2XFTA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
425
structure length
418
Chain Sequence
TPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 139
structure length 418
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xftA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xftA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xftA02
2Y2JA 3SOIA 4GZBA 4OPQA 1HVBA 5AQ7A 3W4PA 2XFSA 4Q8IA 4MLLA 3Q1FA 2HPBA 3HLGA 1JVJA 4EWFA 5KZHA 5A91A 4KQRA 5CTMA 5GHZA 3P09A 4RYEA 1ONHA 1BLSA 4QD4A 3FKWA 4OPZA 4MNRA 3C4PA 2EFXA 1J9MA 3UDFA 3BLSA 3G35A 1BT5A 2XH9A 2Y2LA 4BD0A 3VFHA 5TFQA 4YINA 4JXSA 2A49A 2Q9MA 3CG5A 3A3EA 3UPNA 3WS1A 2J9PA 4BENA 1BULA 3CJMA 4X69A 4A5RA 3CZDA 2J8YA 4LCLA 5A90A 1S0WA 4S2PA 1K54A 1IELA 4P6BA 5KSHA 1ERMA 1G6AA 1IEMA 3AGDA 4QY5A 3AGEA 2XEPA 1CEGA 1O7EA 1XP4A 1FR6A 1WE4A 1IYOA 3Q7VB 4N1HA 3S22A 1LHYA 3UNWA 3V3SA 4RA7A 1YM1A 1KGEA 3O88A 2Y91A 3UDXA 4PM5A 5KMWA 5F82A 5M18A 2Y2GA 2Y4AA 5F1FA 1BUEA 1LI9A 1K6RA 5GL9A 1IKIA 2H0TA 5FI2A 5CEDA 1Q2PA 2Y2OA 4KZAA 2XK1A 3Q7ZA 1YT4A 4WEKA 5CHJA 1K4EA 5EOEA 1HD8A 2E8IA 1YLTA 3MZFA 1K56A 2G2UA 3NDEA 4H8RA 1PWDA 2X71A 4JF4A 4LENA 4XUXA 1JWVA 1KE4A 2ZD8A 2VGJA 4X68A 5FQJA 1WYBA 3ZG5A 2JC7A 5IHVA 1K56D 4NETA 1FCMA 2QZ6A 2V2FF 3BRMA 2ZC5B 3Q07A 3MXSA 5HL1A 5FQMA 2ZC7A 2XGNA 4KZ3A 1YLWA 4KZ6A 1PW1A 3C7UA 3LY4A 4UA7A 5HARA 2XQZA 3BEBA 3UE0A 5FASA 5DF7A 2Y2PA 3W8KA 1RCJA 3HUOA 2HP9A 5FAQA 2WGWB 4R3BA 2J7VA 1ZG4A 1LL5A 3GR2A 4S2OA 4PM8A 4ZTKA 4BJPA 3MKFA 2ZQ7A 2C6WB 3G32A 1YLJA 1I2WA 1ES5A 4MBFA 4DRTA 4GB7A 1JWPA 4LV0A 4OPYA 1W5DA 3JYIA 1VM1A 5DTKA 4BL2A 4O7DA 1NXYA 4KZ7A 5CRFA 1YLZA 4PM7A 5EPHA 3FZCA 4MBKA 3BFFA 1FSWA 4WELA 4C75A 3GMWA 2Y2NA 3DWKA 4KENB 4QY6A 3UDIA 3HLFA 3ZGAB 4ZDXA 4X56A 5JYOA 5EOOA 3MZDA 4WMCD 4LCMA 5AQBA 3ZCZA 1QMEA 1Z6FA 2P9VB 2HDRA 4S2MA 3ZHHA 1XPBA 4EBNA 4DXBA 5A92A 4CJNA 3NDGA 3DTMA 3HLDA 3IF6A 1W8QA 2WZZA 1U60A 1XXMA 3VSKA 3WS2A 3PBTA 5CGWA 4R23A 3N8SA 5CTNA 3ZVTA 2ZQAA 4IBRA 1YLPA 3G31A 3B3XA 4EV4A 1ZG6A 5F1GA 5DVAA 2H5SA 2XR0A 4B4ZA 1CI9A 4DE2A 4QB8A 3GV9A 4UHUA 4DDSA 3MZEA 3P98A 2H10A 5CHMA 1NYYA 1EROA 4OQIA 1K57C 4BLMA 5CGSA 4HBUA 4N9KA 1KDWA 3VP4A 2JCHA 2ZJ9A 3G2ZA 3M2JA 4JPMA 4P85A 2ZC6B 4GDNA 4GNUA 4R4SA 2WKEA 2ZM2A 4Y0TA 4UAAA 3EQUA 1MWTA 2EXAA 1WYCA 1BLCA 4KQOA 1XKZA 5FQQA 5CERA 4QU3A 3NIAA 1ES2A 2ZQ9A 5E2FA 3W4QA 3TOIA 2I72A 1XGJA 2WKHA 1OMEA 3OCNA 5FAOA 5HFOA 3N4IA 2ZC3B 4KG2A 5D3OA 1K55C 1SDNA 3E2LA 2WAEA 3MKEA 1L0DA 3HVFA 5G18A 1TDGA 2ZMAA 3HUNA 1FR1A 3NBLA 5CEBA 1FOFA 1FCNA 5CECA 1YMXA 3M6HA 3QNBA 5FQ9A 1PI5A 3LO7A 3G4PA 2WGIA 4GKUA 1JTGA 4KZ5A 3S4XA 4R3JA 3D4FA 5BOHA 4GD6A 4FSFA 5FDHA 3O87A 3A3FA 4KG5A 3IWOA 3N8LA 1GHMA 4XUZA 3O3VA 4CPKA 3MFDA 1JTDA 1TVFA 3WS4A 2Y2MA 3Q81A 1L0EA 5F83A 1BLPA 1TEMA 2OV5A 3FYZA 5GLBA 3SS5A 4U0XA 2PU4A 1E4DA 3BLMA 4M3KA 2XD5A 2XD1A 4WZ5A 3BFEA 1MWSA 4EBLA 4E3IA 1PYYA 5FATA 2HP5A 1CI8A 5M1AA 3ITBA 4OOYA 3Q7VA 3W4OA 4S2NC 2Q9NA 1YQSA 4IVIA 2HP6A 5CHUA 4U0TA 4C6YA 4DE1A 4Y7PA 1FQGA 2DCFA 3N8RA 1K6SA 2Y2QA 4RX3A 4PPRA 4WZ4A 4K0XA 4S2NA 1KVLA 3UN7A 4HEFA 1MPLA 5KSCA 1QMFA 3VP3A 5M19A 4MEZA 4RX2A 3SS3A 3IF5A 3RXWA 1W7FA 3MBZA 3UO9A 4XXRA 3G34A 1H8YA 2P74A 4FH4A 2IWBA 1IYSA 4E6XA 3IWQA 4MBHA 4ZBEA 3AGFA 4Z9QA 3BFDA 1LI0A 3GRJA 3VP1A 2PBYA 2OSUA 4ZJ2A 3IQAA 4LV2A 3WS5A 2WUQA 2JBFA 2Z2LB 1YMSA 2XDMA 4LV1A 4BL3A 3IXDA 1MBLA 2WADA 3HLBA 3PTEA 4BQMA 3HUMA 3OPRA 1HZOA 2BG1A 1S6RA 2C5WB 4K91A 4N9LA 4OVDA 4Y0OA 3VP2A 3I7JA 1E3UA 3C4OA 3SH7A 3UPPA 5EVID 3SH9A 1K25A 1ZC2A 1GA9A 3SH8A 3HREA 2Y59A 3M2KA 4JXWA 4WZ5C 4S2KA 5GLAA 1K4FA 5E43A 2B5RA 1PIOA 1NZOA 1BLHA 4OQGA 4KQQA 2Y2KA 3ZDJA 2R9WA 2BLSA 4IBXA 1L2SA 2R9XA 1SHVA 4IEDA 3G2YA 5EUAA 1H8ZA 3A3JA 3UPOA 2Z2MB 3V50A 5EVIC 4JXGA 3MXRA 1ERQA 3DW0A 3HLWA 3BFCA 4PMAA 4DKIA 4JLFA 3OC2A 5HAQA 3ITAA 1GCEA 4WM9A 2PU2A 3PBQA 5DF9A 4OPRA 2UWXA 5FI6A 4NK3A 4ZJ3A 3IT9A 4KZBA 2HDQA 3ISGA 3ZG0A 4E3OA 1GHIA 1I5QA 5GLDA 1NYMA 1NY0A 3FKVA 4FCFA 3UE1A 1PZOA 2X01A 4N92A 5FQIA 2WYXA 1JWZA 3DWZA 3ZVWA 3PBSA 4OLGA 3VFFA 3GSGA 5E2GA 1FCOA 3HBRA 2WZXA 2RL3A 2FFYA 2H0YA 4GDBA 4WYYA 4OH0A 1PI4A 4YFMA 4JF6A 4WBGA 1L0FA 1N4OA 3ZG9B 3NCKA 2ZQDA 3GVBA 3QNCA 1KE3A 3HLCA 4UA6A 5U47A 4GN2A 3OPLA 1DY6A 2Y2IA 2WGWA 4LV3A 1K54C 3LEZA 4DE0A 4GD8A 2QPNA 4JBFA 3IH9A 1ALQA 1RGYA 1K57A 3ZG7B 2ZQ8A 1IYQA 1ESIA 2EX9A 4KZ8A 3A3IA 4EUZA 4OP8A 3NI9A 5L2FA 2WKIA 3RXXA 3RJUA 4OQHA 1W79A 2EX6A 1ESUA 1RP5A 5EE8A 1KE0A 3V39A 3VMAA 4QJGA 3C5AA 4OQ0A 5FAPA 5AQ9A 2OLUA 1ES4A 3ZNYA 4HESA 1DJAA 5HW3A 1GHPA 3VOYA 2HDUA 2JE5A 2CC1A 3V5MA 3M6BA 4F94A 4L0LA 1HTZA 2ZM0A 3WWXA 1BTLA 3PBNA 2ZQCA 2A3UA 1Q2QA 3UY6A 4IVKA 4DF6A 1H5XA 1IYPA 3LCEA 2EFUA 1W8YA 3NC8A 1GA0A 3WS0A 1K55A 1NZUA 3E2KA 4OP5A 1PW8A 2ZM8A 5EVIB 4OONA 5FQKA 4U3TA 2HDSA 2EX2A 1E25A 1E3UD 5A93A 1NRFA 2V1ZA 3N7WA 3UE3A 3ZFZA 4JXVA 3VP0A 1ZKJA 1PZPA 5FA7A 3IXBA 2WGVA 1NJ4A 1EI5A 3G30A 4JF5A 4S2JA 2FFFB 1DJCA 5GLCA 4KZ9A 4E3JA 1CK3A 1KGFA 3BYDA 5EVIA 1MWUA 3A3DA 3EQVA 1VQQA 3IHAA 4K0WA 5DTTA 5CXWA 3FV7A 3IHBA 4R1GA 3GTCA 5DF8A 4E6WA 4R0QA 5EVLA 1M6KA 3PAEA 3O86A 5HAIA 2RCXA 3Q82A 5FSRA 4DDYA 4D2OA 3TSGA 4DE3A 1MWRA 4Y0UA 3OZHA 4E3KA 1I2SA 3IF6C 1M40A 1XA7A 1RGZA 2J9OA 1SKFA 1BZAA 4QHCA 1ONGA 4ZAMA 5TGFA 1XA1A 2EX8A 1O07A 2V20A 2IWDA 3SS4A 2VGKA 3PBOA 1G68A 5J8XA 1EWZA 2XLNA 4X53A 1DJBA 4FD8A 4EQIA 2DNSA 5DTSA 3VSLA 3S1YA 4S2IA 3BECA 5E2EA 2G2WA 4OOMA 5I94A 2X02A 3HLEA 3FWLA 5JYPA 5GHXA 4OKPA 5TR7A 2XFTA 1KDSA 1YLYA 1Y54A 1LL9A 1C3BA 4FH2A 5EECA 5FI7A 4GOGA 4P0MA 4ID4A 4JKTA 4B4XA 4B88A 4KG6A 1CEFA 4DXCA 2Y55A 2XF3A 1MY8A 3V3RA 3WRZA 4E3NA 2DRWA 4OLDA 4X6TA 1MXOA 3ZG8B 4RVAA 3OPPA 3IWIA 1L0GA 3C7VA 3IXGA 4HBTA 2EXBA 5E2HA 5HX9A 3HL9A 3IXHA 5CGXA 1BSGA 2IWCA 3PBRA 2P9VA 2QMIA 3QHYA 1KVMA 4EBPA 2GDNA 3IF6B 2WK0A 4P87A 4E3MA 1AXBA 3OPHA 4R4RA 3BM6A 4PM9A 1MKIA 4WMCA 1K38A 2ZLYA 5AQAA 1SCWA 3CMZA 1XGIA 3GQZA 3IH8A 3VOZA 3NY4A 4C3QA 4WEJA 4BD1A 4X55A 1N9BA 3ZNTA 4ZJ1A 1XX2A 1SDEA 3N6IA 3TG9A 4E3LA 3PAGA 1IKGA 1PWGA 2Y2HA 4S2LA 2OLVA 4N1XA 2ZC4B 1KGGA 3WRTA 4KZ4A 4OOLA 1ES3A 1LLBA 2WAFA 3LY3A 4UA9A 4PM6A 5GHYA 5HAPA 1TDLA 1FSYA 3OCLA 1PWCA 3BFGA
chains in the Genus database with same CATH superfamily
2KW0A 3TWMA 4OVZA 1HVBA 2V0WA 4OPQA 4WF0A 5FTMA 1QMAA 5AQ7A 1JZOA 2HGVA 3BNDA 3Q1FA 2Z3XA 4HZBB 1JVJA 1EFUB 1D0LA 1GD4A 2UGIA 5LC6A 3MS6A 3AMOA 5EXSA 1OKSA 5FTJA 3BW6A 4OPZA 3C4PA 1N8QA 3UDFA 1E97A 4LF9M 4WP5A 2XH9A 4NXMM 1ZS7A 2Y2LA 4BD0A 3SMSA 1RTUA 2B18A 3T4LA 2A49A 2HHHM 4GIPA 3NOUC 2M7OA 2J9PA 1BULA 1OIPA 3KIIA 3CJMA 4A5RA 2F4VM 2QJ7A 3TQSA 3PNVA 2EO2A 2W0NA 3M8CA 2FNQA 1O7MB 3L9KA 1OCVA 5JI3E 5CLKA 3Q8XA 1OACA 2F4YA 2XEPA 1CEGA 1O7EA 3ZYTA 1DYUA 1O7NB 4XDVA 4HJLB 1DP6A 4HM5B 1LHYA 3V3SA 3B42A 4CIZA 2Y2GA 1LI9A 4EU0A 3NV0A 1GOYA 3A76A 3SYUA 1YSPA 5GL9A 2H0TA 5FI2A 1Q2PA 2VQEM 1YT4A 4YHHM 4BTXA 1Z1SA 1DP9A 2K7SA 3SFZA 4O2HA 1EG9B 1ACFA 2E8IA 2WKRA 4JF4A 3T15A 1VQ93 4LENA 4N6UA 1UDII 5FQJA 1G5UA 3R7WB 2OO9A 3ZG5A 5JPUA 3ZC7B 2QZ6A 4GMQA 2V2FF 2RNTA 5CXOA 3VF1A 3CCV3 4MJDA 1XMQM 2WSCF 4G1MB 3JVCA 4KZ6A 1PW1A 4I4LA 4IBDA 1OH0A 5HARA 5FASA 4FW9A 3WA2X 1BNJA 3W8KA 4NSOB 3S28A 2WGWB 1ZG4A 3FKAA 4PM8A 2OTL3 5IERA 4XBXA 1T19A 5IW9A 1S4RA 5DJTA 3U5ZB 1CYVA 4DRTA 4HNBA 4JI5M 2KRKA 4LV0A 2H5XA 1RHLA 3NBBA 3D5GA 1SXJE 4NXBA 1OJGA 4IBJA 1WGLA 3SOAA 3BNCA 4O7DA 5EPHA 2KF5A 2B3TA 3FZCA 3GRUA 4FCZA 2DAKA 3DWKA 4LMIA 1N78A 2FOIC 3UZUA 1GO5A 4KENB 1IDPA 1QANA 3D9YA 5JYOA 5HOHA 3MZDA 1M1K4 2B95A 1T43A 1AIPC 2HWJA 2HDRA 3GZXB 1XPBA 4CJNA 3X41A 3IF6A 3LYXA 3TJZC 4P6ZS 1U60A 4OK0A 2IUKA 4Q7JA 1FUSA 1PFLA 3ZVTA 3FE3A 2YKFA 3UL5A 3FRIA 3B3XA 4DJ3A 2RBIA 1ZG6A 2CC3A 2H5SA 4R4KA 2XR0A 4X1LA 4WN5A 3WR2A 3K3CA 3IX8A 5KQ8A 2IY2A 2OWJA 3LQRA 4UHUA 3MZEA 4ETZA 2H10A 5EVHA 5CHMA 3DZLA 3DM8A 4HJ6A 4BLMA 1K57C 2CWBA 3HY5A 5CGSA 1VDDA 3X40A 4N9KA 6STDA 5L10A 4WUJA 3VP4A 1EKMA 1YJN3 2ZJ9A 3G2ZA 3M2JA 1F5MA 1BSAA 2FNAA 1TRPA 2CWVA 2ZC6B 1JR3E 3E98A 4GDNA 1C1KA 1IU7A 2MF7A 1MWTA 1XNRM 3T1HM 1AQZA 3WOEB 2CFGA 1KFVA 4KQOA 4FD2A 2RSXA 3WODG 2O25A 4QU3A 4MN7A 3NIAA 5E2FA 4DV6M 1DO0A 2XSHB 2OOAA 3KS8A 3W4QA 3W0FA 1I94M 3T8NA 3OCNA 3U1WA 2UV0E 3T4KA 1NHWC 2UXBM 1K0KA 2OCTA 1LL8A 1Y4OA 5FAOA 4RNTA 1T6OA 5D3OA 3E2LA 3ICYA 1VEUB 1W00A 3MPHA 2D7HA 3RGSA 4RNAA 3J7AS 4R7GA 4BU4A 3L28A 5HZHA 1F4IA 1NNJA 2ZMAA 3HUNA 2O9BA 5J4EA 1YMXA 3GLFB 3QNBA 5FQ9A 1DVCA 3KN4A 3K5TA 5IT5A 2Y20A 3G4PA 2WSEF 5LMUM 4LGQA 1TH2A 4KT0F 4WP2A 3S4XA 2O01F 4IPBA 2MROB 5C5KA 2XSZA 2L7HA 1OTRA 3L7HA 2BIRA 3UGJA 2LHCA 3MFDA 1O7GB 2HAKA 3QP4A 3U6SA 2Y2MA 5A8BA 3Q81A 2AAEA 2RFRA 5F83A 5J3WA 3FLJA 1N9LA 3FYZA 1W63M 3L27A 1BRSA 1AV4A 1I2EA 2PU4A 1BIRA 3BLMA 1B2XA 2J3TD 5KP3A 4DV3M 3T38A 2BNGA 2XD5A 3BFEA 3KYEA 4WZ5A 3NBIA 1IT7A 1PYYA 5FATA 2HP5A 4QOSA 1D0MA 4S2NC 2SBLA 1YQSA 2DHRA 2VGLM 2JY8A 4HAAA 3K0ZA 4GJ4A 3U6DA 1FQGA 2W1TA 1OTBA 5EEOA 4FR9A 4WZ4A 1BSEA 4K0XA 3Q3FA 1KVLA 2K0BX 3CU3A 3ZCBB 2ZHXB 2APLA 5CF2A 1GSXA 4KHPM 5IU1A 1YIJ3 4B3SM 3MBZA 2HL7A 3F1OA 4XXRA 3VOLA 2L1SA 3FUVA 1OTDA 2IUJA 4R3AA 1QZEA 5IT9S 4PD2A 4MBHA 2J80A 4E6XA 3JUPA 2JY5A 2PBYA 2CH9A 4LRSA 1IY0A 3X3YA 2WUQA 4NRVA 3IBJA 2C4BA 3HLBA 1GSPA 3KOZE 1RCLA 1OIZA 1S6RA 1TDZA 3RGRA 3QP6A 3OBFA 1UCLA 3I01M 4CHTB 1FGQA 1QALA 3DGLA 4I81A 3SH7A 4DR7M 3UPPA 3T4JA 4X64M 1K25A 4RKUF 1O7HB 2HOHA 5H37D 1F2KA 4JXWA 1NWWA 1B2MA 2YR0A 4L8OA 2V6ZM 5AIIA 1OUNA 4OQGA 2R9WA 1PJSA 3U6PA 1L2SA 3PHYA 5ITRA 1SHVA 5TBMB 1TGUA 1MNLA 4J5GA 3A3JA 4HJ4A 5FEFA 4LGWA 2Z2MB 3SW1A 2E2VA 2HMLB 2CHVA 2P09A 4K61A 5AIFA 2D7GA 5KPZA 2MGWA 3DW0A 3VE3A 3HLWA 1U8CB 2CHCA 4PMAA 1Z09A 4DKIA 3A0SA 1WMOA 2UUGC 4QWTA 4WM9A 2PU2A 1VQO3 4PAUA 4GLQA 3SAWA 4AW4A 1YVSA 2UWXA 3KCHA 4ZJ3A 3WMDA 3FF2A 2HDQA 3ISGA 3GLFA 1YAXA 2W3FA 3JUNA 3U60A 3Q90A 1NYMA 1NY0A 3FKVA 3VV4A 1TH4A 3D8BA 1JWZA 3ZVWA 1FCOA 2RGOA 3U6LA 2W2CA 2W1TB 2RL3A 1TFKA 4OH0A 4JI6M 3NCKA 1VETB 2ZQDA 4KFFA 3C58A 1KE3A 4UA6A 2CWUA 3OPLA 2CE7A 2HMJB 2WGWA 1MX0A 3UB9A 3DZDA 2JP7A 3CNMA 5BIRA 3DOAA 4IBCA 3LEZA 4GS9B 2KRUA 3UB7A 1HNWM 4Y13A 4MH0E 4LF6M 2Y21A 5G1KA 3V99A 1K734 3ZG7B 1MOLA 4XBOA 4M9XA 4KZ8A 1DMQA 4R80A 3PZWA 3LCVB 4WFOA 4OP8A 4NEED 4NREA 4DV5M 3T1XA 1W79A 2EX6A 1ESUA 5CX7A 4OVZB 3VMAA 5E26A 4GEWA 4EXOA 1FUTA 5DYGA 3EBYA 3V98A 1ES4A 1STZA 4HESA 2VZWA 1DJAA 2O0YA 4ME4A 4DV0M 1QDTA 2O99A 1ZHHB 3HU1A 2BMQB 4HI4A 1QAFA 4L0LA 4BTYA 3WWXA 3FTFA 3FUWA 1V74A 1ORYB 1KYIA 5AIGA 3RGAA 3CPW2 2A3UA 1OTIA 3L0RA 1T2IA 4H8RA 3IPTA 1Z5AA 1TS8A 1IYPA 4IVKA 4EEPA 1G6OA 1OGXA 5FDSA 4NRWA 1E9SA 3HKPA 1KWIA 4OONA 3SAVA 4L8RC 2R4EA 2HDSA 5HGRA 2P04A 5AVEA 3VE4A 3AHSA 4N6MA 5A93A 1D0KA 3CCU3 1WR1B 2EA0A 3ZFZA 3N7WA 1Y4KA 1HNZM 4HOIA 3DTKA 1VQK3 2Z4SA 4ANRA 3E9SA 1JR3D 3UE6A 4A3VB 2FFFB 4KZ9A 1IYYA 5G4ZA 3U97A 3UB6A 2PZVA 3EX9A 3IHAA 4PT5A 3LMMA 3RGPA 1AVLA 3LH4A 1T1BA 1UGUA 3FV7A 1YNVX 4K0WA 5CXWA 5DF8A 2R18A 5DTTA 2VQFM 4E6WA 1N36M 5EQLA 4G4QA 2V9AA 5HAIA 3Q82A 3LVWA 3OZHA 3LIEA 2X4AA 3SX1A 3KSXA 4N6NB 3M6AA 2W27A 1RGZA 3VDPA 1SKFA 1LOVA 1XA1A 1TDLA 3EN1B 1LSWA 1D6UA 1O07A 2EX8A 3AGOA 1OFIA 2CG1A 6RNTA 1VB6A 2QJ5A 5J8XA 4EQIA 1DGBA 4I5SA 1TUHA 3KFUG 4HYZA 4S2IA 3THGA 5E2EA 1N9NA 5I94A 1V9ZA 1KDSA 1Y54A 2V8FA 1PJIA 3CCM3 4WYKB 4GOGA 4IBFA 5FI7A 5IZ7D 3QK9A 4ID4A 4RZMA 3EEAA 1RRLA 4X6TA 1XXHB 2Z76A 1MXOA 4L78A 1AR0A 1JKGB 3OPPA 4OU7A 3IWIA 4RVAA 1L0GA 2D7EA 3GLGB 2KAAA 3G0KA 2XSSA 2OQ4A 4MEIA 1RGKA 1QAOA 1GY7A 3HL9A 3UMDA 1WQLB 2WZJA 1BSGA 3WA3A 3K2NA 4LPZA 4DR2M 3DTEA 1A2KA 3H3HA 2P9VA 3QHYA 3HGIA 3G6OA 4CISA 1ASKA 2BASA 2A24B 3X3XA 1IBLM 5BXQA 4LYLB 1IVWA 1BVIA 1G0TA 1VQN3 4O02B 2H0IA 3GQZA 2BTFP 2PT7A 3TE6A 4X55A 2JZ0A 3EN8A 4ZJ1A 4ILFA 1IKGA 2Y2HA 3S67A 3KKGA 2ZC4B 3S7OA 1RN4A 1OQYA 2OOLA 2WAFA 4UA9A 2XA7M 4XBTA 4LY6A 3UK6A 2Y2JA 4JGPA 4GZBA 2BNKA 3W4PA 1L8QA 3FPVA 3HZJA 2XRXB 3HLGA 4EWFA 2ACGA 2OWHA 3LYGA 3GLGE 1U5OA 1NHGC 1YGEA 4EERA 5K5BA 4RYEA 5G2GA 3KSGA 4QD4A 1TDHA 4MNRA 2EFXA 1J9MA 5D82A 3CCJ3 5BR8M 2P5TA 4B7HA 1Q864 1BT5A 1GKIA 2VK3A 3VFHA 3K92A 4N6TA 4KQDA 4MMNA 3J7BA 2O5RA 3SLUA 3CG5A 3A3EA 1LRAA 4IUHA 4BENA 1IN5A 3GPXA 2P38A 3CZDA 1QAKA 1ULJB 1S0WA 1K54A 2V1CA 4LJ8A 3DTIA 3EF8A 4CDLA 3LTDA 3F9SA 1I2FA 2Z4RA 3D79A 1XWIA 4L15A 1L2BA 4NHFA 1FILA 1G6AA 3QRDA 1IEMA 1YUBA 1WE4A 4N1HA 4Q0HA 1FJGM 1YM1A 1N9OA 5D81A 4LLOB 3JUOA 5M18A 1IXZA 4O3VA 1NB5I 5F1FA 2JKGA 3OTOM 2CX1A 1L1ZA 4Y17A 1CYUA 5HDSA 4BIRA 1ZGXA 3ALAA 1MJGM 4EC6A 4WEKA 2RKOA 1D7EA 1K4EA 3GLIB 5EOEA 4L9FA 1TRQA 3MZFA 2G2UA 1D1JA 3KP0E 1QAQA 1JBRA 3IX4A 2R62A 1KE4A 3D3OA 2GU1A 1OJLA 2JC7A 1SG9A 1FCMA 2FZ0A 1JZDA 2XGLA 3BRMA 2ZC5B 1VEKA 2OQEC 4AKYA 5FQMA 3FTDA 5HL1A 2JXNA 1YIT3 2HV1A 1ZV1A 3LY4A 4UA7A 3V92A 1S3SA 1T1AA 2HP9A 3UMMA 2M1CA 1IVXA 1BRJA 1TS6A 3JVUA 1LL5A 4S2OA 4GHIB 3T1YM 3GZYB 4F3LB 2ZQ7A 4JYAM 4K1UA 4MMXB 3S29A 2C6WB 4JI8M 2YX9A 1YLJA 3BY8A 2MR9A 4MBFA 4GB7A 3UL6A 2C11A 3MKIA 5IENA 1VM1A 1ROAA 3VGNA 4BL2A 1B27A 1WMNA 1H6UA 1NXYA 4KZ7A 2L4FA 3FYCA 2XZUA 4NKPA 1VEGA 3BFFA 1FSWA 4C75A 1Z59A 4KO8A 3F40A 3U60B 1SXJD 3KOWE 1NDOB 3WOFB 4CCVA 3HLFA 3U61B 4X56A 3IG5A 1ZMWA 2R78A 1Z6FA 1XJ4A 4DXBA 3I553 3ZHHA 3U6EA 4EBNA 3NDGA 3HLDA 2OAQ1 2H0HA 4XBYA 1XXMA 3PBTA 5CGWA 4R23A 2L2DA 1GOUA 2ZQAA 2NQ8C 5CF1A 1YLPA 3G31A 2IYJA 2Y79A 3AOEA 1OHSA 3SHGB 5C18A 3QP8A 1DMNA 1KC84 5EFWA 5L8RF 4JGRA 2RRUA 2O9AA 7GSPA 4XM4A 4X2HA 1VZZA 4DE2A 1CQSA 2Q2EB 1S67L 1PGYA 2K2NA 2ZTCA 2LBCA 1EROA 4OQIA 4XB5A 1QQWA 1BUJA 2HZ5A 4IIWA 3LR3A 4L6V6 2EA9A 1T2HA 3E21A 4N3VA 4LF5M 3BXWA 2WKEA 4Y0TA 2VDBB 5IREB 2WKPA 4WL9A 1Q9EA 4KFDA 3GLHA 3JAMS 1BLCA 5FQQA 5CERA 3W2ZA 1G96A 4BMWA 1ES2A 1H3QA 4DN0A 4GW9A 4BBUA 3T4SA 1XGJA 2WKHA 2Q07A 1OMEA 1EEJA 3CF6E 3EB8A 5F3WA 2UUBM 4FCJA 3MKEA 3JR5A 3NQYA 3HVFA 4YNRA 5AI1A 3VKHA 3K3DA 3LICA 1ODVA 5G18A 4IT7A 3L29A 1TDGA 3RTYA 5IF6A 3LI8A 4FWDA 5EV0A 1FCNA 4AG6A 1R5LA 1WNHA 4LRZE 1IVUA 3QAUA 1LTMA 2Z7JA 3CUEA 4Q0IA 3FRHA 4FCVA 4GKUA 3HHWA 2ML5A 1UUVB 2Y0QA 1IVVA 1JN5B 3A0VA 2J7OA 4GD6A 4M9SA 1B20A 1IQ8A 3N8LA 1E3VA 1I0VA 1NRJA 1YSQA 3NJAA 3BBZA 5G4YA 2LH0A 2W56B 2VF8A 3E46A 4GS9A 2JUJA 3MHVC 1LOWA 1VG5A 2QWSA 3MR0A 2J3WA 1RGGA 1ZMUA 4QHTA 3P01A 2M7UA 2JKRM 2W9PA 2GEYA 2NUTC 2QKPA 4LJAA 2OV5A 4U0XA 1E4DA 2HMMB 4M3KA 1S1YA 2XD1A 5LC7A 3CCR3 2DWLA 1XB2B 1V92A 1MN3A 1V9YA 4OOYA 5DFXA 2JN7A 3Q7VA 4IVIA 2HCBA 3VK8A 2VLGA 3JVVA 4MCWA 3EC9A 1CJFA 4JXJA 2XRNA 4DE1A 1QUTA 3EIEA 1X1XA 3AHWA 3SARA 3LXUX 3N8RA 5HPFA 2Y2QA 3DA1A 4RX3A 4KFEA 1W01A 4LEHA 4PPRA 4S2NA 5HL6A 2HJ9C 1IBKM 4AKIA 2ZBBA 1FZUA 2CUZA 5KSCA 1UI8A 1TF0B 4L4UA 1BRKA 1QMFA 2Z7AA 4RX2A 2J7NA 2KF6A 3SS3A 3MMPA 3KSIA 3IF5A 1W7FA 1B21A 2D42A 4PKYA 3UO9A 1H8YA 2P74A 3KXEC 3NOPC 3S7PA 5FEGA 2CEAA 3LFVA 1PJQA 3R4KA 3AGFA 4H6JA 4ZBEA 1NNUC 4Z9QA 3VP1A 3KE7A 1X1YA 2INWA 4QNRA 1IY1A 1HU9A 4LV2A 4DJ2A 4BL3A 3IXDA 2WADA 4LJ5A 3PTEA 5ELJA 3HUMA 3OPRA 3TL4X 2YQZA 3CMA3 3EBTA 2ZL1B 3W68A 4K08A 1E3UA 3C4OA 1R4CA 1IN8A 5EVID 3PXPA 1S66L 3S5CA 2O9UX 2F5MA 4WZ5C 4HZ9B 1VQ63 2VJWA 5E43A 2B5RA 2RCDA 1PIOA 2PYPA 5IWAM 4DV7M 3GAXA 1BLHA 4KQQA 1FA3A 2M5ZA 3ZDJA 7STDA 3T1RA 4IBXA 1E94E 4DR4M 1GYBA 2E8JA 3G2YA 4BWIA 3GPYA 3OW22 1QDRA 3V50A 4X65M 4JXGA 4GITA 3MXRA 2LWXA 3F1NA 4EEUA 1FGTA 4NC6A 3BFCA 3DGMA 4QHSA 5DF9A 2FXTA 3I563 1LSVA 4IBGA 4OPRA 3RDEA 4NK3A 3J2PB 1QUSA 1Z5CA 4IBEA 4PKYG 3H51A 2QGUA 2K6BA 4HL4A 4JV5M 2ZOIA 3GLGA 1FGMA 1PZOA 3CI6A 4N92A 3DH2A 5DFYA 4HM3B 3G713 1YI23 2B02A 2QQ8A 2P08A 4OLGA 5E2GA 2KNVA 2W6JH 1YHQ3 2ZAOA 5FL3A 1SIHA 2H0YA 3CTWB 4GDBA 4WYYA 4YFMA 4JF6A 2CW9A 4CLCA 3KSED 2FFJA 3QNCA 3HLCA 2G3QA 1G59A 4GN2A 5U47A 3RFBA 5IG4A 4MB7A 4MGYE 3SHFA 2E5LM 4GHIA 3F1PB 5IS1A 1D06A 4DE0A 4JBFA 1I3FA 3HJQA 2W04A 1ALQA 1RGYA 3PR6A 2I7PA 3CPTB 2ZQ8A 4AI6A 2R4JA 4LF4M 4MGKE 3NI9A 4DUZM 2VA0A 1RGAA 2EWWA 1X1WA 3RJUA 5AEUB 3B7QA 4IBBA 1EUIC 4OQHA 5EE8A 4EW5A 5EM0A 4QJGA 5IG0A 1L3LA 1WJ7A 5HD5A 2OLUA 1G4AE 3FZWA 1DGHB 1NVMA 1P3QQ 3LT8A 5HWWA 4PDGA 3HIGA 3MG3A 2HDUA 1EE8A 3VOYA 4ESPA 2CC1A 3V5MA 1HTZA 2ZM0A 3ZQ5A 5DJUA 1PYLA 1Q2QA 1SPUA 1H5XA 3LCEA 2EFUA 3SC3A 1DETA 4R3DA 2INXA 4G3WA 2JY7A 3WS0A 1N34M 3QP1A 4FTXA 3DBAA 2QHOB 4DV1M 4H6JB 2PD7A 2DAIA 1PW8A 1NJGA 1B2SA 5FQKA 2VGLS 1XXHE 4MM3B 4O0PA 1G71A 3TWLA 4BBTA 1Q3BA 3KSPA 3I51A 2WGVA 3G30A 3AL0C 1EI5A 3FKEA 1XFNA 4JF5A 3NBRA 3IG8A 3K9OA 5A2QS 1QVF2 3NBJA 4Y15A 3PS8A 1LOXA 5EVIA 3GRYA 4G3OA 1E9RA 2WGOA 4R1GA 3GTCA 5FSWA 5JPPA 4R0QA 2UUAM 1M6KA 2LNHC 5EP2A 3O86A 3BOSA 4LSOA 1Q40B 4DDYA 1MWRA 3BNBA 1YKDA 4Y0UA 1XNQM 4KZ1A 1M40A 2UU9M 4ZAMA 2XA7S 1ONGA 3CGWA 3BWLA 3MSHA 2I7NA 1T3TA 2V20A 3LVVA 2IWDA 3M7GA 2XLNA 1OF5A 4X53A 4FD8A 3LIAA 1CH0A 1B3SA 5DTSA 3DY5A 1J5EM 3VSLA 2XSZD 4OOMA 4HM8B 3HLEA 3V76A 4B3TM 5TJJA 4EUVA 2F99A 4WURA 1YLYA 2UUCM 2A5YB 3NDEA 5EECA 1OTAA 4ORLA 4B4XA 3HJ8A 2F5WA 2CX0A 4B88A 4Q0JA 1RGLA 3S7NA 1VQ73 4EV5A 3KW6A 2STDA 1MKMA 1LQGC 3BIRA 2JZ1A 4W5WA 2MH8A 4LFCM 2AHMA 3MSOA 2K31A 3LTCA 3HZPA 2C10A 4D80A 2QZ4A 2QBYB 4EIWA 4DV2M 2EXBA 3H7WA 1ZQ9A 3IXHA 5CGXA 5KPRA 1DMMA 4BLCA 4EBGA 3UNLA 2XLJA 2JDIH 1KVMA 1OT6A 2JKRI 1CUKA 1CF0A 1LT0A 4P87A 4E3MA 2WK0A 1KD14 2LQVA 4XK8F 3D9RA 5EP1A 3C2WA 3BM6A 4LZIA 4MDZA 1STFI 2LVQD 3GRVA 2GBXB 4G4RA 3IX3A 2OAP1 1MU5A 4LRTA 1XGIA 4KUOA 3IH8A 3VOZA 2DWZB 4WEJA 4BD1A 3O8YA 4MMZB 3ZNTA 3PAGA 5KQDA 2OLVA 1IBMM 4N1XA 1KGGA 1JB2A 3C38A 4B93A 2BWEA 1DO2A 2B1XB 5GHYA 1FSYA 4Z8XA 3IXGA 3LIBA 3BFGA 1UGIA 4S12A 3SOIA 1NB3I 3KS4A 2XFSA 2RGQA 2BMRB 3GLIE 3UB1A 4MLLA 3HWSA 1D2NA 4JRFA 3U6QA 2QYBA 1FNNA 5KZHA 3PCSA 3D5IA 2CV2A 3QP2A 4JI4M 3HK4A 3KYZA 3P09A 5BU4A 5I97A 1BLSA 3JUQA 3NHXA 1L5GB 4HP9A 4MN6A 1L2CA 5EQTA 3QYBA 3BLSA 3G35A 1VQ1A 3F7SA 4KODA 3KFQC 2R4IA 5TFQA 2QBYA 1IN7A 2ZL1A 4NOOB 3A98B 3SASA 3IMAB 1KSFX 2JWSA 3AJIB 3KO6A 1TS0A 4LJ6A 5FGOA 1Q814 4Y2FA 5AJGA 4B3RM 2J8YA 1K28A 3IJEB 2XROA 3L2AA 4HKVB 1I4WA 5A0OB 4S2PA 1A0KA 1IELA 2ZL8A 4HM0B 1RRHA 5KSHA 1ZO2A 2P0MA 5TGNA 1RNTA 1IM2A 3DUKA 3LTAA 2VF7A 3NWLA 2CFLA 4QY5A 3DGOA 3AGEA 3NM2A 3Q7VB 1XP4A 3S22A 1IYOA 1E32A 3UNWA 4RA7A 1JN5A 2YFLB 2ZM6M 3JPUA 3MQOA 3UDXA 4PM5A 5KMWA 5F82A 3UJMA 2DVWB 2Y4AA 1BUEA 2HF6A 1OHPA 4FWGA 3CC23 5CEDA 3B8LA 2Y2OA 2XK1A 3NXJA 2F56A 5CHJA 2JKFA 3FUXA 2P05A 4IJEA 3TWKA 3LUQA 4LJ4A 1K56A 2VEAA 4XUXA 1PWDA 1JWVA 2ZD8A 3MQQA 4X68A 2M60A 5IHVA 5GKNA 4KLNA 2PD8A 4EXRA 3I4YA 2C96A 2ZC7A 1IXSA 1YLWA 1RGFA 2Y8HA 3UE0A 2XQZA 3BEBA 5DF7A 2QENA 4JI7M 2CRUA 2CMNA 3C30A 3HUOA 1WGNA 5FAQA 1N32M 4R3BA 4AFIA 4YWZA 3GR2A 2CP8A 3MKFA 4BJPA 4PCZA 3GO8A 1ES5A 1W5DA 3LR0A 4GSPA 2QHKA 1LOYA 2W3DA 1IT8A 3MQ0A 4MGHA 5CRFA 1YLZA 3B4OA 4YOFA 2H1RA 3IBRA 3R8FA 2KDLA 1BU4A 1F8NA 2Y2NA 3U2AA 3MK6A 3ZGAB 4ZDXA 4G4OA 5EOOA 4K1VA 1G8PA 4LCMA 5AQBA 1QMEA 2P9VB 4MGZE 4L9EA 4S2MA 1VHMA 3DTMA 3LQQA 1Z5BA 2LVPC 1W8QA 3VSKA 4EQ1A 3JUMA 1N77A 5CTNA 2CFDA 1WTHA 2K0MA 4RF0A 1TIJA 2DNAA 2YFJB 4EV4A 2L6OA 1PJJA 4LCBA 1OT9A 5F1GA 4NG2A 5DNYA 4BB9A 4J8TA 2GQFA 1JKGA 2K54A 5HWTA 2CV0A 4QB8A 5EVEA 3P98A 3SAUA 4NPBA 3G8ZA 3ULFA 4HBUA 1TTEA 3CITA 2KHHA 4Y28F 3KZTA 1KDWA 2ZA4A 2VV8A 3D4AA 3EGDC 4X1MA 3NV0B 2UXDM 3VK7A 4GNUA 1N75A 3I4VA 2CFOA 5STDA 2ZM2A 5BVBA 2ZOHA 2AVXA 1D6ZA 1EW0A 2KF3A 1XKZA 3WHOA 4F1IA 2ZANA 3GWRA 3MMHA 1LV7A 2ZQ9A 1JRQA 1I2GA 3TOIA 2R6FA 3NQZA 5HFOA 3CCS3 3N4IA 2ZC3B 1J3WA 4JF8A 4KG2A 1K55C 1DVDA 2LB9A 3T4OA 1A5TA 4GRIA 4J5KA 4EW7A 4B7GA 1W2B2 5DFLA 5CEBA 1FR1A 5FTNA 3NBLA 2WOFA 3TRCA 1J09A 5CECA 3M6HA 3F1OB 2XSOB 2L4VA 2WGIA 1UCKA 5EP4A 2LVOC 3ECFA 3LZAA 1JTGA 5F6AA 4CLCB 4STDA 3D4FA 2K9DA 4FSFA 5FDHA 3A3FA 5HDCA 3IWOA 3H4JA 1NJI4 3ZQJA 2Y73A 1VDLA 3FD9A 4LJ9A 3O3VA 2KDKA 4CPKA 3CD63 1TS7A 1X37A 4LFBM 3MG2A 1SXJC 1HNXM 3CCQ3 3AV0A 1BAOA 3DXOA 3MG1A 5KPTA 2PR5A 2VV7A 3HI7A 1W7CA 1TEMA 1I8VA 4WLAA 5GLBA 1QYRA 1BANA 4FMCA 1LNIA 4E3IA 4X66M 1IFQA 1TD5A 4L9GA 5HSQA 3A42A 1VQM3 3ITBA 1WXQA 5G1LA 1TP6A 3T4QA 2FH5A 5BPVA 1W4NA 4FMBA 3GQ5A 4OX9M 1IXRC 3EIHA 2Y74A 2CHQA 1YJW3 1BVSA 2DCFA 2DHYA 4DV4M 1NLZA 2QPAA 3GLFE 4N6V0 3AKZA 3BLZA 1R2ZA 3F8XA 1LVNA 3CWFA 2A15A 1BNFA 4K0KM 3RXWA 4E04A 2EKKA 3K9PA 3BU4A 3G34A 1QVRA 3GP1A 2IWBA 1IYSA 3KDSE 3BFDA 1LI0A 8RNTA 2PBDP 4F2LA 4AKHA 2OSUA 3IQAA 3E4QA 2Z2LB 2XDMA 2FE8A 2QNJA 1MBLA 1S4SA 3SYKA 1XC8A 3CF2A 3PXGA 3HIIA 4BQMA 4LGYA 2BG1A 3PGBA 3VP2A 3FG4A 4K91A 4RBNA 1ZX2A 3QYEA 1M1XB 4Z6YA 3I7JA 4O8SA 2JHEA 2LXEA 1GD3A 1XJ2A 1ZC2A 5D83A 1Q39A 1GA9A 3HREA 2Y59A 2Z8YM 3Q2PA 1HT1E 4AKZA 1JBSA 5GLAA 3LT9A 1NNVA 1NZOA 3E4RA 2Y2KA 2BLSA 2R9XA 5EUAA 1H8ZA 3KX0X 4HY8A 2BO9B 1JNQA 5L09A 3NBXX 1VQ43 4DUYM 4LG2A 2Z6BA 1W5SA 2IA7A 2UX0A 3ER7A 3CC43 4GHLA 3BJNA 2KCDA 2GX5A 1Q42A 4I5QA 5DKKA 1OAOC 4JLFA 1F98A 2B24B 5HAQA 2PYRA 3CAXA 3IECA 1NV8A 5FI6A 3DFZA 3U6CA 1W6GA 4KT3B 3IT9A 3FSDA 3T8UA 5ITXA 3FG8A 1JB4A 1A67A 4KZBA 2F5NA 3ZG0A 1I5QA 1G41A 4UQIM 2I9VA 5GLDA 3F1NB 2CV1A 1RNBA 4FCFA 3UE1A 4R70A 1R2YA 4ZRRA 3K9MC 3DWZA 1P97A 4HH3A 4MMYB 3S7QA 1ISKA 1XXHA 1RGHA 1XJ6A 2JKTI 3VFFA 3HBRA 1W6CA 2WZXA 4GCZA 5IG5A 1PI4A 4NXNM 2P0XA 4WBGA 3OWUA 1L0FA 1N4OA 1S723 3GVBA 1LXEA 4G3VA 2WSFF 5KP4A 1GSVA 3Q1CA 4HBRA 4LV3A 1UCIA 3HX3A 2QA43 1K54C 2OTJ3 1OFHA 2R46A 2QPNA 5EXTA 3FCSB 4Y3IA 1AY7A 1NWZA 3HHYA 5ELUA 3PVSA 1TF1A 1JB5A 1UCJA 2HMOB 1IYQA 1ESIA 1ULIB 1Y8GA 3U61A 2W3GA 4AEQA 5L2FA 2IMJA 2WKIA 2M7VA 5TBMA 3GQ3A 3V39A 4I3AA 3A5EA 2K3DA 5AQ9A 1RN7A 4DR3M 3HX8A 1YGWA 3T12B 5HW3A 2DZNB 1GHPA 1VQ53 2WO0A 1A90A 3M6BA 4F94A 2J8XB 1BTLA 1HR0M 2ZQCA 3CUEC 1EA2A 1A2VA 2LHGA 2KX6A 3PBNA 1K9M4 2YFIB 1BSCA 3EJVA 3EEHA 5L8MA 4BTWA 1IN6A 2H28A 3NC8A 2V1UA 2WOHA 1NZUA 2DAGA 3E2KA 4OP5A 4HEOA 5EVIB 3R7WA 3GLHE 2L4RA 2EX2A 3ZH9B 1E25A 1NRFA 2E2UA 3UE3A 8CATA 1ZKJA 3CNXA 3IXBA 3MXQA 4GKKM 3SBJA 2SARA 1DJCA 2ZMFA 5F68A 5ITQA 5J7EA 3STDA 3BYDA 3FTEA 3LIFA 3A45A 1MWUA 1DGFA 3A3DA 1Q3CA 3E4PA 3EQVA 2W56A 2Z6CA 3IHBA 2HKJA 3KYQA 2YNMD 4ARZB 1MGRA 5KIZA 5EVLA 1BRGA 3PAEA 2RCXA 1BRNL 3GRDA 3TSGA 1JB0F 2L1MA 2E2TA 4GHAA 4DBGB 4DE3A 5KO3A 2L0WA 2OOVA 1UGHI 3B47A 3IF6C 4LFUA 2G8LA 1XA7A 5I5LA 1BZAA 5TGFA 2VIIA 1JBTA 4UEYA 4GHOA 4EETB 1BSDA 3SS4A 4HM1B 2VGKA 1GJSA 3GLIA 4HM4B 1O7PB 1EWZA 1B2UA 2F86B 2DNSA 1C7YA 3S1YA 3AOEC 5JYPA 2H0GA 2G2WA 4QWOA 2X02A 1IOUA 3FWLA 1BYWA 3F14A 5TR7A 1TH3A 4B7FA 1LL9A 1RN1A 3S27A 1PNEA 3DMCA 4JKTA 2C98A 4KG6A 4DXCA 2XF3A 3V67A 2MJ6A 3VFDA 2LVAA 4E3NA 3NULA 5ITUA 4QOZC 3TDGA 1VQL3 1X1UA 2DI0A 4QNMA 2C9OA 3LI9A 2LYXA 3UJNA 1RU3A 3W0LB 3EGXC 3SXXA 1SARA 3H4MA 2N35A 5E2HA 1W5TA 1GMPA 2DMWA 4HBTA 4UQIS 5HX9A 4CGYB 2GBWB 5AEWB 2IWCA 1NLYA 2C5RA 1N33M 3IS2A 3DGNA 1HJPA 4PHTA 4FCTA 5DKLA 3G6E3 4EBPA 3IF6B 2R45A 4I3IA 3HJIA 4Q53A 4R4RA 3PXMA 4WMCA 4FCWA 4FWHA 1K38A 4XT2B 5AQAA 1TR8A 2ZTDA 3CMZA 1RDSA 4I8OA 1GOVA 1UI7A 2MC8A 3NY4A 4HM7B 1WHCA 3F1PA 5EP3A 1E3RA 1N9BA 3URPA 1G3IA 1NY5A 1SXJA 1V33A 3HHZA 2OOVC 2QEX3 1K8A4 1XX2A 3T0UA 2KXGA 1PWGA 1NJFA 2O3OA 4S2LA 3C3EA 3KP1E 4H3UA 4L16A 3VSYA 1UWPX 2GU3A 5LBRA 1LLBA 3AGNA 5RNTA 3TG9A 3LY3A 1PJTA 3J27B 3UB8A 5HAPA 3OCLA 1FIKA 3UDIA 3PYPA 3FUUA 1OHOA 2Q0OA 1J7KA 4Q8IA 4WHAA 3LR4A 4HHDA 2XR8B 2HPBA 2R41A 3P7NA 5A91A 3B7CA 4B3MM 4AKGA 4KQRA 5CTMA 3EWKA 5GHZA 5MC7A 4REZA 1JJ22 3W67A 1NY6A 1L2DA 1ONHA 4P16A 2PRFA 4Y5FA 3UB5P 1HZ1A 4DR1M 3FKWA 3H82B 1OJ5A 1CQAA 4HIAA 4IHQA 4TX4A 3UMEA 1IK3A 3GLHB 4YINA 4JXSA 1ZTUA 2BJVA 2Q9MA 2AADA 3UPNA 3WS1A 2VV6A 3GECA 2FH0A 3SATA 4HOHA 3E99A 2CHGA 4NL4H 2BWBA 4X69A 5A90A 4LCLA 1IQPA 3LEQA 4ZM8A 2W3HA 3SOYA 1PU4A 4I38A 2ERCA 4Z1WA 1YJ93 4P6BA 1RGEA 1PM5A 4M0WA 1AWIA 1ERMA 4JI2M 2GZAA 3AGDA 2L09A 3EQQB 4OW0A 3T6PA 4ARZA 1FR6A 1RLSA 4XT2A 5IEPA 2KF4A 1OGZA 3O88A 1KGEA 2Y91A 5L07A 1W02A 2I9WA 3BB9A 2V1AA 3I04M 1IKIA 2KLIA 2YFQA 3G4S3 4KZAA 2XZFA 2UXCM 3Q7ZA 2JKTM 3B74A 1MGWA 2GEXA 3D72A 2CIUA 4U13A 5HDDA 1HD8A 4HM6B 1SZVA 1YLTA 1HQCA 3J81S 1I70A 1RMSA 4HM2B 5DRVA 1GLNA 2X71A 3MJ5A 3JR4A 2VGJA 1GL7A 1S5AA 1WYBA 4GL6A 1K56D 4NETA 5EXPA 4PEJA 2W1RA 5EM1A 3Q07A 1S1ZA 3MXSA 3FYDA 4CLCD 2XGNA 5HPIA 3KSFA 4KZ3A 4YY3M 3C7UA 4H61A 2D1WA 2HMKB 3FUTA 4NSRA 2Y2PA 1RCJA 1QZMA 2FS1A 3B9PA 2J7VA 2OQEA 2KXEA 2HMNB 4ZTKA 4R38A 3LW5F 4TUWA 3LOYA 4AQYM 3G32A 2R44A 2KA6B 3B89A 1I2WA 2QSFX 1IFYA 1YSYA 3PCRA 1JWPA 1ROVA 3SYLA 3JYIA 4OPYA 2R0IA 5DTKA 3O5YA 4AZFA 4PM7A 4MBKA 1O7WB 4WELA 3GMWA 4QY6A 4HVNA 1GY5A 4WMCD 1WMPA 1M904 3ZCZA 3J7Yd 1N8R4 5A92A 4GB5A 4ETXA 4EV2A 2EKFA 3B33A 2WZZA 3CF0A 1QAMA 4NXEA 3WS2A 3T50A 3FF0A 3N8SA 2X49A 3R9XB 4LJ7A 1K82A 4IBRA 2OPFA 3CCL3 7RNTA 3RNTA 5DVAA 4EYCA 4HQAA 4CLCE 5IEOA 3BQ8A 4B4ZA 1CI9A 1PY3A 3RH8B 3NHQA 4DDSA 3GV9A 5CK6A 4L8PA 3LTBA 1RJOA 1PFPA 2GNOA 2D02A 4R9KA 3HHXA 1JNUA 1NYYA 4FUWA 1US1A 3MJQA 2WGQA 1TTOA 4IJGA 3HJKA 2W03A 2JCHA 4LRYC 1EIJA 4I4KA 1TJDA 4JPMA 3PNYA 2P7JA 4P85A 4LFAM 4R4SA 3IHPA 3H9WA 4UAAA 4F3LA 3EQUA 3L26A 2EXAA 1WYCA 1VETA 1Z6TA 2QCUA 1RSNA 2JA2A 4GC9A 3WHKA 1JR3A 2DXIA 1W5ZA 3T1QB 1P9RA 3GPPA 2ZMVA 3OLOA 3QP5A 1GS3A 2IA2A 1YVBI 3OX9A 2I72A 3J80S 3FG3A 1F9IA 3GPUA 3OV4A 3CC73 1GVNA 1K3WA 1SDNA 2EJSA 3X42A 2WAEA 1C54A 1L0DA 1BNSA 4CLCC 3KOYE 2G5GX 1GMQA 2J3TC 3CLOA 1BUQA 2WKQA 5EXXA 3N6IA 3KSHA 1FOFA 4FMDA 2O9CA 2F5PA 1OAIA 4LF8M 3MHEA 1PI5A 3LO7A 3MF0A 4N6OB 3F92A 1ZAEA 2C9CA 3TPZA 2LVNC 4KZ5A 5FW5A 3NM7A 4R3JA 5BOHA 1TU5A 1D6YA 1M9GA 3ILKA 3TW8A 3O87A 4KG5A 1R4YA 3E4OA 1GMRA 5AIHA 1NU3A 1GHMA 2C99A 4WYKA 4XUZA 4M4XA 4NXFA 1RKYA 1JTDA 5KP1A 1TVFA 4D81A 3WS4A 1Q7Y4 3NUVA 1L0EA 2Z77A 1SKOB 8CHOA 1BNGA 1BLPA 3FG1A 3SS5A 3D3LA 1P0ZA 2V0UA 3N54B 2R65A 2KZUA 4JI0M 4ZPXA 3VLFB 1GABA 1CEWI 3MWZA 2PAVP 1PRQA 1MWSA 4EBLA 3A0RA 3N8BA 4K90B 5M1AA 1CI8A 3U6MA 2W82A 1W2ZA 2OWPA 3W4OA 1FW7A 2Q9NA 2HP6A 5CHUA 5JBSA 4U0TA 1SIIA 1X0OA 3WHLA 4C6YA 4Y7PA 1OTEA 1DRMA 2DKLA 4EESA 3GQ4A 1K6SA 2PR6A 1UUWB 1XFQA 3VDUA 1XHBA 1XJ3A 3UN7A 4R9LA 1MPLA 4HEFA 1QVG2 3K63A 4CQHA 3VP3A 1FGOA 3EE1A 5FTLA 2BMOB 5M19A 4RF1A 5AYRB 4MEZA 3K1JA 4JI1M 3LCUA 2LTUA 3SVAA 4MN5A 4GC5A 2JY6B 2DAMA 4FH4A 1BSBA 2KNAA 3RE8A 2F5SA 1N5HA 4RQ9A 3K8ZA 3WDGB 4LF7M 3T1SA 2DWMA 2CK3H 3GZRA 3T4TA 3IWQA 2QP9X 1R7RA 1R4GA 4RNYA 2BJWA 1G02A 3GRJA 4JI3M 4ZJ2A 4FCMA 1NSFA 3WS5A 1MC0A 3SEDA 2JBFA 4LV1A 1YMSA 4N6LA 5DYIA 1KOUA 1ZMVA 3PFIA 1HZOA 1DE3A 3C8CA 1DV0A 4AG5A 2C5WB 4OVDA 4N9LA 4Y0OA 1Q7HA 3LIDA 3OWSA 3C9PA 3G16A 4BBAA 2F5OA 3OWYA 1OPYA 4R1KA 4O8GA 3SH9A 3SH8A 5C1BA 3VKGA 2F98A 3M2KA 3LGOA 1H0MA 1EQKA 4S2KA 1K4FA 4IUKA 1GSWA 1IXSB 1IY2A 2MJ5B 9RNTA 5F69A 1K3XA 3HOHA 2EWVA 2KNZA 3TE8A 4IEDA 1B2ZA 3AOGA 3UPOA 1STDA 5EVIC 4IJFA 4II7A 1ERQA 2A24A 3MFXA 3RFWA 3FC7A 3I0YA 3NX0A 1VEJA 3ITAA 3OC2A 1GCEA 3PBQA 3EHCA 5LMNM 5HWVA 3K7CA 1UFZA 3C3DA 1Y28A 2DAEA 3GRRA 1LSXA 1I0XA 2VX8A 4E3OA 1GHIA 4M9ZA 3FH1A 1VEUA 3BNEA 4ITQA 2NUPC 3OXAA 3KVWA 1YPRA 2X01A 5FQIA 2WYXA 1UM8A 1QJGA 5AYSC 3PBSA 1C7HA 2VKSA 5FLXS 4IBKA 4HLQA 3GSGA 1MZUA 1Q02A 1HKXA 1UUGB 1IQXA 2W0QA 1BOXA 4IBIA 2FFYA 1N9JA 2JNHA 1T1CA 3ZG9B 3Q8GA 4O01A 4WWUC 4GKJM 4X62M 3GSPA 1OF5B 1DY6A 4J9AA 4FVMA 2Y2IA 1IQYA 1SKOA 1W63Q 3OOVA 5EJCA 3M0EA 3FTCA 4G4NA 1LNHA 4GD8A 4JGQA 1SXJB 3IH9A 4FOFA 1WIVA 3CXC2 4G3KA 1BNEA 1BRIA 4QPRA 1FGRA 1K57A 4FMAA 2D01A 2EX9A 4RNZA 1NV9A 3F8HA 3ROBA 3A3IA 3D8LA 4EUZA 2ZAMA 1UW1A 2CG0A 5GSPA 3LR5A 3RXXA 5E6JA 1RP5A 4WW0A 1HYFA 1KE0A 3C5AA 2F5QA 3BQAA 4OQ0A 5FAPA 2DZOB 1SJWA 4XGIA 2PDRA 3LMLA 4LZJA 4NXGA 3HCYA 3ZNYA 3EOIA 4LRXC 1GL6A 2A2LA 2J5YA 3DGYA 2DZLA 2RGHA 2JE5A 3MYTA 2HJEA 4CJ6A 1IV7A 4P6ZM 2Y0TA 2CFWA 3K2LA 3H82A 1UWNX 2BU4A 3KOXE 1V58A 4OVMA 4PDIA 4XDWA 3GDIA 1V57A 3UY6A 4DF6A 1HLUP 2V1BA 1V34A 2ZDJA 1OPXA 1W8YA 3E0YA 4BBVA 5AVFA 4B08A 2L7IA 1GA0A 1K55A 1I3IA 1WA9A 2ML6A 4I3JA 2CFKA 1A2PA 2GSPA 1HQYE 3GZBA 2ZM8A 4DMZA 4KVHA 4U3TA 2W3EA 5HD3A 2KRTA 1E3UD 2BHMA 2V1ZA 5IG3A 4JXVA 3VP0A 1KSIA 1PZPA 1PRBA 2EUCA 3B7ZA 3H7WB 5FA7A 1K41A 1NJ4A 2V8CA 4S2JA 3B4PA 1IN4A 1H8MA 5GLCA 1R6BX 4E3JA 5JI2E 1FYSA 3BY9A 1CK3A 1KGFA 4R71A 4MGIE 2GNXA 4P17A 4HH2A 1VQQA 3FPWA 1BNRA 3HU3A 4DR6M 1VQP3 1P9WA 1IV9A 1YE9A 1AUAA 1T5YA 5FTKA 5ITTA 3F7XA 5FSRA 2DENA 3AMOB 1FUWA 4D2OA 3U4LP 2KZSA 4L7KA 4E3KA 1I2SA 5ITXE 3NECA 3CME3 1T3BA 2GXFA 3FGYA 1J2BA 2J9OA 4QHCA 2KEBA 3SZTA 2K47A 2CKFB 3PBOA 3CPOA 1G68A 1TFOA 1DGHA 4B9OA 2Z6DA 1DJBA 1HT2E 4HP4A 4LZZA 3A46A 1NO1A 4LGMA 1W6YA 3BECA 5DREA 2G7UA 3CCE3 1L1TA 2KOIA 5GHXA 4OKPA 2XFTA 2LB5A 4FH2A 1GJTA 1C3BA 1N5PA 2JQ5A 2OOBA 4DR5M 4P0MA 1LQMB 1JQJC 2BT3A 1CEFA 2Y55A 3PYJA 1MY8A 4UN2B 3V3RA 3QWLA 3WRZA 4X2OA 1YLAA 1GY6A 2DRWA 4OLDA 3ZG8B 2PNCA 4JN6A 1DGGA 5ITYA 3C7VA 2ZBKB 3N9HA 3CHWP 4OUQA 1KQS2 3HJSA 2FGTA 3U5ZA 1RGCA 1G28A 2V1LA 1SQWA 2L4EA 3B7NA 2CWTA 1Q824 4M0DA 1BGSA 3KSJA 3PBRA 3AFHA 2QMIA 4HJ3A 2GDNA 1NO3A 4D60A 1XMOM 1AXBA 4I39A 6GSPA 3OPHA 4IIAA 4PM9A 1MKIA 1BRHA 2ZLYA 1AVKA 1JV2B 4GH9A 1SCWA 3NOTC 3CPTA 3X3ZA 4G6ZA 3SMPA 1Q40A 4C3QA 1T18A 3IS2B 4R6LA 2X8AA 4X25A 7CATA 1DP8A 4JGOA 1SDEA 4KUKA 4E3LA 2DWNA 2W9QA 3WRTA 1VQ83 3L25A 4KZ4A 3U6OA 4OOLA 1ES3A 5F5YA 2PHYA 2GJ3A 3DAVA 3HU2A 4D82A 2QIYA 1RCKA 1N9EA 4PM6A 1K6RA 1BNIA 2YKHA 1PWCA
chains in the Genus database with same CATH topology
2KW0A 3TWMA 4OVZA 1HVBA 4OPQA 5AQ7A 5FTMA 1QMAA 3BNDA 3Q1FA 2Z3XA 4HZBB 1JVJA 1GD4A 5LC6A 3AMOA 5EXSA 5FTJA 4OPZA 3C4PA 1N8QA 3UDFA 1E97A 4LF9M 4WP5A 2XH9A 4NXMM 2Y2LA 4BD0A 3SMSA 2A49A 2HHHM 4GIPA 2M7OA 2J9PA 1BULA 3KIIA 3CJMA 4A5RA 2F4VM 3TQSA 3PNVA 2EO2A 3M8CA 2FNQA 1O7MB 1OCVA 5JI3E 5CLKA 3Q8XA 1OACA 2XEPA 1CEGA 1O7EA 1DYUA 1O7NB 4XDVA 4HJLB 1LHYA 4HM5B 3V3SA 2Y2GA 1LI9A 3NV0A 3A76A 5GL9A 2H0TA 5FI2A 1Q2PA 2VQEM 1YT4A 4YHHM 4BTXA 1Z1SA 3SFZA 4O2HA 1EG9B 2E8IA 4JF4A 3T15A 1VQ93 4LENA 4N6UA 5FQJA 5JPUA 3ZG5A 3ZC7B 2QZ6A 4GMQA 2V2FF 5CXOA 3VF1A 3CCV3 4MJDA 1XMQM 4G1MB 3JVCA 4KZ6A 1PW1A 4I4LA 4IBDA 1OH0A 5HARA 5FASA 4FW9A 3WA2X 3W8KA 4NSOB 3S28A 2WGWB 1ZG4A 3FKAA 4PM8A 2OTL3 5IERA 4XBXA 5IW9A 3U5ZB 1CYVA 4DRTA 4JI5M 2KRKA 4LV0A 3NBBA 1SXJE 4O7DA 4IBJA 3SOAA 3BNCA 5EPHA 3FZCA 3GRUA 4FCZA 4KENB 3DWKA 4LMIA 1N78A 2FOIC 3UZUA 1IDPA 1QANA 5JYOA 3MZDA 1M1K4 2HDRA 3GZXB 1XPBA 4CJNA 3X41A 3IF6A 1U60A 4OK0A 2IUKA 3ZVTA 3UL5A 3B3XA 1ZG6A 2CC3A 2H5SA 4R4KA 2XR0A 5KQ8A 3LQRA 4UHUA 3MZEA 2H10A 5EVHA 5CHMA 3DZLA 3DM8A 4BLMA 1K57C 5CGSA 1VDDA 3X40A 4N9KA 6STDA 3VP4A 1EKMA 1YJN3 2ZJ9A 3G2ZA 3M2JA 2FNAA 2CWVA 2ZC6B 4GDNA 1C1KA 1IU7A 2MF7A 1MWTA 1XNRM 3T1HM 3WOEB 2CFGA 1KFVA 4KQOA 4FD2A 2RSXA 3WODG 4QU3A 3NIAA 5E2FA 4DV6M 1DO0A 2XSHB 3KS8A 3W4QA 3W0FA 1I94M 3T8NA 3OCNA 3U1WA 1NHWC 2UXBM 2OCTA 5FAOA 5D3OA 3E2LA 1W00A 3MPHA 2D7HA 3RGSA 4RNAA 3J7AS 4R7GA 3L28A 1NNJA 2ZMAA 3HUNA 1YMXA 3GLFB 3QNBA 5FQ9A 1DVCA 3KN4A 3K5TA 2Y20A 3G4PA 5LMUM 4LGQA 1TH2A 3S4XA 4IPBA 2XSZA 2L7HA 3UGJA 3MFDA 1O7GB 3U6SA 2Y2MA 3Q81A 2RFRA 5F83A 3FLJA 3FYZA 3L27A 1AV4A 2PU4A 3BLMA 5KP3A 4DV3M 3T38A 2BNGA 2XD5A 3BFEA 4WZ5A 3NBIA 1IT7A 1PYYA 5FATA 2HP5A 4QOSA 4S2NC 2SBLA 1YQSA 2DHRA 3K0ZA 3U6DA 1FQGA 5EEOA 4FR9A 4WZ4A 4K0XA 1KVLA 3CU3A 3ZCBB 5CF2A 4KHPM 1YIJ3 4B3SM 3MBZA 2HL7A 4XXRA 3FUVA 2IUJA 5IT9S 4PD2A 4MBHA 4E6XA 3JUPA 2PBYA 2CH9A 4LRSA 1IY0A 3X3YA 2WUQA 4NRVA 3HLBA 3KOZE 1S6RA 1TDZA 3RGRA 4CHTB 1FGQA 1QALA 3DGLA 4I81A 3SH7A 4DR7M 3UPPA 4X64M 1K25A 1O7HB 5H37D 4JXWA 1NWWA 2YR0A 4L8OA 2V6ZM 5AIIA 1OUNA 4OQGA 2R9WA 3U6PA 1L2SA 5ITRA 1SHVA 1TGUA 1MNLA 3A3JA 2Z2MB 2E2VA 2HMLB 2CHVA 4K61A 2P09A 5AIFA 2D7GA 5KPZA 3DW0A 3HLWA 1U8CB 2CHCA 4PMAA 4DKIA 1WMOA 4QWTA 4WM9A 2PU2A 1VQO3 3SAWA 4AW4A 2UWXA 4ZJ3A 3WMDA 3FF2A 2HDQA 3ISGA 3GLFA 3JUNA 3U60A 3Q90A 1NYMA 1NY0A 3FKVA 1TH4A 3D8BA 1JWZA 3ZVWA 1FCOA 2RGOA 3U6LA 2W2CA 2RL3A 1TFKA 4OH0A 4JI6M 3NCKA 2ZQDA 4KFFA 3C58A 1KE3A 4UA6A 2CWUA 3OPLA 2CE7A 2HMJB 2WGWA 1MX0A 3DZDA 3CNMA 3DOAA 4IBCA 3LEZA 2KRUA 1HNWM 4MH0E 4LF6M 2Y21A 3V99A 1K734 3ZG7B 1MOLA 4XBOA 4M9XA 4KZ8A 1DMQA 4R80A 4WFOA 3PZWA 4OP8A 4NREA 4DV5M 1W79A 2EX6A 1ESUA 3VMAA 4OVZB 5E26A 5DYGA 3EBYA 3V98A 1ES4A 4HESA 1DJAA 4DV0M 3HU1A 2BMQB 1QAFA 4L0LA 4BTYA 3WWXA 3FTFA 3FUWA 1V74A 1ORYB 1KYIA 5AIGA 3RGAA 3CPW2 2A3UA 3L0RA 4IVKA 3IPTA 1Z5AA 1IYPA 1OGXA 4NRWA 1E9SA 3HKPA 1KWIA 4OONA 3SAVA 4L8RC 2R4EA 2HDSA 5HGRA 4N6MA 5A93A 3CCU3 2EA0A 3N7WA 3ZFZA 1Y4KA 1HNZM 1VQK3 2Z4SA 3E9SA 1JR3D 4A3VB 2FFFB 4KZ9A 3U97A 2PZVA 3EX9A 3IHAA 3LH4A 4PT5A 3LMMA 3RGPA 1AVLA 4K0WA 5CXWA 3FV7A 5DTTA 5DF8A 2R18A 2VQFM 4E6WA 1N36M 5EQLA 4G4QA 5HAIA 3Q82A 3LVWA 3OZHA 2X4AA 3SX1A 3KSXA 4N6NB 3M6AA 1RGZA 3VDPA 1SKFA 1XA1A 1TDLA 3EN1B 1O07A 1D6UA 2EX8A 2CG1A 1OFIA 5J8XA 4EQIA 1DGBA 4I5SA 1TUHA 3KFUG 4HYZA 4S2IA 3THGA 5E2EA 5I94A 1KDSA 1Y54A 1PJIA 3CCM3 4WYKB 4GOGA 4IBFA 5FI7A 5IZ7D 3QK9A 4ID4A 4RZMA 1RRLA 4X6TA 1XXHB 2Z76A 1MXOA 4L78A 1AR0A 1JKGB 3OPPA 4OU7A 3IWIA 4RVAA 1L0GA 2D7EA 3GLGB 3G0KA 2OQ4A 4MEIA 1QAOA 1GY7A 3HL9A 1WQLB 1BSGA 3WA3A 4DR2M 1A2KA 3H3HA 2P9VA 3QHYA 3HGIA 4CISA 1ASKA 3X3XA 1IBLM 5BXQA 1IVWA 1VQN3 4O02B 3GQZA 3TE6A 4X55A 3EN8A 4ZJ1A 1IKGA 2Y2HA 3S67A 3KKGA 2ZC4B 2WAFA 4UA9A 4XBTA 4LY6A 3UK6A 2Y2JA 4GZBA 2BNKA 3W4PA 1L8QA 2XRXB 3HLGA 4EWFA 3LYGA 1U5OA 1NHGC 1YGEA 4RYEA 5G2GA 4QD4A 1TDHA 4MNRA 2EFXA 1J9MA 5D82A 3CCJ3 5BR8M 2P5TA 4B7HA 1Q864 1BT5A 1GKIA 3VFHA 3K92A 4N6TA 3J7BA 2O5RA 3SLUA 3CG5A 3A3EA 4BENA 1IN5A 3GPXA 2P38A 3CZDA 1QAKA 1ULJB 1S0WA 1K54A 2V1CA 4LJ8A 3EF8A 4CDLA 3LTDA 3F9SA 2Z4RA 1XWIA 4L15A 1L2BA 4NHFA 1G6AA 3QRDA 1IEMA 1YUBA 1WE4A 4N1HA 1FJGM 1YM1A 5D81A 3JUOA 5M18A 1IXZA 4O3VA 1NB5I 5F1FA 3OTOM 1L1ZA 1CYUA 3ALAA 4EC6A 4WEKA 2RKOA 1K4EA 3GLIB 5EOEA 3MZFA 2G2UA 3KP0E 1QAQA 2R62A 1KE4A 2GU1A 1OJLA 2JC7A 1FCMA 2XGLA 3BRMA 2ZC5B 2OQEC 4AKYA 5FQMA 3FTDA 5HL1A 1YIT3 3LY4A 4UA7A 3V92A 1S3SA 2HP9A 3UMMA 1IVXA 1LL5A 4S2OA 3T1YM 3GZYB 2ZQ7A 4JYAM 4K1UA 4MMXB 3S29A 2C6WB 4JI8M 2YX9A 1YLJA 4MBFA 4GB7A 3UL6A 2C11A 3MKIA 5IENA 1VM1A 1ROAA 3VGNA 4BL2A 1WMNA 1H6UA 1NXYA 4KZ7A 3FYCA 2XZUA 3BFFA 1FSWA 4C75A 1Z59A 4KO8A 3F40A 3U60B 1SXJD 3KOWE 1NDOB 3WOFB 4CCVA 3HLFA 3U61B 4X56A 3IG5A 1Z6FA 4DXBA 3I553 3ZHHA 3U6EA 4EBNA 3NDGA 3HLDA 4XBYA 1XXMA 3PBTA 5CGWA 4R23A 2ZQAA 2NQ8C 5CF1A 1YLPA 3G31A 3AOEA 1OHSA 3SHGB 5C18A 1DMNA 1KC84 4XM4A 4X2HA 1VZZA 4DE2A 1CQSA 2Q2EB 1EROA 4OQIA 4XB5A 1QQWA 4IIWA 4N3VA 4LF5M 2WKEA 4Y0TA 5IREB 4KFDA 3GLHA 3JAMS 1BLCA 5FQQA 5CERA 1G96A 1ES2A 1XGJA 2WKHA 2Q07A 1OMEA 3CF6E 3EB8A 5F3WA 2UUBM 4FCJA 3MKEA 3JR5A 3NQYA 3HVFA 5AI1A 3VKHA 5G18A 4IT7A 3L29A 1TDGA 5IF6A 4FWDA 1FCNA 4AG6A 1WNHA 1IVUA 3QAUA 2Z7JA 4FCVA 4GKUA 3HHWA 2ML5A 1UUVB 2Y0QA 1IVVA 1JN5B 2J7OA 4GD6A 4M9SA 1IQ8A 3N8LA 1E3VA 2LH0A 2W56B 3MHVC 4QHTA 2W9PA 2GEYA 4LJAA 2OV5A 4U0XA 1E4DA 2HMMB 4M3KA 2XD1A 5LC7A 3CCR3 2DWLA 4OOYA 3Q7VA 4IVIA 2HCBA 3VK8A 3EC9A 4DE1A 4JXJA 3EIEA 3SARA 3LXUX 3N8RA 2Y2QA 3DA1A 4RX3A 4KFEA 1W01A 4LEHA 4PPRA 4S2NA 1IBKM 4AKIA 2CUZA 5KSCA 1UI8A 4L4UA 1QMFA 2Z7AA 4RX2A 2J7NA 3SS3A 3IF5A 1W7FA 3UO9A 2D42A 1H8YA 2P74A 3KXEC 2CEAA 4ZBEA 3AGFA 1NNUC 4Z9QA 3VP1A 3KE7A 4QNRA 1IY1A 1HU9A 4LV2A 4BL3A 3IXDA 2WADA 4LJ5A 3PTEA 5ELJA 3HUMA 3OPRA 3TL4X 2YQZA 3CMA3 3EBTA 1E3UA 3C4OA 1R4CA 1IN8A 5EVID 3S5CA 2O9UX 4WZ5C 4HZ9B 1VQ63 5E43A 2B5RA 2RCDA 1PIOA 5IWAM 4DV7M 3GAXA 1BLHA 4KQQA 1FA3A 2M5ZA 3ZDJA 7STDA 4IBXA 1E94E 4DR4M 1GYBA 3G2YA 3GPYA 3OW22 3V50A 4X65M 4JXGA 4GITA 3MXRA 2LWXA 1FGTA 3BFCA 3DGMA 4QHSA 5DF9A 2FXTA 3I563 4OPRA 4IBGA 3RDEA 4NK3A 3J2PB 1Z5CA 4IBEA 3H51A 2QGUA 4HL4A 4JV5M 3GLGA 1FGMA 1PZOA 4N92A 4HM3B 3G713 1YI23 4OLGA 5E2GA 2W6JH 1YHQ3 2ZAOA 1SIHA 2H0YA 3CTWB 4GDBA 4WYYA 4YFMA 4JF6A 2CW9A 3KSED 2FFJA 3QNCA 3HLCA 1G59A 5U47A 4GN2A 5IG4A 4MB7A 4MGYE 3SHFA 2E5LM 4DE0A 4JBFA 3HJQA 2W04A 1ALQA 1RGYA 2I7PA 2ZQ8A 4AI6A 2R4JA 4LF4M 4MGKE 3NI9A 4DUZM 3RJUA 5AEUB 4OQHA 4IBBA 5EE8A 4QJGA 5IG0A 2OLUA 1G4AE 3FZWA 1DGHB 1NVMA 3LT8A 4PDGA 3HIGA 3MG3A 2HDUA 1EE8A 3VOYA 2CC1A 3V5MA 1HTZA 2ZM0A 1Q2QA 1SPUA 1H5XA 3LCEA 2EFUA 3SC3A 2INXA 4R3DA 3WS0A 1N34M 4DV1M 1PW8A 1NJGA 5FQKA 4MM3B 3TWLA 1Q3BA 3KSPA 3I51A 2WGVA 3G30A 3AL0C 1EI5A 3FKEA 4JF5A 3NBRA 3IG8A 5A2QS 1QVF2 3NBJA 3PS8A 1LOXA 5EVIA 3GRYA 1E9RA 2WGOA 4R1GA 3GTCA 5FSWA 5JPPA 4R0QA 2UUAM 1M6KA 2LNHC 5EP2A 3O86A 3BOSA 4LSOA 1Q40B 4DDYA 3BNBA 1MWRA 4Y0UA 1XNQM 4KZ1A 1M40A 2UU9M 4ZAMA 1ONGA 2I7NA 1T3TA 2V20A 3LVVA 2IWDA 3M7GA 2XLNA 1OF5A 4X53A 4FD8A 5DTSA 3DY5A 1J5EM 3VSLA 2XSZD 4OOMA 4HM8B 3HLEA 4B3TM 2F99A 4WURA 1YLYA 2UUCM 2A5YB 5EECA 4ORLA 4B4XA 3HJ8A 4B88A 1VQ73 4EV5A 3KW6A 2STDA 3MSOA 4W5WA 4LFCM 2AHMA 3LTCA 3HZPA 2C10A 4D80A 2QBYB 2QZ4A 4EIWA 4DV2M 2EXBA 1ZQ9A 3IXHA 5CGXA 5KPRA 1DMMA 4BLCA 4EBGA 3UNLA 2XLJA 2JDIH 1KVMA 4P87A 4E3MA 2WK0A 1KD14 2LQVA 3D9RA 5EP1A 3BM6A 4LZIA 1STFI 3GRVA 2GBXB 4G4RA 1MU5A 4LRTA 1XGIA 3IH8A 3VOZA 2DWZB 4WEJA 4BD1A 3O8YA 4MMZB 3ZNTA 3PAGA 5KQDA 2OLVA 1IBMM 4N1XA 1KGGA 1JB2A 1DO2A 2B1XB 5GHYA 1FSYA 4Z8XA 3IXGA 3BFGA 4S12A 3SOIA 1NB3I 3KS4A 2XFSA 2RGQA 2BMRB 3UB1A 4MLLA 3HWSA 1D2NA 4JRFA 3U6QA 1FNNA 5KZHA 3PCSA 2CV2A 4JI4M 3HK4A 3P09A 5I97A 1BLSA 3JUQA 3NHXA 1L5GB 1L2CA 5EQTA 3BLSA 3G35A 3F7SA 4KODA 3KFQC 2R4IA 5TFQA 2QBYA 1IN7A 4NOOB 3A98B 3SASA 3IMAB 1KSFX 3AJIB 4LJ6A 5FGOA 1Q814 4B3RM 2J8YA 1K28A 3IJEB 3L2AA 4HKVB 1I4WA 5A0OB 4S2PA 1IELA 2ZL8A 4HM0B 1RRHA 5KSHA 1ZO2A 2P0MA 5TGNA 1IM2A 3DUKA 3LTAA 3NWLA 2CFLA 4QY5A 3DGOA 3AGEA 3NM2A 3Q7VB 1XP4A 3S22A 1IYOA 1E32A 3UNWA 4RA7A 1JN5A 2YFLB 2ZM6M 3UDXA 4PM5A 5KMWA 5F82A 3UJMA 2DVWB 2Y4AA 1BUEA 1OHPA 4FWGA 3CC23 5CEDA 3B8LA 2Y2OA 2XK1A 3NXJA 5CHJA 3FUXA 2P05A 4IJEA 3TWKA 4XUXA 4LJ4A 1K56A 1PWDA 1JWVA 2ZD8A 4X68A 2M60A 5IHVA 5GKNA 4KLNA 4EXRA 3I4YA 2C96A 2ZC7A 1YLWA 3UE0A 2XQZA 3BEBA 5DF7A 2QENA 4JI7M 3HUOA 5FAQA 1N32M 4R3BA 3GR2A 4BJPA 3MKFA 4PCZA 3GO8A 1ES5A 1W5DA 1IT8A 4MGHA 5CRFA 1YLZA 3B4OA 2H1RA 3R8FA 1F8NA 2Y2NA 3MK6A 3ZGAB 4ZDXA 4G4OA 5EOOA 4K1VA 1G8PA 4LCMA 5AQBA 1QMEA 2P9VB 4MGZE 4S2MA 3DTMA 3LQQA 1Z5BA 1W8QA 3VSKA 3JUMA 1N77A 5CTNA 2CFDA 1WTHA 2K0MA 4RF0A 1TIJA 2YFJB 4EV4A 2L6OA 1PJJA 4LCBA 5F1GA 5DNYA 4BB9A 4J8TA 1JKGA 2K54A 2CV0A 4QB8A 3P98A 3SAUA 3G8ZA 4HBUA 3KZTA 1KDWA 3NV0B 2UXDM 3VK7A 4GNUA 1N75A 3I4VA 2CFOA 5STDA 2ZM2A 5BVBA 1D6ZA 1XKZA 2ZANA 3GWRA 1LV7A 2ZQ9A 1JRQA 3TOIA 3NQZA 5HFOA 3CCS3 3N4IA 2ZC3B 4JF8A 4KG2A 1K55C 1DVDA 4GRIA 4B7GA 1W2B2 5CEBA 1FR1A 5FTNA 3NBLA 2WOFA 5CECA 1J09A 3M6HA 2XSOB 2L4VA 2WGIA 5EP4A 3ECFA 1JTGA 3LZAA 4STDA 3D4FA 4FSFA 5FDHA 3A3FA 3IWOA 1NJI4 2Y73A 4LJ9A 3FD9A 3O3VA 4CPKA 3CD63 1X37A 4LFBM 3MG2A 1SXJC 1HNXM 3CCQ3 3AV0A 3DXOA 3MG1A 5KPTA 3HI7A 1W7CA 1TEMA 5GLBA 1QYRA 4FMCA 4E3IA 4X66M 3A42A 1VQM3 3ITBA 1WXQA 1TP6A 5BPVA 1W4NA 4FMBA 3GQ5A 4OX9M 1IXRC 3EIHA 2Y74A 2CHQA 1YJW3 2DCFA 4DV4M 2QPAA 4N6V0 3AKZA 3BLZA 1R2ZA 3F8XA 1LVNA 2A15A 4K0KM 3RXWA 3G34A 1QVRA 3GP1A 2IWBA 1IYSA 3KDSE 3BFDA 1LI0A 4AKHA 2OSUA 3IQAA 2Z2LB 2XDMA 2FE8A 1MBLA 3SYKA 1XC8A 3CF2A 3PXGA 3HIIA 4BQMA 4LGYA 2BG1A 3PGBA 3VP2A 3FG4A 4K91A 4RBNA 1ZX2A 1M1XB 4Z6YA 3I7JA 4O8SA 2LXEA 1GD3A 1ZC2A 5D83A 1Q39A 1GA9A 3HREA 2Y59A 3Q2PA 1HT1E 4AKZA 5GLAA 3LT9A 1NZOA 3E4RA 2Y2KA 2BLSA 2R9XA 5EUAA 1H8ZA 2BO9B 1JNQA 1VQ43 4DUYM 4LG2A 2Z6BA 1W5SA 2IA7A 2UX0A 3ER7A 3CC43 4GHLA 2KCDA 1Q42A 4JLFA 2B24B 5HAQA 5FI6A 3DFZA 3U6CA 1W6GA 3IT9A 3FSDA 3T8UA 5ITXA 4KZBA 1JB4A 1A67A 2F5NA 3ZG0A 1I5QA 1G41A 5GLDA 2CV1A 4FCFA 3UE1A 1R2YA 3K9MC 3DWZA 4MMYB 1ISKA 1XXHA 3VFFA 3HBRA 1W6CA 2WZXA 5IG5A 1PI4A 4NXNM 2P0XA 4WBGA 3OWUA 1L0FA 1N4OA 1S723 3GVBA 1LXEA 5KP4A 3Q1CA 4HBRA 4LV3A 2QA43 1K54C 2OTJ3 1OFHA 2R46A 2QPNA 5EXTA 3FCSB 3HHYA 5ELUA 3PVSA 1JB5A 1IYQA 2HMOB 1ESIA 1ULIB 3U61A 4AEQA 5L2FA 2IMJA 2WKIA 3GQ3A 3V39A 5AQ9A 1RN7A 4DR3M 3HX8A 5HW3A 2DZNB 1GHPA 1VQ53 2WO0A 1A90A 3M6BA 4F94A 1BTLA 1HR0M 2ZQCA 3PBNA 1EA2A 1A2VA 1K9M4 2YFIB 3EJVA 4BTWA 1IN6A 3NC8A 2V1UA 2WOHA 1NZUA 3E2KA 4OP5A 5EVIB 2EX2A 3ZH9B 1E25A 1NRFA 2E2UA 3UE3A 8CATA 1ZKJA 3CNXA 3IXBA 4GKKM 3SBJA 1DJCA 5ITQA 3STDA 3BYDA 3FTEA 3A45A 1MWUA 1DGFA 3A3DA 1Q3CA 3EQVA 2W56A 3IHBA 2HKJA 2YNMD 5EVLA 3PAEA 2RCXA 3GRDA 3TSGA 2E2TA 4GHAA 4DE3A 5KO3A 2OOVA 3IF6C 2G8LA 1XA7A 1BZAA 5TGFA 2VIIA 3SS4A 4HM1B 2VGKA 3GLIA 4HM4B 1O7PB 1EWZA 2F86B 2DNSA 3S1YA 3AOEC 5JYPA 2G2WA 2X02A 3FWLA 3F14A 5TR7A 1TH3A 4B7FA 1LL9A 3S27A 3DMCA 4JKTA 2C98A 4KG6A 4DXCA 2XF3A 3VFDA 4E3NA 5ITUA 4QOZC 3TDGA 1VQL3 4QNMA 2C9OA 2LYXA 3UJNA 3W0LB 3SXXA 3H4MA 5E2HA 1W5TA 4HBTA 5HX9A 4CGYB 2GBWB 5AEWB 2IWCA 2C5RA 1N33M 3DGNA 4FCTA 4EBPA 3G6E3 3IF6B 2R45A 4Q53A 4R4RA 3PXMA 4WMCA 4FCWA 4FWHA 1K38A 5AQAA 3CMZA 1UI7A 4I8OA 2MC8A 3NY4A 4HM7B 5EP3A 1E3RA 1N9BA 1G3IA 1NY5A 1SXJA 3HHZA 2OOVC 2QEX3 1K8A4 1XX2A 3N6IA 3T0UA 2KXGA 1PWGA 1NJFA 2O3OA 4S2LA 3KP1E 4H3UA 4L16A 3VSYA 2GU3A 1LLBA 3TG9A 3LY3A 3J27B 5HAPA 3OCLA 3UDIA 3FUUA 1OHOA 1J7KA 4Q8IA 4WHAA 2XR8B 2HPBA 5A91A 3B7CA 4B3MM 4AKGA 4KQRA 5CTMA 5GHZA 4REZA 1JJ22 1NY6A 1L2DA 1ONHA 4P16A 4DR1M 3FKWA 4TX4A 1IK3A 3GLHB 4YINA 4JXSA 2BJVA 2Q9MA 3UPNA 3WS1A 3SATA 3E99A 2CHGA 4NL4H 4X69A 5A90A 4LCLA 1IQPA 4ZM8A 3SOYA 1PU4A 2ERCA 1YJ93 4P6BA 1PM5A 4M0WA