND 3QAZC 3HKZA 1SXSA 5IVXE 1CL7I 3BAWA 3O3AA 3BJLA 4M6OH 3JV4B 5FKPB 3DXAE 1WZMA 2IEPA 3QYCA 3AWGA 4DZBB 2X7LA 3W2DL 5GXBB 2FJSA 4BH7A 4CVXA 4F2EA 1V55B 1CG9A 2G2NA 4YHPA 5IB5A 3D0VA 2WLMA 4W4NA 2QMKA 1CIUA 4X7TA 3CFMA 3B1UA 4LLMA 1CXIA 4PJFB 4WUUE 4J12A 1A7OH 1EJOH 4JZNA 3WIAA 1TZGL 3GXUB 4ABQA 5DRZA 1KLGA 2LU5A 3FO2B 3UC2A 3QRFM 1EVTC 5DEGA 4WV1B 4M62H 1OGTA 3KPTA 3E80A 5DURD 4MJIB 4OCRH 4YZFF 2B14A 1UOLA 3RZCC 2I26N 5EEXA 1VFAB 3ML8A 4KI5C 3O6KH 1GHFL 4QD2E 4QHUB 1HHKB 3GSUB 3HR5B 4TTDC 4U1GB 8PAZA 1VLXA 2P1YA 3AUVA 3D39D 3IFNH 5EC1B 4Y19E 2FQFA 5C0IB 3ARXA 4F7EB 3DMMA 5JXEC 2F9BT 4N0FB 4R7DB 3LV3A 3D8MA 4YLCA 2Y3NA 5C6PB 4EF3A 4XNYH 5FYJU 2FYVA 3Q2NA 3S35L 2JK5B 2GY7B 4I9WD 5L2JA 3V4PB 5TK4A 5A7BA 1JDDA 3EOTH 3HFFA 4DN4L 3MJ7B 4U1KB 4XTRD 4Y2DD 1PG7X 4OLWL 1DYZA 3P30L 3X12B 1QKZH 1KJ3H 4NO0A 2XV0A 4GJTB 4ADJA 2Y5QA 4BK8A 2VR3A 2FQEA 1CT8B 3BEWA 3GK8L 4H88L 5DURB 5AUMA 1B2YA 1XF2A 1QR1B 3P9WB 5D7EA 4OZGB 2EUWA 2WIMA 1NGWB 1I1FA 1A9BB 2I07A 2JJTA 3ZE2E 1MHCB 3KWWA 1LEIB 4S1RL 1FP5A 3ZDYE 1FVDB 1NCDH 4PRAB 1PX3A 4WI6A 4KKLD 1AZUA 2BNQA 3D39B 4YSTA 5FM4A 2WWKO 1T0MB 3KM1A 1ZHBA 1UKQA 1ZY9A 4PY7B 1S5HA 4AGQA 5J9PB 2AV1A 2VMJA 3APDA 1MCPH 4L4VD 3S5LA 1T83C 1KIPA 2PPAA 4E9XA 1A7PL 5HHME 4LRIA 5E6IA 1LP9B 1A2YB 4N2MA 2MEJB 1CI5A 3VGAB 1AR2A 4LIQH 4NQXA 2XV3A 4C8XA 4IKJA 3Q2CA 3RJQB 5IGXH 2XTJE 1F45A 5T1MA 2ICES 1N3NB 3PV6A 2FGWL 2E76C 1J5CA 2FIKB 3IFPB 2VLKE 1K8DA 5EBWB 2D2CC 2VDKH 1GGBL 4BSVA 3Q13A 4OGYL 5I6OA 2HJKB 3IMWA 3QQ9D 3DIFA 4Q6IC 4R0LA 1K72A 3TLRA 2X9ZA 3T4AC 4EN3C 1VADB 3CGTA 3MRQB 2B4CC 2DBJA 3HFMH 4G1EB 4UU9A 3L1OH 1JWUA 3AG1B 4PV9A 2ILLA 3PU7A 1WV7T 5HGGS 3RAJH 5FYJL 3UO1L 3SKNA 2EDOA 3ULAB 3QUMA 1VGKB 1IKNC 4XNAA 2PYEE 1QASA 3LKSB 2Q7AA 4PCSA 4C58B 2A6IB 1FVEA 1INQB 3LXCA 5FA3B 4DN3H 1CPUA 3KPNA 1KC5H 3MODL 4J6RH 2DLFL 3Q5TA 4NO5A 1JZFA 3QCVH 4GXUN 4YN3A 3EGDB 3VFVB 2XSKA 1N6QL 4R7NA 5DC4B 3CVBA 5ACZA 4RWYL 3L3GB 3OGOE 1OV8A 1QWNA 5F7MC 2F68X 4F15C 2OZ4H 2TSAA 2VDOL 1RUAL 3KDPB 3IETB 1ETA1 3FOLA 4LEEA 1TF4A 1KGJA 3GXIA 1MFUA 2WQUA 4OCSL 3T6WA 1HEZA 4X6CB 2AS5M 1OCOB 1XGTA 5TF1L 3HHMA 4ZAKD 3NZHH 1ACXA 1AMXA 3OKDA 3PREA 1N0XL 4IQHA 2Z4QB 3L6FA 2WXQA 1P7QD 1OHZA 4GLRH 3BSZL 2WXMA 4BSWA 3TZVA 1WA1X 3PDOB 4M7LH 2IQAB 1PZ5B 2XQYG 3GBNH 4FI7A 2YMTA 4PWKA 4YHKL 1FZMA 1CU4H 1S7UB 2AEQL 3NCYP 3OQ3B 4D3CH 4WHDA 4FMFA 3GS4A 4N5ED 5DO2C 2VAJA 3V6ZA 3SO5A 3DRTA 3H6AA 3NA9H 2AJ3A 4H0HB 1NEUA 2D8KA 3SDAA 3DOSB 3S36H 3Q6FB 3GS7A 4HUWA 4K7FB 3WKML 1CXKA 5HDRA 3RVUC 4AZ8A 4LCWA 4BXVA 5JTWA 3VX1A 4ZAKB 1SYSB 5G2NA 1OCWL 4AYMC 5IHBA 4NO2B 4NKOB 1R9FA 2D73A 5HGBB 2A77L 3SDYH 2QTEA 3FQXA 1IAKA 3FO9A 2IG2H 4ORGA 4BFKA 1G6RH 3O81A 4NQVB 3I50H 4Z95L 1NUNB 5F9WB 4XC3H 5FYJD 3ZE1E 5BXFB 5ELIA 2AK4D 4E9QA 4YDJB 4LLQA 2NNAB 3F7KA 4PJXE 5J7CC 5I15L 4FFWC 3QGVA 4L8BB 5DZJA 1MVFA 2GC7C 3OG4B 5FC9A 1MCHA 2E9GA 4Y5YB 5DFVC 1I1AA 2ZCHL 1BVOA 2K8MA 4JHZA 2MPAL 2C1PA 1TMCB 3OXRA 4GKLA 1DANT 3P4LA 5T1JA 1XGZA 2GJ6E 1NGZA 3P73A 4QY8A 4NZUL 1CDHA 1YEGH 5DUMH 5FYKL 3L7FA 3ULUC 2D7TH 1HJCA 4KRPC 3QPQD 2WD0A 3IDMB 4ODUB 1Q9KB 3GHEH 1K4DA 5ESVA 1JYXA 2X4TA 4GQZA 5EOCH 5KANG 1BWMA 2R23B 3VWJA 4MQ7B 4LCYB 2AGJH 2KKQA 2BXZA 32C2A 2VN6A 4HPHA 1CLOL 2EXYC 3C5ZB 4U33A 2P80A 4KZ0A 1JF1B 2HT2C 3B9KD 1EO8L 2AK4B 3MYZA 2J6EH 4K07A 4ZMYA 4NN5C 4IJTA 4L1HA 5H35B 1IBYA 3BZ4B 5DFTA 1QEXA 4L1TA 4ZUSA 1YEDA 2I32A 4LSRL 1IIKA 1KTLA 5CZVH 2IFFL 3RNKA 3NZUA 3CBRA 3HG1D 5C0FA 4N3UA 2AEOA 1TZOA 2BM3A 2ZQKA 1S8DB 1Z5LB 2TRHA 4Y9FA 3WV0A 1UHVA 2ADFL 4UAOC 4V2CB 2CE6A 2VDOB 4WFEE 5L4IA 1C1EL 3MAWA 3MV11 3HE6D 4ES8A 3SJVB 4NWUH 3OD3A 2A9NH 4QRSB 3FQ1A 3FHEA 4PJAE 5I1IH 4QLRA 2E4FA 4WK2B 5TQ2L 1UWEH 3J27A 2YD4A 1ASPA 4XN4A 4XP4H 4PR5A 3T6QC 4QLWA 5EO1A 1UKTA 3B9KB 3QUXA 4XMKH 5CIPH 2EYTA 3OKEA 5JNYA 3U30B 1YMHA 2WMPA 4POZC 4KKAD 3MRJB 4DOHE 1LO2L 3EYUL 4JW3A 2NW2B 1H3GA 3CMOH 1SY6L 2X2JA 4L3FA 3HG1B 1SQ2N 4P0DA 3F7RA 1T89A 1UA7A 4BK4A 1P4IL 1TR7A 1R3JA 1UENA 4M7JL 5CEZL 2OTWB 1XF5B 3EJTA 4LRNH 3VXUE 4JFHD 3QJFB 1EMTH 2OMZB 2MOVA 4WW1A 3HE6B 3Q6GL 2WUBH 2H0JA 4DZ8A 1T6VN 4KXCA 2X4SB 3O6FA 4JFXA 5AW9B 1VGEL 4JKPL 3T0DA 2HFGH 3RRQA 4WEEA 2BZDA 1XCQB 5HVHC 2NY0D 4AE1A 4PTTB 3JBG7 3QDGD 4ETYA 3AUWB 4FYQA 5AAWC 2Z6FA 1XEDA 1R3KB 3L4TA 4FQ1H 1E30A 4E41E 5B3SB 3D3VA 4RAUA 3CVIH 1CGSL 3AGWA 1ADQA 2XZQL 3BE1H 5IBUG 1MFBL 1X6LA 4ONOA 2HUEA 3VI4A 4AW7A 4CC4A 1LWHA 3TEUA 4DKFH 4ZSOB 4L8CA 1Z3GL 4GP8B 4ZUTA 4G6AD 1U95A 4XH2B 1FCCA 3UEZA 4NZRL 5CD3B 3PWPA 4BCZA 2CBPA 2K7QA 5IW6B 1QFPA 1MPAL 1DE4A 2BSTA 3K2UH 2K4AA 3T2NL 5D96C 4N2BA 5HTSA 3MMEA 3LEXB 2Y06L 4X6FA 1UJ3C 4XC1H 5HI3D 3GTTA 5I16B 4XO3A 3M6DA 1JXKA 1MHEA 4PVLA 1HEHC 2CUAA 2Y7QA 2OSWA 3RDTA 2JJWA 2NY0B 5ADOH 1UWXK 1T03L 4BQBA 2VXQH 2EEXA 3QDGB 4HGWA 3CPLA 3EO0A 3V4LA 1U42A 5CILL 3NACH 1AI1L 2N3JA 1YEFH 3VB9A 1ZVSA 3DIDA 1FV1A 1ETZA 3FU5A 3KR3H 2IADA 5E5MA 5F7FA 4ACTA 3LAFA 3IGKA 2B9AA 2J7LA 4UT7L 5F0JB 4D8PA 2E8ZA 4IGBD 4XP6L 2WO3B 1BQHA 2FBOJ 4PJ5E 1TNMA 4XVJH 3W5MA 4E5XA 1TJIH 1HL9A 4Z3EA 5ALCH 5I8CA 2P8MB 3MLWL 3N44B 3RA7H 4HXAL 5ABAA 2DI7A 3V5KA 5CEZD 2NXZC 2V8MA 5AW0B 1SQMA 3VFOA 4HULB 1N5AA 1NL0L 3EJSA 1UG9A 7FABH 2WSKA 3JTSA 4PP2B 1URIA 2FT8A 3BH8B 2I9LB 4OF7A 3HLKA 3T0BA 3C6LD 2OMWA 2VUYA 4WO4A 1E5CA 3K6FA 1S3KH 1MI5A 2VERA 3SPVA 2GYSA 2NR6C 3G9VA 3FCSB 4OSUH 1M05A 2H3NA 1OSZB 3QSKB 5FX3A 4N6RB 1V7NH 4GSXA 5D5MA 1MLCB 4HX1A 4IGBB 1SUHA 5I1DB 3QCTL 3PFQA 4BFFA 4XCEB 1ZIAA 3QZWB 1T66D 2OTUB 4N2AA 4OZIB 1MJ8H 2YAQA 3OQRA 2CU9A 1IGYB 2YKKA 3QNYA 4PWGA 4TQIA 5KVFE 4CVWA 4KZDH 2P5WE 2GG1A 3RUGB 4GRLD 5D2NC 1IAOA 3BN3B 5E2WH 2UV3A 1XH2A 3ZKNC 1I4FB 1G7LA 1QBMH 3P9LB 1OZTG 2NLJB 4NDMB 4PFEA 4PJ7B 1NANH 5ANMA 4E42B 5JMRA 1DVXA 1L0YA 2UZXB 2ICWJ 1YNKL 2XHNA 4IEFA 4XPGH 1E7UA 2YJLA 4IRSA 3REVB 1UB5A 2ZWZA 3I9GL 1AHWA 1J1PL 1U8JA 2BSEA 1FYTE 1UYWL 2DM7A 4D9QD 2ED6A 3C6LB 3FU0A 5HYJD 1KJ2B 3HS9A 3CSBA 1NA8A 1FHGA 1J05A 1E4KC 2VZSA 4MQXD 4PAZA 2BNUB 1A6UL 4DVRL 3JZ7A 1F4HA 4I48B 4GSRA 3GNML 3US1A 1B3JA 5F89B 3U6RA 1IIIA 1MJJA 1B4LA 4W68A 4NHUA 1AP2A 4JJOA 3DX8A 3U1SH 3F6IA 3IAQA 3UAJD 4EDXB 43C9A 3QA3A 1JZDC 3PV7A 1UD3A 5HGHB 4JVPA 3WNKA 2KYIA 1IZJA 3CSFA 4X8CA 2X4UA 3T77A 4NNXA 4X6DE 1OQXA 4DO6A 3ES6B 2R0KL 1QA9B 4RMUA 4PY8I 3UG4A 2CUMA 2DYPD 3QJHB 1HT6A 4JPKH 2Z92A 3HUJA 4X80H 1VSCA 4IDJL 4Y5XC 5M7QA 3GSWA 1YSOA 3CFIC 1ZK5A 4R5TA 2PTUA 3JTTB 5E24E 2YPVH 1RZ8B 2MNUA 2XQBH 1PGRB 4IOIB 1SDDB 5EOQH 5A3ID 5HYJB 4W9JC 1JGDB 3MRMA 4FQIH 5E2UH 1W6WA 4KHXL 1UD2A 1YQVH 3B7RL 1KXQE 3NCWA 3TTSA 4QMEA 2BRRL 3BPOC 4N1HB 4NHCL 4OJEH 4XPHL 3TN0D 3LH9A 1JV2A 1PEWA 3F7LA 4N0UA 4Z7QE 2IIJA 4LLYB 2V7NA 5KANI 1S9XA 4ZFOB 1BVKA 1KCRH 2B77A 3IJHB 2PCYA 3GXTA 1TOXA 3GRWL 3QDJA 2Z1PA 3TYFA 3K91A 5LJYH 4NRXB 1IC7H 3BP6B 3U4KA 1T0NA 4QRRD 5IROC 1OT4A 5DK3A 3P0YL 4G8EB 2V2TA 3DROA 2DYPB 2P4AB 1IQWH 5KYWA 2AQTA 1DBKH 3MFFA 1I8AA 2OJZL 3FH7A 4O51B 2QSTA 2WXFA 4FXGB 4WTQA 4MMXB 3RJOA 2BY2A 3G6JA 4NRZB 2FR4B 1QSFD 5KVGE 3VFRB 4IMLB 1AGCA 2DLGA 2HCZX 4CUCA 4BHUA 4YAQA 4ZXBA 2VCOA 4UOJA 5F0MB 1HTYA 4AT6A 4A6YL 4NXKA 3QG6B 1MCQA 3TN0B 4FAAB 1E3XA 5DQDH 2N7SA 3VXNB 1JZHA 2Z8SA 2GTQA 4UZUA 3SE8H 4X8JA 3TO4C 5SV4A 2PO6A 4QRRB 2AITA 5GGSA 2ZONA 1G9NC 2XFGB 4R2GD 4WI3A 4MA1C 5D1ZA 2YGNA 3FRPA 4C47A 4UM9D 1BEYL 4OCWL 2YMOA 5D2LE 5E94A 2IDCA 4MKTA 2Q86B 1IQDA 4LBEB 5J13B 3OF6A 2XRAH 1KBGH 1E4JA 4UTAA 1DBMH 4MAYC 4ALAH 1SFHA 1PPIA 4FXKB 5DJZB 5JQIB 5FF6A 2ZD0A 1BM3H 3SKUD 4X0NA 1J0KA 5K9KB 2C5DC 5IEKA 1ASQA 1QSFB 2APBA 4WK0B 4WI0B 2Z8RA 3U46A 3IMVA 1ZWIB 3NEEA 5GJSH 3VXSD 5KYNA 1EQWA 1D5RA 1UEMA 3MXVH 4YNYA 1TJXA 2HJFB 2ZPKH 2G4GA 1D9KD 1CTNA 4L8SC 2WJ7A 2YEZB 3DI2B 1RUPH 4MNGB 4XRCA 1YPZB 3ZRSA 2X6VA 2AABL 3NZSA 4PGZA 3VFPB 4M00A 5CJ5A 4C83A 2CKBH 1L6PA 2YFNA 3GJFB 4R2GB 5E2TL 4BZ2A 5GGRY 3OKNA 4KK5D 2EDBA 2DMHA 3MUGB 4UM9B 1EUTA 4FEMA 4O4YL 5HHVH 3ARGA 1RHFA 2XJKA 3UBHA 4Y4HC 5FLUA 2Y6TE 3P3RA 1OE1A 4X9GA 1LQBC 5ESQA 3O2DA 4QOKE 2F53D 4YHLL 2ZKHH 3CLEL 1G7IA 1TMQA 2J1ZA 4GUPA 4XMLH 3T08A 1WA0X 5IT2H 3V4VA 3WELA 4KJWC 5A43C 3WFHB 1JYNA 3VXSB 3F8UB 2VR7A 2FBJH 3FTZA 1LK3H 1BD2B 1EEZA 5DJCB 1Y18B 1UT2A 3OGCA 4X4KA 2DZEA 1D9KB 4XPBH 4CN4A 5D7SH 2P8LA 3T0ED 2VN4A 4ISVB 5KBNC 3RB7A 4O2EB 2YEQA 4CU8A 1FIGH 2Z7UA 4P4KD 3QJUB 4XN2A 3QZLA 3EDJA 4MJHA 4PJEB 1IL1B 2W81C 3TBVA 3LIZH 4MB4A 5FR3A 3KJ6L 2CHNA 1ZPLA 3QO1B 4NZTH 5KSBB 2Q8AL 2F53B 3VD5A 2CBOA 5T1KD 4DPCX 3SKOB 3C09C 5EBGA 1L6ZA 4PEEA 1M42A 5G5DA 5F7YC 3TV3L 5KUKA 5CSZB 4GEIA 4KKCD 4Y89A 2J8UB 3MRRA 1D5XB 3WHE1 1I82A 3VWKC 3UYRH 3HAEA 3ABZA 2VH5L 1RURL 3GSRA 1Z32X 2HN7B 3BPLC 2AHIA 4Y2OB 1I3GL 4ZMOA 5I8KH 2F6AA 2PPEA 5H4ZA 1B4JH 3O4OB 1ZT7B 1KGIA 3T0EB 4GW5B 4A6YB 5JO5A 2E9JA 1U91A 4KRNA 4P4KB 2R1YA 4W9HC 4ELKA 3B2VL 3QRGL 3U4AA 1EZVY 1TYRA 4G8GD 4MA3A 4NXSA 3B3IB 1UM6H 1ZEAH 3F05A 3PAYA 5D4HA 3CXHK 3HS0B 4LCWE 4M3KB 1E5BA 1A14L 2CA4A 1HE7A 4AQEB 3BPCB 4HUXB 5D7IA 4Y1AD 2VSKB 2WZ5A 4NQSB 5J12B 4JE0A 4JG1H 5BCAA 5T1KB 1Y1UA 1SHWA 3PHSA 4KZEL 5LXGH 4JO3H 1E8XA 1DQQB 1URLA 1QTYT 3U4BH 2Z7YA 3MRGB 4OFPA 4PRHE 1WFMA 3WIIL 2X1PA 2DQTH 1EA9C 2WKOF 3O11B 3S3CB 2EVIA 1J9RA 1OGAA 1OSPH 1FQ9C 2G60H 4HIXL 1YG9A 5JORB 2CJUL 2Y23A 3EYVA 3D0LB 3HZ3A 2JVUA 2A83B 1A6WH 2GJJA 2Q7YA 3OC5A 3OLGA 5F97E 4JDTH 3NAAH 4DKDC 1S9YA 5FGRA 4AIEA 3FBQA 1J5IA 4FZEL 2VL4A 3S97C 2DQEH 3F6LA 3WDHA 4WSGA 4OZFG 1HDMB 2V17L 1Q9OA 1MELA 4G8GB 5HJGA 3PGFH 4FERA 5B38B 5E51A 1J8HA 4HEMA 1HESA 4JGMA 1YUKB 4P99A 2O93L 2DOCA 1JHLH 4RGNE 1B0GA 2KPNA 1SJEA 1WBXB 4P2QD 4LNRA 5AZ2H 3NJKA 3NQKA 1A4AA 2Y07H 1SN0A 1UJTA 3K2MC 3D9AL 1TZIB 3GKZA 4ZS7L 5GRYA 1N4XH 5JHLH 1E4XI 5EFIB 5GGRB 4GAYA 1XO8A 4UIMA 5DJAA 3QUGA 3OKLB 1A7NH 1FNSL 3CE1A 2WNWA 5I18H 3Q1EA 3HLAA 1MOEA 5KBLA 5FXCH 4O02H 3WNPA 4D2NA 2QVMA 3FT1A 2JQZA 4LCCC 3ILQC 2X05A 5HHQB 4MJJA 4N9GA 2FUTA 5J11B 3KPSA 3HE7D 4LLAA 4PB0L 4AMKL 1SVCP 3GO1L 1J5OH 2DWTA 4QRPA 3C60D 1F6AA 4ZNEA 2HRPL 5ITFA 3U7YH 4OZHE 4KAQL 4ODSL 3GI9H 5DHVH 3QQXA 1J48A 4NCDA 4JFWA 2F7RA 3H42L 1V8HA 4A7UA 1IAIM 2CLZB 2BWQA 3NEOA 4U6YB 2X28A 3IWUA 1TJMA 2QEJA 4G8FA 3CHSA 4X7CC 2X40A 2PP8A 3KZ8A 4LCUA 5IJVB 5CJOL 1NLDH 2EIZA 5J6GB 3NJIA 1W6LA 1K6QL 3QIWC 5TE4L 3UTSD 1H3VA 4DP0X 3INOA 4GG8B 4MCYB 3X14A 1EAPA 4DAGH 2SEBA 4GYBA 1ZGLM 2XOTA 2F5BH 1AO7E 3ARBC 4XNMB 5DD3H 3T6XA 1YJDH 1T5XA 5HGAA 1LLAA 4I1RA 2X44D 1F4AA 4M43L 6CGTA 3QUZB 2XETA 4LARH 1AS6A 3T5WA 4N20A 2WLKA 4JRXA 1RPQA 3I6KA 1KCUL 2V9TA 2GTZB 3BI9X 3HE7B 4UINH 1U30A 2PW1A 2H1PL 3CV5A 1KTRL 4R4FH 5DZ9A 3BP7A 3C60B 4LP8A 4OKVB 4YDKL 4K3EH 1HNGA 4ZFZB 1R4XA 1NAMH 2NYYC 2AQ2A 1NWOA 3NJMA 4WV1C 1Q9WA 1IBGL 2IC2A 4MXVE 1USQA 2HJLA 4JQVC 3HC4L 4XHQA 5ERWB 3UTPE 2C4FT 3VYPA 4PRNB 3G6DH 1PZ2A 4G7VL 5DVLA 3U1QA 1G0DA 2CLRA 2X4NA 2Y36H 3WNLA 4AX3A 4MNQE 5IBTL 2E6JA 3GINA 5T3ZL 4AYFA 5GZNC 1QNZL 2P47B 2VNCA 3B9AA 5EZIH 1E9OA 5DGRA 1XGUB 1WIUA 2OMUA 5T1LA 5A2LH 1R34A 4MMYA 3HG2A 2X38A 4NIKB 1QW8A 3TH2T 5EU7C 4L9LB 5DMGD 2BVOB 4TUJA 3INUH 2OSLB 3D3VE 5IMKB 2YN5A 2CBTA 4H2CA 1NSNH 4P5TC 4FMKA 3VI4E 2ADJB 2JKTM 3DX9B 4ZYKB 1ZDSA 4MD4B 4XN5A 3F5WB 1CFTB 2YRBA 4OBRA 4LGSB 4ZQTA 5KVDE 1ZHLB 2FBRA 2JWYA 3HZVB 4HDIB 1G7PB 4K3DH 4KV5E 4YUEH 3WHXA 1KPUA 1O0VA 4HU8A 5FW8A 1NGXB 2BLFA 4EMZA 5HI5C 2DWDB 4J3OG 1HH6A 2EIEA 3VG0L 4LSSH 2XKSA 4O5LL 4OW6A 2B2XL 2DYRB 4CN6A 3L3OC 5CINL 3QJOA 4HK0B 4ZMZA 4HOMA 3U25A 2PCXA 3FL7A 3D09A 1IC4H 2VABB 3II2A 2GBUA 3WKYA 5LAXA 4J7RA 3P4NB 5HDLA 1NIFA 1IAMA 4L3CA 5D6CA 4AL8C 5BUGA 5T5NG 4DQAA 1RMFL 1FG2A 2GK0B 1T6BX 4Y2LA 2OZ4A 3O6LL 3MV9E 5I28A 2N56A 4Q9CA 5IESH 1L9QA 3VXMD 1QQDA 3WNOA 3KYNA 2R4RH 3ZMEA 4X9BA 4XTRC 4XCCL 5EC2B 3VXOB 5EOCJ 3BUYA 4R83A 2C3GA 2XBZA 1ULVA 1JJUA 5DSCB 3QYNA 5JLZB 1JRHH 2BIIA 2R7EB 3GMNA 4N0YH 4JM2B 4ANUA 1PL3A 2WSDA 1KZQA 1N5YH 3CHOA 1MFDL 1GXEA 4XVOA 4Z7NB 2CGRL 4AI7A 3CVHH 3QIUA 1C5BL 1GGCL 4FP8H 4U7KA 5EDSA 4X42A 2E27H 1FE8H 3RX7A 5GS1A 4PJDE 4JFDD 4FOMA 1Z9PA 2FATH 2YS4A 3CFDB 4F8NA 3ILPB 2H5UA 1DCEA 4Z5RA 5C0DA 1GSKA 1FFTB 3DTUB 4NNPH 5FEBA 1DQML 3D85D 3N1MC 1OCZB 4B9YA 5T3ZD 5ICZB 4YWGL 1QWHA 5A16A 3GMQA 3OPZL 1F58L 4XGZA 3NSCA 3VXMB 4X4YB 1RUKL 4WHYG 3ECBA 4PYHA 1HQRA 5KS9B 1R5VA 4ELDA 4G8AC 5PAZA 3VFGH 1PLBA 3S37H 1CD8A 1THAA 2DQHL 4S10A 1YEHL 1RAMA 1WJ3A 1K8IB 5ANME 2A2QT 4PW3A 2OR9L 3MUY1 3QQ9C 4CMMA 2MNJB 1BGXL 2R59A 2DJUA 5IB3B 1G6RA 2OCJA 2EINB 1N0LB 5AB1A 1ZPUA 4A2FA 2VIRB 4JFDB 4YOKA 4AXWB 2Y9RT 1HL5A 2A3TA 4ELMF 5E1QA 5AG8A 4C56D 2VRQA 5EO0B 3BVWA 2M2DA 4PJBF 5BOJA 3I2CL 4OIFA 1LNUB 1DSFL 2WLZA 3D85B 2KQNA 4YSDA 2C9PA 3WBDA 5HVGB 3K6SA 4MDJB 1P1ZA 2K8QA 2CH8A 3U9PL 5D7LE 4WU7A 2GAZA 3KH4A 1T1ZB 2DI8A 4NUJA 1ZLSH 5HHOA 2UXVA 4WGVB 1IGJB 1MNNA 3NCJL 3KYMB 2HMID 2WBJA 1FO0H 4YLQT 3OKOA 2ITCB 2C3HA 1DL7L 2CA3A 2DJSA 3DV6B 5DVKA 5C07A 4LLUA 3HUJE 4QHPA 2IH3A 3RNQB 4ZW8A 3KLDA 3WJLA 1F86A 4YFEA 3MA9L 4X9FA 5GS0L 5CJXA 3A6CH 4UQ9A 5CU5A 2J6EA 4ZTEA 4ZTPL 4OD2B 3MLXH 4AH2B 1XL4A 4YBQD 4C56B 4P2OD 5CLYA 3SBWA 1JGLH 5SX4H 3BCFA 4ONGL 5F9WC 1PVHA 1NMAH 2PR4H 2XWTB 3NCEB 1FDLL 5DDHB 4Y5YC 1K5NA 2VDRH 4N5EC 3C5JA 3SDDD 3UMNA 3QDJE 4K23H 3WIHL 2HT3C 1I3RB 4BQ8A 3WNNA 1SN2A 3GJEA 4I0CC 2XXFA 1N6UA 2R0WH 4Y88A 2GBVA 1I7RA 3GC3A 5I66A 4Z7WA 4IOSD 3SY0B 1XVSA 3LRGA 1NUFA 1T7YA 3WCYA 2AJXL 2XG5B 1G9EA 2IJ0C 4GSDH 4PIRF 5JA8B 4ZO8A 3ZO9A 2R2BA 2R69L 3LZFL 5CZKA 1I3VA 3KGUA 4LLVA 1PAZA 4ZMAT 2Z34A 2WVVB 3JVGA 3N42F 1FPTL 4BZ1L 1DUZA 3PHQA 2VDPL 3VRLE 4P2OB 1SLWA 5DS8A 5E7FA 3GSNA 3C5ZC 3HOGA 3ISWA 4IMKC 1NBZA 3WTWA 4AW4A 1OD7A 4ETQA 4UCFA 3QI9A 4K9JA 4Z0BL 3PHOB 4UDTA 1XGQA 4F93B 2YD2A 1BZQK 4IM8A 1ZIBA 2WPGA 2YD3A 3SDDB 5BW7C 3IFLL 4K2UL 4LVHC 5D7HA 2IDQA 3NPSB 3HMXA 3BWAB 4M1GL 1MCJA 2C3WA 4Z7VE 3HC2A 4FG2A 5EU3A 2BINA 2IAMB 3N1QC 4RMRA 2AJZB 2P52A 2VM3A 3VI3A 1Q0YH 1LD9B 3JZYA 2FO4A 2CALA 1MAKA 1E9QA 1U9KA 3QFGA 4XZUB 7PCYA 2Y0SA 4G9FE 5DJ6A 1MUJA 3CSYB 3UZQB 4HUNB 5GQBA 5E00B 2J56A 1RZJC 4PTUB 1OF2B 5MEQB 1A8ZA 1MCIA 4KY1H 1MNUH 3H6JA 4QWWC 1KPRB 4FFVD 4MX7B 5GRUL 3DSNA 5GS0D 1VFBB 2OL3L 4XBGB 5FUZL 2V2WB 3FC8A 3GHBH 5KYXB 3B9KC 4JNXA 4OZ4A 2LFEA 5C9JB 4N2HA 4JGNA 3HNSH 1OF0A 4P9HL 3X1BA 1M3JA 4LLWB 5CAYB 3LPPA 1CE6B 1XZWA 4P8QA 3L3HB 3D4ZA 1E28A 2QSVA 4UM8A 5E1AB 3QEQE 4L23A 1I7UA 3VMPA 1BVLA 3PY9A 2X7LB 5J4MA 3ARSA 4Q9QL 4V11A 2J4WH 4HMDA 1F56A 4JFTA 4ERSH 3HBGA 1TTAA 4DEWA 4X7TB 1FFQA 2H8PA 3MV7A 4KQ4L 4MMZB 4E9YA 3ARDA 2VKWA 4K5PA 2ZUVA 4OCXH 1AQMA 4KZCA 3CG8A 5J0BA 4FNSA 4ZMLA 5DEGB 3QARA 3RVWD 5FK9A 5G4NA 3QXDB 1BF2A 3CXFA 4ZX4A 5C0GB 4WFHD 1ECYA 2E4TA 3S5YA 1OB0A 3V4UL 2ZT9C 4JDEA 4UYQA 3LS5L 3K6IA 5LNEA 2YPLE 1QZNA 4KKAC 2CRMA 5GSRA 1NKGA 3GZQA 4Q9RH 4W6XB 2X9WA 4YDMA 4H8VA 2L7UA 4NO3B 3DMMB 4KUZH 4J6IA 4LASL 1LQSR 2O4EA 2W9DL 2X53A 5DTFB 4AUUA 2HKAA 2MCG1 3ZTEA 4KY2A 2OK0L 3W39A 4RDQF 2H0EA 4AIOA 3O3DB 5ANHA 1Z9SA 3BHBA 4WFFD 3RDJA 5CWSB 1RVFH 3N44F 4AJVA 2EDMA 5BV7L 3ZKXB 3D34A 4H8WL 1G5AA 3HN3A 3ZDWA 1HN1A 3IJ8A 1WICA 5D8JH 3IJYA 1VPOH 1DBJH 4GBXA 4JN2B 2QQNH 4LMQI 5MP6L 2Q1EA 3BEWB 1E6OH 2NX5A 4ZJ9A 1WAAE 3BAXA 4QCIB 1DJWA 1XF2B 2NY0C 1HAUA 5JW4N 4IHOA 2PPFA 3VSQA 3EDKA 4EVNB 4AEIL 4B97A 1D5MA 4W9LC 3IDNB 2VDPB 3D2UA 4Q4IA 2YXFA 1UCTA 1IAIL 3MLYL 3EH3B 1C7SA 4N2EA 1K5WA 2ORBL 3ARUA 5F7WC 1BMWA 1NMBH 4H40A 2WWKT 3MO1B 3UJIH 3ZE0B 4YHNA 4IBTA 2RR3A 4GG6A 2XTSA 2WXKA 4R97C 4KGJA 1C08B 3HI1A 1Q90A 2GW5A 2LLNA 3E1F1 3BJ91 1F1GA 3F00A 5D7IE 2IFGA 4M6NL 4HW6A 2BOBB 4Q6IA 5F9JA 1NFDF 3OG6B 8CGTA 3T4AA 4EDWH 2VN3A 3KYOA 3EO9L 5L4FA 1NWPA 1PMYA 5F3BB 5JPNC 4HEPA 3FNKA 2DBLL 4TPRH 3TWYA 1SHMA 3UZEA 4S1DD 4AQZA 3PLYA 4EI6A 3OZ9H 4UU9B 1IKNA 4AQAA 5GHWL 4XBEL 2OL3B 2CIKB 3TXAA 1K4CB 1UXSB 5D1XD 4IGBC 3DJSA 2CIIA 2D31A 4NAJA 1T21A 2PWGA 3CZGA 3H2QA 4XVSH 3ZVVA 5AOLA 3L4XA 3FQWB 1TVHB 3L9YA 1U92B 1J8HE 2IXQA 1JPSL 2GHWB 1EPFA 3SSGA 2YPVA 3ZN6A 3KWUA 4FQLL 2XWJB 1LE5A 1SXZA 1ZV2A 4L8DA 3A5VA 3GZOA 4MB5A 3BISA 12E8H 5GZOC 2YD7A 2EVHA 3AS2A 1YDPA 2WYTA 3NIDE 4GQ9H 4X6EA 4X4ME 4ZRGA 2DH3A 5EORL 4YE4H 5IFJA 1ZS8A 3MLSL 3L4VA 1KT2B 3FB7A 4XB8A 4XOAA 2Z31D 3FCGA 2EDXA 4GW1A 3DX6A 5E5RB 4I0PC 3US0A 4YSCA 3P0VL 3ZTNH 1X6NA 3I3DA 4U1LA 4JAMA 3SOTA 2JI3A 3PNRB 3G04A 3HMWH 3WS3A 3RX8A 4PRBB 5C0BD 2I9TB 4BSWB 5D1XB 5T3XE 3QUYD 4AVKA 2HZHA 3QQ4B 4OB5H 3NIFB 2A6KA 4XE5B 1T66C 2ZIDA 5IB2B 1I9JL 1QO3B 3PXLA 1QUPA 4ZNEE 4JFEE 4YO0B 2OULB 4JPWL 5KSUB 4HAFA 4B3EA 3V6ZB 1TCRA 2FX7L 4HG4K 3W2DH 3QB7C 5B8CA 3K8LA 4MVBD 3BDBA 5BV7B 3SDAB 4JLRB 4X99B 9PCYA 1UWGH 4HUWB 3KPRA 5IFHL 2D3JA 5DWPA 4FKKA 2HG5A 2A1WL 2VL5A 3LXAA 4R4BA 3NTCL 4V1DE 5DD5H 3STLA 3UTQA 3ULVH 1FJ1B 1WBZB 2Z31B 2DDQL 4XX1G 4MQXC 3CX5J 5DJ0A 2YSSA 2NQ3A 3Q3GA 1JD9A 3QR2A 3NGBC 3R4RA 4OZFH 2P44B 4JQXC 3RIAK 3VXTA 3LKPA 3UAJC 3DRQB 3Q0HA 3Q5OA 4R7VA 4HS3A 1PD1A 1RIVH 2UZIL 1X5IA 4LOUD 3AAZB 4PSRA 2Y6SC 4L3EA 4LSVH 2FZ3B 3EYOB 2J3SA 4J3VA 4NOBA 2VLJD 2BS9A 3HZMB 4XX5A 1OTTC 5DJDA 4KXDA 5LGYA 1JNHB 3TIEB 4G9DA 1T0PB 2UXTA 3CDGA 2RBLA 4MKMA 1J1XL 3VGGA 2OKMA 2YFOA 3QHFH 5DUJA 4L0PB 4MMXC 4DN4H 5IR1B 5JDSB 3KPMB 5LNGA 5DYOB 3I84A 4OLWH 5C0EA 3P30H 1RP9A 1PNDA 3P0GB 5H2BB 1PNCA 4I89A 1O5DT 3VACA 2YRZA 3V9FA 4H88H 4UV7L 3UIYA 1J8RA 2CNYA 3CPUA 3SD5A 2RALA 5FCUL 5IVXF 2XDHA 4ANXA 3AACA 4FFYH 3TN0C 1BYPA 4NYLB 3H9SD 3LSOA 4R96A 4RMSA 4F2MA 1XWVA 2Z8VC 2MQGA 4BZYA 4ODHL 4ZUSB 4KJYA 4JVUA 1UOWA 3FUFA 4E0RB 2VLJB 3A4AA 1GW6A 2ZKMX 4ZMQA 3BVTA 3FMGH 2XZZA 3IJSA 3H4HA 5I24A 4B9PA 2WLIA 3IKCA 5J13C 1Z9NA 2XQ0A 1KYDA 1YN7B 5HGDA 3WKQA 4FLQA 5L2KD 4QPEA 3MGTA 1TYJA 4FXKC 5C0CD 1DDHA 1QLEH 1E27A 5JQ6L 3S8WA 1H8SA 4U3XA 2F0CA 2XU9A 1QFWM 5E4EB 3H55A 2G2PA 3KG5A 1H6UA 1ERNA 4LHUA 4TXVB 1GGBH 5IMMA 3ZQ9A 3AJ7A 2C9RA 2D7MA 2MOGA 3H9SB 3E8UH 3IMSA 5IV2A 3N5AA 5I8OL 5LCVL 3LIZA 3LJ3A 2IGFH 3OKEB 4JDVA 1SDYA 3GKWL 4LFHD 5JNYB 3UO1H 2NW3A 3BEVA 5FYJH 3SODB 1JD7A 1V27A 3UZVA 3V7MA 3UPRA 3AFLA 3KLSA 4UWQB 4M03A 1N8ZB 5LGJB 5IJDC 3F7YA 1JHKL 2I69A 4RGMB 2DM2A 3MGAA 3W0WD 5A6MA 5JW5A 3MNVA 2DLFH 3F12B 4QF1A 4UNTA 1BQKA 1N6QH 2QZ5A 4JHAL 2WGNB 5C0CB 1RUMH 3C8KB 4PLNC 1BQLL 4KRMB 4UTCA 4Q74A 5JIKA 5JIPA 1A4BA 3GM0A 2ZUQB 1WBYB 3KDMB 3W9DB 1F11B 2EADA 4HKXB 3O6FB 4QHMB 3TBBA 3ZE2F 5A2KH 2UY7A 5IKCA 3ZDYF 1GKEA 1A4JB 4M1CD 5AAWA 4Z7UE 5D72L 1JK9B 2BNRD 2I7OA 5IOPB 1FZJA 1JWSA 4AM0A 5TF1H 3GSXB 2MMXA 2ZP0T 1D9KC 5C0JA 1BLNB 3MLVH 2FB4L 3MJ9L 3QC5X 1N0XH 4CVUA 4PGDB 1Y7VA 4OI7A 1N67A 1GZPB 3IU3B 2WY3B 3WUWA 1QLRB 2C9VA 3CQPA 3BSZH 4KK5C 4PY8J 4FJ6A 2VQTA 3L95B 4H5SB 5ITBL 5JHDE 1ZDQA 2EJ1A 2E7CA 2ZG2A 3ZIMA 5DRXB 4Y5VC 5AVUB 4HQQL 1BOGA 3AC0A 3PWPB 4APQD 1WLHA 1UJ3A 2WXRA 4NT6A 3UADA 5K9QG 5CEXA 5JIQA 4GMTL 1JS4A 5EEZA 3D4GA 3NIGE 5C0ND 5TE7L 1THCA 1MHEB 5AVYB 2Y7QB 4G7QB 3V6OA 2BNRB 1YY9D 1C9SA 2NUPA 1Q0XL 3IDIA 2JFCA 3L2LA 3NJVA 3P11H 3O4OC 1LO4L 5D93B 3U4EA 5FKAA 3L2NA 1M6UA 4XWOC 5B39G 2A77H 1ZVSB 3EADA 1BAWA 1UEYA 5CBEB 2N59A 1ETZB 4P4KC 4KX8A 4YDIL 4RFNB 4B0MM 2TRYA 1N10A 4Z3TA 2CO1A 3AQDA 4E9RA 4PJCB 4Z95H 5IREA 4GS7B 5AALA 2DD8L 2LAAA 1ZA3B 5JHLA 4L05A 3IT8D 3P4OA 4A7QA 4FNLH 1P6WA 4WTZG 4AY0A 3PJSA 1Q1JL 3TOPA 1NAKL 2MIZA 5E8EB 3L3DB 4C54A 4YQXH 1VACA 5F1IA 3GI8L 4X5PA 3M07A 3MBWA 1K2DB 1R5WA 4NZUH 5CBAA 2NR6A 2VWEC 2A4ZA 4WHYH 2JB6A 5CLXA 2VW6A 1EDYA 4N4YB 4GKNB 4J8RA 3F85A 4Z0XB 1TKWB 1FFOA 4UQ2A 3QO0A 3DO3A 5LG6A 2AW2A 1ZJAA 1IGIH 5HDBF 4K8RD 4PRPA 4KGLA 2CHZA 2XZAL 3R7RA 1CLOH 3HZYA 4AG4L 4HX1B 5D2NA 3CDZA 3WLWD 4OAWA 1EO8H 1M53A 5HYQB 4NCC1 4PJ8A 3LCYA 3NCMA 1JFHA 4CDHA 1SF5A 5FGCB 2C9AA 5GRXG 4LMQE 4WAFA 3MRDB 1Y6KR 3BKYH 1TQSA 4APXA 4LSRH 2XVKA 2IFFH 1JWMA 5AW4B 1HSBB 1WZLA 4NQDB 1G1CA 1XCWA 3ROLB 1BREA 3BSGA 1SJXA 4FHJA 3FFCE 3UBXG 3BAEL 4F7KA 1AHWB 3P4MA 3WXVH 3PWVB 4MFHA 1C1EH 1SRDA 4KK8C 3VFSB 4A04A 1QRKA 2DWYA 4LPCA 1KXVC 3H9HB 3ZE1F 2DKSA 3LOWA 3NFNA 3MLUH 1EXUB 5TQ2H 1RZGB 3WJJC 5IP4A 2FLMA 3IGUA 5MEOA 4Z3IA 2VRKA 5HI4D 2DV6A 2A74B 3B43A 4XCNB 3ASNB 3GLAA 3AY2A 2AK1H 1HC1A 3RLSA 3VI3E 4NJAL 4AGMA 2A9DA 4PI0A 3BRGC 2VW4A 2UWEB 4U3SB 2F7OA 1ZGLP 2XFXA 5AWNH 2RTTA 3LXBA 1NCOA 2OMTB 2WAQA 2IAAC 1YY8A 2IGTA 2RA1A 3I6LE 2NSMA 3FH5A 1P4IH 2BVTA 1EJ6A 2OZNA 3PAVA 4JE4B 4M7JH 5SWSE 5CEZH 1U58B 2WZPD 4KOCA 1M2VA 2CSPA 5CZXD 3OSVA 2FWSA 4ZW5A 3Q6GH 3M45A 2DLEA 2NTSP 2VB5A 3Q2VA 1NQBA 4GXFA 4NNYA 2KMWA 5ESAB 4RZKA 3QUZC 1CDIA 4JKPH 4YDVB 2BIPA 4HJIA 3I75B 4RBPK 5FOJA 3VMNA 3ZDXB 4KKZA 3HE7C 3SGEH 3OV6A 2R15A 5HPMA 2AEWA 2C3XA 4JX0A 3C60C 1FNEB 1MXGA 4N0UB 3MYJA 3EUUA 1LO3L 1S9XB 1KCKA 5IROA 1W0VB 2HSIA 3IE4A 1UM5H 1SXCA 4Z7AA 5J1TC 1SVBA 1R3LA 1RK1B 1M6OA 4X5WA 4ZNCD 3Q8BA 1PG7L 4KI5E 1CGSH 1R19A 3UAFA 4A66A 4FJZA 1MFBH 4QJ5B 4JKLA 4LL4A 1Z3GH 2NNFA 3TBWB 3MCKA 3W9EA 1W72A 2EIDA 1JVLA 3FO0L 3KVPA 5L9DH 4W4OC 2MKWA 2ICWB 4CNIA 3Q48A 4PJAF 5I1EL 4J4PC 2BP0A 1KB9J 1YEWA 3WGUB 4GKZB 1MPAH 4HETA 1K3ZA 5KW9L 8FABB 1YUHB 3F01A 2FJUB 2O5ZL 3KW7A 4G1MA 3FRUB 2TAAA 3DYPA 5LWYL 5EF0A 4WHCA 4QTHA 3CNKA 3ULSB 3CVHA 4GINA 1T03H 3TO4A 5ID0A 4PD4K 3WOVA 1TTUA 3WJMB 4E9VA 1FG9C 2LT9A 3MRHA 3RWGA 4EZMA 4JM2F 3EYFA 1AI1H 2HTLD 3TBYA 4XBPA 1A65A 3MGOB 3RZWA 2W94A 5MERB 3ALPA 1MF2H 1GMEA 4MXQC 2K9FB 4YZFE 1A3RH 1CGXA 3T2PA 5F6IC 2PWDA 1YEEH 2NX5E 4HALA 4MAYA 4JCMA 2APWA 1SLXA 1FLRL 1QVOA 4WCYH 3DHJA 2G30A 3ET9F 4UQAA 5DRNA 1UXWA 3W5NA 1RULL 2CHXA 3FTVA 3B2UD 3PWLA 5EZLA 1UH2A 1JFQL 1G9HA 4MBOA 1JGIA 3RU8L 5FHAH 1H5BB 3MLWH 4EQ3A 4IU3B 5DMGC 3FTGB 4YXKL 3NG5A 4HXAH 4S2SB 4GEJA 5D7JA 1KTDA 2HLAA 3ARED 3CXDH 4KITB 5ICXB 1S7VB 2BVPB 1I9EA 5I0VA 1JCVA 1XB3A 2FL5A 2YD8A 2YA1A 4JBSA 4L8SA 4KU1A 3S96B 3RFRA 1NDGA 4L5FE 4RQQB 4NLHA 3MRNB 2WXGA 4CL7A 4YPJA 3UDWC 4JM2C 2M8XA 5L0QB 3WHE0 2CO3A 5ID1B 1JMZA 3FSZA 5LUMA 1EZSA 2IPKA 2G5BB 4KVCH 2VQ1B 3UTOA 4BWUA 3LNDA 4MA8L 5M95B 2KZKA 4WI7A 3EDEA 3FJTA 4Y4HA 4K94C 2HX7A 4MA7L 4RFEB 2UYLA 4M6OL 3MNWB 2A9BA 3TJHD 1OAQH 4N8CL 4ZG1A 3TTYA 5INCB 1TITA 5IM7A 2X6UA 3EOBB 1GW0A 1JGEB 1DVSA 1WCBA 3IDJA 4PG9A 2C7UB 2VLRE 1U93A 1U8IA 5GGTA 1EGJL 1RLBA 4GSUA 5IEHA 5ISZE 1MEXH 5DI8A 3SKJL 1Z0NA 1N9PA 2OFQA 1EJOL 3AREB 1HHHB 4JPVH 1S7QA 4PV8B 1T22B 1YNKH 4NRYA 3S2AA 3ZHKA 2DYSB 2A73A 1NDTA 1HS6A 1J1PH 1TENA 3ILEA 2ZNXA 3DXAD 4HZLA 2AXHA 4A7GF 1UYWH 4RGOL 3LQZB 4DT2A 4YHML 3FQRB 4OCRL 2I24N 1YCSA 1B0RB 2BH0A 1A6UH 3JV5A 4DVRH 1WVZA 2AVGA 2LE9A 3GNMH 3MACL 4WUUD 3RWIB 1S7SA 4G7RB 5C7XH 4J2XA 1OCRB 1SEBA 4KQ0A 1WRFA 4Y1SA 4LKXA 5EN3A 2DM3A 4N2DA 4TV3A 5IHWA 3IFNL 3F65A 3GJFH 2DWXA 3KPPB 3TNMA 2EKSA 2PCFB 3S4SA 4HHAB 4M8QB 4XI5C 1U8KB 3MREA 1EHKB 4KJQD 4XNYL 2LTQB 2R0KH 3VWKA 5BPPA 3RL2B 4LVNB 3DTXA 1RPUA 3EOTL 5SWQA 3ME0A 2VM4A 2C3VA 2ZF8A 2Q76A 5G55A 2H6OA 1LEKA 1JYWA 2RQEA 3VA6A 2C1OA 1QKZL 1KJ3L 1I8MA 3QDMA 2EVGA 3L48A 4FLRA 4Y19D 3DXAB 3VH8A 5DD6A 3PG2A 3BVNA 4AYSA 1QFWL 4GXUM 2ADIA 3GUFA 4KHXH 1U91B 3EOAA 4WUUB 3G5YA 4XPHH 3IPFA 4BEIA 1X7SA 1AXSA 2NYKA 4BK5C 2Y5TB 2X4QA 3HKFA 5H94A 5DJYA 2A5UA 4MB3A 2P28B 3HNVL 2FYYB 5BUPA 4QRTB 1OSEA 5T5FL 5KN5B 1S7RA 1F00I 2WLLA 3FZUD 3MUJA 4FULA 1BP3B 1HILB 3GMLA 3C5SA 3H0TB 4Z6AT 1CLZH 3W56A 4PVBA 3TA3D 4P23D 4Y19B 3F7PC 2CO6A 2VDKL 1F3DH 2KLRA 3VXPB 1KGUA 4L3EE 2E6PA 5HHMD 3UBXI 3DX7A 1B9KA 2ZSVB 4F7PA 3L1OL 3U9WA 4A6YH 5AVWB 3ULUE 2WVSA 1USZA 3CUPB 3M7OA 1A5FH 1RFDH 1YEIL 2GY5A 5G4MA 5CD5C 2B9BA 2XPYA 1AQDA 3FSVA 4M4RB 4L1DA 4PJIB 3DV4A 3BIAX 4A37A 1A22B 2VLKD 2Q9OA 1OP4A 4J6RL 4P2OC 5IF0B 3VD0A 2AMGA 1BECA 4OJDH 2WINA 4QXVA 5CHNA 3IDUA 2O5NA 1E3FA 4LPTA 4AJ0A 4UI2A 4B5EA 3T3MF 4AGPA 3WMSA 3TA3B 2N1TE 1QATA 2XKNA 5FAAA 2FJHA 3SDDC 2KHAA 2PYED 4LCCA 5B4MC 1CYGA 1NM4A 3AVEA 4IHBA 4OFYD 5KBDA 4IU2A 5KAQF 1J0YA 1I9IL 3O4LD 1OP3K 3E6FA 1QMUA 4Z7QF 5FOBA 5HHMB 3BP4A 2IAMC 4O9HL 15C8L 1E5ZA 1LK2A 1VZGA 3LRHA 1F4WL 3WEOA 2HT4D 3JWOL 4W9IC 3GGWB 4JRYD 2XI9A 4QRPB 4XHJC 4LVOC 1I8LA 4U1MA 4PWFA 3CK0L 4H0GA 5ILTL 4X9HA 2ERJC 5DMKB 2NY2D 2VLKB 2QL1A 5SWZD 3GBNL 4BKLB 1KCSH 5E2TH 1CU4L 4NQTA 3MCYA 1CFQB 1HQ4A 3LHPL 4LCUB 4BD4A 3DVNB 1NFAA 4D3CL 1HXMB 2ZJSH 4WIQA 3JV4A 2EIZB 4O4YH 2Y22A 2DEXX 3O41B 4GB9A 5FKPA 1L9SA 1K3IA 4DZBA 3AB0B 1JNLH 3NA9L 5IB4B 4W9FC 1MCWM 4M8UA 4YHLH 2ZCZA 1IX2A 3LRMA 5BMFH 4GIAA 3S36L 2BW5A 2DQFB 4HIHA 3T2QA 2BRQA 4PJFA 1KOAA 5CZRA 4QO1B 4PMEA 3TF7C 3KLQA 3O4LB 4ZFFB 2VR6A 3Q8EA 2G9HB 4PQXA 4JGJA 1KGCE 4MMZC 3FO2A 4JRXB 1E5YA 2A0LD 2KDYA 3LN4B 2XVLA 3VD1A 2VM9A 4WV1A 3SDYL 4G70B 3C08L 3EFDH 1ZT4B 3BPNC 3BIBX 4JRYB 4MJIA 3UG3A 4JQVA 1PKQB 1VFAA 4QHUA 3GSOB 3SOBL 1BZOA 4HLZH 1ET5A 1HHKA 3I50L 3GSUA 5D70H 3BDYL 3HR5A 4XC3L 3HB3D 4FFVC 5GRJH 1HZLA 5SWZB 3QWQB 5GZNA 1IU1A 1X9UA 4B9KC 4HH8A 4NFCA 2WK2A 1QFUL 2X4NB 3ZLQC 5F0PB 5C08D 5EC1A 2B8OT 5C0IA 2NZ9D 5KSAD 4F7EA 3KJ6H 5AYQA 1X5XA 4N0FA 4R7DA 2Q8AH 4NUPA 4F37K 4DH2A 4N0CD 3W81A 1KELL 1BV8A 1JZ3A 2JK5A 3DMMC 3FN0H 4FI8A 1MCWW 2AQNA 2VDLL 3TV3H 3RYMA 3CZFB 4U1KA 5I76A 3PWNB 3NCCB 1ZAGA 4DO5A 3GPSA 4PGBB 2VH5H 2QJDA 1AZCA 3I3EA 1X9RA 2VISB 2VDKB 3MZGB 5EOCL 3X12A 3ZKXC 3DA0A 4O00A 2AGJL 1CT8A 1E7VA 1UFGA 1AR1D 2AZUA 4FQJL 1CD1B 4HHGA 4OF3A 1QR1A 1W80A 1AD9B 4CGTA 4OZGA 1NGWA 1A9BA 2X2YA 1MHCA 2GJ6D 3ZL4L 1LEIA 5LAPA 2WYZA 3HB3B 1HH6B 3M1CA 1FVDA 2XYCA 3B2VH 2D0FA 2JKRM 3QRGH 4PRAA 2BMKB 2JJTC 2VYRE 5JIHA 3AABA 3D39A 3FS9A 1T0MA 5C08B 1RIUL 2KUTA 4PY7A 3BQVA 3R8QA 4RX4A 5J9PA 1ONQB 1A14H 1DQJB 1DVUA 2QGCA 1MCKA 2X2UA 5C97A 1CGYA 5CR8A 1LP9A 1A2YA 2AJVL 1M7XA 4WRLA 2EE6A 3KJ4C 1ITCA 1U6AL 3PIQA 4LRIC 5AW3B 2EZ0C 3H54A 5GGVL 4NWUL 3WIIH 3ORJA 5CGTA 1N3NA 3ISYA 3FCTB 1RPKA 2FIKA 4OQTL 3IFPA 5I1IL 4HIXH 1AR1B 5EBWA 2CJUH 3ZTJG 4ZX3A 4DKAA 3GMNB 3FUDA 1VADA 3MRQA 2GJ6B 4IKNA 4XMKL 3PHAA 4FZEH 4G1EA 4EPSA 1JZJA 1FAIL 1BZEA 1F2XK 3D25A 1NCBL 2CO2A 1ZLWH 2V17H 5I6XB 1A0QL 3FONB 4PJ9D 2AXGB 3VX0A 2OQJB 2AXJA 1QFHA 1VGKA 2XXCB 3AQXA 4RAVA 1CLCA 2VDMH 2YD5A 1CL7L 3LKSA 3CMOL 2A6IA 4L4VA 4LZKA 1INQA 5FA3A 4X7EC 3N2JA 5E95B 4GT0A 4WU5A 4XMTA 5IMLB 4A2DA 1WP6A 4YGAB 5F1OB 3EGDA 4R4NC 4AVJA 4P9HC 4LRNL 1F97A 3JWNC 4ZS7H 4P4RB 3EJZC 3L3GA 4RMQA 2DTMH 1NBYB 2BY1A 2E9BA 5D2NE 3IETA 3L7EB 3ECBB 4BE5A 1EFQA 4Z9KB 1IC0A 2HFGL 4JM4L 4YSUA 2VC2H 4URTB 3AY4C 2GBTA 2V5SA 4Q7DA 1TTFA 3QCUH 4X6CA 2IH8A 4DUWA 1KDJA 2HX8A 3LQAL 4MCZB 4RMWA 4FQ1L 4JKKA 2D7QA 4JO4H 4PB0H 3T4YB 3VXUD 4AMKH 4PJ9B 3GO1H 4LOFA 3B5TA 3BE1L 5F88B 1UKSA 4LP5A 2NZIA 3TO2B 4DKFL 3PDOA 5KTEL 1R47A 2IQAA 1PZ5A 3QH3B 5D1XC 1HXYB 3TZVC 5J89A 5I1KH 5DXWA 4Y1TA 5CJOH 1NFKA 2VR5A 4PRDB 1Y07A 1K6QH 5TE4H 3K2UL 1GJUA 3RIKA 2F1EA 4WU7B 4E41D 4P3DA 3ZL1A 4DOHB 2VDLB 3NCYS 5HHOB 1CYXA 3DOSA 3JTBA 3Q6FA 4YK4B 1J88A 2B0SL 3DUHA 2WBJB 1NC4D 5JYMA 4NBYB 2GQHA 4TQ8A 4AEHL 2JLLA 1M1XB 2VXQL 5BV7C 3SDAC 5CSGA 4ZAKA 1SYSA 4H8WC 4NKOA 2A6DB 5C07B 2PPDA 3MQIA 5HGBA 3VXUB 4YGVB 2H1PH 1LO5B 3PABB 2CK0L 1P7QA 2Z31C 4BV1A 4ODTH 3UP6A 4L18A 1IUZA 3WI9A 4AQOA 3IMUA 2Q3ZA 3GRBA 4NQVA 5F72S 4A68A 1PZCA 4RISH 5BXFA 3BAYA 4XVJL 4YDJA 2NNAA 4S0HA 3HC4H 1UH4A 4XN8A 3TA4D 4L8BA 1TJIL 2BHUA 4LXFA 3SKMB 4Y5YA 5JHAA 5IBTH 3IAGC 2Y7LA 3ECVA 3RA7L 4OCYL 4MTMA 3MOQA 1AS8A 3DDGA 3M8OH 3FTWA 3IK2A 4PGJA 7FABL 3I02B 1I1AC 3LKQB 2EECA 3O45B 1S2EA 3Q8FA 5A40E 1PIFA 1NCGA 1NC4B 4POYA 1I8UA 2CDFB 3ABMB 4K3JL 4PJ5D 1TFHA 4IRJD 3ZHLA 1OALA 3I9AA 3IDMA 4ODUA 1Q9KA 4YHZL 6FABH 1S3KL 4FYSA 3REWB 1UUNA 2W07B 2F8OA 2R1XB 2R23A 3C75A 4MQ7A 4LCYA 3R0MA 4OSUL 3TBCA 4A39A 1V7NL 4MQTB 4UDUB 5CIPB 1JN6B 4F8TA 4RDQG 1A9EB 4IMKA 1KGYE 1JF1A 3FK3A 5A6IA 3WTSA 1AOHA 3JQOB 3W38A 4XP1L 4F1SA 2AK4A 4NQEE 3U7WH 1F8TL 5I1CL 3VG0H 3IXTB 4KZDL 1KBPA 5HJDA 5H35A 3BZ4A 4UBDC 5CINH 5E2WL 1MWAL 2G75B 1OT1A 2D4DA 2QFPA 4M5YL 3H8NA 4BFBD 3KWXA 1EZUA 1SOXA 4LOUC 1AAJA 1NKRA 4M93B 4ZQKA 3TT1H 1S8DA 1HKFA 1Z5LA 4H1LG 4PCTA 3HRPA 4U1JB 1MRDL 2BWDA 3DK2A 4PJ5B 4IRJB 5I73B 2ZF9A 3ZY7A 3G9AB 3K5SA 2RACA 2P5WD 4N8VB 1DEDA 4QRSA 2J55A 2ZWKA 2APVA 1S7XB 3NA4A 2WQVA 4XCCH 1BX2B 2K0RA 4Z7OE 3GLEA 3GBMH 1HIML 2Z64C 5BZDB 1J0IA 5E4EC 4F33B 3CFCH 4JFYB 3B9KA 3C87A 3QZBA 1MFDH 4FD0A 1I31A 1C5BH 3BSZA 1FYTD 1GGCH 1L0QA 2LFGA 2Z0BA 3N91A 3H7BA 5E56A 4FQHB 3MRJA 2HPTA 5FDYA 1HZKA 1HWHB 1X5JA 3CC5B 4TNWK 2NW2A 1EERB 3HG1A 4F7MA 3VI4F 4FCAA 3NK4A 1WFJA 1I7UB 1DQMH 2OTWA 1XF5A 1TTBA 4WSJA 1B90A 2ZCKL 3WFDL 2N0KA 4RGMC 2DWEB 4YWGH 3QJFA 4HH9B 1ZSDA 4C57C 5EOQL 3HE6A 1SVZA