2XFTA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
425
structure length
418
Chain Sequence
TPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 139
structure length 418
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xftA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xftA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xftA02
1SKFA 1FOFA 4KZ7A 5CRFA 2ZC7A 3HLBA 1SDNA 3HUOA 1DJBA 1U60A 3QNBA 4P0MA 4DXBA 1HD8A 3V39A 4OH0A 4GDNA 1VM1A 2QPNA 3G30A 1IELA 5F1GA 5HAQA 4E6XA 5KSCA 4F94A 2HP9A 1XKZA 4JLFA 5JYOA 1BZAA 1PW8A 5U47A 4Y0UA 1ES4A 4C3QA 2WK0A 1H5XA 4RX3A 3GMWA 1YLZA 2ZJ9A 3OPPA 3UE0A 4OP8A 1IYSA 3ZG9B 2Q9MA 3O86A 4OOYA 4WEJA 1E25A 4X6TA 4QJGA 3E2KA 4OOMA 1ERMA 3B3XA 1K56A 1ONHA 1JWZA 2J9PA 3HLWA 4RA7A 3VP1A 3LY3A 5JYPA 3HLGA 1FCOA 1K57A 4S2IA 2Y55A 4BD1A 3VP2A 2Y91A 4KQQA 5EOOA 5TFQA 1GA9A 1NYYA 2WZZA 1WE4A 1KGGA 2WGWA 2Y2NA 3BFGA 3M2JA 2DCFA 4EV4A 3G2YA 3PBSA 4PM8A 5EPHA 2H0YA 4ZTKA 4E6WA 2R9XA 1MWSA 1YLPA 3ZVWA 4RVAA 3RXWA 1GHPA 1FSYA 1W8QA 3SH9A 4FD8A 4FSFA 5BOHA 4X68A 4LV3A 3TSGA 1CK3A 1KVMA 2P9VA 3FWLA 5DF7A 2EXAA 3WRZA 1N9BA 3VP4A 4C75A 4ZJ2A 3G34A 1LI0A 4X53A 5A93A 1GCEA 2HP5A 3MKEA 5CXWA 1W79A 4RYEA 1LHYA 4GB7A 2OLVA 3ZG7B 4CPKA 4Y7PA 1K57C 1PIOA 5FATA 3HVFA 4DE2A 1BSGA 2Y2JA 3Q81A 3LY4A 4OQHA 4E3IA 3O87A 3MZDA 3GSGA 1NJ4A 4E3OA 3VMAA 5FQMA 4P85A 3C5AA 3SS4A 4L0LA 1GHIA 4EQIA 4BL2A 4B4ZA 3FKWA 1W7FA 3SOIA 4S2LA 3ZVTA 1XP4A 3LCEA 1FSWA 2HP6A 1TEMA 1XXMA 2ZC4B 5FASA 4BL3A 3V3SA 1NY0A 4DF6A 4JBFA 5GHXA 3BYDA 1W8YA 1BT5A 4KZAA 4WEKA 2V2FF 3N8LA 1SDEA 4P6BA 3V3RA 2R9WA 5GLBA 4NK3A 1YQSA 3S1YA 3VFHA 2RCXA 3IWIA 4QB8A 4JXGA 3IT9A 3TOIA 3W4QA 1IYOA 2DNSA 4JXWA 3G2ZA 4LCLA 5I94A 3MBZA 4LV0A 5EVLA 4GZBA 3C4PA 4OPRA 3RJUA 2J7VA 4Y0TA 5DTTA 2Y2LA 3HUMA 1H8ZA 5E2FA 3HUNA 4S2KA 4E3LA 1ESUA 5IHVA 2XGNA 1MY8A 4S2OA 2VGJA 1AXBA 5FI2A 3BFFA 1ES5A 2A49A 1KGEA 1O7EA 4JPMA 1XGJA 3OPHA 4KZ8A 1ZC2A 3W8KA 4IBRA 3WS4A 1PWDA 1DJAA 2Y2PA 4WYYA 5DF9A 3ZG8B 4BQMA 3WWXA 2ZQAA 2IWDA 2A3UA 4B88A 4DE0A 2ZD8A 3BLMA 1XA7A 2Y2QA 5CHUA 5E43A 1LLBA 3WS2A 2H5SA 3PBTA 3IF6C 2OV5A 3Q7VB 5EOEA 4N9LA 2XD1A 3WS0A 1E3UA 4OONA 1PZPA 1M6KA 2PBYA 1TDLA 1HTZA 4WMCD 5EE8A 5CTNA 3N8SA 1LL5A 1CEFA 4IEDA 1PWGA 2PU2A 1S0WA 4KENB 4KG2A 4E3MA 1MKIA 4GOGA 2XFTA 4N1HA 3A3IA 4JF6A 4BJPA 1BUEA 5F82A 1XPBA 5GLCA 3BFEA 5GL9A 3UDFA 3GTCA 5HL1A 5HW3A 3EQVA 2IWBA 5CGWA 3FKVA 4KZ6A 4JF4A 1KE3A 1MWUA 5CTMA 2Y4AA 4JKTA 3D4FA 3A3EA 4XUZA 4K91A 4YFMA 4BD0A 2WZXA 1ZG4A 2Y2GA 1Q2PA 2DRWA 1BLHA 4DRTA 3RXXA 2ZQ7A 5HAPA 3NY4A 4XUXA 4OPQA 2Y2KA 5AQ7A 3UN7A 3UPOA 4KZ9A 4OLDA 3VFFA 2G2WA 2H0TA 1NXYA 3NC8A 1TVFA 4GDBA 4IBXA 2X71A 1YMXA 2WUQA 5EECA 3VSKA 2XF3A 4WM9A 4UHUA 5EUAA 2CC1A 1XGIA 3NDEA 4N92A 3OC2A 3UDIA 4HEFA 2Y2MA 3OZHA 1PI5A 2WAFA 3IH8A 4PM6A 4UAAA 5FQKA 1FCMA 3MZEA 4GN2A 2G2UA 2HDQA 5TR7A 2ZQ9A 3M2KA 5EVIA 3O88A 4R4SA 3QNCA 4PPRA 4QHCA 3BEBA 4S2JA 1LI9A 4CJNA 2Y2HA 3A3JA 4QY6A 4H8RA 3IXBA 1K6RA 2EXBA 2VGKA 3IXDA 3ZDJA 3HL9A 4ID4A 3ISGA 4OLGA 2EX8A 1H8YA 5DVAA 4S2PA 1Q2QA 2V20A 1YT4A 1ZG6A 2EX2A 2ZLYA 3GRJA 3ITAA 2RL3A 4EBNA 3I7JA 4HESA 2P74A 3BM6A 4GD8A 4Y0OA 2X01A 3G4PA 3ZNTA 3IWOA 1ERQA 2J8YA 3G35A 5F83A 2HPBA 4EBPA 3VP0A 4WELA 4GKUA 1W5DA 4KQOA 5DF8A 5M1AA 5FDHA 5HARA 3W4PA 1MBLA 3QHYA 1ALQA 1K56D 1L0DA 2QZ6A 1EWZA 2QMIA 1XA1A 3IHAA 3OCLA 5CEBA 5GLDA 2XH9A 4KZ5A 5E2HA 1IEMA 2ZM8A 1BULA 3C7VA 3IXHA 5CGSA 4OKPA 5CHJA 3UNWA 1Y54A 4P87A 1G6AA 3ZG0A 4X69A 5EVIC 5M19A 3NDGA 5AQBA 1JWPA 5CERA 1NYMA 3G31A 5FI7A 1QMFA 4K0WA 3BLSA 1BLCA 5FQIA 2WGVA 1YMSA 1FQGA 3Q7ZA 3GR2A 3IH9A 4LV1A 4MNRA 1IKIA 4OQGA 4QY5A 1RP5A 3MXSA 1E4DA 3UDXA 1JVJA 3AGDA 3G32A 3Q7VA 2X02A 3CJMA 4N9KA 4OQIA 3Q07A 1NZUA 1O07A 3IWQA 3FZCA 4KG6A 1K55A 1S6RA 5HFOA 1YLJA 3UPNA 2ZC5B 3ZHHA 3ITBA 1EI5A 4QU3A 5FAQA 3W4OA 2WYXA 4DDSA 5CEDA 2ZC3B 1N4OA 1K4FA 3CMZA 3AGFA 4IVKA 2XEPA 1K4EA 4DXCA 5AQ9A 4R3BA 3UO9A 2XK1A 1KGFA 1MXOA 2HDSA 1MPLA 3HREA 2HDRA 1KDSA 1ZKJA 3ZFZA 3ZG5A 5G18A 2C6WB 4WZ5A 1NRFA 4DE1A 5FAPA 3Q82A 4R4RA 4S2MA 4DKIA 4A5RA 3DW0A 3UE3A 3M6BA 2ZQDA 4OOLA 5D3OA 4PM5A 1GA0A 3C4OA 5L2FA 5DTSA 1RGYA 2XFSA 2Z2MB 4ZJ1A 1L0FA 3UPPA 2B5RA 2WADA 4QD4A 5M18A 1PWCA 1L2SA 2XR0A 2ZM2A 4LENA 4DDYA 3DTMA 4KZ4A 4X56A 1LL9A 3IF6B 3N6IA 2Z2LB 2Y59A 4EWFA 2OSUA 2FFFB 3IQAA 3PBNA 1HVBA 5FA7A 3S22A 1K55C 3NIAA 5FQ9A 2ZM0A 4PM9A 1GHMA 5CGXA 4YINA 4E3NA 3M6HA 4NETA 1L0EA 2WKEA 3CZDA 4D2OA 5J8XA 4RX2A 1FR1A 3PBRA 1WYCA 5GHZA 3UY6A 3LEZA 3WS1A 1ESIA 3PAGA 1WYBA 5A92A 4MBKA 1FCNA 2WKHA 2Y2OA 3VP3A 2ZMAA 3MFDA 1QMEA 4GNUA 4LV2A 1EROA 3SH8A 3WRTA 1CI8A 2XD5A 4MBHA 1OMEA 4WZ5C 2I72A 1K6SA 3WS5A 2BG1A 4S2NA 3FYZA 2IWCA 4JXVA 1J9MA 1JWVA 3MZFA 5FI6A 1BTLA 4MBFA 1YM1A 1CI9A 1SHVA 3P09A 2J9OA 5FSRA 4E3KA 5FAOA 3BECA 3TG9A 4N1XA 4ZAMA 1K54A 3PBQA 4ZBEA 5A90A 4EUZA 2ZQ8A 2GDNA 2HDUA 4X55A 5DTKA 2ZC6B 4K0XA 1Z6FA 1I2SA 2EFXA 5FQQA 3NBLA 1M40A 1K38A 3JYIA 5E2GA 1E3UD 2EX9A 4E3JA 4B4XA 1ES3A 2Q9NA 1YLYA 3NCKA 1KE0A 5GLAA 4O7DA 3UE1A 3S4XA 5E2EA 3IXGA 2WGIA 3AGEA 4OVDA 4ZJ3A 4R3JA 4OQ0A 1IKGA 3BFDA 4XXRA 1C3BA 5HAIA 4Q8IA 1ONGA 1MWTA 4WBGA 3BRMA 4C6YA 4S2NC 2EFUA 3SH7A 4R0QA 2BLSA 5AQAA 1HZOA 5KSHA 4HBUA 3N7WA 3N4IA 4JF5A 3HLFA 3Q1FA 5GHYA 5CECA 3V5MA 5F1FA 3VOYA 1PW1A 1K54C 3HLCA 1MWRA 3PTEA 3HLEA 3O3VA 2WGWB 2UWXA 1BLSA 1G68A 2JCHA 1DY6A 4KZBA 4MEZA 4ZDXA 2XDMA 3OPLA 4GD6A 1XX2A 3SS3A 5HX9A 2XLNA 4M3KA 5KZHA 2OLUA 2JBFA 1KVLA 1PI4A 3P98A 4PM7A 3FV7A 3VSLA 4U3TA 1SCWA 1FR6A 1KDWA 2P9VB 5EVIB 4KQRA 3MKFA 4LCMA 3A3DA 4WMCA 1RCJA 5EVID 1YLWA 5FQJA 4UA9A 3HBRA 4IVIA 3OPRA 3SS5A 1BLPA 5CHMA 3DWZA 3GVBA 2Y2IA 2ZQCA 3GQZA 2WKIA 4FH4A 3IF6A 2WAEA 1JTGA 4OPZA 1CEGA 4Z9QA 3GV9A 5TGFA 4U0XA 1RGZA 4U0TA 1VQQA 1PZOA 1IYPA 4R23A 2H10A 2JC7A 3V50A 3E2LA 4R1GA 1I2WA 1JTDA 4BLMA 2XQZA 1KE4A 3LO7A 4PMAA 3NI9A 2EX6A 2E8IA 4MLLA 1DJCA 3BFCA 3HLDA 2FFYA 3DWKA 3N8RA 3OCNA 3PAEA 2JE5A 4JXSA 1NZOA 2PU4A 3A3FA 5A91A 4DE3A 4HBTA 1IYQA 4OP5A 1L0GA 3ZGAB 3IF5A 3C7UA 4KZ3A 4UA6A 4KG5A 4UA7A 3ZCZA 1PYYA 4EBLA 1YLTA 3CG5A 3VOZA 1TDGA 2C5WB 4FCFA 1I5QA 3ZNYA 5KMWA 4WZ4A 3EQUA 4BENA 3MXRA 1ES2A 3IHBA 4OPYA 1K25A 3PBOA 4FH2A 2V1ZA
chains in the Genus database with same CATH superfamily
1TU5A 3Q8XA 1T5YA 3DGOA 5IEOA 4O0PA 2CP8A 3A0RA 2STDA 4P0MA 1XXHE 3QNBA 1NWZA 2W1RA 4L9FA 4HH3A 3V39A 5J4EA 4OH0A 3TQSA 1D0MA 4MJDA 3AMOA 1S3SA 4HKVB 3G30A 5F1GA 5HAQA 2HP9A 1XKZA 2JA2A 1JBRA 2HMMB 3LQRA 1OHSA 2JY7A 4C3QA 4NC6A 4G3VA 2L0WA 1IBKM 1A2KA 1H5XA 1LSXA 1N34M 3OPPA 1DYUA 3LR3A 4WEJA 2KXGA 2W3HA 1TTEA 3B3XA 3GZRA 3NV0A 1XHBA 1ONHA 4CLCB 1Q39A 4G1MB 5JYPA 3A0VA 5BVBA 1FCOA 1K57A 2Y91A 3IBJA 3WHOA 2WZZA 1WE4A 1KGGA 4OW0A 5IENA 3V98A 4NKPA 5LMUM 1Y4KA 2KHHA 4KO8A 2H5XA 2DCFA 2VF8A 1Z5AA 1NO1A 4GH9A 4WURA 3PBSA 4WF0A 4W5WA 3GSPA 5EPHA 2ZOIA 2CWTA 1OACA 1VQ73 2LBCA 4B3TM 3L25A 1GHPA 2Z76A 1V9YA 4GHLA 5BOHA 4X68A 3GLHB 5AYRB 3H7WA 3FWLA 3KYEA 2Y8HA 2CE7A 2CFWA 1N9BA 1PFLA 2O9BA 3AGOA 4C75A 4ZPXA 4H6JB 3LI8A 2QWSA 4X53A 5L8RF 1BSCA 5AEUB 4NL4H 5CXWA 1IBMM 4FMDA 2F5NA 4RYEA 4Y15A 3CC23 1LHYA 1V57A 2CH9A 3CPTB 3X3XA 2VEAA 2VX8A 2LVNC 2OTJ3 1HQYE 2Y73A 4LYLB 3IS2B 3ZG7B 3HX8A 3GLGE 3CCM3 4MGYE 4Q0HA 3LY4A 1DETA 4LGYA 2V9AA 1BU4A 5ITYA 2LH0A 1NJ4A 3T1QB 2XA7S 4IT7A 4P85A 4HNBA 3C5AA 3PR6A 2M5ZA 4L0LA 1OH0A 3SS4A 4EQIA 2CV2A 3MWZA 2HCBA 1IFQA 3MG3A 2IUKA 4R6LA 3EB8A 3E0YA 1IXZA 3V3SA 5FASA 4N3VA 3O5YA 4R3AA 4DV6M 4DF6A 3GLFB 4K90B 1IYYA 4JBFA 1W8YA 1DP8A 4KLNA 4NPBA 3RGRA 2OWHA 4D60A 1JR3D 2V2FF 1N8QA 5AIGA 4DV5M 1HNWM 2R9WA 4HM6B 5GLBA 4WP5A 1TDZA 2RCXA 1LXEA 1T3BA 4JXGA 3IT9A 3TOIA 3S29A 1IYOA 2CHCA 2DNSA 4JXWA 2X8AA 3T8NA 3C4PA 3UMEA 4ILFA 4WN5A 3FPVA 4I3JA 1GSXA 1GABA 2VF7A 1ESUA 1D2NA 3BNEA 2XGNA 3L27A 4ITQA 4S2OA 2VGJA 1G5UA 4TUWA 2EKFA 1AXBA 5DJUA 1ES5A 2A49A 3QAUA 4ETXA 5E26A 4X66M 3U61B 5AIIA 2PR6A 5A0OB 1OTEA 5DF9A 2JY6B 1BSEA 3UJMA 3BLMA 3LCVB 4MCWA 1XA7A 3DBAA 2Y2QA 2QQ8A 1S4SA 3MJQA 4MN7A 1F2KA 3PBTA 5FDSA 2OV5A 1H6UA 3F92A 1RMSA 5EOEA 4N9LA 4FD2A 3N9HA 4ARZB 3WS0A 2MGWA 2PBYA 2R4JA 2Z7AA 3GRUA 3R7WA 5CTNA 2LVOC 3SFZA 1CEFA 1T1CA 3JUQA 2XLJA 2INWA 3VE3A 1IDPA 4GOGA 3BB9A 2K9DA 1YIJ3 5IERA 2HGVA 1EW0A 3BFEA 5ITRA 1O7PB 3FGYA 1SXJC 1M1K4 3EQVA 2KDLA 4HI4A 3JPUA 4GLQA 4X25A 3CXC2 4RKUF 1N9LA 4L7KA 1YHQ3 1ZG4A 1T6OA 1I0VA 1OGXA 5F3WA 5LBRA 3RGPA 3JUNA 1BUJA 2XRNA 3RXXA 2M7VA 1DMNA 4IBFA 2OWJA 1UGHI 4JGOA 4ZRRA 3CWFA 1SZVA 4L8PA 4HYZA 3UN7A 1EFUB 3VFFA 2H0TA 3TWMA 3TE8A 3NC8A 2P7JA 1TVFA 4GDBA 3G6OA 4MMZB 1DGHA 1FIKA 5EXXA 4LFCM 1B21A 2QJ5A 3QP6A 3OC2A 1OCVA 4PM6A 1W63Q 2ACGA 2ZA4A 1O7GB 2GXFA 1BSBA 5HPIA 1NHWC 3LMLA 3QNCA 4QHCA 4KZ1A 5FEFA 1C1KA 4QY6A 2CG1A 2HF6A 1K6RA 4P6ZM 3ZQJA 3GRVA 1TP6A 3ZDJA 1N36M 4MMXB 4IIAA 1XFNA 2FS1A 1GOVA 1OPYA 3CCL3 1NVMA 1TS7A 4HESA 3BM6A 3CNXA 3KO6A 2X01A 4HLQA 4BU4A 4S12A 1Q3BA 1PJIA 2YFIB 3G35A 4NXNM 1UWNX 1G02A 4GW9A 4MB7A 3I51A 5LC7A 2UV0E 5KP4A 5KP3A 2HPBA 5F83A 3T4TA 4U13A 1HJPA 3PGBA 4XBOA 4KQOA 2CV1A 2QENA 5HWVA 3HOHA 3PNYA 4FMBA 3FLJA 2IUJA 3SYUA 1CEWI 3FSDA 1ALQA 1K56D 3ZCBB 2Y79A 1XA1A 4GS9B 2LHGA 4FCTA 2ML5A 1JB2A 3UK6A 1JZOA 1BULA 5CGSA 5IS1A 4WYKA 1FUSA 4MMYB 1IFYA 3EIEA 4LJAA 4CDLA 4OVZA 1RRLA 4ANRA 1DV0A 3T8UA 1T19A 1BLCA 1MN3A 2FZ0A 3GR2A 4LV1A 2W1TB 1I0XA 3MXSA 2KXEA 4EYCA 1YLAA 3DTEA 3U4LP 1E4DA 1JVJA 4D81A 3AGDA 4AI6A 3G32A 3CJMA 2AADA 1NZUA 5EP3A 3WHKA 1K55A 1SQWA 2FOIC 2ZC5B 1STDA 4I81A 3OWSA 3W4OA 1R6BX 1FJGM 1VQM3 3OLOA 1ZMWA 3SATA 4HQAA 1US1A 1IT8A 5KP1A 3FKAA 1BRJA 3PYJA 4CCVA 1W00A 3GAXA 4EW5A 1HYFA 5JPPA 2D01A 2VV8A 2XK1A 3LVVA 4JGRA 2O9CA 2V6ZM 2YFQA 4MN5A 3U6QA 1KDSA 2F99A 3QYEA 3K9OA 4JRFA 5G18A 4WZ5A 4GITA 1ROAA 3WA3A 3Q82A 4DKIA 4JI4M 1DP9A 1QVF2 2ZOHA 3KOXE 1D0LA 1WHCA 1IY2A 1SG9A 1BSAA 4L4UA 1YAXA 3KVWA 5L2FA 2CWVA 3F1PB 2F5WA 1L0FA 2WADA 4QD4A 4HM2B 1PWCA 3J80S 2ZM2A 1UUWB 3VSYA 4X56A 3IF6B 4DBGB 2O3OA 5I5LA 2KRUA 2FFFB 5FA7A 3S7OA 3D5IA 1Q7HA 4IBIA 4NETA 1L0EA 4D2OA 4RX2A 4YOFA 1OJGA 1WYCA 1UW1A 3WS1A 3MPHA 1ESIA 2OWPA 3TWLA 3GRDA 4MBKA 4L15A 1FCNA 1MGRA 2Y2OA 1IN8A 1QMEA 3LR5A 3KZTA 4LV2A 1B27A 1E32A 3WRTA 4HBRA 3ROBA 1CI8A 2VV7A 1UFZA 2DMWA 2HWJA 2XD5A 1PRBA 1OMEA 2HV1A 1SXJD 3SW1A 4DR3M 5L10A 4B08A 4GKKM 3KS4A 2DWMA 1IQYA 1NSFA 2FXTA 2IWCA 2KAAA 1FGOA 1BTLA 2VLGA 4YWZA 2JUJA 4Y3IA 1SHVA 1G3IA 1G28A 1ORYB 4ZAMA 1K54A 2XRXB 5A90A 2CFDA 3MHEA 4X55A 5DTKA 5HDDA 4JYAM 2W03A 4KFDA 3D72A 3IG5A 4GIPA 1K38A 1BVSA 1WTHA 7GSPA 5CF2A 4E3JA 3C9PA 3BY8A 3V99A 1YIT3 1YLYA 2KEBA 2RGOA 4O7DA 1QMAA 1OT6A 2GNXA 2JKFA 3AGEA 4OVDA 4ZJ3A 4R3JA 4OQ0A 4M0WA 3LMMA 3AV0A 5HAIA 1LL8A 1TDHA 1I94M 1RGLA 3BRMA 4C6YA 1VG5A 4GL6A 1JQJC 5AQAA 3N7WA 4WL9A 3MFXA 2LHCA 2Z4RA 5CECA 2WKPA 1PW1A 2Z7JA 1MWRA 1QAKA 2B18A 3HLEA 2Q0OA 3FZWA 3UB8A 1NJFA 1TS6A 1FGMA 3SC3A 3K63A 4MEIA 2HZ5A 4BWIA 3OPLA 3TW8A 5HX9A 4M3KA 3GPPA 1GD3A 1E3RA 1QAMA 1ZO2A 3GPYA 2GBXB 2W56B 3A42A 1SCWA 1R2YA 4L16A 1ASKA 2CFGA 2LB5A 5AVFA 2QHOB 2D1WA 3MKFA 3BOSA 3A3DA 3CUEA 1YLWA 3HBRA 4IVIA 4LGWA 3OPRA 3LOYA 1OKSA 4DR1M 2CX1A 1NLZA 1VEUA 3SS5A 2OOVC 3DWZA 4EU0A 2WKIA 3NUVA 4MGZE 1JNQA 6GSPA 2WAEA 1JTGA 4FMAA 1Z59A 2XSHB 2BHMA 1GL6A 4GCZA 2XZUA 3NBIA 4DUZM 5E6JA 4D80A 1Q40A 4R23A 4PAUA 1J2BA 4PEJA 2ERCA 2MC8A 2O9UX 3MG2A 4OK0A 4MLLA 3N8RA 2DZNB 1ODVA 3OCNA 3P7NA 2JE5A 1XB2B 1NZOA 3IX4A 2QGUA 2Z4SA 4F3LB 1T3TA 3FTCA 4HBTA 4OP5A 1L0GA 3ZGAB 2VV6A 1V92A 3THGA 1ZV1A 3SVAA 3URPA 2JY8A 4KZ3A 4UA6A 3DY5A 3U6DA 3UJNA 3KSFA 2V8CA 1SKOB 3HJSA 4RBNA 3IPTA 2ZTDA 3ZYTA 3CG5A 1NNJA 3EIHA 5RNTA 3ER7A 3SOYA 1SARA 5IF6A 3NOUC 2ZBBA 3GRRA 4OPYA 5STDA 4FH2A 3I553 2LXEA 2G5GX 4KVHA 2EWWA 4KZ7A 4ESPA 2SBLA 3U6EA 4EBGA 3HLBA 1T18A 5D82A 2O0YA 1A2VA 3LH4A 2CEAA 4IBKA 1SXJB 1T43A 2WOHA 4HM1B 1VM1A 4GDNA 4B93A 2V1CA 4B7HA 4HHDA 4F94A 3MJ5A 4M0DA 1BZAA 5U47A 4Y0UA 1X37A 1ES4A 4RX3A 3NOPC 1W6CA 4LF9M 1OTAA 3E9SA 4LJ9A 1OGZA 4D82A 2ZJ9A 3T0UA 3ZQ5A 4MGKE 3J27B 1A5TA 1L2BA 1M1XB 3TDGA 1W01A 1EIJA 3HWSA 4NHFA 4WHAA 4FCZA 5LC6A 4OOMA 1ERMA 1NNUC 2QPAA 1K0KA 1JWZA 2J9PA 3HLWA 3DOAA 1WGNA 3GWRA 3HY5A 1G0TA 3DM8A 4OX9M 5EOOA 2YKFA 1PY3A 1WMOA 1UCLA 3U6OA 1NYYA 2A24A 3PCSA 2YQZA 2INXA 3BU4A 3FE3A 4HL4A 3BFGA 1STFI 2M60A 2E2TA 1NHGC 1KSIA 1PGYA 2XSZD 2PYRA 4PM8A 2CWUA 1OTDA 3L29A 3GQ5A 1QQWA 1B20A 4ZTKA 1STZA 2FGTA 4R3DA 3ZVWA 3UGJA 2I9VA 3T50A 2Y74A 2PAVP 3J81S 1MKMA 1HNXM 5D83A 3OWYA 3AJIB 1KVMA 2P9VA 1UI7A 1EKMA 3WRZA 1OIZA 4AKYA 5AJGA 3VP4A 2G7UA 1RGEA 4ORLA 4ZJ2A 4UQIS 3EOIA 1LQGC 3QWLA 1GKIA 3E99A 2F98A 2PD8A 1W4NA 1TFOA 1XFQA 4DV7M 2DAEA 3NM2A 3EBYA 3TPZA 2J80A 3T15A 1TUHA 3KSED 3U6CA 3K7CA 4GB7A 4DR4M 3X40A 1NRJA 3ALAA 2CHQA 4G4QA 3KP1E 4Y7PA 1K57C 5FATA 3TRCA 3HVFA 4DE2A 5FLXS 1LVNA 1JB5A 1LQMB 1UCIA 4IJEA 4E3OA 3I01M 2E5LM 3L7HA 2CIUA 2GEYA 5FGOA 1GHIA 3VFDA 3UMMA 2W3EA 4LLOB 4B4ZA 3PS8A 1XP4A 2C96A 3LCEA 5F5YA 4EESA 1LRAA 4BL3A 1T1AA 4NXBA 5A2QS 1J5EM 3AFHA 1NY0A 5IG4A 2W04A 1SIHA 4AQYM 2E2UA 1Y28A 4KZAA 1S5AA 4P6BA 3V3RA 4MGIE 1BUQA 3MYTA 3IX8A 1Z6TA 3RE8A 4GZBA 3PXMA 3RJUA 1KWIA 2J7VA 5DTTA 1NNVA 1JNUA 2OQEA 2EWVA 3SAUA 3W0LB 2OOAA 2E8JA 4IUKA 2JXNA 3P01A 4LJ7A 2GX5A 4JPMA 3H3HA 3STDA 2R78A 3OPHA 1D6UA 4X64M 3K8ZA 4MM3B 2UUAM 1BOXA 4IBRA 2DAMA 1OTIA 4WYYA 3WS4A 4BQMA 3FF0A 1MOLA 2QHKA 1IQXA 2R62A 3KXEC 2GZAA 1Z5CA 5CHUA 4Z1WA 4BBTA 1DE3A 3IF6C 4P17A 1ZQ9A 1OFIA 4HJ3A 4LF5M 2F4VM 3KX0X 1E3UA 4OONA 2JY5A 4NXFA 1M6KA 4L9EA 4LF8M 4B9OA 4LGMA 3U6MA 4Y17A 1QDTA 3KOWE 2LTUA 2O5RA 4MN6A 5FSWA 4KG2A 4E3MA 1MKIA 1JKGA 1VDDA 4BJPA 1BUEA 5F82A 1XPBA 5GLCA 3NHXA 3HU2A 3GTCA 4I5SA 2EUCA 1F9IA 2IWBA 4KZ6A 4DJ3A 5AIFA 4JF4A 3SHFA 3B89A 1Q9EA 1KE3A 4G4OA 3GLIA 5CTMA 4JKTA 4XUZA 4IBGA 3D4FA 1AWIA 4LF4M 2WZXA 2Y2GA 3CMA3 4STDA 5G4YA 3EGXC 3UMDA 3F7XA 4EQ1A 3NY4A 3X42A 2K31A 1HZ1A 2Y2KA 4LRSA 2YNMD 1MX0A 3OOVA 1UCJA 3UPOA 2WZJA 1UCKA 3K3CA 4IBXA 4I4LA 3VSKA 4RF0A 2XF3A 2E2VA 3U97A 4LY6A 4N92A 2FNAA 5D81A 3KOYE 2Y2MA 2CHVA 1QVG2 1PI5A 3IH8A 3F8HA 2KF5A 2KNAA 4GN2A 3SEDA 2G2UA 3AHWA 5TR7A 4KT0F 2ZQ9A 2UXDM 3M2KA 1V58A 5EVIA 2P38A 4NRVA 4R4SA 3AHSA 2EA0A 3FPWA 4CJNA 4Y2FA 3I4YA 3JUMA 4H8RA 1KSFX 1IN7A 2EXBA 4UQIM 3UB9A 5GSPA 3HL9A 4ID4A 3R9XB 4KFFA 4OLGA 5F68A 1H8YA 1BNGA 2MJ6A 1XXHB 1S1YA 1YT4A 1O7HB 2ZLYA 4JI2M 4L78A 3HIIA 4HVNA 1WGLA 3NBJA 1C54A 3UL5A 1LOVA 4X62M 2KW0A 1FGRA 3LXUX 4KUOA 1Q824 4X1MA 4Y0OA 5HD5A 1G96A 4BIRA 3L0RA 1ERQA 1BNFA 2BASA 2IYJA 5K5BA 1LV7A 2CG0A 4WELA 2Y0TA 5DF8A 5M1AA 3ICYA 2RSXA 4H61A 4QOSA 3LYXA 1NJGA 2QNJA 1D1JA 5I97A 1L0DA 1K41A 3F9SA 1GD4A 4KFEA 2QMIA 1BYWA 4II7A 3IHAA 1QALA 2XZFA 3EE1A 5EEOA 4F2LA 1WA9A 2ZM8A 2QCUA 1N9OA 1DGBA 3C7VA 2CHGA 1EEJA 1SPUA 3IXHA 2XROA 2B95A 2P09A 1G6AA 4X69A 2L4RA 3NDGA 1S67L 1JWPA 3DGYA 2ZL1B 4RNTA 1U5OA 1NYMA 3G31A 1MU5A 1KQS2 3I563 1VQP3 1RNBA 3BLSA 3Q7ZA 4FCJA 3IH9A 2VKSA 4HM5B 3LIEA 1YSPA 1RP5A 3UDXA 5CLKA 5DNYA 2Z8YM 3Q7VA 5DFLA 2X02A 1BNJA 2RBIA 4NG2A 1XWIA 4LRZE 3IWQA 3KSXA 3FZCA 1S6RA 5HFOA 1KOUA 3DXOA 2F4YA 2LQVA 3BQAA 4QU3A 2CFOA 4FWHA 3KSJA 2QA43 5CEDA 2ZC3B 4HP4A 3HK4A 1K4FA 3AGFA 2A15A 4GHIA 4EIWA 3JUPA 1K4EA 3KSIA 1QAFA 5AQ9A 4R3BA 1MPLA 2LVQD 1BSDA 4RNZA 2L1MA 3H82A 2VQFM 1ZKJA 1ULJB 1IXSA 3KOZE 8CATA 2BJVA 1I2EA 1I2GA 1GOUA 4K1UA 3ZG5A 8RNTA 1NRFA 2C6WB 2JKGA 3GLGB 3BQ8A 4LCBA 1WMPA 4L9GA 4R4RA 3KCHA 4S2MA 5AIHA 4HJ6A 5HSQA 3HI7A 3M6BA 2FNQA 3VOLA 3OXAA 3D9YA 1RGYA 2XFSA 4ZJ1A 2JZ0A 4X1LA 1UGUA 1J09A 2WGQA 3GZYB 5M18A 1WQLB 1W2ZA 3KFUG 1L2SA 1YVBI 3SAWA 3O8YA 2IMJA 4KZ4A 2ZAMA 4EWFA 2Z2LB 2Y59A 2BWBA 3N8BA 3SLUA 2CWBA 5HL6A 1HVBA 1K55C 3NIAA 1H3QA 3LTAA 2MROB 2ZM0A 3SASA 3R8FA 4R7GA 4XT2B 3GLIE 2L4VA 2HL7A 1KFVA 5J8XA 3PBRA 2LB9A 4BLCA 3LEZA 1GSVA 1F5MA 4HM0B 1N9NA 1WYBA 4X65M 4NREA 2ZMAA 4GNUA 3ECFA 2R0IA 1HKXA 2KF4A 3SH8A 2F5PA 3DTIA 4WZ5C 2H28A 1K6SA 3LVWA 3JVUA 4S2NA 4R71A 3C8CA 1J9MA 1O7MB 3MZFA 5FI6A 1NO3A 4MBFA 2GJ3A 3CAXA 1HQCA 3EEHA 5FAOA 3BECA 1W63M 1GS3A 3TG9A 4N1XA 4R1KA 3FH1A 2HJEA 3PBQA 3DZDA 3HZPA 1TR8A 1F98A 2DI0A 1IM2A 1FZUA 4WP2A 3UZUA 2VQEM 3FF2A 3F1NB 4K0XA 2OAQ1 1I2SA 1I3FA 1VEGA 1UGIA 1M40A 2K0BX 2OQ4A 3OW22 2LYXA 1OAIA 3L9KA 2C4BA 4EW7A 5E2GA 1IN6A 3CPOA 4TX4A 1ES3A 1I2FA 2Q9NA 3NCKA 3BNDA 3AMOB 4Z6YA 1ACFA 4RZMA 3UE1A 2X49A 2I9WA 3S4XA 2YFJB 4P16A 1IKGA 1IXRC 1P0ZA 3BFDA 1C3BA 1RN1A 3F1OA 3SBJA 1ONGA 1JN5A 1W6GA 2PHYA 1OF5A 3E98A 2C99A 2EFUA 4HBUA 2HAKA 4IBDA 2XA7M 1IY1A 3NV0B 1RLSA 3NBBA 5G4ZA 1B2MA 1OTBA 1YE9A 3VOYA 1K54C 3HLCA 3PTEA 1FUWA 2UWXA 1QAOA 3GPXA 2KX6A 5HWTA 1DY6A 3V76A 3K0ZA 2V0WA 3LFVA 3VE4A 2JBFA 1W5SA 2W3DA 1RTUA 1Y4OA 3VSLA 1BNEA 4AEQA 5C5KA 3T4OA 4O2HA 3H7WB 5EVIB 5EV0A 5EP1A 4WMCA 5FQJA 2PNCA 3MQOA 1B2UA 3T6PA 4FCMA 4WFOA 3MK6A 5CHMA 2Y2IA 2ZQCA 3GQZA 4FH4A 1OJ5A 3HHYA 3A0SA 3FD9A 4NSRA 1TH3A 1UWPX 4M9ZA 1R2ZA 5TGFA 3FYDA 1RGZA 1NY5A 4U0TA 1ZHHB 4O3VA 4HH2A 2F86B 2BMOB 2H10A 2JC7A 3V50A 3U60A 2HHHM 5FW5A 1FGTA 2V0UA 3AOEC 1JTDA 5FTKA 2JP7A 2L09A 4G3OA 2QYBA 5E2FA 1GSPA 3SAVA 4QWTA 1BRNL 4DV3M 3NOTC 1IYQA 2UUBM 3BY9A 3NM7A 2GU3A 5JI3E 4DUYM 2PT7A 3IF5A 4FOFA 4AKZA 2OPFA 1WXQA 4HOHA 4IHQA 2WSFF 1K82A 4HAAA 1DGFA 4EBLA 1I8VA 2BU4A 3VOZA 5FTMA 2P5TA 1G41A 3ZC7B 3K5TA 4BTXA 4N6V0 3ZNYA 3SOAA 5KMWA 4WZ4A 4QNMA 4JI6M 2R6FA 3PNVA 3MXRA 1ES2A 5DKLA 1FOFA 1XC8A 5CRFA 2QBYA 1X1WA 1W7CA 4LGQA 1SDNA 3HUOA 4I38A 5AVEA 2QPNA 3HJKA 4FWDA 4X2HA 5KSCA 2DZOB 3OTOM 1K3WA 4JLFA 2Y21A 1CH0A 3Q3FA 5EQLA 4DR5M 2UGIA 2HMKB 4N6UA 3B7QA 2WK0A 3CNMA 3SARA 3GMWA 1MGWA 1NDOB 1YLZA 4RQ9A 3NHQA 3F14A 4BBUA 3UE0A 2WSEF 4LF7M 1TS0A 3H82B 1IYSA 4RNAA 2IY2A 2RGHA 3FCSB 1AIPC 4QJGA 8CHOA 2BO9B 3E2KA 1P3QQ 1K28A 1JZDA 3S7NA 3OWUA 4RA7A 1N78A 3LY3A 5DYIA 1N8R4 3HLGA 1PU4A 3HKPA 1ZMUA 2Y55A 4BD1A 3LTBA 2K54A 4KQQA 1VQ53 2R44A 2MH8A 2V1AA 5TFQA 3VP2A 4GEWA 2OCTA 3LIDA 2WGWA 1EE8A 4K1VA 1N9EA 3EC9A 1GLNA 3M2JA 3R7WB 3K9MC 1A2PA 1L8QA 3G4S3 4CJ6A 4I5QA 2H0YA 3IJEB 4E6WA 2R9XA 5L09A 1MWSA 1YLPA 3AL0C 4RVAA 1E94E 3FRHA 1G59A 1GMQA 2CK3H 1FSYA 3SH9A 2KLIA 4DV2M 1CK3A 2ZM6M 2EXAA 1TF1A 3CD63 1VETA 2CX0A 3A46A 3B74A 1L1ZA 3KDSE 1GCEA 4GRIA 4DJ2A 3MKEA 4LZIA 3F7SA 3DGNA 1SJWA 4J8TA 3CITA 5DKKA 3U5ZA 3UB1A 5G1KA 4CPKA 2LWXA 1DGHB 1PIOA 3ZH9B 3RH8B 1BSGA 2Y2JA 3Q81A 4G3WA 4OQHA 4E3IA 1T2IA 3B47A 3MZDA 2V1LA 3GSGA 1PJTA 3VMAA 4AG6A 4DV0M 5FQMA 4NOOB 4DV1M 3NQYA 2Q2EB 1BRHA 3PFIA 5EVEA 5F69A 5CXOA 3FKWA 4JI1M 3X41A 1P9WA 5IT5A 1K734 1FSWA 2HP6A 1TEMA 2ZC4B 1CF0A 1W5ZA 5BR8M 5EP4A 2V1UA 2R4IA 3BYDA 2JKTM 3Q1CA 1CJFA 4XBTA 1RGHA 4LZJA 4DR7M 4PHTA 4WEKA 1L1TA 3N8LA 1TGUA 4NK3A 3X3YA 3VFHA 3S1YA 1D6ZA 2KA6B 2A2LA 1GVNA 1D6YA 1FUTA 2WO0A 3F40A 1HLUP 3LEQA 3LT9A 1EA2A 1ISKA 3M0EA 4LCLA 5KPTA 1XJ3A 1WR1B 3MSOA 5EVLA 4OPRA 4Y0TA 4FUWA 1H8ZA 3RNTA 3VK7A 3SYLA 3I0YA 4E3LA 2I7PA 4G4NA 4XBXA 5IHVA 3HU3A 4OUQA 1MY8A 5A8BA 4XM4A 1TS8A 3HCYA 1W02A 2H0IA 5FI2A 1KGEA 1O7EA 2PRFA 1H8MA 1YVSA 2AHMA 3SMPA 4WYKB 1E97A 4A3VB 3N54B 3W8KA 2H0GA 1PWDA 2J8XB 1DJAA 2F56A 4I4KA 1CQAA 2Y2PA 2XSSA 3SX1A 2ZQAA 3WWXA 2IWDA 4BBVA 4FTXA 4OVZB 2HKJA 2R4EA 2A3UA 4DE0A 3IMAB 5ELUA 3MG1A 2WGOA 3CPW2 3CCS3 5E43A 1LLBA 2W3GA 4GHAA 4CLCA 3MF0A 1RNTA 2H5SA 5CX7A 1FNNA 4IBCA 1YPRA 5HD3A 3VKGA 3EHCA 1CYUA 3KYZA 3HU1A 4IBBA 4R9KA 1V9ZA 2JKTI 3JVVA 3NJAA 1B2ZA 3KIIA 2QP9X 3NBRA 1PWGA 4EV2A 3U6PA 1BRKA 1GMPA 1S0WA 3BXWA 3QP1A 3I4VA 1DGGA 4N1HA 2FH5A 5L8MA 3W67A 5GL9A 2OQEC 2JQ5A 3UDFA 4DR6M 5HL1A 1BANA 5CGWA 1GSWA 5ITTA 3GLHA 2L7IA 3QP4A 2Y4AA 4YFMA 3A3EA 2MR9A 4BD0A 3FUXA 1DRMA 3JR5A 3GQ3A 1Q2PA 2DRWA 4H6JA 3GZXB 2ZQ7A 3NECA 2UUGC 5ITUA 1NLYA 1AUAA 3NXJA 2P0MA 1JBTA 4XUXA 4OPQA 4X2OA 3T1XA 5AQ7A 2DVWB 1LOXA 2G2WA 3CPTA 4JI7M 5DFYA 1R4CA 3IS2A 1QUTA 5FTLA 5IU1A 3CTWB 1YMXA 5EECA 5IW9A 3NULA 4UHUA 5EUAA 3T38A 1QDRA 1XGIA 2CC1A 3UDIA 4HEFA 5G1LA 3OZHA 3T4SA 4KUKA 3IHPA 4B3MM 4JI0M 1Q02A 1FCMA 2HDQA 3H51A 2HOHA 4DMZA 2KRKA 4S2JA 2VJWA 5DF7A 4LJ8A 3B33A 1KC84 1A0KA 4HY8A 3B7CA 2DENA 2L4EA 2VGKA 3IXDA 1YSQA 4J5KA 2EX8A 5DVAA 1RGGA 3GLFA 2M1CA 3GRYA 2M7OA 4KODA 2EX2A 1ZG6A 4B7GA 3ITAA 2RL3A 3GZBA 2J7NA 4EBNA 3I7JA 3SZTA 3IG8A 3C58A 1PRQA 1VB6A 4XBYA 3MQ0A 2P74A 4GD8A 4FCWA 1ROVA 4K61A 3G4PA 3ZNTA 1TIJA 3FTEA 3S67A 3D8BA 1CUKA 2OOVA 1L3LA 2W82A 2J5YA 3LW5F 1XJ4A 3QP5A 4QHTA 3LGOA 2OAP1 4EBPA 4GKUA 1W5DA 2B24B 3I04M 3T1HM 2DKLA 1IV9A 4H3UA 3QHYA 4IBJA 1NY6A 5TJJA 4DV4M 5GLDA 5CEBA 3U61A 4NXEA 3UNWA 2DAGA 2JHEA 5CHJA 3VF1A 1Y54A 3UB5P 4HJ4A 3ZG0A 5EVIC 5IREB 5M19A 3CF6E 3TE6A 5TGNA 5CERA 5H37D 2VIIA 3S7PA 4BB9A 1JRQA 5FI7A 2P0XA 4K0WA 5FQIA 2WGVA 3CC73 4HP9A 4MNRA 2C11A 2RFRA 1R7RA 2EA9A 4EC6A 4QY5A 2ZHXB 4GB5A 3U6LA 2JDIH 2GNOA 3H9WA 4OQIA 6RNTA 4ARZA 1O07A 2QJ7A 1O7WB 4KG6A 1NJI4 3LI9A 2CMNA 2VK3A 3ITBA 5FAQA 4NRWA 2WYXA 3C3DA 4JI8M 1JJ22 4DDSA 2LVAA 1N4OA 5HDCA 3CMZA 4IVKA 2XEPA 2BMRB 1A67A 3G6E3 5IZ7D 4GHOA 4DXCA 1HU9A 3UO9A 3WOFB 1MXOA 1DMMA 2HDSA 3GQ4A 4XK8F 2HDRA 3MQQA 1W6YA 1NU3A 1YNVX 1IK3A 4Y13A 4HZ9B 1Q3CA 1G4AE 1C7YA 2UUCM 4CLCE 2Z6CA 1IN4A 3D4AA 3G8ZA 1Q864 3UE3A 5F6AA 4OOLA 2P04A 5D3OA 1YSYA 3NBXX 1IVUA 1VZZA 3UB7A 1Z1SA 3LTCA 1IVVA 2Z2MB 1VEJA 2FE8A 2L4FA 5BPVA 3JAMS 2B5RA 2K47A 1YUBA 3E21A 1D0KA 1VEUB 2XR0A 3S5CA 3WR2A 3DH2A 4ME4A 3IX3A 2WOFA 3LYGA 3DTMA 1LL9A 3RGAA 1J3WA 4JF8A 1VQ63 3S22A 3LR0A 4PD2A 1HT1E 5FQ9A 2O25A 2F5QA 5CGXA 1UDII 3E46A 3GLHE 4MH0E 4E3NA 4I8OA 1TTOA 1Q40B 2WKEA 1BRGA 1FR1A 2ZAOA 2BWEA 4IJGA 5GHZA 1GJSA 2C9OA 3PAGA 3M6AA 2RNTA 1T1BA 3L28A 2ZMVA 1O7NB 3MFDA 2UXBM 4AKIA 4MGHA 5EVHA 1BRSA 4N6MA 1EROA 2Z3XA 3H4JA 1HNZM 2AVXA 3EJVA 2I72A 3EQQB 3LR4A 1XNRM 2BG1A 3WS5A 4JXVA 3PXGA 1JWVA 1EG9B 1CQSA 4LG2A 1YM1A 3PHYA 4LRYC 1QZEA 4E3KA 3S28A 3A45A 1L2DA 3HX3A 1M9GA 1FA3A 1T2HA 5HWWA 4ZBEA 1M904 4EUZA 2ZQ8A 3CU3A 3TJZC 1XJ6A 2ZC6B 3SYKA 2K2NA 5BU4A 5FQQA 3NBLA 4GS9A 3LUQA 3GP1A 2LNHC 4R70A 1BGSA 2V8FA 1PNEA 1P97A 2RKOA 3GLFE 4HJLB 1E3UD 2EX9A 1X0OA 1ZGXA 3VGNA 4YNRA 4BTWA 1OAOC 1KE0A 1JR3A 2YFLB 2D02A 5J3WA 3ILKA 4F1IA 2K7SA 4JXJA 3BNBA 5E2EA 5BIRA 3IXGA 2O99A 2W1TA 4XXRA 2OO9A 1MWTA 3LQQA 2GQFA 3VLFB 1V74A 4XDVA 4AFIA 3T4QA 4S2NC 4PKYG 3SH7A 1IQPA 5DYGA 5KSHA 4JV5M 2PD7A 4JF5A 4MMNA 5LMNM 3PCRA 1NB5I 1D06A 3Q1FA 4P6ZS 4M4XA 1G71A 3GECA 5GHYA 1TH2A 3V5MA 2J7OA 2JWSA 3WODG 1QAQA 2A24B 1WJ7A 5EXSA 1CYVA 3O3VA 1GY7A 4HM7B 1BLSA 1G68A 3EGDC 4Q0IA 2CFKA 3JR4A 1F4IA 4KZBA 1E9SA 4MEZA 2XDMA 3LCUA 1XX2A 4CGYB 5KQDA 2XLNA 5KZHA 5AYSC 3FUVA 1NB3I 4AG5A 3MXQA 4OU7A 3P98A 5IG3A 1DP6A 4PM7A 3FV7A 3UB6A 5DJTA 4RF1A 1WNHA 3Q8GA 2KNVA 4EETB 1X1UA 4G4RA 4EERA 5JI2E 1FR6A 1KDWA 1WMNA 4IPBA 2P9VB 3F1PA 4KQRA 4JI5M 4LCMA 1X1XA 5EVID 1FYSA 2YR0A 1I4WA 1LSVA 3M7GA 2QIYA 2R46A 3IF6A 3QP2A 3VV4A 4LRTA 4IBEA 1NWWA 4OPZA 5MC7A 5ITQA 3D9RA 3X3ZA 4Z9QA 3LT8A 4U0XA 1ULIB 1G8PA 1IYPA 2W0QA 5EM0A 3E2LA 2BNKA 4R1GA 5DFXA 1I2WA 1N32M 5TBMA 5HOHA 3FG4A 3L2AA 5JBSA 2XQZA 1VHMA 3HHWA 3NI9A 2EX6A 2E8IA 3CF0A 5HPFA 1QUSA 3BFCA 1J7KA 3DWKA 4JXSA 2B3TA 3CC43 2PU4A 3KN4A 3A3FA 5GKNA 3B42A 5A91A 3J7Yd 4DE3A 3KS8A 2CFLA 1K3XA 1QVRA 2NQ8C 3OX9A 4KG5A 4NXGA 4UA7A 3ZCZA 3B9PA 3QYBA 3JUOA 4EUVA 3EBTA 1DO2A 4KHPM 3CHWP 1UUGB 1TDGA 2C5WB 3NWLA 4FCFA 3KW6A 1I5QA 2W2CA 3U2AA 3MHVC 5CF1A 3IECA 3EQUA 2DHYA 4LJ5A 3K3DA 1K25A 3PBOA 1KD14 2IA7A 2V1ZA 3ULFA 4E04A 1E3VA 1XNQM 1OQYA 1SKFA 3FC7A 1S723 2ZC7A 3W2ZA 1VEKA 1DJBA 1U60A 1LSWA 4DXBA 3H4MA 1IU7A 1VQ43 1ZX2A 4DR2M 3MMPA 1RRHA 2CRUA 3PZWA 1HD8A 4JI3M 1IELA 4E6XA 3BNCA 4RNYA 4QHSA 2C10A 1PW8A 5JYOA 5J7EA 2DWZB 1EUIC 4L8OA 2PZVA 2PR5A 1PFPA 4LPZA 2UU9M 3S27A 1IBLM 3EWKA 1BNRA 5KPRA 4OP8A 2QEX3 5JPUA 2Q9MA 3O86A 4OOYA 3ZG9B 4N6LA 1TRQA 3SHGB 2B1XB 1E25A 4GC5A 4X6TA 3RDEA 4REZA 4BTYA 2C98A 1K56A 3C38A 3VP1A 4LMIA 3FTDA 4S2IA 1LTMA 3EF8A 1GA9A 1VQO3 1AVKA 2CC3A 2Y2NA 5EM1A 1YI23 4CHTB 5C18A 4DN0A 1JR3E 1MNLA 4EV4A 3G2YA 2D7GA 3NQZA 1JKGB 3L26A 1TJDA 9RNTA 3QK9A 1AV4A 3RXWA 2W56A 2ZTCA 5EJCA 1W8QA 3BJNA 6STDA 3OBFA 3WOEB 4FD8A 4FSFA 4LV3A 3T4JA 3TSGA 4NXMM 1OIPA 2DNAA 3GLIB 2W9PA 2YX9A 1RGAA 4KQDA 3U1WA 2CUZA 1VQ93 1P9RA 4GMQA 4O01A 4I39A 2VGLS 4IJFA 3G0KA 3G34A 1LI0A 5A93A 2HP5A 2YKHA 5IG5A 3J7BA 4AZFA 1W79A 3CLOA 2KF3A 5IG0A 2J3TC 2OLVA 4R9LA 4YY3M 3C3EA 3HHZA 1TH4A 4PKYA 3CCE3 4KT3B 1S1ZA 2R41A 1K8A4 1VDLA 5ITXA 1W2B2 2L6OA 5IT9S 3U6SA 1RGCA 1RKYA 3O87A 4LJ4A 3CCU3 1B2XA 1GYBA 4XB5A 1IT7A 1NV8A 1ZAEA 1AR0A 1RN4A 1GMRA 4F3LA 2PDRA 3RFWA 4BL2A 4QNRA 5G2GA 1TD5A 1Q42A 1W7FA 4S2LA 4G6ZA 3SOIA 3ZVTA 3KYQA 1YJN3 1XXMA 2BNGA 1SKOA 4PDGA 3KFQC 3SXXA 5GHXA 2MF7A 1BT5A 2FFJA 2M7UA 3MR0A 2Y0QA 2N35A 4O02B 3B7NA 4Y28F 3T1SA 1SDEA 3R4KA 1YQSA 1N5PA 3D79A 4WW0A 2DWLA 3IWIA 4QB8A 3JVCA 2PYPA 5KPZA 1YJW3 3W4QA 1FW7A 3G2ZA 4Z8XA 3VK8A 3MBZA 5I94A 3VKHA 3HIGA 1BAOA 4GSPA 4LV0A 4PCZA 3UE6A 4IIWA 4N6TA 1EQKA 1VQ83 4LSOA 3B4OA 2Y2LA 1SXJA 2EO2A 1BRIA 2HMJB 3HUNA 3HUMA 1OHOA 1RSNA 3QRDA 1WIVA 1QZMA 5CK6A 4S2KA 2W9QA 3TWKA 3AGNA 3J7AS 4HEOA 3CCQ3 1LT0A 2QKPA 3BFFA 2KCDA 3QP8A 2FH0A 2WKRA 3KSHA 2VDBB 3EEAA 2W27A 1XGJA 4KZ8A 1ZC2A 4M9SA 5DRVA 1RCLA 1IVWA 3PYPA 3HZJA 3ZG8B 3FUTA 1OUNA 1K9M4 3CUEC 1IV7A 3BLZA 4B88A 3V92A 2ZD8A 2QZ4A 3SMSA 2BIRA 5EQTA 3DAVA 3WS2A 3D8LA 2DXIA 3J2PB 4GC9A 3Q7VB 4JN6A 3LTDA 2XD1A 3E4OA 4LFAM 3HJ8A 1PZPA 4ETZA 1TDLA 5C1BA 1HTZA 2D42A 3B7ZA 4WMCD 5EE8A 3N8SA 1LL5A 2L2DA 4IEDA 2PU2A 1VQ1A 2JZ1A 2O01F 4KENB 1LNIA 3GPUA 2XFTA 3CME3 4G3KA 3A3IA 3T4KA 2CW9A 1YKDA 4GHIB 4JF6A 3T12B 1R4GA 5EXTA 2KOIA 2P08A 5HW3A 3GO8A 4FWGA 3FKVA 4NEED 1GJTA 2R18A 1Z09A 4HZBB 1IXSB 1MWUA 3A98B 4CISA 4XGIA 4K91A 3DTKA 5TBMB 2XR8B 1R5LA 4HM4B 2R45A 4QWOA 1BLHA 4DRTA 2ZDJA 1GOYA 1Z5BA 5HAPA 2W3FA 5FL3A 1GO5A 3K9PA 3DGMA 3GDIA 1D7EA 2Y20A 2I7NA 2BJWA 4KZ9A 3E4RA 1LOYA 2GEXA 4OLDA 3K92A 2PBDP 4CLCC 4Y5FA 1NXYA 4GKJM 1XMQM 2X71A 2V1BA 2WUQA 1R4YA 4WM9A 4NSOB 1IN5A 1XMOM 3NDEA 1DMQA 2J3WA 4ZM8A 2WAFA 3E4QA 2HMNB 4UAAA 4OVMA 5FQKA 3A76A 3MZEA 2RRUA 2O9AA 1N33M 2B02A 1YGWA 3E4PA 4Q0JA 1DVDA 4K0KM 3O88A 1IQ8A 4PPRA 3BEBA 1LI9A 2VGLM 3DZLA 2K6BA 3KE7A 2ML6A 2Y2HA 3A3JA 2BMQB 3V67A 3IXBA 1Q7Y4 4J9AA 3B8LA 5IEPA 1N77A 3ISGA 4S2PA 1Q2QA 2V20A 1DVCA 2KDKA 3GRJA 2Z6DA 1IVXA 2EKKA 4PT5A 2CKFB 5BXQA 3LIAA 3IWOA 2J8YA 2VZWA 2BT3A 2VA0A 5ITXE 3BWLA 4UEYA 2D7HA 3WHLA 3VP0A 2HJ9C 4B3SM 1UI8A 2G3QA 4I3IA 5FDHA 5HARA 4WWUC 3W4PA 1Q814 5KIZA 1MBLA 2DWNA 2J3TD 2QZ6A 1EWZA 3W68A 3VDUA 3KSPA 3K1JA 2QSFX 3Q90A 3MKIA 3OCLA 2XH9A 3AOEA 1X1YA 4KZ5A 1IEMA 5E2HA 4L6V6 4OKPA 1ZMVA 2A5YB 4P87A 3W0FA 1VQK3 1YGEA 2GBWB 5AQBA 4R4KA 2HMOB 1OJLA 1QMFA 3C30A 3HJIA 1NV9A 1FQGA 1YMSA 4AKGA 4BMWA 2G8LA 1IKIA 4OQGA 7CATA 1TFKA 4Q7JA 2DHRA 2EJSA 3BBZA 1S66L 3F1OB 5DREA 1JN5B 4HOIA 4LFUA 5HDSA 4AKHA 1OF5B 2JN7A 4N9KA 3Q07A 1I70A 1DO0A 1SXJE 5KO3A 3BW6A 1HT2E 1YLJA 1RHLA 4GJ4A 3UPNA 1MZUA 3ZHHA 2H1RA 1EI5A 1LNHA 1PYLA 2C9CA 1GY5A 1V34A 4XDWA 2LVPC 3KKGA 1MJGM 1E9RA 1W5TA 1ZTUA 1KGFA 3LZAA 2L7HA 5EXPA 2OTL3 3HREA 3ZFZA 5FAPA 1PJSA 4DE1A 1TF0B 2P05A 2NUPC 2UXCM 2AAEA 4A5RA 2JKRM 1ZS7A 3DW0A 4EV5A 2ZQDA 2UX0A 4PM5A 1GA0A 3C4OA 3FYCA 4JGQA 1Y8GA 1H0MA 5DTSA 4Q53A 3UPPA 2RCDA 4LRXC 2XSZA 2WSCF 2W0NA 3FUWA 3UNLA 2KZUA 4LENA 1RU3A 3B4PA 4DDYA 1B2SA 3Q2PA 1AVLA 3N6IA 3FG1A 2OSUA 3IQAA 3A5EA 3PBNA 2Z6BA 5AI1A 4PM9A 1GHMA 3WA2X 4YINA 4LF6M 3M6HA 3WMDA 2ZMFA 4PDIA 3CZDA 5L07A 3UL6A 5EFWA 3U60B 3UY6A 1RCKA 3D5GA 4LZZA 3DMCA 5FEGA 3CF2A 3DFZA 3FKEA 4HIAA 1OFHA 5A92A 1KYIA 3IBRA 5AEWB 3FG3A 2WKHA 3VP3A 3HJQA 2K3DA 3MMHA 4B7FA 2F5MA 4YHHM 7RNTA 2WKQA 4K08A 2GU1A 1XXHA 4J5GA 4MBHA 4O8GA 3CCV3 1RGKA 3FYZA 3MSHA 4EXRA 5IWAM 3DA1A 2ZBKB 4FW9A 1BNSA 4N6NB 4L8RC 1CI9A 3F8XA 3P09A 2J9OA 5FSRA 2JKRI 3HHXA 1YJ93 1N75A 1OHPA 1V33A 4UN2B 4JGPA 1LOWA 4FMCA 3EN8A 2L1SA 1AY7A 1GL7A 2GDNA 2HDUA 2XGLA 4MDZA 4IUHA 1L5GB 4BBAA 2OOBA 1Z6FA 2HMLB 3KP0E 2EFXA 4CLCD 1XJ2A 3LICA 3JYIA 2QBYB 1JV2B 2DAIA 3D3LA 3PXPA 5HGRA 4B4XA 3FTFA 5ELJA 2DZLA 2ZL1A 5GLAA 3OV4A 3S7QA 3CI6A 4CIZA 4AW4A 2WGIA 1HR0M 2RGQA 4Q8IA 1IOUA 4WBGA 2APLA 1S4RA 2KZSA 1UUVB 4N6OB 3DUKA 1BVIA 1FILA 1BNIA 2CV0A 1F8NA 2KF6A 1I3IA 3MS6A 2BLSA 4R0QA 1HZOA 4LEHA 4EEUA 3N4IA 3HLFA 3G713 1OT9A 2C5RA 1FGQA 1JB0F 5F1FA 1RN7A 2Q07A 3K2LA 1RGFA 1MC0A 3AKZA 3HGIA 3M8CA 2KNZA 2WGWB 3FUUA 1RJOA 2BTFP 4EXOA 3PVSA 2JCHA 1BIRA 1IY0A 1OPXA 1PJJA 3K2NA 4O8SA 4ZDXA 4GD6A 3SS3A 2F5SA 1JB4A 2JNHA 2OLUA 2W6JH 3DGLA 3GLGA 2DAKA 1RDSA 1KVLA 1PI4A 2XSOB 1TRPA 2Z77A 4R80A 4U3TA 3C2WA 3T4LA 4CQHA 3NX0A 1N9JA 4FVMA 4EEPA 1SIIA 1VQL3 3AOGA 3CCJ3 2R65A 1RCJA 1VETB 2D7EA 4UA9A 1B3SA 5FTNA 3CCR3 1AQZA 1BLPA 5HZHA 1N5HA 2IA2A 3GVBA 4I3AA 2MJ5B 1UM8A 1OTRA 3G16A 4HM3B 1CEGA 1QJGA 2ZL8A 3GV9A 3T1YM 3BIRA 5EP2A 4XT2A 4LJ6A 1VQQA 1PZOA 3U5ZB 4WUJA 3RFBA 4WLAA 2KRTA 3RGSA 2F5OA 3CGWA 7STDA 4FR9A 2X4AA 4FCVA 1GY6A 4BLMA 3EN1B 1JBSA 1KE4A 3LO7A 4PMAA 4QPRA 3RTYA 2H0HA 3LIFA 3EX9A 1VQN3 1DJCA 3HLDA 1U8CB 2FFYA 3PAEA 1QYRA 3WDGB 2GSPA 3D3OA 3T1RA 2ZANA 4B3RM 3C7UA 5FTJA 2NUTC 4HM8B 1A90A 1PYYA 3TL4X 4R38A 4LFBM 1YLTA 1PJQA 3VDPA 1L2CA 4QOZC 2K0MA 3FG8A 3KSGA 1PM5A 5KQ8A 1C7HA 2SARA 1G6OA 2OOLA 4BENA 4M9XA 3F1NA 3IHBA 3FRIA 3LIBA 1QANA
chains in the Genus database with same CATH topology
1TU5A 3Q8XA 1T5YA 3DGOA 5IEOA 2STDA 4P0MA 3QNBA 3V39A 4OH0A 3TQSA 3G30A 4MJDA 3AMOA 1S3SA 4HKVB 5F1GA 5HAQA 2HP9A 1XKZA 2JA2A 2HMMB 3LQRA 1OHSA 4C3QA 1IBKM 1A2KA 1H5XA 1N34M 3OPPA 1DYUA 4WEJA 2KXGA 3B3XA 3GZRA 3NV0A 1XHBA 1ONHA 1Q39A 4G1MB 5JYPA 5BVBA 1FCOA 1K57A 2Y91A 2WZZA 1WE4A 1KGGA 4OW0A 5IENA 3V98A 5LMUM 1Y4KA 4KO8A 2DCFA 1Z5AA 4GH9A 4WURA 3PBSA 4W5WA 5EPHA 2CWTA 1OACA 1VQ73 4B3TM 3L25A 1GHPA 2Z76A 4GHLA 5BOHA 4X68A 3GLHB 5AYRB 3FWLA 2CE7A 2CFWA 1N9BA 4C75A 4ZPXA 4X53A 5AEUB 4NL4H 5CXWA 1IBMM 4FMDA 2F5NA 4RYEA 3CC23 1LHYA 2CH9A 3X3XA 2OTJ3 1HQYE 2Y73A 3ZG7B 3HX8A 3CCM3 4MGYE 3LY4A 4LGYA 1NJ4A 5ITYA 2LH0A 4IT7A 4P85A 3C5AA 2M5ZA 4L0LA 1OH0A 3SS4A 4EQIA 2CV2A 3MWZA 2HCBA 3MG3A 2IUKA 3EB8A 5FASA 1IXZA 3V3SA 4N3VA 4DV6M 4DF6A 3GLFB 4K90B 4JBFA 1W8YA 4KLNA 3RGRA 1JR3D 2V2FF 1N8QA 5AIGA 4DV5M 1HNWM 2R9WA 4HM6B 5GLBA 4WP5A 1TDZA 2RCXA 1LXEA 4JXGA 3IT9A 3TOIA 3S29A 1IYOA 2CHCA 2DNSA 4JXWA 2X8AA 3T8NA 3C4PA 1ESUA 1D2NA 3BNEA 2XGNA 3L27A 4ITQA 4S2OA 2VGJA 4TUWA 1AXBA 1ES5A 2A49A 3QAUA 5E26A 4X66M 3U61B 5AIIA 5A0OB 5DF9A 3UJMA 3BLMA 1XA7A 2Y2QA 3PBTA 2OV5A 1H6UA 5EOEA 4N9LA 4FD2A 3N9HA 3WS0A 2PBYA 2R4JA 2Z7AA 3GRUA 5CTNA 3SFZA 1CEFA 3JUQA 2XLJA 1IDPA 4GOGA 3BB9A 1YIJ3 5IERA 3BFEA 5ITRA 1O7PB 3FGYA 1SXJC 1M1K4 3EQVA 3CXC2 4L7KA 1YHQ3 1ZG4A 1OGXA 5F3WA 3RXXA 3RGPA 3JUNA 1DMNA 4IBFA 4L8PA 4HYZA 3UN7A 3VFFA 2H0TA 3TWMA 3NC8A 1TVFA 4GDBA 4MMZB 1DGHA 5EXXA 4LFCM 3OC2A 1OCVA 4PM6A 1O7GB 2GXFA 1NHWC 3LMLA 3QNCA 4QHCA 4KZ1A 1C1KA 4QY6A 2CG1A 1K6RA 3ZDJA 3GRVA 1TP6A 1N36M 4MMXB 4IIAA 1OPYA 3CCL3 1NVMA 4HESA 3BM6A 3CNXA 2X01A 4HLQA 4S12A 1Q3BA 1PJIA 2YFIB 3G35A 4NXNM 4MB7A 3I51A 5LC7A 5F83A 5KP4A 5KP3A 2HPBA 4U13A 3PGBA 4XBOA 4KQOA 2CV1A 2QENA 3PNYA 4FMBA 3FLJA 2IUJA 1CEWI 3FSDA 1ALQA 1K56D 3ZCBB 1XA1A 4FCTA 2ML5A 1JB2A 3UK6A 1BULA 5CGSA 4WYKA 4MMYB 3EIEA 4LJAA 4CDLA 4OVZA 1RRLA 3T8UA 1BLCA 3GR2A 4LV1A 3MXSA 2KXEA 4EYCA 1E4DA 1JVJA 4D81A 3AGDA 4AI6A 3G32A 3CJMA 1NZUA 5EP3A 3WHKA 1K55A 1SQWA 2FOIC 2ZC5B 1STDA 3OWSA 4I81A 3W4OA 1R6BX 1FJGM 1VQM3 3SATA 1US1A 1IT8A 5KP1A 3FKAA 3PYJA 4CCVA 1W00A 3GAXA 5JPPA 2XK1A 3LVVA 2V6ZM 2YFQA 3U6QA 1KDSA 2F99A 5G18A 4JRFA 4WZ5A 4GITA 1ROAA 3WA3A 3Q82A 4DKIA 4JI4M 1QVF2 3KOXE 1IY2A 4L4UA 3KVWA 5L2FA 2CWVA 1L0FA 2WADA 4QD4A 4HM2B 1PWCA 3J80S 2ZM2A 1UUWB 3VSYA 4X56A 3IF6B 2O3OA 2KRUA 2FFFB 5FA7A 4IBIA 4NETA 1L0EA 4D2OA 4RX2A 1WYCA 1UW1A 3WS1A 3MPHA 1ESIA 2OWPA 3TWLA 3GRDA 4MBKA 4L15A 1FCNA 2Y2OA 1IN8A 1QMEA 3KZTA 4LV2A 1E32A 3WRTA 4HBRA 3ROBA 1CI8A 2XD5A 1OMEA 1SXJD 4DR3M 4B08A 4GKKM 3KS4A 2DWMA 1IQYA 1NSFA 2FXTA 2IWCA 1FGOA 1BTLA 1SHVA 1G3IA 1ORYB 4ZAMA 1K54A 2XRXB 5A90A 2CFDA 3MHEA 4X55A 5DTKA 4JYAM 2W03A 4KFDA 3IG5A 4GIPA 1K38A 1WTHA 5CF2A 4E3JA 3V99A 1YIT3 1YLYA 2KEBA 2RGOA 4O7DA 1QMAA 3AGEA 4OVDA 4ZJ3A 4R3JA 4OQ0A 4M0WA 3LMMA 3AV0A 5HAIA 1TDHA 1I94M 3BRMA 4C6YA 4GL6A 1JQJC 5AQAA 3N7WA 2Z4RA 5CECA 1PW1A 2Z7JA 1MWRA 1QAKA 3HLEA 3FZWA 1NJFA 1FGMA 3SC3A 3K63A 4MEIA 3OPLA 5HX9A 4M3KA 3GPPA 1GD3A 1E3RA 1QAMA 1ZO2A 3GPYA 2GBXB 2W56B 3A42A 1SCWA 1R2YA 4L16A 1ASKA 2CFGA 2D1WA 3MKFA 3BOSA 3A3DA 1YLWA 3HBRA 4IVIA 3OPRA 3LOYA 3SS5A 4DR1M 2OOVC 3DWZA 2WKIA 3NUVA 4MGZE 1JNQA 2WAEA 1JTGA 4FMAA 1Z59A 2XSHB 2BHMA 1GL6A 2XZUA 3NBIA 4DUZM 5E6JA 4D80A 1Q40A 4R23A 1J2BA 4PEJA 2ERCA 2MC8A 2O9UX 3MG2A 4OK0A 4MLLA 3N8RA 2DZNB 3OCNA 2JE5A 1NZOA 2QGUA 2Z4SA 1T3TA 3FTCA 4HBTA 4OP5A 1L0GA 3ZGAB 3THGA 3SVAA 4KZ3A 4UA6A 3DY5A 3U6DA 3UJNA 3HJSA 4RBNA 3IPTA 3CG5A 1NNJA 3EIHA 3ER7A 3SOYA 5IF6A 4OPYA 3GRRA 5STDA 4FH2A 3I553 2LXEA 2G5GX 4KVHA 4KZ7A 2SBLA 3U6EA 4EBGA 3HLBA 5D82A 1A2VA 3LH4A 2CEAA 4IBKA 1SXJB 2WOHA 4HM1B 1VM1A 4GDNA 2V1CA 4B7HA 4F94A 3MJ5A 4M0DA 1BZAA 5U47A 4Y0UA 1X37A 1ES4A 4RX3A 1W6CA 4LF9M 3E9SA 4LJ9A 1OGZA 4D82A 2ZJ9A 3T0UA 4MGKE 3J27B 1L2BA 1M1XB 3TDGA 1W01A 3HWSA 4NHFA 4WHAA 4FCZA 5LC6A 4OOMA 1ERMA 1NNUC 2QPAA 1JWZA 2J9PA 3HLWA 3DOAA 3GWRA 3DM8A 4OX9M 5EOOA 1WMOA 1NYYA 3U6OA 3PCSA 2YQZA 2INXA 4HL4A 3BFGA 1STFI 2M60A 2E2TA 1NHGC 1KSIA 2XSZD 4PM8A 2CWUA 3L29A 3GQ5A 1QQWA 4ZTKA 2FGTA 4R3DA 3ZVWA 3UGJA 2Y74A 3J81S 1HNXM 5D83A 3OWYA 3AJIB 1KVMA 2P9VA 1UI7A 1EKMA 3WRZA 4AKYA 3VP4A 4ORLA 4ZJ2A 3QWLA 1GKIA 3E99A 2F98A 1W4NA 1TFOA 4DV7M 3NM2A 3EBYA 3TPZA 3T15A 1TUHA 3KSED 3U6CA 3K7CA 4GB7A 4DR4M 3X40A 3ALAA 2CHQA 4G4QA 3KP1E 4Y7PA 1K57C 5FATA 4DE2A 3HVFA 5FLXS 1LVNA 1JB5A 4IJEA 4E3OA 2E5LM 2CIUA 2GEYA 5FGOA 1GHIA 3VFDA 3UMMA 4B4ZA 3PS8A 1XP4A 2C96A 3LCEA 4BL3A 5A2QS 1J5EM 3AFHA 1NY0A 5IG4A 2W04A 1SIHA 4AQYM 2E2UA 4KZAA 1S5AA 4P6BA 3V3RA 4MGIE 1BUQA 3MYTA 1Z6TA 3RE8A 4GZBA 3PXMA 3RJUA 1KWIA 2J7VA 5DTTA 2OQEA 3SAUA 3W0LB 4LJ7A 4JPMA 3H3HA 3STDA 3OPHA 1D6UA 4X64M 3K8ZA 4MM3B 2UUAM 4IBRA 3WS4A 4WYYA 4BQMA 3FF0A 1MOLA 1IQXA 2R62A 3KXEC 1Z5CA 5CHUA 3IF6C 1ZQ9A 1OFIA 4LF5M 2F4VM 1E3UA 4OONA 1M6KA 4LF8M 4LGMA 3U6MA 3KOWE 2O5RA 5FSWA 4KG2A 4E3MA 1MKIA 1JKGA 1VDDA 4BJPA 1BUEA 5F82A 1XPBA 5GLCA 3NHXA 3HU2A 3GTCA 4I5SA 2EUCA 2IWBA 4KZ6A 5AIFA 4JF4A 3SHFA 1KE3A 4G4OA 3GLIA 5CTMA 4JKTA 4XUZA 4IBGA 3D4FA 2WZXA 4LF4M 2Y2GA 3CMA3 4STDA 3F7XA 3NY4A 3X42A 2Y2KA 4LRSA 2YNMD 1MX0A 3UPOA 4IBXA 4I4LA 3VSKA 4RF0A 2XF3A 2E2VA 3U97A 4LY6A 4N92A 2FNAA 5D81A 3KOYE 2Y2MA 2CHVA 1QVG2 1PI5A 3IH8A 3F8HA 4GN2A 3SEDA 2G2UA 5TR7A 2ZQ9A 2UXDM 3M2KA 5EVIA 2P38A 4NRVA 4R4SA 2EA0A 4CJNA 3I4YA 3JUMA 4H8RA 1KSFX 1IN7A 2EXBA 3HL9A 4ID4A 3R9XB 4KFFA 4OLGA 1H8YA 1XXHB 1YT4A 1O7HB 2ZLYA 4JI2M 4L78A 3HIIA 4HVNA 3NBJA 3UL5A 4X62M 2KW0A 1FGRA 3LXUX 4Y0OA 1Q824 1G96A 3L0RA 1ERQA 1LV7A 2CG0A 4WELA 2Y0TA 5DF8A 5M1AA 2RSXA 4H61A 4QOSA 1NJGA 5I97A 1L0DA 1K41A 3F9SA 1GD4A 4KFEA 2QMIA 4II7A 3IHAA 1QALA 2XZFA 3EE1A 5EEOA 2ZM8A 2QCUA 3C7VA 1DGBA 3IXHA 2CHGA 1SPUA 2P09A 1G6AA 4X69A 3NDGA 1JWPA 1U5OA 1NYMA 3G31A 1MU5A 1KQS2 3I563 1VQP3 3BLSA 3Q7ZA 4FCJA 3IH9A 4HM5B 1RP5A 3UDXA 5CLKA 5DNYA 3Q7VA 2X02A 1XWIA 3IWQA 3KSXA 3FZCA 1S6RA 5HFOA 3DXOA 2LQVA 4QU3A 2CFOA 4FWHA 3KSJA 2QA43 5CEDA 2ZC3B 3HK4A 1K4FA 3AGFA 2A15A 4EIWA 3JUPA 1K4EA 1QAFA 5AQ9A 4R3BA 1MPLA 4RNZA 2VQFM 1ZKJA 1ULJB 3KOZE 8CATA 2BJVA 4K1UA 3ZG5A 2C6WB 1NRFA 5FAPA 4R4RA 3GLGB 4S2MA 4LCBA 1WMPA 5AIHA 3HI7A 3M6BA 2FNQA 3OXAA 1RGYA 2XFSA 4ZJ1A 1J09A 2WGQA 3GZYB 5M18A 1WQLB 1W2ZA 3KFUG 1L2SA 1YVBI 3SAWA 3O8YA 2IMJA 4KZ4A 2ZAMA 4EWFA 2Z2LB 2Y59A 3N8BA 3SLUA 1HVBA 1K55C 3NIAA 2ZM0A 3LTAA 3SASA 3R8FA 4R7GA 2L4VA 2HL7A 1KFVA 5J8XA 3PBRA 4BLCA 3LEZA 4HM0B 1WYBA 4X65M 4NREA 2ZMAA 4GNUA 3ECFA 1HKXA 3SH8A 2F5PA 4WZ5C 1K6SA 3LVWA 4S2NA 1J9MA 1O7MB 3MZFA 5FI6A 1NO3A 4MBFA 1HQCA 5FAOA 3BECA 1GS3A 3TG9A 4N1XA 4R1KA 3FH1A 3PBQA 3DZDA 3HZPA 1IM2A 3UZUA 2VQEM 3FF2A 4K0XA 1I2SA 1M40A 2OQ4A 3OW22 2LYXA 5E2GA 1IN6A 3CPOA 4TX4A 1ES3A 2Q9NA 3NCKA 3BNDA 3AMOB 4Z6YA 4RZMA 3UE1A 2X49A 2I9WA 3S4XA 2YFJB 4P16A 1IKGA 1IXRC 3BFDA 1C3BA 3SBJA 1ONGA 1JN5A 1W6GA 1OF5A 2C99A 2EFUA 4HBUA 4IBDA 1IY1A 3NV0B 3NBBA 1YE9A 3VOYA 1K54C 3HLCA 3PTEA 1FUWA 2UWXA 1QAOA 3GPXA 1DY6A 3K0ZA 2JBFA 1W5SA 3VSLA 4AEQA 4O2HA 5EVIB 5EP1A 4WMCA 5FQJA 2PNCA 4FCMA 4WFOA 3MK6A 5CHMA 2Y2IA 2ZQCA 3GQZA 4FH4A 3HHYA 3FD9A 4NSRA 1TH3A 4M9ZA 1R2ZA 5TGFA 3FYDA 1RGZA 1NY5A 4U0TA 4O3VA 2F86B 2BMOB 2H10A 2JC7A 3V50A 3U60A 2HHHM 5FW5A 1FGTA 3AOEC 1JTDA 5FTKA 2L09A 5E2FA 3SAVA 4QWTA 4DV3M 1IYQA 2UUBM 3NM7A 2GU3A 5JI3E 4DUYM 3IF5A 4AKZA 2OPFA 1WXQA 4EBLA 1K82A 1DGFA 3VOZA 5FTMA 2P5TA 1G41A 3ZC7B 3K5TA 4BTXA 4N6V0 3ZNYA 3SOAA 5KMWA 4WZ4A 4QNMA 4JI6M 3PNVA 3MXRA 1ES2A 1FOFA 1XC8A 5CRFA 2QBYA 1W7CA 4LGQA 1SDNA 3HUOA 2QPNA 4FWDA 4X2HA 5KSCA 2DZOB 3OTOM 1K3WA 4JLFA 2Y21A 5EQLA 4DR5M 2HMKB 4N6UA 2WK0A 3CNMA 3SARA 3GMWA 1NDOB 1YLZA 3F14A 3UE0A 4LF7M 1IYSA 4RNAA 2RGHA 3FCSB 4QJGA 8CHOA 2BO9B 3E2KA 1K28A 3OWUA 4RA7A 1N78A 3LY3A 5DYIA 1N8R4 3HLGA 1PU4A 3HKPA 2Y55A 4BD1A 3LTBA 2K54A 4KQQA 1VQ53 5TFQA 3VP2A 2OCTA 2WGWA 1EE8A 4K1VA 1N9EA 3EC9A 1GLNA 3M2JA 3K9MC 1L8QA 3G4S3 2H0YA 3IJEB 4E6WA 2R9XA 1MWSA 1YLPA 3AL0C 4RVAA 1E94E 1G59A 2CK3H 1FSYA 3SH9A 4DV2M 1CK3A 2ZM6M 2EXAA 3CD63 3A46A 1L1ZA 3KDSE 1GCEA 4GRIA 3MKEA 4LZIA 3F7SA 3DGNA 1SJWA 4J8TA 3U5ZA 3UB1A 4CPKA 2LWXA 1DGHB 1PIOA 3ZH9B 1BSGA 2Y2JA 3Q81A 4OQHA 4E3IA 3MZDA 2V1LA 3GSGA 3VMAA 4AG6A 4DV0M 5FQMA 4NOOB 4DV1M 3NQYA 2Q2EB 3PFIA 5CXOA 3FKWA 4JI1M 3X41A 1K734 1FSWA 2HP6A 1TEMA 2ZC4B 1W5ZA 5BR8M 5EP4A 2V1UA 2R4IA 3BYDA 3Q1CA 4XBTA 4LZJA 4DR7M 4WEKA 1L1TA 3N8LA 1TGUA 4NK3A 3X3YA 3VFHA 3S1YA 1D6ZA 2KA6B 1GVNA 1D6YA 2WO0A 3F40A 3LT9A 1EA2A 1ISKA 3M0EA 4LCLA 5KPTA 3MSOA 5EVLA 4OPRA 4Y0TA 1H8ZA 3VK7A 3SYLA 3I0YA 4E3LA 2I7PA 4G4NA 4XBXA 5IHVA 3HU3A 4OUQA 1MY8A 4XM4A 1W02A 5FI2A 1KGEA 1O7EA 2AHMA 3SMPA 4WYKB 1E97A 4A3VB 3N54B 3W8KA 1PWDA 1DJAA 2Y2PA 4I4KA 3WWXA 3SX1A 2ZQAA 2IWDA 4OVZB 2HKJA 2R4EA 2A3UA 4DE0A 3IMAB 5ELUA 3MG1A 2WGOA 3CPW2 3CCS3 5E43A 1LLBA 4GHAA 2H5SA 1FNNA 4IBCA 3VKGA 3EHCA 1CYUA 3HU1A 4IBBA 4R9KA 3KIIA 2QP9X 3NBRA 1PWGA 4EV2A 3U6PA 1S0WA 3I4VA 1DGGA 4N1HA 5GL9A 2OQEC 2JQ5A 3UDFA 4DR6M 5HL1A 5CGWA 5ITTA 3GLHA 2L7IA 4YFMA 2Y4AA 3A3EA 4BD0A 3FUXA 3JR5A 3GQ3A 1Q2PA 2DRWA 3GZXB 2ZQ7A 5ITUA 3NXJA 2P0MA 4XUXA 4OPQA 4X2OA 5AQ7A 2DVWB 1LOXA 2G2WA 4JI7M 1R4CA 5FTLA 3CTWB 1YMXA 5EECA 5IW9A 4UHUA 5EUAA 3T38A 1XGIA 2CC1A 3UDIA 4HEFA 3OZHA 4B3MM 4JI0M 1FCMA 2HDQA 3H51A 2KRKA 4S2JA 4LJ8A 1KC84 3B7CA 2VGKA 3IXDA 2EX8A 5DVAA 3GLFA 3GRYA 2M7OA 4KODA 2EX2A 1ZG6A 4B7GA 3ITAA 2RL3A 3GZBA 2J7NA 4EBNA 3I7JA 3IG8A 3C58A 4XBYA 2P74A 4GD8A 4FCWA 1ROVA 4K61A 3G4PA 3ZNTA 1TIJA 3FTEA 3S67A 3D8BA 2OOVA 2W82A 4EBPA 4QHTA 4GKUA 1W5DA 2B24B 3T1HM 1IV9A 4H3UA 3QHYA 4IBJA 1NY6A 4DV4M 5GLDA 5CEBA 3U61A 3UNWA 5CHJA 3VF1A 1Y54A 3ZG0A 5EVIC 5IREB 5M19A 3CF6E 3TE6A 5TGNA 5CERA 5H37D 2VIIA 4BB9A 1JRQA 5FI7A 2P0XA 4K0WA 5FQIA 2WGVA 3CC73 4MNRA 2C11A 2RFRA 1R7RA 4EC6A 4QY5A 4GB5A 3U6LA 2JDIH 4OQIA 1O07A 1O7WB 4KG6A 1NJI4 3ITBA 5FAQA 4NRWA 2WYXA 4DDSA 4JI8M 1JJ22 1N4OA 3CMZA 4IVKA 2XEPA 2BMRB 1A67A 3G6E3 5IZ7D 4DXCA 1HU9A 3UO9A 3WOFB 1MXOA 1DMMA 2HDSA 3GQ4A 2HDRA 1W6YA 1NU3A 1IK3A 4HZ9B 1Q3CA 1G4AE 2UUCM 1IN4A 3G8ZA 1Q864 3UE3A 4OOLA 5D3OA 1YSYA 1IVUA 1VZZA 1Z1SA 3LTCA 1IVVA 2Z2MB 2FE8A 5BPVA 3JAMS 2B5RA 2K47A 1YUBA 2XR0A 3S5CA 2WOFA 3LYGA 3DTMA 1LL9A 3RGAA 4JF8A 1VQ63 3S22A 4PD2A 1HT1E 5FQ9A 2F5QA 5CGXA 4MH0E 4E3NA 4I8OA 1Q40B 2WKEA 1FR1A 2ZAOA 5GHZA 2C9OA 3PAGA 3M6AA 3L28A 1O7NB 3MFDA 2UXBM 4AKIA 4MGHA 5EVHA 1EROA 4N6MA 2Z3XA 1HNZM 2I72A 3EJVA 3EQQB 3WS5A 1XNRM 2BG1A 4JXVA 3PXGA 1JWVA 1EG9B 1CQSA 4LG2A 1YM1A 4E3KA 3S28A 3A45A 1L2DA 1M9GA 1FA3A 4ZBEA 1M904 4EUZA 2ZQ8A 3CU3A 2ZC6B 3SYKA 5FQQA 3NBLA 3GP1A 2LNHC 2RKOA 4HJLB 1E3UD 2EX9A 3VGNA 4BTWA 1KE0A 1JR3A 2YFLB 3ILKA 4JXJA 3BNBA 5E2EA 3IXGA 4XXRA 1MWTA 3LQQA 3VLFB 1V74A 4XDVA 4S2NC 3SH7A 1IQPA 5DYGA 5KSHA 4JV5M 4JF5A 5LMNM 3PCRA 1NB5I 3Q1FA 5GHYA 1TH2A 3V5MA 2J7OA 3WODG 1QAQA 5EXSA 1CYVA 3O3VA 1GY7A 4HM7B 1BLSA 1G68A 2CFKA 3JR4A 4KZBA 1E9SA 4MEZA 2XDMA 1XX2A 4CGYB 5KQDA 2XLNA 5KZHA 5AYSC 3FUVA 1NB3I 4AG5A 4OU7A 3P98A 5IG3A 4PM7A 3FV7A 4RF1A 1WNHA 4G4RA 5JI2E 1FR6A 1KDWA 1WMNA 4IPBA 2P9VB 4KQRA 4JI5M 4LCMA 5EVID 2YR0A 1I4WA 3M7GA 2QIYA 2R46A 3IF6A 4LRTA 4IBEA 1NWWA 4OPZA 5ITQA 3D9RA 3X3ZA 4Z9QA 3LT8A 4U0XA 1ULIB 1G8PA 1IYPA 2W0QA 3E2LA 2BNKA 4R1GA 1I2WA 1N32M 3FG4A 3L2AA 5JBSA 2XQZA 3NI9A 3HHWA 2EX6A 2E8IA 3CF0A 3BFCA 1J7KA 3DWKA 4JXSA 3CC43 2PU4A 3KN4A 3A3FA 5GKNA 5A91A 3J7Yd 4DE3A 3KS8A 2CFLA 1K3XA 1QVRA 2NQ8C 3OX9A 4KG5A 4UA7A 3ZCZA 3B9PA 3JUOA 3EBTA 1DO2A 4KHPM 1TDGA 2C5WB 3NWLA 4FCFA 3KW6A 1I5QA 2W2CA 3MHVC 5CF1A 3EQUA 4LJ5A 1K25A 3PBOA 1KD14 2IA7A 2V1ZA 1E3VA 1XNQM 1SKFA 1S723 2ZC7A 1DJBA 1U60A 4DXBA 3H4MA 1IU7A 1VQ43 1ZX2A 4DR2M 1RRHA 3PZWA 1HD8A 4JI3M 1IELA 4E6XA 3BNCA 4RNYA 4QHSA 2C10A 1PW8A 5JYOA 2DWZB 4L8OA 2PZVA 1PFPA 2UU9M 3S27A 1IBLM 5KPRA