2XG4B

E. coli p pilus chaperone-subunit complex papd-paph bound to pilus biogenesis inhibitor, pilicide 2c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
149
structure length
149
Chain Sequence
AAFHGEVVRPACTLAMEDAWQIIDMGETPVRDLQNGFSGPERKFSLRLRNCEFNSQGGNLFSDSRIRVTFDGVRGETPDKFNLSGQAKGINLQIADVRGNIARAGKVMPAIPLTGNEEALDYTLRIVRNGKKLEAGNYFAVLGFRVDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of C-2 Substituted Thiazolo and Dihydrothiazolo Ring-Fused 2-Pyridones: Pilicides with Increased Antivirulence Activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords CHAPERONE PROTEIN PAPD
total genus 19
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2010-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2xg4B01
5AALA 1KLFB 2UY6B 2UY7B 2W07B 4BUQA 3BFQG 1KIUB 3MCYA 4X5PA 3ZPDA 4CA4A 5FWRA 5FLUA 4J3OF 3SQBB 4XO8A 3ZL1A 5LNEA 4AUJA 3JWNE 3ME0B 1N0LB 2J2ZB 2XG5B 4XOEA 4XOAA 5IQNA 4AV0A 4AVHA 4AVIA 4AVJA 3JWNH 1PDKB 5LNGA 4AV5A 5CGBA 1QUNB 5AB1A 4J3OG 5F2FA 4AUYA 3BFWA 1ZE3H 4CSSA 5FX3A 3RFZA 2WMPB 4AUUA 4X50A 1N12A 4XODA 4XO9A 1TR7A 5AAPA 4LOVA 4AVKA 4X5RA 1UWFA 2JMRA 5JQIB 5ABZA 5IQOA 2JTYA 3ZL2A 5IQMA 2VCOA 3BWUF 2XG4B 5F3FA 4ATTA 4XOCA 4XOBA 3JWNG 5FS5A 4X5QA 4AV4A 4CSTA 4J3OH
chains in the Genus database with same CATH superfamily
2RHEA 2WQSA 4FXKA 4LP5A 1AQ8A 4K3JL 3BZDA 3PWPA 1RJYB 4S1SL 2XVGA 4H88H 3BP6A 4NUJB 3QIBB 2VMCA 3THML 1P7KA 1J8RA 2BP3A 4ZDHB 4YLCA 3ZDYE 3WTXA 3FFDB 4JZNA 4WV1B 3IS0X 1OAYL 3QA3B 1TQUA 3L81A 3VMNA 4NQCD 2EDMA 4MA3B 3N85L 4LSSH 4I0PC 2I07B 3RIFF 4HFWB 3RUGF 4MAYC 3SGKA 5L4FA 1M56B 2A6IB 1KJ2L 2WSDA 3NACL 1AS6A 4YH6A 5DS8B 2DWYA 5F7BA 5FAAA 2AQ2A 3MV7E 1JXJA 4I5BB 3T09A 5DMIH 2BSDA 3AU1A 1X9UA 1X44A 3MV9A 4OGXL 1WFOA 3MNWB 4OCRL 5HGBA 4HWBH 1TZIB 1SOXA 4MMXA 2HVBA 1UGNA 2AC0A 2AJVH 2X5PA 1AGBA 3IB4A 4ZUVA 5SWSA 3BVXA 4G1MA 1MI5B 1IC0A 1JRHH 5DLLA 1IEAB 3S34L 2QQQA 3W0WE 4PJAF 43CAB 4FFTA 4TVPL 3O6ML 4X6DF 4MJ5A 3CCHB 3AT8A 2A7BA 3VFVB 4P23A 1U3HC 4IRZL 4PR5A 3UTQB 3QDMA 1JPST 4LPWA 3QE5A 4I2XA 2A0LC 4YHOL 3T6VA 5IZ7A 5F7HA 2E56A 4UT9L 5D96B 2FAUA 1RHHB 3GT6A 4G7VH 4PS7A 4R0LB 1WVZA 4DKDC 2V2TA 4K94H 3GBMH 1FFPA 2IGTA 3QPQD 5ADOH 5ISZE 4WEBH 3NIFB 5GJSL 3GJFA 3MBEB 1RU9H 4FKHA 1SJMA 3HMWL 4FLOA 3MRDB 3B3BA 1R47A 1DE4A 4TNGA 5DZJA 2YXFA 4LRNL 4XNZC 1ETB1 4OAWA 5SWZA 5DDHB 5FKPA 5TDOB 3W9DA 5ISZD 3PY9A 5AW4B 1F4WH 2NMSA 2XICA 3OVUB 4M61B 4OLZH 5HD8C 5BMFL 1MCRA 4NJ9L 3QUXA 3NJIA 4E2OA 5E56A 3MNZA 1Q9KA 2VZVA 3UH8A 3VFGH 4EXKA 3ECBA 1PD1A 1DQMH 2BY3A 2ZUUA 3SDYL 1KPUA 5HHOE 5IW1A 1KDIA 1MG3C 4QRPE 1E4WL 4WI0A 3BUIA 1W8OA 5LG1A 4N2MA 3U46A 5H4ZA 1DQJA 2EE3A 2ESVD 2HG5B 4ALAH 3C6LB 4ZUTB 1SHSA 2BSBA 4MASA 5TH2B 4OZ4A 4AX3A 3U4EA 1JZHA 5GRXG 1NIEA 2YD9A 1AG0A 3L9BA 4RFNB 1LVEA 1AGCA 5EZIH 2B4CL 1GC1H 1L9NA 4J3OD 4Y9CA 2FYYA 5TD4A 5FB8A 1I3VA 1T66C 2MEJB 3CSTA 4B6ZA 3FB7A 1DEDA 1VFAB 4I85A 4LVNB 4U1LA 5AB1A 3RVVD 4YC2C 3LSOA 4LEXL 4IKKA 4LNRB 4C4UA 1Z9SB 4ENEC 4XMLL 2EDHA 4WNQB 3JVGA 3M46A 5HHXH 4N8VA 3OKYA 3DXAD 4GI9A 3P4MA 4PJBB 4GW5A 1DVFB 4EDWL 4XOBA 3RFZC 4C56B 3BH8B 3J07A 2BNRD 1T0NA 4TPRL 5BS0A 1OZTG 1WPCA 3QFGA 1GJIA 2R59A 1RJZB 1I4FA 5CD5C 1K3IA 4L4VE 4HHAB 2NSMA 4O2CB 2XCMC 3UZQA 2P5WD 5IMKA 1IGYA 1ZJBA 4G9FB 3QC6X 1JGLH 3TT3L 1W72B 1EAPA 5KSAD 3VXOB 3TEYA 1SXBA 3MRQA 4FFVD 1MXGA 5MEND 4XGZA 1FLRL 4B9PA 3WIFA 1NAKH 3LKRB 4WU5B 5KG9A 1FP5A 2VDQH 1YY9C 3BZFA 4KAQL 5LWYL 5E8DH 4X4YB 1FJ1B 1GGIL 1L9QA 3AM8C 4NZ8A 4RGMB 4B9FA 1P5UC 1OPOA 3A23A 2WQXA 2YKKA 3HHRB 3WEOA 1Z1WA 5I6OA 2ZYRA 2V8LA 2VSCA 3EH2A 4L3CA 4N4YB 4JFEE 3NZ8A 5L2KA 4DWHA 3SKNA 1WGVA 1L0PA 1SEBA 4OCMC 1T2QH 3VXUB 2HJLB 2YAPA 3BEVA 4EI5D 1T1ZB 3MRPB 4KMLB 4F58L 1JNLH 1JXGA 5LBSL 4KKLD 5T1LA 5AAWA 2CKBH 2DV6A 2YR3A 4WUUD 4UZSA 3RUGB 4YHKH 2Y6SC 3BCFA 2DTSA 1S5IH 3OV6A 4JCMA 4Q89A 4RAVB 1NC4A 5EO0A 3WJLA 1HSAA 3PAYA 2YFNA 4GEIA 3FCTA 3A6BH 2J1YA 4DP6X 4U0RB 4WDIA 4FFWC 4EMZA 3CIQA 2WSPA 5IWLC 1AXIB 2F1EA 2E27H 3MOAH 2AGJH 5MERB 2M83A 3FN3A 2X4NB 3U36B 4CSZA 2A38A 4Z5RB 4XMLH 5FK9B 3F62A 5D7JC 4MJ6B 2UUDH 1LO2H 4XPAH 4XMPL 4Y1SA 4PP1D 3FO1A 1Q0YL 5DYOB 4UQ9A 5KVDL 3UBHA 1MEXH 2X87A 1JHLL 3GC3A 5D2NB 4H2AA 1GHFL 2DDQL 1RLBA 1TLKA 2B0SH 3IGAB 3O45B 5D5MA 1DBML 2IQAB 1OTSD 3N04A 3K5SA 4AGQA 1KPVA 1HHJA 1UA6H 4ODWA 1P6AB 2H0FA 3PV6B 3D05A 3RX7A 1TZGL 4R0LA 5CILL 3EHBD 2E75C 4OVUA 3IETB 4KXBA 2NUTA 1KOAA 3TH4T 3EZJB 3LB6C 4UB0H 1KT2A 4UM8B 1N67A 2R8SL 1WEJH 3T71A 1BPLB 4S2SB 1KTDA 5DTFB 4BFIB 1JNHA 1C16A 2F53D 2IGFH 3ARFA 3QDJD 5ALBL 1VPOH 1AFVL 5HJDA 2F2HA 3MCKA 3NPSC 4CBPA 3DTDA 2ZWNA 5H94B 4XVJH 5BVJB 1Z9LA 2VMJA 4YUEH 1JZ7A 1N12A 1KJ3L 5D6CB 3MBWB 1VSCA 3EG9B 1E8XA 5E94A 1A7RH 2EYTA 2FEDD 2NTSP 4HFUL 4LSPL 3EGSB 1GKEA 5B4MD 1A4KB 2GVYA 3QJFA 1KB9K 1KLFB 3PGCA 2D4FA 3L3OA 4IOFC 3PP4H 4GSQA 3PWPD 2E7LC 4HG4K 5LBGA 3NIDF 3MACH 5FO9B 3V0HA 5BRZE 1UB5A 1XXFC 4K5OA 1XGPA 4M1GH 3FTYA 5I8EB 3FQTB 1Q9LA 2ITEA 1BZEA 1S7RB 3DYOA 2FZ3B 3SE9L 1FNFA 1F8TH 1EXHA 5G4MA 3RHWK 4OCXH 3JV6B 4NCC2 2FJHB 1UWXH 5D7LD 4GRMA 3QXAA 3RAJH 4ZOAA 3UYRH 4PLKD 4Y2OA 2ZKHL 4ZYKB 4U1SB 1RZGB 1H6TA 4GW5B 5HPMB 1DJWA 3VQ1C 5DMYA 1N26A 2VZ1A 3T8MA 3ZE2F 2E9JA 1OD9A 1YEIL 3ELQA 4Y4HD 4G3YH 1I4FB 3VW3L 2P26A 1AR1C 2H41A 1FZOA 1MJ8L 3BEWA 3GQFA 4NHUB 1CQKA 2QADC 1UT9A 5DUBB 3HTLX 5FA3A 5EWIH 5AW2B 5BQ7A 4IYKA 3VXOA 1BXUA 2V2WB 3RWCA 4MXVF 5C6WH 1GAFL 3WXVL 3WJMB 1ZJAA 4JGNA 5FGBA 2GSIA 1OAYH 3NQIA 4XXCC 5HDBE 2LGNA 3ZXAC 1AVAA 2Q76B 4N2KA 5F9JA 4CMMB 3ZDWA 1TNNA 1O6SA 1OLZA 3GSQA 1NMAL 1TUPA 2X2YA 3C6LD 1DHKA 2DOCA 3L6FA 1U8IB 4LE8A 4WFGD 1HVXA 3FMGH 1D9KA 2GB2A 2H47C 1JK8A 1JAEA 4A04A 5G2NA 1YQVH 5LGHH 3MROB 2QV2A 2I25N 2EO1A 2EDXA 2HT2C 3UOAB 4J5VA 1F1DA 3BP5A 3P3SA 4PCSA 3H42H 4L1HA 1QPXA 1KYAA 3Q8EA 3JQOB 3IJ9A 2DQEL 4L3EE 3N1QC 2R1YA 3BWUC 2DM3A 4XN1A 1RUAH 1QSFA 2J44A 1EIBA 4RETB 5KYXA 1ND0A 5DVNA 2YBRB 5AW5B 5K1JA 3VXTB 3X11A 4D7PA 2KDGA 4YQXH 4WO4C 5EF3A 4OCYH 3IDUA 3BFWA 3AFLA 4NWTH 4HZ1A 4BFNA 4AI7A 2O61B 2L0DA 3L3IB 4HS3A 3ZQWA 2VO8A 5GJTL 1VADB 4AEFA 1NGYB 4WV1A 1UQSB 3WMSA 1G6RB 5K1NA 1IGIL 4UUJB 3RTQD 4BHUA 3NYKA 4OJFL 5HVWA 5CCJA 1XWVA 3PF2A 3LZQA 4PTTA 2Z34A 5EN2A 1Q9WA 4EUPH 4XNXL 4XPFH 3SGEH 4B3VA 1GXEA 1IC5H 2ADFL 5EU7C 5TQ0L 2Y07H 3DOSB 3MOBH 2W9DH 4PJIB 4YGVA 1CF8H 2OQJB 3VD5A 4JPVH 5BCAA 4DJMA 3BVNA 3AU1B 3FU9A 1BD2D 1YECL 1ULVA 2FLBT 1X5JA 1CBVH 1OE3A 1R3JB 2YQGA 5BW7A 2N7SA 1AGBB 2CR3A 1TMCB 2VZ3A 3IMWA 4XP1L 5FGRA 4UBDC 4PVNA 1CLYH 2PXYA 4Z7WB 5LXVA 2YUVA 2JKIS 4JN1L 4NGHH 3EFFB 4AV0A 2H8PA 2ICWA 3UTPE 3K1KC 3RX8A 4FQLL 4ZD3H 1S9WB 4E9LA 1B2YA 1JGDA 4EKJA 4KJWC 5IG7A 3POCA 4PIRF 2X6BA 3VXME 2XVLA 1NSNH 3MXVL 1CFNB 5ALCL 4JNXA 1OGAD 2BJMH 2XNAA 5KW9L 1RJYA 3VVWA 4U1MB 1YECH 5EFIB 5B38G 5GSRB 3VXMB 1KCKA 1KC5H 2X4OB 3FQWB 4LAQH 4PV8B 4Y5YA 2DPKA 1TO4A 2GT9A 5DJZA 3MRDA 3IU3A 2IC2A 5J3HD 4RCAA 1YC8A 2ILLA 1XQ4A 3AXLA 3EDJA 2P8PB 2B1HH 1F6AA 2FRGP 3D4CA 4K5LA 5IVNA 3QUGA 3UZEC 2WMPB 3UGXA 1G6VK 4LLYA 3WFBL 3G6DL 2QGDA 3QDGB 4U33A 3U48A 1AIFB 3GF8A 5LDUA 2KUTA 1QLEH 4NO2B 2MTAA 3VDAA 4U7KA 4L4TE 4CVZB 2KBGA 1EWHA 3EBGA 3OLDA 1JHTB 3WFEH 3VD4A 2XZCH 2YD4A 1CE6A 5ANHA 5FLVA 4GKLA 4MB1A 4M56A 1O7VA 5LCVL 3TZVC 4RGNB 1CFBA 1NCHA 1F42A 2WIIA 1Y6NR 3D0AA 2CDFB 2IGFL 4XO5A 2EDWA 3TFKD 1CDUA 1SHMA 3NIGE 1FNGA 1J1PH 2BFVH 4LK4A 2VH5L 5I6KA 3OLEA 4JFFB 5D7IB 5F89B 3AT9A 3FB7B 3UADA 1PY9A 2G5BA 4JKNA 1EFXA 4ELME 2CNYA 5D7EA 5DUBA 3A67L 5E00B 3R8BB 4YL9A 4CC1A 4Y4KC 4MMZA 3VI4F 1T0MA 1CURA 3IGFA 3BAYA 3HMXH 4K0OA 5IBTH 2JI1A 3O6KH 3QRFM 3QIUD 4GP5B 1FC1A 2FBJH 1OOWA 2FVNA 2E9GA 1MFAL 4F9LA 2WXNA 4BUHA 4XWOD 2LAGB 2ZX8A 5IB1B 3T04D 1MRCL 1OTSC 2VE6B 4NJAH 1RLWA 3MRQB 5TPWL 3LH9A 1L9RA 2OSWA 4JKPL 5HVFB 4WK2B 5D55A 4AC2A 4QOKA 1KGCE 3SDXB 4HKZB 4KJQD 1D6VL 4X4YA 3FSVA 3T3MF 5I16B 5E9DE 5E8PB 1QFUH 1GW0A 4WI0B 2HH0L 4XVSH 5FKAA 2J55A 3VFUB 4YDLB 1NGZA 5HYJB 3DIFA 1N5YH 2YD1A 2VXSL 3OB0K 5DJ0B 3D0LB 1DLFH 2YBRA 1MQKH 1SHXA 3C87A 1WYJA 4DP7X 4E42A 2H2PC 3BO8B 4ONOA 1S5IL 4MX7A 4IGBB 4KKPA 1NCGA 2NY5L 4R4BB 5D2LF 4YSDA 3ZLQC 1YHPA 4OTXL 5K93A 3CWGA 4ABWA 3ULUH 1FVCA 4PPTA 2CR6A 3VCLB 3H3KA 3U9PL 1BM3L 2YSSA 2WVTA 2EYRB 2ZCZA 4M7LH 5I1AA 2IAMB 3X3FH 1AGEA 2VC2L 3U30C 1ITBB 15C8L 1DCLA 1HHGB 4DGYH 3V0IA 4GQPH 1EEQA 3LPWA 4YPJA 4N2LA 1EO7A 3Q2NA 4BK8A 4FL4B 5GGQH 2CPUA 4FZ8H 3KWUA 2EZ0C 2ENQA 2H0JA 3FTVA 3TBCA 5KZCD 3PYCA 1J86A 3FF8A 4UMSA 3GXTA 4TSBL 5D7LA 5GRUH 2BSED 5JXEA 1UZ6E 2HKFH 2VDNH 1KJ3H 1GZHA 4WWKC 4WEMB 4GRWF 1EK3A 1ZT7B 2GPZA 5HI3D 1TZHB 4MXWH 3V2AR 1IGML 4ONHA 5C0AE 1PX4A 4JKKA 5I8OL 4ODUB 3CQQA 4JQVC 1J9RA 2WBXA 3HG3A 3ULAB 3FFCD 5EORH 4DO6A 5K5YA 4U05A 1WEJL 3VGFA 1DJHA 1OWRM 2BLFA 1UACH 2DYPA 5CLTA 5FHAH 2AJXL 4DH2A 3JWNG 3ETBF 3TWYA 4C58B 3PHQA 2HT3D 3LZRA 1TTBA 2Y5EA 1INDL 2C3GA 3F01A 4XE5B 4KKLC 2GJ6D 1WT5C 4LEXH 4LOUD 3FFCE 3BKCL 2XBZA 5AQ0A 1JYWA 1H15A 4L8CB 4P99A 1U95A 5KJRL 4MJIE 4DEPC 4BHUI 1KJMB 2FJFB 2JJTA 4TYUA 4X6FB 4UTBL 4HISA 4YR6A 3VGAB 3DVNB 3D0VB 5JW4M 2FT6A 5DFTA 4KROD 1CK0L 1GTFA 1T7VA 1E4XL 2MFNA 2BH0A 3BP7A 2I9LB 1IAKA 4LHUB 1P9MA 5I73C 4PRBA 5D6CA 3QDGA 1TENA 1UCBL 3NAAH 4UQ3B 1A7QH 1HWWA 1F6FB 2E47A 3MPCA 4K7PX 3SDYH 2DQDL 4NQQA 2JKTM 3DVFA 1A14L 3O8XB 5I23A 5JORB 1XSKA 1QEWA 2AJZB 1YNTB 3BPCB 4GMTL 4JFFE 4GPVA 5HGHB 5DVOA 1CS6A 3DMMA 5HY9A 2NCMA 3R18A 1WA2X 3KGSA 2DLEA 3QB7C 2JIXB 2WBWB 3ARSA 5FYJU 1GYCA 4P5TD 5ESAB 4BEIA 1FH2A 1VB9A 2YIHA 1U8LB 3T2LA 3V6BR 2Q7NA 3HG5A 3W9EA 1NBZA 5K9JH 1GPOH 2F08A 3QCVL 4AXWA 1FPTH 3WIHH 2OI9C 4HEPG 1O6TA 5AKRA 5E8OA 4DEPB 2FJHA 2J88L 3HG2A 3LEYL 2NW3A 3ZHFA 3QXAB 5KZCB 1NLDH 4LEEA 4Z3FA 3B3IA 4WW2F 1LJMA 4QRTB 3DUHA 2CJUL 1WLHA 4JHUA 4X7SL 4AUYA 3D18A 2BWQA 2KLTA 5E6RB 2ENJA 4UM8A 4Y1AD 1QNIA 4Q9QH 4B9YA 4NNXB 4ENZA 1AAJA 4MFHA 3LZOA 4OB5H 3HI5L 5IROA 4NHUA 3IDNA 4FEMA 4PJ5D 4OJAA 1AQDB 5DT1H 4OFPA 2PKDA 4R7NB 2NY4B 5C0GB 3CIAA 2G3MA 2ZPKL 1C08A 1JXKA 3W38A 3I6GB 3LZLA 3I2CL 4CMMA 2VN4A 4KJYB 3AUWB 2EYTB 1MNUH 1LTXA 2GHWB 5AVSB 2VTFA 4UBDD 3HN5A 3KS0J 1MHCB 4PBDA 3F2LA 1KLUA 4L8DB 1OAZH 5HDOA 4GRWE 4U1NA 5IESL 3LMJH 2YPLD 1AOZA 5AVQB 4YHPA 3GSXA 1SOSA 2HTKD 3CBRA 1KY7A 3FU7A 3U0WH 2BY1A 4JFFD 3KPPA 1MW0A 5AB0A 2J72A 4F8PA 2X4QA 1UXSB 1A1NB 3LN5B 3FTUA 3VWJC 4LXFA 2DQ6A 4Z3HA 1RJLB 2XFXB 4NLHA 1ZIAA 4EIBA 4UYPA 4AT6B 2MMXA 1UTDA 2YAFA 4PJDA 3B34A 2OMUB 3KPMA 1JI2A 2JE8A 3SYOA 2XTLA 3WTWA 2OV0A 2YEZA 1YRKA 2CO2A 4NYLA 2LOEA 2LU5A 4WNSA 3VFWB 3ALWA 2NX5D 3CU1A 5HPMA 3PAUA 4H26A 3CG8A 3MBXL 3CHOA 3GXMA 3STZA 5E2UH 1B3JA 1VGKA 2YD7A 1TCMA 3EUDA 3D4YA 3RVXC 1FZOB 3BEWB 4G8FB 4N1HB 5FA3B 2R2EB 4QRRB 3BQVA 4I3RH 3PRZA 1JF5A 4CVWA 3RVWD 4C57C 5EUOE 4NI3A 4M1CC 5T1KD 3VJ6B 1F56A 4NQCA 2IBZY 2GSIB 4ZMLA 5F9JB 1MN4A 2D7TL 1U8MA 2PCFB 2YGVA 4M7LT 4JY5L 4J3XA 2DWXA 4WJG3 1UA6L 3TCLA 3KS0H 3AWGA 4V1DA 4YSEA 1SYSB 3MX0B 2BZCA 3NN8B 4JM4H 3WFBH 1AO7B 4O2FA 3VU1A 3O9WA 3ASOB 3BD5A 1G7JB 4WCYL 1Q9OA 1S7QA 4KKBC 4LVEA 5K9KB 3V6ZA 5AVXB 5BRPA 2ZG3A 2GCYA 2FSEB 5FM8A 3GSVB 2GJZA 4JFQA 5D9SA 5E03A 3L5JA 4JPQA 3EFFA 2IAMD 5HI5D 1MCNA 2NUPA 3FOMA 2XPYA 2VXQH 3QI9C 3HE7D 2HVJA 4N0FA 3JBG7 1ADQL 1OAUH 4TMPA 3EJYD 1OB1A 4POZD 5DA4A 5C0BA 1ND0B 1WO2A 1NA8A 1SBBA 3PNRB 2FT8A 3QUZD 1GGCH 1HKFA 4P23D 5CHNB 4UT6H 5F7FA 1UUSA 2JI3A 4NT6A 3TO4D 3MJWA 3T2NL 3VWKA 3MLYL 2VLRE 4OGXH 2GQHA 5H37G 5ID0A 1H8LA 4H20L 3I9GH 1B4JH 4G9DB 4APQD 2Q2EB 1WG3A 3V52L 3N1GC 1SUJA 3LDBB 5DEJA 3V4LA 4DP4X 2ZT9C 3Q43A 3EJJX 2F8VA 3LRGA 3ECVA 1OO2A 4PB0H 3AY4C 3KJ6H 5FF6A 4FQXC 4GO9A 2H4EA 3ZO9A 3PAZA 2E8ZA 2GJ6E 4YLQT 2VXVL 1J0ZA 4KKQA 4MJ4A 1QSVA 1JFQL 1T1WA 1Q9WB 1EGJL 1F4XL 2OR9H 4KQ0A 1J12A 12E8L 1LE5B 4M3HA 5F7NC 3B9DA 4HOMA 1WV7T 5CEXB 3OBAA 1BWWA 4JZJC 1H5BC 4HBCH 5B38B 1PZAA 2YWYA 2VT0A 1P1ZB 1WT5A 1PG7L 4X8GA 3WXVH 1FO0L 2RB8A 4I0PB 4YWGL 3IK2A 4EIZC 1W80A 3ML9A 5B22A 1XAUA 1MH5B 3SBWC 4ZX6A 4ZT1A 2R7EB 4OM1H 1ZLVH 4PJIF 4MRBA 1TO5A 4JLRA 4NDMB 1AHWB 2O5ZH 2ICWB 2DQMA 2BNQA 5HDBB 2EEDA 4BH8B 4Z3TA 4ZFOB 3S5LB 2XKNA 5EO9B 1P2CB 4WO0A 4W9KC 4OLVH 1NWPA 3UYOD 2J56A 1OGPA 2X2HA 1P4UA 1OT2A 3VB8A 3FFCA 5C92A 1CFVH 3RWFB 2HSIA 2LW3A 3FRUB 4AKQA 2QSQA 4ANWA 2XTJE 2AEQL 3BDXA 4DKFL 3EADA 2WM0A 4ZRGA 2CDGA 1TVBA 1CIDA 4YDVB 4FA7B 1LXMA 2DWSA 5TQ0H 1FC2D 2GJ6A 4XWGL 1AZCA 1W72H 4BUGA 3C60B 2DM2A 4YHPB 4CC0A 7PCYA 2J25A 3FU7B 4AQ8A 3HR5B 3PWLB 1GIGL 1Q1PA 5BOZG 1SQ2N 1M05A 4FULA 3OF6D 3AXIA 4KPHH 1V3LA 4HXBH 4J1UB 4KQ4H 3S36L 3KPSD 2IDQA 3QJUB 5D7SL 1U8PB 1K6QL 1Z3GH 2JF1A 4XCNA 2JFCA 3OR6A 5E2VH 4YHLH 5K39B 4AQEB 1U8HA 4HDIB 4H8QA 1G9MH 1NIFA 5ACZA 1DQLH 4GW1B 3QQ9D 3FTGA 1J11A 4H0GA 3DX8A 1L4IA 3L4TA 4G42A 1Z5LB 5EORL 4AQZA 3LIZA 1JZIA 3MYJA 1JDCA 3CFEA 3VW3H 2MCPL 4M6OH 2NY1D 4A2MA 5IROC 2MHAB 1UD6A 3SPIA 4DKTA 4Z7IA 5JYLA 2FD6L 3B6SB 2WPGA 3D08A 1OAJA 4NJ9H 5CIPA 2GTWA 4JFSA 2NY4D 4MAYD 1V55B 4GSDL 4CMHB 4Y4FC 4F2FA 2GIMA 1CGVA 2ED7A 2WYIA 1NGWB 4OSUL 4UT7H 5KSBB 3LZFL 4JVPA 2K78A 4OIIL 3CN0A 3E8UH 2OMTB 4PSRA 4Y88A 1HQRB 4GG6F 1P84J 1T5KA 1BJ8A 2FB4L 4M62H 1YN7B 3WY1A 3DO4A 3V0FA 3D34A 5E9DA 2KYIA 2CAKA 4K7PY 1KN4L 5DZNA 4XTRC 2K0RA 5GS0L 3RDTC 3IVKB 4OKVB 1AD0B 1KC5L 2C5DC 3LIZL 4OLWL 4HC1A 3PWPB 2VXUH 5IESH 4HGWA 4KUZH 3VA6A 4PREB 3EOAA 3N40F 4XMXA 3W82A 3L1OH 1AYOA 4P5TB 3HN3A 5D1XC 4L48A 2ZUYA 2KC0A 2OMXB 2QPEB 2NX5B 3QUMB 2BP0B 4ZD3L 3BO8A 3TO2A 1XZ0B 4KGLA 4P2OA 3C75A 1FH5L 2ZPKH 3UAJD 4NEHB 1QLEL 4O02A 1UT2A 1HEHC 4PJ9C 1IJNA 1MCQA 2FJFA 1KJMA 3FT3B 3L45A 2CKBL 2JQAA 1KB3A 4R7DB 5DUPH 2IFFH 2Y7OA 1N5AB 1SMOA 3DJ9A 5FDWB 4Y2DD 4S1RL 3WKNA 3TEXA 1P5UB 2VN5A 2R56H 4KTEH 3TPUA 4K15A 1E27B 2QLYA 1IAKB 3HNSL 2FBJL 2X3AA 1MFEH 1WZ1L 4Y4HB 3V5KA 3T3PB 3S48A 2EIDA 4RMRA 1M1SA 4QNPE 4H88L 5C9KA 1KF9B 2O26U 2RQEA 3TLRA 4X9BA 3KYNB 4UANA 1I3UA 2MRYA 4Y1TA 1JNNL 5GRJH 2AEWA 4G1MB 1L0QA 2YPKB 1BJ1J 1OALA 1RK1A 4NAMA 4PHZA 4EJ1C 1YNTA 3BPCA 3QIBC 1R5IA 2JCCE 4XCEB 3SDDD 3FNKA 3LPFA 1LQBC 1N6QL 3ROLA 1YEJH 4IIQA 3ZTNH 1ZLWH 4DESA 1FGVH 3TYGL 4GY4A 2GBTA 1UB6B 2P3YA 4BQ8A 3OZ9L 4CJ1A 4GS7C 8PAZA 2F8XC 1DUYB 3ZKQD 5B3NA 5TK2A 4GBXB 3A6OA 3SCMA 5CN3A 2B59A 2WUCH 5F7DA 3OJVC 3MRCA 4NLAA 3OWRA 4KTDH 3L4CA 2X0UA 4GLRI 4ACPA 1PY0A 2GBAA 4XVOA 3PWUA 3TIDB 3NUKA 3MRNA 5I75B 4HZLA 2GAZB 4Y1AE 1DE4B 4YHIB 4ZW6A 4WI4A 4M7KH 1DL7L 4KNQA 2OFQA 4D9RE 3MLXH 4PVBA 4O9HL 3UP6A 4RISH 4LPYA 2X4RB 3FB8A 5JUEL 2NY0B 3MNZB 1OF2B 3GB7A 4WW1A 2QEJA 4JM2F 1JP5A 3OAZK 5I2IA 4PJGE 3QXUA 4N0YH 3VI3B 3BUTA 4KO5A 4OAWB 4OF8A 3BMVA 3FO2B 2NQDA 4JRXA 1PSKL 5EEUA 3I6GA 3FF7A 1R3KB 7FABL 4GG6E 4P2RD 1MCHA 2I9TB 2Q3AA 2HPOA 3RA7L 4X6EB 4IBZA 2XQ0A 3O8XA 3QO0B 3VMOA 5B1BB 1QEWB 2AJZA 1OKEA 4ICWA 2WANA 3LNIA 5I66B 1D5XA 3R4DA 1VFAA 3C6LA 2VJ8A 2EXYD 3GO1L 4HUMB 4ZUTA 1LMKA 4MBOA 5BMFH 2AJSH 1D9KD 3NJGA 5DVLA 2F9BT 2ZKYA 4ZS6C 4Q2ZA 3BESR 2DWTA 3N91A 1I3GH 2IDCA 3D3VA 2LT9A 3P40A 3CFEB 4NQVB 1TZOA 3APMA 1MCSA 3KG5A 3P4MB 4OIAA 4PJBA 1F3JB 3K2MC 3ETSA 4XP4L 1TKWA 1NJ9A 1KIQB 4FQHB 3UYRL 1SEQH 1GY2A 2VR8A 3P30L 4L8SB 4GQQA 5LBSH 1FV1A 5HHOA 1BZ9B 5IB4B 1KBWA 2LAAA 3CFUA 1QI3A 1EO8H 4JPKL 3ZDXF 3HW7A 4KK8D 4WRLA 4Y5XC 1HFUA 4H26B 4A2DA 4BXSV 3B8SA 3T8VA 1WAPA 4M3JA 3CVIH 4AEIH 4FQ2L 5CMAB 4N0YL 4TVSa 2L7EA 2QTVA 1TTRA 4GKZB 1VF5C 1JFQH 5C0RH 2Y36H 5AL8A 5DZLA 2PPAA 3BKML 3H9HA 5CIPH 2KZWA 2WOBA 4FERA 2DMBA 4YHNB 5I1KH 4UOQA 1WUZA 2Y7QB 2X4SB 3PE9A 2AJVL 1AG6A 4LSRH 4U1KA 4XCCH 3V0WH 2V5YA 3PUUA 1URIA 1ONQB 5AOZA 1RZKH 2CO6B 4PJ7A 4OCYL 2PO6B 3MV11 1XSOA 3ARGC 1D6EA 2AV1B 1Z66A 3ZYZA 2WVSA 5GS2H 3QUKA 3ET9F 1F4WL 1EHXA 1MDAA 5DQ9B 5A2KH 3RNQB 4JM2A 1OOAA 2AEIT 2OS7A 5EO0B 3GRBA 4O02B 5EPMB 1RMFL 2FIKA 5KTEH 1IFGA 3AMLA 5KYYB 4CW1B 1AQKL 4NKIL 4RAHA 1Y6MR 4LSTL 5F0MB 4KXZH 2J6WA 1BX2B 4YFLI 5MENB 2IANA 4HLEA 3X3GL 1H3WM 4O51B 3T0ED 1HL4A 2BS9A 3I3DA 1HS6A 4MDRA 3ZDZB 4GXUN 1J1OH 1D7DA 3CC1A 4Y16A 5BUAA 3SPHA 1DSFH 4LOVA 5E9AA 4G9DA 3L3GB 3TONA 4I77L 4JKWA 3SBPA 2BCKA 4XN2A 1NCTA 4YDKH 4PJGF 4OSUH 1FYTD 2EDYA 2W60B 2JNZA 4LPXA 5I0ZA 1BOGA 1GA2A 3C6SB 3UJJH 5GS0C 2B9BA 3ESUF 1E3FA 3C2AL 3NSFA 1YYML 2HXAA 2B2XL 2WWMC 4ODWB 4E68A 3I6SA 4N0CC 4E0RA 1UGKA 1MFVA 2DQCH 3L2MA 1PG7X 1VA9A 2RA1A 1QLEB 2MKWA 3G6JA 1N7MH 1KCRH 3NIDE 3W39A 3WFEL 1I1YA 5I76B 4S2SA 3X1GA 1OAKH 3BSZH 1P1ZA 2WLMA 5LJYH 3GMMB 4MGXA 4LCWB 4OLYH 4YO0A 4AYID 3B2DC 3GPEA 5HI5C 3BN3B 4F15B 3ECQA 4J3VA 1EZLA 2QTEA 4FTVA 2ZOWA 1RZFH 4JW3A 1JHLH 1AH1A 5DEGB 3QRLA 5F96H 4BKLB 2IAAC 2OLDA 4XPHH 1V27A 2IH8A 4NPYA 2R29L 2W0KA 1YY8B 2AVGA 5C0BB 4ALAC 5I2IB 2VISB 5I73B 4QKXB 4V2BA 5L7XL 4JY6B 3O3DB 5KW9H 3NFPA 4OLYL 2BVEA 4FQCL 2AGJL 1HC1A 5H94A 5BVJA 2EDNA 3CLWA 3BSZL 5FO9A 1TVDA 1IT9H 3DIDA 1JV2B 3AC0A 2GY7B 1H3PH 2Y7LA 2DBJA 1U58B 2FZ3A 3KPNB 2J6EA 3DKHA 5DGQA 3RDJA 2BINA 3HZVA 1BFOA 3S36X 1EDHA 2QPFA 1KXHA 2D0GA 3IJSA 3PWVA 4URKA 4P3CL 2NYYD 3HI5H 1PW3A 3APDA 4AG4L 4P5SA 1SVCP 1T1WB 1BDYA 1W6WA 4UM9D 3WNIA 3SKJH 1BVLA 1JD9A 3FCUB 4G80B 1Q1JH 1ZV2A 1CLVA 3QQ3B 2FGWL 4I77H 2EUZA 2YZ8A 1T2QL 2G30A 4QOKD 3N42F 3LVTA 5JHDB 5K39A 4X6CF 1FV1B 4O5LH 5HHOB 3KPOB 4GRMB 4UT6A 2V7HA 3OG4B 2ZYHA 5HYIA 5JNYB 1WAAE 2VNCA 1GHFH 2DDQH 1DJYA 4L3EA 4QCIB 2MIZA 3NTCL 1I8UA 3RKPA 4L1DA 4PUBH 5LB1A 2VAJA 1D7BA 4D3CH 5D72H 3IJHB 4JLRB 3TBWA 3SDDA 2HUHA 2VMDA 5GJTH 3I02A 5EO9A 3SY6A 3IAGC 3DGDA 1AANA 2JKLA 2XN0A 3BJLA 4YHML 1NDMB 1MREL 1PKQE 3VSUA 3QIBD 5FWRA 5DFVD 5JDSA 1IJ9A 4ZNEA 2CU9A 1S9VA 1HKLL 2JQZA 5IF0A 4WFFE 1MJUL 4OGZA 4QHLA 4WW2B 5HVGB 4N20A 1JZEA 4LP4A 3RWFA 3LRSB 1XCQB 2X0WA 3FT1A 5DJ6B 1FNAA 1XIWB 2F15A 3VXNB 5ISZB 4Y9GA 4FNPA 2GUYA 4RX4A 4XT1C 4X9HA 4CMHC 1F45A 1SXCA 2FH6A 2GJ6B 2WXLA 3DYMA 1BYNA 5I18H 2BSEA 2YA2A 5JXED 5CZXD 4HUXB 4ZUSA 5L8LB 3FQRB 1UM4H 1B9KA 4PRPD 2ZJSL 3M8OH 5GISL 1K5WA 3DSFL 3K81A 4U49A 1IQWH 2VDRB 3FH5A 3GIVA 3VUAA 4DO5A 4GXVH 2VLRA 2WN3A 4KRMB 3K5RA 1AMYA 3H6AA 4HJ0C 4IMLB 3JV4B 1DEEA 3FCSB 4E9RA 2X10A 4AQEA 4HIEB 4RSYA 4UMGA 5GGSB 4ZPTB 1I9IL 1I9RH 4GKOA 3O3EA 4JY5H 3QRGH 4TRPH 4YGAB 4LSQL 3FSOA 5CJOL 4B96A 4RBPH 2OJ1A 5DD3L 2KT6A 3RTQB 3EDDA 5F6HJ 1DR9A 5C0AD 1GMEA 1D5RA 2WBKA 2UY6B 1ILUA 3GMPA 3PDOA 2D9CA 4XP4H 4EIGB 3S88H 2KI6A 5ANME 1KBVA 2EC8A 2AZUA 2HX7A 3W81A 4N1EA 2IPKB 2EQDA 2PCPA 1AD9A 1TQSA 2ZXWB 4U3SA 3L9YA 1G43A 3VSVA 4WSGA 3GXNA 2CCWA 3TOPA 2EUXA 1OXYA 4WK0B 2C1OA 4HQQH 2DMCA 4UT6L 4ZAKD 1I9EA 2Z4TA 4WTWA 1CT8A 2CUAA 3QIWA 4V1DE 3ECUA 2Q1EA 3SKOB 4KJPD 1QSZA 1IKOP 1UHVA 3QDGD 3DI3B 4G6FB 4W4OA 3W39B 1GCFA 3QULB 2BSSA 5T3XD 4LCUB 3SQOL 2HLAA 2UZPA 1M1XA 3AW5A 3GMMA 4HAGA 3MJ8A 2NY7H 4NUQA 5ITFB 2O6FA 3U1SL 2IXQA 4EZLA 3U9UA 2X88A 4KOCA 3S35L 3C08L 3BISA 3CFDA 3PCYA 4P5TA 2DM7A 3STBA 4BKLA 1KBGH 3TTSA 3RZCB 4OIBA 3ZE2E 2E7BA 1AZRA 4HCRL 4IU3A 1LO4H 4G1EA 2HAZA 3DHUA 3GMRA 3UJIH 1J8SA 4NFDA 1XH1A 3CMOL 3P4NA 4OCRH 1GGBH 4S1DC 2JCWA 2DIAA 1TVHA 2IALA 3QPKA 1D2PA 3IDMB 3SE8H 4U1MA 1WTLA 1ZMYA 2R69L 3D2UA 4PG2A 4C83A 1JV2A 2QVKA 4XWOC 1J0JA 2COQA 5E6UB 2DS4A 4J7RA 4IJTA 3RZWA 3PUCA 2P8PA 3L3JB 2G60L 2P80D 5T3ZH 5HHQA 1LEIA 5E08L 4QRBA 5CR8A 1I9RL 4QXGH 1J05A 3G9VA 5GGRB 3V0EA 4YXHH 1DQIA 1K6QH 1Z3GL 2XOTA 2JLLA 2O30A 4Y8AA 1XD0A 5CEYB 1XCXA 2I7OA 4JQVA 4F8QA 1E9PB 3QO0A 3M1CA 2FQEA 1IO4C 2V4LA 3ZGHA 3EOTL 4JFPA 3ZL4H 2XKUA 1KYOJ 5CKAA 3A21A 2HJFA 3WELA 1I7UA 1MHHB 4JHAH 2XC8A 4DHLA 3DX6B 5FK9A 4F1SA 3MFFB 4XWGH 2VIRB 3O6MH 4B9IA 4WKZA 3BLPX 4OCSH 5DWUL 1ZHLA 2PMZA 4Z7VF 2JKNA 4J23A 3CFKB 3MRBA 3DUSA 3N1PC 3REVA 4GINA 4HIQA 4FFVC 1FG2A 3FONB 3IJ7A 2MPAL 1L5GA 3DA0A 4UU9B 2WLIB 1HHIB 4R7VA 4LQFH 1NANI 3K0WA 1U2YA 4XX5A 1CXHA 1FORL 3CAFA 1KYOK 4NZUH 5CSBA 4JG0L 1IM3D 1RULL 2GFBB 3FN0L 3UTZA 1AZUA 1PLGL 2RTTA 5DZVA 4ZX4A 1FRGL 2OMYA 1ASPA 3M7OA 1RZKL 2E9BA 3EYUH 2YS4A 3RVXD 2H2SD 1OF2A 2KLSA 5LGJA 1BXAA 1NGXA 4PRNB 3Q05A 3ZN6A 2YXVA 4MSWB 5E6SB 3R8QA 2F1BA 1FUNA 5DEFA 5HYJA 3APCA 2LVEA 4NAQA 5CN2A 1DFBH 3UL4A 1TQBB 4JRXB 4TTDD 1T3FA 2XN9D 4XCFL 1WCBA 5F7LB 2F18A 3A6CL 4FXKB 1MJ7L 3UAAA 1MZZA 4D8OA 2VDPB 4ATWA 2DLHA 3RX9A 4XCFH 3FTZA 3D69B 3HVDA 3PXHA 2WBJC 4R4BA 1YNLL 1DSWA 1A3RH 1EQWA 3EGSA 1T5WB 4NUJA 1BM7A 2B7DT 3HS9A 2BJML 2IBBA 4LP8A 3SDAB 1X3DA 3E2HB 4OZGA 4OV5B 2ARJQ 5D1QD 4HIHA 2EECA 3HAEA 2IWKA 1WBXB 3ZKMC 4HIPA 2PR4H 2R0KL 4NZFA 3B8YA 4P9ML 3KCPA 3RBSA 2NY4C 9PCYA 3ULSA 1ECZA 2XXCB 3IKKA 4NPKA 4B3EA 1QX1A 3PL6A 2HRGA 5IEKA 2H3KA 4AVHA 5IB3B 5AL0A 1WIUA 1XT5A 4PTUA 3WTYA 1KNOB 2YD8A 2DBLL 3FYIB 2N1TE 3MCG1 4H1LG 4U6YA 3B2VH 4WFEE 3ML8A 5HYSG 3AB0C 4U1JA 2IAMA 3GO1H 3RGHA 5IQ9A 2QHRH 2P24A 4EDWH 3B9EA 3K6SA 4FADA 1Q94B 3HE7A 5AWNL 1R5WA 1KTCA 1DN0A 5CJXA 1E9QB 1S9XB 1DQLL 2OMNA 4MNGB 3L4VA 3QZWB 4PJ7F 3GZKA 4N9GB 1ECYA 4QPEA 3OL2A 4U6XB 3F7YA 3S37H 1O0VA 2R2HB 4FG6C 5C7ZA 1A7PH 4MYPA 4AKOA 3VXRD 5HHVL 3VWKD 3LEXA 4HH9B 1GC1L 3BUDA 3NA4A 3ULVL 1AP2A 4AVIA 2CQVA 3SSGA 2CLVB 4WI9A 2DQGH 2V5TA 4F57L 2IQ9H 2JK5A 2Z1KA 3JTSA 1KEMH 3T08A 1BQHG 1W9XA 3MJ8B 4E41A 2IDFA 2GHZA 4O9HH 5I6LA 1J10A 4KH9A 3EO1A 4FLHA 1RHHA 5ES4B 2AK4E 2OBGA 3TNMB 1MLBB 1LGVA 2CUHA 1RUQL 4G5AA 3FTXA 1U91B 1DANT 4OZGE 1XBRA 3ATBA 3VI3F 2P28B 3SO5A 1JK8B 2EADA 1LHZA 4P3CH 3RWGA 2X0VA 2BNRE 3MRFB 3FHEA 3QUMH 4DP5X 1LO0H 1LEGB 1TDQA 1JV5A 5DFAA 3JTTA 3CN2A 4MBRA 2ZCHL 5F2FA 3P9LA 3PGDB 3MV8E 3S6CA 5ADPL 4DP0X 3TEZA 2PNDA 4KUCF 1EDYA 5A40E 3D30A 5JPNB 3O3AB 2RAMA 1TETH 4HGKC 1FFTB 3HC3L 2WQUA 1RUPH 5CLZA 1BWMA 1XTMA 5EPMA 3O41A 3QEUA 1Q0XH 2BWDA 1KTLA 4PM1A 4PBXA 4XOCA 3VNZA 2WIMA 4JFXA 4HGMA 1LO5A 4ETQB 4F7TB 1KYDA 5E8EA 2QMJA 3RWEA 5I1IL 4LDEB 4HWBA 2VLRD 3U4AA 4LL4A 3UABA 4H8PA 4ZFQA 1KCVH 2D31A 4M6AA 1KELL 1OTUD 2GJRA 2VC2H 3LOWA 3VO0A 3TT1H 1J9SA 4J12A 2A74C 4WK4B 1CFSB 4GNKB 5DD6B 1G84A 1JRHL 2VR6A 4M7JH 3AWEA 3ZDYB 4OM0L 5HY9B 2HJKA 1E4KC 2EDJA 4EXPX 3MLZL 4RBPK 2H7WA 2Z92A 1BZ7A 3OAWA 5IOKA 1ZD6A 3QZLA 5JW4Q 2XZQL 1P4IL 1ZHLB 4R5VA 5EU3A 3UTPD 2BC4A 4HWBL 5FCUH 1AY1H 2HLEB 3HC2A 4YNYB 5AW6B 3IE9A 4QGYA 4NKOB 3G6JB 4OCWL 4UAOC 4F92B 2JTDA 4FMVA 3QQ9C 3FBQA 2Y24A 2VAAB 3KPSA 2HN7A 5KS9F 2ZF8A 5AVRB 2YJLA 1DYZA 3LKOB 4FTDA 3D09A 4UDUA 5DR5L 4Z7WA 1OAUL 3P77A 3BKMH 4J3UA 4FQ1L 3T0XA 1GL4B 3KLQA 2LV4A 4X99A 1A6PA 3VYPA 5J12B 1I9IH 4TRPL 5E4OA 2A74B 4M1GL 3THMH 1TTAA 3HC4L 5IG7B 1J9QA 3TWCH 4F7EA 1UKTA 4K71B 3KPSE 5TF1H 2YPLE 1HOCB 4FD0A 4X4KA 4DN4L 4AH2B 4A66A 4B9JA 3WY3A 1QFWM 1JGUL 4R96A 5TE4H 5L2KB 4Y4KA 4JM0A 1G1YA 1ZS8A 5AW8B 3GKWL 4KDTC 3B5GA 5DK2B 1TETL 2D7TH 5CCHE 4N0RA 1GGTA 1YEGL 2X09A 1P7BA 2GIXA 4NQDE 3SDAA 4OV5A 3IMUA 4FYQA 2FD6H 3HE6D 2UVEA 3K6OA 3BKJL 4Z7UE 3KPMB 3BZ5A 3SJVB 1CLYL 4NNYB 3SBWA 5IQ7L 2ZUVA 1ACZA 4IRJC 5J9PB 3HFMH 4K73A 1K3ZA 1UJ3B 4X5XA 2D9QB 4LDCA 3ZDZE 2GTQA 4XCYA 3NJFA 3GK8L 4HLZH 2R83A 1CIUA 4PCKA 3CLEL 4NO0A 3OXRB 3PV7A 4PJBE 3K6SB 3LPGA 2QQKH 4XN4A 5CU9A 4Y2LA 1ZLSL 2XT1B 1JGVH 1TYEB 2NXYB 1FNGB 3ME0B 3RRQA 3VRJB 2MJWA 3GHEL 4AY0A 4RGMC 3F58L 3VM7A 3O2DA 1KIPB 2BMKA 4P2OD 3TF4A 1DDTA 5ILTH 3NIGB 4PRAA 2F7QA 1X4YA 4MCYB 1YYCA 3IMSA 1MW3A 3L5XH 2O5XH 3VDCA 2VKXA 3BLKA 3RVTC 1IFHH 4KTGA 1QI5A 3SDCB 5E5RB 4XHQA 5JW5B 2WNKA 1PIFA 5IFJA 4AM0Q 3ZDYF 1YMME 1TJGH 1Z7JA 5HGDA 1J88A 3MLUL 4PJHE 3JTBA 2K4AA 2XZZA 1SHWA 3EJZD 1ZK5A 3D50A 1DQQB 5D7KE 5F7YC 2BSRA 3KM1A 4LRIC 3T2QA 5DFWH 2J21A 1DLHA 4EAEA 3UMTA 4W9CC 3LQZB 4KDVA 5DTFA 4W70A 3S35X 3WLBA 4XP9L 2R2BA 4WWNA 1C16B 1MAMH 3KYAA 3WEBA 3HNVL 5ICYA 3PJSA 4X6CA 3FW6A 4N26A 4XP1H 1DBAH 2GCYB 1M6OA 1IT9L 4NN5B 2X1WL 4QWWD 5CHNA 4K94C 4XP6H 3U9UB 4UIKL 3EG9A 5E94B 1P53A 1JK9A 2B15A 2HRHA 2HVJB 1DEEB 5IVXB 2WXHA 2ADFH 3M7FB 2PTVA 2MNWA 2L4OA 3QZPA 1M7UA 5DD0H 4G6JL 1GKOA 3B9KC 4P3DB 1KXTA 1HAUA 5IVXE 1ZDSA 3BWAA 1CPUA 1C5DA 4PJEE 3TTYA 3D2UB 4Y0GA 4XO9A 4C83B 3O11A 4LGSB 4TTDC 4KXDA 1QOKA 1XGPB 2N59A 2WO4A 4XNQB 3DBXB 3CVHL 2PCYA 2W81C 3OXSA 1MLCA 2JKSA 3K2UH 4MD5B 1IBBA 1U0QA 5F7EL 5CEXA 3INOA 4N2BA 3EYVB 4R26L 4NO3B 5C0CB 2F7RA 4IBVA 2Z35B 2FX9H 3GMQB 5J7CC 3O6LL 2X1XR 1XR8A 4HD9A 3QIUB 2HFFB 3JZ7A 4HMEA 2WTRB 3EYOA 1R9FA 4S0HA 3G5ZA 1MCOL 3GTVA 4ZUVB 4TUKH 2D3NA 4JRXD 2YPVL 3RB7A 4XH2B 1NTDA 1YEKL 4JDVA 1VJSA 3HPJA 4YBHA 4YHMH 2BNQB 4Z7UF 3MLVH 4LCUA 2MCG1 4DUXA 5SV3A 2ATKA 1NCWH 3VFRB 1U3ZA 3MRKB 1OP4A 3GSRB 4F2MB 1CO1A 5AUMB 1R3IH 2EIBA 2K6WA 2BOCA 2HTLC 2XN9E 1L9TA 4CDHA 5ITFA 4KRLB 4ECNA 4JCLA 1UOLA 4TN9A 2X6AA 1IEAA 3UC0H 4PJXA 2NYZA 1N0LB 3G5VA 4OQTL 2Q8AH 5IMOB 2XJLA 4PJ6A 3RUGE 1XGZA 3H1ZA 5D7JD 3D3VD 5EU7E 5J89A 2JWYA 4NIKB 5HYQA 4WCYH 1DVFD 4TQEH 4HCRA 4K9EL 1H5BB 1DCEA 4FYSA 3TZVA 1QG3A 3BWUF 3FYEB 1T6VN 3IDMA 4P5MB 4X5WB 2IFFL 5ANMB 2OMYB 3W5MA 4UOZA 1QTSA 3CUPB 4GS7B 4BFKA 1SDDB 2DLFL 5I5JA 2MCAA 3T77B 3KMDA 1OWWA 1WBYB 2QMKA 4J2XA 4JG1L 4FQIL 4QRSA 3QPQC 2ZZUT 4DIXA 4YBQC 2CDGB 5KBPA 1F3RB 5FOBB 4J3TA 1T7YA 3WJMA 1SLUA 2VRQA 1NBYA 4GRLD 4JO2H 4IDJH 3BHBB 2I9LA 4LHUA 1CD8A 2QPSA 3DX9B 3Q6FA 4DQOL 4EDXB 2IPUK 4HCFA 1AR1B 3K71B 3IFOA 3NZUA 1MIEH 3MRMB 1AZBA 1JPTL 1TFPA 4LGRB 2MHAA 3IPBA 3Q2CA 1FZMB 3OM3B 2B0SL 3T0EB 3I9AA 1A02N 4B53A 2YA0A 5ESAA 1NGWA 2W80C 3ZKNC 2SEBB 3HBZA 1F11B 3K2IA 3P0GB 2MQGA 4AM0A 5D1QB 3WFDH 3ZKXC 3SBRA 1O7DE 3BJ91 5GS2D 1U92A 4OLXH 2ZXCA 1KN2L 4KQ3H 1CGWA 2BMKB 1BIHA 4JM2D 4RFEA 1KCUH 1JPTH 4PP2B 2VLJB 4I13B 2ZWYA 3E2HC 2ARJA 4K9EC 2X44D 1N64L 2VLKE 4PJEF 8FABA 1BHGA 3RVVC 1MQKL 3AADB 2D2CC 2IANE 4FG0A 1QR4A 3T3PF 2RH0A 4WU5A 3EH1A 2AXGA 1CGSH 3Q2WA 4ZS7L 4LESA 4NN7B 2VLKD 3QO1A 2KS0A 4R8WH 2B16A 1JBJA 4KY1H 5C0GA 2PYFB 2VN3A 3RA7H 1CDYA 1S78D 3PABB 3C09B 3LKRA 5KG9B 3HHSB 3OD3A 1J8HE 3HZMA 1Z3RA 4LF3B 2OW7A 1HHKA 5IMMB 3VXUA 4PG9B 3E6FA 3RWDA 4KRPD 2FB4H 4P06A 3WMPA 1XH3B 3CZKA 1JK9B 5TDPB 1KZYA 2J88H 1EFQA 4K3JH 3S3SA 2OR9L 3LKSB 4FAAB 1X5KA 5FYLD 4MQXC 4EI0A 3SGEI 1N5AA 2IJ0C 1X9LA 1HX0A 5FDWA 1T20B 1A1OB 1M2OA 3QJOA 1LP9A 3QNZA 4LCCB 3KVPA 3A67H 3UZVA 2HJLA 3ZK0A 2VZSA 3BEVB 4Q0XH 5IQMA 1NC4B 2HKHH 4UINL 2BP8A 4XNQA 1OLLA 4JZOA 2XFXA 3OXSB 1BQHB 1BBJA 2MSPA 25C8L 3KW8A 5DJAA 2UZXA 1LNUA 4QHPA 5DRWA 4M6OL 4NP4H 2BRRL 4NN7C 1P0SE 1JHTA 1XF4A 2Y2WA 1F1GA 1DN0B 5SWQA 3EUUA 5AW3B 3GS7A 4OD3L 4EEEA 5DC4B 3NCWA 4W9GC 1EH9A 5E2VL 1NGQL 4ZFZB 4IRJD 5JXAH 2ADGB 4M93B 1GJUA 2E7DA 4KKAD 3RIKA 3BD4A 5HVHC 2J6EL 5EU6E 3EHBC 4D8PB 2K3HA 4HJJL 5DXWA 3U7YL 2XVBA 4OZFH 3RWHB 5AUMA 4A63A 4GI6A 2HFTA 3IDJA 5GGSY 4N8CH 1HL8A 1FNEA 3PPSA 4PJHA 2VLMD 1OGTB 2O5YL 3ABZA 3MREB 2NUTB 3IETA 3S37L 4CGUB 4Q9RL 1YMMA 2R4RH 1MUJA 3EF7A 3V6FB 3BSHA 3EIFA 12E8H 1U2CA 1XR9B 1PCXA 2APWA 1SYSA 3I74A 4YEFA 1C1EL 2P5ED 3IFPB 3WSQL 4R83A 4KAQH 5LG6A 3IPFA 3MUGB 1H5BA 4R8WL 1DBAL 2NNAA 3CDGA 5C08A 5IB1A 2J8OA 3GZPA 5E4IA 1USQA 2I85A 1TJHL 1DDHA 1ED3A 2AABL 3GMLA 4JRXE 4EKXA 4OLZL 5JZ7C 4MXWL 1A65A 1U8KB 2P42B 4ODHH 3DX0A 2XIIA 3T77A 4NSKA 4PB9L 3SDXA 4DEWA 5I30L 4ZI8A 4U3CA 3V6OE 3AAZB 3EFOB 5GRUL 4PVMA 3AG1B 4HCRH 4K23H 2ZCLH 3RWEB 1HOCA 2DQHL 3DX9A 4MLIA 2WZPD 3VXPB 5ACLA 2QSTA 1R3KA 4GBXD 1RP8A 2Y3NA 1MWAH 3EBHA 3LIZH 4OLWH 3S3BB 4EZKA 3QIBA 3CFQA 4Q2ZB 3BXNB 1JWMA 2PW2B 5E1AB 3C6EA 5E8NB 3HS0A 4HT1H 4HKBB 2XTJB 2OP4L 4M62L 1WAEA 4Z7UA 2A3TA 5HDBF 4OY9A 4QY8A 2Z92B 1XGYL 1VERA 2PETA 2A6IA 5TQ2L 5K33A 4NNYA 5CD5D 4IQHA 4LLAA 3SDXF 2Y5QA 3B9KD 1MFDH 2BFGA 1UD8A 4PRPA 4G11A 1I85A 4K5NA 3SYQA 3BAXA 3H2PA 3LAFA 3FK3A 3LXAA 4XCYB 4IRSA 3L5WA 5F44A 1E7UA 3G04A 4GQZA 2BVPB 3I3EA 4OJYA 4H0HB 4B27A 3FTWA 3SE4A 5E5MA 2FLMA 4P9HH 5E5UB 1Z5YD 4KFMA 4LKCB 4JKPH 2R7EA 1CI5A 1TQVA 43CAA 1TR7A 3F00A 4AOFA 2OSLA 4PRAB 4JR9L 1O6SB 1NKGA 2ZP8A 1YEJL 1XEDA 2XX0A 4YDKL 1KN4H 3APFA 4J27A 4LDOB 2WZ5A 3FT4A 1D9KB 1D6EB 1Z0MA 5DD1H 1UZGA 1RUML 1CXFA 5IBLC 5MHSE 1HXYA 3QUKB 4APQB 3BVWA 3FQXA 3BWZA 1P84K 3U4BH 5BXFB 2YFOA 4L1TA 2VW4A 4DN3H 2Y7MA 1GTNA 4JM4L 2ADYA 2HA1A 1HXMB 2I26N 4P59L 1U95B 3N1MC 1MJJB 5A2LH 1ZA6A 2AV1A 3QIWD 3U0WL 3PWJB 3LN9A 5IKCA 5B7FA 4JL2A 5SWZB 3A47A 1WISA 3LCYA 5JR1L 2Z7UA 3HKZA 4FKKA 4JR9H 1R17A 3FXIC 2H6PA 3OMIB 4OUUA 4JFED 3GZOA 3MOAL 3X17A 4O2EB 4AK2A 4MA7H 4H5SB 1CLCA 5M95B 2WTOA 3ECBB 4OF5A 4ILDA 1PZ3A 4BGLA 2XN1A 5GRZA 1D2OA 4FI8A 1E90A 1LDSA 2QELA 2QZ5A 4LO9A 3W57A 1VADA 4UWQB 3WV0A 5EOQL 1XO8A 1U8HB 4B9KC 3DGGA 3ZIMA 1OIOA 2EIJB 4JDZB 4Q8BA 1FFNA 4GQ9L 4NQDD 3KLHD 1U3NA 2ED9A 2WINB 4UYQA 2EVFA 3L4YA 4HPOH 1MHEB 2BERA 3D3VE 3KL0A 3ARDD 5JDJA 2V2XB 3MV01 2CDEB 3MV8A 3P3RA 1ZPLA 4R3SA 4Z78B 4WI5A 3F6JA 4IIZA 3PHSA 4XZUB 1OGSA 3DRQA 2DMHA 1J8HD 4LNRA 1QA9B 4JY4B 4ZUUB 2ZUWA 3CVIL 4AEIL 3EAKA 3SYCA 4KI1A 3HG1A 1F4YH 2R0WH 5IFJB 4S1SH 3V4PA 5KSBA 3B3IB 4YDMA 1F4XH 1IBDA 1X5HA 1LK2A 4OBSA 3RTQC 1K85A 3AS1A 1UVQB 4OLUH 1EO5A 3H7BA 1CE1L 1QZ1A 3BQUD 3W0WD 4PJIA 4YGVB 4PRHD 5EDSA 3HNTL 3C5ZA 4NFCA 4BUQA 2OK0H 2IH1B 3IFPA 1QR1B 2HWZL 2UUDK 1CR9L 2X53A 1KJ2B 4XN8A 4YZFE 3GSRA 3PJLA 2LR4A 4K7FA 3V52H 3FJTA 5ICYB 5DJXB 1HI6A 2BVQA 4PJ5B 3FU3A 4UOW0 2MCPH 4AIXA 3L16A 2WQWA 1JNJA 2VW6A 3FPYA 4N2GA 3Q3GA 4TSBH 4PJ5E 1TQCC 4Z76A 5C9JB 1ET8A 1S9WA 4Y5YB 2MQ3A 4XXWA 4JPSA 5FW7A 3DMMC 3NGBC 2AQNA 2CRZA 2FATL 3WDJA 2NY6D 3AAZA 3WD5L 4PJFA 3ZYOA 1H19A 1WC7B 1JPGA 2VQUA 4M02A 2XNAB 3PWNB 4DP9X 3KLLA 15C8H 3VXUD 3EJQA 5LNEA 1CD9B 1CD0A 1N59A 2OX5A 2HT4C 2WMPA 3AACA 3VE0B 3P1VA 4I48B 3KPPB 4HJJH 5EA0L 5EC1A 3U7YH 3QNXB 1ZLUK 4ELMF 1X5MA 3KYKL 5I1HL 1IM3A 2PW1B 4G8IB 1ZE3H 3W1ZA 4JO1L 1CTOA 2WY3B 4KU1A 1FL6B 1KTKE 4RAUA 3ZRSA 1MFMA 2QQKL 4MZIA 3F7VA 2Q5BA 2FATH 4G7YH 5CGMA 5F3BB 4GQ9H 2HFFA 4OZFA 1NGQH 2FNBA 4Q6IC 4J3OH 3V7AE 2AITA 1R1CA 4R7LA 3AABA 3HMXA 2ITDA 3VXUE 1WE5A 4U6VL 1FORH 1REIA 4PRPB 2G3ZA 3FUEA 4LBEB 4NIYE 3KLAB 1VIWA 4I4WA 4IKJA 4PMFA 3PQYE 2Q7YA 4YQXL 3MXWH 2NXZD 1KTRL 3GUTA 2CR0A 3Q01A 4X4XA 1Q72H 4PGDA 2RALA 5DRNB 1KXVC 1NCUA 3PNWB 3QJXA 2F5AH 2CDFA 2B39A 4BA8A 1RZKC 4LKCA 4F8TA 5F7DB 5A2CA 3ZT6A 3RDTD 5CZRA 1A6UL 4QEGA 4YX2H 3WJJA 4PJ8B 5DJYB 5K9QI 1OGAB 2VLJA 1PG7H 2BVUA 3MV7D 2Q7AA 3UPCA 2A6DB 1JPFA 3GXDA 3VGAC 5I1CH 1BLIA 4JGJA 2A9NH 1MFEL 1PTZA 2WNGA 4HXAH 3NP3A 1JSYA 2CIKA 2FUTA 5C8JB 3DVGA 3FUMA 2DEYX 2ZX6A 3US0A 3F5WA 1T0MB 3SQRA 4X5WA 2J2ZA 3WNNA 1KGCD 3PHOA 1TYJA 2UY7A 4XNUL 5I8KH 2YMOA 2FSEA 2GSGA 2VABB 4OD2A 1ZT4B 2DJMA 2Z31B 5INCA 1RFDH 5L4JA 1BIIB 4JREB 4BFIA 4HKZA 3O4OC 1B6UA 1MJJA 2FHFA 3EYQD 4OU3A 5LNDA 3WUWG 1F18A 3HUJF 1IRAY 4XPTH 5IKCB 3BUPA 3VXRA 4FQXA 5CU5A 2JCCA 2DWDA 1CXIA 5IW6A 1MFBL 2X89D 1B9ZA 1EDQA 4U0QB 5E6IC 4TUOA 1ZPUA 1ACXA 2I9TA 1QLRA 4BJLA 5I6NA 3QFJB 1GMIA 2WXKA 5L2JA 5I5RA 2XPZA 3DV6B 5L8JB 3LKSA 1FZMA 1KBGL 1YQ2A 3DGGB 3A4EA 1XGYH 1X5FA 4QHKJ 4PS4H 3ESPA 1R33A 2AXHA 2OXHA 1FGNH 1B4TA 3S97C 1FYTE 3AWFA 3F64A 4XMVA 3RVTD 4APXA 3ESNA 2H2PD 1L0YA 1UURA 5CCKH 2BY0A 1I7ZA 3D48R 4HUVA 1E5CA 3ARUA 2QT6A 5IY5B 3NEEA 1QFHA 3SDAC 5KSVB 2K45A 3VM5A 4Y2OB 2FX7L 1J0YA 4UV4L 3JSSA 2H1PH 4OZHE 4F8OA 3MQIA 2B9AA 2KZKA 1KIRB 1A4JA 4HC1L 1FE8H 1SJVA 1W8EA 3NCMA 4I18A 2BP5M 2GUOA 5ENWA 3CFDB 2ZAHA 1IL1A 2UWEE 3QO1B 4PLJC 1GW6A 2CUMA 4GMTH 5ALBH 3VTMA 5CP7A 3ZYJA 4AL8C 2JJUA 1QR1A 2EH7H 3A5VA 3PQYD 4M5ZH 4ZFOA 1TSHA 2W91A 1G9ML 4XPGL 5I9QC 4P4RB 5E2UL 1WWCA 4P2RE 5IQOA 1I7TB 4LF3A 4UV4H 4A7VA 1T21B 4OF6A 3ZW3A 1UZ8B 4P59H 5EC2A 1MKFA 4R4FH 3WHE0 4KKRA 2OULB 1KFAH 5IJVA 2Y07L 2ZKMX 4NQTA 3B9KB 2EIEA 4K9EH 3AY4A 4DNLA 1KENL 1BYOA 4YR6B 4L0PB 1MCWM 4MVBC 5DURB 5IK3A 5J6GB 2EVGA 3GBLA 5FECA 5F7MC 1RUMH 5A3IC 1L3NA 1LEIB 1MEXL 2G5UA 1X5IA 2BXZA 4AIZA 1RZPA 4LKXA 4ZTOL 3RI5K 2PPCA 1EJ8A 1IC1A 4Y89A 5EH1A 3BT0A 4DK5A 3O2WH 4NHCH 1BVKA 1ET7A 5GZOC 1HYSC 3STLA 4L1LA 4JFEA 1BQKA 2AZAA 2AJ3A 4E5XA 2HFEA 5C0IB 2VM4A 3A6BL 3LN4B 4ADGA 2WBJD 1CL7L 4RGOH 4JJOA 3LKQA 4LVHC 5KYWA 3EYSL 2Z7WA 4UQ3A 4AYMC 1JJUA 1NMCC 3SBQA 1D5IH 2AS5M 1JL8A 2IOIA 4WHTB 2FR4B 1OAQL 3CFKA 4I4WB 1XGTA 5TE7H 3TO4C 3DUSB 5DA0B 2ICWI 4CKVX 4Y4KD 1AZVA 1B4LA 2FYYB 4LDLB 5CIPB 1BYPA 1NICA 2GKIA 3UG3A 3G6DH 4PGDB 5IBUG 3MFFA 3Q13A 2C4FU 4ZSOE 5F9DC 1NDGA 4S0TD 3SE6A 4PWFA 4WIQA 4N2AA 1SJHB 1YN6A 3X1FA 1LE9B 4LSUL 1T1XB 4TVUA 2OSYA 3O2VL 3QARA 2OQJA 1IBZA 5IHBA 4ZO7A 4UQIM 5BS0B 3Q1SL 3QJSB 5E8OB 5BZWB 1PKQA 4AV5A 3X3FL 1RJZA 4FKEA 1F2XK 4XVUC 5AYQA 3RI5F 1E6JL 1X4ZA 1HINL 3QHTC 1WFNA 4IMKA 4WEUD 2CIKB 4AQ8C 1W72A 1S7TB 1UACL 5FHAL 1C5BL 2FO4B 1QQDA 3C5SB 3DNKA 3C5ZD 4IKNA 4H25B 1LD9B 4LVHB 2J12B 3VFPB 2WB1A 2GSGB 2NNFA 3H54A 2QKIB 5FA4A 5AOLA 1ZY9A 4X80H 4XO8A 1N2RA 1EJFA 4LPTA 3WIHA 1FJ1A 1XZWA 1MHCA 2VSMB 4GBXC 5BZZA 2JXMA 3N0PB 3OG6B 5EBGA 4RMUA 4HMCA 3KPQA 4FHKA 1ASQA 2QGBA 3NFPB 3HG4A 3DC0A 2VZTA 4FQXB 3IDGA 4GIPD 2Q86B 1TJGL 4JJ5B 5C86A 4QRPA 3ZYIA 2DH2A 4RMSA 2ROYA 2E9IA 3SPVB 2X4QB 5TE6L 1BF2A 5LN8A 1DZBA 1U58A 3KPNA 2DYRB 5D2LB 3AROA 4OCSL 3HS8A 3OKMA 3ZKND 3H42L 3BMWA 4GFXA 3AXLB 5A2FA 2E59A 3I9PA 5T1LB 5D2NE 1HT6A 2EZ0D 4GG8B 1A64A 1HHHA 4RMWA 4PJDB 4Y2DB 3IJSB 3N06B 1EZUA 3BGAA 5IHZB 1HNYA 3U9PH 4OZGF 3E1F1 4HWUA 1G5GA 3GGWB 3QS3A 4EN3A 1OB0A 2ZNWA 5C3LD 1KNOA 3RWJB 5EUKA 4R4ND 4OGYH 5HHPA 4N1CA 1X5LA 2E6QA 3NRPA 2CRIA 1KCBA 2ZUXA 3E9TA 5T33L 2ITCA 4L3EB 4QCIA 1AFVH 1G4MA 1DQML 1WD9A 5F93C 2BRRH 1CGSL 2WAQA 3VFGL 3FRPG 2KQNA 4FTVE 4NZRL 1CYGA 1WFUA 3UJJL 5DYOA 1JI1A 3DDFA 3QQDB 4IJ3B 1JDAA 2FIRT 4A37A 4XAKD 1XMWA 3HBPA 4R7XA 5IQLA 3GJEA 1I1CA 2VR7A 4PBVC 1F02I 3NN8A 3JWOH 4XRCB 4IGBC 2A73B 2YRLA 32C2B 1S7VB 1RJCA 4IHBA 4N6RB 3UYPA 4UCFA 4TL5A 3VFMA 5LAPA 1JV5B 3L2NA 1YQVL 5LGHL 2VLJD 3MV7A 4BH7A 3GSVA 1P4BH 1T21A 4K94L 1IEBB 4Q7DA 2EKJA 2QADD 2NRDA 3CFBA 2V8MA 5IJVB 2X4RA 1IB5A 3FB8B 1SM3H 4O2FB 4J3BA 3HC4H 5F71A 4PGBA 1GOFA 1OB1B 1OE1A 4S10A 5C09D 5J6GA 1X5AA 2MNUA 2UWEA 3RGVA 2GEEA 3L3DB 2XQYA 2H6PB 3RWIA 5DUJA 3ESOA 1IBYA 2IOOA 1O7DC 4NQEE 5EO1A 4EI6A 5D9SB 1NAMA 3VWKB 2VLRB 5L88H 1NMBL 3FHQA 5I6XB 3MXVH 5ALCH 2B4CC 4XAWH 3GJFK 4DEUA 1YEIH 4BWUA 4FQXD 3SB3A 1ZANL 4CJ0A 3I75B 5DD6A 1ZWIA 5DS2A 1JPGB 4M4PA 1WCQA 5I66A 3N9GL 2I07A 5EULV 4QXVA 4X8XA 2CA4A 1FFQA 4KKAC 5ID0B 2D31B 5EF0A 3R7QA 3QUZC 4ISVA 4JFYB 4JVWA 5D71L 5I24A 3O0RL 1DBJL 1BD2E 1JF6A 4NBXB 4ZQKB 1XF3B 3HI1A 1AMXA 1QTYT 1A6AA 3CD4A 4N3TA 4BSVB 3D6GA 5BRQA 3BQUC 3DOIA 4R97C 4OZFB 4Q9RH 4B5EA 2H32A 1W0WB 3C5JA 4P57B 2EO7A 1AKJA 4QTIL 4TQPA 5FO2A 3ARYA 2RACA 4FG4A 4YSTA 2AK4A 3BOVA 4RA0C 2JJWA 4QI3A 4Z7OB 1UWGL 2BW4A 1ASOA 2W0LA 3K4ZA 3L4ZA 1CXLA 2RFXB 5CZVL 4OI8A 4L4TA 2WQVA 1BVOA 2A74A 3VXRE 5AZ2H 1KJ2A 3K91A 4UTBA 1FA4A 2ODIA 3T1FB 1MIML 4K5PA 5AD0B 5KSUB 4PV1C 4NXKA 3WMQA 1EVTC 3IBEA 3I9GL 4JM2C 1EANA 3EOYG 3PGFH 1XX9C 4LLVA 1RPQA 4Y9FA 2WXIA 3MJ9A 1OD7A 3VFVA 2CIIB 4R96B 4G59C 5DJYA 2P45B 2CO6A 5T3XE 3LPPA 4XMUA 1FNSL 2X6VA 4I8DA 4NENA 2DQDH 2K8QA 2RIKA 3PHQB 4U1GC 2PF6A 4BZ2L 3IMBA 3WSQH 1A5FH 4FLRA 3PWNA 4FP8L 3F5WB 2VN7A 3W9DB 5EZOL 3NCJH 4ZFOL 1VDGA 3GDCA 4WUUA 4U2YA 4ZTOH 4N87A 2RJMA 5I82A 2VSDA 1CGTA 3FRUA 4MA8H 4F20A 1NCBH 3V95A 1JZJA 5C0EB 5INCB 1S8DA 1UG9A 4D3CL 3HI6L 4XPFL 2Y36L 4LLDA 4W9HC 1BMZA 1K5NB 2B4CH 2OA9A 3C8HA 3TN0D 3UC0L 5DHMC 3HI6H 1T4KA 4PJAE 5E7BA 5B8CC 4QTFA 3ULVH 2JQMA 3P02A 5IVZB 2W9EH 3X13B 1NM9A 2IH3A 4AMKL 2P5EE 3II1A 4HBQA 4K71C 4U1IB 5FUCC 3ULVC 3QDAA 4I18C 4FP8H 5FYLH 2EUVA 2P8LB 1GGIH 4JGMA 2ADIB 4EN2A 1KBKA 1SYVA 3SYAA 1IGCL 4Y16B 4ZAKC 5AWNH 5DZPA 3TEUA 5HGHA 1QBLL 1BAWA 3IT8D 4PJGA 1V7MH 2W95A 1J0KA 5HJ3A 5TH2A 4F9LC 2NZ9D 4L4JA 5DRNA 2G5RA 4PJCF 4DUWA 2J5WA 2W07A 3C6SA 1MOEA 5JHMA 1J1XL 5C07B 3MJGX 1QPKA 3LRKA 4J6RH 2LLGA 4XC3L 5C3TA 2J1ZA 3D25A 2IIJA 2WOYA 4L9LB 1RZJC 4HK3J 4RZKA 4GUQA 1OT1A 3HMWH 4XX1E 4KKBD 3F8UB 1YEEL 5CWSA 1IZKA 2NW3B 1RZJH 1P6WA 1QPPA 3PS6A 3BVNB 2PYED 2VWEE 3P9WB 1D5BB 2AJYH 4YOKA 5T5NF 2BSCA 4QOKE 1YEFL 2I27N 2Z91B 4LEOA 3N0AA 5D1ZC 1PJWA 3QAZC 4UNTA 1HQRA 2FWLB 3TBTB 5ENWB 2E5EA 2PXYB 3SPGA 5A16B 1V05A 2GW5A 3VYOA 2Q8BH 3EOAB 1BM3H 3IMTA 3TYFB 3TIEB 4JCWA 5HGAB 4F3FB 4EOWL 1K4CB 3I50H 4W6YB 1WUNT 3VH8B 5KSAB 4L1BA 4KVPA 5DQJB 1SUHA 5B7MA 2ZD0A 4IRJA 3ZZ1A 4LEBA 1MCBA 2N56A 3O0LA 3X12B 4AV4A 2NXYD 1CF1A 1A5FL 3JWNC 3T8XA 4OD1L 1DVFC 3KLHC 1MAKA 3S8FB 5EV7A 1INQB 1M3IA 4CILA 1XDTT 5L2JB 3L1EA 3DBXA 4XPTL 5D7KD 2FE0A 1MCLA 1DUZB 3EO0A 4HA1A 3DXAB 3GS4A 2VITA 2NY1B 4ZXBD 4JHVA 1RUAL 2ZX7A 4P3DA 1XZ0A 1ID2A 1E27A 1SQMA 5AVVB 3P54A 5C2UB 5I1JH 4Q0XL 1IFHL 4AK1A 2PP7A 3DXAE 3G6AB 3SD5A 1QW8A 2WTRA 3EYOB 3C09C 2IG2L 2WYZA 3O11B 4FCHA 3OB8A 4LOEA 3QEQD 4GRLC 1HDMA 3EH3B 5D4IA 3RL1B 3ATFA 5CS7A 4G80A 2YC1A 2P24B 3H2WA 3KNBA 5ITBH 3HE7B 4FJZA 4Z7VB 4Y4HA 3AGWA 2F53B 5BO0D 3UTSB 5KYWB 2H32B 1TMQA 3J2PA 4P57A 3AG4B 3NJXA 3D8MA 2WIIB 4LSPH 3ZTJH 1XB6A 3QK0A 3MRGA 3RILA 1QLFB 3QI9B 1B6DA 4GBXA 3SCMB 2C7UA 2X4PA 1RZQA 1R5IB 4MNQE 4ACTA 2V0AA 4XX1G 4R2GC 4P5RA 3AG3B 4L4TB 2Y1ZA 4JB9L 4AJ0A 5MEPB 3GRWA 1JVKA 2APFA 5IB5B 3CHRA 3CSYB 4OCLC 5ETUB 4XB8A 4HC1H 3O3BB 1JE6A 1CLZL 4MMZB 3QP3A 1QWNA 3OAYH 3RKDD 3TJHD 5IMOA 2DQJH 1DJSA 4HAFA 4K55A 4R5XA 3DROB 3RG1C 3ULUC 4QXWA 4WZ9A 4O58H 3RAJL 1RU9L 3B9KA 5CBAB 4LSRL 1I1FA 4WEBL 3CPUA 1LLAA 2P9RA 4X7TA 1PQZB 2J5LC 4UTBH 1EZSA 1UXWB 2YBGA 3S35H 3P9LB 4AIZB 1FDLL 3QFDA 2NQ3A 1SFDA 3TA3A 2W59A 2WV3A 4N6QA 3FSZA 3NH7L 2HFGL 3V9EA 3GB7B 4YXLL 1WBYA 4HUUB 5J56B 5AZUA 1NCOA 3IFOB 4X9GA 4YHZH 3SCMC 1A4KA 5KVFL 1NPJA 1L9PA 4JFEB 4UQCA 4LAQL 3BHBA 3V4PL 3Q6FB 2EDEA 1HE7A 2UZYA 2NXZC 4LLWA 4WI7A 2J20A 1PYWA 2ZUQB 1TQTA 4U1IA 4UT9A 3E3QE 3HCVB 2C4FT 3U2JA 3VB9A 4KZDH 1IGFL 1CTNA 3HNVH 3RTQA 4QRQB 4A6YB 5AZEH 1Q9LB 5C07E 2OM5A 3OKLA 1AJ7H 5JLZB 4XVTL 2E4TA 3U7WL 3MR9A 1GRWA 4TNWF 5FW8A 1ICTA 3MLRL 1BQSA 4BELD 3L5HA 4N8PA 4PD4K 5CFHA 4WW2C 3T65B 2R0KH 1BAFH 3RNKB 4A7UA 5MHSD 4JANB 2IADB 2FDBP 2K9FB 4KHTL 2C3VA 5AKVA 4D0DB 1E4JA 1MFCH 4UB0L 4HF5H 1S7RA 1XIWD 4X7CC 1RZGA 4HLZG 1RK7A 4HJGB 2FSDA 5D93C 5DD5H 1JZGA 1KLGB 3SHSA 1KIQA 1A6TA 1IC5L 2AANA 1PEZA 4HXAL 1PKQB 4N90E 5ESQB 1CN4A 4PJXF 4XHJC 4ERSH 1AKJD 2P8MB 4XNXH 5EU4A 3QXVA 5I6PA 2Y7QA 1GYAA 5EZIL 4Z0XA 3M8OL 1DJIA 4LPUA 3L4UA 2EO9A 1T2JA 4PEEA 1FCGA 1AHWA 2BNQE 5DHYA 4KK8C 1L0XA 1K4DB 3ARDA 4N5ED 1NCWL 3S5LA 2ZG1A 2E9WA 4YZWA 3KPLA 5C6TH 3VG9B 4Q58C 4BZ2H 1E4WH 4JG0H 4N28A 3C9NB 3N50A 4PMEA 1NUNB 3MROA 4LCVA 1ETJA 4G1EB 3MJ7A 2YN5A 3UYPB 2WWKT 3PG2A 4IIQC 1FVEB 1L7IH 1A1OA 3H9ZA 3T2NH 4QRPB 4BYHA 4KTDL 1A7OL 1ZOXA 3UXFA 1ZLEA 4P2QB 4WHYG 4PG9A 5E9NA 2DIJA 5EIIB 4ZK8A 2AV7A 1MREH 4U3HA 4JZOB 4P9MH 1ODUA 4Z18A 1ZLUH 5EF1A 3FRPB 4UILH 3CXHK 1QACA 3N42B 4X7DC 3EDKA 5FGCB 4A55A 3B5TA 5B3JE 2K1MA 4C55A 5KUMA 5AVTB 3T4AA 5C0NC 3K72B 5HHMB 1FZJB 1YEHH 2ZXAA 1UEYA 1A3RL 1ZGLM 5CUSL 1BPVA 5GGVL 2Q2LA 1NAMH 3GGWA 5F70A 3UTSE 1DJXA 5CLWA 1NZRA 3AS2A 5GGRA 2ERJC 1U8PA 4PRHE 5JA9A 2N3JA 4MXVE 4A1RA 4D9RD 3RWJA 1MCJA 2A4ZA 3P73B 3D39D 5KYXB 1Q90A 2WUBH 3ZIYA 1KFAL 3E6HB 2NR6D 2W60A 1ZSHA 3RL2A 1G6RA 4KZEH 4N0CD 1U33A 2NZ1A 3VYNA 5KVGH 3ARGA 4GMSL 3HN8A 2YD2A 2O61A 2XWDA 2VIRA 4POUB 3W11D 2KHAA 2NY2B 3HJEA 3O2DL 4CC4C 5EN2B 4Z9KB 3B2VL 1AYRA 1Y18B 3FH8A 4I3RL 4ZSOB 3SDCD 2I60L 2PR9A 5FYKL 4DPRA 3MREA 3FQUB 1MUJB 2VQTA 3V6FA 5IHWA 1CLOH 2VLLA 3P0VL 4UUJA 3VD2A 1NIBA 3DJRA 1NOLA 1IAOB 2G2RA 1DSYA 3MLYH 4D8PA 3CMOH 3D51A 4G72B 3RWHA 3DTXA 3ARQA 2QR0B 3QZMA 2PWHA 1RIHL 5GGTL 1GCYA 3S3DB 1IBFA 1UD2A 3QR1A 1JZ5A 4OLUL 4UNVA 4G43B 1YMMB 5T1DH 3MLWH 3UBXG 2WGXA 1BVNP 5I76A 4PRIA 3H0TB 4RMBA 2CLZA 1YY8A 5EUOA 3WLBB 3EO9L 5E23A 3RVUC 3BAEL 5GZOD 4JGUA 1SOKA 2V3DA 4A2LA 2YSTA 1WA1X 1B2WL 3JT2A 4NKDA 4NZDA 4M48L 4JUTA 1VGEH 3VSTA 3F12B 4BV1A 1FSKB 4LLMA 1NFIA 3UAFA 2IPTL 4O58L 3SPCA 2VDMH 3H3PL 4HFUH 5FCSH 4FXGC 3MO1A 4RQQB 1G9NC 1HXKA 4NZUL 3M45A 4FFWD 4MMXC 4N24A 2MTPA 3HAEB 4NXSA 5A2AA 3U2IA 2X4OA 5HYFA 4RDQF 2APTA 4X8CA 3CXDH 3BXNA 2BSTB 4GKNA 1NFDF 3V7MA 2L7JA 3OKLB 4PCTA 4KGJA 4YSUA 2CE6A 2VMFA 2DQUL 2M2DA 1XR8B 2YARA 3T65A 2A77H 3RNKA 1OSEA 5I1DA 4TV3A 3HUJA 4XP5L 3BZ4A 3BW9A 3LKNB 1W0VA 4JFTA 4DN4H 4MJID 2EDRA 4L23A 5K1VA 3EOTH 4OFDA 2X89A 5CM1A 2NYYC 1CFQB 4E36A 3D52A 5IVOA 4NX0A 3BAEH 2CCVA 3NCXA 2J6EH 4YHOH 4M6ML 5IFAH 3CHXA 4L5FL 3QYMA 2DW5A 3ILEA 1OM3L 5LGKA 4IRZH 5JMOC 3MTXA 1UD3A 2XTJC 3FU0A 4F2MA 4FXKC 4GAYA 2P8MA 2FCBA 4ZTEA 5EU4B 4PGEA 4XI5C 5FO8B 2DYPD 1XCTB 4FJ6A 3WJLC 1S9VB 4OT1H 5JHLL 4YE4H 2LLNA 2WHVA 2Y25A 1C8PA 4KV5F 2YK1H 4QWWC 4HWEL 3TNMA 2C9QA 4W9FC 2HKAA 3RJQB 5IJCC 2NLJA 3AQYA 5KS9A 1F97A 2ZSWB 3MODH 4X4ME 3DETC 4HZLB 3QEQB 1G7HB 5D2LE 1RIUL 3LHPL 4MHHI 1D5BA 3MCLH 3P0YL 4H40A 3KWWB 4M8VA 2A99A 3T2PA 2X9XA 4NNPL 4PRDB 5HHNB 3NAAL 3MJ7B 4HUCA 4RGNC 3AGVA 1QVOA 4HIJB 3LRSA 3FULA 4I88A 2PR4L 4KK6C 3EGDA 4F27A 3KDPB 5KBDA 4P2QA 1Z32X 1VCAA 4IU2A 2AV7B 1ZA6B 3NSXA 2V17H 4IMLA 2ZXEB 3T0EC 3E8VA 4XAKE 1LDPH 2ADJA 2AQSA 1FL5B 2A9DA 2VE6A 1YMHB 3IGUA 4TXVB 2XG5B 5BO1H 2IOMA 4HT1L 1LO5B 3ESMA 4ETQA 2B1AH 2PWGA 4ZZFA 1DO6A 3G3LA 4AQ1B 4G5ZL 1G5AA 3PQYA 2H9GB 3QWQB 1SJXA 3GYRA 4I89A 3DOHA 2EP6A 5E8PA 1TFHA 3VFUA 4YZFF 1S4IA 3RGBA 1GPOL 2ZCLL 3GSOA 4RWHA 1I3RA 4XZUA 1OF0A 2FBRA 4PJGB 3MNVA 4WHYH 1AGEB 4FNLL 4MX7B 1RSFA 3WGUB 1F58L 4XBGB 4C4BA 4QGTA 5IEHA 2YN3A 3AS3A 2H1XA 3V4PB 1FVCB 5DZAA 1QFOA 3GBEA 1H3PL 4J8RB 3NT0A 3VCLA 4YAQB 5DRZA 5CGBA 2XQYG 2I5YL 1A6ZB 4OJDH 3GJFH 1QA9A 1RL1A 2C26A 3MLUH 1W16A 3S96A 1BVNT 4M43H 3H4FA 4JPVL 5T5FL 2QDVA 4Y7MA 2VLKB 1FL3B 1HI6B 3CJJA 3MNDA 4WSKA 1UJTA 2BVQB 4PJ5A 5BRZD 5SWSB 1I8IB 3VXSD 3D9AH 3QI9A 4ONHB 4KO6A 5A16A 2VZOA 4QHMA 5ILTL 4F8NA 4WY7H 3JWDC 1WFTA 3ZL4L 2EIKB 3WIAA 2EEXA 1JS4A 4GP8B 43C9B 5MEPA 4PP1C 1ZT7A 4LCCC 4F7EB 1QYGH 1G7PB 2IXQB 4D0BB 3OPUA 3VD3A 5T5FH