2XG4B

E. coli p pilus chaperone-subunit complex papd-paph bound to pilus biogenesis inhibitor, pilicide 2c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
149
structure length
149
Chain Sequence
AAFHGEVVRPACTLAMEDAWQIIDMGETPVRDLQNGFSGPERKFSLRLRNCEFNSQGGNLFSDSRIRVTFDGVRGETPDKFNLSGQAKGINLQIADVRGNIARAGKVMPAIPLTGNEEALDYTLRIVRNGKKLEAGNYFAVLGFRVDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN PAPD
publication title Design and Synthesis of C-2 Substituted Thiazolo and Dihydrothiazolo Ring-Fused 2-Pyridones: Pilicides with Increased Antivirulence Activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 19
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2010-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2xg4B01
2XG5B 4AVHA 5JQIB 4CA4A 4AUYA 3ZL1A 4AVKA 4XO8A 2XG4B 3ZPDA 4AVIA 1N12A 2UY7B 5IQMA 3RFZA 3JWNH 4X5QA 4XOBA 1KLFB 4AV4A 5AAPA 5CGBA 3JWNG 1UWFA 1QUNB 4XODA 5FX3A 1ZE3H 3BFQG 4AVJA 1N0LB 4X5PA 4XOAA 4X5RA 2WMPB 4XO9A 4BUQA 3BWUF 5AALA 4AUJA 5F3FA 4J3OH 4XOEA 4AV5A 5IQOA 3ZL2A 2UY6B 1PDKB 5FWRA 2J2ZB 5AB1A 3SQBB 4CSTA 4CSSA 5FS5A 4LOVA 2W07B 5LNGA 2VCOA 4J3OG 5FLUA 2JMRA 3JWNE 4X50A 3BFWA 5F2FA 3MCYA 4J3OF 2JTYA 5ABZA 4XOCA 1KIUB 5LNEA 3ME0B 4ATTA 4AUUA 5IQNA 4AV0A 1TR7A
chains in the Genus database with same CATH superfamily
3LQAC 1JWSB 4HKBA 2WO2B 2FSEB 3QQ9C 4KJWD 4N9GA 4Y16B 1V8HA 4OZIB 1ZTMA 2H47C 1PLAA 1UOWA 4CU7A 5LDUA 2A9NH 1NIBA 3C12A 4UV7H 5DHVB 5DWUH 3RUGA 4X5LA 1HZKA 1CLYL 4TTGA 3ARDC 2UXTA 4PEEA 1E5YA 1KCWA 5D1QB 3QXTA 1WT5A 3V6OE 4JCLA 3WFEH 4A68A 1RK0B 3KGSA 4PGCA 5AYUL 2VXUL 5IJCC 3VGFA 3DO7A 4FXKC 4M4RA 1IFHL 3HBGA 2YPVH 2R2BB 3TT1H 3AB0C 1U95B 4EVNA 3EH2A 1Y18A 2O1AA 1XGTB 2EDNA 2HXAA 3AG1B 1FSKB 5EC1B 1ZVNA 2A2QT 1IC0A 1HNFA 1SQ2N 2R2HB 3QIBD 4MQSB 2GK0B 5DJ2B 4KKRA 4M7LH 1BQLL 4F7KA 2FX8L 3UYPB 5J5EA 4QHPA 1U8JA 4U6TA 5EZIL 3O3EB 3CC5A 1VERA 3DTXB 1HWWA 4PJ7E 4PBVC 5B8CA 1LQBC 2AABH 4M7KH 4PS4H 4GIAA 1AGDB 1B0IA 2SEBA 4W9HC 2WXMA 3MGAA 3QZWA 4G9DB 2YAEA 3ECBB 1BZQK 3MO1A 5DJ6B 1UWEL 3F65A 3ME0A 2GSGB 4AL8L 2AQRA 3VFOB 1BBJA 2AQ3A 3T4YB 2LABA 1E4XI 2CKBA 2QPEB 2GSIA 3P4NB 4KI5E 4I3SH 4AYMC 1GC1C 3FTVA 2WZ6A 1DQML 4X6FA 4ZUSB 3C75A 1WVZA 4JPVL 1RK1A 4MMZA 3UERA 3T0AA 3D6GA 2YJQA 3FJTA 3BW9B 3ZYIA 1AGFB 1ORSA 3S37X 3MV9D 4OCSL 3STBA 5HYFA 3MXWL 2GBUA 4K15A 4HOZA 2CHXA 5I24A 4H2CA 1CIDA 1A7QH 4P3WA 1B9KA 1U8MB 2VZTA 3LV3A 3PWLB 2O61A 1A14H 1TFPA 3ARXA 1U8QB 4LHJB 4NXKA 3VFWA 4DN3H 3H9SA 1OV8A 5KZCD 3AREA 2EVHA 5F97E 1D7FA 3UO1L 1Z9PA 2IADA 2UZYB 1ICTA 3SY0A 3VFVB 5IIEB 4CW1A 4BQCA 1I1RA 3P3UA 4O51A 4U49A 3QIUC 4QCIA 1FORH 3PGCA 1AJ7L 3DI3B 3BKCH 4H44C 5HDQL 1EAOA 1YNLL 1A5FL 1I8KA 4WRLA 4KBPA 3QRGL 3UPCA 1MCWW 2D4FA 5DD6B 3U2IA 2XQYG 5AVQB 2F5BL 1HHIB 2FIRT 4HXAL 3DX9A 4LFHD 3S7GA 2O93L 3VX1A 5DS1A 3LIZA 1OVZA 5D5MF 1IU1A 1JXGA 3LNGA 1CD1B 3L5XH 2DQIH 5I0VA 2J4WH 5I73B 1S3KH 1VDGA 2VC2H 1ZDQA 4U7SA 4UMSA 1BVKA 5AAPA 1H9VA 1IKFH 5I1KH 3JV4B 5CGBA 1NH6A 1M7DA 3OQ3B 1F4WH 3CHSA 4UT9L 3HE7B 1ZJAA 2AV1B 3U4EA 1YNTA 1BGXL 1E6OH 3F7RA 3G3LA 4B3EA 1UQSA 4XCEA 5GSRA 5LQBH 3M88A 4Y8AA 4JQIA 2ZWZA 5ILTH 1U3JA 1EJOH 4GSRA 5CN1A 1RZ8B 1B4LA 3ARYA 2JI3A 2NY0B 4MA7L 4GAYA 3CBJB 1QA9A 4PG9A 1WF5A 2CDFA 2EDEA 4WGKA 2CJTA 4DVBA 4EMZA 5HGAB 5IR1A 2EJ1A 4KC3B 5C0NC 2EYRA 3CZJA 3OM3B 1AAJA 2A74C 3HC2A 1FL3B 1UM4H 2EYTB 3WDIA 1L9OA 2GJ6D 3S9DB 1EVUA 2UY6B 3F00A 4X6EA 2EDHA 2JCCF 3IN0A 3UBXI 4DK5A 4LCYB 2BNUB 4LB8A 2XA8L 4L8SC 4NC1E 1RUPH 2O30A 3QUZC 4PJBE 1GOFA 1YPZE 4U1GB 5IG7A 4MAUL 5KVDE 3OKEA 5I71B 4WZ9A 4MNQA 4TULL 2LU7A 1I1AB 2DDQL 2Z7YA 5F9OH 2DQUL 3QUHA 4QRPD 3AITA 1LO3L 3W0WA 4EEEA 4HFUH 4L3AA 2EE2A 3BRDA 1U30A 4XNZC 1X5LA 2WCGA 3CSPA 1KWGA 1O5PA 4AXWB 4NM8L 1AIFB 5FGCE 1INQA 4YHMH 1AFVL 3SOTA 1BZ8A 1IAIL 3HG3A 2CO4A 4J3OC 4NJAL 4HJUA 5AW3B 2QV4A 2Z3FA 4UQBA 4PBWD 3P3TA 3IGLA 2WZPA 3PL6B 4H7VA 1T0MA 3FU7B 1HILA 2Y2YA 4IDJH 1N0LA 4YEEA 3QB7C 5DQ9A 3QZPA 2QKSA 4PGDA 2FB4L 4HXBL 3ZDWA 3V0VB 2C34A 2P3YA 5HGBA 3BEVB 1XGRA 3Q3GA 1GJIA 4JJHA 3DX0A 4YIQA 1OGAD 3EGXA 3ZIMA 4N6RA 2HN7A 2QTVA 1ZLWH 2N0KA 3CUPB 1FDLL 1YY8A 1DBMH 1E30A 1BSIA 1JK9B 2NYYD 4GW5A 4XNBA 1YC8A 3V95A 3K8KA 3P3SA 3BKJL 1VCBC 1IX2A 2FQEA 3EUUA 1T7YA 3GIZL 2DTMH 1X7TA 4LKCB 4E36A 3BVUA 4P48A 1MRDL 4X6DB 3SCMC 3TEUA 2AITA 4JRYD 5LAXB 2VLLB 3QQ3B 3PDDA 5KSBB 3O4LD 3RDJA 1MFEL 1WTGT 3UTPE 1OEZW 2BM3A 1I9RH 1VGKA 2CJUH 4JFVA 3SDCA 4Z7OF 4R0LB 3U9UB 1WFIA 3DI2B 1RJYA 3C87A 4WFHE 4R3SB 1JCKA 3REVB 4ZUTB 2PPCA 1RPQA 4HWBL 3LNEA 5JIHA 2PW2A 4E5XB 4TQIA 4UIKH 4QHUA 4XRCA 1IBDA 1EZVY 2H2SD 3O41A 5T5FA 3NSFA 3LX9A 3NCCB 4P07A 1F58H 3QNYA 1ETZB 1D7DA 4JHVA 4FEIA 1P9MC 1B4TA 1MEXL 1XR9B 3P9MA 3QG6A 4HZAA 1SRDA 4M7LT 4ZOAA 5FGBA 5JDSA 2V5YA 5J06A 3RB5A 4X83A 1A6UL 1Z5HA 3ETBJ 1CGXA 1U3HA 2ESVB 1ET8A 3MV9E 4RCAA 3V52L 4WO0A 1MCWM 3ULUL 3ARFA 5I1JL 1HNYA 1DQKA 2FH6A 5DD5H 3TJHC 1XGQB 1W8EA 4HUXA 4YSPA 3ABKB 2FLMA 3QUYD 4YGAB 5EU4A 1JZ2A 3BD4A 1GJWA 1MIEH 1AO7A 4M1DL 3ZTJH 3HI6H 3KBFA 4YZWA 4LCWD 5AZUA 2DLFH 3U7WL 2IG2L 2AVGA 2QQLH 2VR7A 4ZS6D 3KAAA 3O3AA 3QEUA 2A73A 4NDMA 1P7HL 1PX8A 1ZY9A 3LIUA 4PCYA 2RQEA 1RCYA 3BO8A 1B2YA 1A7PL 4XP1L 3TWCH 2LLGA 2AVFA 1YYML 2AANA 3DC0A 2GI7A 5D2NC 2XRAH 4FQIL 3SKMA 3FU8A 3NAAH 5CJOH 1YG9A 2NCEA 2YD2A 2ATKA 2L3BA 4H8UA 5LBSL 1INEL 2VSCA 5CWSA 2AQ2A 4RSVA 4UTAA 4OFDA 2APWA 2K3HA 3IKKA 5CEZL 3ARDA 1UYWH 1AKPA 3MOBH 3ZE1B 1BVZA 4LIQH 4X0NA 1WAPA 2BOLA 4UUJA 4D7PA 1KEML 5MEND 5IQ9A 1HEHC 1Z9SB 4NQTA 4NX0A 5KJ4A 3QEHA 2VXQA 5J6GB 4F9LA 3K2MC 3F84A 4HUWB 4ZMLA 3GSXA 4UT6H 3PHAA 3UTTD 3T0DA 2CO3A 3BDYH 3WKYA 2O5YH 1EERB 2CK0H 5D7IE 3TF4A 3CIQA 5B4MC 4RDQG 3H4HA 4R84A 3S36H 2UYLA 1TQBB 5D93B 5IFJB 2VDPB 1TZHA 5T3XH 1D2OA 12E8H 3VDAA 2W92A 3IRPX 4BKSC 4XNQB 4G9FE 1CLZH 1H3GA 2PCYA 4NKDB 2GTZA 2GCYA 3O2VL 4OT1L 5K9OA 2OXGA 2NYKA 1WA1X 2FD6H 3KPRD 4JM2C 2X4UA 3BUIA 4FFZH 4QT5B 3WJLC 4EXPX 1L0YA 2FLRT 4O5LL 1BFTA 4XPGL 3IMBA 3ZZ1A 32C2A 1E2VA 4G72B 3BPOB 2MFNA 2VERA 1N0XL 5DO2D 1CDGA 2NTFA 1U4EA 4RESB 4ZXBB 1QYGH 4RH4A 2GJ6E 4Y1AA 3LY6A 1BJ8A 2DI9A 3FULA 5C0GA 1HC1A 5I0ZA 2P8PB 4PJIA 1G5AA 1KT2A 1GMIA 2D7TL 25C8H 1GAFH 4GKSB 2FR4B 1CICB 4FQ2H 2ROXA 2VLJB 3LQAH 1D5BB 1F3JA 2BRQA 5F7BA 1PD0A 4X6CB 1QSEB 3CU1A 4QRPE 1JUFB 3ZKXC 4X99A 1U8HB 2XN9D 2ID5A 3D05A 3KNBB 3VRIB 1NCWH 1G6VK 3AC0A 1F1AA 1X5XA 5E8EB 3BI9X 4QNPF 4MJIB 4FOMA 2CDEB 4JX0A 2RR3A 3FO9B 2WNWA 3HHMA 2BP3A 2OZ4H 3CFCL 5BW7A 3SPVA 2ZCKH 3G5YA 4NQCD 1YDPA 3VDBA 3TIDA 4KGLA 3RIFK 2Z4QA 1PCSA 3V0GA 5JHDB 1I9JH 1UD3A 3X14A 3ESOA 1OGAE 4YWGL 5A7BA 3CDGA 1AS7A 2JI1A 4GSDH 4G80A 1DVFB 3QZWG 5ALBL 3OJ2C 2IBGA 4YLQT 4O02A 3T6XA 5L8LB 4E0RB 1EO7A 1IE4A 3F6JA 1F56A 3AVEA 2RA1A 3CVCA 1JDDA 1RZKL 3FN0H 4PRDB 4MTMA 3DGCR 4LBEB 3L4ZA 2XNAA 4P4KB 4KRNA 4PVMA 5E1GA 3RJOA 1L9MA 3QIUA 4I2XA 2CCLA 4UQAA 1DQJA 1IAIM 2VDPL 3MMEB 4M5ZL 3NA9L 3HJEA 1H15B 3D25B 3A4DA 4JRYE 4KNQA 1F8TH 1NCCL 2V0AA 2NQDA 2VIRA 3O4LE 3IB4A 1TCRB 4PJXE 4KXZI 1JPEA 2WZAA 1NWPA 4P23C 3N3EA 4MYPA 5AW5B 4Y9BA 3HE6A 3NUKA 4XGZB 3SZKC 3HHSB 1EQWA 5EBLA 1KPUA 3R7QA 3W5MA 4IBYA 1NWOA 1AQKL 1A4BA 2F9BT 1IVLA 1MG3C 3GI9L 2M8XA 2OI9B 4APXA 1FBIL 3NIFE 5IFHH 2YBRA 3CLFH 2CG9X 5EIVA 2E76C 4RFOH 2EUZA 5B39G 1V10A 1A4KA 3ZBMA 2NUTA 3SHSA 4UNIA 4OCWL 2VITB 3P4LA 1AQMA 1NM9A 2AEIT 2WO3B 2XWJA 2YD6A 1ZXKA 3IKCB 3DV6B 2ENPA 3CSYA 4PHZA 5EUOF 2W5PA 4CVXA 3SDAC 4M8UA 5F0LB 5AW6B 5EEUA 5EDXA 5JYMA 1P4IL 1ZHBB 3LD8C 2DM3A 3MREB 2YSTA 2A74A 3VWJD 2Z64C 4KZEL 3X1BA 5JR1L 4MCZB 1FCGA 2ZXEB 1H3XA 3K46A 2D31B 4U3XA 4ZO6A 1T21A 5KBLA 4UBDC 1FV1B 3MACH 4L8SA 4M5TA 1RD6A 1QBLL 3CV5A 2IPTH 1CXLA 3QUZA 3UJTL 2EEAA 4L5FH 1A9EB 3IDUA 4LARL 4X4ME 1CDIA 3P0GB 3QI9B 5IROD 5ESVB 4X7EC 2X6BA 2CMRL 2BOCA 2HTLD 5ETUA 1AMXA 4MD0B 1JL8A 2EIMB 3C2AL 2YD7A 5C2BH 3FTWA 4UM9D 5KBPA 3HPLA 3PXLA 4KHTL 4LGSB 5BS0D 1I8MA 5EZLA 4LCCB 1JWSA 4WJ5A 5FWRA 2E46A 1JPFA 4AK1A 4R7VA 4OZIA 4P2RB 2WXNA 1XD0A 3I6GB 4LLQB 5DHVA 3U82B 5DLLA 4ZNEA 5MENE 2WWKT 1ZLUK 3RPBA 3MRQA 5D1QA 3ZHNA 4XNYL 1RIUL 1EUTA 1RK0A 3T0EE 4IJ3C 2NW2B 1XBDA 1NL0L 3NFSL 2V9QA 4ICWA 1X4XA 5DLML 3F12B 5C1MB 1ML0A 1OGPA 4EO5A 3BSGA 2P48B 5GIRB 3O9WB 5LNGA 4KFZC 1XGTA 3HZVB 3KR3L 1IGJB 1DBJL 5FFLA 4WW2C 4PJDA 3G9AB 4DIXA 3KPRE 1GKEA 2GK0A 3N06B 1T3FB 4Y2DC 4MDIB 3UYPA 2HG5B 3F7VB 4KK9D 4ECNA 5JPNC 5MI0B 2WBJD 3FSOA 2IH1B 1G9NC 3FFCD 1C8QA 3HS0B 4H1LB 5H35A 3ABMB 4GO9A 1IAOB 3DTXA 4NYLB 1TPXB 1KGCD 2XWRA 2LOEA 2F1EA 4MJ6B 1UA6H 4GP4B 1HJCA 1MCOL 3KLAB 3IK2A 4MCYB 2B5IC 4YE4L 1L5GB 3ZGHA 1NSNH 2DEWX 5DJ6A 1CGUA 4TQPA 4L29A 1ACYH 2DMKA 2GSGA 2WSDA 1ZHNA 4FTVB 4OCXL 3T4YA 1LK3H 4PRID 1IGTB 1MCSA 3CZKA 3GSRB 2CSPA 4JFFD 2C9SA 3VXUE 1URIA 1MCFA 2XN9E 1YO4A 3O3UN 4I0PB 3UTSE 3N9GH 1XF4B 4LCVA 4ZS7L 4YX2H 2HMID 4ZUSA 1WWBX 3GZQA 1U8CB 4QRRE 4XP6H 5HYJD 3BPLB 5GRJL 1TJHH 4W81A 1KJ3L 1AGFA 3K1KC 4FQCH 2NZ9C 2EEXA 3RVWD 2IALB 4PJCA 3GJFB 2Y0SA 1OTTD 3HA0A 2A9MH 3HR6A 3TPKA 3REWB 2YUXA 4RQQB 3O0LA 1BQKA 3HUJE 1NMCC 3IDJB 4KU1A 3B2UC 4WWID 3V6FB 3M8OH 4FQXD 4IBQA 1HDMB 3SGJA 5CR8A 4HKZA 4BFGA 3HN3A 5JHMA 4JG5A 4P5TD 4NWUH 1MWAH 5D2NA 4FHJA 1BM7A 5E6IC 2UZYA 3MSPA 2ZKWA 2VZUA 1R33A 4JFDB 3ZOAA 1TYRA 3QCTH 4ANKA 4JGNA 4H20H 3HBZA 5FKPB 4UDUB 3WN6A 3HFML 4XC3H 1PKQA 3VO0A 5B3JE 2BS71 2ZKHH 3D0AA 5DD6A 3PWJB 4MZ3A 1QRNE 5F1OB 4ZO9A 1NANI 3JVFC 1HHIA 4YBQC 3WFCL 4LMQI 4JZJC 2AJUH 1ZE3C 3U83A 3BN9C 4ZMPA 4BCXA 4FXTA 3PABA 1TQSA 2GY5A 5AVTB 3WJJC 4HH9B 2AI0H 3UPRB 3AT0A 3DIFB 4ODWB 3E8UL 3I6SA 4CRPA 1F11B 2HH0H 4YHNA 3IJ7A 3VE0B 3A67H 2YRBA 4Y4FC 1TEYA 2WYIA 1OP3K 1K5WA 3DUSA 1DVSA 4FMFA 2AC0A 3MKGA 4LCIH 3MGTA 3HE7A 2AV1A 3VNZA 3RJQB 4V11A 3SQOL 4YDLB 4JM2A 3B5HA 4EN3C 1TQVA 2AMGA 1FVCA 5KTEH 5MP6L 2L7EA 4XTRD 1MDTA 2XVBA 4MSWB 1AP2A 1RZ8A 3RY6A 4YL9A 5KVFL 2UY7A 2BNQB 2VXSH 2W1NA 1B6DA 3CH1B 3JTBA 1DQQA 1GYUA 1TNNA 3D3VB 3W11C 4W68A 5HGAA 4AM0Q 4IBTA 4CVZB 3CLWA 3J2PA 1SMAA 1LMIA 4R7LA 2G9KA 3EJCA 4V2BA 5EOCL 3F8UB 5IM7B 2OR8A 2UY6A 2J6EL 4I87A 3PF2A 4EF3A 4RDQF 2IANB 1NAMB 5DD3H 4LCYA 2QBWA 2QMJA 2OTWB 4ZUUB 1F1DA 2WLNA 3D85D 4G6JL 4G1EB 4L1SA 4LEXL 4P3DB 1XXDC 4PG2C 3VXTB 4XZUA 5IQMA 5D4HA 1FNEB 1FIGL 2ZUQC 4PWKA 4Y4KB 5DURD 5LGHL 1I1AA 2FYYB 5BS0E 4O58L 3IFLL 1FPTH 2DJSA 3GZOA 3SDYL 4HKJB 1U9KA 2DQDH 4WI8A 1AIFA 4H40A 4HPOH 3N1QC 2ZWKA 3SYAA 2ZKMX 1A0QH 2IIJA 3FQWB 4A7VA 2RMNA 3Q6GL 3D4YA 2DZEA 3RUGF 4ZFZA 3FU7A 5C0AB 3RP1A 3CXDL 1HT6A 4XN2A 4AC2A 4DQOH 4WO4B 3FFDB 4B5ZA 4LVNC 2J21A 4WFGD 2R1YB 5GGTA 2FJFB 3BEVA 2IGLA 1BZ7B 1EZVX 2QGBA 2WY3B 4QRUB 1J86A 3FL7A 2QLVB 1XEDA 2YQGA 1GS8A 4NZUH 3AS3A 4RMWA 5DF0A 5FV1L 5GJTL 3O3BB 3TU6A 3VGEA 2OR7A 4ES8A 1JK9A 5DQDL 4WI6A 5D1XE 4EAEA 2BSBA 3CDZB 3IXTB 4HZLB 4AKPA 1TQWA 1K85A 5ADPH 2DWYA 1XGZA 4X6DA 5ISZB 3DRTB 1H6TA 1PGRB 5I28A 1SZNA 3QQ3A 4HHWA 4H2AA 4LL9A 4NQUA 3MRHB 4AZ8B 2WQAA 4PY8I 3HC4L 2L0DA 4GRWF 4MB4A 2QSQA 5EA0H 2EC9U 4OR1A 3EF7A 5IGXL 4X9BA 2HVJA 4R3SA 4NQEB 3QW9A 2XVGA 4ZSOE 5GGVH 2GUYA 4NKMB 4ZUTA 2W0FB 1FNHA 3DYOA 5I1LA 1DBAL 2UUDH 4JKPL 4I1NB 4XMVA 4G3YL 3QDMD 3QJUB 1XF3B 4NC0B 4WTQA 1NAML 5KSAD 2JNZA 4XAWL 2GJRA 4AQ8A 3V6OC 3TEYA 1MZZA 4AKOA 3VH8A 3WS6C 3DV4A 5L8JB 1AQ8A 1UWXK 1XR9A 3B83A 3WFDL 2F5AH 3L54A 3VGAC 1PYWB 1XIWC 4G8FB 1UWGL 3SGEH 3HZKA 3QIBB 5I18L 1L9QA 3D5OF 4MQ7B 3US1A 2DRUA 1VIWA 4L2YA 5IUSA 1QOKA 2BSSB 2NR6C 2ZWSA 3FU9A 4N1HB 4GUQA 1H8OA 1XGQA 2R29A 5L88H 2MCAA 5ID0B 1IKNA 1OGTB 4C4UA 2LFEA 2XLLA 3FCSB 1RULH 1D9KD 2F54D 4L0ZA 2BNRE 3W38A 1E67A 3WNPA 3VMNA 2DLEA 2A6JB 1XEUA 2FQDA 4HLEA 4JFED 2J6WA 5E4EB 2VLME 1QZ1A 5C9JB 4YSDA 1QSFD 5D6DA 1WCQA 4HU8A 2F8VA 3ZQXA 4KKLD 4S2SB 2YUZA 2MIZA 3BGFC 1OALA 3HG1E 4M6NH 6TAAA 1AGBA 1Q0YL 4B50A 4B5EA 1VKXB 1NBVL 3LTVA 2OTUB 3KEDA 4IRZL 1LMKA 3OPUA 4NI3A 5FUOL 1YVLA 4LP4A 4ACPA 1E0OB 5TE7H 3QISA 2J20A 4HMDA 4NKIH 3OF6D 1AYOA 3MV7E 4KI5C 3QQDA 1XSIA 2Y07H 1WAAE 3GBMH 2NY6B 4Z7VB 3EO1B 4OUUB 1FO0B 4PM1A 3I9AA 3KPLA 1P4LB 5DS8B 3VG0L 3NJLA 5GGSB 4LPUA 1A9VA 5JA9A 1JI2A 3MBEB 1Z9SA 3EBAA 1AE6L 2OFQA 1YY9C 3BP6B 3PG2A 4HUWA 1EPFA 4AJ0A 4ABQA 4JDZA 3CDYA 2PWGA 5DO8A 3IS1X 1MCRA 5KOVC 5EG6C 3MRNB 5PCYA 1DL7H 4WW2A 3P73A 4JY6B 4XI5C 1I82A 5J1AA 4ACTA 1EXHA 4DUWA 2B1OA 4PVNA 3ASNB 1GGIH 4L1TA 2QJDA 3LNDA 1T1YB 1J0JA 1RZPA 2ITDA 3H55A 4N0CD 1P5UB 4XNQA 4XXWC 4Z7WB 4IBZA 4NKDA 1U2YA 1YNTF 2X44D 5C0RH 4NUPA 4QT5A 4B6ZA 1Q38A 1DJSA 3E6FB 5B38B 5I66B 5C2UB 1RSFA 3WEAA 2YGNA 3EJYD 3CVHL 5GRWA 4ZXBA 4FL4B 3NTCL 4J3OG 5LBVA 3JWDH 3SE8H 4C83B 1DP0A 2VO5A 3LN4A 2VJ0A 1BWMA 1YQ2A 5GSVB 3B2VH 4IU2B 1HXMA 2AQPA 5D55A 5EN2A 4BQBA 2B0SL 4GKSA 2Y7OA 2FR4A 3NT0A 1CICA 2X1PA 3P0VH 4NQDE 2YAHA 4E41D 1PLGH 2VLJA 2WN2A 1D5BA 3VVVA 1A1NA 4X6CA 1QSEA 2FO8A 4AITA 3A22A 4G7RB 1RPUA 1REIA 4BE5A 3KNBA 2DQEH 3COOA 3CX5J 1FYTB 4MJIA 1WAEA 2BY1A 2CDEA 4NJ9H 3ZSTA 3DGGA 3WAKA 3T2LA 4Z7NB 1OLZA 2DLHA 1MRFL 1JV2B 4AT6B 2XG4B 3DX7A 3VQMA 3ZZQA 5I8CA 4G83A 3AFLA 5GXBB 2IGFH 2FO4B 4Q52A 3FCUB 5MEQB 4JN1L 1C12B 1W9XA 2N1TE 2BSCA 4HZ1A 4AQ1B 1B4JH 4I0CC 2BDNH 5D4JA 1DEEB 2BSDA 2AK4B 1DVFA 4Q8BA 1DDHB 2H0JA 5FYKE 4ZDHA 5AG9A 1KN4H 4E0RA 2VLKE 1ZANH 4PRDA 4XO4A 4LBEA 4P4KA 2YOCA 3VXNB 3BUQA 4K94C 1Z3GH 1T5XB 4WTZA 3TBWB 4XVSL 4NC1C 4RGMC 3D25A 4J3VA 4HAKA 4XO9A 5E1HB 1EV2E 4XP4H 2PYEE 5AUMB 5CO1A 5F1NA 1JHKH 1TCRA 3RFZC 3RJDA 1BAFL 2LAGB 5DA0B 1KACB 4N2OA 5G2NA 3TA3B 3RNKB 4XGZA 1WWWX 4M1GH 2AAVA 3HHSA 3OAYH 4S1QL 4ODSL 3ALPA 1U2CA 3HNVL 2X0UA 2HRPL 5M7QA 2ZUWA 4XPTH 2YGVA 5KJ7E 1CG9B 5D9SB 3QHZL 4N2GA 2Q86B 3QDME 3W81A 2F53E 2AXFB 5I6OA 1V5JA 3RL2B 1IQWL 1C16A 2FHFA 4HJ1A 43C9B 4W9CC 4EN3A 4X7FC 5CEYB 1FL6B 1E5UI 4LLVA 2Y5TB 3SGKA 4YXHH 1PJWA 3IKCA 3L4WA 3DV6A 2AHIA 3AQDA 2OJZH 4I9XA 1J87A 4P59H 5FYJD 1FFTB 3R1GL 2FL5B 2F54E 3VD7A 3TESA 1NC4B 1ZHBA 4LPXA 2AQNA 3ES6B 3HC3L 3MLUL 2O5XL 1JGVH 2AV7B 1FC2D 2F8IA 3BXNA 3D4CA 1QSFE 1MHPL 3G5ZA 1NUFA 1FV1A 5C0BA 3STZA 4GQRA 1R3IL 1OAUL 1F18A 4D94A 4Z3JA 1A9EA 2PWFA 2HWZL 1MCQA 2ZOKB 5KS9A 3QI9A 3GBDA 1X4YA 2PTUA 2DBLH 2CDGB 5I1CL 2AGJH 1RZ7H 3QWRA 2ZJSL 4HCRA 1JPSH 1W6WA 1E2WA 4MD5B 4OM0L 1MREL 3EH1A 2VN5A 4BZ2H 2E9GA 2DQHL 1QVOB 4BFOA 1IJNA 1IGCH 4LCCA 3ULVE 2R83A 5C0FA 2MEJB 1ZSHA 3QRBA 4JPWH 1ED3B 3V5HB 3QUYB 4X80H 3NJVA 3ABGA 3ROOA 3UDWC 4I9WD 4XMLL 1VZGA 4LCWB 4OKVB 2WXFA 4AV4A 2ADFH 2APBA 1WZMA 1FH5L 4QHMB 4YHOH 4ZQKB 4A6YA 5KBKA 1V7NL 3F12A 5J6HA 3HRZC 1I9IH 3SPHA 3M6DA 3O9WA 5T3ZH 2J1XA 1QFWM 1R75A 4JRLA 1IGJA 4N2DA 5DZJA 4Y19E 4AYSA 3BUPA 2VR8A 3QCVH 4LSVL 5IVOA 4NN7B 5I1EL 4X5RA 4ZNCD 4O2FA 5K5YA 1KTDB 5D7LD 1JTTA 1BIIB 3J27A 1GGBH 2ICWI 4MDIA 1A7RL 1J0YA 2HG5A 4DWHA 1YMHB 4QMEA 4H1LA 4JS7A 4NYLA 4YVNA 3U1SL 2WUBL 2P5EA 1I1CA 2CUHA 4UMGA 4F7EA 1IC7H 2FAUA 1CB4A 2RQ8A 4MJ6A 5DFVC 4XE5B 3KLAA 4LPYA 1CR9H 4ONGH 3FTGB 1Z5LB 1L5GA 1NCDH 1VFUA 2IQ9L 2BWIA 2JI2A 4OF6A 3K74B 3HN8A 5AB1A 1TJGH 3U2JA 5E6YA 7CGTA 3VI3E 2ZQKA 4PJIF 4YDNA 3UTTB 1KTJA 3PPSA 3WS6A 1JNLL 4U1IB 1HL5A 5I1GL 3GSRA 2CBQA 1NGQL 1WRFA 2TSAA 4LEOB 1KOAA 1O6SB 3ARTA 2QZ5A 3QFDB 2QDWA 4PJ5E 4XMPL 2OSWA 3UGUA 1U8CA 3L3KB 3MOQA 5ABAA 1UURA 3EFOB 4GNKB 2VMDA 2Z1PA 1AZCA 2B4CL 1RIVL 3G5XB 2MQGA 2IAAC 3NJIA 2DL9A 3GHBH 1TTFA 3GJFA 3Q2VA 2OP4L 3SO5A 2PETA 1IGMH 3SDXE 4PJ7A 4DK6A 1HFUA 1PPIA 4YFLF 3RU8L 1FFRA 2FRGP 3IDJA 3VB8A 3V6FA 1G9MC 4WUUD 4UZGA 5FR3A 3V4LA 1HDMA 4TQ8A 5GGUB 5EDSA 4FQJL 4JG1H 5HI4D 2KLRA 1P1ZB 1PNDA 5AVVB 2GYSA 3P40A 2BJML 4I89A 5SX4H 2KS0A 3RTLA 1I3UA 5E70A 1T2XA 3DO3A 4JFDA 1JGLH 4KX9A 5FK9B 4YZFE 3MBWA 2E8YA 2FWOB 5FKPA 2R4RL 3EHBC 1A2YB 2BFGA 4OJYA 4GG6E 4WV1C 2WMPA 3PWJA 2VO8A 4XP9H 3IXAB 4MJHA 2V5TA 5E5UB 5JUEL 4P4RA 1OARH 5JZ7D 1XH1A 1FNSH 4H88L 4GRMB 4ZO7A 5F6HJ 4NQCB 5DMGC 1ACXA 2HX9A 3UPRA 3DIFA 4GMTL 2V9TA 4RFNB 1F11A 3L7EB 3VE0A 3Q8EA 1MFDL 2Q87A 5A3IC 1I3GH 2CRZA 2ZD0A 2N56A 5LCVA 3WG7B 1SXCA 4BZ1H 3U9PH 1OT2A 3W37A 4Y1TA 3QRLA 5JTWA 4IGBC 3KVDD 3OG6B 4P2OC 4QXUH 5FYJE 5IVZB 4K2UH 4MSWA 2JSFA 2VRQA 3VQ2C 2WXLA 3FT2B 2FGZA 3FT0A 1UD6A 4PJHB 4M7JL 3CH1A 4DSYA 2H3KA 1GTFA 3D3VA 1XAKA 4L3FA 3DX6B 1OAZL 2FBRA 4NAMA 4QXGL 4TLKA 4CVZA 3QPQC 1FLRL 5B1JC 3FQRB 2R0KH 5IM7A 4JJ5A 1OE1A 4FTVE 3P77A 1JXJA 1A1OB 1V3LA 4PY7B 1NAMA 2A9AA 4W9EC 4AJVA 2FX9L 2OTWA 3GYRA 4ZUUA 3T3MB 4G2AA 4C8XA 1T20B 4UOW1 3FQTB 4G1EA 4P3DA 1OB1B 1ROCA 1FNEA 4XPBL 4JL1A 4Y4KA 4ZD3L 3T2NL 1HHJB 3HMWL 2FYYA 3M7FB 1OP9A 2JWYA 2KZ1B 1Q4NX 2HKHH 2N3JA 2ZYIA 3MODL 1BVLB 1LK2B 3BVXA 4YDVB 3BHBA 4E9YA 1QI5A 1NBZB 2R15A 5GS0C 5D7SL 5BRPA 1CGTA 4AIZB 3FQWA 4J3OF 3MR9B 2JJTA 1HHGB 3DETD 4KH9A 4PRBB 4DO6A 4OZIF 3BPNB 4EKJA 4U1JB 3RIAK 2VZ1A 1WBXB 5C0AA 3UIZA 1ESOA 2ZYSA 3WLBB 3I9IA 1TTRA 4GQPH 4LF3B 4OIAA 4F3FB 4WO4A 3DMMC 3FFDA 4YK4C 2X4PB 1HXKA 2R1YA 4DAGH 3B8SA 2JELH 3I2CL 4DFHA 3CSTA 4GG8B 3OAZK 4MXVF 4QRUA 5J13B 5JA8B 2UWEB 1SXAA 4JKLA 1KJMB 2IQAB 4CBPA 3WXWH 1CXFA 3GGWA 4PWJA 1AKJD 3O3BA 3KWUA 4N6QA 1YPZA 4PJDF 4X2UA 3IXTA 1N12A 1I31A 4HZLA 5KG9A 4GW1B 1MF2L 2CLVB 5JW4N 1D5IL 4I5BA 3RFZA 1XB8A 2EP6A 4UM9B 2X2HA 4OAWB 2J71A 5HPOA 3ZMRA 4XE0A 3RWDB 4AZ8A 3MRHA 2WANA 1NIDA 1TMCB 2QKIB 1ANUA 2LHAA 4TNEA 1D5XA 5IQ7H 4FA8A 2R39A 5FX3A 1OP5K 3VXSE 2NT0A 3GUTB 4WCYL 1S7VA 4GLRH 4A2GA 4DGYL 1H5BB 2A0LD 3CSFA 2GAZB 1T0PB 3DNKA 4ZAKB 1XF3A 3MRFB 1I7UB 4K55A 5ITFA 2W0LA 3I50H 4QRFA 4ODHL 5J7CC 1JHLL 1NGYB 4WHTB 4XZ4A 3T0EC 3GMQB 2NNRA 4NWTL 2W9DH 4G8FA 4J3TA 4KXDA 4EUPH 1TZIB 3O4OC 3QIBA 4MQ7A 4GRWH 3TN0C 1HCZA 3V0WH 5E2VH 1G87A 4WTZG 3O6LL 3C09C 2WBJB 3OLEA 1QG3A 1HINL 3IAPA 2IWKA 3FFCB 5F7DA 2JKNA 3N42B 3NJFA 1L3NA 1T2JA 3FOLB 1IM9B 1JGIA 2RFXB 4PLKD 3FCSA 4FG4A 3WS3B 4JFYB 2JKJA 4PJCF 5C0CD 3KZ8A 2WLKA 1KXHA 3CDFA 3NIGB 1VFOA 3KLKA 3P0YH 4BK4A 3T1WA 4K94H 5C9JA 5SWSB 1SYSB 1WITA 2QQKH 1JVOA 3QXDB 3I6KB 4HSCX 4ELME 7PCYA 2CUMA 4S2SA 2WXKA 4NRYB 3MLSL 2Y06L 1LWRA 3UG3A 1BFSA 4PRIB 2MQ3A 1VKXA 1KCLA 2WYHA 2OTUA 1P7BA 4JFFB 2A77L 4PLJD 4V1DD 4WHYH 1G6RA 5CZKA 5T1MB 1ZHKB 4ZMTA 4OZFH 3KD4A 5TFSL 2XZAL 4FG6C 2LVEA 1CF8L 3TBBA 3VXRD 2WQ8A 5HYJB 2HJKB 3H4FA 4FLHA 4H25B 2WKGA 3MV9A 2GC4C 4HK0B 1RUKL 4Z7VA 1YEEL 3EO1A 1FO0A 1A7OH 1NGXB 1P4LA 3WNLA 4M93C 5DS8A 1BCIA 1TQCB 3UDWA 5GGSA 3TS8A 1DJXA 4ALAC 4ENED 1LO0H 2RALA 1JGDB 1NBYB 3BP6A 3RPIB 3QAZC 3VQLA 3QCUL 4DHLA 1NOFA 2JLLA 3MRNA 4BRVA 3IRZA 4CJ1A 1AY1H 4FQXB 4P0DA 4AL8C 1FZJB 2C1OB 2I26N 3Q44A 2BP8B 4G8AC 5DS2A 4I1PA 3EGDA 3MRIA 4P5TB 5CKGA 2W9LA 3ELAT 3DXAE 1U8OB 3I9GH 1B88A 1KXQA 1GCYA 2C9XA 1TVBB 4CADB 4MBOA 3MCLL 4Z7WA 3CC1A 1MWOA 1PZ3A 4ABUA 3QDGD 4KKBD 3L7FB 1E5BA 2IAMD 1EHKB 4GINA 4JM2F 4KK8C 1MLCB 2PTTB 3E3QE 4PWIA 1S6NA 3E6FA 5B38A 1JTOA 2R0WL 5I66A 3HTLX 1N6QH 1WPCA 2GBTA 3PHOB 1CTOA 4JY4B 1BEXA 5JOPD 1BZDA 3GFUA 1TLKA 4HH8A 4WF7A 1LNUB 2J73A 3QO1B 5HY9B 1E8WA 4BSVA 1KJ2A 4HAGA 4P3CL 5CINL 1P1VA 5GSVA 5I15H 1HE7A 4IU2A 4GB9A 5BQ7A 1KBBA 1R5IA 2YMTA 3E9TA 2ZCZA 2I9LB 2CIIB 4NO2B 1DVQA 4QY8A 4AWJC 3FB6B 3UROR 3LRGA 4APQB 1YEHL 3OAUL 4URTB 4MAYD 3SGDH 1U33A 1HX0A 2K6ZA 1XB6A 1IC4L 4G6FD 5KANG 4R7DB 1ZTXE 4H0HB 2Q10A 1XZWA 1H6EA 4PRPD 4YSUA 5HHXH 5LWYH 1BQHB 2NX5D 1F97A 3R06B 1KGJA 3LZLA 3MXVH 4P57B 1TG8A 2BZDA 3A4EA 2AQTA 3MJ6A 3B34A 5KAQG 3NP4A 3UYOD 3CHOA 3S3CB 1JV2A 4AT6A 2XG4A 4H1LG 2H2PD 3KYMB 4A63A 2FO4A 3DROB 5EWIH 5E7BA 3HS9A 4Y5YC 1C12A 3GWJA 3L9BA 4AQ1A 1YAZA 4OF7A 3JT2A 3VWJC 5GGQH 1DEEA 2GJ6A 5BRQA 1A1MA 1AZBA 1FFQA 1U8NB 3D39E 4GXVH 3WOVA 4OCNC 1QLEB 4MJ5A 3D85B 3VXNA 1GPOL 4Y5XB 3VAEA 4N8UA 3RTQC 5DURB 4TUKL 2RB8A 3TBWA 1AR2A 3L1OH 1RZQA 5I1HH 3WN5B 4WV1A 3LB6D 2YEQA 4QRQB 1JV5A 3B7YA 1PFCA 4QRPA 4GXUM 4OJEH 4K7PH 4IRJD 4K7FB 4LMQE 4UTBH 5AUMA 4LSPL 3CXHK 4X6DF 2WIMA 2PUQT 2XICA 2I07B 1IRAY 3EUDA 4NHCL 4UNVA 3S8FB 1MCBA 4H8HA 2NXYC 1PY0A 1KDJA 1UVQB 4IOFD 2K9UA 1AGCB 4G8IB 4Y88A 3GK8L 3B3IB 2K70A 5KUKA 2Q86A 5D9SA 3EJJX 1R5VB 4TOYH 1MCPL 5C71A 5GRVL 2AXFA 1L9PA 3HZMB 1N3NB 2XOTA 1OGAA 4LO9A 3JV6B 43C9A 1QKZH 3F3HA 2OSLB 5CEYA 3GTNA 4BKTC 4HG4K 2Y7NA 1P4BL 1FL6A 3MLVH 1F4HA 1P7KB 2Y5TA 4M6AA 2M26A 3D48R 2XBDA 2Y22A 7FABH 1UM5L 3GSNH 5D6CA 3DA0A 1O5DT 4U6HB 3EYVA 2C4FT 3FQNB 2WJ7A 3D07A 1G9MH 1Q1JL 2FL5A 1AXIB 2VXVL 4H0GA 3L16A 4HCIA 4JRYA 5D1XC 4F2ME 3VWKD 4G6MH 2D0HA 3O4LA 3ES6A 4PJXA 5I6LA 1BD2D 1EFXB 2EDWA 4UM8B 4MDJB 5C07E 4ODXB 4U1SB 1KCVH 1S9YA 3FNKA 1NCTA 2V9UA 1IIKA 4YDZA 1FGVH 3QPKA 5CBAA 1KELH 4JK0D 4E68A 1EHLL 3CPUA 3WKNA 2CDGA 3UX9B 5KSAB 2ICEC 3I02B 3N50A 3C5JA 1RUAH 4MD5A 1RU9H 4HLZH 3TPUB 4RGOL 3ZHKA 3DDFA 5FYKU 5CM1A 3SDDC 5J9PB 3KS0J 2C5DC 5DEFA 3F7YB 3W9DB 4OZGE 4G43B 1U3ZA 2FIKB 2WKLA 4H0IA 4IKNA 1OSPH 4LOVA 1E9PB 1HESA 3QUYA 3E38A 3ZE1F 4N2AA 1D9KB 3RVWC 3WIHH 4RMQA 4UYQA 2XZZA 3GI8H 4LCWA 4OKVA 5BQDA 3QG7H 1OTTC 2O26U 4Z7UB 5F7YC 1SEQH 1E5CA 4ZQKA 4JFEB 2BVTA 3LDBB 1WCBB 3APMA 3UBXB 4HULB 3UTZB 2K6YA 1A8ZA 4ZFGL 2QPUA 5DJAA 2HKFL 4WW2F 4KUCD 4E9TA 3S3PA 4X4MA 4IM8A 4L4VB 3QDGE 1KTDA 4BFBD 4UAHA 5L6YL 1BIIA 1IEAB 1NMBL 2BIQA 3PWPE 4XMKL 5ELIA 4DJMA 3KLHC 1YMHA 1YEWA 1DBBL 3FK3A 5L4JA 3UOAB 3C6LD 3VFGL 3QEQD 1EMTL 4ZUWB 2HLAB 3PGFH 4HGMA 4LPCA 3QJTB 4JFOA 1L9RA 5DVKA 4MJ2A 1SMOA 4M56A 5F7UA 1KBKA 2VXQH 5INDB 2D2CC 3VSVA 3V7AE 1Z5LA 1CE1H 5MENA 3L9RB 2EDDA 4YSEA 1PX3A 4LEBA 1NCAL 2EKSB 3GUFA 4GUPB 1XGPB 1NLDH 3UTTA 3M17B 2D7MA 5EN3A 1KZYA 3X12B 4AIOA 4U1IA 5HI3D 1SHXA 1HYRC 2VQTA 3CVDA 3N43B 4IRSC 4OBSA 1B9ZA 3T6ZA 4BZYA 1O6SA 3A3YB 3QFDA 4X6CF 2NX5E 1KCRL 4HC1L 3L3KA 2EILB 2QADC 1F90H 3KPRA 4LHUB 3IJYA 2WLLB 5I6MA 1NINA 4PJ8D 4F15B 3ZDYF 1N5AB 4XTRC 2J2ZA 3MUHL 2APTA 5JNYB 3S2CA 4J39A 2GPZA 4O2EB 5GRXG 3V4UH 2HLEB 2XT1B 3CQPA 1SYVA 4KK5D 3GSVB 2ITCA 1TDQA 4WI3A 4JRFA 3UH8A 3P9LA 5F89B 2IOOA 5C0JB 5GGUA 3BQUD 5TF1H 4XCCL 4J4PC 3SD2A 3ENEA 3ZE0E 1A6WH 4F7CB 2CPCA 5I1IL 1EWHA 2J56A 2O5ZH 2X4TB 1P1ZA 4P2YA 1L6ZA 3WNNA 4E41B 2NY1C 5IMKB 4K3EL 4JY5L 5HBBA 3DVGA 1LL1A 4MHHG 3E1ZA 1FLTX 1MZYA 1Z9MA 3X13B 5FK9A 4YQXL 2LU5A 3EJUA 5EOTB 5D4QA 1YYLH 2FWOA 4MS8D 2XN9A 4KVCL 5D72L 2MCPH 5CLWA 3EOAB 2AS5M 2KPNA 4ZPVA 4U0RB 1QP1A 4KXBA 4KO9A 2W07B 3LEVH 2WQRA 3IXAA 5B3SB 4KH2A 2AXJA 1LP9B 1N2RB 2QSCH 4XMWA 5DJYB 5IV2B 3Q13A 1JNNH 3PP4L 1Q9LB 1QSZA 5DHYB 4XMTA 3BMVA 1MFAL 4NQCA 4XNXL 1CLOH 4QO1B 2AJVL 3BSHA 4ERSL 4KO7A 3NRFA 3RWIB 1FZKB 4PP1D 3L7EA 2OCFD 4WTXA 1RUQH 5F7WC 5DRNB 1UHVA 1P6WA 4ZO8A 1OWWA 4UAOC 3MLTB 2EDFA 1FF5A 1EX0A 2WLZA 1E4HA 2CPUA 1PD6A 1FUNA 4GI8A 3CFNA 2EE0A 4A2FA 1D5ZB 1CLYH 1RZGB 1U91A 3KJ6H 4JFWA 4Y2NA 5C09D 1TLMA 5PAZA 3RRQA 3FT2A 3IJ8A 2VXUH 5AYUH 4M6ML 4PJHA 4A7GA 3II1A 1BD2E 1K4CB 3OKKB 4XXCA 4OLZL 1IFHH 3QH3B 2DIAA 3BUTA 3K5SA 3DECA 4PLNC 5I1AA 2ENYA 4LDOB 1SLWA 1SVZA 2F15A 3LSOB 4BFIB 1A1OA 4PY7A 2VR5A 2WZ5A 2Y5QA 2FK9A 3NRQA 3D0VB 3ZKMD 1S9WB 1KTBA 2APVA 2DM2A 3DUUB 4EQ2A 3FQTA 1BQLH 2FX8H 5KS9F 5EZIH 1EO8L 3C08L 1HHJA 1WC7A 4MKTA 3GEFA 2XTJD 3K91A 1LK2A 1ID5I 4YDVA 4KQ3L 5DT1L 4HD9A 1G43A 3QC5X 4D9QD 3LKOB 5I6XC 1WG3A 1E7UA 3EYQC 4KKCD 5EU6E 4FQPA 3V4PL 4AIZA 1UWEH 1BPVA 2X70A 3MR9A 4PRBA 4F57L 4AL8H 4ZW7A 4N2EA 4EE2A 4PMFA 4U1JA 1II4E 5B38G 3B9KC 3BZFA 2C3VB 3AG2B 2IH8A 4YSTA 3VWJA 5BXFB 1OAKL 3MRGB 2G2RA 4FG0A 4LF3A 1M6OB 4LRNL 4PJFE 4F3FA 5HSFA 2X4PA 3ARVA 4IBLT 4LFHG 4N68A 4XCYB 1XH2A 3K6OA 4GBXC 3KWVA 2Z8WC 4LGPB 3LZNA 5F9WB 3TH2T 4EBQL 2OMZB 2UWEA 4I4WB 4JPVH 5E51A 1J8HE 2AXGB 2IQAA 5IROA 3K72B 4WI0A 4OJAA 4OCSH 1NUDA 3HC0A 5FS5A 3FT3B 3MXWH 1FIEA 4LSTL 3L5HA 4GW1A 4GIOA 4CC4A 2ISDA 2CLVA 3CVIL 4RA0C 4ZYKB 4ORZC 1E40A 4UM9A 2JH2A 5KAQF 5DHVH 3HLAA 3OWEA 5BS0A 5IBLD 2WBXA 5K33A 4N2MA 3FOMB 1S78D 4Y9FA 3G6JE 3RWDA 4Z7AA 2E7BA 3AWFA 3MOAL 1YC7A 2PPEA 2QKIA 4X7DC 1G7HA 5FYJU 1ZLWK 1KFAH 5DTFA 3ULVC 1K3IA 1UACL 1EIBA 3UO1H 3GUTA 1QWUA 1T03L 5TK4A 2ADYA 2HLFD 1H5BA 1RP9A 5E00A 4P2AA 2MKWA 2VL4A 2GAZA 5I8KL 4NNPL 3MRFA 1I7UA 1KIUB 3ZJAA 3CFJB 5DHMC 4OUOA 1AJ7H 1UA7A 5HDQH 4PB0L 1LO2L 1YNLH 1KN2L 1A5FH 4JAMA 4WHTA 2CJSA 3GMQA 3QRGH 3MV11 4J3WA 5HVWA 5BOJA 2F5BH 2Y2TA 1TZIA 3OV6A 4HXAH 2Y7QB 3GZPA 3LH9A 4K9JA 5D7LB 1WK0A 3QNZB 4E9RA 1SDDB 1IGFL 3WY1A 5BUGA 1BFVL 3CIAA 1CS6A 2WBJA 2XXMB 3FFCA 4LVHB 3FF8A 1IFGA 1OPGL 3FOLA 7TAAA 1OM3L 2RFXA 2YAFA 1S5HB 3PDOB 3GXTA 1CTNA 2FEEL 3WS3A 4JFYA 5BMFL 2YQ3A 3D8MA 1SY6A 4NGHL 3EJYC 5DRWB 4B7IA 1QACA 4PJ7F 5T5NF 2YLKA 4UT9H 4KTGA 3CSBA 3IDYB 1SYSA 1OAXL 3SKNB 3JWNG 2DYRB 1BGXH 3I6KA 3SGEI 2ICEA 1UGKA 3IBOA 3ORJA 3PAZA 3V55A 3S8WA 1ZJBA 3VXME 3W57A 5I5MA 2OX5A 4PRIA 1J48A 2X12A 5CBEA 3JV5A 4MA3B 4GT0A 1E3FA 4G70B 4JFFA 4K8RC 4MA7H 5E8OA 5T1MA 1ZHKA 2BW5A 4KI5F 3D87B 5HYJA 3GS4A 3IJ9A 4H25A 4XHQA 2A38A 1UZ6F 4HK0A 1B3IA 1NGXA 5JIKA 1RVFL 4PRNB 4ZMYA 2XA8H 4OGXL 2PCPA 1W16A 1KYAA 5TDPB 5CIPB 5HDOA 3RPIA 3ZUNC 4MAUH 4BFJA 4G8GE 3NIDB 4TULH 1YEGL 4RETB 4WUUB 4DP4X 1L7IL 2DDQH 4FQXA 4JG9A 3PQYD 2DQUH 3DVIA 3QJXA 2OAAA 1LO3H 2C1OA 3VI4E 2Y7LA 1XDTT 2CR3A 43CAB 1LD9A 1W91A 2BP8A 2PXYC 1RI8A 4OF3A 4P5TA 3WTYA 4YBLB 5F9JB 1IL1B 1U8OA 4HK3J 3ZDXE 4CADA 1TVBA 1WFOA 1AFVH 4JQXA 1VSCA 1IAIH 1GGTA 4NJAH 2AJYL 4XB8A 1DQLL 1B2WL 3UAJD 4AG4L 2NNXA 4IK7A 3S5ZA 4Q97A 1W15A 4UOZA 1WUZA 4ADJA 2FB4H 4HXBH 4HJGB 4NBYB 1HKFA 4JY4A 2VB5A 3B2XA 4R2GC 1DYZA 3IEAA 5CS7A 3UP6A 1LNUA 4J1UB 3QO1A 5DUPL 5HY9A 1WAAA 3KPMB 2WZ0A 4GIPD 1KPVA 4OD2A 4WFFD 4JMNA 3PHQB 1FDLH 5G5DB 3SO3C 5DJ0B 1JZGA 2CO1A 2YZ1A 2YXWA 4OLYL 4W9JC 5MHSE 4MLIA 2XHNA 3HKFA 4AUUA 1MPAH 1W2KT 2ZX6A 3BKJH 4PBDA 3KMDA 4NO2A 3JTTA 3BDBA 4L37B 4N0UB 2APFA 3FB6A 3GIZH 1WEJL 5D5MB 3MBXL 3RWHB 4CA4A 2J1ZA 5IB1B 1MRDH 2FTAA 3F6IA 3H1ZA 3DOHA 2XTJE 3HB3D 3U4KA 2X0WA 1ZT4B 3FUNA 4LLWB 1N8ZB 4XPHL 1MFEH 4QDGA 4XO8A 4JRXD 5I17B 1ZGLP 1JPTL 3IETB 1U2HA 4RGND 2G30A 4NQQA 3B1UA 2X6CA 3L3IA 4QJ4B 5CUSL 5EHFA 1T7WA 3WV0A 4HWBH 5AVUB 2HVBA 1RY7B 9PCYA 3KYMA 1YN6A 1JFQL 4YLCA 3BP4B 1H9DA 1UASA 3OB8A 1OK8A 2DF3A 1MEXH 1DFBL 2IO5A 3GMLB 3GRBA 4J7RA 3QJOA 2N7AA 4XXDB 1A6UH 4BELD 3IPBA 1SBBA 1U8NA 1PS3A 3D85A 3V52H 2BVOA 5F9WC 3ULUH 3K0YA 2B9AA 5I1JH 3OKOA 4HVBA 4P2QD 2JCCB 1USQA 2WLIA 4HW6A 1T0NB 4WHDA 3WN5A 1YPZF 2IVFC 5HGGS 4C4KT 4G7QB 1OCZB 4M1DH 4K7FA 3U7WH 4ZX3A 2IG2H 1MFCL 5FOJA 2I07A 3LZRA 1X9LA 5HDBB 3ZT7A 1TXKA 1S7QB 4YHZL 3R0MA 2QVKA 1QR1B 2JB6B 5EUKA 1UVQA 2Z0UA 2PP9A 1DHKA 4G8IA 4XP1H 1A7PH 2Y1ZA 4RAHA 2E6JA 4FNLL 1YYMH 4I18C 1F6AA 4E9LA 1R5VA 3RZCD 3QP3A 4FQIH 3H0TB 2ZKXA 4M3HA 3HZMA 3RDTD 4GH7B 3KYKL 3SJVE 4P2RE 2OSLA 5LBSH 1INEH 3CMGA 4MA1C 2O6CA 2OMNA 1P7KA 4KO5A 1AKJB 1CYXA 4NSKB 4W70A 4A2MA 2EDXA 4X5WB 2F8XC 2HRLA 3RURA 1BVNP 1KEMH 4OCYH 4U6HA 4XWOD 5EU3A 3VU1A 3L4UA 1MLBB 5E23A 1RURL 3J8F7 3NCYP 4JDTL 5AZ2L 3CFKB 5T1KB 4UM8A 5I8OL 4MDJA 5T3XD 4Z0BL 3WO3B 4ODXA 4U1SA 5M94B 4WK0B 5IREA 4OZHE 3O2DL 2G75A 4MNGB 4PH8A 4QTHB 1WP6A 1SJEB 1E43A 3O2VH 4OT1H 4UQCA 1IMHC 1UOKA 3QDMA 1PD1A 5KSAA 3LQMA 5FA4B 1K72A 1KTLA 2F74A 3FHQA 4O5LH 4XPGH 4D3CL 1GA2A 1JSYA 1KYOJ 1N0XH 4J2XA 1BXUA 3ETTA 2HT3D 5A2IH 4NZRL 2A3TA 1XGYL 2YZ8A 1SXZA 1JXFA 3C5ZD 5K1JA 2JJWA 2WXIA 3FT1A 2X3CA 1SEBB 4YN3A 4JNXA 3F7YA 3W9DA 3UG5A 2EEFA 4G43A 2AEWA 4U1HA 2D7TH 2FIKA 2KQNA 3T1FB 4Z7VF 2AK1L 5KSUB 1D9KA 2F54A 3UYRL 2XKNB 3QQ9D 5C0CB 2DKUA 1U3NA 2ERJC 1FAKT 5I5RA 2V17L 2BC4B 2V3EA 4JFEA 3ALXA 5FYKH 4DKDC 2VM9A 3UBXA 1QSFA 3MROA 3ILEA 3UTZA 3I3EA 2Z7UA 3NK4A 4WSGA 3SIKA 4NBZB 3TGXA 5DJXB 1YA5A 3UEQA 4BE6A 3RI5F 5DJCB 1PG7L 1HH9B 3MLWL 4DKEL 4OQTL 4C55A 2UVFA 1SPDA 1XF5B 4HBQA 3HAEA 4CGUB 3X11B 3GS0A 1IEAA 3BZ4A 4YO0B 3CFCH 2YPLE 3B9DA 3AT9A 4Z7WF 1ILSA 2EDYA 4Q6KA 4V1DB 4ZUVA 4DP2X 1JGUL 5BV7B 4O2CB 1Y7VA 4XVTH 4B41A 5BOZG 1TVDA 4ZUWA 3OF6A 1DCEA 1JF5A 2VRAA 5E9AA 3VXRB 3A24A 3MUGB 4HUKB 4YWGH 5T1LD 5INDA 3ZKNC 2F58L 3G5VB 3HVDA 4UZSA 5ALBH 3TNNB 5EV7A 4WFFE 5IBUG 1AC0A 1RZKH 1F5WA 3WHE0 5JZ7C 3TL5A 3KXFD 2NRDA 3NEXA 1KBGL 1QFPA 4GUPA 2VDPH 1AGEB 1LDPL 1AQDA 3M17A 5DUJA 4M5ZH 4YR6B 2B8OT 5DEGB 3X12A 5ICZB 5IB2B 3QJSB 5IVXE 5DQJB 3GMMB 1CDCA 4KAQL 3LKPA 1X44A 3MA9L 3W39A 3H9HB 2HRHA 2WUCH 1NFAA 3Q5TA 4U1MB 1NEZA 3TH4T 4JRXE 4FFWD 3ZDZB 4AYDC 3NA4A 4HIQA 1DR9A 2WXRA 2IAMB 2R0LL 1AQKH 3C8KB 4WNQB 4L8CB 1AR1C 3KPOA 1N5AA 2HKAA 3GI9H 2JIXD 4W6XB 1FBIH 5JNYA 5KYXB 1K8IB 4Z7NF 1UXSA 2R23B 1UATA 2YEVB 3EOBB 5LGKA 3WU1A 1B0GA 3E3QC 3ZW3A 4Z5RB 1TJXA 4OCWH 5F89A 5C0JA 1WD9A 4FNUA 2E74C 1AZVA 1A8JH 2VW6A 2D7OA 3HJ0A 2CRIA 3TCLA 4F7CA 4JKKA 4E41A 2X4TA 5K59F 1ULVA 3L5IA 4P2QE 3ESPA 1RZIB 4IEFB 1MHCA 5HXMA 5L2KD 5B7FA 3NYKA 3D18A 3X13A 1QFHA 3JV0A 2Q8AL 2MCG1 1P4IH 5EOTA 2RACA 1AD0B 3ILPB 4KZEH 2AXHA 1UJTA 5JR1H 4PRPB 3V4VA 3DTUB 3ISWA 1MDAA 3HI1B 2W07A 4HBCL 3D4ZA 5HVHB 1QBLH 5E08H 4R97C 3TVMB 1N2RA 1WS8A 3UJTH 5IV2A 3LZOA 4LARH 1VENA 4JM0A 1Q9LA 4P9HC 5DHYA 4OD3L 4JGJA 3QRFM 3DETC 4RMSA 1WGVA 1CFTB 4H8WC 2CMRH 5SX4I 3BWUF 3RWIA 2QGCA 3C2AH 2K7QA 2PXYA 2VN7A 3H7BA 4K07A 3S96A 3CFIC 4S1RL 1ASQA 4YHLL 4KHTH 4AV5A 1PZ5B 3VG9B 1PZSA 1PQZB 3EJPA 3MLTA 5HHPB 5F8RC 2P8MB 1KZQA 3BVNA 3NSYA 2GT9B 4UQEA 1RZGA 3ZR5A 4R5XA 4QEGA 3T3PB 3CD4A 1U8IA 4XNYH 1RIUH 4IRJB 3NGBC 3O6FD 1NL0H 2BCKB 3NFSH 4GG6A 5DLMH 3LJ3A 4WFED 2WVVB 2X1XR 1ZRUA 2ZUYA 5IB3B 4OFYD 1DLHA 3CDCA 3MX0A 5AYQA 5E9DD 4PJXF 3KR3H 1DBJH 4UDTA 3IDNB 4ISVB 3RA7L 2D73A 4BFIA 3O8XC 4GP5B 3MCKB 1K3ZA 4ESKA 1FNFA 3K6DA 5E1AB 5C0ND 1S9WA 3DUUA 4GRLC 1MFUA 4JDVA 3ARBC 1NFDB 4S1SL 5HHOE 4RWYL 4YPJA 5E94B 4Q9RH 3IU4L 2H3NA 1IBYA 5J89A 3FW6A 1MCOH 3UTOA 4YE4H 1GR7A 3TFKC 4ZMZA 1JZEA 3CFBB 3WNKA 1JMZA 1S9XB 3HEIB 2WWOA 4MCMA 2BLFA 3RVUC 1TR7A 2YA2A 1V55B 1NLBL 3EXLA 4OCXH 2O6FA 1PZBA 2C3VA 3S35X 1MNUL 2VERN 5DD1L 3RAJL 2K78A 1D3CA 4PLKC 1MOEA 3B4NA 3GT6A 4XCYA 4KTYA 4ZS7H 2NDGA 3IMRA 4GFTB 5E0QA 1ACZA 4DGUA 3QSKB 1MW2A 1A6VL 2LU4A 3BLPX 4HMEA 4I4WA 4BDVB 1VPOL 3QDJB 3CZGA 4GO8A 4U05A 4XWGL 5I5JA 3K72A 5GRJH 2DMBA 1KJ3H 2IH3B 3TO4C 3VYNA 4C56D 4DEPB 3FT3A 4JO8A 2OJEB 2OV0A 4RWHA 4ZFOB 1ZV2A 5ABDE 2V5RA 1I3VA 3TO2B 3EBIA 1DJWA 3HI5L 2WLJA 4HCFA 3IF1B 1XL4A 1KJVB 1EVTC 2E3VA 3SCMD 1WFMA 1UWYA 3GLDA 3MJ9A 4L3ED 4L1LA 2WP3T 5BCAA 4P46C 1JDAA 3ZR6A 1VAHA 1R3HB 1RLBA 3CBKB 3P30L 2WQWA 4F1ZA 1D5MA 2ZCHL 1F3DJ 3MRCB 3QZNA 1LE9A 2BY3A 1KIUA 3H3KA 3CFJA 1HZLA 1ZA3B 3HFMH 2XPGA 4B9CA 5I75B 4JL2A 2YK1L 1R3LB 4JO1L 4BFEA 1S5IL 1JK8A 5D7LA 3WFCH 1Y07A 1H3UA 5AAMA 1HKLL 5FYLL 1QBBA 4CSTA 2CRYA 3UZEA 2Q8BL 3KCWA 4M03A 2KC0A 1I7TB 4NN6C 4PCKA 4BBWA 3C6LB 3QEQB 5MEOB 1G0DA 3E8UH 3NSJA 4BK8A 2UUDK 3WMQA 1S5HA 1V05A 3PDOA 4LCUA 5TPWL 4NRXB 1R3JB 2Z8VC 2WGXA 1SBSL 3HG0A 5ANHA 3G6DL 1MELA 4KX8A 4N90E 3FQUB 1UEYA 2W65B 5G4MA 3GBNL 2TSBA 4L18A 1GCFA 4WEEA 5KYNA 3SQOH 5I26A 2YQBA 4PWGA 4XAKE 1WZKA 1Q9WB 5MP6H 1EA9C 2X7LB 2NNAA 3JUZA 1MI5E 3O0RL 4XMZA 3H9ZA 1AHWB 5I16B 1KENL 2H3XC 3CN2A 4MAYC 2NY5L 2NMSA 3GJFH 1I7ZB 4ZW8A 4L5FE 4PU2A 2HJFB 1P69B 3L5WB 2RH0A 5EOCH 5TDNB 5DVPA 4Y8DC 2J6EH 4HV8B 4PJ8B 1JAEA 2VMJA 1MAJA 2FCBA 3H3PL 3VGDA 2VLRD 4PRNA 4OIIL 4X42A 3NCWA 4CVUA 4G6JH 4LEXH 3QUMB 4WDIB 4TSBL 5GS1C 5CIPA 1FIGH 3WIFB 2NY4C 3HW7A 3MU3A 1J9TA 2ADJB 2NY2B 5LGHH 1JYVA 1BXAA 3BFOA 4WUUA 2WNKA 3NVQA 4O58H 3IFLH 2VABB 3BQUB 4NEHB 4F27A 3L4YA 2G5UA 3SDYH 1PEWA 1M9WA 1U6AL 3VYPA 4EDXB 4P9ML 5AEAA 5F9JA 1IL1A 1U93B 2VDLB 5B4MD 4K5NA 4KXZH 3VD2A 3K1DA 1M05A 1UJ3C 3CFMA 3VRJB 3Q6GH 1C5DA 5K9KB 4XCNB 1I8IA 4Z7QE 3CXDH 3MVSA 1KWKA 2E27L 5F7LB 4HJGA 3LB6C 2LE9A 1GMEA 1UD2A 4A7GF 4PJHF 4YSAA 2EUVA 3OPZL 4J1UA 4Q56A 5E2UH 5AVZB 3L9YA 5IF0A 5H2BA 5EEYA 5G5DA 5DJ0A 2PPDA 4R7NA 5GJTH 1F4AA 2L8AA 1KB3A 4IOFC 5DQDH 1C7SA 2G5BB 1WSST 5KN5B 1BYNA 3MC0A 3NCEB 4L37A 3AG3B 5IB1A 4TNFA 3BX7C 3UBXG 2Q7AA 5CF3A 4N8PA 2MKLC 2P42B 4LLWA 5I74C 4FI7A 1KY6A 1A4AA 4NOFA 3WMSA 4ADGA 3HC4H 1KV7A 1CMOA 5I17A 4Y1SA 1H3PL 3IETA 5IGXH 1D2PA 1A21A 3NBNA 3HAEG 3EKCA 5IWLC 1RZJL 2DW5A 4OLEA 4JVWA 5C09B 2IFGA 1S9VB 4WY7L 1DBAH 2RCSL 4B9GA 4JKPH 4FI8A 4QXWA 5I19L 1G7MA 4G3YH 2HT4C 1MCJA 1NAMH 3BP4A 4XAWH 3VWKC 5DRXA 3ZO0A 2P49B 3SGDI 2W0KA 3N2JA 1WDAA 3EFDL 3WFDH 1ID2A 5EZJB 4XXDA 4OQ1A 4X9FA 4I85A 2A4CA 3TH3T 5EZPA 1UWGH 3PWVA 5FB8B 3N85L 3OC5A 5I18H 2UWEF 4P04A 3TONA 5F7HA 4PY8J 4FD0A 4N28A 3E9UA 4EIUA 1T0NA 2OYLA 2YUVA 1YMMD 2VDLL 1XGUA 3AABA 3DGDA 3WJMB 3CHXA 3RX8A 1OANA 4HEMA 1NEZG 4OI9A 3QUKA 2XFXB 3KDMB 3KBPA 2AW2A 3LH8A 2ODHA 1ADQL 2BCMA 2Q1EA 1S7QA 3RGVC 3CFQA 4X4KA 2VR9A 1QR1A 2DQFB 5EC2B 2JB6A 4P23D 2YRZA 3BOVA 3JVGC 1Q0YH 2YXMA 3GSQB 1NBVH 2V8MA 4HKBB 4NAJA 3GTTA 4N9GB 4BQ9A 4IRZH 4X0KA 3K8MA 5FUOH 4TPRL 4BQ8A 1T5WA 4W6YB 3UGEA 1CU4L 1QBML 4FX5A 4BFNA 1PBYA 3W3BA 5BVPL 4PGCB 3DO7B 1AKJA 5J11B 3W1ZA 1HQ4B 2WB1A 2W94A 3OAYK 3VG0H 2BHFA 4X5WA 3VD5A 5CU5A 2N59A 3MZTA 4OLXL 1D5RA 4EVNB 1AE6H 1J9CT 2J72A 4D0DA 4PRHE 5DRZA 1N5YL 1MLBA 3N42F 4CUCA 1MRCL 2A6IB 4KRMB 3SDAD 5JDJA 2Q5BA 4A67A 2PWEA 3CFKA 1RXLA 1KULA 2DOCA 3DJTA 4K9EC 2XZCH 5L0QC 3NIGF 4K5MA 5AKSA 1PDKB 4MNGA 4QTHA 5LXGL 4MJJA 4N0UE 1ECYA 3OKNB 4HIIA 2FWSA 2R69L 5ECJE 5FA4A 2VDQL 1TSHA 2XVKA 5F7NC 4FQ1L 4R90L 3LPFA 2JLPA 4U3CA 5DJZB 4PPTA 3B37A 3CVHH 4FG2A 4H26A 1AC6A 4M62L 3NTCH 1HWGB 1W0VB 3QFJD 1X4ZA 2CWRA 1C8PA 4KDTA 4MAZA 3WEBA 3BE1L 4UOQA 4P49A 5F1SA 2E5EA 2GSIB 5CJXA 2YLHA 2VC2B 5GGVY 4OFIA 3ZE2B 35C8L 1CD8A 2LT9A 3NPZB 4MMXB 2B0SH 5KSUA 4W4OC 1E4KC 4X6FB 3T04D 2XKNA 5C0CA 1L3WA 1RK1B 1J8SA 1PFOA 3FUJA 4QYAA 3B9AA 5D7HA 1JYWA 1QHPA 4KMTL 3STLB 2BC4A 1ORSB 2J8UE 2UXFA 4NB7A 3SYCA 2OMTB 1NJ9B 2GJPA 5IT2L 3FRUA 3EJRA 4YC2B 1FQ9C 5DJCA 1FAIL 2X3AA 1HH9A 4QRAA 5DK3A 1HJBC 4XBEL 1XF5A 2WXPA 1A47A 4Q2ZB 5B39B 1HCFX 1MRFH 4YO0A 5C70A 1NANH 4V1DA 5AW0B 1HZHL 3UBFA 2FJGA 2G3XA 4Z23A 5TE6L 4JN1H 4NO5A 5DMKB 1A02N 3UZQB 4D9LL 3VXRA 1A7QL 4MS8C 4Y2DD 2IADB 4AOFA 4DKAA 4CVWA 1IARB 2CM6A 2QGDA 3G5VA 4CW1B 3TNNA 2J8OA 4YBHA 3S3BB 4DN3L 1WAAF 3S36X 1CGSL 4YXKL 3APFA 3EFFB 4NENB 1HL4A 4HALA 1AGEA 1CC3A 2VZ3A 4XVSH 3OWRA 5ICZA 5IB2A 4HLJA 3NJNA 5DQJA 3PQYB 3MV8E 5HHMD 4PP1C 1TVHA 4GSXA 3GMMA 3L1EA 3H9HA 1BAFH 3E2HC 1EGJA 3QULA 2P5PA 3WTSA 2H6OA 1Z32X 4X7SL 4DPBX 4E9WA 3QDGA 4S1QH 2IAMA 4YHYB 3HNVH 2CAKA 2QVTA 4WNQA 2HRPH 4HIPA 2B59B 1CVSC 4IQHA 4L8CA 1P4UA 4JKNA 1A66A 5KYXA 3QHZH 4AIEA 1K8IA 5HI5D 2R23A 4AJYV 2CKBL 3EOBA 3F04A 4ANVA 1NDGB 3MJGX 2F7OA 4KNUA 5GSRB 1IQWH 3F7KA 2GUOB 4Z5RA 4QPEA 1FGNL 2VWEE 4KVPA 1FVDB 1G7IB 3BAIA 3KJ4B 1IBHA 4Z7OE 4NERA 1YECL 4KXAA 3U0WL 1CPUA 4LSQL 4QKTA 1XX9C 2BY0A 2QQNL 3TZVC 2CDFB 5HGHB 3OLGA 4G71B 3UADA 3OX8B 4W9FC 3ZKMC 1RZIA 5F3HB 1Y6MR 5JORB 2V6HA 2KKQA 2ZXWB 1VJSA 1S8DA 1YMME 3R1GH 3HB3B 4MAYA 4AEFA 4XNDA 4PJ9D 5FDYA 4B60A 4X6EB 1AD0A 3ILPA 2ED7A 1TIUA 1E9OB 2YMXH 3HC3H 3MLUH 5E6ID 4AYGA 2O5XH 4PRPA 5HYSA 5EO1A 1K5NB 2NX5A 2XTJC 1MHPH 3HI1A 4NUJB 4RGNB 4FZEL 5D7JD 3QYCA 3OKEB 1R3IH 1YEKL 2EIEA 1OAUH 3KPSD 4MNQB 1HHKA 5FO7B 4QKXB 4Y9GA 5DK0B 1WTLA 1NAKL 5GS1A 2HWZH 3VTMA 4KKCC 3EADA 1WA2X 3DYMA 2BVUA 5I1CH 1XBRA 4YBQD 2IWEA 1CFTA 2ZJSH 2ZOLA 5FLVA 3CU7A 3BAEL 4OM0H 1MREH 5KVGL 3BN9D 4DGIL 5AZEL 1JZJA 2NY3C 5BRZE 1MW3A 1WISA 2DQHH 3QBTB 4AGPA 4MX7A 1N4XH 1PZ5A 4AENB 1T0MB 2YKLL 3A23A 1N9PA 2BRRL 1XTMA 1PQZA 5E4AA 3LIZL 5IMMA 4AYBA 3CX5K 4PGDB 1E5AA 5HHPA 2P8MA 4OJFL 4Y4FD 4LL4A 4ODBD 3F64A 2YAQA 2GT9A 5FHBH 1GIGL 3EGXB 1G7QB 2HN7B 5DZLA 1A4CA 3VQ1C 4IRJA 4OI7A 4XMLH 4A66A 3EW3B 3JWNH 1J5CA 3K2UL 2ZXAA 4R9HA 1FH5H 2BCKA 1Z6JT 4HWEL 1V7NH 1VCAA 4HMCA 1WS7A 4GW5B 4ELDA 2VUKA 3GRWA 4G1MB 3SE4C 4YJZL 3V0FA 2NZIA 5CCHE 5CZVL 2CKNA 1AXTL 4OF8A 4KTDL 5I9QC 5IOPB 4ISVA 3K2KA 2QV2A 4LSVH 4Z95L 3W11D 1H8SA 1Z9LA 4JQIL 5I1EH 3MCKA 1AMYA 5E1AA 2WOBA 2WQUA 5T8IA 2G4EA 1NFDA 1A7RH 4N8CL 3UAEA 1CBVL 3RDTB 1RJYB 2F2HA 3V7MA 5E94A 2BIHA 3U1SH 2WUBH 4BV1A 4AKQA 4UB0L 5SWQA 4LE8A 3GHPA 3QFJE 1MFMA 1ZDSA 3TBVB 1NIFA 3VD9A 4WWNA 3CFBA 4XRCB 1JYXA 2FH8A 2IQ9H 2ZE0A 1CDUA 2R51A 1TEGA 2YSSB 5BZZA 4DOHB 1TMQA 1KV3A 2NLJB 3FUMA 1NCIA 5D1ZC 2XQ0A 1CDYA 3FU5A 3VWKA 1O9VA 1JNLH 1LEIB 5I1GH 1BD2A 3BKYL 5GJSL 2X2YA 4IKLA 1FFPB 4QI3A 1NGQH 2ICWJ 2DJUA 3GKWL 5DZOA 1BG1A 3NJJA 4ZMOA 4LRIC 7PAZA 4KZ0A 4HUXB 4XMPH 2YD9A 3NZHL 5EMYA 3WSQL 2WTPA 1AO7B 1PSKL 1ZHLB 1JWUB 6PCYA 1Z1WA 3HBQA 4U3HA 2C9VA 2B4CH 1DVUA 3T3PF 1RIVH 2JJVA 1HIML 4TL5A 3QEUB 3NJMA 4ZFOA 4B9PA 2OP4H 3O6KL 1BXVA 1ZPLA 1JS4A 3T4AB 2CCVA 3A21A 1QWNA 4NO0D 3RU8H 3C5ZB 3IF1A 3RG1C 2Q9OA 1GZHC 1QFOA 4KPHL 4QNPE 2E75C 4FQJH 5ABZA 4K3JL 5INCA 5JQHC 5H37G 2ATKB 5BJTB 1FL5B 2BJMH 2XG5B 1KGUA 3MRPA 2QVFB 4G7VL 3LXBA 2ZUSA 3ARDB 4PJFA 3KGTA 1O6VA 2JKXA 1OCRB 2R4RH 2H32A 1ZA3A 3LYRA 4W6WB 5IQ9B 5C7XL 1MVYA 2KPWA 4FXKB 2Q3AA 4HDIB 4XN7A 3Q8CA 1R3LA 3FZUC 5DC2A 4F8NA 5JUEH 4AVIA 2F7IA 3AB0B 4JHUA 2GQHA 5FPIA 4IMLB 4H88H 1I7TA 1XIWD 3C6LA 2H6PB 3QEQA 5MEOA 4GMTH 2WPGA 3V2AR 2DWDB 1C5CL 3H54A 4HOXA 3UAJC 4EIZC 2NR6D 1S7RB 4JJOA 3APDA 1UWFA 4NRXA 5T1LB 1MFDH 4L9LC 4RMBA 2GTZB 2GCYB 1OW0C 2OXGB 2GSMB 3FQUA 2W65A 1BECA 5EFIA 1SLUA 3DIDA 3CFDB 4A2LA 3L1GA 3KXFB 1QSVA 2AQQA 2HVKA 5D70L 3J07A 2MNUA 5SV4A 5FYLE 5BOPA 4Y1AB 3Q2CA 1J1PL 5C0GB 4KY1L 4PCTA 4FFYL 4M7JH 4PJIB 5GGRY 1KT2B 1EEUA 3WTWA 1AHWA 5I16A 5AVWB 4U4BA 4QJ5B 2ENQA 1OAZH 4QXGH 4L4TE 3P11L 1FLRH 4XVUC 5FOBB 1QYGL 2HJFA 3L5WA 3VM5A 5TDNA 4PJ8A 3B5TA 5EUOE 1CFSB 2JIXB 2FX9H 4X99B 5D2LB 4XX1E 4HJTA 2KZKA 3QUMA 3TLRA 3KPTA 4GKLA 2P4AB 4XPBH 5GHWL 3WIFA 2P5WE 3WGVB 3T6WA 4ZD3H 3JZYA 3T2NH 3FUEA 1IAMA 3HMWH 4AYFB 5K9JL 5ANME 4F20A 4JN2B 3FF7A 3U6XA 2YXVA 4BGLA 1YY9D 3BQUA 2IFFL 4J6RL 3MODH 4UTAL 2X53A 2B2XL 3G5YB 4EDXA 5EPMA 1YDPB 2CHDA 3Q48A 1MW0A 1OF2A 1U93A 3L3DB 1OM9A 2VDRB 5D7SH 5L2KB 4XI5D 3X14B 4JG0L 1F0LA 3VRJA 4PW4A 4G80B 4TS6A 3GC3A 2VQ4A 3BC9A 3CFUA 4XCNA 2DWEB 5T3ZE 3BP7B 2AZUA 4FQQB 1PLBA 3GMNB 3I2CH 4YZFF 3QIUB 2W38A 3NEOA 4GG6F 3PXHA 2TRHA 3CK0L 5DFWH 5IHLB 2R1XA 1CO1A 4QHLB 4RMVA 4BSWB 5JQIB 1T89A 2XU9A 1YZZA 4YLBA 2COVD 1IAII 5JQ6L 2OL3B 2G5BA 3OBAA 5KN5A 2XV2A 4N3UA 2D7PA 1AZZC 1MF2H 1D5IH 3RZCC 3AY4C 2E7DA 3HBPA 3NFPB 2B1HL 1FZOB 3FSZA 4ILDA 2DBJA 3N04A 1OWRM 1NDMB 1L7TH 4G6AC 3RVTD 3K4DA 2YBRB 2ICWA 4AM0B 1YSOA 2XWBA 4NZTH 5KVEL 1LE9B 4MYWB 3GO1L 1T7ZA 3LHPL 1X5GA 5GRUL 4EZLA 1A4KB 3ULSB 4WCYH 5C09A 5A2JH 2MRYA 2YO3A 3FO2A 4DGYH 2DQJL 1GC1L 4MCNA 4ZTOL 1DJHA 5ACZB 3CSYB 3NCMA 3DJ9A 3LZQA 4MXWH 3HG5A 4ODHH 5E9DB 4KK6C 1ZVHA 4N20A 4K3GA 3LNFA 2WVUA 2VZOA 2XJKA 2VQ1A 4NWTH 3V6ZB 5EZJA 2PABA 2R69A 5F7MC 2MCMA 3EJQA 5FB8A 2A74B 5J4MA 2DMHA 2EADA 1LWJA 2CO7A 5DUBB 2CJ3A 3O6LH 1O0VA 2LU3A 1HINH 1VFBA 5C6TL 1T21B 4J27A 3BPCB 2AQ1A 4IJTA 1HVXA 4L8SB 4DVRH 3PV6A 3WJMA 3QUZB 2DYSB 2VDRL 5JIMA 3CG8A 5E6SB 2DL2A 5D8JL 5A2CA 4YHPA 2XFXA 1UB5A 3FKUS 1QR4A 3KDMA 5HD8C 4O02L 4LDLB 1F4YL 4HOWA 3WUZA 3Q8BA 1OY3B 3NP3A 4XNZB 2DQFA 1A7BA 3MLSH 5EC2A 1R4XA 2Y06H 3WEXB 4ENZA 4BJLA 4JZNB 4Y5VC 4PTTB 4JO5A 5A2KH 3U46B 1JGEA 2WN3A 1QZNA 4JM4L 4WJ5B 3GSQA 2VCOA 1JPFB 1PZAA 4CNIA 4QLWA 2A77H 5EIIB 1KGYE 2B3RA 3V7AG 3ARGC 5H94B 1OAQL 2OL3L 1JCVA 2XZAH 5TFSH 1CF8H 2JKLA 1FG9C 1ZKAA 3AG4B 2QVMA 3MRQB 4PS7A 2GABA 4Z3GA 4YDKL 3RX7A 4TLTA 5DVNA 1LGVA 1T83C 2OYMA 1RUKH 4C56B 1YEEH 1P5VB 1HQ4A 2CO6B 2NPLX 3SY6A 2ZPKL 5B21A 2WO4A 2CR0A 3FCTB 3WFHA 5JPMC 3KHQA 3LRHA 3MNVB 5DHDA 3C60C 3CZFB 5B1AB 2VL5B 3QCUH 4AMWA 4PJDB 2FATL 2D2OA 1X5AA 5HYSG 3JSSA 2A6IA 2EVIA 1ECZA 4HS3A 2K9FB 1MWAB 1GY2A 3LRLA 5B7EA 3SCMB 5C97A 4FAAB 3GEWB 2HA1A 1RIHL 4L3EB 5F96L 4Z78B 5H35B 3FTSA 5CCKL 1PDKA 1J1OH 1NTDA 4QOKE 3ZPDA 4XC1L 3HKZA 3Q5YA 3MCLH 5ADOL 3GXUB 4ZRGA 2Z92B 3OKNA 3V79C 2WLMA 4BH7A 3P4MB 1PCXA 2GHWB 2YOAA 2YD0A 3UTPD 5HYIA 1VGEL 4JQVC 1G0XA 4MDRA 2R0WH 3ZRCC 3QZOA 3VXPA 3JTSA 4WFHD 5DJZA 4F5CE 1KLUB 4L29B 1ZHNB 2CA4A 2NSMA 2XBTA 3NABH 3RIKA 1W0VA 4FFWC 2VDNB 1XT5A 4P3CH 5CINH 1X5IA 2PP8A 3A6BL 3M86A 1AS6A 4KKNA 4FEMA 4MMXA 4F8OA 3TYGL 4M61B 2WJ5A 3ZHDA 4FXGC 1T5KA 2GHZA 1LK3L 1YEHH 2BFVL 3OAUH 3STLA 1AH1A 3N6YA 1R3KA 3SZ6A 5I0WA 1IC4H 4J3UA 3O45B 3NIDF 3WENA 4PJCB 2BSTB 1NJ9A 2CE6A 2OMTA 1EJ6A 3WTUA 3LXCA 2X4SB 2P28B 3D50A 3TV3L 3OKDB 4Q2ZA 3FT4B 5EH1A 3RVXD 5B39A 4QYOA 3DX2A 1GZHA 2WXQA 2GIMA 4HKZB 4YH6A 3BZEA 2BOBA 4RMUA 5DMKA 3UZQA 3CGTA 5D2NB 1O9ZA 5BPPA 2DI7A 2VDMB 4QJ3B 4JFXA 5GS2H 3CNKA 3DSFL 2EYSB 1IM3D 2ATPB 1NPUA 4FE9A 3PHSA 3VGBA 2YA0A 3BRFA 4HHAB 5BO0D 3T5WA 2VLRB 3O81A 1TCMA 4CKQA 4ZMQA 1BEYL 1MJ8L 3L3OC 2PR4L 4N24A 1GPOH 5DFVD 3S48A 4IK6A 4BK5C 4Y9CA 2DY2A 1PKQB 3EFFA 3PP3H 4BUGA 4E42B 4NENA 5FWQA 4TUKH 3RUGE 4PIBA 2EDRA 3U9WA 2K7PA 3RKPA 1M3JA 3LAFA 3PQYA 2BWDA 1NBQA 4PJEB 3FTUA 3PABB 3BWSA 4P05A 4QWWD 4NHCH 4PV9A 4YHNB 1BIHA 4Q6IC 2E59A 1S7SB 4LSRL 1F2XK 2R56L 4U0QB 4X9GA 5E5RB 1IBBA 3EIFA 4Y89A 2XIDA 3QYNA 3UAJA 3QHFL 2B59A 1FHGA 1RP8A 3DUSB 3GK8H 3MGTB 2E7LC 2EXYD 4L9LA 2VDNL 1MCPH 2QEJA 4Z76B 1NDGA 4JM2B 5I6PA 5I0DA 5LUMA 1FVCB 1K2DB 2GUOA 4G9FD 3O6FC 1EH9A 2ED8A 1FVDA 1G7IA 2A6KB 1A6ZA 1AP2B 3THML 3OB0H 4GRWE 2BY2A 2JJSC 1DJYA 2IDCA 4Q0XL 3NDZE 2UY7B 1JZHA 3KH3A 1DQQB 5GZOC 1UM5H 5HGHA 2BHZA 2OMVB 3FB7B 3OX8A 2P24A 4CC1A 1BMZA 4HU2A 5F3HA 4YNYB 2X6MA 5JORA 4PSPA 1Q1JH 5CP3A 2VXVH 2R7EB 3TCXA 5IVXA 1ZGLB 2LLLA 1J9QA 1YLBB 1E9OA 2XI9A 5J8OA 4JRXA 1K5NA 1YEFL 3UPAA 4NUJA 4XZUB 1M53A 3EO0B 1E42A 1A4JA 3ZKXB 4CMHC 3ZT6A 2PTVA 3EHBD 2E56A 1BQUA 5FO7A 2VDML 5DK0A 4W9IC 5ID1A 3F85A 5HDBF 4HJEA 1EHLH 4M02A 1MAML 3WY2A 4DW2H 2P43B 3GMPA 3L4CA 5JW3L 3AXLB 1MN4A 3RBGA 4TNWK 2V2TB 4FDWA 4RGOH 2ZUXA 2XN2A 4D0BB 1M3IA 4UTCA 4M29A 4OSUL 5DMGD 3ZRFC 2OKMA 3GSWB 1V54B 4ZFZB 4AENA 1PU0A 1V7ML 1G94A 5A3ID 4AQOA 4XT1C 3QPXL 3H9SE 4P2QA 1CDHA 3QUXC 2WTOA 4DPAX 1W72B