2XGGA

Structure of toxoplasma gondii micronemal protein 2 a_i domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
147
Chain Sequence
GTNQLDICFLIDSSGSIGIQNFRLVKQFLHTFLMVLPIGPEEVNNAVVTYSTDVHLQWDLQSPNAVDKQLAAHAVLDMPYKKGSTNTSDGLKACKQILFTGSRPGREHVPKLVIGMTDGESDSDFRTVRAAKEIRELGGIVTVLAVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICRONEME PROTEIN 2
publication title Structure of the Micronemal Protein 2 (Mic2) A/I Domain from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Hydrolase
total genus 52
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2010-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2xggA00
3EH1A 3IBSA 1IJKA 1PCXA 4MMYB 4IHKA 4WK0B 4UM9B 2NUTA 3EH2A 3EG9A 1T0PA 3TW0A 1M2OA 1U0NA 2I6SA 4IGIA 1M1XB 1IJBA 1QC5A 2VDKB 4JDUA 3QA3E 4NENB 3EFOA 4CN9A 5KYXB 2NUPB 1JEQB 5KYNA 3F74A 4O02B 1N9ZA 4BJ3A 3EGXA 1DZIA 1ATZA 5E6UA 4DMUB 1ZOOA 3F78A 2XWJI 5LN1A 4HQNA 4G1MB 2O7NA 3EGDB 3VI4B 2ODQA 2ICAA 3PPVA 3IJEB 4HQFA 3TVYA 5E6RB 3BQNB 1MQ8B 1ZOPA 1MQ9A 4F1JA 4F1KA 1OAKA 4G1EB 1CK4A 4M76B 1JEYB 1QCYA 4NENA 2WINI 3Q3GE 2NUPA 1AUQA 1PD0A 3NIDB 4IXDA 5KYWB 3ZDYB 2VC2B 3HXQA 5E6SB 4CNBA 4Z7OB 4Z7QB 1AOXA 1FNSA 3BN3A 3ZE1B 3ZDXB 2VDNB 5HDBB 2IUEA 1RD4A 2ADFA 1BHO1 2VDLB 4HQKA 1PD1A 3PPWA 5KYUB 5E6RA 5ES4B 1RTKA 4XW2A 4CN8A 3N2NA 3T3PB 2VDRB 3VI3B 3T3MB 3ZDZB 3ZE0B 3PPYA 2XGGA 1JEYA 1V7PC 1UEXC 1M2VB 3BQMB 1SQ0A 1ZONA 3EG9B 5KYWA 3RAGA 3FCUB 5KYXA 4C2BA 5KYYB 2B2XA 4WFQA 1JEQA 2M32A 3NIGB 3ZE2B 1PT6A 2ODPA 2WW8A 1JV2B 3E2MA 1FE8A 4FX5A 1L5GB 3GXBA 3NIFB 1MQAA 1RRKA 1XDDA 3K71B 3PPXA 3HXOA 2XWBF 3HI6A 3K6SB 3EGXB 5HJ2A 1U8CB 4NEHB 1M1UA 3V4VB 3EGDA 1IDN1 4MMZB 3ZQKA 1IDOA 4PN7A 3FCSB 3TXAA 3EOAI 4WK2B 5BV8A 1CQPA 4UM9D 1SHUX 4WK4B 4Z7NB 3V4PB 1MJNA 1M2VA 2QTVA 4HQLA 1XUOA 1XDGA 1YVPA 1DGQA 5KYYA 5HGJA 1MF7A 2NUTB 4C29A 4UM8B 2VDOB 2NVOA 2X5NA 4HQOA 1QC5B 4MMXB 5E6SA 3K72B 1RS0A 3EFOB 4C2AA 1Q0PA 3TCXB 1MHPA 1N3YA 3K6SA 2VDQB 1LFAA 4WJKB 2VDMB 1JLMA 2VDPB 1TYEB 1NA5A 5E6UB 5KYUA 2I6QA 3EOBI 2I91A 1YVRA 4A0QA 1AO3A 1M10A 3M6FA 1SHTX 1BHQ1 1U0OC 1T6BY
chains in the Genus database with same CATH superfamily
4EGSA 1UXIA 3C2QA 4UM9B 1JHVA 1ZSYA 1X1CA 4ZPXA 1M1NA 4GQBA 4YECA 3WWYA 2WYWA 5JJLA 3AG5A 5JQGF 2VRWA 1EZ4A 1P91A 2HWXA 1KDVA 2B20A 1PEYA 3DV9A 2CK3A 3IDFA 1C1DB 2GAFA 4M0PA 1GGJA 4RZHA 3UJAA 4KITB 1O94A 2BR4A 2VT3A 4U6SA 4CVNA 3MGBA 1DZIA 4C0HA 4WT7A 4EVQA 3KAJA 3B1YA 4GR5A 3ZCQA 1U0GA 1ZFNA 2C7BA 3R75A 4UTPA 1A82A 3LUAA 3W5IA 4B45A 4HKTA 4HLDA 2ICAA 3Q3VA 1JXQA 2PUGA 1MG0A 4LXTA 4FOTA 4QE3A 3IQHX 4D4LA 3HVKA 1MAUA 3KHKA 2JCYA 6GPBA 1H2BA 1E6UA 1XTIA 2O2DA 3B1FA 3IAXA 4MUIA 1SKAA 1EH5A 1W94A 2FOXA 1M75A 3NW9A 4OXNA 3AFOA 2QN9A 5IMSA 3PXEA 2HBZA 3ANNA 3KL2A 4DDWA 3H42B 1UC4B 4O4IF 4Z4IA 1BVYF 4D0LB 4Q4DA 5F7XA 2CFTA 1W93A 2GO7A 2J7KA 3VHXA 1OAAA 2R3SA 3Q8LA 5TJHA 4LJLA 3TB6A 3UIEA 3VR2D 3HEAA 1I4WA 1QHEA 1T0IA 4PX9A 5AO9A 2B99A 3C3XA 3TN7A 4BGIA 3ZZ0A 5F1YA 4WDQA 1T8WA 2VRNA 4D3SA 2NTEA 3M2TA 3ZJVA 2XVZA 2ILVA 3S2UA 1W36C 1Z8NA 3SEAA 1YRLA 4JJEA 1L5RA 3C3CA 4IQ0A 4H6VA 2XVMA 10MHA 3BL6A 4DJAA 4BLRA 3GAAA 3KQPA 4OFXA 3COZA 3MUNA 1KZ9A 2I71A 2WPNA 1YMVA 3VH4A 4KN6A 2YV2A 3IOCA 3U9TA 4C2BA 5CYFA 2M32A 5DGCA 4AURA 2OY0A 3WXBA 3WRXC 2D7JA 2OHOA 2ZB7A 3MD9A 3NHSA 2ZZMA 3TKYA 1XFAA 3RSZA 4R4JA 5COQA 3OESA 1YDMA 4NFYA 3U40A 5F23A 5JFTA 3H7IA 1BA3A 1ZDMA 1JA1A 4V02A 5C5EA 4ZTUB 2W00A 1Y7TA 2HMYB 5DYNA 1IBRA 5COAA 3W0LB 4LJ5A 3T4UA 5GM2A 3I8XA 4YCBA 3QJYA 5TARA 3JASB 4XVUA 1PS8A 1DUIA 3QLVC 2FFAA 3F3YA 3GMTA 4JJ4A 4I66A 4TVBA 1FLDA 3HXPA 4EMTA 4UMDA 2G4VA 1E5XA 2TRSB 1UFRA 1MB4A 2B5OA 1K7SN 4IJ5A 1KRWA 1Z33A 5F64A 2HBRA 1RJEA 5IH7A 3K0AA 3V7FA 3WL4A 5G40A 3ROXA 5CNKA 4ND1A 5EOVA 3LCJA 1I80A 2YWEA 3DTVA 3SSNA 3H04A 4K5QA 4PHFA 4GOOD 1Y4AE 2PGXA 1ZMXA 3Q3IA 4HHEA 2I65A 3U4GA 3FG9A 3NTLA 5JWHA 2ZJBA 3VDRA 3BPSA 3ZHCA 4NU8X 2BFPA 3UK0A 5DX1A 1AO3A 3PU6A 2ZQYA 2XTNA 3X44A 3D7SA 5A4FS 1YRBA 1TT7A 1C7JA 1BE8A 3ZQ6A 4CF4A 2XOXA 1CUYA 3AMVA 3GJ4A 1ESDA 1Z36A 5CFLA 1AXEA 4EPYA 4C1BA 3ZI0A 3G0IA 3OEEA 1RXVA 4BMSA 2QD2A 1JDVA 1QC5A 1HMYA 2DX7A 1PFWA 2IU4A 3FF4A 4EG6A 2ATVA 1C3EA 3LWDA 4TV8B 1XU9A 5EMJA 5IT9A 1VA4A 4N4AA 1U8EA 1O3YA 3B6EA 3GO4A 4FSHA 4N54A 4KNYA 2WG2A 3L8GA 1KOGA 5G1OA 2PU7A 3A6HA 3PFNA 3UYLA 4YP6A 4MI3A 1NOKA 4OMFG 4WE3A 4ND2A 5BW8A 3T35A 5BWLA 2QUZA 3ZD8A 1XAHA 2PLRA 3OPNA 4CG3A 3FTEA 2IS1A 3GW8A 3FGZA 1XJ0A 1U65A 3KQLA 1EI9A 2FHPA 5CLJA 4NV0A 3V2GA 1I4TD 1UOEA 2FPPB 5ICSA 3D1JA 4C0QC 4I4NA 4HWRA 3RYHB 2VP5A 4P4UA 5IU6A 2HL6A 2EEZA 1CYDA 1RI1A 2Q2NA 4FYKA 4H17A 5TT1A 1D8AA 3W8RA 3TLCA 4DAEA 1SU7A 4ARVA 1C81A 1JZSA 2XGOA 2QB5A 1JIUA 1TCUA 1Z47A 3GMSA 2GAJA 2FCRA 4E51A 4IR7A 4YAKA 5FYQA 1H69A 1UT5A 2ADFA 3G8CA 4MQBA 5LFAA 1PD1A 4UVEA 5BV0A 4AJ9A 2ZAGA 3QSGA 2EXXA 3MTEA 1ZN7A 5ED0A 3FTPA 1M5TA 1KVSA 1Q1EA 2CLDX 4CODB 3CJTA 3FCYA 2QIOA 3DLPX 3FYUB 2B8NA 4JLWA 1WP4A 3PC8C 1O77A 1JLSA 1UMBA 2BSQA 3FPBA 2GARA 1JMKC 1RAAA 4ZGBA 2VQEB 1Z5OA 3NVKI 1X7XB 1KDOA 3JQCA 3P32A 4D4KA 3TZCA 3DDNA 2HLPA 2Q6OA 4Y6LA 5FX2A 3MTIA 1Y3IA 4UFNA 4TWIA 1YQGA 1RRKA 3TUJC 1WO8A 1QIKA 1I3OA 2RH8A 4B6PA 4TT3A 3GGOA 4DLLA 1RQRA 3URKA 1KDPA 4QRHA 1XROA 4DIDA 5EEHA 2IZ6A 2HHJA 3I6IA 3M0EA 1KO8A 4KQKA 4P7GA 5GQSA 3KB8A 3VR5A 6CHYA 1ZZGA 2G63A 1QIIA 1MZVA 4EL0A 1T1RA 3OPYA 4JLVA 1IY8A 2QTZA 5BT8A 4YV1A 2C99A 4NEQA 2CMHA 2WEKA 4RGYA 1IWPB 1M2VA 2IUSA 4C0SA 1SPBS 3R0XA 1ULBA 5A3QA 2J59A 5G0TA 1QNLA 1CCWA 3QZUA 3DB1A 1NVTA 3LOPA 2P69A 4IIGA 4K6OA 4R1NA 5EP2A 4OM7A 1ISFA 1KY5A 1RXSA 5SZKB 3B85A 4ZYZA 1ZVVA 1DXHA 4ALNA 4PSUA 4XFDA 4W5TA 4D57A 2VQFB 5AUPB 4LZAA 5I4KA 2AK3A 2DR0A 2B3TA 4ZAGA 1DIAA 2AQ8A 1N6NA 4M54A 4WTOA 2C2MA 4U1RA 3UAXA 1JKXA 1R8SA 2Z58A 3HYSA 2Y27A 2BEJA 3L01A 3NWBA 3SPXA 3TH5A 4HUQA 2DP4E 4QELA 1PR9A 4R84A 2VG8A 3QU4A 5IXJA 2WFAA 3E1SA 3H1TA 3N6XA 3REGA 3AF0A 3UWPA 4ND8A 1JP7A 2O3QA 1V71A 1T0PA 1YZKA 2WOOA 5EZ5A 4JQCA 4RWEA 1IONA 4F56A 3AR8A 4Z9AA 2XMSA 3O2JA 4U00A 4BWVA 2AW5A 5A0FA 2O54A 2VYQA 3LYLA 3UPUA 3MMSA 3ESZA 3F67A 4DDHA 3H3JA 3MGGA 4DR4B 4UUMA 1JKJB 3T1NA 3MSXA 1VJRA 3WSTA 1K8ZB 3VYVA 3TFOA 1ZM7A 2EL7A 2F3RA 5CXXA 3RC9A 4UUNA 4JNCA 5E95A 3BJRA 3HZOA 4S1VA 3UG6A 3VYRB 1OXTA 1X1SA 2NO4A 4G0OA 2TECE 3EJ6A 2NZ8A 3IXMA 3ZHXA 1U02A 2L42A 5JARA 3G6WA 2FRVA 3QBEA 5G0UA 1H2YA 4JI5B 1N2XA 3L8DA 3PRHA 5ARCA 5KDDA 1SEPA 3RG2A 4Z1MD 1JHRA 4PAOA 2GESA 1NIPA 3IQDB 4RMJA 2UU9B 1M0SA 2PV0A 4C0WA 2W70A 2WYIA 4YX9A 1OXBB 1AM4D 2OPBA 3P0RA 3CRVA 2C7PA 5FWDA 2J3IA 3C6ZA 2VC2B 4O4LA 4LZLA 4XYMA 4G65A 4M1YA 2PKQO 4QNMA 2KJQA 2ZYHA 3BIJA 4DQKA 2F8MA 3V8NA 5KIAA 2IOHA 3V8EA 1CUSA 3K6RA 3DO8A 4TTAA 3QYJA 4A91A 4OX9Y 3K20A 2WIAA 4UE6A 1QVZA 2DPGA 1KDZA 3RUPA 4DV6B 3LNCA 2WJHA 5DM2A 1J25A 3RFCA 5CAEA 3MHTA 3OZTA 3DHWC 4NPAA 2NZ2A 1BE1A 4YJGB 3JAKA 5DP1A 3UAGA 1Z5NA 4OSEA 4WKOA 1E9FA 2F1RA 3W3AA 2Z4RA 1BGXT 1H9BA 1TJ4A 1OLSA 2IPMA 2P5UA 2R86A 3W1VA 4TM8A 3QVMA 3NHBA 2CVZA 1I36A 1SVLA 4FD3A 4JGGA 2YJTD 4C7JA 3FWKA 2Q3JA 3OTHA 5CB4A 3B3JA 4LHZA 1OJLA 3LX4A 5FADA 4OB8A 3UVEA 4ZCQA 2IDZA 4HX2A 1GITA 2LE0A 1EP1B 2I2WA 1TEVA 2HPHA 2AN9A 3HWX1 3P96A 1C2TA 1J49A 3IB6A 4XM2A 1MT0A 1QR2A 2RONA 5DCLA 4NFLA 2AWNA 1KEZA 1OMOA 1OYWA 2IQ5A 3LX6A 2F62A 2F67A 1II0A 4LF4B 1M2FA 4UMVA 2ZI5A 3NHMA 1FP4A 3BXPA 1T0HB 2HLHA 2JH8A 4YRGA 1PR3A 2CNBA 3E9YA 3LVFO 3KZNA 1RQGA 4JI4B 2BEWB 1U1FA 1DGQA 1UR5A 2XZTA 1EB8A 2DWUA 1CEXA 2E6UX 1OILA 2FH5B 1C5KA 3DD1A 2G6BA 1RKBA 1U11A 5IH3A 5HS4A 1NW7A 1NRIA 1JFRA 1Z6XA 1PFUA 3NAQA 4IMPA 1WG8A 3WZMA 2RGUA 3I37X 4BWYA 3IBCA 2VOJA 1XX6A 4YJHB 1ZITA 5FOVA 1T0BA 1PAUA 2VHUA 1KJ9A 2IODA 1Z06A 2GF9A 3MUOA 3T5AA 1CEYA 3I2HA 3KEFA 2A1IA 3AM1A 1MA3A 4D2IA 4PAQA 1Y8ZA 3C6XA 4UZFA 5CVJA 3P2JA 4OM8A 4DQ0A 4NHOA 1N0VC 1MJHA 3Q7SA 4AO8A 7REQB 1T9BA 2X8AA 5IJ9B 5EJ9A 2A0FA 1LQUA 4HXGA 4NCIA 1GTMA 3EG9A 5TJ9A 1KPGA 4CKWB 1HEIA 1KMCA 1XU7A 2W2TA 5K3EA 4C78A 5HWSA 4II2A 4MRSA 4X66B 1R5NA 3SD7A 2RCNA 2VJCA 2NU8B 2Q5LA 5CT5A 3R7WB 1E8MA 1HE5A 4M9RA 4B9AA 2FQQA 2R1VB 1QFXA 4RFLA 2A4MA 4RM3A 3A7DA 3AVQA 3BXGA 4KGZA 5C51B 3TGWA 3IKVA 1CY0A 1SHLA 3TW6A 1ZNQO 2BV3A 3B1ZA 2HJSA 3RVDA 2AK2A 4ETWA 5K03A 2IXBA 2WG0A 2GF0A 5JYEA 2XA1A 2VNIA 4RPHA 1AB5A 3V1LA 2PZBA 4TLMB 1IBCA 4IFEA 2R1TB 4ZEWA 3K92A 4FWIB 4MROA 2EZ9A 3ZDQA 4ZQHA 3OQIA 1WXGA 5JANA 2XMCA 4JHLA 3F90A 2EF1A 3GLGB 2BM0A 1I2BA 1G9SA 1XOIA 4I3HA 4E1BA 2H2IA 2CNOA 5I47A 1ZCBA 4BLQA 2GFHA 3FNFA 5CDFE 4U2CA 5U9CA 2H1CA 3HKDB 1A27A 1M1YB 2I4RA 5BURA 3DE7X 3EJWA 3CT4A 4DMLA 2FI1A 3DGFC 4LSZA 3O5AA 3KZVA 1WXFA 2QTGA 4X1YB 3IEPA 1AS2A 2AFIE 2B92A 4FZ3A 2P75A 3ONWA 4WZBB 3TBFA 1TZCA 5CLGA 4OHXA 4R01A 3OUUA 5B3JA 2ID4A 2IY7A 4UEQA 1U9IA 2BCJQ 2MMCA 3E70C 4M60A 4Q1EA 4WEOA 4BZWA 4CM9D 3Q0TA 2LRHA 4O59O 1C8BA 5KOIA 5CR9A 1J00A 1KYTA 1X1DA 3MAGA 5B1HA 4GLJA 3P9SA 2H1SA 4O2BB 3SVZA 4FMDF 1ONPA 1RXIA 3K9LA 3IVCA 2FZEA 5INTA 1TMOA 1E4YA 1L5GB 4GPBA 2VL7A 3L8FA 3DPUA 4KB5A 1XPRA 1MRZA 2JBWA 5CMLA 1F0PA 2C78A 4FLFA 1H2HA 4QASA 3BJIC 4TV9B 3G0OA 2PX5A 3IAAA 2H2AA 5AVKA 1CF9A 3CUKA 3IQIX 5LDHA 4L2IA 2BF4A 3HN6A 2HC9A 3GLFE 2Y1CA 4PLGA 4BGUA 1YZYA 3X1YA 3GLKA 3GLHA 3OA0A 4NYJQ 1QYRA 1FY2A 2QTFA 4XGNA 3VX3A 5D5QA 4MW6A 3FFWA 1GZ4A 3HJNA 3H75A 1W1IA 1VJGA 2W2MA 3RC1A 5D3MB 5FHQA 4Q9LA 2X4DA 4P84A 4DXHA 4IIHA 2VZLA 1U2DC 3DP7A 4NX2A 2Q9CA 3OAAA 5IUNC 2ZT5A 1AMNA 4K81B 5JMTA 1QV9A 1ZOSA 3LWBA 2NN3C 4M1EA 2G0TA 4WN9A 4JQYA 1W59A 4F71A 3OT1A 4G2NA 3OETA 4MOWA 1C7IA 4RVUA 1JIVA 1F3LA 2C04A 2FN9A 3P0IA 5FOTA 2OAP1 4QPCA 3LFHA 4ZQGA 1UADA 3OZUA 2I9PA 3A9RA 4IKEA 3TLAA 5IF3A 4DV7B 4ABTA 1E6LA 3FPKA 4E2ZA 2W6ID 4Q9HA 1E32A 1GXSB 2QDKA 4KIJA 3M6FA 4N5DA 4N0QA 1KI9A 3WGHA 1XRRA 4ZQCB 2G09A 4OXKA 1WXHA 1WKCA 3HUFA 2LBPA 2NM0A 2WZCA 4KLZA 4BEJA 3FOEC 5HZGA 4L5BA 1K6IA 2Q07A 4G0XA 3ASVA 1C80A 1DDOA 3BK1A 3JAWB 3DZCA 3AEYA 2Z5LA 3OSUA 3A3OA 2X3FA 1E2LA 5L9AA 4LVCA 1QOZA 1K2VN 3KUXA 3KCNA 3KFVA 3NDRA 5DW3A 3U7IA 4FX2A 5KHLB 4M99A 3WDMA 3O6VA 3CBQA 3MAAC 5AW6A 2BF7A 5T5QA 2HUPA 4NL4H 1IIRA 1Z5GA 1OLUA 1DRKA 1QFMA 1XMOB 1WMAA 3QNWA 5CHYA 3KEGA 5B2FA 5CCXA 1H3NA 5A0TA 1LXCA 3L4BC 4RZUA 1TC2A 4D92A 1ULSA 2EP8A 4QUHA 4HRYA 3SZUA 1Z17A 4R1TA 4IX1A 3KPUA 4MJXA 4NOKA 1S8FA 4PIMA 4YP7A 2XYPA 4LZZA 2HMUA 2AI2A 4XVHA 1QCYA 2ZRAA 4GYYA 4FFBA 2GZ3A 3C45A 4Q3DA 4UEWA 5EHGA 3RYTC 1R6XA 1AUQA 3M1YA 2LGJA 3K0CA 1P0IA 2QN6A 3WP1B 2CE2X 3KXPA 4G9GA 3ZS8A 1IN8A 2ZJAA 4Q0MA 5CT8A 1NHGA 4F5YA 3QEJA 1FTWA 3ES9A 2NSJA 3RHTA 3R6DA 1HH4A 4IXMA 2HM7A 2YMLA 3ILVA 2EBHX 1ZISA 3Q72A 4J9UE 3OM1A 2WSYB 2O2SA 1KZ7B 1ZIPA 2OHXA 3L04A 4CL8A 3GNTA 5ESXA 2YIVX 3O3OB 3VR3A 3P9XA 1U81A 2XDYA 2ZBDA 1O0CA 2UZ3A 1ULTA 4HAZA 1OBCA 3HLYA 5GWXA 1X1EA 4PTZA 1EVZA 1C1XA 2WD7A 2CFOA 1NE7A 1RKVA 4X71A 3ROKA 3QG5A 5HBRA 3I92A 3KHSA 3OJ0A 1EUCB 1U6KA 4CLHA 2FUCA 1GL3A 4IVRA 1COWD 5KVCA 1GU1A 5LYJF 2CMFA 2CN1A 5BOSB 1MOPA 3EEBA 2FQXA 3H6KA 3KTFA 4MP8A 2ZAOA 4MPDA 4NQZA 3V4VB 2JFBA 1IDN1 3THYB 4G8DA 3ZHOA 2KS6A 2NYVA 5LZ4A 2HJ9A 3EGCA 4QEZA 4ZOLB 3MW8A 4Z8XA 4ABYA 3FXAA 5DH9A 2C9BA 4BNKA 2AFHE 2JLXA 3QVJA 1SKUA 1A8HA 2N3ZA 3M4JA 3WLEA 3T94A 2B7BA 3S3TA 1ISPA 1NR7A 1IQPA 3FNBA 3JATB 2CBZA 1XZGA 1NAHA 5EJFA 1B0PA 3WX0A 3IBYA 2PWPA 4LHVA 4K6KA 2PSDA 3UGTA 1W49A 5JUWA 1DWOA 3UAOA 3UKDA 2C42A 4R54A 3DZ8A 4BP8A 1PNQA 2CV2A 5H9WA 3H17A 3RVJA 3HVRA 1DKQA 4LV5B 3PHCA 3UM9A 4TTQA 4DQDA 4Z4FA 3ZC3A 1T10A 3IUNA 3C5WP 3KB2A 1L3CA 4J0HA 4D1YA 1NVMB 3QFCA 3PNSA 3A6GA 5DHTA 1CVLA 4LDZA 2Q3LA 5J5CA 1TM4E 1JDTA 2JJMA 5BR1A 4JJKA 4BTLA 3VSBA 1O96B 2C57A 3C15C 4L4UA 2FW1A 1KOJA 1OU4A 1ZM9A 2NXWA 1I0ZA 2ZG6A 1HK7A 5FIUA 2NUTA 3RV4A 4CKEA 1ZICA 1N2GA 2IHUA 4D8TA 2EJTA 2VJMA 3AHDA 2WJAA 1ZY2A 4ZVUA 1PWXA 1VLHA 1MW8X 3AJAA 3RYIB 3UG7A 4UFPA 1YFLA 1FMFA 4TRMA 5KNCA 4O63O 5FUBA 3Q7RA 1SNYA 1HT3A 4FDUA 4P7FA 3VKHA 4J1TA 3WY9A 3H18A 1ITZA 2OBMA 3EIUA 4ZKDA 5AI0A 3GRFA 1YK0A 2FN4A 3LRXA 4WOCA 1UM9B 1LJ8A 2G1AA 1LX7A 1NMXA 3A36A 2POQX 3VPBA 3ZUGA 4B8WA 4ZOAA 1BROA 2AEEA 1IC6A 2ISCA 4IPTA 4LK3A 4IV5A 2VJLA 2CBGA 3TLJA 4WZAE 1SUCA 2QJTA 1KSGA 4ZTBA 4BWGA 4Z3OA 1EUDA 1W85A 2VF2A 3JVDA 4QBHA 1QYVA 1OH8A 1LK5A 5BSGA 5FUMA 1XP8A 4M9QA 3ECAA 3FNQA 1YJCA 2YV1A 3K70B 1DS6A 3ENQA 2V55B 5SY9A 3IQXA 3IJRA 1U2TA 4HCJA 3L4KA 4MV3A 1Y3BE 1XL0A 2JZOA 4D45A 3ON5A 1HE2A 1Q21A 3FH0A 5ADHA 3J7AC 1GZHB 2BFBA 3DV0B 5TNXA 1UKBA 4OSOA 4HVAA 4QJ4A 1PS9A 2GWHA 3FWNA 4JT9A 1KARA 3GAMA 1X7WB 4X8OA 2RCYA 5HCNA 3F6EX 1KC3A 2QI9F 3X1DA 5IM4A 3EGEA 3VTFA 2O2CA 4WECA 4BTVA 5EJ4A 3HKBA 4IDQA 3GDOA 3PDCA 4QU9A 4EVIA 2AUNA 1WHTA 2P2NA 4G63A 2ZJ8A 3E4DA 2N46A 1AQJA 2O5VA 1EZ1A 2JI6A 3WRYA 4DR2B 2Y05A 4PYIA 1DAGA 2QTCA 2HJGA 4G4GA 3JU3A 3Q6NA 4DDTA 1TK9A 1YE8A 1QYXA 4F06A 4QTUB 1DO8A 3THXB 4E22A 2WWIA 3T9AA 4KQCA 1V41E 4X0EA 3UV3A 1P73A 3F6SA 8ABPA 1IY1A 1F8XA 4U3JB 4WADA 4EY3A 1VL1A 2BGJA 1TPYA 2ZIVB 2ASEA 3HDJA 4KQ2A 4RHXA 4EQ6B 2Q4TA 3C8DA 1M6WA 3GFPA 1FFXA 1FFSA 1VLJA 3FCSB 4D8UA 4CEJA 2J3HA 3F5QA 1GPYA 1MXHA 3LP5A 3R6GA 3RSOA 4QLBA 4EKDA 2DOKA 3FI9A 5IAJA 2BFFA 2F8SA 2C8JA 3MWEB 5GZ6A 4LBZA 1XFDA 4G67A 3UMCA 1NJFA 4FWTA 2IYRA 2R79A 5E2IA 3DZKA 2GSDA 4MAFA 3UTDA 5AKHA 4EHBA 3ICQB 4BFZA 3GUUA 3JQ8A 1GT6A 3HCDA 2I7CA 4UBOA 3RREA 2CLMB 3BGWA 4YH1A 3UQYS 5FL7A 1YQDA 1KMQA 1T5HX 2F3QA 2O3JA 1VJ0A 4A4DA 1OIXA 4IDNA 1G3MA 3A9SA 3N0TA 1JAYA 3PFKA 2JAQA 2YMMA 1YQTA 2QZZA 2YUIA 1N7HA 1F7VA 3L5OA 4M7PA 1S7CA 1CR0A 4KXFB 1IHUA 3CNHA 4RTMA 1U7DA 3FFTA 3EXHB 1VMEA 3OQPA 4FONA 3NM4A 4IHJA 1RAFA 3N70A 2ZCVA 1DEKA 1PCXA 5JZSA 1QPZA 2AFVA 2C5SA 3QEBZ 4B2LA 3LI2A 2VJAA 2CCJA 1TA9A 4IUYA 5LL6P 1TD9A 1U4OA 1V2GA 4Z3DA 2O6HA 2XUJA 4IDCA 3TQHA 4DLNA 1TE2A 2E4YA 5J4YA 4IWYA 4EUEA 4FLEA 4B6JA 3GMDA 1NY5A 1DWPA 1UJ4A 2HQOA 1QYDA 1U2GC 2V6BA 3HBAA 3RFUA 3WE7A 2B1QA 2FWBA 4UDOA 1E1LA 4LBVA 1UMCB 1VKZA 5GPBA 2CXQA 2CJXA 3EIEA 4NV3A 3NXSA 4HDMA 1BRTA 1JB1A 4CYMA 1LPOA 2K7ZA 2VKTA 3U9LA 2ONZA 3TI7A 2J48A 3VVBA 1Z2PX 3SF8A 3VZCA 4CM3A 3GZJA 3T6KA 5KQLA 4KE7A 3D6VA 3I1IA 1TZMA 2HMTA 4NXMB 1KBQA 3IOEA 1QFJA 4XCVA 4DC9A 2GUGA 1E89A 4GGPA 4QDZA 3T7EA 2IBMA 1TAGA 3F7TA 3H8JA 3PPIA 4NENA 1QX3A 4UXJA 5TQ0A 4CHGA 5IYZB 4GX5A 2PGDA 3R7LA 3WO0A 3WL3A 3HUEA 1OH7A 4KN5A 1BKSB 3KLMX 2II6A 4JODA 3OCCA 3EGOA 3I9FA 1Q14A 5BVHA 2NTJA 1BC5A 3B5JA 5AVYA 3KKKA 2RAPA 4M21A 4BX8A 2Z3ZA 1L5SA 2VJNA 3H1PA 4KQ9A 4BV9A 3MCTA 1VSVA 4DYVA 3LVQE 2FPGA 3TCNA 1YFZA 2BMFA 1Z6ZA 2QLNA 4F3KA 1XDUA 5DNYB 3U31A 4D82A 1AV7A 1A69A 3GGDA 1RWQA 5FTJA 4D26A 2CB9A 1P1IA 1UXJA 3ZWYA 4MDFA 4RHYA 4C07A 3V1TC 3T4PA 1NI4A 1QU2A 1YS2X 4CEIA 4QOGA 4WZ6A 1L4BA 5A5FA 1RJ9B 4E70A 3CR7A 3GEHA 4WFQA 1QVRA 1X14A 1EJBA 3M4ZA 4CCSA 2ZXEA 3IMFA 2XTJA 7AT1A 4BO2A 2AG1A 3Q9UA 4HAXA 3I39X 3NWJA 1Y7HA 1E61A 4QARA 4R7TA 3D3EA 1D07A 5DNUA 1GNQA 4URXR 3AZQA 3OLYA 1HE8B 1I33A 2JLRA 3BK2A 4C0LA 5GZ3A 1Z0UA 3JWHA 4QGSA 5C1BA 2W43A 2K5UA 3W9SA 3LY5A 4TXNA 3FTCA 1J9GA 2HB6A 1KP2A 4CG1A 1R64A 4DA8A 3W5VA 1GNPA 3EAQA 2X6TA 3DP9A 3OU2A 2IXTA 1K92A 1XKQA 2QGFA 4OJTA 1SXJC 5C35A 1R16A 1KMHA 4X1KA 5JNLA 4FGSA 1GGVA 1NDHA 1RLIA 5G1NA 4DXAA 1HR0B 3C85A 4TQAA 4OHBA 1BCRB 5K3DA 3V4SA 4BNHA 1IUKA 5B36A 1E2UA 3K6SA 2IIPA 2QUKA 4UNPA 4HWOA 2GZHA 3R5FA 4HFNA 3KKZA 3WLSA 4F4FA 4TLBA 2YNMA 2FK7A 1DEHA 4KR7A 2ZTUA 3BIOA 5ALUA 4YRNA 2CLHB 5BSVA 3HBFA 1DBQA 1ORTA 1E2EA 3WNCA 3WV4A 1D7AA 3RKSA 3NAGA 3LTEA 4QYXA 5GIOE 2FKNA 3TAHA 3LIIA 2QN7A 1WTAA 4K9PA 4B2IA 4TKMA 4QTYA 4LGVA 1Z0JA 3IH5A 3HUUA 3KYCA 4MWCA 4RSRA 2BHLA 1D6MA 1KI6B 1JI0A 3RASA 4AF6A 3KZXA 3V2HA 3U7QA 5KNBD 4TYYA 3PL1A 1RYFA 4OGKA 4RL6A 4Q9DA 5TSDA 1NBOA 4AIRA 1D4FA 1P0PA 2RH4A 2ZB2A 4X6LA 4CIYA 2C4HA 1U3TA 1VC2A 2XUHA 3AR2A 2ZZKA 1WXXA 3JARB 3ORYA 3P4UA 5KTKA 1TTPB 4XR4A 1KQFA 3OH8A 4J4BA 4CF6A 2GVDC 2J6IA 1E1RA 4OP2A 4P7JA 4UDYX 1A3CA 2IY8A 1F0NA 2XVAA 3RVRA 1I4LD 1WDWB 2OHHA 4G26A 4IW3B 2HIAA 3I1FA 4KDCA 4D5EA 2D1SA 2GCGA 3F7NA 4TZKA 4UVIA 1TO1E 3ROTA 4BVLA 3SIWA 1JJBA 1OAKA 1W9HA 1NMSA 3EXAA 3HUTA 4G23A 4ARSA 3N2LA 3BH6A 1DDIA 1G60A 2BE9A 3AR6A 4JL8A 4YV2A 3BT7A 2F48A 4F60A 1OB5A 2DLNA 2WFLA 3ITKA 3D0QA 3UHFA 1Z82A 4B6OA 4B46A 3H84A 1NXQA 3K0FA 1I2ZA 1SPXA 2WKPA 3A4IA 4JYCA 2H3EA 2IUEA 4BQNA 4OI4A 4EW6A 1WW3A 3GJ8A 2IP1A 1TM1E 3G5AA 2R47A 5ESRA 2L69A 4I50F 3OY7A 3G7UA 1XA0A 3SR0A 3A6LA 3V97A 1B14A 3G0DA 2ZU6A 1MIOB 2PGOA 3W5AA 4ARIA 1L5OA 3QXCA 2WYVA 3N0RA 4PYRA 3VZSA 3W2EA 1YZQA 4MYRA 3ZW7A 1VMKA 2BH9A 5I9LA 1LDMA 1ZN8A 2ZBUA 3ZLJA 1YRYE 2FQ1A 2LCIA 2X0NA 1N8TA 5L3SA 1VPVA 2B5WA 1S9DA 2ZQZA 4TL7A 3V1NA 3FVQA 3M6MD 5LWQA 2PH1A 2OKCA 1TK2A 2O8FA 2WTXA 2J3MA 4WNAA 2RHWA 3FTFA 1HQYE 5JS1A 2YWDA 3BE8A 1S8NA 5FFMA 4TL9A 4U7WA 4KTTE 2XNDD 4KXLA 3G23A 3ZTYA 4GMGA 2PGNA 2YC2C 2EOAA 5E4JA 4ER0A 3ZQKA 2D2VA 3CEMA 4FOPA 4XX0B 4ACAA 2IDMA 1YCHA 3B7GA 3AR7A 4B9EA 3IMCA 4D0NA 1WBJB 1GZ3A 5B1DA 2J31A 4GFDA 1A4XA 2AA3A 1TVMA 1WVMA 5HMMA 5K6AC 3DCIA 221PA 2O3RA 2XNJA 1Z7GA 2CJFA 2RHCA 2YXNA 2X8JA 3INRA 3LE8A 4QNRA 1U4SA 2ZUVA 3C16C 5EWLA 3ZYZA 5A9SA 1FJGB 2X9VA 3BJZA 3N8HA 1YR8A 3AVVA 1F51E 4HNGA 5HEKA 3CWZA 5I51A 1GSAA 2DLDA 2HWKA 4O0LA 1RI3A 4O6VA 1DQNA 2WAXA 2ZRBA 3K1JA 4DIKA 4IZOA 4BNJA 4JP1A 2OCGA 4MB6A 1V3QE 2XUQA 1GPJA 1DUSA 1XBTA 3ABRB 3ISJA 4MTLA 4I4TB 3COPA 3PJDA 3FSGD 4OGFA 1T5TA 2ZYAA 3SICE 5EJGA 1QUFA 2CD9A 3DOFA 4JFRA 2VSNA 3DKVA 3S1AB 1EIZA 1I24A 1CUVA 3PUZA 4G81A 3LBFA 1IVNA 3T9DA 1LGYA 1X77A 1B15A 3L0YA 5KNDH 3PLAE 4EEZA 1U2RA 4DSOA 3BGOS 2IYSA 1DBRA 1E1QA 3OUTA 1U5CA 3EUWA 2PZJA 2KHZA 1YJBA 3CLUD 3FYCA 3GPCA 3IUEA 5CW1A 3SP1A 2RFLA 1WD5A 2J9GA 2RHGB 3AOEC 1C14A 3GLFB 1MRNA 3KJZA 2CJWB 3NVMB 2O5RA 1P0MA 2YWFA 3J81k 3LRTA 2I67A 2X41A 2GZDA 4RFSB 3G2NA 3ZY2A 2Q62A 1FU8A 3BGSA 5JAPA 1TJ5A 5F2NA 1CB7A 3CVVA 5A2QA 1GSHA 1N6PA 5FBZA 1KBOA 3TXXA 1W4CA 3WIVA 1PF7E 1W25A 2P2YA 3BICA 3KQMA 3P0JA 4GYJA 4PRLA 1UQRA 3O0DA 3OFJA 4LXUA 5E1MA 1Z7EA 2QX8A 3H11B 1IZ0A 3AKDA 4FDTA 3OSZA 2ADMA 4QG7A 2XCTB 2NYAA 3H0CA 1ILEA 5A4DA 2YCLA 1UKYA 2ZM5A 1TA0A 1BX1A 3U5ZB 3MWFA 5TX7A 2QAJA 1VDMA 1R4NA 5CD1A 3WLOA 1QS0A 5FO1A 4BYMA 3VO9A 4HR7A 4JELA 4RZ2A 4G0UA 4Z6KA 1D5WA 3RIHA 5EQDA 3ID6C 1C9EA 1OJ7A 1XSEA 3CW2A 4D8WA 1G8KA 1NYTA 1Q1AA 3FKQA 1GNLA 3C6BA 3LPDA 3N39C 5CYOA 3D3WB 5KOHA 3A1FA 5LP6A 1JU4A 2YZGA 4JBGA 1AF7A 2OO7A 2RH9B 1SVSA 5DYWA 3GX1A 1NBWB 1U4NA 3CRRA 4FFMA 4TLAA 5IUKC 5JPIA 4BDSA 3TSWA 5KTMA 1X42A 4QTZA 3N05A 4WNIA 4YHHB 4YTEA 2WK1A 3ULKA 2ZRLA 4A27A 1V4BA 1W2GA 2CBXA 2WIGA 3EA4A 4GC5A 1OGYA 1EFVB 1NJGA 1VM6A 2ENWA 3CLSC 4YRLA 4DG8A 2EARA 3DFIA 4PXSA 4GPTA 4PPNA 5AVXA 3FPFA 1QHNA 1X6VA 3PUJA 4R83A 3EXG2 3RJZA 2JAHA 3VO2A 3ENZA 1JIKA 2HZ7A 1JEQA 2V3WA 3TIGA 3LWNA 3A1CA 2H1HA 2XBMA 1BTOA 3VFDA 2R8OA 2G9QA 1Y33E 3J7TA 3M5PA 4HN2A 4QUJA 2G06A 5AI6A 3KTAA 2VLBA 4K46A 1NQAO 4DM7A 3ZTWA 1M2GA 1E6CA 3TRFA 1V7CA 3ETGA 1AS3A 1XPOA 5DCUA 1YUMA 1GUBA 5COBA 1XJ5A 3ORRA 1C29B 1CIJA 4HS4A 4YO7A 4BY9E 2J9YB 1SHKA 1RR6A 3LVBA 1LV7A 2JHGA 3D5QA 3SKXA 4ZO7A 4TKZA 5L7YA 4A0SA 5HGXA 1E5TA 5AKLA 2OCXA 5HOEA 4LXQA 3HNOA 4PLWA 1E3TA 3B38A 5I7SA 5KMGA 1DE0A 2JHAA 3CLSD 2KWIA 1OCEA 4LJ6A 5J2UA 1TX4B 2FZVA 5BW6B 3VHRA 4QODA 1U31A 2GJ8A 2HPVA 2SICE 3AR3A 4NZNA 2BH2A 3IPCA 4IIJA 4H60A 4J91A 1FMLA 1B2LA 2RGNA 4R1LA 3LYHA 1O54A 1P9OA 1UPBA 1YS4A 2XHZA 3KJIA 3AI2A 4O2BF 3SM9A 3VNSA 4AKEA 1B8NA 2PMBA 2R4QA 2A78A 2VQ6A 2JFPA 5LQMA 4MA0A 3V9PA 4I99A 1HFWA 4L5JA 4RTSA 4V0NA 2IVZA 4M36A 1OC4A 1FTGA 1HM5A 3LDHA 1Y8CA 2XCOA 3BWBA 2IDJA 1ISRA 3QUSA 4HDAA 4LJSA 1K4YA 3ZY6A 4AMZA 1ORWA 3RVOA 1ZUIA 3FX2A 2AF3C 3PCXA 4RJIA 1YQEA 4UBIA 1MEOA 2C9DA 3TW0A 2PK3A 3FCOA 4TXLA 4KQ1A 1GYRA 3KYDA 3LUHA 4IJQA 4KGVA 3O03A 5BRAA 3NDBB 3HLTA 1MLDA 1JIQA 1GRQA 1H0RA 1PJTA 2GEKA 3N2EA 3U0BA 1EIWA 1M7GA 3HCNA 4JASB 2G1PA 1UBMS 2J08A 1WXEA 2AFHB 3VSDA 3ADDA 4MGYR 4TZ6A 1N2ZA 3K5PA 5GP1A 1SCDA 2QTMA 1E96A 2P9GA 1U0EA 2WWWA 5K1ZA 3RO7A 3D6NB 1OIWA 2JDID 4LVOA 5C1DA 5L95A 4M46A 4HJRA 4EKYA 1IMOA 2OZEA 4G8BA 2PSSA 3AX6A 1ZGBA 1XVTA 3CPSA 4U0KA 4CLDA 2XOKD 1K97A 2WG1A 1O9HA 3EAFA 2XCLA 2E49A 1IOZA 3KG2A 3I6YA 1ZH8A 4FSDA 3CRQA 2QUAA 4LECA 3ZJ4A 1I14A 1I10A 1PL7A 1P3DA 2PJRA 4FEAA 2GX6A 4WNYA 5BSMA 5E4TA 6NULA 2O2EA 2UZIR 1I3KA 1QPBA 5L8VA 3AHHA 4RUKA 1U7WA 2Q27A 3SC6A 3OM0A 4C4SA 4DM3A 3RUHA 3OCUA 4QDOA 4E6EA 1Q7CA 3L6CA 3WYDA 1A8QA 3MGCA 2PRJA 4ZREA 3T52A 3PCTA 4CGYA 2W2OA 2E4ZA 2RHHA 2HF9A 3CNOA 3E4CA 4C3UA 3JWGA 1A98A 1SN7A 5EI5A 3OOWA 2HJRA 3WL5A 1ADYA 4K6GA 4XOIA 4W7SA 5KU1A 4DLZA 4QECA 4DUZB 1ZG3A 3UHAA 2CLSA 4CCYB 2QRVB 3D8UA 1BAPA 1CZKA 1XR3A 2FN3A 3HGMA 2PVSA 2QXYA 1A4UA 3KR2A 4HDSB 5AI5A 3L6EA 1JT9A 2B1JA 3GCDA 3WLNA 3A6PC 2H4HA 5CA1B 3TPCA 3PPXA 2Z6QA 2I2AA 4H1VA 4CTOA 1GFIA 1HQKA 2VT7A 2XDWA 1ZZEA 3P9YA 4LI0A 3UB2A 5EHXA 3DQPA 2BP7B 1E2IA 3COWA 4OLHA 1F2UA 2NACA 1Y6ZA 4DUGD 4U8HA 1ILWA 1DC7A 2JGIA 4CLRA 2X13A 1Z6PA 3GJYA 1YVDA 1WMFA 4MICA 1NR5A 2XXJA 4KN9S 4RE6A 5DU2A 3QW2A 5A3VA 4RJLA 3SYTA 3U7RA 4RAQA 4CDNA 1SXQA 2PA0A 4H18A 1L4MA 1J5XA 1ZH6A 1N92A 1ZK4A 2N47A 2RIRA 3EZ2A 3N3BC 3N2KA 4RY0A 3CEJA 3TRJA 2WAAA 1DFGA 1NXPA 4EYSA 5JZVA 1AQYA 2EW2A 3C3YA 5CVEA 1Y3CE 4TTJA 3MMXA 5AQEA 5P21A 4FWBA 3TVDA 4BMDA 4DIBA 4E07A 5IT0A 5CCBA 4DG9A 1T3SA 1WE2A 1V9SA 1XZEA 5KTPA 1U3DA 2WHEA 3GJSA 2AW3A 2DRIA 2W6PA 4JUAA 3TK1A 3QI7A 4NU5A 4OL0A 1PSZA 3HMQA 4G86A 4A10A 5K8UA 2H08A 3KYJB 3R2JA 5I7AA 2ZTVA 2DY1A 1X8JA 3NFRA 4XIGS 3ZGYA 3QVGA 1MDBA 1SUAA 4LZOA 1E2PA 2C2HA 1Y6JA 1QUEA 2CSUA 2P9ZA 1IZ7A 2Z30A 1CUXA 4FGKA 4QPZA 4R68A 3FDJA 5IBQA 1Q7GA 2WA1A 4EQZA 2VF7A 4QGAA 5H9VA 3KLNA 4UCQA 2DJ5A 2KMLA 1PV4A 4ZOLF 4Y2TA 4B33A 3K2QA 1NFFA 3NGLA 4AZTA 2EKDA 5CK5A 2IXFA 1HSOA 1T4GA 3HE3A 4MQFB 4TVSA 1Q15A 1YB7A 3SJAA 3G3EA 3GQBB 3B60A 5LQNA 3R5XA 1FXWA 3HA2A 3QQPA 3RDPA 2SECE 5JSYA 3REQA 2D06A 4OHYA 5I9MA 5B1IA 3ZZNA 4B3FX 1AZWA 2WE7A 2NU6A 4G9EA 4UXIA 1QO7A 3O1HB 2WBLC 2XUOA 3CLTC 2R4TA 3MTJA 1QDUA 2E55A 2FW9A 4U6QA 1ZLYA 4ZVVA 4AT1A 5M29A 2Z3VA 4BVBA 5BYBA 1GGFA 2FFQA 4HBGA 2FQYA 4TKVB 1ISGA 1JEEA 1PR4A 5A5VA 4UU0A 1O1YA 3ZWVA 1Q11A 3UK6A 4YV0A 1A8IA 5FWXB 1XB2A 3HY6A 1M6VA 2VTVA 3FWYA 3SZRA 3GARA 2C2BA 1HNNA 2JCBA 4QWWA 5KCMA 5IWCA 4IVQA 1Z4MA 3PYMA 5J5AA 1H94A 3PDUA 1U9CA 2ZTMA 4GOLD 1N1DA 2C5BA 2EJUA 3RYCA 1BS1A 4NH0A 1EFRA 2HUNA 1FA9A 2DR2A 1R6BX 1LBEA 1JDUA 3RKUA 4XB1A 3UMSA 1ECBA 3WIOA 3KOOA 1L4KA 4X1IA 5JEEA 3ESAA 3L0IB 4TQUS 2ZB8A 3FD8A 3OIUA 3CRNA 4NDAA 3NIBA 2XKAA 3WK4A 3F9RA 5K6TA 3O4RA 1FFYA 1O6ZA 1E20A 2AYXA 3KK0A 3OHPA 3CLTD 4LK2A 4UHKA 2OYCA 4B6EA 1YHZA 4PLPA 3DW1X 1V37A 3C6KA 4ZJZA 3ORSA 1IHYA 2FZGA 2I2XB 3QELB 2E37A 4E5DA 2X22A 1JGTA 2TS1A 1PU2A 5EPOA 2AKEA 3Q2KA 3GFGA 2IUTA 2QI9C 4P5EA 4UDNA 3ZCTA 4BQPA 4GMKA 4WY5A 5GJVC 5JMWA 2FLKA 3PEUA 2N9UA 3KQHA 1T5SA 4ON9A 3QY9A 2B8TA 1GR1A 2BKUA 4WA8A 1MAVA 1TVCA 3L82B 2YIMA 4RLSA 2OVFA 5ICEA 2DSTA 1ZC3A 1AK2A 2PUVA 3TUIC 3PX2A 4E30A 5JQGA 4A2QA 1A5SB 4YCAA 1Q57A 3SYLA 1FU4A 3JD4A 4M0CA 1DRUA 4UM9D 3PUHA 1CD5A 1HA3A 4PQRA 2C4WA 3PNQA 4JYBA 4JOQA 5KAPA 2LWIA 4KR2A 1WUYA 1ICEA 1ZUHA 1G7SA 1O58A 2G17A 3ADOA 1TIKA 3IULA 3G2JA 5BV2P 1QH9A 1XZQA 2WLSA 3JQBA 4O29A 1XZFA 3B5IA 4CKBA 4YRMA 4FR0A 1WP9A 1RXCA 2BFOA 2A7QA 3OF2A 1KTIA 3C7KA 3SOPA 2HU5A 2JGMA 3UATA 4P0QB 4YI3A 3T3NA 3BRCA 3CZ9A 3MG9A 1OTHA 1ODLA 1SVOA 1KXZA 3OPYI 1K75A 1TYEB 1F17A 3H2SA 3GDWA 2OV6A 4K7JA 4OJQA 2H0QA 3ZGVA 2AUMA 3FKSD 5HP4A 1M10A 2ZITA 3HFGA 3OE7D 3GRCA 3WADA 5JD4A 4MI1A 1Q2XA 1QFSA 3OJFA 4N6GA 5CT9A 1A2QA 4DCOA 3QEMA 1CRWG 1SD1A 4PNHA 3M8KA 4C4XA 3RFVA 1P5JA 1ZCZA 2HO4A 2IY9A 5E9WA 1JH8A 1HOTA 3PFGA 5LA6F 4BFXA 1GL7A 2Q3BA 3MNFA 1ZH0A 3PIRA 4GWLA 4HBZA 4MKXA 4D80A 2VJBA 1T9KA 5EKSA 1TUBA 3VHXB 1VJ5A 4PFKA 2QPTA 4H3HB 1M8PA 1YR6A 2E9SA 3DMTC 3NQ41 3PUIA 4FGZA 4YUZA 4G1MB 1CLEA 1N0UA 2JVKA 3CUEF 2UUBB 2VH2A 2VNHA 4Y8VA 4L9SA 3CW8X 2HEIA 3RTEA 2I34A 3UHOA 3WNBA 4RTPA 3DG9A 5HTKA 3E9QA 1DHTA 4JR2A 5MGBA 4WD3A 2XQVA 1I7SB 4ADSG 3NIDB 3P9RA 3ZUPA 5DX8A 2VYNA 4J75A 3AEKA 4TSFD 4W4TA 2CHFA 3WGJA 1IRIA 3GJ7A 4W63A 2ZATA 3FYTA 2R60A 4N7RA 3O38A 5K3SA 2IHNA 3PWTA 5EXTA 4F3RA 1S2MA 4BNFA 2Z5FA 2DFTA 4RHCA 2OB1A 2FPSA 3E9ZA 3GRPA 4Y9RA 4UCXA 4MYDA 3L6OO 1Z37A 1CBUA 1JG3A 3RU2A 5CITA 3NI2A 4LC0A 1WPXA 4M0UA 4QTTB 1FFHA 1T1EA 4MLZA 1GPDG 4ZMRA 3H9CA 2NTVA 4HK4A 3HGTA 4G8JA 4B74A 4F5EA 5KOJA 1XTJA 1YBVA 2YYYA 3I6MA 4FYYA 4KXQA 4ZFNA 1UEXC 1I3CA 2OC4A 1N3BA 2VRCA 2I3BA 5JAHA 3MUEA 3NYQA 4LOAA 4QUAA 2XECA 1JR3D 3CH7A 5HRUA 3I42A 1RC1A 3K0AB 1DLJA 4FIZA 5F52A 4CQMA 1FUUA 3PG5A 2V74B 4GE0A 5IYZF 4ENWA 3HTXA 3TOSA 3S2ZA 2FDCA 3NBQA 1R6UA 4L78A 2FSUA 1FFDA 2GHRA 3FZNA 3VYUB 3FHLA 3GP3A 3RADC 4M0LA 4ZMBA 3AUKA 1QNFA 2W4QA 5JD5A 3T7JA 3ZVNA 2V7VA 2J32A 3IR6A 1SC3A 2W6JD 4JQOA 4OQZA 3C41J 2R7MA 2VDUE 1HFJA 1GAEO 1PJ8A 4BZQA 3BWXA 4HPXB 1P7ZA 1JEAA 2Z57A 3Q8XB 1L4FA 3LCMA 4HQLA 1D2AA 1UJCA 1KVQA 1IN1A 1O8BA 4BNVA 3C8UA 1O95C 1QJCA 1SOVA 3HU5A 4UM8B 3V8MA 4B31A 5JYCA 4WX2B 3BQ9A 1P7PA 3A8TA 3EBOA 4H1TA 1GKUB 1QC5B 1CW2B 2XZDA 1C3VA 3HB0A 4TWJA 2WSLA 3HCCA 1V8FA 3HFRA 3K5WA 3CB4A 3L5KA 3OEHD 1IOLA 1QGED 4K8OA 4LXXA 2YZ7A 3GH3A 1HSZA 4B7UA 4PYKA 1NNI1 4PSAA 1QFZA 3SX2A 1IULA 1LRJA 3K73O 3COYA 3FYUC 4DT1B 2WUVA 4MR7A 4OK6A 5JSQA 4D8VA 3W06A 5JALA 4IO1A 1H2ZA 2WJGA 1ZC4A 3EISA 4JYMA 2Q7DA 2VEDA 4ZXPA 3S5JA 3TO5A 1QM5A 2C82A 1SUPA 4IIXA 4B4WA 3L4EA 2HIMA 3EYAA 4MVJA 4POAA 2GPWA 3TXYA 3AHCA 2Q8QA 4FHGA 4KQMA 1O95D 1EP9A 1HFKA 2D62A 4RY9A 1ADJA 1P1RA 3I45A 5FWAA 2DJIA 3A04A 3SYMA 4BGEA 2EAUA 1FSFA 2O52A 5NLLA 1JH9A 3JW8A 4MZXA 3F78A 5J23A 1E99A 2UXCB 1U3FA 3P2KA 3AV0B 4U63A 1W52X 2AZDA 4HS9A 3LPMA 3TRDA 1T4MA 2X14A 4G84A 2V1XA 1SXGA 4US1R 4HNAA 1LPBB 1Z8HA 3DFZA 3I34X 3AB7A 5EIOA 2XPCA 4BP3A 2DUMA 4GUAA 3RSQA 3LLUA 2QE7A 4HEHA 3AU9A 1QRTA 2PH3A 3TZBA 3NM6B 5EZ6B 2GI4A 3T9BA 4RPKA 4RPLA 2PL1A 1JG2A 3HWWA 3B1JA 3IIIA 1J8DA 3JQ9C 5E38A 3UV6A 1PFGA 5MDHA 4TYNA 2HKIA 2JHFA 3AI1A 1KDRA 1UBOS 4PS1A 2BZGA 5CT6A 4QIHA 1XZ8A 1I5OA 3GUYA 1RWVA 1N77A 4CIXA 5D86A 1RD4A 3WKEA 3ZZUA 4URZR 5AVTA 2RHOA 2Q2QA 4ITVA 3D8NA 2JJ2D 2IHTA 2Q28A 4ZDWA 3RSFA 4C7OA 2AYZA 2JIQA 3FM9A 2A0KA 4MULA 5FCDA 4ZVKA 3T38A 1K3TA 1TM7E 1M2HA 3KPYA 3Q11A 3VI3B 5I45A 2AN5A 4GX2A 3TGLA 4WCFA 1X13A 1YTLA 3MT9A 1NULA 2FSHA 1WRBA 1FDWA 3AFNA 1M2VB 1FDUA 1RHUA 3I62A 3OZWA 5E2AA 5KYWA 3U19A 5A4JA 1AKQA 2VPXA 4Z2AA 3KXIA 4D44A 1M2OB 1AQLA 3PDIB 3C8MA 2ZROA 4UMFA 3D7RA 4XIYA 3PTAA 1LK7A 3PB3A 1M73E 3E2MA 4BYGA 3RC3A 3ILSA 1Q50A 2O3UA 1A04A 2V7BA 3Q3CA 4EUNA 1RCTE 3L41A 2FPWA 3P2OA 5HKLA 2M1ZA 5I9TA 4DJ5X 1G6OA 1KZGB 3TQOA 4RTKA 9MHTA 3DOHA 3BERA 1ZS9A 3UICA 2R7NA 4KQFA 2B4AA 1P33A 1Z2DA 1E2HA 1KRHA 4LUCA 5B1EA 1MD9A 4CETA 3ZWXA 1KDTA 4JI7B 4ER6A 2PD4A 4TTSA 1WXQA 3O4JA 4Y6SA 2P6NA 4D9EA 2L0XA 1U8FO 1UPTA 3HI4A 1Q1NA 4RYLA 3EE6A 1CS0B 1NURA 1XUOA 4V39A 1XDGA 4KQJA 1R12A 1E4VA 1RW4A 1FYFA 1XQYA 1ODJA 5C53B 4J0DA 3FCEA 4UTOA 1S96A 1NJ2A 4PG4A 3UGQA 2GXSA 1NPYA 2PZKA 2G9UA 1Q44A 1UBTS 1IQ0A 3PXBA 4OVKA 3O9ZA 4B43A 1H2EA 1ORHA 1V25A 2SKDA 2YFKA 1B41A 2WJPA 3ZKWA 1G6Q1 4TXHA 1QHHB 4P31A 4Y6QA 1E3WA 4GM4A 1NDUA 2Y67A 1E3IA 5I5EA 1AQ6A 4URHA 2GD2A 1CJTC 5DHQA 1I3NA 5TS3A 1J1IA 5KJEA 3LT2A 2VPIA 1M34A 3WBJA 3UBTA 1S4QA 4CR6A 1TVEA 2QSJA 4NR0A 4MPRA 1FLVA 4MRNA 1TTQB 3ZQUA 4BQEA 3W1EA 4GYKA 1F2VA 3NWEA 3KQVA 2CLCX 4ALLA 4DSNA 1CR1A 4RO0A 3ZHZA 1DFHA 2A0UA 5FD8A 1FMJA 4P4SB 2C2XA 1V2HE 1SXIA 3K1TA 1JX6A 3CEAA 3C6YA 1E1NA 1JQAA 3IDZA 1E92A 4F2PA 2FX2A 4JEHA 4KYUA 2ZJ7A 2AZ4A 1MO2A 3HZZA 4LMPA 2WD9A 3QMMA 3BXHA 2WU4A 621PA 4C21A 3BB1A 3KJEA 2HA5A 3L1VA 4IWNA 4KNWA 4P86A 2WF6A 4PSCA 5D5HA 2OCDA 4Q4LA 2DQYA 1KFBB 2Q5FA 5CAEB 5ALGA 4RYDA 3MYYA 4Z9YA 3REOA 4DVJA 2D1QA 5G4KB 3LC2O 4X95A 2F3TA 2XYHA 5DN9A 4AKTA 5AUNB 1H1LB 3DE5X 3AGPA 3LYUA 5LU9A 1SCJA 5LQRA 3ABSB 4GL2A 2GUWA 1OLSB 2IU3A 3H1EA 4HH0A 2G25A 3OKFA 3LX5A 2IEDA 1CQXA 4KMOA 5F21A 2AI1A 2JIPA 1KNXA 4B83A 3CB2A 2X0IA 1WA5A 1N0WA 4IILA 2YBEA 2HA6A 4MK4A 5TIIA 1ACMA 1IM5A 4ZD6A 4MB2A 5L53A 4D02A 4DADA 1T1IA 1WEKA 2D59A 5KKNB 2ONKA 3IAHA 2C9CA 2ZIAA 3MJ4A 4HB4A 3LPCA 2R6CA 1KMIY 2J7PD 3LT1A 2XCQA 3QTLA 3RB8A 2H5IA 1LSUA 1KI1A 1VYVA 2ZVDA 3DDHA 4HEA6 4KLAA 4UVGA 2PGAA 3BKXA 3GLIE 3T06B 1S7GA 9GPBA 1Y8QA 4BJHB 2R8ZA 1R0XA 4FDLA 4C06A 1RPAA 2I2BA 3HO1A 3U17A 2P2CA 3IILA 4RNCA 4AO6A 3JQQA 4DV4B 1MX5A 5H5JA 1RQ2A 3I0NA 3DLHA 3JZDA 2P9YA 3IEMA 2AN3A 4QPJC 1XDDA 3IHWA 3IKJA 1NRXA 3RF7A 5LYYA 1J2UA 3KE8A 1OT3A 13PKA 4JL6A 3CURA 2V0NA 1RADA 1XCJA 1S2GA 4KIWA 3N2GB 5I7WA 1U0HC 4J0JA 3LUGA 4F97A 1NQTA 4AXBA 1OXSC 1KBZA 3OLVA 5EMNA 5CTJA 4UATA 1NY6A 4HLNA 1VOTA 1EU1A 3X2FA 1NF2A 1RXUA 2C5GA 1UQTA 2ZUEA 3CVOA 1H4QA 2CYAA 2VTEA 3QKSA 1BXZA 4UFOA 4AWXA 2GPYA 4GMFA 1D2HA 2O0JA 5C2JB 4JP5A 1HDXA 5EP1A 1XELA 2EQ5A 4AK9A 2C58A 4C2AA 2Y1OA 3OLCX 5DEIA 3HYNA 3VXKA 5AHOA 1L5NA 4XA8A 5LWHA 4ENSA 2G3YA 2A9RA 3JALA 3EZ9A 5AHWA 2EFDB 1WHSA 1AV6A 2FX3A 1FB5A 1KA9H 5BPFA 3V5NA 3DE3X 3EOBI 2LNDA 5JCJA 2VZ8A 4IGKA 2VUHB 4RA9A 3QNMA 2C3UA 1NJ1A 1EFDN 4ALKA 3IESA 1F38A 4Q37A 3TRKA 1DP4A 4I6JA 5LQSA 1RE1A 1KEUA 1R27A 1GGHA 2QRUA 1GM5A 1AGRA 1CUDA 4ENUA 4OTZA 4IY1A 4DB4A 2NNWB 5DTJA 3BL5A 4NBKA 4F84A 1VZ3A 3GPDG 4JZYA 4J3JA 3GAZA 3PGA1 4K8RB 2P6RA 2VSYA 1FP7A 1X70A 5AM1A 2V4UA 3GOHA 4H1UA 3OP4A 4HWTA 3S68A 4E03A 2JFXA 1XO1A 5AOAA 2GK7A 2PZEA 4OBBA 2EW8A 4JBYA 4JP3A 4M1TA 1UIRA 4JLKA 3RLFA 3SJCA 4PM4A 1ZA1A 4BKUA 5KJ1A 1W75A 2WMYA 3SR4A 2SKEA 1A72A 1PSWA 1UBSB 1PJSA 2V4ZA 1VG9B 2AHOA 2DWPA 1L8OA 4JOCA 1P18A 1RJDA 3PZRA 5ALWA 3AINA 1P80A 4M76B 3T99A 2MCFA 1XZKA 3C8HA 1D2RA 5HJ5A 2FK8A 1Y37A 4BKQA 3D4BA 4UU1A 2BY4A 3G7SA 3KU1A 3R5TA 3HCRA 2O8CB 2F1KA 2XR1A 3I9KA 1JVBA 3T41A 1N5RA 4UQOA 4QHYA 4JV5B 4Q01A 5E4FA 3HN2A 5AM5A 2X19A 1RTTA 2ZT7A 3M6XA 3WQHA 4C3OB 2C29D 2B69A 2Y1WA 2OK8A 1G8GA 4R0MA 1JMYA 4L2IB 3SYKA 3TDKA 4DWOA 2QRMA 3VMFA 4H0FA 4ZA2A 2QTHA 3WGZA 5K0TA 4EHLA 4K40A 1SBYA 5G02A 5BWCA 3R74A 1HYGA 2K6GA 1JFFA 4CTNA 4ARAA 3S1LA 1EX1A 3HJHA 4Q3NA 2H4YA 3BXEA 4JLAA 4TMZA 4R2XA 2GPSA 4RMIA 5BSEA 1L8XA 4B3DA 4A6PA 4GKKB 4UZEA 3NIGB 4NG4A 3VPAA 3THRA 4RTQA 4B4DA 4WN9B 3ICCA 1SELA 3NIFB 4OEHA 3QVSA 4M37A 4G5QA 4P4GA 4NPHA 4PYQA 1TLFA 1KY4A 3TOXA 2PA3A 4M49A 4OHKA 5IX8A 3COVA 4YP9A 2IYXA 4Q02A 1D0IA 2ZYWX 1GTRA 4RCVA 1O03A 3IA7A 2ZJ6A 4EY5A 2C95A 2QZPA 1IUPA 3ROEA 1D2EA 1G8YA 1NI3A 3P9NA 1GQFA 4KVGA 1UC9A 1Y9EA 4P35A 3QP9A 2BKLA 1YVPA 4PPGA 1TZKA 2YFQA 2VZ0A 2X9QA 2AEMA 1TF2A 4AJLA 3D3KA 5EKXA 3MELA 1ARZA 3ELUA 2YY7A 4EOGA 3ZJUA 4Y9TA 4BO9A 3ZW9A 1DADA 5IBRA 1ISJA 2NAPA 2HV8A 2AC2A 4H31A 4ZZ2A 1H4TA 2OZPA 1XQVA 2WWHA 4Q7LA 3KRTA 5CA1F 3EMKA 4DLTA 1HRKA 2QD3A 1OKKA 4WBNF 2IH5A 5TEWA 3WFJA 3AEXA 1Y1RA 5AR1A 1E66A 2JASA 4X85A 5CCEA 3TSOA 5AKYA 1UBKS 1ECCA 4L4SA 3RRMA 4Y2UA 1B6TA 4FS3A 4NJOA 5AM0A 3AY7A 3JY6A 1L4EA 3ZCSA 5HXAA 2XB2A 3K9FC 4M1OA 3CEHA 1Y9AA 3L43A 4S35A 2OPHA 1I6WA 3U3ZA 2INGX 1Z74A 1P5FA 2YTZA 4HLQB 2ODEA 4PIVA 5JD3A 1ODSA 3B6JA 4LMAA 4H59A 2BGLA 1T2VA 1SG0A 3ZCXA 1PFQA 2R6FA 1S89A 1LFDB 5A2GA 3LY9A 4YLEA 4M8KA 1QIJA 3OURA 3PE6A 3LQYA 3RRBA 3O21A 4FJ0A 1Y81A 5HUJA 1DAMA 1PR1A 4J6FA 3RKRA 1TC1A 1KORA 4G5XA 3I2JA 4MUFA 2FVYA 5JO9A 1RRPA 2YZMA 2A33A 1WPQA 3HY3A 1J0XO 2HRDA 3VTZA 1G2QA 2FGJA 1NBMA 1I0LA 4ZARA 1ZI9A 4URFA 3L49A 1Y3AA 1GG5A 4GSKA 1TAHA 3CC8A 1LTHR 3HUDA 1I9GA 3Q7EA 1Z5PA 4QXOA 1KAQA 1C1XB 3PGKA 2XDQB 1K9SA 3VUFA 3HXQA 3PF9A 5B7PA 4MCHA 1LV8A 5EMMA 4OI1A 1WU7A 5IJAA 4KMSA 4HLUA 4XEUA 3LDGA 5FPQA 3CNEA 1A9TA 3KLOA 4H16A 1N6LA 1YV9A 1TYAE 4P36A 4EB3A 5DGIA 5YASA 2BZ1A 2ID7A 4D9HA 1T9HA 1YL5A 2CL0X 2XNHA 4XW2A 2MWMA 3WI7A 2ZE6A 3U2QA 3EY4A 4ILKA 3CUWA 1EK2A 3QGMA 1RYEA 2DFKB 5JJIA 4LYAA 8MHTA 2HJWA 4B6SA 4NDZA 1H66A 4BO8A 1BMFA 4GBJA 4CI0B 4E33A 2CL7X 1T43A 4FC6A 5IC4A 4AUNA 1G16A 1QCDA 1ADCA 1XALA 1ENPA 2F43A 2R25B 3H8WA 3MS4A 1UIMA 4TWRA 4NLLA 3S1SA 1E58A 1QU3A 4HDRA 3IHTA 2ZIEA 4FX5A 1G7TA 4XQEA 2OA0A 3L7YA 3BF8A 3VPGA 4LWQA 4D4GA 2AI3A 1NSTA 2GN0A 2H52A 2PL9A 5K8IA 3AR9A 4X8MA 3K9CA 1UOQA 3PHHA 4BBPA 4B7AA 4CF3A 2JIBA 1RPJA 1RWNA 2BMAA 3HFSA 1NX9A 2V5VA 1SBCA 3IURA 1BFUA 5HILA 4MDEA 3MJCA 2JEOA 2ENUA 4RHTA 2WNSA 2WNHA 4DLPA 3RSSA 3K70C 3CH6A 4HX9A 5T64A 3OZEA 1YE5A 1Z6YA 2NUTB 3L0DA 4HUTA 3ZD7A 3NEYA 1Y4ZA 4G5HA 4MQ4A 2ZWMA 3O1JC 2QD4A 4F46A 3EZ6A 5JXGA 2Z2YA 1J56A 1VGVA 2VDQB 4F8JA 3OFKA 2WV9A 3I12A 4RH0A 5AW1A 3V55A 2H5JA 1H93A 1NP6A 3K8QA 6REQB 1OUMA 2PWAA 4LNHA 3RABA 3ZX4A 5G0SA 3TTTA 1D1TA 1Q16A 4N65A 1W0KA 5E7QA 1Y89A 3KYIB 5DEOA 2OGSA 4BUJA 2B1GA 4DHWA 3HY4A 3VR4D 3ZWNA 4AQDA 4QUKA 3HJCA 3QMPA 4FT2A 1Z15A 1JHYA 3M49A 1SEVA 2D54A 4H7KA 3O8QB 4XGRA 3BMQA 4Y9UA 1WB6A 5JH7A 1DX9A 3ZHQA 5JV5A 4W6QA 5EN4A 2PWZA 1A5ZA 3GVXA 1KYIA 1W4AA 3EWNA 1EBUA 3DGEC 5HUHA 2R5FA 1KTVA 4FFVA 4RVGA 2I55A 4OYHA 3TQFA 3IALA 3Q4GA 1BIFA 1OR8A 1A5TA 4FFWA 4QFCA 3DW3X 3RTCA 1A95A 3R8CA 4AMYA 4JU8A 3VH2A 1EP2B 4FFDA 2QMOA 4CM4B 3DOOA 3ZJTA 1MT3A 3E18A 5JLAA 4IQGA 1DJOA 2Q1UA 5HKOA 2Z2ZA 3I2IA 1GZ6A 3GWGA 3LKVA 4KQXA 1QHGA 1Z29A 2BFBB 3BCRA 4BRSA 1QAMA 2HDNB 4OO3A 5KYGA 2X2FA 4U7DA 2NYRA 3F49S 2CE7A 3AVOA 4LNAA 5ARDA 2YHAA 4E3WA 4FDMA 2YWBA 4I4IA 4XWYA 2GYYA 3HKBB 4DKJA 1P6QA 1IOWA 1NXVA 1B6RA 1BW9A 1VB3A 1WHTB 3N6RA 4DF3A 8LDHA 2JPDA 1P77A 3AP3A 2FMXA 1OTYA 3LO5A 3T34A 3E1GA 4DR5B 1ZO8A 2DMRA 2QX6A 4FKMA 3UTCA 1ML4A 1J33A 1GZ5A 3JAMA 3UOAB 4EDFA 2P4QA 4I4CA 4EJ6A 2XVYA 4F6CA 1UC5B 3UFXB 1YHNA 2DHCA 3HEBA 4CFZA 5F78A 4JENA 2V7QD 2CUTA 4FFPA 1AOXA 3OZAA 3P19A 1N9GA 1YBFA 3EXHC 1X0VA 3G68A 3L0BA 4DJFC 3EMDA 5K0JA 3ZY4A 2F3UA 5FPPA 1X80B 1SA0B 1TB4A 1JG1A 3ZY3A 3ZKAA 3U4CA 3HH8A 1FFXB 5HVNA 5K01A 1ICIA 4A16A 2I80A 3BB3A 3JV7A 2SCUA 1PJBA 4NYJR 4TUYB 1RLTA 4LQ4A 4AN1A 4KPUB 1XP5A 2XAUA 3CJQA 1P0CA 4FR2A 3VR4H 5BWMA 1AGYA 2Q8PA 3HJBA 3MIZA 3BB4A 4FMCF 2H16A 2P0YA 3SC4A 3ZV4A 1N8KA 4D6PA 2PXAA 3E6AA 5KWSA 2E4UA 2IYFA 3KQWA 1SKQA 4EZEA 5HM8A 1OWOA 4F3TA 3RJ5A 3TOCA 1LI5A 3EHDA 2QVGA 1IZYA 1TQDA 1UKEA 1SU4A 3DAHA 3QPCA 4B09A 5HK9A 5HKKD 4LMBA 2IPLA 3HP1A 2OBNA 5EHZA 3AF2A 1L7VC 2P2ZA 3NAMA 1T9GS 1I51A 1RQPA 2XMDA 3LJKA 5JXJA 5LCXA 1R6AA 4C03A 1QV6A 4ENRA 5AJUA 3FBTA 3SNHA 3IOMA 5TDHA 3BEOA 4BQRA 1WCYA 3ZBTA 4C0BA 3E8SA 1XF1A 3O9VA 2CHEA 1GUDA 4KE8A 4LV6A 4LTDA 5EIHA 1E94E 1G3IA 1JT2A 5JAUA 2BI8A 5F5XA 3U4QB 3IPAA 4PO8A 1H85A 4JC4A 3JWEA 4XUEA 3TOZA 4IVNA 2RD2A 5FBWB 1II8A 4I19A 2YXEA 2ZTLA 3DEIA 3G82C 4NG5A 4BCBA 2HLDA 1JJFA 3A1DA 2X5JO 5IXSA 4GQIA 1L5VA 4CQJA 3Q3EA 4UNNA 2QAGB 5DO9A 1LFAA 3HR7A 4RKWA 3B7WA 3EPRA 3IX7A 3PWSA 3NKVA 4FKZA 4BX0A 1N2CA 4DYDA 2P3LA 2IVFA 2QMYA 2OD7A 5IRCD 2ATEA 4RK5A 1FFBA 2A0YA 1R0CA 4HDMB 4WMLA 3ZZMA 3GGJA 5BSHA 2FZWA 1KC1A 3GZTB 2GCEA 1Z4QA 1T6BY 2D1RA 3NHLA 3EH1A 4FINA 3PXUA 1BKYA 4GVXA 3EFHA 1CDDA 5THXA 3RGGA 2PZGA 3PR3A 2REQA 1ZNWA 3KQKA 3R9XB 3MTQA 1Z0IA 4BVAA 4HDOB 2P5TB 3IELA 2HA4A 4M0EA 1GIAA 1RM3A 2UYYA 4NENB 4I8DA 3UH0A 1H22A 5TQ0B 4XCQA 1W88B 1RHQA 1UKCA 3WA7A 3UA4A 3NG1A 4JXJA 3SLKA 1ZRNA 4GD3Q 5JPCA 5KCZA 5CIYA 3PK0A 2QROA 1OX5A 4GVLA 4NATA 5BVHB 1E5LA 2EQAA 8ATCA 1U9JA 3HWSA 2WMDA 1F6DA 2RHDA 2ZJFA 3M3DA 3K4PA 3KB1A 3TR5A 3Q8WA 1YKGA 3PX7A 3GBSA 4A2WA 4A36A 2F9MA 4PGHA 3ZHUA 4P3OA 1LDYA 1UZMA 1KAEA 1ZMBA 1A97A 4DMMA 1DG9A 4FE4A 4MA4A 1EWVA 4B2YA 4RTJA 1JSCA 2ZB3A 4G3XA 4IG9A 4LYJA 4Z9FA 4HB3A 5JZ9A 2JLWA 1JHUA 1DC6A 2NO7A 4NJEA 5C7YA 4A6EA 3B48A 5EKUA 5SYNA 4CEIB 1DRWA 2XSZA 4HGPA 3SQDA 2JGDB 4AWAA 3PYLA 3OIWA 1LZLA 1T2AA 4W8HA 2WFMA 4ASUA 4C4ZA 4XOUA 1K3FA 5BR8B 3NDIA 3RBAA 3P94A 3WKBA 1U2SA 4BOYA 1DUVG 1CJCA 3JZAA 4RSGA 4WOKA 2ZI7A 4MUJA 2RJNA 2EJWA 1Z0ZA 2ETXA 3HPRA 4BMNA 1NATA 4BE7B 2Y0CA 4NABA 5CA0F 2Y0BA 3EXIA 3MOIA 3Q7PA 3R7DA 5HIAA 5CDUA 2RKOA 3LLVA 4ER7A 1IPHA 4ZT6A 2ZDQA 1CG6A 2ZB4A 2FNAA 3PPYA 2X58A 2P91A 2VLIA 1J1UA 2OHJA 1HLPA 1CEEA 4J76A 3G17A 4K6FA 3PVSA 4RVHA 3RRFA 3V6MA 2B4YA 5KYXA 3HJGA 4E6PA 4PSDA 5EMLA 1TLLA 2VJKA 1KMHB 1JPUA 2FWIA 4X1KB 4E1AA 4ARUA 2FDXA 1MORA 4EDHA 1FE8A 2C92A 3FWHA 1HDGO 3A4NA 3CFYA 4NK4A 4BO0A 2DHDA 5EE3A 1QH1A 3K6SB 2IZ1A 3A10A 2OLJA 1AE1A 1U8CB 2PMCA 2ZSJA 3I2YX 4HF7A 4JVNA 4M0MA 4OREX 4PC6A 4ZDKA 2JFHA 1P6UA 3F8WA 3QLUC 2UUOA 2FMHA 2A86A 1UXHA 1C3LA 1VG1A 2PAAA 1SCNE 3A25A 3JYLA 4IQ4A 3K09A 3ZWQA 3AYZB 3NRCA 5AVQA 1TOAA 2ATCA 5KYYA 2YJGA 5A7FA 3NB0A 3LPAA 1DNPA 1ND6A 1GTG1 3JRWA 3LPNA 2HA2A 2DQZA 4IP0A 3RS2A 1Q0PA 3Q8KA 1A8PA 2BFCA 3I2GA 521PA 2X9NA 3HA5A 3WOVA 5DTRA 1ZN9A 4XSVA 1GPWB 3NVDA 2VPPA 2W4IA 2ODWA 3JQEA 2AYYA 5K0LA 1XVIA 4EB6A 1NXSA 2I6QA 4JB2A 1LDBA 1ORDA 4KI7A 3RS9A 2VDVE 1G5TA 2Y1KA 3I8SA 1NW5A 4OX9B 3T1VA 2PZAA 5ALSA 4S1OA 4KOEC 5BUSA 3NP9A 1RZRA 4JY7A 3Q2IA 2REXB 2HRQA 1I8TA 4NECA 1HOXA 5BMVA 2H9YA 2NVWA 3JQRA 5BN5A 3R20A 4AJEA 2PRZA 2VNKA 2RHJA 4L51A 3WRWA 3E7WA 3L6RA 5BYAA 2H4WA 2E4AA 1BZYA 2X1HA 4OK3A 4ZHQF 1XA3A 3KEOA 2J09A 2PE5A 2WFLB 4YP0A 1J23A 5B64A 4N5MA 2JH3A 1K2WA 1K7YA 4JMLA 3K0FB 1OXVA 2IKQA 4MRPA 1G4UR 4P5PA 4DMUB 4CMBA 2JKVA 3CPJB 4H7FA 4QULA 4RM2A 1YC5A 4PZDA 4OQ4A 4AYXA 3P4XA 4EYOA 5KWVA 1SHZA 2FW0A 4Q3KA 1KU0A 1VI2A 1VGRA 3EFBA 3NH6A 5C7IO 2I22A 3CWQA 4KAJA 3TQSA 3AM3A 1WQ4A 3EODA 4OOEA 2PGLA 3SFZA 3JQPA 1O9GA 2D2EA 5JSKA 3IAS6 4GLFA 4FB5A 4EPRA 1YJAA 5TB5A 3FAKA 3T3IA 3HP7A 4LRXA 1XE3A 3QMVA 2PYDA 3AT1A 2AC4A 1QGYA 3ZPXA 2QTTA 5EIBC 4LPKA 4AZ0B 2GJ9A 5AUQA 2O8FB 3AJDA 3NEAA 1DKPA 4UARA 3UJ8A 4QVGA 4WNAB 3ZDXB 1UEJA 1RJWA 2A9QA 3GVPA 2A84A 2W0MA 2OXRA 3ZLVA 5E6RA 2ZXUA 4MV5A 4O4LF 2A5YB 3A2LA 3A58B 3I0ZA 3AF1A 2H5EA 2VAXA 4GNKA 4EHAA 1WMSA 4E4RA 1TPZA 1AG9A 2GCOB 3T7TA 4CV3A 1QZXA 1FP2A 1ABEA 4WJZA 3RWOA 3ERCA 2WIBA 3IO5A 5HIMA 1Z2EA 5CDSA 1T0UA 4EG1A 4R2LA 5C7OO 5CGQB 5K4HA 4AI6A 2PSHA 5EWLB 5EWJA 5B4UA 4UD6A 3D3NA 4MGZR 2XF8A 4AS3A 4DJTA 2C5HA 5C81A 1XZNA 4ZO6A 4GMHA 3V42A 1J21A 1E0AA 1LBIA 2OYSA 1FDRA 1QF9A 4R6WA 3E1KA 2B30A 3PP8A 5B3AA 5FWNA 5JDCA 5TMPA 1E6MA 4AG5A 4YVFA 1XZBA 2G76A 1JSZA 1E79D 2Z83A 1P9NA 3AI3A 1M6HA 3QUCA 1C3JA 3JQAA 2G1JA 3BILA 5CB4F 2EIHA 3UMGA 4DCNA 4HO1X 3QOWA 4WIAA 3LXXA 2A8YA 2NSYA 2K7FA 3DE1X 1K3UB 5AI4A 1CJMA 1G0NA 3TEJA 4AU1A 3ELWA 2DTDA 1A8UA 3HKCA 4G2TA 2JANA 3RS7A 1NJ6A 1CE8B 1Q22A 2OZKA 3Q40A 3F98A 4FEEA 4E5YA 5I9IA 3EC2A 3C4QA 4OQQA 2IYQA 3VNBA 1GJRA 3WICA 4AJJA 1YB1A 4QG3A 1EG2A 1G5PA 1TAQA 3HK2A 3GEGA 3NHWA 3QVOA 3PGJA 4RD3A 3V4LA 3ORFA 4PEVA 3HVHA 4NZ9A 1KJNA 4LJYA 3CUTA 4COOA 1Y8RB 1OD6A 2HLNA 1AN9A 2H2DA 2UYOA 4PZ0A 4NMWA 4DQXA 2EC5A 4DSZA 2C77A 4AL4A 2WB4A 5IJWA 4OKNA 2JGKA 3ZDFA 1ONBA 4U39A 2H17A 2QT0A 5JCOA 3VGPA 1ENZA 1J97A 3DONA 3ETDA 4WLEA 4EELA 2I62A 4YUXA 5BSFA 5DBIA 1CF4A 4K9QA 2PLAA 1S1CA 3PNBA 3N2YA 1PW5A 3NV7A 2GN1A 3TINA 4J1QA 1R4NB 2XD9A 3EIXA 2FSIA 2L19A 3KFXA 4MW4A 9ABPA 5CLQA 3DUFB 4RACA 1INLA 4MS1B 1IAQA 1T6YA 4RTRA 3M9XA 3NNSA 1IH8A 4EX7A 3AF4A 5AUOB 5LQCA 5LP6B 2R6HA 1P3JA 1H8EA 2GRAA 2AX3A 4ISCA 3TTYA 4BJ1A 1P1CA 2UXBB 1R10A 1PTJA 1IY9A 4COKA 1F6WA 3NPAA 4KMRA 1C2YA 4U7GA 1WPGA 3QF4A 5DNEA 4MJLA 1PR5A 1L4LA 1LQTA 4DQVA 1KERA 3BRWD 1IIBA 1PSDA 1ZJJA 3KJQA 4BECA 4TZ0A 2CNNA 3JQFC 4KXXA 1UK7A 4D81A 1TQ2A 1FPMA 1YA4A 2HY7A 3G6KA 3SDZA 3TS1A 4FGUA 3FFXA 3WGOA 4CM9A 4OQYA 1ZRMA 4LF5B 4LF7B 2G7MC 1QBGA 3H8SA 3GK3A 2OP1A 4JL5A 1E60A 5A05A 1KAOA 4UU8A 4Z9XA 4I6GA 2H9AA 3HVIA 4CWAA 4O4JB 3DAFA 3A4TA 3SHQA 1RYDA 2NWQA 3ANMA 4JWKA 5C8YA 1CY2A 1EVEA 4L7QA 2JA2A 3FOCA 5F2KA 2HMAA 5KTNA 1UBJS 4D74A 3T9FA 1Z38A 1YZ3A 2GNAA 3MINB 3HHPA 3FNEA 1S0UA 2YW2A 3HMKA 3UCXA 2UYCA 2VVTA 2O19A 3UJ3X 2H7XA 5EXXA 5B37A 5KAMA 3KKOA 1AZTA 1UPXA 4C3ZA 3GHHA 4UJ5A 4EBFA 1ZONA 4EL5A 3QVTA 5KMGB 3L6BA 4TTTS 3VO8A 2XXAB 2XYRA 4CR8A 4CUZA 3I28A 1DJPA 2W6CX 3AC0A 4QOIA 5GONA 4DGQA 5AW2A 1AHNA 2HSJA 4JCCA 4EYGA 1YB2A 4CUKA 1XMXA 1U3UA 1M8KA 1U6IA 3U7FB 4ETMA 1KYXA 2OZLB 3RJTA 1I32A 4TWZA 2VHQA 1QWOA 1MH9A 1U6JA 1WSAA 3PV0A 1RKQA 3O4FA 4V2UA 5FRDA 1D4ZA 3QKWA 3A2MA 3GPIA 3WNDA 1K7XB 1GUFA 5JASA 3ESBA 3TF5A 3UK2A 4D9JA 3H8VA 1XD9A 3AEUB 3IQWA 3R5HA 4G1FA 3FBWA 4OBWA 5D51S 5IKPA 1NVDA 1SBNE 1U1IA 1KJ8A 5H7XA 2AJDA 3ZHRA 1PT5A 3HSKA 2A0XA 3G13A 5GTDA 2J5BA 2WWFA 3W04A 2JJYA 1GRNA 2Q5IA 4C43A 4A1OA 1POXA 1WMDA 2SKCA 1VRVA 2PD6A 1QIDA 3H5AA 3OQHA 2VNSA 5BPHA 3ZBPA 1GQYA 2VDOB 3PFCA 4MRMB 3P9QA 3ZV5A 2OHIA 3C5VA 4IAOA 4RJKA 2BEUB 3KYDB 4F93B 1RP1A 3PC7A 1YZVA 1V5WA 1ZJ6A 2OHVA 1CP2A 2AG6A 4BKOA 1CJBA 2WICA 3BTSA 3CX4A 2V54A 1RWOA 2AN4A 3OVMA 2YICA 4J4HA 2AV6A 2VK4A 3BBLA 4LF8B 5EKTA 2IXDA 2HSWA 1KQOA 2ZOSA 4KH1A 2RHBA 4OXYA 1N6IA 2CMDA 1E5DA 4J0KA 5T57A 1OZHA 1ZH2A 1VHQA 4NH4A 1DI0A 4DIMA 1HYQA 2H6EA 4FXPA 1OREA 2VI5A 1K6MA 1N5LA 1PV1A 1YQQA 2YY6A 1MO3A 1KO4A 3EBPA 1WL8A 1TCCA 2HK6A 4LVUA 5CGZA 3V4ZA 3VM6A 4XGQA 4YRBA 3PQCA 2VXYA 1UFKA 4HEQA 3IUMA 2JIMA 2H54A 4H15A 5AOCA 2X9GA 4YJ2B 4FTWA 3SXUA 1PZNA 2OORA 2WSMA 3IV7A 2IL1A 3F47A 4HMPA 1WZCA 3R3JA 3WO1A 4DLKA 1G41A 1U28C 2ZWOA 4KPFC 3STXA 3HDQA 2JVIA 1T36A 4RV5A 5DN6D 1JJAA 1YJXA 3NONA 4F5ZA 4P82A 1NUPA 3MVEA 3M6VA 2YQ5A 3DL4A 4G1BA 5JG7A 4KIGA 1XD8A 4MUMA 3W6PA 5ILOA 3IEXA 2Y9MB 3CCCA 3SZGA 3R09A 3WZLA 1JU9A 2IYPA 2QVYX 3EDMA 1JXAA 3L4BA 1XAGA 3Q9NA 4FXOA 4QD3A 4YIKA 1XXHE 1VCHA 4R2HA 3W6OA 2IFTA 1GCUA 3EHEA 3G85A 2XXBA 1UDAA 3P27A 3SDSA 1SUBA 2W2LA 3T7RA 5EHIA 5KC9A 1M67A 3N0WA 4DSUA 2QDXA 1RP7A 1KSHA 1UK8A 1NVFA 1W29A 3ETJA 3FGOA 4YO8A 3UJ9A 5AMXA 1AKRA 3C3WA