2XFMA

Complex structure of the miwi paz domain bound to methylated single stranded rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
RSETVLDFMFNLYQQTEEHKFQEQVSKELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PIWI-LIKE PROTEIN 1
publication title Recognition of 2'-O-Methylated 3'-End of Pirna by the Paz Domain of a Piwi Protein.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna/protein
total genus 24
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 2xfmA00
4NH5A 2QVWA 4NHAA 1SI2A 4Z4EA 3O7VX 2L5DA 1SI3A 4Z4HA 4F3TA 3QIRA 3MJ0A 4NGGA 4NGFA 4NGBA 4Z4FA 5T7BA 3O6EX 3O7XA 4Z4GA 4OLAA 4KREA 4KRFA 1R4KA 2XFMA 2L5CA 4NH3A 4NH6A 1T2RA 2FFLA 4NGDA 4W5NA 4OLBA 3O3IX 4W5TA 1VYNA 5JS2A 4W5RA 4Z4CA 4W5QA 5JS1A 1R6ZA 5KI6A 4W5OA 1T2SA 4Z4IA 4NGCA
chains in the Genus database with same CATH superfamily
4NH5A 2QVWA 4NHAA 1SI2A 4Z4EA 3HVRA 4L1UA 3HJFA 3O7VX 2L5DA 1SI3A 4Z4HA 4F3TA 3QIRA 3MJ0A 4NGGA 3DLHA 4NGFA 4NGBA 1Z25A 4Z4FA 5T7BA 3O6EX 3O7XA 4Z4GA 4OLAA 4KREA 3DLBA 4KRFA 1R4KA 3HK2A 2XFMA 2L5CA 1Z26A 4L1PA 4NH3A 4NH6A 1T2RA 3DA5A 2FFLA 3HO1A 4NGDA 3U1UA 2DB9A 4W5NA 3F73A 2BZEA 3O3IX 4W5TA 4OLBA 1VYNA 5JS2A 4W5RA 4Z4CA 4W5QA 5JS1A 1U04A 1R6ZA 5KI6A 4W5OA 1T2SA 3HM9A 4Z4IA 4NGCA
chains in the Genus database with same CATH topology
4NH5A 2QVWA 4NHAA 1SI2A 4Z4EA 3HVRA 4L1UA 3HJFA 3O7VX 2L5DA 1SI3A 4Z4HA 4F3TA 3QIRA 3MJ0A 4NGGA 3DLHA 4NGFA 4NGBA 1Z25A 4Z4FA 5T7BA 3O6EX 3O7XA 4Z4GA 4OLAA 4KREA 3DLBA 4KRFA 1R4KA 3HK2A 2XFMA 2L5CA 1Z26A 4L1PA 4NH3A 4NH6A 1T2RA 3DA5A 2FFLA 3HO1A 4NGDA 3U1UA 2DB9A 4W5NA 3F73A 2BZEA 3O3IX 4W5TA 4OLBA 1VYNA 5JS2A 4W5RA 4Z4CA 4W5QA 5JS1A 1U04A 1R6ZA 5KI6A 4W5OA 1T2SA 3HM9A 4Z4IA 4NGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NH5 A;  2QVW A;  4NHA A;  1SI2 A;  4Z4E A;  3O7V X;  2L5D A;  1SI3 A;  4Z4H A;  4F3T A;  3QIR A;  3MJ0 A;  4NGG A;  4NGF A;  4NGB A;  4Z4F A;  5T7B A;  3O6E X;  3O7X A;  4Z4G A;  4OLA A;  4KRE A;  4KRF A;  1R4K A;  2XFM A;  2L5C A;  4NH3 A;  4NH6 A;  1T2R A;  2FFL A;  4NGD A;  4W5N A;  4OLB A;  3O3I X;  4W5T A;  1VYN A;  5JS2 A;  4W5R A;  4Z4C A;  4W5Q A;  5JS1 A;  1R6Z A;  5KI6 A;  4W5O A;  1T2S A;  4Z4I A;  4NGC A; 
#chains in the Genus database with same CATH topology
 4NH5 A;  2QVW A;  4NHA A;  1SI2 A;  4Z4E A;  3HVR A;  4L1U A;  3HJF A;  3O7V X;  2L5D A;  1SI3 A;  4Z4H A;  4F3T A;  3QIR A;  3MJ0 A;  4NGG A;  3DLH A;  4NGF A;  4NGB A;  1Z25 A;  4Z4F A;  5T7B A;  3O6E X;  3O7X A;  4Z4G A;  4OLA A;  4KRE A;  3DLB A;  4KRF A;  1R4K A;  3HK2 A;  2XFM A;  2L5C A;  1Z26 A;  4L1P A;  4NH3 A;  4NH6 A;  1T2R A;  3DA5 A;  2FFL A;  3HO1 A;  4NGD A;  3U1U A;  2DB9 A;  4W5N A;  3F73 A;  2BZE A;  3O3I X;  4W5T A;  4OLB A;  1VYN A;  5JS2 A;  4W5R A;  4Z4C A;  4W5Q A;  5JS1 A;  1U04 A;  1R6Z A;  5KI6 A;  4W5O A;  1T2S A;  3HM9 A;  4Z4I A;  4NGC A; 
#chains in the Genus database with same CATH homology
 4NH5 A;  2QVW A;  4NHA A;  1SI2 A;  4Z4E A;  3HVR A;  4L1U A;  3HJF A;  3O7V X;  2L5D A;  1SI3 A;  4Z4H A;  4F3T A;  3QIR A;  3MJ0 A;  4NGG A;  3DLH A;  4NGF A;  4NGB A;  1Z25 A;  4Z4F A;  5T7B A;  3O6E X;  3O7X A;  4Z4G A;  4OLA A;  4KRE A;  3DLB A;  4KRF A;  1R4K A;  3HK2 A;  2XFM A;  2L5C A;  1Z26 A;  4L1P A;  4NH3 A;  4NH6 A;  1T2R A;  3DA5 A;  2FFL A;  3HO1 A;  4NGD A;  3U1U A;  2DB9 A;  4W5N A;  3F73 A;  2BZE A;  3O3I X;  4W5T A;  4OLB A;  1VYN A;  5JS2 A;  4W5R A;  4Z4C A;  4W5Q A;  5JS1 A;  1U04 A;  1R6Z A;  5KI6 A;  4W5O A;  1T2S A;  3HM9 A;  4Z4I A;  4NGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...