2XFGB

Reassembly and co-crystallization of a family 9 processive endoglucanase from separately expressed gh9 and cbm3c modules
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
172
structure length
172
Chain Sequence
GSPDPKFNGIEEVPEDEIFVEAGVNASGNNFIEIKAIVNNKSGWPARVCENLSFRYFINIEEIVNAGKSASDLQVSSSYNQGAKLSDVKHYKDNIYYVEVDLSGTKIYPGGQSAYKKEVQFRISAPEGTVFNPENDYSYQGLSAGTVVKSEYIPVYDAGVLVFGREPLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDOGLUCANASE 1
publication title Reassembly and Co-Crystallization of a Family 9 Processive Endoglucanase from its Component Parts: Structural and Functional Significance of Intermodular Linker
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/sugar binding protein
total genus 36
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2xfgB01
3ZQXA 1KFGA 4B9CA 4B9FA 2XFGB 2YLKA 2L8AA 2WOBA 3ZUCA 1G87A 2WNXA 2XBTA 3ZU8A 3ZQWA 1G43A 1GA2A 1TF4A 4B9PA 1JS4A 2WO4A 4B97A 3TF4A 1K72A 4TF4A 4B96A 1NBCA 4JO5A 4C8XA
chains in the Genus database with same CATH superfamily
5D7HA 3RPIB 2GCYA 3DX9A 4NLAA 2K6ZA 1QQDB 2BW5A 1N9PA 3L5WA 4O02B 3UBXG 2JB6B 1GKOA 3VW3H 3DHJA 2UZXA 2Y22A 1DBBL 4X8JB 3X14B 4EAEA 4TV3A 2I5YL 1U3HC 2DL2A 1KUMA 2PR4L 1INDH 4ZTPL 3DARA 4PJDF 5AVUB 1F11B 1I7RA 3I84A 3CHXA 2NNCA 4M6MH 4NKDB 4U49A 1WZ1L 2NXZD 1DSYA 4X5WB 3HS0B 4Q56A 4JFZH 4A6YB 1WBZB 5FYKL 4JN1L 1GGUA 1V7NL 1ULVA 1VJSA 2IBZX 1WF5A 1I1YA 2D3LA 1HESA 5EUKA 2ENSA 2R2HB 3M88A 1TEGA 5TDOB 2Z8SA 4ABUA 3NTCL 1ZHKB 4ANKA 5AZEL 2WXGA 1JK8B 4QGYA 4P2QE 4OJDH 4H25B 3VWJD 1ZEAH 2NDGA 1TTAA 3MRFB 4Z18A 1IAII 5C0BD 2VTFA 3QJVB 1OE1A 1P5UB 5AYUH 5D6CB 1DJXA 4FG4A 5ADPH 2OLDA 4IDJH 3VE0A 3ZHNA 2EVIA 4WAFA 1JF5A 1RUKL 1JPFB 3MCYA 5CBAB 2EDJA 2WV3A 2QQQA 1RJYA 2MFNA 1KBVA 3UGXA 1USZA 1N59A 4ONHB 3C6EA 4KITB 4PLJC 4C4KO 5I6OA 1U8KA 5C0JB 4FQ2H 2X70A 4U7KA 4LEXH 1T21B 2YAOA 3N55A 5D7LA 2MTPA 1HEJC 2BNRD 4HS8H 3S3PA 5H2BB 1X9QA 2W07B 5MEPA 4JKNA 4UT6H 4ERSL 2ZX7A 2MKLC 1WG3A 3C8KA 3IWUA 2P48B 5A7EA 1SZNA 1YNLH 3V6FB 2FLMA 5C07D 5I15L 4DCQA 2JQAA 1FNHA 1YEFH 3U4EA 4I1RA 4P2CG 3UJIH 1PF3A 2HKHH 2ZXBA 4DOHB 2JI2A 3NA4A 4RDQF 4PHZA 2VMEA 1YEJH 4NO5A 5HJ3A 3MFGB 3DOSB 35C8L 3BDYL 3QIWC 1KN2L 4KQ3L 4NPKA 3SPVB 3IJEA 2EZ0C 4PJBF 4LDCA 5F7WC 4WI4A 4Q6YA 1CLYH 1U58A 3PGCA 3ROOB 1NANI 1VA9A 3P11H 4CGUB 5FECA 2J71A 2XTJE 4PI0A 3WFHB 5JXAL 1CDIA 3D4CA 5IUSA 5E9AA 4BRVA 3X1BA 5AOKA 4Z77B 4HD5A 3NIGB 4GB9A 3KR3H 4HPOH 2NXZB 4FEMA 2UZIH 3NCJL 3SKNA 3VM5A 1KBGH 5I75C 4K7PL 1KXVC 3QFDB 4CW1A 1M53A 1MCPL 2BRRL 2EC8A 2EIBA 3PNWB 4OLZL 3FCTA 3HFFA 4FI7A 5FDWB 4XCEA 5EG6C 1OPOA 1AHKA 2BNUB 3KPMA 3RL2A 2PO6C 2BIHA 2AW2A 3CX5J 3HC0B 3VWJB 1FRGH 1QSFE 4A1RA 2D0GA 5C0BB 4U6HA 4JRYE 4N9GA 4NHUB 3S2CA 3E2HC 4KDTA 2Z8WC 5AW2B 1BFVH 2VN3A 4L8CA 1A7OL 1G6RL 2FJUB 5GZOC 4I3GA 1KJ3H 1G43A 3FTUA 4OT1H 1CDCA 1T22B 1U8HA 5JQ6H 2OAAA 4I9WE 1FL3B 1QI3A 4BH7A 4EPSA 2AQQA 2K4AA 1A64A 2BNRB 5F0MB 5SV3A 4IRSD 4F1ZA 3HUJA 2ADGB 5EEXA 1CGXA 3MPCA 4KK6D 4MHHI 1CG9A 2WQ8A 1JTPA 5C3LD 1B6DA 2VN6A 2OTUB 4QRUA 4R7NA 1DFBL 2YAFA 1JAEA 2NQDA 5C07B 3CHOA 4Z7VA 2BMKA 4ZUSA 2EDOA 3ZL2A 4LASL 3PY9A 1MI5A 3B3BA 2FWSA 1MRCH 5EN2A 2HN7B 1GW0A 5DYOB 2I9TB 3HI6L 1NGWB 4IBQA 2EXWC 3NJGA 3JWDL 4G9DB 4PH8A 5GPRA 2X6MA 4HKZB 1OIOA 1DCLA 2A1WL 3FOLA 3NRPA 2CG9X 2KZWA 1A6AA 1AGEB 1EEUA 5JUEH 3FF7A 4S1QH 2FBJL 1W16A 1YPZB 1A4KA 3MOAL 5I0ZA 2GTZB 5ACZA 4FQXA 3ZUNC 1JWSB 1BIIA 4NRYA 4MSWA 4CNIB 1MAKA 3OAZH 3PDGA 4HVBA 3K2MC 4HETA 4LLDB 3KLDA 1BJ1H 2QKIC 1QEXA 1YDPA 4JDTH 4JM2A 4ZW7A 2PXYC 1FNGA 1SVBA 3SE8H 2BXYA 2ARJB 2DTML 5DZLA 3JUZA 3VFWB 3CVHH 4DP2X 4BRJA 3ZYJA 1YEKL 1XF1A 2X1OA 3NJHA 4IBTA 1OAQH 1HZHH 1NBVL 2C1OB 3LEYH 4J6RL 3BCDA 3II3A 1C5DA 1Z9SA 3TN0C 3DROA 5B4MC 4OIAA 2H0PA 3IFLH 1A7QH 4HWZA 3ULVF 3I3BA 3BMVA 4WFGE 1RIHL 1IGCH 2D3JA 2EUZA 1JP5A 2OYLA 4PS8A 2JELH 1F97A 1I9IH 2O61A 1IL1A 3KPQA 4XMUA 2XKNB 2Z91B 3B2MA 4IRSB 5EWIL 2V6HA 3QCTL 1ICTA 4BH8B 5DWUL 1E4KA 5DLLA 2GJ6D 1AD0A 3QIUA 1S7WA 2O6DA 2WQSA 4G8FA 4G8IB 1AZRA 3AITA 3VD0A 2OXHB 2PR9A 3K8MA 2P26A 3PABA 5I24A 1M6OB 2C9VA 5F70A 1S5IH 3BO8B 3DV6A 5F97E 3M46A 4JRXA 3DGDA 4KO7A 3ENEA 2XV0A 2YD0A 3O3AB 2Y24A 3NSJA 5CHNB 4FXKA 3O45B 4YHYC 5C0ND 4QEGA 5JO5B 3UJTH 1PZ3A 1J8HD 1UWEL 2NZ9D 2ROYA 4RMVA 1ZVHA 4RAHA 2FGWH 3R7QA 5DD5L 2CDEA 4Z3IA 4KKLD 2HFGH 4R5XA 2EYSB 4POUB 4QXUH 1DANU 1MHHB 2J5LC 3KJ6L 3MZGB 1BZ8A 2ZOTA 2N7SA 2AV7B 3BH9A 1NMCC 1A8ZA 2R0ZH 2CXKA 1RULL 4OLYL 5IVXE 4CUCA 3KPRD 4LPVA 1A8JH 1E9PA 4MB3A 2B4CL 4PPTA 4YXLH 1S8DA 1JHLH 2EIZA 4PJGA 1TG8A 4RAVB 5AVRB 4JFPB 4N0UE 5IFAH 3MR9A 3GNML 5I9QC 1KDJA 4MMYA 3WSQL 2H45A 1V7ML 2CGRH 2FIRT 1FO0A 1PJ9A 2EEFA 4HH9B 1WAAF 2JE8A 1H15B 2NNRA 5ICYA 2Y7QA 1FFPA 2ZCHH 5IUCA 5MEQB 4KQ4H 4I1PA 2CDFA 2R4SH 4KDWA 1BZDA 4IMLB 4IQHA 3WJJC 4HLZG 1R3JB 3IMVA 3ZZLA 1OW0C 5CU9A 2GJ6B 1HQ4B 4KI5F 4NQVA 1NCBL 2NTFB 1A21A 4J8QA 4G7QB 4MCZB 5AYQA 1JMXA 4UAOC 3B4NA 3RP1A 3OWEA 1NBCA 4N90E 4TL4A 1OGAA 3KGSA 2VZSA 3TGXA 3MOBH 1HH9A 1LE9A 4ZD3L 2EH7L 1IEBA 1QSEA 3GHPA 3IEAA 3QUXC 1KLGB 1CCZA 5L4FA 3VD9A 1KV3A 5JOFB 4KY1L 3U7WL 5GZNC 4NZUL 1FZJA 1T3FB 1A7RL 5INDB 1EHKB 5E94A 4NZ8A 1J8HB 2LR4A 4KZEH 3ZE2B 2P5WD 4FQJL 2E7BA 3MRGA 4YR6B 1AGCA 3EG9A 1ZT1A 5BRZD 2X1WL 5JIPA 3TT3H 2YXMA 2X4NA 2Z31C 5KBMA 1S7RA 4B53A 2P5EA 4HS3B 1F18A 1I9EA 4LL9A 4LPUA 2IGFL 2VDRH 5A6LA 4GMTL 4LZKA 1GGYA 2J88L 3LIZL 5HHPA 4QY8A 2OQJA 4ZFZB 4C57C 5E99L 3FCUB 4L9DA 4DTGL 1ROCA 2YMOA 4HYTB 4LHUA 3KPRB 5BQ7A 1CLOL 1C16A 3EF4A 2BHFA 2VZTA 3CFBA 5FB8B 4HXAL 5F6HI 5BUPA 3RNKA 1JXDA 1AQDA 3P69A 3LQMA 4PJ8A 5KAQG 3WNNA 1DBBH 2I5YH 5SWSA 4XMTA 1JNLH 4WWNA 1YQVH 3RB5A 3Q05A 2WTPA 3V4PB 2V5TA 2PR4H 3CXHK 2HT2C 5D1QD 2QV2A 2X87A 4OW6A 4ZTPH 3ZW3A 5HYSA 2P46B 3Q6GL 5LCVL 4AY0A 2XOTA 4PCTA 4NGHH 1OOAA 1BM3L 4H0GA 5FYKH 4HS6A 4EE2A 4FKKA 1UXMA 1V7NH 3PWNA 1AP2B 1I1AA 3CCHB 4NI3A 3DX3A 3CVIL 4GYBA 2EVJA 1OWWA 2KMWA 1GAFL 5AZEH 2VDQL 3RIAK 4ONGL 2ZXDA 5GS1A 1AIFA 2QPDB 5CJ8A 4TVUA 1WFMA 4XN8A 1RUKH 4DVRL 5HY9B 3HI1B 2HWZL 5HVHC 3QCUL 1RLBA 4R26L 2ZP0T 4B50A 4JDEA 2HMID 5ISZE 2P5WB 1E65A 3MA7A 1MWAA 2WHVA 4PRPE 4OFYD 1OZUA 2NY2C 5BRZB 2GK0B 3EJPA 1WLHA 2HG5B 6PCYA 4XN5A 4ERSH 5JQIB 2LU4A 3TNMB 3EFOA 2IH3A 2VDML 1LEGB 3RGBA 4AXWA 1ACYH 2BSSA 2JLLA 5DMJB 4NKQB 5I15H 4J1UB 2V3EA 4JM4H 4R4FH 5D72L 3VH8G 3CVDA 5GSRB 4FQHB 1DVFA 3OAZK 1HDMA 4N6QA 3ZE1B 2MOQA 5D71H 2X53A 3RA7H 3TO4A 1RPKA 4XOBA 1CK0L 1EMTL 5DMGD 2Y1YA 2BFVL 4UV7L 3NPZB 3MJGX 3UACA 4U3HA 1Q1PA 1KB5B 2K8MA 5HGHA 3M1CA 5BS0E 2OSLB 2I25N 2RTTA 4XNYL 3L3HB 3LD8C 3SGDH 3ZR5A 1K2DA 5D1QB 4G1MB 2DB8A 5BUGA 1FLTX 4H7VA 4JHAH 3Q2CA 4NC2B 3FN9A 4Q7DA 1HEHC 4Y7MA 3MNVB 4R7DA 3X1FA 1AD9A 3NCJH 4LDOB 3FBQA 3V4LA 1E4WH 4J3OF 4K7PH 1P2CB 5ESQA 5I71B 1MHEA 1MCPH 3LV3B 1IAOB 2VLRA 4OLZH 4Y89A 4F24A 3E6FB 1PSKL 5DRXB 2YRPA 1DTUA 2C3GA 3QXWA 2BWDA 4GP4B 1EH9A 5SWZD 1IM3A 2VLLB 5EEUA 3WHE0 1BJ1J 2GBAA 2Q20A 4EI0A 1B0RB 4R90L 5E00B 1IM9A 2XY1A 2CO7B 1A7OH 3GMPB 3A4FA 5IROA 1LO0L 5FW8A 2A4ZA 3POHA 4HUMB 1LDPH 1L5GB 3OJVC 1X4ZA 4EDXB 4XCYB 1PAMA 5B1AB 3TVMD 4DPBX 5I16A 3L7FA 3D87B 5IW3A 3RFZA 3FCBA 3IFPA 4L3CA 3LKQA 1SVCP 5BRPA 3QZLA 3TBTA 2JKLA 4N22A 1G9MH 3FQNA 1MCQA 1DFBH 3TJPA 4E41E 2HTKD 1EJFA 2H4EA 2DKMA 4HGMA 2UY6A 4JO4L 1KZYA 2W81C 3P4NA 3L1GA 2IDTA 3IFOB 3OJMB 4K7FB 4NN7B 1KN4L 4FL4C 5GS3A 3QJOA 4G1EB 1BMZA 3BCFA 2C3VB 1J05A 2WBJA 4WENB 4Q9QL 5IMLB 3HI6H 5F9WB 1MNNA 3JWDH 1ETJA 5B39G 2A6IB 2A1WH 5EZLA 3AT9A 3LNDA 4QHNA 4L37A 5CSGA 2NYYC 4P23D 1XCTB 2FBJH 1G87A 3MOAH 3VTAA 3I6KA 2J12B 1JL8A 1USQA 3MREA 4JQXA 4MQ7B 2JKRM 5I1KH 5K39B 4XPAH 1XSJA 4WHTB 4NEHB 3SQRA 1RJZA 1TNMA 1CXLA 3AY2A 3HN3A 4N0CD 3DOIA 4YHPA 3VDAA 3Q44A 2DLTA 3MX0B 4IMKA 2DTMH 3L5IA 5T5FA 1YNTA 3ARQA 5F7NC 2OK0L 1BVNT 1JXGA 3W56A 3UIZA 2PWHA 3TBWB 1YEKH 5SWZB 4P2OA 5HHQA 4Q4IA 4YFEA 4QHPA 1Z9MA 1J1PL 3MV9D 3RWJA 4ZUTB 2UZYA 1SFHA 4Z7UF 3NRQA 2FLBT 3GRWH 5J6HA 2AXFA 4WUKH 5HYJB 2D2CC 2OMXB 3SKJH 4PRAA 1JFHA 5E1AB 4EI5A 2HFTA 3CFEA 3H55A 4MJ6A 2AABL 2PTTA 5T1MB 2ESVD 4G42B 3TVMB 5JORB 1KBPA 3DX0A 4NUMA 4JVWA 4GG6E 4OZHF 4JX0A 2PP8A 3FTGB 4PRHA 4X4XA 4JFFE 2NW3A 5DWUH 1IVTA 1TVBB 1BXAA 4OZFA 4F2MB 4ZMYA 4YEFA 1L6XA 3FO2A 3BAWA 3OZ9L 1FA4A 2HJFA 1K6QL 2EVFA 4L1SA 1QLFB 4KVCL 3VXSD 1NDGB 2FR4B 4D7BA 5ANHA 5E8DL 5MEND 3O9WA 3WEMA 3MLWH 1J11A 1ONQA 3SGDI 4ANWA 2B1AL 3ZQWA 1OZTG 3WKYA 5I0YA 3KLKA 4O2EB 5AZ2L 3SKOB 4N20A 1JGDA 4ZTOL 2OJZH 4YAQB 3HRZA 3K74B 1T1ZA 4KDTC 5K69A 2VZVA 3IGUA 2J8UF 5EPMB 4HOZA 4LL1A 4HIHB 3FQYA 1UWEH 5E4IA 1JOIA 3MRDB 2CCWA 4P23B 5KSBB 4CDHA 5EMYA 2K3TA 5E8NA 2A77H 1WFJA 1UCBL 1JHKL 1GKEA 4JFWA 1J18A 3HB3C 1U8MB 3KJ6H 5AZUA 1IJ9A 4B9GA 3VI3A 1FL5A 2EKSB 5HVWA 4OLYH 1HIML 2WQRA 4ETYA 1RULH 4FQ1L 4TUJB 5AAPA 2ICEB 1CWVA 5FA3B 5HD8C 2B4CH 2W0PA 1OE2A 5FUZL 3P2BA 3ESVF 3BD5A 4IRZL 3US0A 3MV9B 1XF5B 2UYLA 3GRGA 4FZ8L 3GNMH 4HKXB 1EVTC 3N1GC 5F1IB 2L7UA 1V7MH 3NSYA 5PCYA 3H56A 4KK9C 1RZQA 4CMMB 5I1CL 3W0WE 5CP3A 5A6MA 2G9HA 3VG0H 2ESVB 1L9NA 1YNKH 2V5SA 4XO5A 5E70A 5I0XA 3ZKXB 1TCRB 2HJKA 1EHLL 1NJ9A 4JL1A 4Z95H 1CVSC 4UTAH 1FIEA 4L3EE 4G6AC 3WU1A 1ZVSB 2WO2B 4N2BA 5FOBA 4TQEH 4S0SD 3QFJA 2WVUA 1U8NA 3DSFL 4JZNA 3VG9C 1G7MA 1NCBH 1IB5A 3NJVA 4W9KC 1IJNA 4B0MM 2WSDA 3LEVL 4OQTA 4JM2C 4YDJA 2VDPL 3VXSB 4GQ9L 4BDVA 1BG9A 4W6WB 5ECGA 1E42A 5MENB 2R2CA 4PGZA 2ITEA 2VR5A 4WFED 3B2UD 1X5HA 2DM7A 4WNJA 4XPFL 3T09A 1N70A 1RZJH 1INEL 1V55B 4G9FE 3NEOA 2ZP8A 1T4KA 2UXFA 5IB1A 1WGVA 4CVXA 4YS4A 2RR3A 1HE8A 3U7WH 2BCMA 3RY5A 1A7RH 2BC4B 1P7KA 2GIMA 3ZGIA 4GQRA 4Y9CA 3ILDA 3QZWB 4G70B 5L4MA 3VDBA 1EV2E 1R5WA 2ZWLT 4K9EC 4JJ5A 3NMEA 1KIRB 4JY4B 2Y69B 4NBZB 3VWKA 4W9FC 1SM3L 5AW6B 2W60A 3LPFA 1B0WA 2BH0A 4GMTH 4N8CL 3LS5L 3QUMB 3LIZH 4QXGL 1E4XH 4LFHG 3ECBB 4DTGH 1JXKA 4FXTA 2FSEB 5E1IA 4AH2A 4LE8A 2IQAB 3SZKC 2VAJA 1CLOH 2HXAA 2WXOA 3PIQA 43CAB 4I48B 4ENZA 2NXYC 4G9FD 5F88B 1QW8A 5HHME 4B9PA 2Y06L 2JVUA 1OTTC 1DUZA 3WN5B 1LTXA 2BINA 5KSVA 3HZYA 2ZSVB 4OB5H 3O4LE 5C8JA 3T08A 1TQCB 1WFNA 5DRNB 4F7TA 3BP7A 5DUML 4FXKC 2HVJA 4CSSA 4U1SA 3QHTC 1XXFC 3ABKB 3OKDA 1JHTB 4MB1A 5LCVH 4ZAKD 4F8LA 4FQCL 1IILE 3F12A 5HGBA 1BM3H 3LDBC 3RZCA 3NOIA 4Z3JA 4OIBA 2V2TB 3BHBA 3J7HA 5DCCA 3QDAA 1TQVA 3CVIH 2K45A 2VLJA 3WXVH 3R8BB 3DVIA 3T4AB 3V0WL 3PWVB 4RZKA 5IOKA 4DK6A 2H6UA 5A43C 4UOQA 4HT1L 4YL9A 2CLVA 4BSWA 1J5HA 4JLRB 4S2SA 2LU5A 4JMNA 4P3DA 1G7HA 2BS71 4DVBA 4Z7OB 2ICWA 5DU7A 4NZFA 4AGOA 1GYWA 5FUCE 2AXJA 1E6JL 1HHHA 3O3BB 4W4OC 3VU2A 2FDBP 4ONOA 4DK5A 4YDKL 4R26H 5IMKA 4N2AA 1QLRB 4OKVB 2VR3A 4TQIA 2XJLA 3AREA 5DFVC 5MHSD 2CA3A 3NIGF 3MLZH 1YEEL 2Y7MA 2OYMA 3A23A 3D34A 4H13C 4MQXC 4Z1PA 4U1MB 4GH7B 5AAMA 5DQDL 2X3AA 3OMAB 3HFMH 2VDMH 1IGMH 4XI5C 1F45A 2X4TB 3ZVVA 4KPHL 1B9ZA 4ZW5A 4JFUA 4X6FB 3QYCA 3SOTA 4HIJA 5K1VA 4YSAA 1Y07A 4PJEA 5D72H 3F7LA 4Y0GA 1ORSB 3AG2B 3FU7B 1XB8A 5EUOE 1C5BH 2PUQT 5KG9B 4HDIA 3K2IA 3FB6A 4HUUA 1CK0H 1O6SB 3ZY7A 1EMTH 1KPRB 3ZU8A 4GRWE 2MNJB 4QHUB 5GGSB 1H6EA 2C9PA 3OVUB 1ND0B 2WVVA 4HHAB 2VL5A 4FERA 5LVEA 2FJGB 4G83A 1A65A 3KLHC 5DLML 4A37A 4XNYH 2VM9A 3QDMD 2Z6FA 4NERA 4RZCA 1XCWA 2A74B 4FFWC 3QWOA 4JQVA 2CRIA 3CXDL 1JD7A 2E5EA 5AB1A 4XTRD 3AQDA 1EFQA 1WHOA 4RMBA 4ZX5A 3ULUE 4ZAKB 4KKAC 1J5CA 1G0XA 3TBVA 1GS6X 2HJLB 1GGCL 4PJIE 3AQYA 2G4EA 1WQVT 3RI5F 4Z76B 1RURH 1CS6A 1N3NB 3GINA 3MRPA 4KNUA 2WUCL 4MCYA 1WC7B 4M43H 3IE4A 4NI6A 5D7LE 1PSKH 3DBSA 4AL8C 4LKCA 3G6AA 4ETQB 3MLVL 5DMIL 1PG7W 3BKCL 4LSRH 3ATAA 1FYTB 3H2WA 1ZPUA 4DZ8B 2F61A 4MAYA 5JOPE 2FCBA 4KU1A 1LO0H 3HAEH 4PJ8C 3FDWA 1YPZF 3H9ZA 5GRZA 5ITFA 4LCWA 4E9TA 2MQ0A 3VFOA 1E4XI 4HG4J 1OVZA 1TZGL 1VFOA 4OR1A 4LHUG 1KB9K 4NO0D 2ZWKA 4GEJA 3ZKMD 5KANG 5E08L 1CO1A 1M2OA 4TKWA 1MG3C 2QGBA 3EYQC 1BOGB 1E0OB 3BJ91 3DUSB 3UJJH 2MOGA 3CFNA 4W70A 1OSEA 1F4AA 1TQUA 2GT9B 4JO4H 5DO2D 4OLVL 3TJHC 3DGCR 4H5SB 3T3ME 1J0HA 3FB8B 1HCYA 3O2WL 1LL1A 1TZOA 3QUYD 3BVNA 1UEYA 2VKWA 5GS1C 2YQ2A 1ZE3C 3EJZD 4ZOAA 5DUPL 3TJEL 3E3QC 1N5YL 2C4FT 4KUCD 3QDMB 3RURA 4FKHA 4A7QA 1KLFA 1VESA 4HCGA 3MLXL 3WS3A 1J86A 1YYML 3CN4A 3HKZA 1RKRA 4BCZA 1XIWD 1XH2A 1IGYA 1X5KA 3F7PC 4WLCA 5A2IH 2J20A 1KB9J 4WCYH 3U46A 4CN1A 4FOMA 2BIIA 5TK4A 2MJWA 1NMBL 3AM8A 1G5GA 2J6EA 1VGEL 4WU7A 2Q7YA 1TQTA 2AJVL 3WIFA 1FUNA 2C3WA 3HR6A 5IG7A 1SNRA 2OK0H 1WPCA 4YPGB 4KKCD 1SDYA 3FQTB 5DXWA 2F6AA 4PJXA 2DQHL 2APWA 3CLEL 1KWGA 1U8PA 1DVFC 3AC0A 5DD6A 1J1PH 2DQTL 3JWNC 3KJ4B 3TO4C 1FG2B 5DK2A 5DJXA 4AGNA 1BXVA 1VFBA 3KYNA 4Z7VE 2Z8RA 4X6DE 4F7CA 1B3JA 3IF1A 3F7VB 4HOWA 1LWJA 4OCLC 3THML 1X5LA 2OMTA 3FO9B 1T7VA 2P8MA 4X5LA 3MJ9L 1IAKA 5FIEA 1O9ZA 1PNDA 3NIFB 2XCMC 4NO0B 4YSOA 2YRZA 5JHDD 4X6EB 3JWNG 1R5VB 2GABA 5B38B 3D4GA 5DHDA 4XGZA 3OZ9H 5DEGA 4XPBL 3OMIB 1K6QH 4B0MB 2NR6D 4HSAC 4KVCH 5DA0B 1SHMA 4XBEL 5DRWB 5E8DH 5I1LB 4Z7IA 4KUZL 5G5DB 1QSVA 4U0RB 2QR0B 2B1AH 4HZLB 3UOAB 5C0CA 1ID2A 2YEZA 4IOIA 3GB7A 3QUYB 4K3GA 4NUQA 1PZDA 4Y9FA 2OMZA 4ZTOH 1XF4A 4LOFA 1EIBA 2D7TL 4ZXBD 3ZR6A 4J8RB 4G8EA 2X4RA 2OL3B 4PI2A 3UZQB 3OGCB 3RWCB 3CH1A 1LO5B 4BFFA 3C6SB 4M1GL 1LO4L 5BQDA 5IROC 3JTSA 3ZTJH 2D0FA 1DDHB 1U8OB 1MFCL 3VVWA 1XIWB 4OU3A 1J9QA 3LZRA 4OGXL 3ZE0B 1UCBH 4IRJD 3VI4B 2AXGB 3RFZC 2YLHA 1NIDA 2Z93A 3RL1A 3MODL 1SOKA 2A4CA 3BT2H 2XYBA 1CFNB 4OJYA 5IB5B 1ZHLB 2KI6A 3ZDXE 5KS9A 1IKFL 4JO5A 2JF1A 3PS6A 4DZBA 2BSED 3FMGL 4NZRH 5GS0H 2CO6B 1I3GL 4JR9H 1D5BB 1ES0B 1RPQA 4K9EL 2GITA 1P7QA 1JZEA 4NBXB 5FUZH 5A7BA 3MLPA 4HX1B 1VCBC 1QUNB 3O6KH 3PWUB 4LHJB 4DKEH 2PCFB 1OD7A 4H1LB 1RK1B 3U7YL 1JF1B 3SBRA 5KOMC 1CQYA 2YPKA 4WGVB 4DO6A 3ZE2F 1GS8A 1KTLB 3NZUA 2A9BA 4Y2DC 2HFFB 4IDLA 1NFIA 3NH7L 4XAWH 5F3HB 2VJXA 5I1CH 2XWTA 1AHWC 4X7TB 1IO4C 3TWCL 3ILQD 2NY3C 3IFNL 4LBEA 2LTQB 1TVHB 3WEAA 4N2MA 4R83A 4OIIL 3ZDWA 3QUKA 2IH1A 3HE6C 4JQXC 4Z0BL 3B9DA 4BBWA 5JHDB 1A14H 1LLAA 2F8IA 2PWEA 4P5KA 5E8PB 5AB2A 1MQ8A 3DSFH 3P2TA 1ZHNB 4GEIA 3T65A 5FHBH 5HDLA 4X0KA 5HGAB 2VDPH 4IMKC 5DHVH 5DHMC 4GQ9H 5AVXB 3RILA 1UVQB 3T2QA 4QJ5B 2GI7A 4M7LL 3KLAA 3ZL4L 4P2OC 1D9KA 2HYMA 4XPFH 1BVOA 5I6LA 4WUUD 3FAXA 3ARXA 1NCHA 1INEH 3BWSA 3ZBMA 3QEQD 4ZXBB 3ULAB 3S3BB 3O6LH 3L4WA 4AUYA 2Z7WA 3H6AA 4EI5C 1OSZA 2DKSA 4Y5XA 4F8QA 2R2BB 1VKXB 4ZUWA 1W6WA 3EH5B 4J3VA 3H7BB 4K0OA 4IRJB 1SM3H 3TIDB 3VO0A 4TLKA 4LLQB 4KRPD 4NO2A 3DBXA 3VXOB 1FG9C 4TTGA 2Z4TA 3EO0A 3LS5H 4Y5YA 2AK4A 1RI8A 1V3KA 4OLXL 4Y1AA 3PWPA 3N9GL 1CI3M 4LAQL 1FO0L 2F53D 5J7CC 3EFDL 4UQCA 3DLQR 3FHAA 4TUOA 3ZZQA 2XRAL 1XSIA 1AE6H 1HSBA 2Y06H 3FB5A 3O9WC 3F62A 4JDVA 2EAEA 2PYFA 2BP0A 4KV5F 5CLYA 5D9SB 1BMWA 3BPLB 4DH2A 4IKJA 3HRZC 3PU7A 2UWEA 2WVSA 3GSVA 2JKJA 5HHOD 3QUGA 5I6PA 5D1ZA 4OZFG 5DUMH 4YSSA 3M6DA 1CDBA 1HXMA 3MUY1 3BRFA 4UM8B 5E5MA 1YY8A 2ZD0A 4JY5L 1QSEE 2HLFC 1PZ5B 3OF6D 3PG2A 4FQCH 3UTQA 3WYRA 1BQHG 5ANMB 4X98B 1O9VA 5F7FA 4M9OA 4NO3A 4D9RD 5ID1B 1WCBB 3BRGC 4JGMA 4EIBA 1ML0A 3ZE1F 3GMOB 4GRMA 1PZUB 4FFVD 4U1NB 2Q6WA 3V4VH 3MZTA 4HT1H 2R7EB 2XTSA 3C5XA 2R23B 5IWLA 2EO1A 4FTVB 3APMA 3VYOA 5E2VH 4OCXL 4WUUB 1CDJA 1F90H 3QEQB 3J27A 3HC3H 1RU9L 2W9EL 1UB5B 3HPJB 1E6JH 4LCVA 3OGOE 4RDBA 3VFUA 1ZA6B 3F7QA 4OFKA 4AL8L 2YKLL 5HYFA 1MCOL 2IMMA 3B1TA 3RWFA 3HZMA 2G2RB 3W82A 3EUDA 2MNWA 4L9LA 5SWSE 4KRPB 3FW6A 3CN2A 1OM3L 2ZF9A 1NMAL 3TESA 3L4UA 5HGDB 1OSYA 3BESR 3ILEA 4P46A 1D2OA 4XWOD 1MCSA 1QBLH 3STLB 3SJVE 5I66B 2E7CA 5D2NE 2F53B 1K3IA 3U4KA 2YPVA 3CNKA 4W9EC 4C4UA 3L9YA 3S3CB 1FZKA 2ZUVA 4KX9A 4DAGH 1LE5A 1E5YA 3K80A 1GZHC 1MXGA 2XTLA 2WMPB 3H42L 4S11A 4UOZA 1DO5A 5FW6A 5EC2A 3CDGA 4ZK8A 2OULB 3S35L 1D6EA 1XGYL 5TPWL 5HHOB 1GMIA 3QULA 1P4BH 3IM1A 4CVZB 3ES6B 4GRWH 4ZG1A 4XP5L 2BJMH 1LJMA 1WWBX 4JFYA 2VL4A 2Z8VC 5CCKH 1DVUA 3RWDA 3WLWD 5FK9A 3QCVL 1T0NB 4NKMA 3VWKC 3IYLW 3MNZA 5LAPA 2VXQA 1OAKL 3S35X 1R47A 5LN4A 3UTTA 3CPLB 5I8KH 3ULUH 5C9JB 2GC7C 5AAWA 1PZAA 1OCCB 4UZGA 1E5ZA 3MV8D 2ZX9A 3CDCA 3HS8A 5FV1L 3MLVH 4WEUD 2GSIA 2JXMB 4YH6A 4QD2E 4ZOEA 5D7JD 1MWAL 4NIYE 1GZQB 4MX7B 3SDAD 1F3DJ 4JFXA 4AZ8B 1A1NA 1Z5YD 2X3CA 2PNDA 1F4HA 2FLRT 4G8GA 1NGZA 2MCMA 4LRNH 3CH8A 4K8RC 2TRHA 3HCVB 1AQ8A 4P59L 4DIXA 1M2VA 1SEQH 3GEFA 4NM8L 3VSUA 3RVUD 3DXAD 2ZUWA 3DSNB 3FB7A 4KXDA 4WNQB 7PAZA 3BIAX 3I9PA 4FP8H 2ZF8A 5K5YA 3OKMB 1NCNA 2WTRA 1IU1A 1NSNL 4QGTA 1ET8A 3B9AA 3BVXA 2X2HA 3HC2A 5DI8A 5TF0A 1IMHC 2E86A 3EDFA 1KCRL 4NP4L 2ZX6A 2F9BT 4HFUL 2I07A 4HJJH 4OLVH 3RTLA 2IAAC 2PWFA 2O6CA 2WO3B 1OB1A 3O2WH 4YFDB 1L9QA 3GSXB 2DLFL 3B3IB 2FL5A 4N0YH 1SJEA 2OMYA 2ZCZA 3HNSL 3TWYA 3TEWA 1K8IB 5DUPH 4BK8A 2QZ5A 3APFA 2E27L 2FX9L 4Y2OB 4BHUI 5FPIA 4KJYA 4NZTH 5FM4A 1YEHH 3TJEH 1N5YH 3CC5A 3M07A 3IETB 4QR7A 3G7TA 4J3SA 2V9UA 3ASWA 2NW2B 3MRNB 3VXNB 2DQUL 1MKFA 1YYMH 4S10A 4HWBH 3DX8A 3AREC 4IKNA 4WFHE 3QEUB 3VGHA 2W94A 3MLUL 3AU1A 1MN4A 3TA3A 5FYLE 1CGYA 1JPEA 1NMBH 1KV7A 5AAMC 1KC5H 2HG0A 1VGEH 5LBVA 3WO4C 4EKXA 2AJVH 3GSQA 5FYLL 3MV8B 2Q76B 3PQYD 2BY1A 4PGEB 3T6WA 4JHWL 2DQHH 5D7JB 5C6WH 3SDAB 2W0KA 3KCWA 5FYKD 4W9DC 3P9MA 1IC5H 4LP5A 3ML9A 4XXDA 4P48A 2MCAA 1UASA 3IAPA 1EPFA 5CM1A 4GUQA 5E6ID 1KTBA 2EC9T 3D07A 1LXMA 4JQVC 3DXAB 4JFEA 5ERWB 5LDSA 1NEUA 3FFDB 1RJLB 4M7ZC 2ED9A 1EGJA 1G6VK 4P5TA 4AJVA 5GHWL 1KTDA 4MBOA 3Q8CA 3MHZA 2WUBL 4M02A 5I74C 2EIDA 3S4SB 1OK8A 5AG8A 4M9PA 5CFAA 3PAVA 3HW7A 4WI6A 3DA0A 4HJTA 3MO1A 3NFSL 4XBEH 1E30A 4TNVK 2XWRA 3D2TA 1R19A 2DMKA 1P7HL 2ZOUA 5IMMB 1DFXA 4XO3A 1AKJB 1P1ZA 1WEJL 4XNDA 5T33L 3D05A 3KM2A 4XPTL 2D7TH 4KNSA 1PQZA 3QH3A 5J6GA 2KZBA 1JCKA 4M1GH 2CRYA 2Q86A 5DK3A 1UJ3B 4MAYC 5T3XE 4FD0A 1LO4H 2NX5A 3UTZB 5T5FL 3VFNB 4PIRF 3FSAA 1MFCH 1AACA 4OFVA 3DV4B 5BO0D 1S78C 2NT0A 4G7VH 4OGXH 4XP4L 1BEXA 3OR6A 4YGAB 1X5XA 3DVGB 4N0RA 5JMRA 1KOAA 1LD9B 3WFEL 1J5IA 4H40A 1M1XA 1N6VA 3PUUA 1M3IA 3TZVC 5EBWB 1I1FB 1QSZA 4BK4A 1I3GH 5E8OA 4HUCA 3NK4A 3PQYB 3T0EA 4K9EH 4MJHA 4ZW3A 4MNGB 3IDXL 3MGOB 1K5WA 2D7MA 4K4KA 4BFIA 5GGSY 3TASA 3ZDZB 2DQDL 3U7YH 2K7QA 3WFCL 5D2LA 1WGOA 3WY3A 4J23A 1Z9NA 2YAMA 3B7UX 4K94C 3UERA 2IG2L 1FGVL 5ESVA 3TWCH 2NY4C 3LRSA 3VDCA 3FRPB 3RFRA 3IFNH 2AXWA 3LAFA 5KVGL 3ERXA 4AWJC 3IJYB 1N12A 1T0MA 2E6PA 4M6OL 1XWVA 4OIIH 4PSRA 3QJZA 4Z0BH 3FOMB 4HIXH 4KHXH 1ZLDA 2HSIA 3AGVA 2E8ZA 4XH2A 1WS7A 1F1AA 1IX2A 3AM8C 3EJCA 1CI5A 3EKCA 2AJ3B 2EIJB 1LNUA 4D3CH 3Q06A 2GJRA 5GRWA 3UAEA 3LHAA 5DUBB 5E8EA 4M7LH 3ZL4H 4YK4C 4D8PA 2D3VA 2GB2A 3T8XA 4GW4A 1RHHA 4N5EC 4P4RB 4POZD 3H9YA 1A3ZA 3BKML 1HHIA 2X7LA 4MNQA 4WSGA 1LO3L 2B7DT 2ORBH 1I8MA 5JDSA 2NLJB 4ZMVA 5E56A 1GZPB 4OCNC 5LQBL 4HW6A 1UXWA 4N8VA 4R4ND 4Y16A 5EFIA 3IDMB 4YBHA 3C5ZD 1I9RL 3T9WA 1W0VB 5IHBA 1PL3A 4OLEA 4JDZA 3TBYB 5C2BL 1A4CA 3NSFA 1KPVB 3LN5B 2O5XH 4PRDA 3AFLA 4CJ1A 1FO0H 1U2CA 3MDJA 4PCSA 3QJFA 4Z7OF 1ZTXE 25C8H 5C09A 4XZUA 3QFJE 4WJ5B 1PG7X 3DPDA 3VFSA 3WOVA 2XRAH 1JK9B 1PD0A 3W38A 5ICZB 3NEXA 3PGFL 2H8PB 5I17A 5KVDL 1DEEB 2Y7SA 1BYPA 1WD9A 3MGTB 2LU7A 1ZTXL 1H0DB 4ODXA 3QHFL 4DQOH 1D5MA 2F7QA 3GJEA 1XGUB 3D39A 3L2MA 1KCUH 2FJFB 3NFPB 4OQTL 2D73A 3REWA 4B97A 1X6LA 1DBML 1CDYA 4JY5H 3EBGA 4Y19E 3CFIC 3KZ8A 5TH2A 4I89A 3TCTA 5C9KA 3OR7B 4FNQA 3ESMA 5DJZA 1BQRA 1G6RB 2NMSA 4TNWF 4ES8A 3BQUA 1J5DA 4NJ9H 4X4ME 1OP9A 3VJ6B 5IB4A 1TQSA 4GT7A 5JA9A 1RXLA 2QADD 3SKUD 2R51A 2O6PA 3EBIA 5F44A 5CSBA 5J57B 2X0WA 3C5SA 1E9QB 4ICXA 2YOCA 2L4OA 1NAMH 2VABA 3MBWA 4XN1A 4DF9A 4HISA 4F3FA 1NIEA 3BAEL 1A9BA 3W9EB 2W9EH 3F05A 4DT2A 3MRBA 3QA3B 2IPKA 1V54B 2BOCB 4Y19D 1VFMA 4AL8H 4BKTC 3IKCA 1JWUA 2YKLH 2XDHA 3GKZA 1CL7H 2V5MA 1GXEA 1MCOH 5CZKA 3O2DA 1G7IA 2KERA 4PQXA 5F1SA 1QRKA 2EILB 1YN6B 3MRMA 4OBRA 5EOCH 1B2WH 1OAUL 2NY1D 3C5ZB 4TUKL 2K4WA 1OM3H 2CIKA 1NMAH 4G6KL 3EBAA 5FWRA 1J48A 2E9IA 4CC4A 4K8RL 1D5IH 4NFDA 4HWNA 4H8WC 1OY3B 4YHIB 3UIYA 2OSYA 3C75A 1DO6A 3F6IA 3GZOA 5IHUL 1J0KA 1G1YA 3QUHA 3BIBX 1YEDB 3HMWL 3MACL 1I85A 2VLJE 3VGAB 1D9KC 3RIFF 2TAAA 4XVUC 4I5BB 3P3RA 1KNOA 2P4AB 5TPWH 1Y18B 3P4OB 1HXYA 4YDNA 2XT1B 4G6FD 2PPEA 5F89B 1BD2D 2XBDA 3D52A 5EA0L 5GS2D 4PW3A 4HIIB 3BH8A 4OZGA 1PS3A 4Y5XC 1BZ7B 1DE4A 1TITA 4LLMA 3B34A 3QCVH 3FO1A 4TSAL 1E9OB 4KX8A 1TYEB 4LPYA 1OAKH 2XWCA 1JPGA 2ZWYA 3EHBD 3GRBA 3B2XA 3L81A 2V2XA 3S5LA 4Y5YC 2QADB 2Q0ZX 1LEKB 3VXUA 4AYBA 1WZKA 4BD4A 2C9RA 6PAZA 4LCIL 4JPWH 4PJFA 3BGFC 3CXFA 3FJTA 3G5YB 1QFOA 4F58H 4H8QA 4X83A 1OPGL 4JS7A 4WFFD 4HLJA 4X8CA 2X89A 1JE6A 3MYJB 4Q2ZA 4XPGL 1U3HD 1PMYA 1UT2A 4E2OA 2Z7UA 4P59H 4P2RE 2WQUA 5CJOH 2C9QA 3M1BA 5JPNB 2WLZA 3IVKB 2XY2A 3QZPA 5D1ZC 3L17A 5FO7A 2WYZA 4A63A 4BV1A 4BFKA 2J1ZA 4WK2B 1FFOA 4NXKA 1DUYB 2AI0H 3TT1L 2NY1B 1H6FA 2OP4H 4OF8A 1B4JL 2VC2L 2ITDB 2OI9B 2CO2A 2XG4B 1KT2A 4PJDA 5L88H 4G80A 1KCRH 4RGOL 1KIUA 4YWGL 2CLZB 3K4ZA 3OJDB 3OXSA 2D2OA 4WTZA 4MLSA 3KE0A 5M94B 2GSGA 3QXAB 1RCYA 1VEOA 4YDVB 1F6AB 3HNSH 3LSOA 3NCBB 4MNHA 5IWLC 2OTWA 2FX9H 5I19L 4NQCA 4AENA 1NCCL 3MN8A 2J1KA 4HUNB 3SD5A 3QEHB 2EYTA 4MDJA 3KDMA 4YQXL 1A6PA 4PLJD 5J12C 4G6FB 5D70L 5FCSH 1BD2B 3BC9A 1M3JA 2G9KA 3A47A 2DM2A 5BO1H 4X9FA 1XAKA 4JFOB 3K6DA 3KYMB 3MLUH 4FJZA 4PV8B 4NN6B 1UCTA 2KLRA 1R3HB 4LCWE 3D08A 1J8SA 1M57B 3CDZA 3EHBB 1J7VR 4L1HA 2ZUQC 2A2QT 3WE6B 4GNKB 2CUHA 5FYLH 4G11A 3TNNA 4GFTB 2Z4QB 4P46C 4AT6B 2JWYA 5KN5B 2AJZB 3BE1H 4JHWH 5FC9A 5K59F 1X7TA 4OZ4A 2EZ0D 3B9EA 2A6JB 3UEQA 1B3IA 3G5XB 1SBSL 4XB7A 3ROLA 1V10A 2HVKA 2V2WA 1UQSA 3EYUL 4KUCF 4ACTA 4EUPH 1U3HB 2DDQH 3KM1A 3MCKB 5I18L 4TTDD 2A73B 2GBVA 3CZKA 43C9B 1OTUD 1T66C 4TSCL 3ZE0F 4AIEA 3MLSL 1F3RB 4P4KA 3CC1A 1BBJA 3NESA 3RKDC 3MROA 3LOWA 1DJGA 3FTZA 4I88A 4LSPL 2A3TA 3DMMA 4KXBA 5D4QA 5GHWH 2WUBH 4XB8A 1VLXA 1JGUL 1JNHB 1QRNA 2JB5L 3C5JB 5IJVA 2R69A 1BZ9A 2WYHA 3OAUH 4K94L 5AAWC 3NFSH 3WTUA 1MF2H 3WL9B 5E4AA 4U1KB 3VGBA 1I53A 2B1OA 5JR1L 2OMWA 3D1MC 1T89C 3S96A 5DJCA 1GYCA 1M05A 1ZLVH 3IDUA 3P3SA 3S36L 3CBRA 5I0WA 3B2VH 1MUJA 3O4OB 1XF3B 5T33H 1QTPA 1KYOK 3KGUA 4XPTH 1OAYL 5TQ2L 2O6EA 1T1WB 2XETA 5GZOD 3KXFA 2FO4A 2ITCA 4PJXE 4CU6A 5T5FH 1M9WA 1Q9WB 3RG1C 3QR0A 1Z3GL 4C4BA 4NKOA 1SHWA 3IJHA 4XP4H 2JJSA 5T3XH 4MB4A 5LXGL 4ZS6C 1MREL 5CSZB 2CKBA 4A7SA 4HBQA 3WFEH 3SE4A 3JZ7A 2HFEA 4PJAB 3B7YA 1L9TA 2WBWB 2GTWB 4H26B 1N19A 2YFNA 3QIBA 5CEYB 1G7PA 1D6VL 3T0DA 4W68A 3OG6B 1MZYA 1JGEB 1K72A 4J12A 2CCLA 3J8F7 3L08A 2DQDH 1CTMA 4YFLF 2N1TE 3WFCH 2Y5QA 2EXWD 3VMPA 4L4TA 1XFPA 3PNRB 1DQQA 3AB0B 3QZMA 2VDQB 2IG2H 1FGVH 5C0CE 4UV4H 4P9ML 1EXHA 1ZT4A 2DQCL 1F8TL 1IBYA 4QRPA 2MHAA 4ODVL 2A0LC 2VAAA 4JFQA 3GO1L 1F6FB 3DOHA 1W72A 2WCSA 4D0CB 2X4PB 5I75B 2HT3C 1XCQA 3VFMA 3WFBH 1UOWA 3QRGL 4MD0A 3X3FH 3GUTB 1G7QB 2OTPA 2BVQB 1Z0NA 1H6UA 5DTFA 1QPXA 2OXGA 1JUFA 4V1DE 1RP9A 2PO6B 4IK6A 5CCGE 2VM3A 3TN0D 2UV3A 1EUUA 5B4MD 4NNYA 3K71B 4CRPA 3E2HB 4Y1TA 5D55A 2VDMB 5HPMB 5KS9E 3BKMH 4GBXD 1XT5A 4NFBA 5LNEA 4JREC 1ZLSL 4UT7H 4AQ8A 2WKLA 2WWKT 3HBQA 4AQAA 4LB8A 1S9VB 2DH3A 4PG2A 1FPTL 3AUVA 1CD8A 1XX9C 3CQFA 3GMNA 4YSCA 5LQBH 1TKWA 2F68X 3WIHA 3FHQA 1HX0A 3Q9PA 4Q8BA 1V5JA 1VFAA 4KJPC 3SQBB 5ICUA 2XWBA 1BZEA 4V1DD 4P5TC 2IWFA 3U4BL 3K91A 3OKKB 4G2AA 5H37G 3EYOA 5DFTA 4AV0A 4M5YL 4K5LA 5IJKA 1Q1JH 5ACLA 4LLYA 1PTZA 4IBSA 5CP3H 5C3IA 3BWUC 5B1BB 3R06A 4OGYH 3I75A 3FU5A 1LP9B 3PGFH 4ESKA 3JV6B 3BVUA 2OJEB 3LQZA 4PRNA 1ZTXH 4XNXH 4PWJA 3QHFH 4FQQB 4H8WL 3ESOA 1C12A 4FQIH 1C8PA 3MYZA 4WGWB 5IBTH 1G1CA 3BP6A 1DBMH 2LLNA 2R15A 1FIGH 5I30H 3L4YA 4XBGB 1THAA 2EECA 5DC2A 3L7EA 3WELA 3NQKA 2QKIB 4WWID 2IQ9L 5KYUB 3BT0A 3BXNA 1KXHA 9CGTA 1IC4L 2J44A 1UADC 4A2HA 3QNYB 2H3NA 2X2YA 3HG1E 5C6PB 1FGNL 3W1ZA 3W39A 3QORD 5T1KA 3T0EC 3TN0B 1KIPB 4LLWA 4ZUVA 3H3PH 4ODWA 5E95B 5HHNA 1MZZA 3AWEA 3HG5A 4Y1AE 5JW4Q 5AWNL 3FQXB 4GBXB 1JV2A 4QTHB 1RZKC 3MRCB 2DYPD 1P1VA 2H2SD 1MQKH 1QR4A 1JGLL 2P42B 2IAND 2Z35A 3QDJA 5KW9L 4TL5A 2E47A 1BQUA 2P7TB 3B5GA 1TZHA 3QG6A 2EDBA 4R0LA 4W93A 3WEXA 2R1YB 3KW7A 1HHJA 2UWEE 5B1JA 1TTGA 1AS7A 1F2QA 2BO0A 3GS7A 4X80L 3T0XA 5IGXL 3ARBD 1PFCA 4R2GC 4G6KH 1KJMA 4QIRA 3UBFA 3NSCA 2K9UA 3T8VA 3VFRA 4K8RH 4R7LA 1GC1C 4H88H 1EEYA 4UM9D 3IDNB 2H1PL 4L3AA 2X38A 2F8OA 2Q3ZA 4NQDD 4OLUL 3OAWA 4DKTA 1I8IA 4OM0L 4DP1X 2O93L 3GDBA 1FNEB 3HMWH 1MOEA 3MACH 4NC1C 5BZWB 3KEHA 3PDDA 2APXA 3QUXD 5BNXD 1B88A 4QF1B 2V5RA 2VXVL 3VXPA 2B59B 4NDMB 1KBKA 5GZND 3STZA 4AYFA 4YHYB 1G7LA 3B1UA 3GS4A 3BLBA 1O9WA 2UUDH 4WEBH 3RJOA 4FHBD 4AVJA 4EBQH 3JTTB 5ETUB 2B1HL 3FONB 5EA0H 1CJYA 2CO3A 5EH1A 4G3YL 3TV3H 4UQ3A 4PJCB 4QYOB 3QRLA 2VDKB 3EJTA 1QWNA 2IBZY 3G5VA 1WBYB 4PY7B 2J5LB 2ATKA 4Y16C 4AW7A 4TSAH 3BISA 3HA0A 5EBLB 2AMUA 1AGBB 1I31A 5FGRA 2GAZA 1NMCB 3DECA 5CN1A 2UXTA 3VFTA 2ZYSA 1EEZA 4Z78A 1MJ7H 5D5MB 3QORB 3VRLE 1JDAA 2R1XA 5AKSA 4YXKL 1U3NA 2KPWA 5C0GA 3FTVA 3HIZA 2XXFA 5F9JA 4Z7AA 1N8ZB 4OSUL 3GXDA 1BQSA 4N8VG 3SPCA 4Q0XL 4QLWA 4QRTB 4ZMNA 1B0GA 3BFWA 2Z1PA 2DYPB 4GUCA 1UM4L 2IANB 1H3UA 3BKYL 1ZLVK 5EO9B 1HZLA 2AMGA 2VT0A 1AR1C 1GJUA 1I7TB 4GW1B 4XCFL 2GIYA 4UNIA 2Z34A 2GKIA 2YPVL 3QO0B 3C60A 4WSJA 5DZVA 5TDNA 3B5HA 3Q6FA 4L29A 4OCSL 3CSBA 2DY2A 3P4MA 2VC2H 2WLKA 2EUXA 2Y3NA 3SD2A 3ARBB 2MPAL 5FKPA 3GI9L 4P3CH 3U9UB 4RGOH 3BQUC 1QWUA 4UM9B 1C5CL 2ARWA 2V17L 2XZCL 4NQDB 1CXEA 4WTWA 4X9HA 4ZUUB 1IZKA 2IFGA 3MNWB 3QUXB 1VB9A 5EOQL 3HHRB 4YIQB 5EIIG 4U6YB 5FF6A 2VXQL 4YQXH 3WO3B 3ZPDA 5JW3L 5F3BB 1YN7A 4O4YL 3BLKA 3WG7B 5KUMA 3CLFL 5C0RL 5INCA 1SQMA 2GUYA 5FYJL 1CDGA 2Z31B 5JIMA 3KL3A 3LZFH 4BFOA 4C56E 3FFCA 2L7QA 4N3TA 4MJ2A 3VACA 3BZEA 5DQJB 5F8QC 4LCCA 2QT6A 4XOAA 1ZLEA 3GMQB 1TTUA 3JSSA 3LN4B 4CC4C 4D0DB 1U8IA 3MRQB 5TDPB 4A7TA 4F8NA 2H32H 2WAHA 4ODSL 4DPCX 3DHMA 3DX6B 3RDTC 2LU3A 4A55A 3INUL 4XMWA 5IBUG 3ZDYE 1SBSH 3AXLA 4IOSA 3O41A 1KG0B 1E8ZA 3EYUH 1I85C 3L3IA 5MERB 1KGWA 5I18H 3R18A 1EAJA 1ED3A 2CE6A 3L4VA 1OF0A 2HKFL 3SYOA 3MLSH 4Q58C 2YAEA 2YXVA 3UCRA 4C56D 1QFUL 5CEZE 2ZIDA 4PTUB 5EU5B 4PV9B 4LSPH 3BEVA 4GS7C 1EZUA 3H9SE 4LEOB 2RJMA 4AQ1A 5GRVK 1JGUH 4EIZC 2DWSA 32C2B 2UVFA 1TU2A 2X2UA 5FEBA 3D3VE 1EHXA 1Q90A 2JB5H 4Y4FA 5BJTB 3D50A 4K94H 1DBAH 2VNCA 2QLYA 4OKDA 3ZDZF 1E40A 4FLSA 4IIQA 2DEXX 4PGBB 4BQ6A 3CLWA 7CGTA 3S36H 2X1QA 5DJDB 1BM7A 2G75A 2VDLL 5IB2B 1VEPA 4JG1L 2K6WA 1RMFL 4ISVA 4LSVL 5TQ2H 6CGTA 1OAYH 4GRLA 1DN0A 4OAWA 3D85D 4XXWA 3VH8B 5HVHB 4JBSA 1C9SA 4FF9A 2J6EH 3V5KB 1HJBC 3KLLA 4MXWH 2ICWI 3EOBB 1S5HB 1F4XH 1UURA 2KZKA 3P54A 3MLYL 1V3MA 1KJVA 2WLIA 5LXGH 3U0PB 4YHLL 4XWGL 5MEOA 1MREH 2AJXH 4HU2A 4DO5A 4A7GF 4MD4B 1NCAL 3PWJB 4YVUA 3REVB 1CGWA 4BFJA 3IGKA 3U9PL 1J0ZA 2HTLC 3QZOA 3VQMA 1NCJA 1WAEA 2DTSA 2ZOKA 4AQEB 3QEGL 1D6VH 1FSKC 4PJHA 1FZMB 1U21A 5E9DA 3B37A 3C9NA 2CD0A 2I27N 3QQNA 1FHGA 3V9FA 1UGKA 5DEJA 1EGJL 3GSRA 5TTRA 2CPCA 2DMBA 2GUOB 1S7XA 1KLUB 3LD8B 3HPLB 2N7AA 2EDYA 1B4TA 4ZSOB 4NNXA 1YY9C 4P9MH 2DQCH 1WCQA 4H2AA 4PWEA 4U1GC 4MXQC 1JWMB 3WTVA 1GH7A 2FEDC 2IO5A 5CJQH 3SDXE 2E9WA 5FCUH 1XR8A 1BVKA 1OF2A 2VB5A 2GTQA 3ISYA 4CGTA 3T1WA 1SHXA 2ZPKL 3WGUB 1BX2B 2J8OA 3L3JA 4RGNC 1HQRB 4GUPB 5D7KE 4XXCA 1IGFH 3CZFA 1ETZB 3NIDE 1MJJB 4UYPA 1JYWA 1XDTT 4ZMOA 2WB1A 5GIRB 4CC1A 1NFDB 4ATTA 4DKFL 5K93A 3V6OE 2QJDA 2GCYB 4IU2A 2CM5A 3OKOA 1CE6A 1Y6KR 1PEZA 5JOEA 1GGBL 1XAUA 5DC4B 1QNZL 5HDBB 3L5WB 4L18A 3OHXA 5BPPA 5MI0C 1TETL 1EBPA 2YMXH 3T0EE 4L1TA 1A2YA 4EJ1C 3WTTA 1ZLSH 1JYVA 1SPDA 4OCWL 1KIQA 3SYAA 3SN6N 3RWGB 1SUJA 1FPTH 4Z7UA 4JY6B 2D31B 3H0TA 5TF1L 3D25A 5FFGA 1I7RB 3FZUC 3T0WA 2BM3A 5D2LE 4MJ5B 1DLHA 2XZAL 3PPSA 2DQIL 5E1QA 2PWDA 3DMMC 2JJTA 2XC8A 4RIRB 2UUDK 4YHML 3U4BH 1I1YB 2XKSA 2EDXA 4PJ5A 3VYPA 2FECL 2P47B 3OKLB 1A9EA 1U95A 4OZHA 5ABZA 3RWEA 3WHE1 4M5YH 4F92B 4FL4B 1FNAA 3T2NH 4E9VA 3U0TA 4DJMA 3VE0B 5L6YL 4F7EB 1AHMA 2LT9A 5IHWA 1CN4A 4GOSA 3ARDA 5HI4D 1AKPA 3SDCA 1GC1L 1RJYB 5FHAH 2XNAB 1J1XH 4ALAH 1IC0A 4HLZH 5IOPA 4G71B 1U4EA 1D5ZB 3GFUA 3BFQG 2X70B 4MNQE 3EOAA 4UAHA 2J8UA 3AADB 3S8FB 2QQKL 1D2PA 2ZAIA 2JJSC 4H0LC 5DYFA 1NWPA 3C8KB 4OJCA 2BOLA 1Z5HA 5AOZA 5HD8D 3SE4C 5FFLA 4DCQB 1DBKL 5F7HA 3U4EB 3RWHA 1TJMA 1X9LA 2VZOA 3GBNL 3QIBC 4TULL 3A67H 1MI5D 5HJ3B 5C7XH 3SBPA 4NP9A 4DN3L 3K6NA 4AI7A 4KK9D 1Z7JA 4ORGB 4FNLH 5IW1A 5IVNA 5C09E 4X8XA 1JGLH 4XOCA 3T0AA 3ZSSA 3UYPB 2C7FA 1ZVYA 5KW9H 5L8LB 1OL0A 4XP9L 2YRBA 1EJ8A 4YHOH 1ZSDA 2D03L 4G6AD 3P40A 2YPLA 1EBAA 4Z7QE 1MLBA 3S0PA 3ARFD 4OF5A 1ZGLA 4V2CB 5F1NA 2VITA 5IGXH 2G3NA 4ENEC 2WCGA 4PD4K 4FCAA 4P2AA 4CW1B 5T3ZD 1FL6B 5CILL 1KMGA 2L8AA 2GVYA 1WWAX 3PPEA 1YUHA 3FCTB 4ODTL 3PDOA 3TPUA 2CHXA 5L0QC 2H1PH 4M4PA 5K9OA 1IUZA 1ZT7A 3KPMB 4OLUH 4B5EA 1MFBL 1IFHL 2BNQA 4OM0H 3CPUA 3RY6A 5I8CB 2X9YA 2X09A 4R6UA 3MAWA 2EE9A 3KYOB 4LFHD 2AQPA 1AIZA 4PRID 4BFRA 4I7ZC 4L8CB 1WT5A 2D9QB 5CR1A 5IQMA 2JB6A 4GXFA 5BV7B 1ODUA 1WWWX 1BFSA 4EOWL 4HUKB 1U8HB 2X2JA 2B1HH 1HEZB 1XSOA 2YAHA 1MFDH 2NYZA 1X5IA 4G3YH 4BH7B 8FABB 2XI9A 5GGQL 3GTTA 2DBJA 3BPNC 3HUJB 3PXJA 3Q9QA 5DD1H 3S5YA 1CG9B 5HJDA 1K85A 4CKVX 2QMKA 1WBXA 1Z9LA 2YGOA 4MS8C 3HS0A 3C09C 3TCLA 1WBZA 3I9IA 5E4EC 2VGLM 3UC2A 3U4AA 2BMKB 2Y2YA 2QLVB 4WDIA 3BWZA 1TO4A 2NXYD 5EZIL 3DTDA 4TF4A 4YXKH 1NBQA 1SUHA 4B96A 1ZHKA 5IJKC 1OTTD 3WBDA 1MI5B 4JRXD 3O2DL 4H25A 4OSUH 1NEZG 4OJFH 2YZ1A 3MRFA 4AJ0A 1EZLA 4Q0XH 1P5UA 1XH3A 4P06A 5D6CA 1B9KA 4C4KT 3UAJD 2ZCKL 2EXTA 1P84K 5D1XA 3H2QA 4HQQL 1UM4H 2O72A 5E6SB 4XCFH 5C6TH 3RUGA 5E1HB 4ONHA 3KW8A 5ACZB 4YE4H 1BIIB 3NSXA 4NRYB 4NQEE 4WKXA 4OCSH 3ARFB 1T21A 3ARVA 3VG9B 4GSRA 5H2BA 3ZOAA 1N64L 2XV3A 2ZAGA 4JM2B 4OY9A 2FZ3B 1GS7A 3S3DB 4U3SA 2I26N 3B8SA 1NGYA 1TOXA 3V6FA 2K0RA 3I6SA 3D4YA 2XZCH 1II4E 3GIVA 4GSDL 2Z7ZA 1M1SA 2ODIA 2FQGA 2RALA 4X4YB 5A6IA 1Z9SB 3VB8A 3BPOC 3WXWH 1T5WB 1FVCB 2F54D 3U82B 4PRIB 5CBEA 4KZDL 3DOSA 1AVAA 3SE6A 4URTB 3SPVA 4RMWA 5C08E 2DMCA 4XP6L 3KPLB 5HVFB 3E8VA 1FYHB 3ROOA 2O61B 1IL1B 1CBJA 5C0RH 2XXGA 3KBPA 4ZT1A 2CJSA 4XI5D 1IFRA 4R7VA 3WNKA 1GHFL 1S7WB 3LYRA 5IJCC 1JRHL 5LB1A 3N50A 3QFDA 5JYLA 4HJGB 2Z65C 1TUPA 3P0VL 3PNWA 3PABB 2NXYB 3V5DB 1Z6JT 1NKGA 3QPQC 1OGAD 4AK1A 3DV6B 2IWKA 5FDWA 2WXIA 4C47A 3ZMEA 2ED6A 4JRXB 4PJDE 4PJ6A 3VWJA 2UX6A 3HC0A 5DMKA 1U8CA 3UBGA 2W8CA 2CWRA 4NHUA 4LSQL 2X12A 3ASOB 2JKXA 4FFWD 3G04A 2HKFH 2XX0A 3LKRA 4RFNC 2WSKA 4NPYA 4KKAD 3VGEA 1X9UA 3VSTA 5J1SC 3BUTA 5F9OL 3LDBB 4QKXB 5CD5C 5D1ZI 2E7DA 2P5ED 2CHZA 1UWFA 4PJAF 1R33A 5CEZH 3ZGHA 1NLDL 3CFKB 3BH9B 5F7BA 2VDNL 2OTUA 4LHUD 3QDGE 1MJ8L 4P2QA 1E9PB 2A9AA 3FUEA 4UBDC 5C07A 3E1F1 4RGNE 1QFWL 3H2PA 2VH5L 3V9CA 4PJGB 3SDYL 2VDLH 3KDPB 2WNKA 4JG1H 1RMFH 4DGIH 1MRDL 2F54B 1AQMA 3OJ2C 4MMYB 5IESH 5F0JB 4IHOA 4YSQA 2HN7A 1OCRB 4B6ZA 5DT1L 1NGWA 5ICYB 3L9RB 4G9DA 2HRHA 4ODUA 3NFNB 1N26A 1TQWA 1FFPB 1VF5C 3FAWA 3MLYH 4HZAA 4AV5A 3A6BL 4E9RA 1AGEA 2A6DA 4Y4HD 5CLZA 1LILA 2CDFB 5ADOH 2QL1A 4YHLH 3IB4A 3L2NA 4LOUC 1YPZA 2GTZA 3FT3A 3C60C 4GINA 1E4JA 1JWSA 5ALCH 3QDGD 4CNIA 4PJBE 2ZWSA 5CEXB 3U9PH 1ET5A 3TJHD 3P3UA 4DHLA 4F7PA 4P04A 1V27A 2C4XA 2ARJA 1L9SA 1OGAB 3UO8B 4MTMA 3LH2L 2YD2A 1F13A 1HH9B 1LE9B 1JYNA 1PD1A 2C1OA 1QRNE 3ZYZA 3NRFA 3L9EA 2YSSA 5L9DL 1NC4D 3IN2A 1IVLA 5GJSL 1HHKB 2WJ5A 3DTXB 5ILTL 1U42A 4BINA 5E94B 4DGYL 4FQLH 2R69L 3DO7A 1RZGB 3MRGB 3P0YL 1G9EA 3EG9B 3ZIMA 1SOQA 5JHLA 2ETWA 4HEPG 2X4NB 2XKNA 4J27A 2ZPKH 4PWFA 1U8JA 3AT0A 2P5EB 5KSUB 3H85A 4IRSA 5GGVH 5B38G 1CICD 1WVZA 1V3JA 1SYVA 4BH8A 3OLEA 2OQJB 4DP4X 4A2EA 1JZIA 3OXRA 4LCCC 3MXWH 4XBMA 4LHUB 3O0RH 4XC3L 5BQ7B 1LP9F 1DVFD 1QSFA 1C16B 3MRIB 5IT2L 5I6XC 4S1RL 1M6OA 4WNSA 1SLUA 1QNZH 4GKSA 3BO8A 1RUML 1XH1A 1E8YA 1TETH 2WIMA 1Z5LA 4PJ8B 1L6ZA 4OCWH 2CKBL 3O8XA 4NQXB 3I9AA 4YHZL 1DLFH 4Z3TA 4MHHG 4QJ4B 1HNFA 2BHYA 5JO5A 1H8LA 4Y4HB 4L4TE 5FWQA 1A25A 3S5ZA 5E9NA 1XGTB 4LSSL 3F5WA 4HS6B 5A3IC 4YHMH 3PWNB 1N5AB 4AQ1C 3DYPA 1MCCA 4WF7A 1CE1L 3N3EA 4QRPE 3ORJA 2VLRD 4Z7WB 4FHKA 1I82A 1UA6H 2DQ6A 2LOEA 4H20L 4Y4FC 3RAJH 3CG8A 2XVLA 3QISA 3WHXA 1KY6A 3JTBA 3B9VA 4IIQC 4DP6X 5GS1B 1AIFB 5JYMA 2CHWA 4DGUA 1JPSL 2DQJL 1GL4B 2WXQA 1EZVY 3I3EA 1W72L 4XNZC 5L6YH 4RAVA 4ZMWA 2XZZA 4P57B 1NC4B 1MCJA 5EZOL 4XXWC 3EDJA 3K2UL 4JDEB 2ADFH 4JG5A 1A6UL 3MA7B 3E8UL 1MWAB 5I1EL 4HH9A 1GSMA 1XGQB 3O81A 3C8HA 4YUEH 1NM4A 5DGQA 3EFOB 5ALBL 3WTXA 4Y8AA 4MAUH 3US1A 2ARJQ 1KTJA 1CICB 4R3SA 4BZ1A 4IMLA 1EDHA 4OCRL 3ULVE 4OJAA 5JNYB 1ZCRA 3OL2A 4PW9A 1M7DA 2E4FA 1HQ4A 3ABZA 4PYGA 3GRWA 1LYQA 2JV6A 1DVFB 2CSPA 2CUIA 4NUJA 3VNZA 2C7UA 3GBNH 5I5IA 1SLWA 3PHOB 4TULH 1OHQA 3I85A 3WIHL 4N2HA 3IRZA 4I8DA 3ECWA 2DYRB 1JZFA 4LOVA 4DN3H 4E36A 2BZDA 3DDGA 4Y2DD 1LQSR 4L2YA 4KO9A 4G6JH 3U0WH 4QJ3B 4DNLA 3BUYA 4Y9EA 3ABGA 4PJCF 2ZKHL 3QC5X 4N2NA 1W8EA 3GBDA 1SXZA 5INDA 2MSPA 1PEWA 3HE6D 2P8PB 3NN8A 4QRRE 3ILPB 4R7DB 1AD9B 1U8QA 2YWZA 4NM4L 5F2FA 4YR6A 3SPGA 3ULVD 5AD0A 4N87A 4BUQA 1L9MA 1ETB1 3IMBA 1CYGA 1MHEB 3QHZL 1RZ7L 3MFFA 1V3LA 4XCNA 5CILH 5D5MF 2VLRB 4HS3A 4PWIA 4QOKD 4I9XA 4ODTH 3HNVL 4XXCC 2WLJA 4X9YA 1YC7A 3RTQA 1I8UA 4P2OD 1MFBH 2E75C 2DJ4A 3KPRA 3ZX1A 4E5XA 3VXQB 1N6QH 2K8QA 2WQXA 5FKAA 5KJRL 3ZTNL 5DGRA 4I87A 2BW4A 3OHXC 5KBDA 2QFRA 3TBSB 3F58H 3V4UL 3IPFA 4KTEH 1BAGA 3WD5L 4EOWH 4FXGA 5DJ2A 2X42A 4MA1B 5I16B 1MH5B 5SX4H 4F15C 1XZ0B 3QS3A 3RFZB 5GGQH 3IFPB 3K3QA 4J3UA 4CMHC 4PRHD 2EVHA 3ZRCC 3LKQB 3PAUA 4GP8B 4OFDA 4M8QA 3TBTB 5HGGS 4CBZA 7FABL 2WZ5A 3U30B 2JJTC 3QDJE 3SO5A 4AKPA 3FQNB 3GJFH 4AE1A 2WK2A 4PCKA 2ZXEB 4Q9RH 1UWXH 2UY6B 4P5MB 3P4NB 1WAAE 5EZIH 5DC9B 4YSTA 3LVEA 3O9WD 1KCLA 1COBA 2B39A 3O2DH 1UB6A 1IC7L 3QDHA 4N0UA 4IK7A 4MWFA 1J05B 1F4WL 4ZW6A 4DW2L 4GAYA 2DBLL 1IEAA 3O6FD 4XE0A 4XOEA 3DK0A 1LO2L 4TVPE 4A7VA 4Y2DB 5KBLA 2ZCKH 1AHWB 3MJWA 2MH4A 4UTAA 5I1IH 4HQQH 3ARDC 5HY9A 4KI5E 3SDCC 4L37B 5CLWA 3NAAH 5KAQF 2FECI 4FABL 4IHBA 2FYVA 3HE6B 3I6KB 3GK8L 3MREB 3HE7A 5CIPB 1QEWA 1X44A 4U1LA 2PMZA 5DHYA 5TE7H 1T2XA 1XGZA 1R3IL 1CR9H 5BRZA 3R4DA 2HG5A 1RJZB 4IJTA 2R4RH 5CZXC 5B8CA 1C1EL 3TNMA 4QOKB 4CA4A 1LEGA 3MV7D 3AAZB 3IGAA 4NHCL 1X5MA 3BAXA 4P2OB 5ES4B 5HHQB 4J1UA 2XBZA 3SB3A 5GSRA 3ELQA 4FQHA 3RWJB 1C08A 4TPRL 2UZYB 3TIEB 3FKUS 4ZODA 2LE9A 4CN4A 4KZDH 5J6HB 4FCHA 1J8KA 1VEMA 2XVBA 4YSDA 1JNNL 3FN0L 3EGSB 4XP6H 4PB9L 4EI5B 3CFEB 3QP3A 3Q48A 4MJ6B 2J4WL 2PTTB 4YNYB 2IGTA 3L3HA 2H1LM 4BCYA 2JKSA 2BHZA 1PY4A 3APNA 4PRHB 4X4XB 5ENWA 3CJJA 5IF0B 4JAMB 4OZFB 3MNVA 2ZUTA 1ZJBA 3FO2B 3U2JA 1GHFH 4FC3E 5E2TL 2B0SH 1S7TA 4H8HA 3IGLA 3SCMA 1SHSA 4F8TA 1IAOA 4KVNH 4TNGA 3D6GA 1AH1A 3PXHA 1K8DB 3E6FA 3O9WB 4NQTA 4C58B 3S8WA 2EP6A 5D7IB 4X7SL 3RY6C 5FGCB 1DVXA 1CD1B 1JGDB 3K6IA 1E50A 2VQ1A 3HRZB 4PBXA 3O6FB 4LNVA 1T1ZB 3UYRL 1YEWA 4D8OA 2R9HC 4P5SA 4WWKD 1WT5C 3LPWA 1ZANH 1H3WM 1OCWL 3IT8D 2G3MA 4FLHA 3T3PB 5E8NB 3QWNA 1L5GA 4WI0B 2A6KA 3PJSA 2FHFA 4YSRA 3QFGA 4NENA 1ZA3A 3J2PA 5HDWA 2VLKD 1AANA 3VSVA 3OLDA 2YD3A 4XVSL 4CJ0A 4PG9B 4K71C 1NGPH 3B7RL 3VI3B 1FL5B 1O7DC 4PW4A 1KYDA 5F7YC 3HS0C 1TENA 3UO1L 2C1PA 1FJ1A 2Q9OA 3MV7B 4Y2LA 1QFWH 2VH5H 4LU5L 1QHQA 3SDYH 1H8OA 1RLWA 4K7FA 3IFOA 3HG2A 2UYLB 4ZNEA 4JPVL 1MRDH 3KPOB 1QASA 2H3XC 5GGVY 4G1EA 5I8EA 1YYLL 2OFQA 1P5UC 1JZ7A 5IMLA 1CB4A 4PRPA 2G9HB 4UYQA 5D1XC 1E6OL 4NC0B 2A6IA 2OYPA 2HJKB 1QHPA 1NJ9B 2OSWA 4PWHA 4KY2A 1XCTA 2J43A 1A7NL 5FOBB 4MQ7A 3SE9H 1WIUA 5SWQB 1SLXA 4JZNB 5K39A 1G7MB 3L5XH 2FNBA 2G0KA 3N2JA 1MVYA 3RE0A 4AIOA 4WHTA 1NFDF 5KVFL 4M6ML 5E6ZA 3NSDA 1RZIA 3OV6A 1DVQA 4BDVB 5IR1B 4XHQA 4JFZL 2NSMA 5HDBF 4IOFC 1Y6MR 2E59A 1QI5A 3QNZA 3F83A 1NICA 5L9DH 1QD0A 1T4KB 5GJSH 2UZPA 4ZUTA 4WWKB 1ZEAL 1P7KB 3ZRFC 4DGYH 3K4DA 5AYUL 3GT6A 2R69H 2OMXA 5ADPL 1R5WB 3NCYS 1VAHA 4IDJL 5E1AA 3RVTC 3P0YH 1UD6A 4TS6A 4ZYKA 1VGKA 5KUKA 2VLKB 3TVMA 4MDIB 5JORA 2W60B 4N25A 1F56A 3HN5A 5IMOB 3S4SG 4GXVH 5B21A 3EH4B 1TVBA 2NXZC 4F2MA 4DPRA 2A83A 3QNXA 1ZS2A 5AOJA 3PIQB 1NDGA 4NOBA 3RX9A 2IALB 1EFXA 4Y9GA 4HSCX 4Y5VA 3ZK0A 2WXLA 4RRPA 1FNLA 5KSVB 3HZYB 3EAKA 4ABWA 4H8UA 1MVFA 2CKBH 3GD1C 3GXTA 3IKKA 1QWHA 4KK5D 5C8JB 4F7TB 5E9DE 2HVJB 5DFAA 1A6VH 3OKDB 4PJ7B 3CIAA 8CGTA 1JRHI 1CU4H 4HIHA 1BQ5A 5FS5A 3MRDA 1CLYL 4EXKA 5KSBA 1CFVL 2P44B 4WWPA 1XHHA 5HGBB 4LSSH 1JTOA 2HLAB 3J07A 4HAFA 4UUJA 4F7MA 3L9BA 3F64A 4M5ZH 4ICWA 1CE1H 1NIBA 5DJAA 4E41A 1PKQE 4JKWA 3TEYA 5F7DB 2NDFA 1DQML 4LVNC 4NKIL 4H20H 3OTTA 3FQRB 2VSDA 4DP0X 4KTDL 2G3XA 3KVQA 1O5PA 3OZKA 4KTYA 3UTPD 5AVTB 4P3DB 1G7HB 1JPSH 2LVCA 4XZ4A 3GJFK 2E7LA 1W72H 3UPRA 3MV9A 1UWXK 4JW3A 1XF5A 4MAYD 4QYAA 1HHHB 4AW4A 4KGJA 2RGSA 5LUMA 4L8DB 3CHRA 5F1IA 3W3BA 5IMKB 3DJZA 3FRPG 1A6UH 2J21A 3E8UH 5I1EH 4CMMA 1BFVL 4MGXA 1UWGL 4KMLB 5AW9B 3W9DA 1Y1UA 4JFDD 3WO4B 1KJ3L 3GSNB 1QFWI 5AL8A 3TZVD 4OT1L 4GKOA 5JQ6L 4Z7UE 3KL5A 1ZVSA 3A6OA 4OCRH 3PAZA 4X7FC 4K23L 3FUJA 4LGRB 4I0PC 3ZKNC 5G2NA 2WLNA 2VM4A 4HIJB 4U4BA 1AG6A 4PJEB 3WDHA 3L16A 4PHXA 5BZDA 1IFGA 1Y0LA 4FJ6A 5E5RB 3WIHH 4HDIB 4HUUB 3WTYA 2DWEB 5MENA 5E2UH 3P3TA 4OZHE 2GG1A 1XGPA 4XNAA 1KGXA 4JFTA 1H3XA 3HLAB 3D2UA 4UDUA 3ARRA 3QWOB 3HUJF 3RRQA 1W9XA 3LZNA 3QZWA 3CFCL 2WXKA 4GG6A 1ZSHA 4MYPA 5HYQA 2PP7A 3NCEB 3TBVB 4NM4H 4JFFA 1VZGA 5EZPA 4F20A 1AC6A 4JY4A 1CFSB 1MFEL 4IBLT 4X0NA 3MRPB 3B9KA 1M6UA 5EO1A 4IRSC 4NNPH 4MCYB 2YJLA 4RAUA 3HNVH 4LKCB 2J8UE 2ZSWA 2RCSL 2YS4A 4KFMA 3H6JA 2W65A 4N5ED 4IKIA 3CWGA 1AO7D 4JDTL 4PJ9A 2F58L 4LVHB 3GZPA 5CN2A 3BD3A 3FQUB 4YPJA 4BE6A 3ZTNH 3G9VA 3EJYC 3TH4T 4MAYB 1ZPLA 1EHAA 1BSIA 1OAQL 2XN2A 1UZ8A 3LEYL 4K73A 5TQ0H 3V4UH 4Z5RB 3O8XC 2ZSVA 3GGWA 1CF1A 1CBVH 2OMVB 3VFOB 1A7QL 2MWCA 4WHYH 3U7AA 2H6PA 1KWKA 1IGCL 3CU1A 1G9MC 3EYVA 3NJNA 2J2ZA 4JFDB 4JM2F 5E5UB 4FA8A 2X6VA 4HV8B 1NLBH 3MMEA 3QI9D 2JELL 1JPTL 1NOFA 3OX8B 5B1KA 3TZVB 3WNMA 3N91A 3MNMA 4NQUA 4ZMXA 1CD0A 4A66A 4G72B 4HPHA 3ZQ9A 3NA9L 3CBJB 3RGVA 2AVFA 1ZD6A 1F4WH 2PN5A 3BVNB 4OD1H 1UXLA 2DBLH 3QJQB 4YC2C 3CHSA 4HGKC 3V6BR 3W11C 5DS1A 1CYXA 1YMHA 1S5IL 3ZDXF 2NY4B 3EBHA 4I18A 3W0WA 4K15A 1KLFB 2BXZA 3WE1A 2WXFA 3KPPA 3O3BA 3SO3C 3WS3B 4FABH 3GSWA 4TVPH 5JPMC 3UTOA 1QLRA 2G0LA 5BOZG 4L3EA 2BK8A 5DHVA 1R4XA 2FO1A 1R3IH 2CJ3A 2QDWA 4U1MA 4JG9A 1GYVA 4O00A 4WU7B 1NCIA 5JLZB 2FQEA 1C1EH 3ISWA 3WIFB 1T4WA 5IG7B 1DQTA 3CSTA 3W5MA 2Y36L 4XPHH 2HFGL 2WN3A 4YK4B 5H94A 3EO1A 2DICA 2HPTA 4F2EA 4ES9A 1P7QD 4CVUA 1JCVA 1AO7B 1U8PB 5DD6B 4FADA 4TPRH 5G4OA 1OXYA 4M29A 5DK2B 4G9FA 4R96B 2YRLA 1VFBB 1BREA 4I13B 3P4LA 3VD5A 1UTDA 3OSVA 4F7CB 4WKZB 1JNNH 5KYXA 2CUMA 2WLMA 2YD9A 3FN0H 1W8NA 3IF1B 3ZHDA 1JHLL 3H8NA 4HHAA 1KBBA 2FJGA 2J4WH 4HHGA 4QRFA 2YUZA 2OMTB 5AKRA 4TNEA 1IAKB 5HPOA 5C0NC 1ADQH 5IEHA 3QB7C 2EICA 3LZPA 4ZX6A 3QI9B 4OQ1A 1QNIA 1S9XA 4LHQB 2HJLA 3MJ6A 3QXTA 4XGZB 5DEGB 4B9KC 1SGKA 4B27A 1U36A 4DO4A 1NOAA 4Z76A 4ADGA 5J9PB 1QPKA 4KQ4L 1BAWA 1URZA 1N3NA 2X41A 1QYGL 2BY3A 4PJGF 4M1CD 2DRUA 1KGUA 3I6GA 1J87A 2BRQA 3FRUA 3NEEA 3MRHA 1RUPL 2DI7A 3RTQC 4MA3B 3II2A 4IOIB 2YEZB 1D9KD 4X7SH 4ETQA 5BVPL 3GB7B 1NH6A 4XVUD 2OMZB 1UEMA 1SXBA 1XF4B 5C0IA 3SIKA 3IGFA 4G8EB 3UYRH 2CPUA 3O4LA 3WKMH 3CH1B 3TA4D 4DZ8A 1AXIB 3IJSA 5B3NA 3MOBL 2GIXA 1OCWH 3JTSB 5IK3B 4DOHE 4BE5A 3E9UA 3UGEA 4FXGC 4EN3A 5C3TA 3H1ZA 4X5XA 1OGPA 2NQCA 3Q5YA 2Z93B 3RL1B 3V4VA 4Y4KD 2KLSA 3IXAB 4JHBA 2AK4D 3GLEA 4AEIL 5FM5O 3PWPD 4DZBB 4YDMA 2E7MA 3UO1H 2AQRA 2AEIT 2J8HA 3NK3A 4MAZA 2GITB 1P7QB 3HZVB 1BF2A 3AG1B 3NIGE 4OV6F 4E9XA 3DDFA 4RFEA 4BQCA 2YPKB 2FATL 2B8OT 2GJZB 1YYLH 2EEXA 2IADB 5CINL 4JE4B 1HINL 3IMUA 3ZTEA 1NFIB 4UT9A 3HTLX 5D1ZD 2XWTB 2AANA 3A3YB 4XNBA 3VRIA 1DZBA 1H3PL 4YLQT 1E6OH 1I3UA 3QS2A 4GAFB 2AK1L 3QDMA 5C0BE 3UABA 2BCKA 3CU7A 3QUKB 2B14A 4JFHD 4N8PA 1A7NH 3KBFA 3HE7C 4M8VA 1JNLL 1YQVL 4KKRA 5TJWK 4ZMPA 1EWHA 1SN0A 2QMJA 3FSVA 5KVFH 1WAPA 2E0PA 3KWXA 5B8CC 1MFNA 4NGHL 1Q9LA 2FE0A 5EU7C 1RZJC 3BJLA 3C12A 2BNRE 5EUOA 5EEWA 3KLAB 4MLIA 2ZCLL 4YLBA 1D9KB 3RIKA 3QWRA 1PGRB 4LLUB 2ED8A 4ZMLA 4OD2B 4G8AC 3BZFA 1KPUB 1U41A 4RH4A 5C07E 2BSRA 1PFOA 3KS0J 4N2FA 2FJHA 4J28A 4QLRA 2FRGP 1OSZB 3F7VA 2R1WB 4J3OH 4ZUWB 2H26A 4PVBA 2B77A 5F7LB 4PJIA 4MCNA 2HRGA 4Z7WF 4Y4KB 3OHMB 1H5BA 4NZJA 3TYGL 4W4NA 3EO0B 2JKNA 4NO0A 4Y5YB 2AK4B 1I9JH 1KYUA 3Q1SL 4P46D 3PWPB 4X6EA 3O6ML 1A6TA 4AYGA 2X40A 1YPZE 3SCMC 3BGFB 2ZG3A 3I2CH 4LRIA 5E0FA 4TUOB 1XGRA 3FB5B 1HSBB 5I1LA 1ACYL 2MTAA 2QR0A 4DP8X 2BP0B 8PAZA 4JM4L 4R4FL 4J39A 2WP3O 3DURA 2VERN 2H47C 1ODAA 5HHXL 2DWYA 5LJYH 1T66D 5IBLC 5D71L 5D1ZB 3RA7L 3UZQA 3C6SA 2WPGA 1DQKA 2VW4A 1BPLB 4ZX3A 1A6ZA 4WV1A 1YY8B 1QX1A 3G08A 2WAQA 4EZKA 2QELA 1CFVH 3FT4B 3WNLA 4NO3B 1A3QA 3VI4A 3UTTD 4EQ2A 4MJID 4JHAL 1DQMH 2XVGA 5PAZA 1UENA 4KTGA 5IB5A 4GRMB 1ZHLA 4NKIH 2OMBA 1B4RA 4AMWA 2EDLA 3BSZA 5FYJD 2IEPA 2WSPA 4KTDH 1W0WA 4NWTL 1E4WL 1FDLH 1A0QH 3MQIA 2QTVA 1ES0A 4O5LL 1D3CA 3DUUA 4H0HB 1P6WA 5JHLL 1UFGA 4MXVF 3PWUA 4HWBA 4G8GD 4H1LA 1RK1A 1I8KA 4Z3EA 1TLKA 2CALA 3LMJL 5J12B 5DMGC 4FE9A 4APQC 1KGCD 3FCSA 3G3LA 5DJ8B 4LLVB 1KTLA 1NZRA 1CLVA 2HFFA 4K7PX 3RWFB 5F3HA 3U6RB 4X7TA 1UWGH 4XCCL 3AS2A 5EO0B 1QLEL 1LDPL 2G4GA 3FO0H 4OBSA 3MV01 1W80A 2ZUQB 4E42A 4OZIB 4KWUA 2GSMB 5A2LH 4P46B 4K23H 1FLRH 4RISL 1ZHNA 4LT7A 3MJ8B 1AR2A 1INQB 3FULA 2X4UA 4O2FB 1FZKB 2Y07H 1LE5B 4YZFF 5AW3B 1G9ML 4JO2H 3SE3A 1UVQA 5FLUA 3BLPX 1Q4NX 2QHRH 5GGUA 3CDGB 4X6DA 4LBAA 5I1DA 1P4IL 4WU5B 1V8HA 2Z7YA 4FFZH 4ZXBA 1W0YT 1XXDC 3EJSA 4G5ZL 3VYNA 2A0LD 3CFQA 1OP5H 4NSKB 3CFCH 3LRKA 4JFYB 2HT3D 2WLYA 4G59C 1IKNA 2QGDA 1D7DA 2DMGA 1VKXA 2BVOB 2QPSA 4TNFA 3GZQA 3SYCA 1MFEH 4LKXA 3CE1A 3UTTB 3ZHLA 4LLQA 4HKBB 4MJIB 3P73B 3GBMH 3DVFA 1PJWA 2VJ0A 4X6CB 4XNMA 5I1KL 3EYSH 2RCSH 3FPXA 3EFFB 4LOEA 3WEBA 4XPAL 2GSIB 3UDWA 3IRPX 3VFPB 3FYIB 4JO3L 4D9QD 1AQKL 2F58H 4TQPA 1W91A 4JB9L 1PPIA 1A1NB 3ZT7A 4MKTA 3NPSC 2GJ6E 4G8GB 1NGZB 2A9DA 3FT2B 1TVDA 4V2BA 4Y5VC 3GF8A 2IFFH 5A2BA 4BZ1L 5F96L