2XFTA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
425
structure length
418
Chain Sequence
TPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 139
structure length 418
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xftA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xftA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xftA02
5CTMA 3FYZA 1XX2A 3WS2A 1PWGA 3TOIA 1N4OA 3PTEA 3V5MA 3LCEA 4QY6A 5CHJA 3Q7ZA 2WADA 5E2GA 3WWXA 4GD6A 1XA7A 1J9MA 3CZDA 5JYPA 3N8SA 4IBRA 2DRWA 2Y2PA 4Z9QA 4BL3A 2DNSA 1K55C 4C3QA 1MXOA 3OPLA 5A93A 3OPPA 5TGFA 4RX2A 5GHZA 1U60A 4RA7A 3SH9A 2QMIA 3G35A 3C7VA 1AXBA 3PBOA 4ZJ3A 1K57C 3WRTA 2Y91A 4LV1A 1G68A 3OZHA 1NYYA 2PU4A 5HAQA 4WZ5C 2JBFA 4E3MA 3MKEA 1ONGA 3HLEA 2WGWB 3VSKA 5FAQA 2XQZA 4HBUA 3TSGA 1KVMA 3UO9A 2HDRA 1XKZA 2RCXA 4PM7A 3BFCA 2C6WB 1PW8A 3BRMA 3HREA 4MBFA 5E2EA 4ZJ2A 1SCWA 2Z2LB 4BD0A 4EUZA 2H5SA 4UAAA 1K55A 4KZ7A 2XEPA 3OPRA 4JKTA 3IHBA 4PM5A 5FASA 1PIOA 3AGFA 5EE8A 2E8IA 1IKGA 2J8YA 3UDXA 2QPNA 3LEZA 4B88A 1I2WA 4Q8IA 4IBXA 4OKPA 4UHUA 4EBPA 1EI5A 4WELA 3Q82A 2Y55A 3W8KA 5CXWA 2WUQA 5GHXA 5HFOA 3RJUA 3QNBA 4X6TA 4DXCA 1VQQA 1Z6FA 1YLJA 1GHMA 1YMXA 4WM9A 1MWTA 3MZFA 4EWFA 2JE5A 2X02A 1ZG6A 2ZM8A 2G2WA 3S1YA 2EX8A 3SS3A 1LL9A 1ERQA 2HP9A 3C7UA 4EBNA 4KZAA 1ES2A 5CGXA 5G18A 5GL9A 4DXBA 4R4SA 3W4OA 1E3UA 5A90A 2J9PA 4OPZA 4FSFA 3C4OA 4JXWA 5AQAA 3SS4A 3UY6A 2B5RA 1Q2QA 1YLPA 3CMZA 5DVAA 5E2FA 3BFGA 1FSWA 2EX6A 4IVIA 2OV5A 3HLCA 3ZG0A 2XDMA 2OLVA 4GB7A 2OLUA 2OSUA 5CGWA 2Y2KA 2Z2MB 2ZLYA 2ZC7A 3S4XA 2HPBA 2A49A 2HDQA 4EQIA 5EOOA 4D2OA 5F1FA 3UDFA 1FSYA 1NRFA 1FOFA 5DTSA 2XF3A 1FR6A 1XP4A 1RP5A 3BFFA 1WYCA 2IWCA 2UWXA 3VP0A 2ZC5B 5EVLA 4DKIA 5CTNA 1JTDA 3OC2A 3JYIA 3S22A 5L2FA 4P6BA 1L2SA 4RX3A 3HLFA 1CK3A 2HDUA 2Y2NA 5EECA 4RVAA 4OLGA 5HL1A 4XXRA 5E43A 3PBTA 5BOHA 3GV9A 1E25A 4O7DA 2ZM2A 4HEFA 4BD1A 1MWRA 3NBLA 4QHCA 3VSLA 4GZBA 3UE3A 3D4FA 3DTMA 2BLSA 4GD8A 4GN2A 3VOYA 3VP3A 5F83A 4BJPA 4QJGA 5GLCA 2ZQAA 5FQMA 3HUMA 4FCFA 3N7WA 3FV7A 4QY5A 3ZGAB 2XD1A 4YINA 4DDYA 3ZG7B 5E2HA 5KSHA 3O88A 4FH4A 3A3EA 4IEDA 4RYEA 2Y2JA 5AQ9A 3ZG8B 1K6SA 1IEMA 4S2NA 4LCLA 5FQKA 4WBGA 1JWVA 4KENB 1LLBA 3HL9A 4CJNA 3BFEA 1W5DA 2ZC3B 4Y0TA 5FATA 5J8XA 4X68A 1L0DA 5HAPA 3C4PA 4MLLA 4KZ4A 1O07A 1BLHA 4BENA 3UPNA 5EVID 4S2MA 5FQQA 2C5WB 1W8QA 4R0QA 2PU2A 2Y2GA 4EBLA 3VP1A 2EFUA 1MWUA 1Q2PA 5CHMA 2Y2MA 5AQBA 5FQ9A 4WMCA 3WRZA 1ERMA 1K56D 4WEKA 3M2JA 4KZBA 4YFMA 2ZM0A 3VP4A 3BFDA 3IF6C 1MBLA 1LL5A 3BLSA 5FSRA 3SH7A 1DJAA 1G6AA 3G4PA 1PW1A 2ZC6B 5FDHA 1BZAA 1KGGA 1CI8A 3MXRA 5EVIC 2XH9A 3A3IA 1PWCA 4JF6A 4E3OA 4S2PA 1NYMA 1SHVA 5EPHA 4A5RA 1BLSA 3BECA 3G32A 1BULA 4BQMA 5FAOA 3IF6B 5GLDA 3VOZA 1YLYA 4BL2A 1K4EA 3IF5A 5KSCA 3G30A 5GLAA 3NIAA 4OOYA 3EQVA 3LO7A 5F1GA 1HD8A 1GHPA 1TVFA 4C75A 3QNCA 1CEFA 3G31A 1KE4A 4LENA 1ZC2A 2R9WA 2Y2LA 3FZCA 1K54A 3LY3A 1XGJA 5I94A 4GDBA 2EFXA 5M1AA 1O7EA 4N9KA 2WGIA 2WGVA 4QD4A 4JPMA 1H5XA 5HAIA 3UN7A 4OQGA 4HESA 1KDWA 2WGWA 2G2UA 2I72A 4LV0A 5EOEA 5U47A 3HLDA 4ZJ1A 4OLDA 2XLNA 2V20A 4F94A 3MBZA 2IWDA 2Q9NA 3HUOA 4M3KA 5DF9A 4GOGA 4DRTA 4OQIA 3DWKA 2XD5A 4WMCD 1L0GA 3PBSA 5FAPA 1YMSA 4R23A 2ZMAA 3ZHHA 1XGIA 3ISGA 3NDEA 4DDSA 3O3VA 3PBQA 4MNRA 4KZ5A 3UE1A 5GHYA 4HBTA 4NETA 2IWBA 3BYDA 1OMEA 1PZOA 5FI7A 2XFTA 3HUNA 4WZ4A 4U3TA 4E3JA 3FKWA 1RGZA 1SKFA 2XR0A 1YQSA 1H8YA 3NC8A 1GA9A 3PBNA 4QB8A 4DE0A 3C5AA 2Y59A 1NXYA 4FD8A 1RGYA 2HP5A 5F82A 2FFFB 3M6HA 4OQ0A 1QMEA 1PWDA 1ES5A 1C3BA 1HZOA 2ZJ9A 4E3KA 2ZQ8A 3CJMA 4ID4A 3P98A 1BLCA 1HVBA 3UPPA 3Q1FA 3EQUA 2P9VB 2XGNA 2R9XA 4K0XA 1TEMA 4OOMA 4WEJA 4N1HA 4R4RA 3NI9A 3N8RA 1WYBA 4H8RA 3Q81A 4R1GA 5D3OA 4JBFA 1EWZA 4LCMA 3Q07A 1L0FA 2Y2IA 3MZDA 4N92A 4GDNA 4JF4A 2Y2HA 2QZ6A 2WZXA 4UA6A 5EUAA 1IYOA 5FA7A 3ZG9B 1I5QA 2RL3A 4OPRA 2PBYA 3IF6A 4JF5A 1BT5A 2XFSA 4OP8A 1WE4A 3ZG5A 2VGKA 2WK0A 1KE3A 3HVFA 4B4ZA 2P74A 2H0YA 1NJ4A 1YLTA 2WKIA 4DE1A 3HLWA 4JXSA 2X01A 3MKFA 1YM1A 4U0XA 4U0TA 2CC1A 3DWZA 4KQOA 4OQHA 1MY8A 1QMFA 2EX2A 3V3SA 1IYSA 4IVKA 1XXMA 5CEDA 1KGEA 3N8LA 5HARA 1VM1A 3NY4A 1LI0A 3IXBA 3V50A 1KVLA 4ZAMA 3IXGA 2XK1A 1BTLA 1JWPA 3BEBA 5JYOA 5CEBA 1NY0A 2JCHA 4KG6A 1E3UD 1TDGA 1YLWA 3GTCA 2WKHA 4KG5A 4E6WA 1FCOA 1I2SA 4EV4A 3VMAA 5KZHA 5CECA 2X71A 4KQRA 1GA0A 1PI5A 4MBHA 3Q7VA 1K6RA 3ZCZA 1EROA 3N4IA 4JXGA 3GQZA 3GSGA 3IWOA 1ESUA 5CRFA 1K38A 1LI9A 1S0WA 3ZNYA 5FQJA 1CEGA 3GMWA 1XA1A 1YT4A 3VP2A 5FQIA 1FQGA 1IKIA 3NDGA 1BSGA 3W4QA 1KGFA 5TFQA 2JC7A 1W79A 3GVBA 3AGEA 4OOLA 2ZQ9A 1W7FA 4ZBEA 3UE0A 3IH8A 2WKEA 2GDNA 1ZG4A 2ZC4B 4PM9A 4CPKA 1KE0A 1XPBA 3WS5A 4P85A 2WYXA 3RXWA 1ES4A 3G34A 4PM8A 3BM6A 3V39A 3GRJA 3ZNTA 2V1ZA 1M6KA 4S2OA 2Y4AA 2ZQCA 4X55A 1IELA 4Y0OA 4WZ5A 1K25A 4L0LA 2Y2QA 2EXBA 5CHUA 4Y0UA 3OCNA 1DJCA 5TR7A 4UA7A 3ZVTA 2ZD8A 2WAFA 2H10A 4LV2A 3P09A 1ONHA 1PZPA 1JVJA 2Y2OA 4KQQA 1M40A 3UNWA 3G2ZA 4KZ6A 3ITAA 3FWLA 4S2JA 3QHYA 4ZTKA 1PYYA 2H0TA 3IHAA 4E3IA 1ESIA 3OCLA 4OP5A 5AQ7A 3MFDA 3V3RA 2DCFA 5CERA 4OH0A 3NCKA 4MBKA 4S2KA 1JTGA 5DF8A 4OPQA 2J7VA 2Q9MA 1DY6A 3IWQA 4WYYA 4QU3A 1IYPA 3CG5A 3WS0A 4DF6A 1NZUA 1MPLA 5EVIA 3HBRA 1FCNA 3IT9A 3Q7VB 3RXXA 3ZVWA 5EVIB 1BUEA 3MXSA 3ZDJA 1FR1A 4S2NC 2EX9A 4N1XA 4X69A 3WS4A 3O87A 2BG1A 4S2LA 4DE3A 4KZ3A 2HP6A 2EXAA 3IQAA 3PAEA 1K56A 4E6XA 3A3DA 1S6RA 4XUZA 5DTKA 3A3FA 1N9BA 4DE2A 3IH9A 5A91A 3M2KA 3TG9A 3WS1A 3O86A 4S2IA 4KZ9A 5FI6A 1H8ZA 2ZQ7A 3IXHA 1SDNA 1HTZA 3E2KA 3LY4A 2ZQDA 4NK3A 5A92A 1NZOA 1K54C 5KMWA 3HLBA 1ALQA 1K57A 1RCJA 3SS5A 4UA9A 1MKIA 3PAGA 4BLMA 4GKUA 4OVDA 4ZDXA 5GLBA 4K91A 4XUXA 4B4XA 1E4DA 4C6YA 1JWZA 4KG2A 4N9LA 3DW0A 4JLFA 5CGSA 3B3XA 4OPYA 3VFFA 3FKVA 4MEZA 1W8YA 3M6BA 4K0WA 4X53A 5HW3A 2WZZA 3I7JA 4FH2A 5IHVA 3W4PA 2HDSA 5DTTA 3SOIA 4E3NA 3G2YA 3MZEA 1MWSA 4KZ8A 2VGJA 3VFHA 5M19A 1PI4A 2WAEA 3IXDA 3N6IA 1BLPA 1GHIA 4LV3A 1YLZA 3IWIA 1KDSA 4Y7PA 1K4FA 4OONA 4E3LA 4R3BA 5DF7A 2A3UA 3UPOA 3E2LA 1ES3A 1Y54A 3A3JA 1DJBA 1CI9A 4GNUA 4JXVA 4P0MA 5HX9A 5FI2A 1IYQA 2P9VA 2J9OA 3SH8A 4PM6A 4R3JA 1LHYA 3PBRA 1TDLA 3ITBA 3AGDA 3GR2A 1SDEA 3HLGA 5M18A 1GCEA 4X56A 3BLMA 4P87A 1L0EA 1ZKJA 3OPHA 2FFYA 4PMAA 3ZFZA 2V2FF 4PPRA 1FCMA 3UDIA
chains in the Genus database with same CATH superfamily
2OWHA 4JI3M 1PWGA 2XRXB 3NHQA 1KSFX 4QY6A 3WDGB 3P01A 5CHJA 2R44A 3Q7ZA 3UJMA 1VQ53 4G1MB 1JR3E 3LQRA 3CZDA 5JYPA 5D82A 4IBRA 1QYRA 2Y2PA 3T1QB 1PJTA 1OF5A 4LY6A 2DNSA 5TBMA 2Z4RA 3OPLA 1OTAA 5GHZA 5LC7A 4M0WA 4EBGA 2QMIA 2AADA 4I4KA 3PHYA 3ZCBB 2X49A 2QWSA 1MOLA 2O9AA 5HZHA 2PU4A 4Y17A 1Z1SA 2HMNB 3NV0A 4E3MA 1SXJD 4L15A 3KCHA 3IG5A 2WGWB 2YFLB 3F1OA 3VSKA 3K9PA 4HBUA 1CYVA 1ZAEA 5FGOA 2QSFX 1A5TA 3DGYA 4PM7A 3BFCA 1P97A 3BRMA 3DAVA 4DUZM 4R6LA 1SCWA 5STDA 2Z2LB 3E98A 2H5SA 5AI1A 2WSFF 1VQM3 4JI4M 2SARA 1K55A 2FGTA 2X4AA 2VQEM 4WP5A 1WGLA 4EESA 5IU1A 5FASA 4D60A 3AFHA 3KOYE 2E8IA 2H28A 3S29A 3CNXA 4B08A 2QJ7A 4MGYE 4UHUA 2RGOA 5BIRA 4FCWA 3QNBA 2WKRA 1QAMA 1Z6FA 3U61A 1GHMA 1IDPA 5DREA 2IA7A 2C96A 2X02A 4A3VB 4DR1M 2G2WA 2EX8A 4Y15A 1MGWA 1UGIA 5EP4A 1LL9A 3K5TA 1JBSA 3IMAB 5G18A 1EG9B 1B20A 2LVNC 1TIJA 2GEXA 4LFCM 2O9UX 1XMOM 2J9PA 2FH5A 2C9OA 1Q2QA 1YLPA 1OTDA 5DVAA 2LHGA 1NY6A 2OQEC 3VK8A 3GLIA 3T8UA 3F1PA 1BOXA 3JAMS 2YFIB 4GJ4A 3VE3A 1UFZA 1Y4OA 2ZC7A 5JBSA 1UCIA 3MQ0A 1LV7A 3B4OA 2HDQA 4EQIA 4D2OA 3AL0C 3PGBA 7GSPA 5DTSA 2JNHA 3I04M 4GHOA 3BFFA 2ZC5B 3IS2A 1WXQA 1P0ZA 1JTDA 3GRYA 5HDDA 3OC2A 1MKMA 4MN5A 1EFUB 2DAKA 5L2FA 4JI2M 2XZUA 3CPTA 1W2B2 4RX3A 3AGOA 1CK3A 2HDUA 4HP9A 2V1AA 4OLGA 4XXRA 2OOAA 2GZAA 1IV7A 4O7DA 2ML6A 2UXCM 2ZM2A 1DVDA 1JB0F 1UUWB 4L8PA 4QHCA 4J5KA 3VSLA 2FH0A 3T4KA 3UE6A 2BLSA 1X1UA 4N6MA 5GLCA 2ZQAA 5ITQA 4K0KM 2DWNA 3J7AS 3FV7A 1RSNA 3ZGAB 1C7YA 2V0WA 1SIIA 3LYGA 4YINA 1S4RA 3A3EA 2L0WA 2D7GA 4DMZA 1RCLA 1K6SA 1DE3A 3NQZA 2G3QA 2QJ5A 4HKVB 3LIFA 4L9FA 2J8XB 5KP3A 3OWUA 2A15A 3BFEA 4LMIA 4LJ7A 5AYRB 4LGWA 4MLLA 4KZ4A 1G8PA 1O07A 3QRDA 4WYKA 1S3SA 3ICYA 4S2MA 2C5WB 2VV6A 4NSOB 3KOWE 3RFBA 1Q7HA 3VKHA 3L7HA 2CFLA 4OVMA 1NVMA 2I7NA 4WLAA 4MN6A 5H37D 2FFJA 3LIDA 4WMCA 2HMOB 1N8QA 2VLGA 4IBDA 3M2JA 5FLXS 2ZM0A 4KZBA 2DAMA 3PNYA 3IF6C 4M9SA 4QWOA 1MBLA 1SXJE 1ODVA 2JWSA 4HM4B 2PD8A 2PHYA 1PW1A 3G4PA 4UQIM 1QQWA 4LZJA 3K9OA 3MXRA 3HZJA 2XH9A 3B74A 3H7WB 2AHMA 4IBGA 1PWCA 3H4MA 4E3OA 3JR4A 4WHAA 3NULA 2W56B 1OTIA 2OTL3 5EPHA 1I8VA 1CH0A 1LSXA 1R7RA 3BXWA 3DZDA 3BECA 3NWLA 5FAOA 1NJI4 1W63Q 2LYXA 3A0RA 4BL2A 1ZGXA 5KSCA 1V9ZA 3IF5A 3KOXE 1JB5A 4OOYA 3LO7A 1B3SA 2XZFA 3QK9A 1NJFA 2OWPA 3PYPA 3QNCA 3T4SA 1XWIA 2R9WA 1LVNA 1J09A 1MGRA 1XGJA 1XNRM 2K2NA 1LOVA 2WGIA 5GSPA 2L09A 1GSWA 4XBOA 3AHWA 3UMDA 1FGQA 5U47A 3LCUA 3X3XA 3AOEC 3CUEA 1NRJA 1XJ3A 3MBZA 3GLGE 3UMMA 3CWFA 3KSHA 4QPRA 3EX9A 3DWKA 2XD5A 1YMSA 3A42A 1RGCA 2ZMVA 1X0OA 4Q0IA 3B7ZA 3SMPA 3R9XB 3BYDA 4B3MM 4REZA 4HVNA 3HUNA 4B7FA 4WP2A 2WZJA 4DV7M 1RRLA 3X40A 3UZUA 2W3FA 5EVEA 3RFWA 3NC8A 1L1ZA 1GA9A 1TH3A 2HJEA 3PBNA 1E9SA 4XBTA 3MWZA 4DE0A 1CYUA 2HP5A 5F82A 4PDIA 2FFFB 4O01A 3S5CA 1J3WA 3L0RA 2B02A 1QMEA 1T3TA 2RNTA 1PWDA 1M9GA 1IFYA 1T5YA 3KSPA 1C3BA 3KO6A 3K9MC 4KFFA 2JKRI 2QIYA 3CJMA 3ZC7B 5HD3A 4Y5FA 3Q1FA 3D4AA 3CCL3 4D82A 2KNAA 1PJIA 5AIGA 3UNLA 3DBAA 1BYWA 4R4RA 3PFIA 3OV4A 1QANA 4H8RA 5ITXA 4JBFA 2J3WA 1EWZA 2Y2IA 4GC5A 4N92A 3ZH9B 4JF4A 2KXEA 1OT9A 4RNTA 4IBBA 5FA7A 3SHFA 2XROA 1IOUA 4LJAA 3D3OA 2B3TA 4GH9A 4G4NA 1BSAA 1SKOB 2LNHC 4II7A 2WK0A 3E4QA 4U13A 2F56A 1VQ63 1YLTA 4N6LA 2X01A 3MKFA 1JRQA 1LQGC 3RGRA 1TS0A 4LF5M 2CC1A 1IY1A 3IS2B 1E3RA 3ER7A 1KWIA 3AOEA 4X1MA 2IA2A 5KPTA 1TTOA 4OQHA 3MHVC 2UX0A 2F5QA 4WF0A 3GZBA 1AQZA 2PR5A 3D72A 4EEUA 1XXMA 1PFPA 3N8LA 2DMWA 3NECA 1E3VA 3V50A 3GLHE 1KYIA 3CMA3 3FF2A 2XK1A 1BTLA 4WURA 2V1UA 4KHPM 1YSQA 1YVBI 3R8FA 4HM2B 3CME3 2QYBA 9RNTA 2JCHA 4KG6A 2EKKA 1J5EM 2H0HA 1ISKA 3VMAA 2RGQA 5KZHA 1WQLB 5CECA 3GLGB 2ZTCA 2B18A 1J7KA 1IVXA 4NREA 1GA0A 1PI5A 1K6RA 5HGRA 1HNWM 2PDRA 4IJGA 1NHWC 2UXDM 4I3AA 3ZCZA 4I3IA 3IWOA 1G02A 1FW7A 1LI9A 3CCU3 3FF0A 2VIIA 3FUXA 1JZDA 3EHCA 3GMWA 1YT4A 3T4JA 1ZHHB 5GKNA 4R7GA 5DYIA 4EXOA 1IKIA 2EJSA 5LC6A 2GBXB 2JC7A 3Q3FA 2L7IA 5FTLA 2DZLA 4OOLA 4Y13A 2ZQ9A 2EUCA 1GY6A 4ZM8A 4ZBEA 5KIZA 3UE0A 3IH8A 1M1K4 1ULIB 1G5UA 3ECFA 4PM9A 2IY2A 2DNAA 4CPKA 4P16A 2INWA 4H61A 4I38A 3KSGA 3WS5A 3RXWA 3H9WA 3EJVA 3LTAA 4HL4A 4GKJM 1M6KA 4X55A 3KXEC 1IN4A 2QP9X 1IELA 4GIPA 5G1KA 1QDRA 2J80A 1PRQA 2VGLM 1OHOA 3MYTA 3QYEA 2EXBA 3EWKA 5G4YA 4LF4M 3CITA 2ZD8A 8CHOA 3C2WA 1VQ83 2FNQA 3P09A 2QQ8A 1PZPA 1STFI 3C3DA 4KQQA 4XT2B 1M40A 1OH0A 1Q9EA 3UNWA 4WFOA 4KZ6A 4MGZE 3VDUA 5ITUA 3QHYA 4S2JA 1H6UA 1N33M 5CF2A 1PYYA 1XXHE 1QUSA 3OCLA 1YJW3 2W82A 2YX9A 2JZ0A 1GSVA 4NXGA 2LVAA 1G59A 2J7VA 2DENA 5IZ7D 2PR6A 3HHZA 3BY9A 3QWLA 2V1BA 2O3OA 1VQ73 3WA3A 4LJ8A 1WJ7A 3IT9A 3ZVWA 3Q7VB 2VKSA 4Q0JA 1N9JA 2VX8A 3RXXA 4G6ZA 3ZDJA 1TFKA 1ZMVA 3RGAA 2W1TA 4N1XA 4ARZA 1TR8A 2BG1A 2CP8A 4S2LA 1TH4A 1OHSA 3N54B 4KZ3A 2EXAA 1K56A 1NB5I 3GQ3A 4GLQA 5DTKA 4GKKM 4DV3M 2GU1A 1T43A 1GMQA 3TPZA 1IYYA 3IHPA 4WUJA 1N9BA 3JR5A 3GAXA 1RRHA 1QVG2 1CJFA 4DE2A 3GLIE 1IBMM 1Y4KA 5A91A 3WS1A 3O86A 4KZ9A 1H8ZA 2PBDP 2Y21A 3CCJ3 3IXHA 4AKZA 3E2KA 4LGMA 2F5WA 4CISA 4FCMA 4BBTA 4WWUC 4X62M 1KQS2 5A92A 5KMWA 1ALQA 1RCJA 3SS5A 2P0MA 4BTXA 2AVXA 1O7PB 1RN1A 3MG3A 3AMOB 3KE7A 1RGKA 2KAAA 4MMNA 4CGYB 5GLBA 3U6PA 4B4XA 4N9LA 3B3XA 1N9EA 3VFFA 2DHRA 2R0IA 1S4SA 4RNAA 3UGJA 2UUCM 2WZZA 5IHVA 3W4PA 1IV9A 5DTTA 1MNLA 4X66M 2R18A 3G2YA 3KYEA 1QDTA 3MZEA 2CV0A 1RN4A 3LICA 4YWZA 1UGUA 2VGJA 4R71A 2WAEA 4G3WA 1D06A 1TFOA 5DRVA 3KSJA 1BSDA 4G4QA 1IN6A 3FRHA 1A90A 4HM0B 4LSOA 1SZVA 5DF7A 3OX9A 3SATA 4EC6A 3UPOA 3A3JA 3NQYA 1CI9A 2HHHM 3MHEA 1JB2A 1W6YA 3K92A 2W1TB 3S7PA 4BBUA 1LXEA 2WKPA 4R3JA 3B7NA 3ITBA 3H82A 3GR2A 3HLGA 2M1CA 4N6TA 4P87A 3RGPA 4PMAA 2KLIA 2V2FF 1IM2A 3ZQ5A 3FYZA 4HM6B 3HIIA 3AHSA 1XX2A 1EIJA 1HYFA 3QP6A 3SOAA 1GD3A 3RDEA 2CUZA 1RGHA 2Z7JA 3LCEA 2JKGA 1F2KA 3HGIA 1J2BA 5K5BA 1RHLA 3B9PA 1XA7A 1NSFA 4OVZB 3NOPC 2P09A 4LF6M 5TGNA 4C3QA 5DFXA 1PJQA 2Z6BA 4XB5A 3M7GA 4AQYM 3OPPA 2BMQB 3DOAA 4HAAA 4RA7A 5HD5A 3SH9A 2C98A 3G35A 3BWLA 3FG3A 3C7VA 3J2PB 4OUQA 3BNBA 1AXBA 1SG9A 4ZJ3A 1HR0M 2RKOA 1K57C 3WRTA 1AVKA 1P9RA 3OZHA 4FOFA 5HAQA 3KN4A 3T4OA 3E9SA 2JBFA 1A67A 3MKEA 3QYBA 4S12A 3L25A 3CC43 4PKYA 3QAUA 8RNTA 5FAQA 5FTJA 2PAVP 4PD2A 1R4CA 1RNBA 1US1A 4B93A 5ITRA 3MMPA 2RCXA 2JUJA 3CF2A 2C6WB 3MXQA 2O25A 2YFQA 3IPTA 3VF1A 1N9OA 3CHWP 3K3DA 4EUZA 4DBGB 1D6ZA 4UAAA 4KZ7A 2XEPA 2JZ1A 3FRIA 2W3DA 3FE3A 3SAWA 2HMLB 1IKGA 4GB5A 1Q7Y4 1K8A4 3LEZA 4B88A 4DR2M 4FCVA 1TDZA 4MMYB 4IBXA 5GHXA 4AFIA 2Y0TA 5JI2E 1V9YA 3RJUA 1B2SA 1QVRA 1TDHA 3U5ZB 2VEAA 3HWSA 1BNIA 2CG0A 3WOEB 4GW9A 4DXCA 1EA2A 3WR2A 1RKYA 2QENA 3C58A 2JE5A 3S1YA 1ZG6A 2E2UA 3J7BA 5DJTA 4IPBA 3SS3A 2JQ5A 1ERQA 2HP9A 1I4WA 1ES2A 3HJSA 2XA7S 5CGXA 5GL9A 1SARA 4R4SA 1ZS7A 1F4IA 2OAP1 5L10A 1E3UA 1XHBA 3KX0X 4FSFA 4JXWA 3MS6A 5AQAA 3UY6A 2B5RA 1NWZA 3CMZA 5G2GA 4IVIA 2KZSA 1RTUA 2EKFA 1NNUC 2OSUA 2Z6DA 2ZLYA 3S4XA 2UU9M 5F1FA 4AKIA 3UDFA 1FSYA 1NRFA 1T19A 2XF3A 1WYCA 3VP0A 3EGDC 2DZOB 3I51A 4IBJA 3FG8A 2GXFA 3EC9A 4PDGA 3UB8A 4DV4M 2MH8A 3GPPA 5LMUM 1L2SA 3HLFA 4NKPA 1IXZA 5EECA 2D42A 2O9BA 3HJQA 4CJ6A 5BOHA 3H4JA 1MWRA 3NBLA 5HL6A 2L6OA 3TE8A 3D4FA 3DTMA 1I3FA 4GN2A 3VOYA 4QJGA 4BJPA 1N9LA 1NLZA 5FQMA 2K7SA 2ZM6M 1W6GA 3BBZA 4RNZA 2IUJA 3A0VA 1XJ4A 3HCYA 3ZG7B 5E2HA 5KSHA 3O88A 3GPUA 1L3LA 2K6BA 3KZTA 1IEMA 4QHTA 4R1KA 1DVCA 4HOHA 3VK7A 4S2NA 4EQ1A 4FCJA 3CCS3 4LCLA 2CHVA 5FQKA 1R4GA 2R4IA 5IG5A 1DGHB 1T2IA 1LLBA 2KF3A 5G1LA 2A24B 4DUYM 1FYSA 1LOXA 1IN7A 4Y0TA 2HZ5A 1BSCA 1D0LA 4Q7JA 2Q07A 1FILA 4MGHA 3UPNA 5EVID 1UI7A 5IEOA 1W00A 3IJEB 3KSXA 1DETA 4R0QA 2L4EA 1YGEA 2Y2GA 1TF0B 3FPWA 1BANA 3FKEA 1UDII 1MWUA 1M904 5AQBA 5FQ9A 4LGYA 4AKHA 3WOFB 4WEKA 2RCDA 1TGUA 2AAEA 4D81A 5A8BA 3BLSA 1FGRA 5EJCA 1BRKA 2ZC6B 1BZAA 5ITTA 1FUWA 2I9WA 4MN7A 3LH4A 3A76A 2SBLA 3NOUC 1NYMA 1SHVA 4FMBA 1HT1E 1GJSA 4A5RA 1YHQ3 2LBCA 3NBBA 1V92A 1N5HA 3VOZA 1VEUB 1VZZA 4G4RA 5E26A 4EERA 1Z09A 1K4EA 3VGNA 3EQVA 1YUBA 4XK8F 5F1GA 4R38A 1SXJB 2CC3A 3URPA 3LYXA 4LLOB 4DR3M 1GHPA 1TVFA 1GL6A 1CEFA 3DTIA 5BR8M 4JRFA 5CX7A 2R6FA 1TF1A 1VEUA 1ZC2A 4LENA 3MSHA 1K54A 1UCJA 1Q02A 2EFXA 3SBJA 1I94M 3VDPA 1OJLA 3C9PA 4B7GA 4IIAA 1TU5A 2EA9A 4MEIA 1PYLA 1RLSA 1GOUA 3KFUG 4BTYA 2G2UA 3HLDA 1G96A 4OLDA 4XBXA 2XLNA 4F94A 1NV8A 3T6PA 1AVLA 1W6CA 3AMOA 2IWDA 5DF9A 3HK4A 3B4PA 5BVBA 1F5MA 1V58A 1L0GA 1RGGA 4R23A 1HLUP 1SKOA 1VQL3 3S67A 2YKHA 3ISGA 4RZMA 5BU4A 3NDEA 3PBQA 4IJFA 1GVNA 5GHYA 3V76A 4NETA 4I39A 1PZOA 2V1LA 3X41A 4U3TA 4WZ4A 4E3JA 1JJ22 1RGZA 1Q3BA 4DJ2A 1YQSA 2Z77A 4IT7A 3K8ZA 2LHCA 3A98B 4O0PA 1V33A 2MJ6A 2Y59A 1NXYA 1RGYA 2UXBM 2BJWA 3EE1A 4IBKA 2ZL8A 3LUQA 3QP4A 4YY3M 1H8MA 1RU3A 2ZQ8A 1FUSA 3A46A 1YPRA 1DYUA 1BLCA 1HVBA 3U5ZA 3KSED 3E0YA 4G3KA 4Z6YA 1PGYA 1WHCA 4WEJA 4OOMA 4K0XA 1TEMA 4EV5A 2P04A 4PHTA 3A0SA 4ETZA 1ROAA 1SQWA 2PYPA 3Q07A 1PFLA 2KCDA 3KIIA 1L0FA 2HV1A 3FG4A 3MZDA 5HPIA 3HHWA 2KZUA 3MMHA 3NX0A 3ZG9B 4OPRA 2PBYA 4JF5A 1OTRA 2G8LA 1VETB 3GECA 3GDIA 2JY5A 1LOWA 4OP8A 1JN5A 5HPFA 1WE4A 1W2ZA 3GZXB 3A45A 3HVFA 4IBCA 2FNAA 1WMOA 2BWEA 4DE1A 2WKIA 5TJJA 5L09A 3K1JA 2XSSA 1A2KA 4JXSA 1W02A 3EIHA 1YM1A 4U0XA 2LVQD 3LVWA 3GRVA 4O8SA 1CQSA 5L8MA 3U6SA 3HZPA 1X1YA 2ZOIA 4QNMA 4CHTB 1QMFA 4NL4H 3V3SA 4Q53A 3RGSA 3G4S3 3PVSA 1QAQA 4IVKA 5J7EA 1NO3A 1IVVA 1Z5AA 2F4YA 3RNTA 3NY4A 3IXBA 3E4OA 4EETB 5DJUA 2R4JA 1R4YA 1KVLA 3IXGA 3EBTA 2C99A 4AG5A 1BAOA 5JYOA 2JY8A 1N36M 4GCZA 2P38A 4QHSA 2QPAA 1NY0A 1TDGA 3NM7A 2GU3A 3CCV3 3GTCA 4E6WA 1I2SA 3S28A 2X71A 3U6OA 1D0MA 2E2VA 3H7WA 4ANRA 4JXGA 3GSGA 1YJ93 1K38A 4DV0M 3C38A 3GSPA 2KX6A 2BNGA 1S1ZA 3GO8A 4R3DA 1IU7A 5AVFA 5FQIA 2JY7A 2IUKA 1ZTUA 3NDGA 3W4QA 1IQPA 4LFBM 3JVVA 2WO0A 2FS1A 1I70A 1KGFA 5LBRA 3LI9A 5FTKA 3PXMA 1TS7A 1JBTA 4PKYG 4RNYA 4J9AA 4JI8M 5FTMA 2HKJA 1GS3A 2WKEA 4WYKB 2GDNA 1YJN3 1RCKA 1RJOA 3LOYA 4AW4A 1KE0A 1OIPA 1VEKA 4PM8A 3PXPA 3ZNTA 3D8LA 4HNBA 3MQQA 3B42A 4S2OA 2Y4AA 1W5TA 1IVUA 3KFQC 4Y0OA 1N34M 3GWRA 4CLCC 3BU4A 3UB1A 1V34A 2FXTA 4Y28F 2Y2QA 4WN5A 1VETA 3OCNA 1DJCA 5TR7A 3ZVTA 3T1SA 4HLQA 3LEQA 3C8CA 4LV2A 1AUAA 4G3OA 1ONHA 3UL5A 1LT0A 3N8BA 3T1HM 1YLAA 1F9IA 2M7UA 3N9HA 1S67L 3IHAA 4JN6A 1ESIA 4E3IA 2MGWA 4OP5A 1NWWA 3LR4A 5AQ7A 3MFDA 2QZ4A 3V3RA 2FE8A 1X1WA 3LT8A 2VV7A 4S2KA 3HX8A 6STDA 4NRVA 3GQ5A 3DZLA 1JTGA 4OPQA 5DF8A 3IWQA 3RTYA 4GSPA 2JN7A 4QU3A 2ZAOA 1YKDA 4WYYA 3WS0A 4DF6A 1NZUA 1RGEA 1OCVA 1T3BA 1E9RA 3Q8XA 3TE6A 2VQFM 1BUEA 5EVIB 4R9LA 5DKKA 1XJ2A 1FR1A 4S2NC 1UM8A 2HMMB 3LIBA 2W0NA 4DE3A 1LSWA 4NOOB 4G4OA 1A2PA 3G8ZA 1IXSA 3C3EA 3L28A 1XXHB 1QAFA 3QP1A 1NDOB 4XUZA 4OW0A 4BU4A 4GHLA 1TH2A 4L16A 1PM5A 1BRSA 5ELJA 3L27A 1DRMA 3RE8A 7CATA 3DUKA 3D3LA 1NY5A 3M6AA 1K9M4 1DGBA 1JBRA 1RGAA 3EOIA 4XT2A 3LQQA 5F6AA 2V1CA 1OPYA 3SOYA 4F1IA 3TWMA 3HLBA 1DGFA 2CHCA 5FEGA 3B7CA 4ITQA 4UA9A 1MKIA 3PAGA 4GKUA 4EEPA 3QP5A 4QOSA 2PD7A 4CQHA 4ZDXA 3OWSA 1L8QA 1N77A 2F5MA 3X42A 4K91A 4P17A 4XUXA 4MB7A 3DW0A 4JLFA 5CGSA 1LL8A 4JV5M 4KUOA 2DAGA 2F5OA 4MEZA 1BSBA 3V98A 1T1BA 4X65M 3M6BA 5HW3A 3I7JA 2BIRA 1T18A 2EA0A 2ML5A 1BNRA 2D7HA 3SOIA 3DMCA 3F7SA 2BJVA 1MWSA 3CU3A 3D79A 4KVHA 4KZ8A 3T1XA 3LR5A 1UGHI 3CAXA 3N6IA 1LTMA 1YLZA 3FUUA 5ELUA 1W01A 1KDSA 4HIAA 4Y7PA 3EIEA 2FOIC 4OONA 1DP6A 3WA2X 2CFGA 4R9KA 3PR6A 4GL6A 1GOVA 2GEYA 3CC73 2IMJA 1ES3A 3CI6A 2F5NA 5HX9A 2RFRA 2G5GX 1GOYA 2C10A 3K0ZA 3GLFA 1VEGA 3PYJA 3S7OA 4Y3IA 4DN0A 2KRTA 5FI2A 2MR9A 1QAKA 3V92A 3GP1A 5AVEA 4B9OA 2J3TD 2V6ZM 4LZZA 1OGZA 1ULJB 4WW0A 3JUPA 1TDLA 2XRNA 3T50A 5M18A 4FW9A 3F14A 5ITXE 1GCEA 1SDEA 3B47A 3BLMA 4FMAA 3DY5A 4PPRA 1O7HB 5IG3A 2CFKA 3FGYA 2CKFB 3TOIA 3JUMA 1N4OA 3F7XA 1V74A 2CWBA 3B8LA 3V5MA 4F3LB 3KSFA 3GLHB 2W03A 3WWXA 1SXJC 5E2GA 4GD6A 1EQKA 1GSXA 3UB6A 1J9MA 4H6JA 1GY7A 2JA2A 4Z9QA 5TBMB 4LFAM 1A0KA 1YE9A 1MXOA 1VDLA 5TGFA 6RNTA 4MM3B 2CK3H 1C7HA 2W2CA 3W0FA 1X37A 4Z1WA 3PBOA 1P3QQ 5DFLA 3U1WA 3F1NB 5EXSA 2Y91A 1FUTA 1G68A 4JGOA 3TWKA 3NV0B 1Y8GA 2ZHXB 1BUJA 4WZ5C 1ONGA 2OTJ3 5HSQA 3MJQA 1LNIA 2OOBA 3BIRA 4H3UA 4ILFA 1FNNA 3H82B 3TSGA 1KVMA 2HDRA 5EP3A 4EW7A 2VK3A 5E2EA 1CUKA 4MBFA 4I81A 1G71A 3GRDA 2D1WA 4DV6M 2CX0A 3KSIA 1HNZM 1ZV1A 3K2LA 4DJ3A 2KRKA 5EQLA 1R2ZA 2K31A 1WR1B 4YHHM 2W0QA 2E2TA 1PIOA 3AGFA 5EE8A 2Q2EB 5IG4A 2J8YA 3UDXA 2QPNA 4HM3B 2LXEA 1K734 4AI6A 4JI6M 3Q82A 5CXWA 2WUQA 3W8KA 3I563 4PAUA 4X6TA 2Y20A 3J80S 1YIT3 1YLJA 1YMXA 4WM9A 2NUTC 1S5AA 1BRGA 4EWFA 1ACFA 2ZM8A 4P6ZM 3C7UA 4EBNA 3D8BA 3U60A 3KKGA 4IBIA 3GLFB 2CX1A 3PCRA 4K90B 3JPUA 1FGOA 4DXBA 1NLYA 4MJDA 2ZAMA 3W4OA 4PCZA 1DP9A 1JNQA 4AKYA 4OPZA 5EV0A 3C4OA 4RBNA 3SS4A 5A90A 3TDGA 3PNVA 1B27A 1SPUA 3DA1A 4K1VA 1FSWA 1OHPA 3Q8GA 4HEOA 3CCQ3 1G0TA 3D9YA 1JZOA 3F9SA 3HLCA 1OJ5A 2OLVA 2XDMA 3LXUX 4E04A 2HAKA 1BRIA 3EQQB 2Z2MB 4XDVA 4TUWA 2GSPA 3FUVA 2HPBA 4HZ9B 1EUIC 3TJZC 1IFQA 3NBIA 1FR6A 4AG6A 1XP4A 1RP5A 3W67A 3O5YA 2C4BA 2IWCA 2UWXA 5EVLA 1TD5A 4DKIA 2QGUA 4M4XA 2E8JA 3JUOA 1IT7A 3MR0A 1DP8A 3KS4A 4JGPA 3KOZE 1OIZA 4HY8A 3HX3A 1Q39A 5E43A 4R4KA 4HHDA 8CATA 3GV9A 1E25A 3MKIA 2B1XB 4BD1A 2L4FA 4W5WA 2XR8B 4JI7M 3EBYA 1XMQM 3X3YA 4NSRA 4N3VA 4GZBA 3UE3A 2P08A 3HHYA 2KDLA 3GLHA 1S1YA 4GD8A 1IT8A 5C1BA 3VP3A 1Q864 4QY5A 3BQAA 3U97A 1BNGA 5HDSA 1O7MB 1MU5A 3BNEA 4NPBA 4FH4A 3LVVA 4IEDA 4RYEA 3FUTA 4KT0F 3HHXA 2XSHB 3ZG8B 1PU4A 3EN1B 3LI8A 5C5KA 2M7VA 1TRQA 4WBGA 2JKTM 5KP1A 3A5EA 4O02B 1U8CB 3KYQA 3FTCA 2W9PA 4R80A 3NHXA 2YKFA 3OW22 2B95A 1BVIA 1HJPA 1L0DA 5HAPA 3C4PA 1I2FA 1LOYA 1QZEA 2ZL1B 1IN5A 3LMLA 2K3DA 3EEHA 3OLOA 4EBLA 5AJGA 4NXEA 2EFUA 1G41A 5CHMA 2Y2MA 3SYLA 3WRZA 1K56D 4GRIA 2XSZA 3VP4A 3BFDA 3U6EA 5FSRA 4AKGA 3SH7A 3GZRA 3LR0A 3LMMA 4NXNM 2Z76A 1U5OA 1N78A 3O8YA 5EVIC 2F98A 4JF6A 3MJ5A 4EUVA 1LQMB 2GJ3A 4S2PA 2L1SA 1FZUA 2V0UA 2K9DA 3BOSA 3KDSE 2W04A 3VV4A 3G32A 1BULA 4BQMA 1S723 2CWTA 5IF6A 2OOVA 5GLDA 1GLNA 1TS6A 1PJSA 1OF5B 2OQEA 2GQFA 1UI8A 3LIAA 2HF6A 5AEUB 4LJ9A 3L2AA 3CLOA 1BIRA 3NIAA 4LG2A 4LRXC 3L26A 1HD8A 3PS8A 4QNRA 3TL4X 2Y74A 1XXHA 2Z6CA 4M0DA 2Y2LA 3LY3A 3FZCA 2R41A 5M1AA 1O7EA 3SXXA 3LZAA 3T4QA 3CPTB 1IQYA 4GS9B 2BHMA 5IENA 4CLCB 2QCUA 5HAIA 3UN7A 3IX8A 2CWUA 2O5RA 1KOUA 4HESA 2WGWA 4LV0A 5EOEA 2HMJB 1BNFA 1KC84 2F5SA 3F1NA 3HUOA 2Q9NA 4M3KA 4FWGA 4DRTA 5EP1A 4LJ5A 1AV4A 2OQ4A 1O7NB 3KS8A 2W3HA 2MC8A 3IBJA 3PBSA 4DDSA 2RGHA 1G3IA 3O3VA 2P0XA 3W2ZA 3UE1A 4HBTA 4XBYA 1W5ZA 1AIPC 7RNTA 4PT5A 1OMEA 2OCTA 5FI7A 3I01M 2M5ZA 1L5GB 4DV2M 4I3JA 3FKWA 3BY8A 3JUNA 1SKFA 2NUPC 1WMPA 1OACA 2L4VA 1H8YA 5AIHA 4QB8A 5EXXA 3AJIB 3C30A 2ZDJA 3OXAA 1ES5A 1NU3A 3RH8B 5HWWA 4ID4A 2Y73A 3EEAA 3UPPA 1IQXA 4IIWA 3G6E3 1GSPA 2XGNA 1WNHA 2R9XA 5LMNM 4EV2A 5IREB 3H51A 4LGQA 1XB2B 4R1GA 1NHGC 3Q81A 1UUVB 5D3OA 4B3RM 2XSOB 2WKQA 2CHQA 4F2LA 4BB9A 4EW5A 5KP4A 5EEOA 1IQ8A 5CLKA 3SC3A 4HOIA 4G3VA 4XGIA 3K63A 1ZMWA 3E99A 2QZ6A 4CDLA 2WZXA 2WOHA 5EUAA 2HJ9C 1IXSB 1E94E 1YSPA 1OFHA 3FYDA 2GNOA 1I5QA 1D1JA 1XJ6A 2XFSA 1JR3A 2LB9A 1UUGB 4B3TM 3CXC2 3ZG5A 4AEQA 2VGKA 3SLUA 3DGLA 1KE3A 1HT2E 1NJ4A 2O01F 3FZWA 5BPVA 4U0TA 7STDA 2DHYA 3FTDA 1BNJA 2BASA 3DWZA 3F40A 1MY8A 3PZWA 1JN5B 1IYSA 2CFOA 2H1RA 4CIZA 4L8OA 4DV5M 3HY5A 1KGEA 3IX3A 5HARA 1VM1A 3MK6A 4QWTA 3M8CA 1I3IA 3B7QA 2D01A 4ZAMA 1HZ1A 4ZRRA 4IJEA 1G6OA 2GX5A 4JF8A 4OVZA 3BEBA 1UWNX 2QNJA 1E3UD 3NBJA 3M0EA 1YLWA 1W7CA 4HH2A 5F5YA 3J81S 2BMRB 3HJIA 4EV4A 3H3HA 2WSEF 4ORLA 4KQRA 2WOFA 4MBHA 4BBVA 2QHKA 1TRPA 5HDCA 3N4IA 3UB9A 3GQZA 5CRFA 3THGA 2LWXA 3UJNA 3DM8A 4CLCE 1T1AA 5FQJA 1CEGA 4MDZA 3T0UA 1ZMUA 4NEED 3FTFA 4GMQA 3AV0A 1IY0A 2QKPA 1BSGA 1GO5A 1G28A 2DXIA 3KP0E 3AGEA 3CPOA 4N6OB 5EM0A 1B2UA 3GLIB 1R5LA 2F99A 3T1YM 4IBEA 1FJGM 4GEWA 2BMOB 3GPXA 1VQ43 2JY6B 2MROB 5MC7A 3ALAA 1ZG4A 2W3EA 2ZC4B 3DTEA 1Z6TA 1RMSA 4P85A 3VSYA 1Q40A 1UW1A 1ES4A 4FVMA 3CD63 3G34A 4EU0A 1I0VA 3PXGA 2V1ZA 2VZWA 3GZYB 2ZOHA 2ZQCA 2I9VA 3TRCA 5CXOA 1TP6A 4L0LA 2L4RA 5CHUA 3QP2A 4B3SM 3G16A 1B2ZA 4JI1M 2V8FA 2H10A 3SFZA 4LJ6A 4X2OA 1JVJA 2C9CA 2I7PA 3R7WB 3J27B 3W0LB 4HM5B 3FWLA 3ITAA 2HCBA 3T38A 4MCWA 1D7EA 4L9GA 3W68A 1V57A 2L7HA 2VGLS 2R4EA 1DMMA 1VDDA 4OU7A 3BLZA 3U60B 1JKGB 2XGLA 2PT7A 1DY6A 4LJ4A 5HOHA 3I4YA 5AEWB 1YGWA 1IYPA 1H3QA 3MG1A 3CG5A 4GHIB 3CC23 3ULFA 4KFDA 1FCNA 6GSPA 4BBAA 3GLGA 3UB5P 1E97A 5F69A 1QALA 2EX9A 4X69A 2WGQA 2X8AA 3HU2A 3SW1A 3LFVA 2HP6A 2DAIA 4NRWA 2OOVC 1OTEA 1S6RA 1JR3D 4R70A 1FGTA 3D5GA 1EEJA 3A3FA 1Q3CA 4LF9M 1WA9A 4FTXA 3VFDA 2CHGA 3KYZA 1XC8A 1QAOA 5FI6A 4N6NB 2W1RA 2ZQ7A 1SDNA 1HTZA 3LY4A 4NK3A 1NZOA 1K54C 4K61A 2ZL1A 5G4ZA 2QBYA 2A5YB 4FWHA 4TX4A 3LR3A 4BLMA 3OWYA 1N8R4 3E46A 2ACGA 2L1MA 1N75A 1W5SA 3V99A 1JWZA 2O99A 4KG2A 5F3WA 2VF8A 3WODG 3D5IA 5D83A 1OKSA 3UK6A 4OPYA 2UV0E 1XFNA 1N5PA 1W8YA 4HI4A 4K0WA 4LEHA 4LCBA 4XDWA 4FH2A 2ZBKB 4R3AA 1ROVA 2R62A 4MGKE 1AY7A 2Z8YM 3F1PB 4HP4A 5M19A 1CF0A 2H0GA 3CPW2 3K7CA 3U2AA 3NOTC 2CMNA 1N32M 1BLPA 2WGOA 3IWIA 4KODA 4KUKA 1YI23 4O3VA 1IBKM 1K4FA 1PJJA 3SYKA 1VQO3 2LTUA 1AR0A 1F98A 5L8RF 1S66L 5EVHA 1RGFA 3E2LA 1Y54A 4JXVA 4GNUA 3U6MA 5CF1A 4HYZA 1VQN3 3WMDA 1K3WA 1GABA 2LVPC 1L2DA 3DXOA 5FW5A 1GL7A 1IYQA 2P9VA 3BJNA 3G6OA 4RKUF 2J9OA 1PRBA 1LHYA 2MJ5B 3KW6A 3PBRA 4NXBA 1IN8A 4RQ9A 3U61B 3FD9A 1Z59A 4X56A 2KF5A 1GKIA 1L0EA 4JXJA 2MF7A 4JGQA 1GYBA 4KLNA 2B24B 1FCMA 1TUHA 2STDA 3UDIA 4BMWA 1HQYE 5CTMA 1MN3A 3T4TA 1MJGM 3WS2A 1IY2A 1ZO2A 2PYRA 1GMRA 1HNXM 2DI0A 1QJGA 1O7GB 5A2QS 3SX1A 3PTEA 3F8HA 4CCVA 2WADA 4I4LA 4KT3B 3N8SA 3WHLA 3CCR3 2DRWA 4BL3A 3V67A 5AIIA 1K55C 2VDBB 3FKAA 4K1UA 2W3GA 1YAXA 5EXPA 5A93A 3CNMA 1N9NA 1JB4A 4RX2A 1U60A 3X3ZA 4YNRA 3OBFA 1KFVA 4HJ3A 4I5SA 1GD4A 3U6LA 3UMEA 1STDA 4LV1A 4BWIA 2VA0A 4WL9A 1NYYA 2PRFA 1VQ1A 5D81A 1K0KA 3HLEA 1RDSA 2P5TA 2XQZA 3I4VA 1D0KA 3UO9A 1XKZA 2GNXA 4PEJA 1JV2B 2JXNA 1PW8A 1YNVX 3HREA 4ZJ2A 2HGVA 4ESPA 2HWJA 4N6UA 1L1TA 4BD0A 2BT3A 1ZX2A 1QUTA 3OPRA 4JKTA 3IHBA 5IEPA 3GQ4A 4PM5A 4LYLB 4F3LA 1JNUA 5ITYA 5BXQA 4ETXA 2UUAM 1I2WA 4Q8IA 3IBRA 4OKPA 4AZFA 4EBPA 1EI5A 4LRZE 4WELA 2VV8A 2Y55A 3HIGA 5HFOA 2APLA 3LCVB 2KF6A 1VQQA 1I0XA 4FCTA 2KF4A 4MH0E 1BRHA 1MWTA 3MZFA 2QA43 4JI5M 4KZAA 5DYGA 4NG2A 1YSYA 4FWDA 3MF0A 3S27A 3FYCA 2LVOC 1MZUA 2J5YA 5J4EA 2V9AA 1W4NA 3ROBA 1SIHA 2W9QA 5E2FA 3BFGA 2UUBM 2EX6A 3STDA 3Q2PA 3ZG0A 2OV5A 4EYCA 1XFQA 3D9RA 1YIJ3 4GB7A 2OLUA 2JP7A 3CF0A 5CGWA 5EP2A 2P7JA 2Y2KA 1HKXA 3SYUA 3CCM3 2A49A 1HQCA 2FZ0A 5EOOA 3FH1A 1F8NA 1FOFA 3R4KA 2H5XA 2CV2A 4KO8A 5EQTA 5HWVA 3MQOA 2F86B 5CTNA 1TTEA 3VLFB 1UCKA 4GC9A 3JYIA 3SARA 2HOHA 3I553 1NB3I 2OPFA 3NBRA 4STDA 3S22A 3SHGB 5IT9S 4P6BA 3HJKA 2Y2NA 4HQAA 4RVAA 3QP8A 5HL1A 1DO2A 1OGXA 1UWPX 3PBTA 2KW0A 4HJLB 1OFIA 3PCSA 4M9ZA 3LT9A 4EXRA 1VQ93 4HEFA 4IHQA 4LZIA 3FLJA 2CH9A 4YOFA 3TQSA 1B21A 1OTBA 3U6CA 3FC7A 5F83A 4M9XA 2M7OA 1T6OA 3IG8A 5KO3A 3T8NA 2A2LA 2JKFA 3HUMA 3N7WA 4FCFA 4BIRA 2XD1A 5F68A 4DDYA 2ERCA 3T1RA 1AWIA 2PNCA 4LRTA 4LF7M 2W56A 2Y2JA 5AQ9A 3L29A 3SASA 1STZA 3MFXA 3F1OB 5EXTA 1JWVA 4KENB 4J8TA 1WGNA 1OQYA 3HL9A 5DFYA 3MSOA 1PNEA 1Z5CA 4CJNA 1Q40B 1W5DA 2ZC3B 1LRAA 2WSCF 5FATA 3T4LA 1A2VA 4X68A 5J8XA 2LH0A 1VEJA 4ZPXA 3U6DA 3I0YA 3Q90A 1CQAA 5AIFA 4BENA 2JHEA 1BLHA 1JQJC 5JPUA 4X25A 2N35A 5FQQA 5E6JA 1W8QA 2PU2A 2IYJA 3VP1A 1Q2PA 5AYSC 4FMDA 1ERMA 3L9KA 2DWMA 3AGNA 4YFMA 3T12B 3E4RA 1VQK3 3DTKA 1LL5A 2KOIA 2KNVA 4BLCA 3FCSB 1DJAA 1G6AA 5FDHA 3MPHA 2JKTI 2RRUA 2KHHA 1KGGA 3FUWA 1CI8A 3U4LP 4GITA 3A3IA 2YR0A 4CLCA 5FL3A 2KA6B 1LNHA 2O9CA 4GHIA 1FA3A 2VJWA 1Q42A 1WMNA 1BLSA 2QBYB 2R45A 4UN2B 4O8GA 1BNEA 1O7WB 3IF6B 1K28A 2P05A 3CF6E 2DKLA 1Y28A 1YLYA 2YNMD 3G30A 5GLAA 4LRYC 2RBIA 4NXMM 3BQ8A 1ASKA 4C75A 3G31A 1KE4A 5IT5A 4GHAA 5I94A 4K08A 4GDBA 4MMZB 3SAUA 1D6YA 2OAQ1 4N9KA 4DR7M 4P6ZS 4ARZB 2INXA 1G4AE 2WGVA 4QD4A 1ZQ9A 5DNYA 2Z3XA 2CFWA 4JPMA 1H5XA 4OQGA 1KDWA 3EN8A 1DV0A 4IUKA 2I72A 3K3CA 2CG1A 2E5LM 4ZJ1A 2V20A 4L78A 3CTWB 4GOGA 4HBRA 1QVF2 4OQIA 2KXGA 4WMCD 2ZTDA 5FAPA 3ZHHA 2ZMAA 1XGIA 1X1XA 3FPVA 1C1KA 4MNRA 4KZ5A 1TS8A 1EW0A 1RGLA 3IECA 1ORYB 2IWBA 4LFUA 4RF1A 2CW9A 2XFTA 1CEWI 1OUNA 2XR0A 3EF8A 2CV1A 4H6JB 2BU4A 2C11A 3P7NA 4B7HA 3CGWA 1BRJA 3C5AA 4LRSA 1DO0A 4FD8A 2Z4SA 3M6HA 4OQ0A 3SAVA 1EKMA 2DVWB 2ZBBA 1NJGA 3HU3A 1HZOA 4L9EA 2Z7AA 2Y8HA 2ZJ9A 4JGRA 4E3KA 4XM4A 4D80A 2UUGC 3P98A 5A0OB 4GS9A 1K41A 2P9VB 3EQUA 3DGMA 3LTDA 2XLJA 4N6V0 1OT6A 4N1HA 3BNCA 5DKLA 3NI9A 3N8RA 4L7KA 1B2XA 1WYBA 1TJDA 3ZYTA 2NQ8C 4LCMA 3B33A 3TWLA 4NC6A 1I2GA 1RN7A 3UL6A 4L4UA 2VF7A 3GPYA 3KVWA 3E21A 4GDNA 4NXFA 3U6QA 2Y2HA 3JUQA 4UA6A 1IYOA 2Y0QA 1D6UA 2RL3A 3IF6A 1BT5A 3WHOA 3UB7A 4HH3A 4DR6M 3Q1CA 1RNTA 1GY5A 3GLFE 4B4ZA 2DAEA 5IG0A 5FTNA 5EFWA 2P74A 3HOHA 2CIUA 3EB8A 2H0YA 1Z5BA 3HLWA 2W27A 1OJGA 1T1CA 3BB9A 2OWJA 5I97A 3K2NA 3NXJA 4L6V6 3LTCA 4FMCA 3KP1E 4Y2FA 4KQOA 1GMPA 4IUHA 2DWLA 3ILKA 3CCE3 2EX2A 1OAIA 2H0IA 3GRRA 2OOLA 5CEDA 4X64M 3BW6A 2UGIA 1LI0A 3B89A 2F4VM 1PY3A 4FR9A 4FCZA 1B2MA 1VHMA 3F92A 3TW8A 2CEAA 2CRUA 1L2BA 1JWPA 5L07A 2R78A 1DGGA 5CEBA 3T15A 2K0BX 1BNSA 1YVSA 2O0YA 2WKHA 4KG5A 1XNQM 1FCOA 1DGHA 1DMQA 5HWTA 2JDIH 2A24A 3SVAA 1H0MA 5J3WA 3Q7VA 3OOVA 5FSWA 5KQ8A 3G713 1Q824 2YFJB 1EROA 2M60A 3DFZA 4DR5M 1W63M 1ESUA 2J7NA 1S0WA 4L8RC 3ZNYA 4KFEA 5CK6A 3GRUA 1JKGA 2RSXA 2BO9B 2YQZA 1XA1A 3VP2A 3FSDA 2EWVA 2KEBA 1FQGA 2K47A 1NNVA 5TFQA 3HU1A 1W79A 3GVBA 2CE7A 4HJ4A 4CLCD 1QMAA 1W7FA 3R7WA 2PZVA 2KDKA 3S7QA 4Z8XA 1BUQA 1FIKA 4LF8M 1BSEA 4QOZC 1XPBA 1WIVA 4JYAM 2CFDA 1R6BX 1WTHA 1BRNL 2WYXA 1KD14 3BNDA 3CUEC 3VE4A 3BM6A 2OO9A 5IW9A 3V39A 3DGOA 4J5GA 3GRJA 3HKPA 5RNTA 4LPZA 4WZ5A 2W6JH 2EWWA 1K25A 1OPXA 2F5PA 4EIWA 1BVSA 3NBXX 4Y0UA 4RF0A 4MMXB 4OK0A 2BTFP 3JVUA 1K82A 3VKGA 2DWZB 1C54A 4UA7A 2HMKB 3LGOA 2WAFA 2JKRM 3OTOM 3S7NA 4Q0HA 4HM1B 4HM7B 3LIEA 4HJ6A 4ME4A 3F8XA 2Y2OA 1MC0A 3G2ZA 1EE8A 3WHKA 5FEFA 1SXJA 2R46A 4ZTKA 2H0TA 2QEX3 1K3XA 2BWBA 2DCFA 5CERA 4OH0A 2HL7A 3NCKA 4MBKA 1NV9A 4JI0M 2ZANA 4I5QA 1VB6A 2Q9MA 3EGXC 2ZA4A 3IX4A 1MPLA 4UQIS 4OX9M 4FUWA 1R2YA 3HBRA 5EVIA 3NJAA 4NHFA 3DH2A 3MXSA 3SEDA 4I8OA 2G7UA 1QZMA 1BU4A 3WS4A 3FTEA 3HI7A 4DV1M 3O87A 2Y79A 2XSZD 3SZTA 3IQAA 3PAEA 2L2DA 1HU9A 3A3DA 4E6XA 1BGSA 2V8CA 1T2HA 2Q0OA 2R65A 5IWAM 5EM1A 1GJTA 3IH9A 1OAOC 3M2KA 3TG9A 1IK3A 4S2IA 1DMNA 4O2HA 2EO2A 2CWVA 1P9WA 3SMSA 2ZQDA 2DZNB 3AKZA 1I2EA 2D02A 1M1XB 4UEYA 4DR4M 1K57A 3LTBA 4HM8B 3E4PA 2K54A 2K0MA 3JVCA 4OVDA 1SJWA 5IERA 1VQP3 1E4DA 4C6YA 2D7EA 2J7OA 3NM2A 4BTWA 3J7Yd 3FKVA 1D2NA 5JI3E 1UCLA 4X53A 2KRUA 3AOGA 2HDSA 3HJ8A 4E3NA 2QHOB 5KQDA 4MGIE 1NNJA 2J3TC 5C18A 2ZMFA 1L2CA 5KPZA 3VFHA 1FGMA 1PI4A 3IXDA 1GHIA 4LV3A 2XA7M 5I5LA 3MG2A 1IBLM 2GBWB 2BNKA 3VOLA 4KQDA 4FD2A 4KZ1A 3LW5F 4E3LA 2LB5A 4IBFA 4R3BA 2A3UA 1IXRC 5IS1A 4X2HA 4P0MA 1DJBA 3G0KA 3NUVA 3ZQJA 4X1LA 5JPPA 5KPRA 1VG5A 1Q814 3SH8A 5FDSA 1E32A 1IVWA 1MX0A 4PM6A 1KSIA 3DGNA 2C5RA 4HZBB 3AGDA 1NO1A 2KNZA 1LSVA 2LQVA 1ZKJA 3OPHA 2FFYA 3ZFZA 3FG1A
chains in the Genus database with same CATH topology
4JI3M 1PWGA 2XRXB 1KSFX 4QY6A 3WDGB 5CHJA 3Q7ZA 3UJMA 1VQ53 4G1MB 3CZDA 3LQRA 5JYPA 5D82A 4IBRA 1QYRA 2Y2PA 1OF5A 4LY6A 2DNSA 2Z4RA 3OPLA 5GHZA 5LC7A 4M0WA 4EBGA 2QMIA 4I4KA 3ZCBB 2X49A 1MOLA 2PU4A 1Z1SA 2HMNB 3NV0A 4E3MA 1SXJD 4L15A 3IG5A 2WGWB 2YFLB 3VSKA 4HBUA 1CYVA 1ZAEA 5FGOA 4PM7A 3BFCA 3BRMA 4DUZM 1SCWA 5STDA 2Z2LB 2H5SA 5AI1A 1VQM3 4JI4M 1K55A 2FGTA 2X4AA 2VQEM 4WP5A 5FASA 3AFHA 3KOYE 2E8IA 3S29A 3CNXA 4B08A 4MGYE 4UHUA 2RGOA 4FCWA 3QNBA 1QAMA 1Z6FA 3U61A 1GHMA 1IDPA 5DREA 2IA7A 2C96A 2X02A 4A3VB 4DR1M 2G2WA 2EX8A 1LL9A 5EP4A 3K5TA 3IMAB 5G18A 1EG9B 1TIJA 2GEXA 4LFCM 2O9UX 1XMOM 2J9PA 2C9OA 1Q2QA 1YLPA 5DVAA 2OQEC 1NY6A 3VK8A 3GLIA 3T8UA 3JAMS 2YFIB 2ZC7A 5JBSA 1LV7A 3B4OA 2HDQA 4EQIA 4D2OA 3AL0C 3PGBA 5DTSA 3BFFA 2ZC5B 1WXQA 1JTDA 3GRYA 3OC2A 5L2FA 4JI2M 2XZUA 1W2B2 4RX3A 1CK3A 2HDUA 4OLGA 4XXRA 1IV7A 4O7DA 2ML6A 2UXCM 2ZM2A 1DVDA 1UUWB 4L8PA 4QHCA 3VSLA 2BLSA 4N6MA 5GLCA 2ZQAA 5ITQA 4K0KM 2DWNA 3J7AS 3FV7A 3ZGAB 1SIIA 3LYGA 4YINA 3A3EA 2D7GA 1K6SA 3NQZA 4HKVB 5KP3A 3OWUA 2A15A 3BFEA 4LMIA 4LJ7A 5AYRB 4MLLA 4KZ4A 1G8PA 1O07A 3QRDA 4WYKA 1S3SA 4S2MA 2C5WB 4NSOB 3KOWE 3VKHA 2CFLA 4OVMA 1NVMA 2I7NA 5H37D 2FFJA 4WMCA 2HMOB 1N8QA 3M2JA 4IBDA 4KZBA 5FLXS 2ZM0A 3PNYA 3IF6C 4M9SA 1MBLA 1SXJE 4HM4B 3G4PA 1PW1A 1QQWA 4LZJA 3MXRA 2XH9A 2AHMA 4IBGA 1PWCA 3H4MA 4E3OA 3JR4A 4WHAA 2W56B 5EPHA 2OTL3 1R7RA 3DZDA 3BECA 3NWLA 5FAOA 1NJI4 2LYXA 4BL2A 5KSCA 3IF5A 3KOXE 1JB5A 4OOYA 3LO7A 3QK9A 2XZFA 1NJFA 2OWPA 3QNCA 1XWIA 2R9WA 1LVNA 1J09A 1XGJA 1XNRM 2WGIA 2L09A 4XBOA 1FGQA 5U47A 3X3XA 3AOEC 3MBZA 3UMMA 3EX9A 3DWKA 2XD5A 1YMSA 3A42A 3SMPA 3R9XB 3BYDA 4B3MM 4REZA 4HVNA 3HUNA 4B7FA 4DV7M 1RRLA 3X40A 3UZUA 3RFWA 3NC8A 1L1ZA 1GA9A 1TH3A 3PBNA 1E9SA 4XBTA 3MWZA 4DE0A 1CYUA 2HP5A 5F82A 4PDIA 2FFFB 3S5CA 3L0RA 1QMEA 1T3TA 1PWDA 1M9GA 1T5YA 3KSPA 1C3BA 3K9MC 4KFFA 2QIYA 3CJMA 3ZC7B 3Q1FA 3CCL3 4D82A 1PJIA 5AIGA 3UNLA 4R4RA 3PFIA 3OV4A 1QANA 4H8RA 5ITXA 4JBFA 1EWZA 2Y2IA 4GC5A 4N92A 3ZH9B 4JF4A 2KXEA 4IBBA 5FA7A 3SHFA 4LJAA 4GH9A 4G4NA 2LNHC 4II7A 2WK0A 4U13A 1YLTA 1VQ63 4N6LA 2X01A 3MKFA 1JRQA 3RGRA 4LF5M 2CC1A 1IY1A 1E3RA 3ER7A 1KWIA 3AOEA 5KPTA 4OQHA 3MHVC 2UX0A 2F5QA 3GZBA 1XXMA 1PFPA 3N8LA 1E3VA 3V50A 1KYIA 3CMA3 3FF2A 2XK1A 1BTLA 4WURA 2V1UA 4KHPM 1YVBI 3R8FA 4HM2B 3CME3 4KG6A 2JCHA 1J5EM 1ISKA 3VMAA 2RGQA 5KZHA 1WQLB 5CECA 3GLGB 1J7KA 1IVXA 4NREA 1GA0A 1PI5A 1K6RA 5HGRA 1HNWM 3ZCZA 1NHWC 2UXDM 3IWOA 1LI9A 3CCU3 3FF0A 2VIIA 3FUXA 3EHCA 3GMWA 1YT4A 5GKNA 4R7GA 5DYIA 1IKIA 5LC6A 2GBXB 2JC7A 2L7IA 5FTLA 4OOLA 2ZQ9A 2EUCA 1GY6A 4ZM8A 4ZBEA 3UE0A 3IH8A 1M1K4 1ULIB 3ECFA 4PM9A 4CPKA 4P16A 4H61A 3WS5A 3RXWA 3EJVA 3LTAA 4HL4A 4GKJM 1M6KA 4X55A 3KXEC 1IN4A 2QP9X 1IELA 4GIPA 1OHOA 3MYTA 2EXBA 4LF4M 2ZD8A 8CHOA 1VQ83 2FNQA 3P09A 1PZPA 1STFI 4KQQA 1M40A 1OH0A 3UNWA 4WFOA 4KZ6A 4MGZE 3VDUA 5ITUA 3QHYA 4S2JA 1H6UA 1N33M 5CF2A 1PYYA 3OCLA 1YJW3 2W82A 2YX9A 1G59A 2J7VA 5IZ7D 3HHZA 3QWLA 2O3OA 1VQ73 3WA3A 4LJ8A 3IT9A 3ZVWA 3Q7VB 3RXXA 1N9JA 4G6ZA 3ZDJA 1TFKA 3RGAA 4N1XA 2BG1A 4S2LA 1TH4A 1OHSA 3N54B 4KZ3A 2EXAA 1K56A 1NB5I 3GQ3A 5DTKA 4GKKM 4DV3M 2GU1A 3TPZA 1N9BA 3GAXA 3JR5A 1RRHA 1QVG2 4DE2A 1IBMM 1Y4KA 5A91A 3WS1A 3O86A 4KZ9A 1H8ZA 2Y21A 3CCJ3 3IXHA 4AKZA 3E2KA 4LGMA 4CISA 4FCMA 4WWUC 4X62M 1KQS2 5A92A 5KMWA 1ALQA 1RCJA 3SS5A 2P0MA 4BTXA 1O7PB 3MG3A 3AMOB 3KE7A 4CGYB 5GLBA 3U6PA 4B4XA 4N9LA 3B3XA 1N9EA 3VFFA 2DHRA 4RNAA 3UGJA 2UUCM 2WZZA 5IHVA 3W4PA 1IV9A 5DTTA 1MNLA 4X66M 2R18A 3G2YA 3MZEA 2CV0A 2VGJA 2WAEA 1TFOA 5DRVA 3KSJA 1A90A 4G4QA 1IN6A 4HM0B 4LSOA 5DF7A 3OX9A 3SATA 4EC6A 3UPOA 3A3JA 3NQYA 1CI9A 2HHHM 3MHEA 1JB2A 1W6YA 3K92A 1LXEA 4R3JA 3ITBA 3GR2A 3HLGA 4N6TA 4P87A 3RGPA 4PMAA 2V2FF 1IM2A 3FYZA 4HM6B 3HIIA 1XX2A 3SOAA 1GD3A 3RDEA 2CUZA 2Z7JA 3LCEA 3HGIA 1J2BA 3B9PA 1XA7A 1NSFA 4OVZB 2P09A 4LF6M 5TGNA 4C3QA 2Z6BA 4XB5A 3OPPA 3M7GA 4AQYM 2BMQB 3DOAA 4RA7A 3SH9A 2C98A 3G35A 3FG3A 3C7VA 3J2PB 4OUQA 3BNBA 1AXBA 4ZJ3A 1HR0M 2RKOA 1K57C 3WRTA 1AVKA 3OZHA 5HAQA 3KN4A 3E9SA 2JBFA 1A67A 3MKEA 4S12A 3L25A 3CC43 3QAUA 5FAQA 5FTJA 4PD2A 1R4CA 1US1A 5ITRA 2RCXA 3CF2A 2C6WB 2YFQA 3IPTA 3VF1A 4EUZA 1D6ZA 4UAAA 4KZ7A 2XEPA 3SAWA 2HMLB 1IKGA 4GB5A 1Q7Y4 1K8A4 3LEZA 4B88A 4DR2M 4FCVA 1TDZA 4MMYB 4IBXA 5GHXA 2Y0TA 5JI2E 3RJUA 1QVRA 1TDHA 3U5ZB 4DXCA 3HWSA 3WOEB 2CG0A 1EA2A 1RKYA 2QENA 3C58A 2JE5A 3S1YA 1ZG6A 2E2UA 3J7BA 3SS3A 4IPBA 2JQ5A 1ERQA 2HP9A 1I4WA 1ES2A 3HJSA 5CGXA 5GL9A 4R4SA 1E3UA 1XHBA 4FSFA 4JXWA 5AQAA 3UY6A 2B5RA 3CMZA 5G2GA 4IVIA 2KZSA 1NNUC 2OSUA 2ZLYA 3S4XA 2UU9M 5F1FA 4AKIA 3UDFA 1FSYA 1NRFA 2XF3A 1WYCA 3VP0A 2DZOB 3I51A 4IBJA 2GXFA 3EC9A 4PDGA 4DV4M 3GPPA 5LMUM 1L2SA 3HLFA 1IXZA 5EECA 2D42A 3HJQA 5BOHA 1MWRA 3NBLA 2L6OA 3D4FA 3DTMA 4GN2A 3VOYA 4QJGA 4BJPA 5FQMA 2ZM6M 1W6GA 4RNZA 2IUJA 3ZG7B 5E2HA 5KSHA 3O88A 3GPUA 3KZTA 1IEMA 4QHTA 4R1KA 1DVCA 3VK7A 4S2NA 4FCJA 3CCS3 4LCLA 2CHVA 5FQKA 2R4IA 5IG5A 1DGHB 1LLBA 4DUYM 1LOXA 1IN7A 4Y0TA 2Q07A 4MGHA 3UPNA 5EVID 1UI7A 5IEOA 1W00A 3IJEB 3KSXA 4R0QA 1YGEA 2Y2GA 3FKEA 1M904 1MWUA 5AQBA 5FQ9A 4LGYA 4AKHA 3WOFB 4WEKA 2RCDA 1TGUA 4D81A 3BLSA 1FGRA 5EJCA 2ZC6B 1BZAA 5ITTA 1FUWA 2I9WA 3LH4A 3A76A 2SBLA 1NYMA 1SHVA 4FMBA 1HT1E 4A5RA 1YHQ3 3NBBA 1N5HA 3VOZA 1VZZA 4G4RA 5E26A 1K4EA 3VGNA 3EQVA 1YUBA 5F1GA 1SXJB 2CC3A 4DR3M 1GHPA 1TVFA 1GL6A 1CEFA 5BR8M 4JRFA 4LENA 1ZC2A 1K54A 2EFXA 3SBJA 1I94M 3VDPA 1OJLA 4IIAA 4B7GA 1TU5A 4MEIA 3KFUG 4BTYA 2G2UA 3HLDA 1G96A 4OLDA 4XBXA 2XLNA 4F94A 1AVLA 1W6CA 3AMOA 2IWDA 5DF9A 3HK4A 3B4PA 5BVBA 1L0GA 4R23A 1VQL3 3S67A 3ISGA 3NDEA 4RZMA 3PBQA 4IJFA 1GVNA 5GHYA 4NETA 1PZOA 2V1LA 3X41A 4U3TA 4WZ4A 4E3JA 1JJ22 1RGZA 1Q3BA 1YQSA 2Z77A 4IT7A 3K8ZA 3A98B 2Y59A 1NXYA 1RGYA 2UXBM 2BJWA 3EE1A 4IBKA 2ZL8A 4YY3M 2ZQ8A 3A46A 1DYUA 1BLCA 1HVBA 3U5ZA 3KSED 4Z6YA 4WEJA 4OOMA 4K0XA 1TEMA 4EV5A 1ROAA 1SQWA 3Q07A 2KCDA 3KIIA 1L0FA 3FG4A 3MZDA 3HHWA 2KZUA 3NX0A 3ZG9B 4OPRA 2PBYA 4JF5A 2G8LA 4OP8A 1JN5A 1WE4A 1W2ZA 3GZXB 3A45A 3HVFA 4IBCA 2FNAA 1WMOA 4DE1A 2WKIA 3K1JA 4JXSA 1A2KA 1W02A 3EIHA 1YM1A 4U0XA 3LVWA 3GRVA 4O8SA 1CQSA 3U6SA 3HZPA 4QNMA 4CHTB 1QMFA 4NL4H 3V3SA 4Q53A 3RGSA 3G4S3 3PVSA 1QAQA 4IVKA 1NO3A 1IVVA 1Z5AA 3NY4A 3IXBA 2R4JA 1KVLA 3IXGA 3EBTA 2C99A 4AG5A 5JYOA 1N36M 2P38A 4QHSA 2QPAA 1NY0A 1TDGA 3NM7A 2GU3A 3CCV3 3GTCA 4E6WA 1I2SA 3S28A 2X71A 3U6OA 2E2VA 4JXGA 3GSGA 1YJ93 1K38A 4DV0M 2BNGA 3GO8A 4R3DA 1IU7A 5FQIA 2IUKA 3NDGA 3W4QA 1IQPA 4LFBM 2WO0A 1KGFA 5FTKA 3PXMA 4RNYA 4J9AA 4JI8M 5FTMA 2HKJA 1GS3A 2WKEA 4WYKB 2GDNA 1YJN3 1RJOA 3LOYA 4AW4A 1KE0A 4PM8A 3ZNTA 3D8LA 4S2OA 2Y4AA 1W5TA 1IVUA 3KFQC 4Y0OA 1N34M 3GWRA 3UB1A 2FXTA 2Y2QA 3OCNA 1DJCA 5TR7A 3ZVTA 4HLQA 4LV2A 1ONHA 3UL5A 3N8BA 3T1HM 3N9HA 3IHAA 4JN6A 1ESIA 4E3IA 4OP5A 1NWWA 5AQ7A 3MFDA 2QZ4A 3V3RA 2FE8A 3LT8A 4S2KA 3HX8A 6STDA 4NRVA 3GQ5A 3DZLA 1JTGA 4OPQA 5DF8A 3IWQA 4WYYA 4QU3A 2ZAOA 3WS0A 4DF6A 1NZUA 1OCVA 1E9RA 3Q8XA 3TE6A 2VQFM 1BUEA 5EVIB 4R9LA 1FR1A 4S2NC 1UM8A 2HMMB 4DE3A 4NOOB 4G4OA 3G8ZA 1QAFA 3L28A 1XXHB 1NDOB 4XUZA 4OW0A 1TH2A 4L16A 1PM5A 5ELJA 4GHLA 3L27A 3RE8A 7CATA 3DUKA 3D3LA 1NY5A 3M6AA 1K9M4 1DGBA 3LQQA 2V1CA 1OPYA 3SOYA 3TWMA 3HLBA 1DGFA 2CHCA 3B7CA 4ITQA 4UA9A 1MKIA 3PAGA 4GKUA 4QOSA 4ZDXA 3OWSA 1L8QA 1N77A 3X42A 4K91A 4XUXA 4MB7A 3DW0A 4JLFA 5CGSA 4JV5M 2F5OA 4MEZA 3V98A 3M6BA 4X65M 5HW3A 3I7JA 2EA0A 2ML5A 3SOIA 2D7HA 3DMCA 3F7SA 2BJVA 3CU3A 4KVHA 1MWSA 4KZ8A 3N6IA 1YLZA 5ELUA 3FUUA 1W01A 1KDSA 4Y7PA 3EIEA 2FOIC 4OONA 3WA2X 2CFGA 4R9KA 4GL6A 2GEYA 3CC73 2IMJA 1ES3A 2F5NA 5HX9A 2RFRA 2G5GX 2C10A 3K0ZA 3PYJA 3GLFA 2KRTA 5FI2A 1QAKA 3V92A 3GP1A 2V6ZM 4LZZA 1OGZA 1ULJB 4WW0A 3JUPA 1TDLA 1SDEA 4FW9A 3F14A 5ITXE 1GCEA 3BLMA 5M18A 4FMAA 3DY5A 4PPRA 1O7HB 5IG3A 2CFKA 3FGYA 2CKFB 3TOIA 3JUMA 1N4OA 3F7XA 1V74A 3B8LA 3V5MA 3GLHB 2W03A 3WWXA 1SXJC 5E2GA 4GD6A 1EQKA 1J9MA 1GY7A 2JA2A 4Z9QA 4LFAM 1YE9A 1MXOA 5TGFA 4MM3B 2CK3H 1C7HA 2W2CA 3W0FA 1X37A 3PBOA 3U1WA 5EXSA 2Y91A 1G68A 3TWKA 3NV0B 4WZ5C 1ONGA 2OTJ3 4H3UA 1FNNA 3TSGA 1KVMA 2HDRA 5EP3A 5E2EA 4MBFA 4I81A 3GRDA 2D1WA 4DV6M 1HNZM 3K2LA 2KRKA 5EQLA 1R2ZA 4YHHM 2W0QA 2E2TA 1PIOA 3AGFA 5EE8A 2Q2EB 5IG4A 2J8YA 3UDXA 2QPNA 4HM3B 2LXEA 1K734 4AI6A 4JI6M 3Q82A 5CXWA 2WUQA 3W8KA 3I563 4X6TA 2Y20A 3J80S 1YIT3 1YLJA 1YMXA 4WM9A 1S5AA 4EWFA 2ZM8A 3C7UA 4EBNA 3D8BA 3U60A 3KKGA 4IBIA 3GLFB 3PCRA 4K90B 4DXBA 1FGOA 4MJDA 2ZAMA 3W4OA 4PCZA 1JNQA 4AKYA 4OPZA 3SS4A 3C4OA 4RBNA 5A90A 3TDGA 3PNVA 1SPUA 3DA1A 4K1VA 1FSWA 1OHPA 3CCQ3 3HLCA 3F9SA 2OLVA 2XDMA 3LXUX 3EQQB 2Z2MB 4XDVA 4TUWA 2HPBA 3FUVA 4HZ9B 3NBIA 1FR6A 4AG6A 1XP4A 1RP5A 2IWCA 2UWXA 5EVLA 4DKIA 2QGUA 3JUOA 1IT7A 3KS4A 3KOZE 1Q39A 5E43A 4R4KA 8CATA 3GV9A 1E25A 3MKIA 2B1XB 4BD1A 4W5WA 2XR8B 4JI7M 3EBYA 1XMQM 3X3YA 4NSRA 4N3VA 4GZBA 3UE3A 3HHYA 3GLHA 4GD8A 1IT8A 5C1BA 3VP3A 1Q864 4QY5A 3U97A 1O7MB 1MU5A 3BNEA 4FH4A 3LVVA 4IEDA 4RYEA 3FUTA 3ZG8B 3HHXA 2XSHB 1PU4A 3EN1B 4WBGA 5KP1A 4O02B 1U8CB 3FTCA 2W9PA 4R80A 3NHXA 3OW22 1L0DA 5HAPA 3C4PA 1IN5A 3LMLA 4EBLA 2EFUA 1G41A 5CHMA 2Y2MA 3SYLA 3WRZA 1K56D 4GRIA 2XSZA 3VP4A 3BFDA 3U6EA 5FSRA 4AKGA 3SH7A 3GZRA 3LMMA 4NXNM 2Z76A 1U5OA 1N78A 3O8YA 5EVIC 2F98A 4JF6A 3MJ5A 4S2PA 3BOSA 3KDSE 2W04A 3G32A 1BULA 4BQMA 1S723 2CWTA 5IF6A 2OOVA 5GLDA 1GLNA 1OF5B 2OQEA 1UI8A 5AEUB 4LJ9A 3L2AA 3NIAA 4LG2A 3L26A 1HD8A 3PS8A 4QNRA 3TL4X 2Y74A 1XXHA 4M0DA 2Y2LA 3LY3A 3FZCA 5M1AA 1O7EA 3SXXA 3LZAA 1IQYA 2BHMA 5IENA 2QCUA 5HAIA 3UN7A 2CWUA 2O5RA 4HESA 2WGWA 4LV0A 5EOEA 2HMJB 1KC84 2F5SA 3HUOA 2Q9NA 4M3KA 4FWGA 4DRTA 5EP1A 4LJ5A 1AV4A 2OQ4A 1O7NB 3KS8A 3PBSA 2MC8A 4DDSA 2RGHA 1G3IA 3O3VA 2P0XA 3UE1A 4HBTA 4XBYA 1W5ZA 4PT5A 1OMEA 2OCTA 5FI7A 2M5ZA 1L5GB 4DV2M 3FKWA 3JUNA 1SKFA 1OACA 1WMPA 2L4VA 1H8YA 5AIHA 4QB8A 5EXXA 3AJIB 2ZDJA 3OXAA 1ES5A 1NU3A 4ID4A 2Y73A 3UPPA 1IQXA 4IIWA 3G6E3 2XGNA 1WNHA 2R9XA 5LMNM 4EV2A 5IREB 3H51A 4LGQA 4R1GA 1NHGC 3Q81A 1UUVB 5D3OA 4B3RM 2XSOB 2CHQA 4BB9A 5KP4A 5EEOA 1IQ8A 5CLKA 3SC3A 4XGIA 3K63A 2QZ6A 3E99A 4CDLA 2WZXA 2WOHA 5EUAA 1IXSB 1E94E 1OFHA 3FYDA 1I5QA 2XFSA 1JR3A 4B3TM 3CXC2 4AEQA 3ZG5A 2VGKA 3SLUA 3DGLA 1KE3A 1HT2E 1NJ4A 3FZWA 5BPVA 4U0TA 7STDA 3FTDA 3DWZA 3F40A 1MY8A 3PZWA 1JN5B 1IYSA 2CFOA 2H1RA 4L8OA 4DV5M 1KGEA 5HARA 1VM1A 3MK6A 4QWTA 3M8CA 4ZAMA 4IJEA 4JF8A 4OVZA 3BEBA 1E3UD 3NBJA 3M0EA 1YLWA 1W7CA 3J81S 2BMRB 4EV4A 3H3HA 4ORLA 4KQRA 2WOFA 4MBHA 3N4IA 3GQZA 5CRFA 3THGA 2LWXA 3UJNA 3DM8A 5FQJA 1CEGA 3T0UA 3FTFA 4GMQA 3AV0A 1IY0A 1BSGA 2DXIA 3KP0E 3AGEA 3CPOA 4N6OB 3GLIB 2F99A 3T1YM 4IBEA 1FJGM 2BMOB 1VQ43 3GPXA 3ALAA 1ZG4A 2ZC4B 1Z6TA 4P85A 3VSYA 1Q40A 1UW1A 1ES4A 4FVMA 3CD63 3G34A 3PXGA 2V1ZA 3GZYB 2ZQCA 5CXOA 1TP6A 4L0LA 5CHUA 4B3SM 3G16A 4JI1M 2H10A 3SFZA 4LJ6A 4X2OA 1JVJA 2C9CA 2I7PA 4HM5B 3J27B 3W0LB 3FWLA 3ITAA 2HCBA 3T38A 2L7HA 2R4EA 1DMMA 1VDDA 4OU7A 3BLZA 3U60B 1JKGB 2XGLA 1DY6A 4LJ4A 3I4YA 5AEWB 1IYPA 3CG5A 3MG1A 3CC23 4KFDA 1FCNA 4BBAA 3GLGA 1E97A 1QALA 2EX9A 4X69A 2WGQA 2X8AA 3HU2A 2HP6A 4NRWA 2OOVC 1S6RA 1JR3D 1FGTA 3A3FA 1Q3CA 4LF9M 3VFDA 2CHGA 1XC8A 1QAOA 5FI6A 4N6NB 2ZQ7A 1SDNA 1HTZA 3LY4A 4NK3A 1NZOA 1K54C 4K61A 2QBYA 2A5YB 4FWHA 4TX4A 4BLMA 3OWYA 1N8R4 1N75A 1W5SA 3V99A 1JWZA 4KG2A 5F3WA 3WODG 5D83A 3UK6A 4OPYA 1N5PA 1W8YA 4K0WA 4LEHA 4LCBA 4XDWA 4FH2A 2ZBKB 1ROVA 2R62A 4MGKE 5M19A 3CPW2 3K7CA 1N32M 1BLPA 2WGOA 3IWIA 4KODA 1YI23 4O3VA 1IBKM 1K4FA 3SYKA 1PJJA 1VQO3 1AR0A 5EVHA 3E2LA 1Y54A 4JXVA 4GNUA 3U6MA 5CF1A 4HYZA 1VQN3 3WMDA 1K3WA 1L2DA 3DXOA 5FW5A 1GL7A 1IYQA 2P9VA 2J9OA 1LHYA 3KW6A 3PBRA 1IN8A 3U61B 3FD9A 1Z59A 4X56A 1GKIA 1L0EA 4JXJA 2MF7A 1GYBA 4KLNA 2B24B 1FCMA 2STDA 1TUHA 3UDIA 1HQYE 5CTMA 3WS2A 1IY2A 1ZO2A 1QJGA 1HNXM 1O7GB 5A2QS 3SX1A 3PTEA 3F8HA 4CCVA