2XFTA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
425
structure length
418
Chain Sequence
TPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 139
structure length 418
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xftA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xftA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xftA02
4EV4A 2OLUA 3SH9A 4OPYA 3O88A 3UY6A 4KG5A 3GR2A 3ZNTA 1MKIA 2XGNA 4FCFA 2IWBA 3NDEA 3WRZA 1BTLA 5TGFA 4N9KA 1K57C 4OOYA 1VM1A 4P0MA 5JYPA 3W4OA 1G68A 4KENB 3I7JA 5KSHA 1PW1A 4P6BA 5DF7A 3WRTA 2C6WB 5HX9A 3N6IA 3IF6A 1GCEA 5FI7A 5DF9A 3WS0A 1SCWA 1YMSA 1VQQA 1W7FA 4KZ5A 4LCMA 5HAIA 4CPKA 2H0TA 4KZ4A 2H0YA 3GV9A 4KZAA 3ZCZA 4OONA 4UHUA 4KG6A 3SH8A 3VOYA 3WS4A 2R9WA 2V20A 3V3RA 5HAPA 5EPHA 1LL5A 4RX2A 2E8IA 4UAAA 4QY5A 1I2SA 5E2FA 1KGEA 3BM6A 5M19A 5AQ9A 4Y0OA 1DJAA 4ID4A 3UDFA 3GMWA 2X01A 2HDRA 3BYDA 4WM9A 5CHMA 2WADA 1L0GA 2WZZA 4FH4A 4YINA 3BFFA 3A3JA 2WUQA 5F83A 3IH8A 3W8KA 1ERQA 2XD1A 3G4PA 4PM6A 1C3BA 1EROA 3M2JA 3IF6C 4L0LA 5GHZA 1HZOA 4KZBA 5FA7A 5FI6A 3ZG7B 5F1FA 3ZVWA 2EFXA 4N92A 2WKHA 2XR0A 3Q7ZA 4IVIA 4OQIA 1EWZA 4HEFA 3WS1A 4MBHA 3N8LA 3OCLA 2ZC5B 4GNUA 1YLYA 2BLSA 4WEJA 5EE8A 3Q7VB 3VMAA 2ZLYA 1KVLA 2G2UA 2WAFA 5F1GA 3G31A 1CI8A 2QMIA 2Y2KA 4OLGA 4WYYA 4OP5A 4OKPA 2XFSA 2XFTA 4P87A 4CJNA 5IHVA 4JF4A 3G34A 4XUXA 3MXSA 3HBRA 4WEKA 4YFMA 5FQJA 3FYZA 3HUNA 5J8XA 1L2SA 3OPRA 1IYOA 2VGKA 1BLCA 2HP5A 2P9VB 2Y2IA 5A92A 5KZHA 4ZJ1A 1GA9A 4PM7A 1Q2PA 3C5AA 1OMEA 4BENA 4GB7A 4N1HA 2WGIA 2Y2HA 4A5RA 3OC2A 1DJCA 3OPPA 2V2FF 5AQAA 2ZM0A 3RJUA 3HREA 3LCEA 3Q81A 3O87A 4R23A 5EVIA 1JWZA 4E3IA 3NY4A 2XK1A 4E3OA 1IYQA 2DNSA 4S2IA 5E2HA 3C7VA 4QJGA 4LV1A 3IQAA 3W4QA 1TDLA 3DW0A 3PBOA 4P85A 2A3UA 4S2NA 4NETA 5A93A 1O07A 1MY8A 3UE0A 3UN7A 1XXMA 4IBXA 1MWTA 3A3FA 1H8ZA 3GRJA 3OCNA 1MXOA 5E2EA 4WZ5C 1YT4A 1YMXA 2P74A 2DCFA 2PU2A 3CMZA 3HLDA 1ZC2A 3HLEA 4GD8A 4WELA 2WGWA 5FI2A 4X55A 3ZHHA 5HL1A 4Y7PA 3UO9A 2ZQAA 4FH2A 1IYPA 4U0TA 2Y59A 1BULA 1Q2QA 4R3JA 2CC1A 3ZFZA 4GKUA 2ZC3B 2ZQDA 3M2KA 4ZBEA 5M18A 3N8SA 3ITBA 5FAQA 3BEBA 3S22A 1GA0A 2XLNA 1S0WA 1K56D 1N9BA 4X68A 3C4OA 2Y2NA 4X6TA 5EVIC 2Y2JA 4KZ8A 3GTCA 2PBYA 1LI9A 1H5XA 5D3OA 5FAOA 1FQGA 3ZG8B 4DRTA 3LY4A 1PWCA 4EBPA 2VGJA 3HUMA 1J9MA 4S2NC 4R1GA 4X56A 4N9LA 2EXAA 4DE0A 3SS5A 4S2JA 1L0EA 4RA7A 2RCXA 1RCJA 2WK0A 3BLMA 1S6RA 5TR7A 5CGWA 4X69A 3V50A 3CG5A 3BFDA 5M1AA 1W5DA 1GHIA 1PYYA 1SDNA 4QHCA 5EECA 1ES4A 2Y2QA 3ITAA 4JPMA 1WE4A 4LV0A 5AQBA 3UNWA 2Y2GA 4MBFA 4U0XA 1TVFA 4RYEA 2ZQ9A 2OV5A 3SS3A 3BFCA 4DF6A 2HP6A 4R3BA 2ZM8A 3GQZA 4MEZA 4MNRA 5CHJA 5EUAA 1KGFA 1L0DA 4DDYA 3ZVTA 2GDNA 3HVFA 1HD8A 1K56A 4DXBA 1E25A 3VOZA 4D2OA 4BJPA 4E3JA 1YQSA 2QPNA 4HBTA 3FZCA 5U47A 1K38A 2EX6A 3IXBA 2V1ZA 5EVLA 3BECA 1DY6A 3VP2A 1JWPA 1QMFA 1FCMA 4C3QA 3O86A 5GHXA 4OQ0A 1BUEA 3PBRA 4E3KA 3Q1FA 2H5SA 3M6HA 4FD8A 2ZC7A 3A3DA 1U60A 3UPOA 1XP4A 1NRFA 2WKEA 3HLFA 4MBKA 1H8YA 1KDSA 3PAGA 4WZ4A 3RXWA 1ES5A 3WS2A 4E3MA 3MZEA 1BLPA 1E3UD 4GDBA 4M3KA 3AGDA 3MZFA 5GLCA 4OVDA 1NYYA 2XD5A 3UDXA 3M6BA 3NI9A 5KSCA 1WYBA 4E6XA 1I5QA 3VFHA 3PBNA 3VP1A 4BLMA 3MKEA 3NC8A 1NYMA 1SKFA 4WMCD 5HAQA 4WZ5A 4QB8A 3OPLA 1K25A 2H10A 4B4ZA 3N8RA 5CHUA 1NZOA 5JYOA 4S2LA 5CEBA 3IWOA 4EUZA 3TG9A 3DWKA 3SOIA 2Y2PA 3TSGA 3HUOA 4LENA 4X53A 2J9OA 3IT9A 4JXGA 1MBLA 3FKVA 4B88A 1YLWA 1E4DA 1ZKJA 4C6YA 1CK3A 3HLWA 1ESIA 2Z2MB 2Q9NA 3D4FA 3G32A 4KQRA 3CZDA 4JXSA 4KQQA 3WWXA 3IWIA 4OOMA 4PPRA 1FSYA 2EXBA 3QNBA 4S2KA 2QZ6A 4KZ3A 4BQMA 4ZJ2A 3G2ZA 3VFFA 5CXWA 1AXBA 3LY3A 5TFQA 4E3NA 1PWGA 3V3SA 3EQVA 4K91A 3N4IA 5FAPA 4JF6A 1KE4A 4PM9A 1G6AA 2BG1A 5FSRA 1E3UA 2ZD8A 5KMWA 3C7UA 5HFOA 1RGYA 5EVIB 4RVAA 3RXXA 3MFDA 3BLSA 1RGZA 5FQ9A 4S2PA 3NBLA 2WZXA 2OLVA 4GOGA 5CRFA 2JE5A 3LEZA 2IWDA 2WGVA 3IXGA 3EQUA 3Q07A 4BL2A 1ES2A 4EQIA 1JWVA 1K54A 1QMEA 3PBQA 2A49A 1I2WA 1LLBA 3OPHA 5HARA 4DE1A 4UA7A 3P09A 4KZ7A 2ZQ7A 1DJBA 2FFFB 5FQMA 4JF5A 4Y0UA 3S1YA 4EWFA 2Q9MA 2XEPA 1JTGA 3IWQA 2J7VA 4K0XA 3WS5A 1ONHA 2WGWB 5F82A 4C75A 3DWZA 5GL9A 2XF3A 5FQQA 2XQZA 5EOOA 3G30A 1BLHA 4BL3A 3HLBA 4E6WA 2J9PA 4E3LA 5FATA 1PI4A 3PAEA 1W79A 1YLTA 1TDGA 4QY6A 4EBLA 3G35A 4Q8IA 4S2MA 4OPRA 4KZ6A 1YLPA 3AGFA 4GD6A 1CEFA 4MLLA 1YLJA 1XGJA 3ZGAB 1RP5A 2DRWA 2Y4AA 2X02A 4PM8A 1CEGA 2HPBA 2JC7A 1FCNA 3FV7A 1WYCA 2R9XA 3QHYA 1ERMA 4GZBA 2JCHA 5HW3A 1K54C 2EX2A 1IEMA 4JBFA 4LCLA 2Y55A 2Z2LB 5DF8A 1ZG6A 5GLBA 1ES3A 1FR1A 1K4EA 1K6RA 1BZAA 1MWRA 2FFYA 2RL3A 3A3EA 4KQOA 5CTNA 3ZG0A 4F94A 5A90A 3IF6B 1MWUA 3NIAA 1NJ4A 4RX3A 3TOIA 1W8QA 3N7WA 3ZG9B 1XA1A 5DTSA 5DTTA 4S2OA 1W8YA 3IHAA 5FASA 3AGEA 1FOFA 1GHMA 1KE3A 5GLAA 4Z9QA 1FSWA 1JTDA 1NXYA 3P98A 3V39A 1LL9A 4PMAA 1FR6A 4HESA 4R4RA 4K0WA 4QU3A 4ZAMA 5E2GA 3S4XA 3IH9A 3UDIA 2EX9A 2OSUA 2ZC4B 4JLFA 4DE2A 2ZM2A 4KZ9A 3UE3A 3HL9A 2ZMAA 1EI5A 4U3TA 2HP9A 2XH9A 1KGGA 2WYXA 1PWDA 1Y54A 4KG2A 1KE0A 2ZJ9A 4DE3A 2G2WA 3CJMA 3VSLA 1MWSA 4IBRA 5CECA 3VP3A 3HLCA 3QNCA 1BSGA 3ISGA 3ZNYA 5I94A 1HTZA 1PW8A 2Y2LA 3FWLA 2HDQA 3VP4A 5CGSA 3VSKA 2ZQCA 4LV3A 5E43A 2EX8A 3PBSA 3MKFA 2Y2MA 5DVAA 4OLDA 4EBNA 2J8YA 3Q7VA 4HBUA 1XPBA 3OZHA 2B5RA 1K4FA 5EVID 2IWCA 3E2KA 1KDWA 4ZJ3A 4ZDXA 1ZG4A 3MZDA 1XKZA 1JVJA 1IELA 3G2YA 1ONGA 2Y2OA 2WAEA 1PIOA 1PZPA 2UWXA 4R4SA 5A91A 3IXHA 4IVKA 5CTMA 1Z6FA 4JXVA 1YLZA 2P9VA 4OPQA 2Y91A 4WBGA 4OQGA 4JXWA 5CGXA 2JBFA 5EOEA 1KVMA 4DXCA 3NCKA 1M40A 1ALQA 5L2FA 4N1XA 1IYSA 2WKIA 3UE1A 3UPNA 1LHYA 1HVBA 4UA6A 1K55A 4GN2A 3C4PA 1PI5A 3E2LA 3JYIA 3W4PA 1TEMA 3MBZA 3BRMA 3GVBA 4JKTA 5FQIA 5GHYA 5CEDA 1N4OA 4O7DA 1O7EA 4XXRA 1IKIA 3O3VA 2ZQ8A 4DKIA 2XDMA 3NDGA 1NZUA 1IKGA 1M6KA 1MPLA 2I72A 1XA7A 3A3IA 1SHVA 3LO7A 4XUZA 5GLDA 3GSGA 3IHBA 4WMCA 3PBTA 3UPPA 4QD4A 3B3XA 1PZOA 3SS4A 2HDSA 2X71A 3HLGA 1BLSA 3IXDA 4DDSA 3V5MA 3ZG5A 1BT5A 3MXRA 4OOLA 5AQ7A 3VP0A 2HDUA 3FKWA 1K57A 1GHPA 1ESUA 5G18A 4H8RA 1XX2A 1XGIA 1FCOA 2C5WB 1K6SA 4LV2A 4NK3A 4Y0TA 3BFEA 1LI0A 3DTMA 1K55C 3ZDJA 1SDEA 5DTKA 3BFGA 3SH7A 2PU4A 3Q82A 1NY0A 2EFUA 4GDNA 4OPZA 4OP8A 4PM5A 2ZC6B 4OH0A 4OQHA 4FSFA 5CERA 4B4XA 1L0FA 4R0QA 4UA9A 1YM1A 3IF5A 4BD1A 1CI9A 4IEDA 5FDHA 4ZTKA 3PTEA 5FQKA 5BOHA 4BD0A
chains in the Genus database with same CATH superfamily
1IBMM 3ALAA 4EV4A 1EE8A 2YKHA 3O88A 1WGNA 3UY6A 4CIZA 2HKJA 4AW4A 2Y74A 1P0ZA 3ZNTA 3PVSA 1MKIA 4CQHA 4Y13A 2FZ0A 4FCFA 3KW6A 1FILA 1SXJA 2IWBA 1VQK3 3WRZA 3K8ZA 2R46A 3T1RA 1R4CA 5JI2E 3VK8A 3MYTA 4IIAA 4BU4A 1TF1A 5TBMA 1TS0A 1OTDA 1PW1A 3HX3A 3L29A 3KOXE 3N6IA 3IF6A 2EKKA 1GCEA 4Y5FA 4N6UA 4JI8M 4XT2A 3HK4A 2XGLA 1GY5A 5HAIA 4DV4M 1DP6A 2D7GA 4X62M 2K0MA 1VQ43 2H0TA 4KZ4A 3GV9A 1EIJA 2N35A 1GO5A 3GQ5A 3RFBA 5J3WA 3SH8A 3E4QA 1MNLA 3CHWP 5HWWA 3MWZA 3DZDA 1Z6TA 4LRSA 2F4VM 2D42A 1GY7A 3ECFA 1YKDA 2E8IA 3JUQA 3VDPA 1F2KA 3H4JA 1VQ1A 5AQ9A 1S67L 3FC7A 4Y0OA 3UDFA 4J5KA 5EXTA 4LRTA 1IN6A 2KAAA 3BFFA 1MN3A 3U6LA 1PJIA 1ZTUA 8CHOA 5D83A 3QWLA 3G4PA 5IREB 2HMKB 3JPUA 1C3BA 4MMYB 3NOUC 4L0LA 3RGRA 4Q0HA 2JKTI 1I2EA 1HZOA 2VV8A 3T8NA 2Z4SA 1Y4KA 3WR2A 3ZG7B 4QHSA 4B08A 2C9OA 1W5TA 1NJI4 4IVIA 2K9DA 3WS1A 2L2DA 4MBHA 1G96A 4GNUA 3VMAA 5EE8A 3Q7VB 4QWOA 5AI1A 1BANA 2G2UA 1RNBA 2WAFA 2NUTC 5F1GA 2QMIA 2B3TA 4HL4A 3MG1A 1GVNA 2OOAA 1IDPA 4KFDA 3JUMA 3MQ0A 4P87A 3V99A 1BYWA 1CQSA 1LOYA 4M9ZA 2AADA 1YIT3 3HBRA 3MMPA 3T4QA 2Q0OA 3FYZA 3HUNA 3N8BA 3GLIB 3DZLA 1L2SA 3U6PA 3K0ZA 4JGQA 4BENA 2O25A 3S29A 3D9YA 1TJDA 3J7BA 4I4LA 1SG9A 3SARA 2WGIA 2Y2HA 2KDLA 2OWJA 4EUVA 1OAOC 3FD9A 1GJTA 3AL0C 4MMZB 2ZM0A 4LRYC 5AQAA 3HREA 2WKPA 2DZLA 1D06A 2WGOA 5EVIA 2W3DA 3T38A 4B3SM 1S4RA 1UI7A 4E3OA 3C8CA 4FCJA 3NOTC 3WHKA 1R2YA 1C1KA 1B2SA 1BSBA 2QCUA 1DO0A 2J80A 3CF6E 5A93A 2W82A 4G1MB 1O07A 1TF0B 3UN7A 1NJFA 1H8ZA 3GRJA 3OWUA 3L7HA 2W04A 1YT4A 3CMZA 4WELA 1FIKA 3HLEA 4IBBA 4X55A 1IYYA 3ZHHA 2CX1A 1JB0F 3SAWA 1Q7HA 1OFHA 4Y7PA 3UO9A 4G4QA 3BLZA 4AKIA 4LFUA 3VLFB 4PD2A 1DRMA 4HEOA 4KT0F 3LYGA 2CC1A 2ZC3B 5M18A 4FW9A 3ITBA 3U6MA 2E2TA 3Q90A 5FAQA 3S22A 1GA0A 2OQ4A 1S0WA 3F9SA 1N9BA 4X68A 1TGUA 3DGLA 2VV7A 4DR6M 4DJ2A 3G6OA 5FAOA 2P04A 4DRTA 2KA6B 3EOIA 4EBPA 2JQ5A 1BNFA 3B7NA 3CWFA 4FTXA 4REZA 1J9MA 4HI4A 1N34M 1IV7A 4N9LA 2VGLS 4DE0A 3S67A 4S2JA 2F98A 1L0EA 2QSFX 3LZAA 4RA7A 3D79A 3PNVA 4HHDA 2BMOB 3EBYA 1TTOA 1GHIA 3A0SA 3GLGB 2UXCM 5KPRA 5BVBA 3MG3A 2WKQA 3MS6A 4LJ8A 3DXOA 1WE4A 1HU9A 3EEHA 5AQBA 3SW1A 2MF7A 5CLKA 2QQ8A 1LXEA 2OV5A 2F5MA 3BFCA 3AV0A 4DDYA 3ZVTA 3HHXA 3FTFA 1UUVB 4MN5A 4FCTA 1K56A 4DXBA 2E8JA 4G6ZA 2QPNA 1RRHA 3KN4A 3GDIA 3IXBA 5EVLA 4ESPA 2W3HA 3BECA 3RGAA 1OTEA 4NXMM 2ZL1B 1QMFA 3J7Yd 3O86A 3U4LP 3KS4A 1B2MA 2XA7M 3VE3A 2QP9X 3WOFB 5IERA 4WF0A 4PDIA 4FD8A 3B74A 4MGZE 3EC9A 3JR4A 4XBTA 3FRHA 2W1TA 1S5AA 3HJIA 3RXWA 1EG9B 1H8YA 1KDSA 4E3MA 2J7OA 3MZEA 3PHYA 2DAEA 1XJ4A 1OCVA 1E3UD 5GLCA 4LF7M 5AIHA 1FNNA 3VKHA 3T4JA 4Q53A 3RGSA 2XD5A 5DJUA 3M6BA 4ILFA 1WYBA 4E6XA 2KHHA 5F3WA 4BLMA 3EN1B 3NC8A 1LNHA 4WMCD 3CI6A 5HAQA 3OW22 2EWVA 4WZ5A 3CPTA 3J80S 3HZPA 3BOSA 4LPZA 2OQEC 3MSOA 3SOIA 2Y2PA 2RNTA 3MR0A 2CV1A 1DGHB 1QQWA 1HQCA 3EB8A 3KYEA 4B88A 3CCJ3 2XSSA 2R62A 5BXQA 1CK3A 1VQ53 3HLWA 4B9OA 2CP8A 2Z4RA 2Q9NA 2V1CA 4UQIM 3UJNA 4KQRA 4M0WA 3CZDA 3FTCA 1XNQM 3IWIA 2R18A 3FYCA 4LF5M 3SOYA 1FSYA 2EXBA 3QNBA 4PPRA 2QZ6A 1E9SA 3G2ZA 2HMJB 5CXWA 3SMSA 2ZAOA 3S28A 3NM7A 3V3SA 3MSHA 3N4IA 1OFIA 5EM0A 1YJW3 1G6AA 1N5HA 2ZD8A 5HFOA 2OCTA 2QGUA 2EKFA 3RXXA 5H37D 4FOFA 4KVHA 1B3SA 1VETB 3D5IA 3FF2A 4I5QA 2WZXA 3TQSA 3X41A 2IWDA 3Q07A 3EQUA 2CG1A 2DWMA 2P0MA 3HY5A 1CYVA 1LSWA 4I5SA 3CCR3 1T18A 1IBKM 3QAUA 1JN5A 3OPHA 4B7GA 1W6GA 1WXQA 1FGMA 1LVNA 3P09A 2ZQ7A 4EEUA 3A0VA 4K0XA 2W3FA 3WS5A 1VQO3 1D6YA 3R7WB 4C75A 3DWZA 1S1YA 4R7GA 1GL7A 2XQZA 1DGGA 5EOOA 5FQQA 4BL3A 1BLHA 1WNHA 4E6WA 1BNGA 4JGOA 3FLJA 2BASA 3NUVA 5FGOA 3PAEA 4R6LA 1RLSA 3HU2A 2IA2A 4BMWA 4Q8IA 1LSXA 2FGTA 2P05A 2GU3A 4S2MA 4EXRA 3GAXA 4O2HA 1CYUA 4OPRA 3FG3A 3UZUA 3S7QA 4MLLA 1YLJA 3CXC2 2K47A 1E32A 5JI3E 3ZGAB 1SXJB 1ZV1A 1OTAA 1XXHB 2CFDA 1FCNA 3FV7A 1STZA 3KE7A 2OOVA 3LEQA 1IM2A 2EX2A 5TBMB 3VOZA 1ZX2A 3CCS3 2Z2LB 5DF8A 1ZG6A 1MWRA 2RL3A 3ZG0A 2QYBA 1GABA 3IF6B 3FCSB 4UN2B 1NJ4A 1VDDA 4KUKA 3LCUA 5DYIA 3F1OB 4EETB 3FSDA 3LVVA 4FWGA 2LVNC 1W8YA 4IBGA 1FOFA 2GEXA 4Z9QA 3IBJA 1EEJA 2ZTCA 1NO1A 1VG5A 3SMPA 1G8PA 3P98A 2J3WA 8RNTA 3V39A 1LL9A 3HHWA 4PMAA 1DETA 4R4RA 2MJ5B 3LT9A 1F8NA 4QU3A 2VDBB 4RNAA 2BJWA 3PGBA 3HZJA 3SHFA 3SXXA 2ZM2A 3EGDC 1QDRA 4KZ9A 1AR0A 1K28A 1OTBA 1ZO2A 3S27A 2ZMAA 1L8QA 2HP9A 2XH9A 1Y54A 1OH0A 3CJMA 5CECA 1BSGA 3ZNYA 4BBTA 3NM2A 2P38A 1GD4A 1Q7Y4 1HTZA 5KPZA 3SYUA 5F6AA 5F5YA 5I97A 5LC6A 1X1XA 2ZQCA 5E43A 3TE8A 2Y0QA 3LCVB 2EX8A 4GHLA 1F9IA 4HNBA 3Q7VA 4R71A 1IY0A 1HNXM 1XPBA 5CX7A 1K4FA 4ZJ3A 3WODG 5ITXA 3E99A 1OUNA 1I3IA 1XKZA 1JVJA 2CKFB 4L78A 3FG4A 4LZJA 1V74A 2WAEA 3TWKA 3E4OA 1IU7A 3LR3A 1PIOA 3IXHA 3TWLA 3GLIA 4N6MA 4OPQA 2V8FA 1M1XB 3QP8A 1QVRA 1TR8A 3GQ3A 1T5YA 1KVMA 2JBFA 4N3VA 3SC3A 5L2FA 2WKIA 2UGIA 1T3TA 1NSFA 1LHYA 3CMA3 1NU3A 3K5TA 1W4NA 3TWMA 1K55A 1C7HA 3LGOA 2CWTA 4O7DA 4G3OA 3WHLA 1K734 2VF8A 2WO0A 2A5YB 1MGRA 2W9QA 3BIRA 1N78A 3LO7A 2PDRA 2OAP1 4XUZA 4B93A 3IMAB 3RTYA 3NV0A 4WMCA 4FMCA 2AVXA 1Q9EA 1SXJD 4QD4A 3TE6A 3B3XA 2HDSA 2EO2A 4IT7A 4FCWA 1O7WB 3C9PA 4QHTA 1AQZA 4OOLA 2CV2A 2FH0A 3T1XA 1B2UA 2P7JA 4LYLB 1Z59A 5FTJA 2JKTM 4H8RA 3EHCA 5A0OB 1FCOA 4R80A 2R45A 4DUYM 1K6SA 3QP4A 4NK3A 2LQVA 1YAXA 3ZDJA 2F86B 3LIEA 5DTKA 4F3LB 3DM8A 2PU4A 2QKPA 5LBRA 1KQS2 4NSOB 4OH0A 3LI9A 4OQHA 1L0FA 3WMDA 4R0QA 4UA9A 1HZ1A 2RFRA 1G6OA 3Q3FA 1B20A 3FPWA 1CI9A 7STDA 4AKYA 1RMSA 1V34A 5FQKA 4LF6M 5BOHA 4N6OB 4BD0A 2I7NA 4RZMA 2ZMVA 3ZQ5A 1CUKA 1Z5AA 1SIIA 5IENA 2J3TD 2SBLA 1IFYA 4OPYA 3PFIA 2AAEA 4P16A 3J2PB 4HJ3A 2F5NA 1N9OA 5TGFA 2YFJB 4GL6A 4N9KA 1K57C 2DWLA 2Z8YM 1VZZA 4Y17A 5JYPA 1XMOM 3LICA 1G68A 2XSZD 5DF7A 1JR3E 3LT8A 3QP5A 3WRTA 3MK6A 3BNCA 5FDSA 1VEJA 2C96A 4IBFA 3HHZA 5FI7A 4RQ9A 4H6JA 5DF9A 3WS0A 2Z7JA 3UL6A 1VQQA 1Q864 1W7FA 3T1QB 3KX0X 2MJ6A 5EXXA 5DYGA 3J81S 2H0YA 3OX9A 4KZAA 3ZCZA 3TRCA 3EE1A 1P9WA 3VOYA 3TJZC 5ITRA 2GNXA 3WS4A 3L28A 1VQ63 5HAPA 1Q3BA 3LW5F 2ACGA 2ZL1A 1LL5A 1ODVA 1KC84 1S1ZA 5TJJA 4UAAA 2DAMA 3GLHA 4PKYA 2F99A 1WR1B 3Q2PA 1Y4OA 4CLCB 1DMQA 1KGEA 5DFLA 5ELJA 5L8RF 1TS6A 1PFPA 1GL6A 1I3FA 1Z5BA 2X01A 1WTHA 2WOFA 1IQPA 1X1UA 4FCZA 4WM9A 2WADA 2UU9M 4GHAA 1BVSA 4HLQA 4YINA 3FH1A 3A3JA 2WUQA 1QAMA 2DHYA 3V76A 2CEAA 2XD1A 3IH8A 1T3BA 2ZANA 1UM8A 3NULA 1TH2A 1OHPA 5G4ZA 2H1RA 2W1TB 2QWSA 4MGKE 1ZGXA 1I2GA 4KZBA 2L4VA 1K3WA 1N32M 4K1VA 1UCLA 2D7EA 5IWAM 2ZL8A 3SBJA 2BU4A 3D9RA 1FGQA 1TDHA 1E94E 1TS7A 3I01M 4XDVA 3OCLA 2ZC5B 3T1HM 3LR0A 2ZLYA 1AVLA 3N9HA 1KVLA 3BB9A 4P6ZS 3CPTB 3G31A 1CI8A 4OP5A 3STDA 4HYZA 2W6JH 4XM4A 2K6BA 4XUXA 1BNJA 3MXSA 3GWRA 1WA9A 3I04M 3MJQA 2IUJA 5EV0A 3OPRA 1IYOA 1BLCA 2VGKA 2Y2IA 2GBXB 4M9SA 4ZJ1A 1Q2PA 3C5AA 4GB7A 4I3AA 4QNMA 1WQLB 3BQ8A 4NOOB 3GZRA 4A5RA 4IBEA 2QBYA 1DJCA 1EA2A 3OC2A 2H28A 4DBGB 3V67A 3K2LA 2H0IA 3LCEA 1D6ZA 2XSOB 3O87A 3UL5A 2DMWA 1JZDA 3NY4A 1L2DA 1NDOB 4GITA 1O7HB 3MQOA 1IYQA 1OQYA 3B7ZA 1G3IA 2DNSA 5E2HA 3C7VA 2CV0A 4XGIA 4L9GA 3S5CA 2A15A 2RCDA 4LV1A 2OWPA 2VV6A 3IQAA 3W4QA 4P85A 2JKRM 1FUTA 4L15A 2C10A 2A3UA 4NETA 3CAXA 5L8MA 3HWSA 1QAQA 2CFGA 4IBXA 3PXGA 3A3FA 1B2ZA 5C1BA 4R4KA 3OCNA 2D1WA 3VFDA 4BWIA 2HZ5A 5HSQA 3DGOA 2P74A 4LJ4A 1JKGB 2LB5A 1YLAA 4MH0E 2XLJA 3BNBA 4B3TM 1YJN3 3U6CA 5HL1A 1N36M 4MEIA 5JBSA 1JJ22 2OOLA 2FXTA 1Q2QA 2ZOIA 3T6PA 4R3JA 3ZFZA 4DUZM 2LHGA 4G4RA 3W0LB 2W3GA 3M2KA 4ZBEA 4LF4M 1SPUA 4HVNA 1GMRA 1GSWA 1TP6A 2PZVA 2XLNA 1K56D 2D7HA 5DNYA 1VEUA 4X6TA 1TRQA 1K41A 1GLNA 3E46A 3DUKA 4PKYG 1TTEA 5G4YA 4CLCD 1YI23 3AOEC 3UJMA 1VQ73 4IPBA 1H5XA 5D3OA 1HT2E 5IT9S 5K5BA 2WSFF 5D81A 3LY4A 2LVOC 1PWCA 4X1MA 4YWZA 1XXHA 3EN8A 4I3IA 3HUMA 3IG5A 2EXAA 2JNHA 1V58A 2WK0A 1W6YA 3BLMA 2ZDJA 5TR7A 5CGWA 3V50A 1NWWA 4H3UA 5EQTA 1N9JA 3CG5A 5FEGA 4JI1M 3F1OA 1D1JA 4QHCA 1SDNA 5IZ7D 5IF6A 2X49A 2KF6A 5CF2A 4Y2FA 1G41A 2O99A 4L8PA 2HL7A 4PCZA 1IQXA 1ES4A 4JRFA 4OVZB 3GQ4A 4WURA 5IU1A 1BRNL 3RH8B 3UNWA 4N6NB 1TVFA 2FH5A 2HV1A 3KSFA 3AFHA 3F40A 3AGNA 2ZM8A 3GQZA 1PJJA 4MNRA 3NQZA 5CHJA 5LC7A 1WJ7A 2CG0A 3JUPA 1L0DA 2NUPC 2XRXB 3JUOA 1LQGC 5KP1A 4FR9A 1HQYE 1N33M 1FGTA 1JB5A 4TX4A 1FW7A 2DXIA 3Q8GA 1YQSA 4JI7M 5EEOA 4HBTA 5U47A 4E3JA 2OQEA 1W63M 5FTKA 4LFCM 4NPBA 1W6CA 2K3DA 1FCMA 4C3QA 2V9AA 3RGPA 2XSZA 1HJPA 3HJKA 3GP1A 3G6E3 4NXEA 1AV4A 4E3KA 1YIJ3 1WMOA 2LWXA 3B7CA 3UPOA 1IN8A 4Q0IA 3M8CA 2CE7A 1XP4A 1NRFA 4WZ4A 3HLFA 4MBKA 3DA1A 3WS2A 4HH3A 3LVWA 1QALA 5L09A 3R9XB 4OX9M 3CPW2 4ARZB 3KYQA 2J7NA 1BLPA 4DR2M 2WGQA 1DVDA 1NYYA 4IBKA 3A0RA 4IBJA 2HMOB 1W7CA 2H5XA 2KOIA 3VP1A 1NB5I 3HCYA 3HJSA 1M1K4 3MKEA 1SKFA 4J9AA 5HPFA 1AUAA 1NHWC 3N8RA 1N75A 3I4VA 5GKNA 5CEBA 1RHLA 2ZAMA 3IWOA 3LYXA 4EUZA 3U6SA 1JV2B 4MMNA 3MHVC 3U6DA 1N8R4 4LG2A 2JHEA 3DWKA 5HDCA 1N77A 3HUOA 4ANRA 1I2FA 4LENA 2J9OA 1YGEA 3VF1A 3HU1A 1SJWA 1TUHA 3I0YA 5ELUA 1D0LA 3NXJA 3OWSA 1YE9A 4EW7A 3KS8A 1I8VA 3F7XA 3T50A 3D4FA 3IX8A 3I51A 4BTWA 3WWXA 2IY2A 1US1A 4OOMA 2RGQA 3E21A 4KZ3A 3AKZA 2OPFA 3VFFA 1NVMA 3LY3A 5TFQA 1FUWA 4GS9A 2K31A 4KZ1A 3BJNA 3L25A 4PM9A 1UCIA 4NKPA 5KMWA 3PS8A 3C7UA 3L27A 1QZMA 3NV0B 1RGYA 1DE3A 2L0WA 5IT5A 3T4OA 5DREA 3NBLA 5GLBA 4F3LA 4BL2A 3T8UA 2WGVA 3LEZA 5G1LA 1JWVA 4HM1B 1SARA 1YGWA 1PU4A 2A49A 2GZAA 3PBQA 4UA7A 3F8HA 1IXZA 1SQWA 4R9KA 1DJBA 2FFFB 2BJVA 2BMRB 3S1YA 2Q9MA 2XEPA 3IWQA 2J7VA 2WGWB 2C99A 4BTYA 3CME3 1A2KA 4IBDA 1CF0A 2B18A 2M60A 1JNQA 3K2NA 3C2WA 1PI4A 4YY3M 5FATA 3Q1CA 3KDSE 4LFBM 1N5PA 1W79A 2OWHA 4QY6A 3EIHA 3NJAA 4IJGA 3M7GA 3LQRA 4QNRA 3BY8A 3SFZA 3KFQC 3CCQ3 2V8CA 2ZBBA 2CK3H 5IG0A 3CPOA 3UE6A 4E04A 2KRKA 4HJ6A 4GD6A 3AGFA 1FGRA 4MN7A 1RP5A 4JI5M 1J3WA 2Y4AA 1CEGA 4KFFA 2JC7A 3DGMA 5KP4A 4GZBA 8CATA 3LXUX 3A3EA 1P97A 1BZAA 4KQOA 3GLFB 3D8BA 3GPYA 1MWUA 2JZ1A 4H6JB 2VKSA 5GSPA 3HJ8A 4NXBA 5DTTA 4S2OA 1XFNA 3AGEA 3VSYA 5DKLA 1GHMA 3S7OA 3QK9A 5FASA 4HM0B 1FSWA 3FRIA 2CH9A 2Z7AA 2ZMFA 4CLCA 4XBOA 4HESA 4LFAM 2VQFM 3KSXA 2KXGA 1IV9A 1JR3D 4K0WA 4ZAMA 3UDIA 1BRHA 3IECA 4DE2A 2LNHC 4QOSA 3GLHB 1RGEA 1IFQA 3UE3A 3HL9A 1N9LA 3L2AA 5KQ8A 1O7MB 1KGGA 1NRJA 2WYXA 5LMUM 1KOUA 2KF3A 5EP4A 1WMNA 2R41A 1W5SA 4AEQA 2W3EA 4MGIE 3ISGA 3CUEA 3MFXA 3NBRA 3NHXA 3DTIA 3QP6A 2ZHXB 2HDQA 2V1LA 5IG3A 3U5ZA 3QRDA 2IMJA 3VSKA 4LV3A 2VJWA 1FJGM 3FTEA 3ZC7B 2CC3A 4OLDA 2CRUA 2JKGA 4HBUA 1BUJA 3OZHA 4WYKA 1OAIA 4X66M 1U5OA 2Q07A 1KDWA 2IWCA 3E2KA 5F69A 4AFIA 4GEWA 3DTKA 1IELA 5DRVA 3F8XA 4Q7JA 2E2VA 3ER7A 3DY5A 2UWXA 2DENA 2WZJA 4G3KA 4R4SA 5A91A 1QVG2 4GRIA 5CTMA 4JXVA 5HD3A 2Y91A 3L26A 4DXCA 5EOEA 3T4TA 1W2B2 3NCKA 4LJ9A 2FNQA 4N1XA 3TL4X 3U1WA 3CF2A 1IYSA 3UPNA 3B89A 1JQJC 3SYLA 2HMNB 5AIFA 3DBAA 4UA6A 4BBUA 2HMMB 3OTOM 4LZZA 3C4PA 1PI5A 3JYIA 4KFEA 3MBZA 2BT3A 2R4EA 4JKTA 5GHYA 3PYJA 1N4OA 1GOYA 2LXEA 2QBYB 1O7EA 1O7NB 2W2CA 3HJQA 1IKIA 4X1LA 4XXRA 5HWVA 2V0UA 1K82A 3NDGA 1NZUA 1IKGA 1DV0A 1M6KA 2QA43 3UB5P 4RF0A 2HF6A 3VOLA 2G5GX 2X4AA 4I81A 2UUCM 3PBTA 1PZOA 2X71A 1JKGA 2L09A 2WOHA 3NBIA 3LTCA 3IXDA 4N6V0 2V1BA 1BSAA 4NRWA 1K57A 1GHPA 3BWLA 2FE8A 1WGLA 5DFYA 1Q39A 1YJ93 1K3XA 3GRYA 4LV2A 3SHGB 1UGHI 6STDA 3LUQA 4HIAA 3DTMA 1SDEA 4KHPM 1NY0A 2EFUA 1ZMUA 4OPZA 4OP8A 4PM5A 3C38A 3AHWA 4B4XA 4MM3B 3CNXA 5EP2A 2LBCA 4WW0A 1G5UA 4IEDA 1VEUB 3DOAA 5FDHA 4ZTKA 3LMLA 1O7PB 4JI3M 1S4SA 4JI4M 2EUCA 5KPTA 2UXBM 4KG5A 4B7FA 3CTWB 2F5OA 1D7EA 4K1UA 3U6QA 3X42A 3NDEA 1BTLA 3K9MC 2KZSA 3AGOA 1A90A 2ZOHA 4HY8A 4GLQA 3JVCA 4OVZA 3KSGA 4GJ4A 1SKOA 1W2ZA 4P0MA 1NJGA 4R70A 1ZQ9A 3I7JA 4JF8A 3I553 4P6BA 5HX9A 2R4IA 4H61A 2O3OA 1NY5A 4ITQA 1ZS7A 1OT6A 1PJSA 4OUQA 1SCWA 1YMSA 2BTFP 2HGVA 4KZ5A 3MXQA 4CPKA 4WFOA 2JKFA 3TDGA 1VQM3 1TDZA 1DP9A 3KIIA 2PYRA 2JP7A 3LQQA 4FD2A 3AJIB 1V9YA 3PYPA 1ZAEA 1NHGC 3SAVA 4HM2B 5E26A 4LMIA 1I2SA 2SARA 3BM6A 1O7GB 3B47A 4F1IA 4NXFA 1ULJB 3P01A 5EXPA 2W9PA 2CFWA 3UB8A 5HDDA 1L0GA 1BSDA 2WZZA 3P7NA 2LTUA 2HJEA 1XFQA 5FTNA 1GYBA 1ERQA 4ARZA 5EFWA 1QJGA 4RF1A 3T4SA 2K2NA 4YNRA 4DV2M 1EROA 4X25A 3B42A 2DVWB 3K92A 5GHZA 4JYAM 1DVCA 2OTL3 4FVMA 3LTDA 2KDKA 1PM5A 4K61A 4NG2A 3DAVA 1F5MA 4HM7B 5FI6A 2WKHA 3Q7ZA 1FGOA 1STDA 1EWZA 4I4KA 4EC6A 4HEFA 2O9CA 1A2PA 1A67A 3KVWA 2W0QA 1JR3A 3EF8A 1YLYA 2BLSA 4WEJA 4HZ9B 1TH3A 2X8AA 4AZFA 4B7HA 1QMAA 3KP1E 4IJFA 4OLGA 4WYYA 2Y2KA 3UMEA 3VK7A 4M9XA 2UX0A 4DV6M 2XFSA 1R4YA 4OKPA 2O01F 2XFTA 3K7CA 3D5GA 4RNTA 2CFLA 4WEKA 3JAMS 5CK6A 1LOWA 5J8XA 2M5ZA 1G0TA 3KOZE 3NECA 2P9VB 4AG5A 5KZHA 1G02A 4QOZC 1OJGA 1Q824 1P3QQ 4CGYB 1GA9A 4PAUA 1QUTA 1T1AA 3C30A 2FNAA 1IXSA 1IVUA 1DYUA 3UMDA 1GS3A 3KSED 1W63Q 1CQAA 1L1ZA 2CIUA 1TD5A 4EERA 5KO3A 4JI0M 4CHTB 3RJUA 1RGFA 2STDA 1J5EM 2KF4A 3E9SA 1B21A 4I3JA 3IS2B 2LVQD 3S7NA 2UXDM 4GS9B 1EUIC 2Y20A 1NB3I 4S2IA 3JUNA 3C3EA 3H3HA 4QJGA 1YSPA 3SYKA 3ICYA 3UMMA 3CLOA 3UE0A 1GY6A 1PNEA 4HBRA 1XXMA 1MWTA 2Z77A 2UV0E 1MXOA 2XROA 4WZ5C 1YMXA 3HLDA 2DCFA 5ITQA 2Z76A 2W27A 4GD8A 2WGWA 2XA7S 2QHKA 3VE4A 4GH9A 4IBIA 2JN7A 4BBVA 2LVAA 4FH2A 3CD63 1L1TA 2KF5A 3E4PA 4PHTA 1RGKA 4DV7M 1HR0M 2UUAM 4GKUA 2ZQDA 3UGJA 1B27A 2GEYA 3OV4A 4FMAA 2BHMA 2QJ5A 3BEBA 2GXFA 3N8SA 3S7PA 2GJ3A 4ZPXA 4II7A 1V33A 1BNRA 2Y2NA 1BU4A 2MC8A 2CFKA 1BSEA 2CUZA 1NO3A 3A42A 4O01A 3L9KA 5JPPA 5DKKA 1XJ6A 3ZG8B 2DKLA 1LQMB 4IBCA 1UW1A 1IN5A 2VQEM 5IG4A 1VHMA 3PCRA 1TS8A 4IUHA 3I563 4PT5A 4S2NC 1OACA 4X56A 1JZOA 3SS5A 4RNZA 2APLA 3X3XA 1XWIA 2PT7A 2RCXA 3GLFA 1T19A 1S6RA 5DJTA 1IY2A 2W0NA 4X69A 4Z1WA 2F4YA 1RNTA 2KNVA 3SATA 1ACFA 2G7UA 2DZNB 5M1AA 3BFDA 4HH2A 1PYYA 4HKVB 2DWZB 1RGGA 2CHVA 1ROAA 3EJVA 4UQIS 3TPZA 4AKHA 1OF5B 2Y2QA 3ITAA 3T12B 3GRVA 4JPMA 2HJ9C 3V98A 3T1YM 1RGLA 1YHQ3 2Y2GA 4RYEA 2ZQ9A 3GLIE 4R3BA 1T43A 1FZUA 4X2HA 1BOXA 1KWIA 3HVFA 1BUQA 3D3OA 3CITA 4MGHA 1FUSA 3G0KA 3JVUA 3F14A 3H51A 1K38A 3FKAA 2I9VA 2V1ZA 2FOIC 4LSOA 4KODA 4EIWA 1JBRA 1NWZA 1JWPA 3B33A 1GMPA 3AMOA 4MB7A 4K08A 4D82A 1Q40A 4OQ0A 4WLAA 1RGHA 2YFLB 2IUKA 2XRNA 1U60A 3KOYE 1YVBI 3ZYTA 2GBWB 2PAVP 3U5ZB 3CCV3 3PAGA 4GHIB 3B4PA 4O8GA 2ZTDA 4AQYM 3CNMA 4GDBA 1C7YA 3AGDA 3MZFA 4M3KA 3MG2A 4OVDA 1OT9A 5FTMA 4I38A 4WYKB 5KP3A 3NI9A 1S3SA 2W56B 3VFHA 1QDTA 1IVVA 3PXMA 3SEDA 2Q2EB 1NYMA 4GB5A 3SVAA 3OPLA 1WHCA 1BNEA 4S2LA 3NOPC 1F4IA 3M6AA 2O9BA 2VGLM 4RNYA 3TSGA 4LGYA 4X53A 1SZVA 5J7EA 3QYBA 3MKIA 1Y28A 1MBLA 3FKVA 1VQ83 5IEPA 2YR0A 2HOHA 2HAKA 2P0XA 3GPUA 1ZKJA 3LI8A 1ESIA 4Y3IA 1BRKA 5BPVA 2B1XB 4KQQA 3BW6A 2P08A 1HT1E 4BQMA 4ZJ2A 4LRZE 2RGOA 1UUWB 4R3DA 1M9GA 3EQVA 4K91A 1GOVA 3GLGE 2KX6A 4JF6A 4DMZA 2RKOA 1D0KA 1BGSA 1KE4A 5FSRA 4DR5M 2JUJA 3EX9A 3G8ZA 2OTJ3 3QP2A 4RBNA 3K63A 4GSPA 3GPPA 2HWJA 4L6V6 4NXGA 5J4EA 3MJ5A 4X2OA 4B3RM 2VA0A 3B8LA 2W03A 2OOBA 4K0KM 2OLVA 2JE5A 1PRQA 1GOUA 4EQIA 1ES2A 4Y15A 2INWA 4FMBA 1QMEA 4FWHA 4LCBA 1I2WA 1LLBA 5HARA 4JI6M 4DE1A 4LF8M 3T1SA 1Z1SA 3HU3A 5FQMA 4L16A 4STDA 4JF5A 4Y0UA 4EWFA 1JTGA 2QPAA 5HPIA 1ONHA 4EESA 1QUSA 1IN4A 1OIZA 2XF3A 3HHYA 5GL9A 2LB9A 1CEWI 3CC43 1UGUA 3FUWA 2J9PA 4E3LA 3LIBA 1KYIA 2DAGA 2QNJA 3WOEB 2K0BX 3KO6A 4YHHM 2J5YA 1YLTA 3KCHA 1B2XA 1BAOA 3WA3A 1DGFA 1E3VA 1XNRM 2QIYA 3IBRA 4EEPA 2KXEA 2QZ4A 2EA9A 5BIRA 1Q3CA 4KZ6A 2UUBM 2PNCA 1C54A 1CEFA 2VK3A 1XGJA 4PM8A 3DGYA 1RCLA 2HPBA 2X02A 4GCZA 2O5RA 2PR6A 3QHYA 2R9XA 1SKOB 1ERMA 1H3QA 4HM3B 4XDWA 1MKMA 1K54C 4S12A 2V0WA 2Y55A 3AOGA 4FCVA 1IT8A 2CWUA 1VQ93 1FR1A 1K4EA 1K6RA 2FFYA 5A90A 3ZCBB 4CISA 1YVSA 3OXAA 4O8SA 3TOIA 1W01A 3JR5A 4G4NA 1P9RA 5DTSA 5CF1A 2WSEF 3IHAA 5CXOA 4G3VA 3NHQA 4M4XA 1OKSA 1JTDA 4XB5A 1VB6A 1JBTA 3TG9A 1FR6A 3KYZA 3D72A 2BNKA 1XHBA 3W68A 5F68A 4HJ4A 3S4XA 5E2GA 2DZOB 3H82A 2OSUA 2ZC4B 3OOVA 3SOAA 4L8OA 3NBXX 4U3TA 1X0OA 2IA7A 1KE0A 2P5TA 4QWTA 2ZJ9A 2G2WA 4N6LA 1MWSA 1TFOA 4LY6A 1MX0A 1MZUA 1IVXA 2I9WA 1NLYA 4IBRA 3VP3A 3HLCA 4LJ5A 3K9OA 3QNCA 5AEWB 4CJ6A 2B24B 3BXWA 3UNLA 4AKZA 5I94A 1BNSA 2G3QA 1AY7A 2Y2LA 3FWLA 5CGSA 2L1MA 2YKFA 2INXA 4D81A 4GKJM 2P09A 3MKFA 1CJFA 3JVVA 3PCSA 4EBNA 4EXOA 2BWBA 1RDSA 1RCKA 2Y79A 2VX8A 2CMNA 2VLGA 4KQDA 3A46A 4DR7M 1BIRA 3FG1A 1ZG4A 3MZDA 1LOXA 1UGIA 3LTBA 4NREA 4XK8F 1Q42A 2Y2OA 3QYEA 3KFUG 4IUKA 4Z6YA 2HCBA 4LJ6A 4LEHA 2LH0A 1YLZA 2P9VA 4WBGA 1IN7A 4P17A 1VQL3 4OQGA 4DR3M 5CGXA 1QVF2 2EJSA 3LH4A 1M40A 2YFQA 4LJAA 4BIRA 1ALQA 1YPRA 3U6EA 5EXSA 2A24B 4GHOA 3WDGB 3K3DA 2MH8A 4ZRRA 5FLXS 1V92A 3CF0A 2IYJA 1LOVA 1I0XA 6GSPA 3E2LA 3W4PA 4L9FA 2PD8A 3IS2A 1TEMA 1IXSB 5D82A 3LFVA 4JGPA 5CEDA 1ZMVA 3RE8A 4IHQA 4EQ1A 1SXJE 4G4OA 1TIJA 3DMCA 3O3VA 2ZQ8A 1XXHE 4DKIA 4GMQA 3GRRA 2R65A 2DWNA 4MN6A 1T1CA 1OGZA 3FF0A 1H8MA 1MPLA 1IOUA 1BRSA 1OGXA 3IHBA 3PZWA 4LGQA 3UPPA 5E6JA 1LNIA 1GKIA 3SS4A 4GW9A 1RTUA 3HLGA 1BLSA 2ML5A 5STDA 4DDSA 1AVKA 3U61B 3V5MA 1OIPA 1BT5A 3MXRA 1LV7A 3HKPA 5AQ7A 3VP0A 1BRIA 3HOHA 3FKWA 3HIGA 4Q0JA 3UB6A 4BB9A 3IX3A 2VZWA 2R6FA 2ZBKB 2L4EA 1XGIA 1I0VA 2V1AA 4J5GA 2C5WB 4Y0TA 4NXNM 3BFEA 5EJCA 1L2CA 3GRDA 1ULIB 2XSHB 5HWTA 3BFGA 3ULFA 3DFZA 1KFVA 3Q82A 4LGWA 1D6UA 4GDNA 2CWVA 2ZC6B 3EGXC 4FSFA 5CERA 3SX1A 2K54A 3C58A 2KCDA 4EW5A 4PEJA 3IF5A 2FFJA 4BD1A 2KRUA 3OBFA 3H7WB 1FYSA 3PTEA 2VF7A 2OLUA 4AKGA 4EYCA 3SH9A 1R4GA 1PRBA 3HGIA 3GR2A 5EVEA 1E9RA 3B9PA 3G16A 2XGNA 1OJLA 2DAKA 2RGHA 3KZTA 4GIPA 1GSPA 2YQZA 4OOYA 1VM1A 1OF5A 2GSPA 2B95A 3FPVA 3W4OA 4KENB 5KSHA 1QAOA 2F5WA 2E5LM 1L5GB 3WHOA 2C6WB 2PRFA 4LRXC 4DV0M 2PYPA 4ETZA 5MC7A 3LIDA 4LCMA 1TFKA 1VEKA 2J8XB 5BU4A 5FW5A 2O9AA 1M904 1BRJA 2OAQ1 2KRTA 3O5YA 3VDUA 2VIIA 3A5EA 1WIVA 4OONA 4UHUA 4KG6A 5LMNM 1ROVA 3NX0A 2R9WA 1XB2B 2UUGC 2V20A 3MMHA 4MDZA 2JA2A 3V3RA 3GRUA 9RNTA 5EPHA 4MMXB 1QZEA 4BLCA 3B7QA 2BMQB 2PD7A 4RX2A 4WP2A 4IJEA 2FS1A 4QY5A 3GSPA 5E2FA 4KLNA 2MR9A 5ITUA 6RNTA 5M19A 5BR8M 4ORLA 3K1JA 1DJAA 4ID4A 2KEBA 1SXJC 3GMWA 3F92A 2HDRA 1R5LA 3BYDA 5CHMA 4R3AA 3EQQB 1R2ZA 4NL4H 2GU1A 4O3VA 4FH4A 3AMOB 4GHIA 2O9UX 4D80A 4EV2A 3FUUA 5F83A 3W8KA 1QYRA 1Q40B 3BNDA 3VKGA 1YNVX 1J09A 1OTRA 4GC5A 4A3VB 5AJGA 4PM6A 2D02A 2JKRI 3DTEA 3FUXA 3IF6C 3M2JA 1W00A 4FUWA 2M1CA 1L2BA 2W56A 3HX8A 4DV1M 1KD14 5FA7A 4L4UA 1XC8A 5F1FA 2JY8A 1TU5A 3ZVWA 2EFXA 1XJ2A 2CX0A 4N92A 3FZWA 2XR0A 4OQIA 3UB7A 1OHSA 1IQ8A 1T1BA 3N8LA 1A0KA 2EWWA 1MOLA 2L1SA 4HM8B 4LLOB 1XJ3A 1OJ5A 1G71A 2DI0A 2OO9A 3V92A 4F2LA 1EW0A 2H0GA 4CJNA 1AWIA 2F5PA 3B4OA 3F1NB 1MJGM 3G34A 3OLOA 2J3TC 4JF4A 3GPXA 5IHVA 1RJOA 1TRPA 4YFMA 3IHPA 1DGBA 2Z6BA 2DHRA 1R6BX 1RGAA 5FQJA 2NQ8C 3IX4A 4EU0A 2JY6B 1T2HA 1KSIA 2HP5A 5A92A 4DV3M 3U2AA 4PM7A 1ISKA 1OMEA 3MF0A 4N1HA 2K7SA 3CC73 1OPXA 3SAUA 1PY3A 2LYXA 2CFOA 3OPPA 2V2FF 4I39A 3MHEA 5AYSC 4NHFA 1PFLA 3Q81A 1GMQA 4R23A 3PR6A 5DFXA 1JWZA 1RN7A 4E3IA 2XK1A 4WL9A 5TGNA 3A98B 1ZMWA 1HNZM 1W02A 5G2GA 1TDLA 1T2IA 3DW0A 3PBOA 4S2NA 4JV5M 4HM5B 3X3ZA 4JGRA 1YSQA 4GKKM 1MY8A 3M0EA 4HM6B 5A2QS 1IT7A 5E2EA 2LHCA 1EKMA 3KSJA 4BTXA 1G4AE 4L7KA 1NNVA 2PU2A 2PR5A 3W0FA 1ZC2A 1ZHHB 5FI2A 2W1RA 3T15A 3GZBA 3U60A 4O0PA 4WUJA 2ZQAA 3G4S3 1IYPA 3FUTA 2EA0A 4U0TA 2PHYA 4HM4B 2Y59A 1BULA 2Z6DA 1HNWM 4CLCE 1LSVA 2YNMD 4EV5A 3FGYA 1UWNX 1D0MA 3CCU3 5FEFA 1DMMA 1RKYA 3C4OA 5EVIC 4NSRA 2ZA4A 2Y2JA 4KZ8A 3GTCA 2PBYA 1PJQA 1LI9A 5AYRB 4NEED 1FQGA 1U8CB 5FSWA 4P6ZM 2RRUA 5IW9A 4HQAA 1XMQM 7CATA 2JDIH 2VGJA 1IBLM 5IS1A 1BNIA 2C11A 1FA3A 4WHAA 3VV4A 4R1GA 2QENA 3K9PA 3F1PB 1RCJA 2L4RA 3C3DA 4DN0A 1DO2A 1UCKA 2BO9B 1Q814 1STFI 1YUBA 1W5DA 1A5TA 3GECA 5EECA 4MGYE 1T6OA 2WSCF 1IQYA 1UDII 3SZTA 1AIPC 3TW8A 1OPYA 1VDLA 2ERCA 2Y21A 3KSIA 5FTLA 3NBJA 1R7RA 4HAAA 4LV0A 4CDLA 4MBFA 4U0XA 1JRQA 2I7PA 5AEUB 4LJ7A 3KP0E 3SS3A 2A2LA 4DF6A 2HP6A 4L8RC 4MEZA 5EUAA 1MU5A 1KGFA 1EFUB 4XT2B 2KNZA 1G59A 2GDNA 2M7OA 3QP1A 5AVEA 1HD8A 2JWSA 3HI7A 1E25A 3PXPA 1RGCA 4D2OA 4YOFA 3A45A 5I5LA 4BJPA 3FZCA 1YSYA 1MC0A 3H82B 2EX6A 1DY6A 3VP2A 3D3LA 4R9LA 3H9WA 3EIEA 5GHXA 1VEGA 3O8YA 2MGWA 4N6TA 1BUEA 4OK0A 1JBSA 3PBRA 3Q1FA 2H5SA 3M6HA 2MROB 2ZC7A 3A3DA 1N9EA 2WKEA 1OTIA 1ES5A 4KUOA 2BNGA 4U13A 2QJ7A 2BIRA 4Y28F 1X1WA 3SLUA 1ASKA 1RSNA 2HHHM 1ORYB 3K3CA 3W2ZA 4KO8A 3UDXA 4NRVA 5KSCA 1UI8A 2C4BA 1UFZA 7RNTA 3UK6A 1I5QA 2LVPC 3PBNA 2G8LA 3W67A 1JB4A 4QB8A 1K25A 2H10A 1UCJA 1V57A 4B4ZA 5CHUA 1NZOA 4OU7A 1CH0A 1RN1A 2A24A 5JYOA 4CLCC 2WKRA 1SIHA 1JNUA 1NV9A 2QHOB 2GNOA 1BRGA 1L3LA 2HMLB 3GZXB 3IT9A 3X3YA 2JY5A 3LIAA 1NLZA 4JXGA 4FWDA 4X65M 3DH2A 2XZUA 1YLWA 3IPTA 1H0MA 1E4DA 4C6YA 5AIIA 3N54B 1LT0A 1X1YA 1DP8A 2Z2MB 5AVFA 4WWUC 1IK3A 1BVIA 2F5QA 3G32A 4MCWA 1I4WA 4JXSA 4S2KA 3AOEA 4DJ3A 3R8FA 3CUEC 4HP9A 4HOIA 4W5WA 1AXBA 4E3NA 3IJEB 1PWGA 2M7VA 5C5KA 5FAPA 3U61A 3AHSA 2BG1A 3IG8A 4Z8XA 1E3UA 5EVIB 5HGRA 3OWYA 4RVAA 1PGYA 5A8BA 1X37A 5JPUA 3MFDA 3BLSA 4XBYA 1GSXA 3KSHA 3UB9A 1RGZA 5FQ9A 4S2PA 1HKXA 4GOGA 5CRFA 3IXGA 3FUVA 1OHOA 4WP5A 5RNTA 3FYDA 3BBZA 2CWBA 1I70A 4EBGA 2GX5A 5L07A 1K54A 3RFWA 1NNJA 4HP4A 5FL3A 2KW0A 4KZ7A 5ITTA 1DMNA 3NQYA 1J2BA 4X64M 5EM1A 5AIGA 1G28A 4ETXA 3LTAA 3LR4A 3H7WA 3DGNA 3ZH9B 4AG6A 2RSXA 5F82A 1IVWA 3X40A 3G30A 4IIWA 3HLBA 1RN4A 4O02B 1QAKA 4DV5M 2Z3XA 4CCVA 1TDGA 3CGWA 4EBLA 3G35A 4JI2M 3T0UA 2CHCA 3MQQA 1JB2A 1KSFX 3G713 3LMMA 1Y8GA 1YLPA 4LZIA 5G1KA 2DRWA 4QPRA 1VQN3 5ITXE 5IG5A 3CCL3 2Z6CA 1WYCA 3GLGA 2F5SA 2JCHA 5HW3A 4LCLA 4JBFA 1IEMA 1ES3A 4NC6A 5CTNA 4F94A 3Q8XA 3CC23 4BBAA 5KIZA 2QEX3 3ZQJA 2R4JA 3NIAA 4RX3A 2D01A 2Y0TA 1W8QA 3N7WA 3ZG9B 4JN6A 1XA1A 3EBTA 2DAIA 3T4LA 3J7AS 4LGMA 4FCMA 3ROBA 1KE3A 3BY9A 5GLAA 1E3RA 1PJTA 4RKUF 1NXYA 3J27B 1A2VA 4ZM8A 1K8A4 5EP3A 3BU4A 3D4AA 2CW9A 2BWEA 3ILKA 3IH9A 2EX9A 1N9NA 4JLFA 2C9CA 4R1KA 4JXJA 3PNYA 2ZM6M 5L10A 1W5ZA 1IXRC 2JZ0A 2H0HA 5HL6A 3RNTA 1EQKA 1EI5A 4KG2A 2ML6A 1PWDA 5ITYA 2M7UA 3FKEA 1GJSA 3VGNA 3LIFA 4DE3A 3VSLA 4FMDA 2R78A 3GO8A 1TH4A 4PDGA 5HZHA 4B3MM 1D2NA 2OOVC 1RRLA 3HIIA 3CCE3 1PW8A 4HZBB 3T4KA 3VP4A 4L9EA 5EQLA 1NNUC 1E97A 3LR5A 2JXNA 3PBSA 1IY1A 3EEAA 2Y2MA 5DVAA 3CU3A 3A76A 2J8YA 4HJLB 4DR1M 2B5RA 5EVID 5HD5A 2JY7A 4ZDXA 1K9M4 1GD3A 2O0YA 1HLUP 2KNAA 5KQDA 3UB1A 1ONGA 2B02A 3G2YA 3F1NA 3KOWE 1F98A 3D8LA 1PZPA 4AI6A 2L7IA 3FG8A 3LOYA 4IVKA 1Z6FA 2E2UA 2R44A 2RBIA 3I4YA 2YX9A 3BNEA 5HDSA 4JXWA 2AHMA 1DGHA 1WMPA 1NV8A 2CHQA 1N8QA 4ME4A 3U6OA 2Y8HA 4J8TA 2GQFA 4UEYA 4DR4M 3CCM3 3UE1A 1LRAA 2C5RA 3WA2X 1HVBA 2DNAA 4K90B 4OVMA 3EWKA 4GN2A 5IEOA 4R38A 3FTDA 5FQIA 1S723 3BRMA 1RU3A 3GVBA 3R4KA 2Y73A 3KKGA 3BQAA 3SASA 1S66L 2XDMA 1PYLA 3H4MA 2I72A 3E98A 1XA7A 3A3IA 2V6ZM 7GSPA 1SHVA 3E4RA 4WN5A 5GLDA 2L6OA 3FE3A 3GSGA 3GLFE 1GSVA 4LF9M 2KZUA 1QAFA 2YFIB 3KSPA 1UWPX 2KLIA 5EP1A 3L0RA 1BSCA 3ZG5A 3NWLA 1HYFA 3URPA 1VETA 5C18A 1NY6A 4HOHA 2HDUA 1ESUA 4M0DA 1UUGB 4OW0A 2VEAA 5G18A 2CHGA 1J7KA 3MPHA 1XX2A 3NBBA 4GC9A 2XZFA 4TUWA 2F56A 3THGA 2R0IA 1LI0A 3E0YA 3U60B 4XBXA 1K55C 1K0KA 3SH7A 3GLHE 5EVHA 3RDEA 1LL8A 3R7WA 2L7HA 2L4FA 2XR8B 4D60A 3F7SA 4MJDA 1JN5B 2V1UA 3GZYB 4KT3B 1VQP3 1YM1A 3U97A 1H6UA 3KXEC 1LTMA 1MGWA 2PBDP 4G3WA 1Z09A 1Q02A 2C98A 1Z5CA 5HOHA 4I8OA 1V9ZA 3F1PA 1I94M 1QANA
chains in the Genus database with same CATH topology
1IBMM 3ALAA 4EV4A 1EE8A 3O88A 3UY6A 2HKJA 4AW4A 2Y74A 3ZNTA 3PVSA 1MKIA 4FCFA 3KW6A 2IWBA 1SXJA 1VQK3 3WRZA 3K8ZA 2R46A 1R4CA 5JI2E 3VK8A 3MYTA 4IIAA 1PW1A 3L29A 3KOXE 3N6IA 3IF6A 1GCEA 4N6UA 4JI8M 3HK4A 2XGLA 1GY5A 5HAIA 4DV4M 2D7GA 4X62M 2K0MA 1VQ43 2H0TA 4KZ4A 3GV9A 3GQ5A 3SH8A 1MNLA 3MWZA 3DZDA 1Z6TA 4LRSA 2F4VM 2D42A 1GY7A 3ECFA 2E8IA 3JUQA 3VDPA 5AQ9A 4Y0OA 3UDFA 5EXTA 4LRTA 1IN6A 3BFFA 3U6LA 1PJIA 8CHOA 5D83A 3QWLA 3G4PA 5IREB 2HMKB 1C3BA 4MMYB 4L0LA 3RGRA 1HZOA 3T8NA 2Z4SA 1Y4KA 3ZG7B 4QHSA 4B08A 2C9OA 1W5TA 1NJI4 4IVIA 3WS1A 4MBHA 1G96A 4GNUA 3VMAA 5EE8A 3Q7VB 5AI1A 2G2UA 2WAFA 5F1GA 2QMIA 4HL4A 3MG1A 1GVNA 1IDPA 4KFDA 3JUMA 4P87A 3V99A 1CQSA 1YIT3 4M9ZA 3HBRA 3FYZA 3HUNA 3N8BA 3GLIB 3DZLA 1L2SA 3U6PA 3K0ZA 4BENA 3S29A 3J7BA 4I4LA 3SARA 2WGIA 2Y2HA 3AL0C 3FD9A 4MMZB 5AQAA 2ZM0A 3HREA 2WGOA 5EVIA 3T38A 4B3SM 1UI7A 4E3OA 4FCJA 3WHKA 1R2YA 1C1KA 2QCUA 1DO0A 3CF6E 5A93A 2W82A 4G1MB 1O07A 3UN7A 1NJFA 1H8ZA 3GRJA 3OWUA 2W04A 1YT4A 3CMZA 4WELA 3HLEA 4IBBA 4X55A 3ZHHA 3SAWA 1OFHA 4Y7PA 3UO9A 4G4QA 3BLZA 4AKIA 3VLFB 4PD2A 3LYGA 2CC1A 2ZC3B 5M18A 4FW9A 3ITBA 3U6MA 2E2TA 3Q90A 5FAQA 3S22A 1GA0A 2OQ4A 1S0WA 3F9SA 1N9BA 4X68A 1TGUA 3DGLA 4DR6M 5FAOA 4DRTA 2KA6B 4EBPA 2JQ5A 4REZA 1J9MA 1N34M 1IV7A 4N9LA 4DE0A 3S67A 4S2JA 2F98A 1L0EA 3LZAA 4RA7A 3PNVA 2BMOB 3EBYA 1GHIA 3GLGB 2UXCM 5KPRA 5BVBA 3MG3A 4LJ8A 3DXOA 1WE4A 1HU9A 5AQBA 2MF7A 5CLKA 1LXEA 2OV5A 3BFCA 3AV0A 4DDYA 3ZVTA 3HHXA 3FTFA 1UUVB 4FCTA 1K56A 4DXBA 4G6ZA 2QPNA 1RRHA 3KN4A 3IXBA 5EVLA 3BECA 3RGAA 4NXMM 1QMFA 3J7Yd 3O86A 3KS4A 2QP9X 3WOFB 5IERA 4PDIA 4FD8A 4MGZE 3EC9A 3JR4A 4XBTA 1S5AA 3RXWA 1EG9B 1H8YA 1KDSA 4E3MA 2J7OA 3MZEA 1OCVA 1E3UD 5GLCA 4LF7M 5AIHA 1FNNA 3VKHA 4Q53A 3RGSA 2XD5A 3M6BA 1WYBA 4E6XA 5F3WA 4BLMA 3EN1B 3NC8A 1LNHA 4WMCD 5HAQA 3OW22 4WZ5A 3J80S 3HZPA 3BOSA 2OQEC 3MSOA 3SOIA 2Y2PA 2CV1A 1DGHB 1QQWA 1HQCA 3EB8A 4B88A 3CCJ3 2R62A 5BXQA 1CK3A 1VQ53 3HLWA 2Z4RA 2Q9NA 2V1CA 3UJNA 4KQRA 4M0WA 3CZDA 3FTCA 1XNQM 3IWIA 2R18A 3FYCA 4LF5M 3SOYA 1FSYA 2EXBA 3QNBA 4PPRA 2QZ6A 1E9SA 3G2ZA 2HMJB 5CXWA 3SMSA 2ZAOA 3S28A 3NM7A 3V3SA 3N4IA 1OFIA 1YJW3 1G6AA 1N5HA 2ZD8A 5HFOA 2OCTA 2QGUA 3RXXA 5H37D 4KVHA 3FF2A 2WZXA 3TQSA 3X41A 2IWDA 3Q07A 3EQUA 2CG1A 2DWMA 2P0MA 1CYVA 4I5SA 3CCR3 1IBKM 3QAUA 1JN5A 3OPHA 4B7GA 1W6GA 1WXQA 1FGMA 1LVNA 3P09A 2ZQ7A 4K0XA 3WS5A 1VQO3 1D6YA 4C75A 3DWZA 4R7GA 1GL7A 2XQZA 1DGGA 5EOOA 5FQQA 4BL3A 1BLHA 1WNHA 4E6WA 3FLJA 3NUVA 5FGOA 3PAEA 3HU2A 4Q8IA 2FGTA 2P05A 2GU3A 4S2MA 4EXRA 3GAXA 4O2HA 1CYUA 4OPRA 3FG3A 3UZUA 4MLLA 1YLJA 3CXC2 2K47A 1E32A 5JI3E 3ZGAB 1SXJB 1XXHB 2CFDA 1FCNA 3FV7A 3KE7A 2OOVA 1IM2A 2EX2A 3VOZA 1ZX2A 3CCS3 2Z2LB 5DF8A 1ZG6A 1MWRA 2RL3A 3ZG0A 3IF6B 3FCSB 1NJ4A 1VDDA 5DYIA 3FSDA 3LVVA 4FWGA 1W8YA 4IBGA 1FOFA 2GEXA 4Z9QA 3SMPA 1G8PA 3P98A 3V39A 1LL9A 3HHWA 4PMAA 4R4RA 3LT9A 1F8NA 4QU3A 4RNAA 2BJWA 3PGBA 3SHFA 3SXXA 2ZM2A 4KZ9A 1AR0A 1K28A 1ZO2A 3S27A 2ZMAA 1L8QA 2HP9A 2XH9A 1Y54A 1OH0A 3CJMA 5CECA 1BSGA 3ZNYA 3NM2A 2P38A 1GD4A 1Q7Y4 1HTZA 5KPZA 5I97A 5LC6A 2ZQCA 5E43A 2Y0QA 2EX8A 4GHLA 3Q7VA 1IY0A 1HNXM 1XPBA 1K4FA 4ZJ3A 3WODG 5ITXA 3E99A 1OUNA 1XKZA 1JVJA 2CKFB 4L78A 3FG4A 4LZJA 1V74A 2WAEA 3TWKA 1IU7A 1PIOA 3IXHA 3TWLA 3GLIA 4N6MA 4OPQA 1M1XB 1QVRA 1T5YA 3GQ3A 2JBFA 1KVMA 4N3VA 3SC3A 5L2FA 2WKIA 1T3TA 1NSFA 1LHYA 3CMA3 1NU3A 3K5TA 1W4NA 3TWMA 1K55A 1C7HA 2CWTA 4O7DA 3WHLA 1K734 2WO0A 2A5YB 2W9QA 3LO7A 1N78A 4XUZA 3IMAB 3NV0A 4WMCA 4FMCA 1SXJD 4QD4A 3TE6A 3B3XA 2HDSA 2EO2A 4IT7A 4FCWA 1O7WB 4QHTA 4OOLA 2CV2A 1Z59A 5FTJA 4H8RA 3EHCA 5A0OB 1FCOA 4R80A 2R45A 4DUYM 1K6SA 4NK3A 2LQVA 3ZDJA 2F86B 5DTKA 3DM8A 2PU4A 1KQS2 4NSOB 4OH0A 4OQHA 1L0FA 3WMDA 4R0QA 4UA9A 2RFRA 1CI9A 7STDA 4AKYA 5FQKA 4LF6M 5BOHA 4N6OB 4BD0A 2I7NA 4RZMA 1Z5AA 1SIIA 5IENA 2SBLA 4OPYA 3PFIA 4P16A 3J2PB 2F5NA 5TGFA 2YFJB 4GL6A 4N9KA 1K57C 2DWLA 1VZZA 5JYPA 1XMOM 1G68A 2XSZD 5DF7A 3WRTA 3LT8A 3MK6A 3BNCA 2C96A 4IBFA 3HHZA 5FI7A 5DF9A 3WS0A 2Z7JA 3UL6A 1Q864 1W7FA 1VQQA 5EXXA 5DYGA 3J81S 2H0YA 3OX9A 4KZAA 3ZCZA 3EE1A 3VOYA 3WS4A 5ITRA 3L28A 1VQ63 5HAPA 1Q3BA 1LL5A 1KC84 4UAAA 3GLHA 2F99A 3Q2PA 1DMQA 1KGEA 5ELJA 1PFPA 1GL6A 1Z5BA 2X01A 1WTHA 2WOFA 1IQPA 4FCZA 4WM9A 2WADA 2UU9M 4GHAA 4HLQA 4YINA 3FH1A 3A3JA 2WUQA 1QAMA 3IH8A 2CEAA 2XD1A 2ZANA 1UM8A 1TH2A 1OHPA 2H1RA 4MGKE 4KZBA 2L4VA 1K3WA 1N32M 4K1VA 2D7EA 5IWAM 2ZL8A 3SBJA 3D9RA 1FGQA 1TDHA 1E94E 4XDVA 3OCLA 2ZC5B 3T1HM 2ZLYA 1AVLA 3N9HA 1KVLA 3BB9A 3G31A 1CI8A 4OP5A 3STDA 4HYZA 2W6JH 4XM4A 4XUXA 3MXSA 3GWRA 2IUJA 3OPRA 1IYOA 1BLCA 2VGKA 2Y2IA 2GBXB 4M9SA 4ZJ1A 1Q2PA 3C5AA 4GB7A 4QNMA 1WQLB 4NOOB 3GZRA 4A5RA 4IBEA 2QBYA 1DJCA 1EA2A 3OC2A 3K2LA 3LCEA 1D6ZA 2XSOB 3O87A 3UL5A 3NY4A 1L2DA 1NDOB 4GITA 1O7HB 1IYQA 2DNSA 1G3IA 5E2HA 3C7VA 2CV0A 4XGIA 3S5CA 2A15A 2RCDA 4LV1A 2OWPA 3IQAA 3W4QA 4P85A 2A3UA 4L15A 2C10A 4NETA 3HWSA 1QAQA 2CFGA 4IBXA 3PXGA 3A3FA 4R4KA 5C1BA 3OCNA 2D1WA 3VFDA 3DGOA 2P74A 4LJ4A 1JKGB 4MH0E 2XLJA 3BNBA 4B3TM 1YJN3 3U6CA 5HL1A 1N36M 4MEIA 5JBSA 1JJ22 2FXTA 1Q2QA 4R3JA 3ZFZA 4DUZM 4G4RA 3W0LB 3M2KA 4ZBEA 4LF4M 1SPUA 4HVNA 1TP6A 2PZVA 2XLNA 1K56D 2D7HA 5DNYA 4X6TA 1K41A 1GLNA 3DUKA 1YI23 3AOEC 3UJMA 1VQ73 4IPBA 1H5XA 5D3OA 1HT2E 5IT9S 5D81A 3LY4A 1PWCA 1XXHA 3EN8A 3HUMA 3IG5A 2EXAA 2WK0A 1W6YA 3BLMA 2ZDJA 5TR7A 5CGWA 3V50A 1NWWA 4H3UA 5EQTA 1N9JA 3CG5A 4JI1M 4QHCA 1SDNA 5IZ7D 5IF6A 2X49A 5CF2A 1G41A 4L8PA 2HL7A 4PCZA 1IQXA 1ES4A 4JRFA 4OVZB 3GQ4A 4WURA 3UNWA 4N6NB 1TVFA 3AFHA 3F40A 2ZM8A 3GQZA 1PJJA 4MNRA 3NQZA 5CHJA 5LC7A 3JUPA 2CG0A 1L0DA 2XRXB 3JUOA 5KP1A 4FR9A 1HQYE 1N33M 1FGTA 1JB5A 4TX4A 4E3JA 2DXIA 1YQSA 4HBTA 4JI7M 5EEOA 5U47A 2OQEA 5FTKA 4LFCM 1W6CA 1FCMA 4C3QA 3RGPA 2XSZA 3GP1A 3G6E3 1AV4A 4E3KA 1YIJ3 1WMOA 2LWXA 3B7CA 3UPOA 1IN8A 3M8CA 2CE7A 1XP4A 1NRFA 4WZ4A 3HLFA 4MBKA 3DA1A 3WS2A 3LVWA 1QALA 3R9XB 4OX9M 3CPW2 2J7NA 1BLPA 4DR2M 2WGQA 1DVDA 1NYYA 4IBKA 4IBJA 2HMOB 1W7CA 3VP1A 1NB5I 3HJSA 1M1K4 3MKEA 1SKFA 4J9AA 3N8RA 1NHWC 1N75A 3I4VA 5GKNA 5CEBA 3IWOA 2ZAMA 4EUZA 3U6SA 1JV2B 3TG9A 3MHVC 3U6DA 1N8R4 4LG2A 3DWKA 1N77A 3HUOA 4LENA 2J9OA 1YGEA 3VF1A 3HU1A 1SJWA 1TUHA 3I0YA 5ELUA 3NXJA 3OWSA 1YE9A 3KS8A 3F7XA 3D4FA 3I51A 4BTWA 3WWXA 1US1A 4OOMA 2RGQA 4KZ3A 3AKZA 2OPFA 3VFFA 1NVMA 3LY3A 5TFQA 1FUWA 4KZ1A 3L25A 4PM9A 5KMWA 3PS8A 3C7UA 3L27A 1QZMA 3NV0B 1RGYA 5DREA 3NBLA 5GLBA 3LEZA 3T8UA 2WGVA 4BL2A 1JWVA 4HM1B 1PU4A 3PBQA 2A49A 4UA7A 3F8HA 1IXZA 1SQWA 4R9KA 1DJBA 2FFFB 2BJVA 2BMRB 3S1YA 2Q9MA 2XEPA 3IWQA 2J7VA 2WGWB 2C99A 4BTYA 3CME3 1A2KA 4IBDA 2M60A 1JNQA 5FATA 1PI4A 4YY3M 3Q1CA 3KDSE 4LFBM 1N5PA 1W79A 4QY6A 3EIHA 3M7GA 3LQRA 4QNRA 3SFZA 3KFQC 3CCQ3 2CK3H 5IG0A 3CPOA 2KRKA 4GD6A 3AGFA 1FGRA 1RP5A 4JI5M 2Y4AA 1CEGA 4KFFA 2JC7A 3DGMA 5KP4A 4GZBA 8CATA 3LXUX 3A3EA 4KQOA 1BZAA 3GLFB 3D8BA 3GPYA 1MWUA 3HJ8A 5DTTA 4S2OA 5FASA 3AGEA 3VSYA 1GHMA 3QK9A 4HM0B 1FSWA 2Z7AA 2CH9A 4XBOA 4HESA 4LFAM 2VQFM 3KSXA 2KXGA 1IV9A 1JR3D 4K0WA 4ZAMA 3UDIA 4DE2A 2LNHC 4QOSA 3GLHB 3UE3A 3HL9A 3L2AA 5KQ8A 1O7MB 1KGGA 2WYXA 5LMUM 5EP4A 1WMNA 1W5SA 4AEQA 4MGIE 3ISGA 3NBRA 3NHXA 2HDQA 2V1LA 5IG3A 3U5ZA 3QRDA 2IMJA 3VSKA 4LV3A 1FJGM 3FTEA 3ZC7B 2CC3A 4OLDA 4HBUA 3OZHA 4WYKA 2Q07A 4X66M 1U5OA 2IWCA 1KDWA 3E2KA 1IELA 5DRVA 3F8XA 2E2VA 3ER7A 3DY5A 2UWXA 4R4SA 5A91A 1QVG2 4GRIA 5CTMA 4JXVA 2Y91A 3L26A 4DXCA 5EOEA 1W2B2 3NCKA 4LJ9A 2FNQA 4N1XA 3TL4X 3U1WA 3CF2A 1IYSA 3UPNA 4UA6A 1JQJC 3SYLA 2HMNB 5AIFA 2HMMB 3OTOM 4LZZA 3C4PA 1PI5A 3JYIA 4KFEA 3MBZA 2BT3A 2R4EA 4JKTA 5GHYA 3PYJA 1N4OA 2LXEA 2QBYB 1O7EA 1O7NB 2W2CA 3HJQA 1IKIA 4XXRA 1K82A 3NDGA 1NZUA 1IKGA 1M6KA 2QA43 4RF0A 2G5GX 2X4AA 4I81A 2UUCM 3PBTA 1PZOA 2X71A 1JKGA 3LTCA 2WOHA 2L09A 3NBIA 3IXDA 4N6V0 4NRWA 1K57A 1GHPA 2FE8A 1Q39A 1YJ93 1K3XA 3GRYA 4LV2A 3SHGB 6STDA 3DTMA 1SDEA 4KHPM 1NY0A 2EFUA 4OPZA 4OP8A 4PM5A 4B4XA 4MM3B 3CNXA 5EP2A 4WW0A 4IEDA 3DOAA 5FDHA 4ZTKA 3LMLA 1O7PB 4JI3M 4JI4M 2EUCA 5KPTA 2UXBM 4KG5A 4B7FA 3CTWB 2F5OA 4K1UA 3U6QA 3X42A 3NDEA 1BTLA 3K9MC 2KZSA 1A90A 3JVCA 4OVZA 1W2ZA 4P0MA 1NJGA 1ZQ9A 3I7JA 4JF8A 3I553 4P6BA 5HX9A 2R4IA 4H61A 2O3OA 1NY5A 4ITQA 4OUQA 1SCWA 1YMSA 4KZ5A 4CPKA 4WFOA 3TDGA 1VQM3 1TDZA 3KIIA 3LQQA 4FD2A 3AJIB 1ZAEA 1NHGC 3SAVA 4HM2B 5E26A 4LMIA 1I2SA 3BM6A 1O7GB 1ULJB 5EXPA 2W9PA 2CFWA 1L0GA 2WZZA 5FTNA 1GYBA 1ERQA 1QJGA 4RF1A 4DV2M 1EROA 2DVWB 3K92A 5GHZA 4JYAM 1DVCA 2OTL3 4FVMA 3LTDA 1PM5A 4K61A 4HM7B 5FI6A 2WKHA 3Q7ZA 1FGOA 1STDA 1EWZA 4I4KA 4EC6A 4HEFA 1A67A 3KVWA 2W0QA 1JR3A 3EF8A 1YLYA 2BLSA 4WEJA 4HZ9B 1TH3A 2X8AA 4AZFA 4B7HA 1QMAA 3KP1E 4IJFA 4OLGA 4WYYA 2Y2KA 3VK7A 4M9XA 2UX0A 4DV6M 2XFSA 4OKPA 2XFTA 3K7CA 2CFLA 4WEKA 3JAMS 5CK6A 5J8XA 2M5ZA 3KOZE 2P9VB 4AG5A 5KZHA 4QOZC 1Q824 1GA9A 4CGYB 2FNAA 1IVUA 1DYUA 1GS3A 3KSED 1L1ZA 2CIUA 5KO3A 4JI0M 4CHTB 3RJUA 2STDA 1J5EM 3E9SA 2UXDM 2Y20A 1NB3I 4S2IA 3JUNA 3H3HA 4QJGA 3SYKA 3UMMA 3UE0A 1GY6A 4HBRA 1XXMA 2Z77A 1MWTA 1MXOA 4WZ5C 1YMXA 3HLDA 2DCFA 5ITQA 2Z76A 4GD8A 2WGWA 4GH9A 4IBIA 4FH2A 3CD63 1L1TA 4DV7M 1HR0M 2UUAM 4GKUA 2ZQDA 3OV4A 3UGJA 2GEYA 4FMAA 3N8SA 2BHMA 3BEBA 2GXFA 4ZPXA 4II7A 2Y2NA 2MC8A 2CFKA 2CUZA 1NO3A 3A42A 5JPPA 3ZG8B 4IBCA 1UW1A 1IN5A 2VQEM 5IG4A 3PCRA 3I563 4PT5A 4S2NC 1OACA 4X56A 3SS5A 4RNZA 3X3XA 1XWIA 2RCXA 3GLFA 1S6RA 1IY2A 4X69A 3SATA 2DZNB 3BFDA 5M1AA 1PYYA 4HKVB 2DWZB 2CHVA 1ROAA 3EJVA 3TPZA 4AKHA 1OF5B 2Y2QA 3ITAA 3GRVA 4JPMA 3V98A 3T1YM 1YHQ3 2Y2GA 4RYEA 2ZQ9A 4R3BA 4X2HA 1KWIA 3HVFA 1BUQA 4MGHA 3G0KA 3F14A 3H51A 1K38A 3FKAA 2V1ZA 2FOIC 4LSOA 4KODA 4EIWA 1JWPA 3AMOA 4MB7A 4D82A 1Q40A 4OQ0A 2YFLB 2IUKA 1U60A 3KOYE 1YVBI 2GBWB 3U5ZB 3CCV3 3PAGA 3B4PA 4AQYM 3CNMA 4GDBA 4M3KA 3AGDA 3MZFA 3MG2A 4OVDA 5FTMA 4WYKB 5KP3A 3NI9A 1S3SA 2W56B 3VFHA 1IVVA 3PXMA 3SEDA 2Q2EB 1NYMA 4GB5A 3SVAA 3OPLA 4S2LA 3M6AA 4RNYA 3TSGA 4LGYA 4X53A 3MKIA 1MBLA 3FKVA 1VQ83 5IEPA 2YR0A 2P0XA 3GPUA 1ZKJA 1ESIA 5BPVA 2B1XB 4KQQA 1HT1E 4BQMA 4ZJ2A 2RGOA 1UUWB 4R3DA 1M9GA 3EQVA 4K91A 4JF6A 2RKOA 1KE4A 5FSRA 4DR5M 3EX9A 3G8ZA 2OTJ3 4RBNA 3K63A 3GPPA 3MJ5A 4X2OA 4B3RM 3B8LA 2W03A 4K0KM 2OLVA 2JE5A 4EQIA 1ES2A 4FMBA 1QMEA 4FWHA 4LCBA 1I2WA 1LLBA 5HARA 4JI6M 4DE1A 4LF8M 1Z1SA 3HU3A 5FQMA 4L16A 4STDA 4JF5A 4Y0UA 4EWFA 1JTGA 2QPAA 1ONHA 1IN4A 5GL9A 2XF3A 3HHYA 1CEWI 3CC43 3FUWA 2J9PA 4E3LA 1KYIA 3WOEB 4YHHM 1YLTA 3WA3A 1DGFA 1E3VA 1XNRM 2QIYA 2KXEA 2QZ4A 1Q3CA 4KZ6A 2UUBM 2PNCA 1CEFA 1XGJA 4PM8A 2X02A 2HPBA 2O5RA 3QHYA 2R9XA 1ERMA 4HM3B 4XDWA 1K54C 4S12A 2Y55A 3AOGA 4FCVA 1IT8A 2CWUA 1VQ93 1FR1A 1K4EA 1K6RA 2FFYA 5A90A 3ZCBB 4CISA 3OXAA 4O8SA 3TOIA 1W01A 3JR5A 4G4NA 5DTSA 5CF1A 3IHAA 5CXOA 1JTDA 4XB5A 1FR6A 2BNKA 1XHBA 3S4XA 5E2GA 2DZOB 2OSUA 2ZC4B 3SOAA 4L8OA 4U3TA 2IA7A 1KE0A 2P5TA 4QWTA 2ZJ9A 2G2WA 4N6LA 1MWSA 1TFOA 4LY6A 1MX0A 1IVXA 2I9WA 4IBRA 3VP3A 3HLCA 4LJ5A 3QNCA 5AEWB 2B24B 3UNLA 4AKZA 5I94A 2Y2LA 3FWLA 5CGSA 2INXA 4D81A 4GKJM 2P09A 3MKFA 3PCSA 4EBNA 3A46A 4DR7M 3FG1A 1ZG4A 3MZDA 1LOXA 3LTBA 4NREA 1Q42A 2Y2OA 3KFUG 4Z6YA 2HCBA 4LJ6A 4LEHA 2LH0A 1YLZA 2P9VA 4WBGA 1IN7A 1VQL3 4OQGA 4DR3M 5CGXA 1QVF2 3LH4A 1M40A 2YFQA 4LJAA 1ALQA 3U6EA 5EXSA 3WDGB 5FLXS 3CF0A 3E2LA 3W4PA 1TEMA 1IXSB 5D82A 5CEDA 3RE8A 1SXJE 4G4OA 1TIJA 3DMCA 3O3VA 2ZQ8A 4DKIA 4GMQA 3GRRA 2R65A 2DWNA 1OGZA 3FF0A 1MPLA 1OGXA 3IHBA 3PZWA 4LGQA 3UPPA 5E6JA 1GKIA 3SS4A 3HLGA 1BLSA 2ML5A 5STDA 4DDSA 1AVKA 3U61B 3V5MA 1BT5A 3MXRA 1LV7A 3HKPA 5AQ7A 3VP0A 3FKWA 3HIGA 4BB9A 2ZBKB 1XGIA 2C5WB 4Y0TA 4NXNM 3BFEA 5EJCA 1L2CA 3GRDA 1ULIB 2XSHB 3BFGA 3DFZA 1KFVA 3Q82A 1D6UA 4GDNA 2CWVA 2ZC6B 4FSFA 5CERA 3SX1A 2K54A 3C58A 2KCDA 3IF5A 4PEJA 2FFJA 4BD1A 2KRUA 3PTEA 2OLUA 4AKGA 4EYCA 3SH9A 3HGIA 3GR2A 1E9RA 3B9PA 3G16A 2XGNA 1OJLA 2RGHA 3KZTA 4GIPA 2YQZA 4OOYA