2XGGA

Structure of toxoplasma gondii micronemal protein 2 a_i domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
147
Chain Sequence
b'GTNQLDICFLIDSSGSIGIQNFRLVKQFLHTFLMVLPIGPEEVNNAVVTYSTDVHLQWDLQSPNAVDKQLAAHAVLDMPYKKGSTNTSDGLKACKQILFTGSRPGREHVPKLVIGMTDGESDSDFRTVRAAKEIRELGGIVTVLAVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICRONEME PROTEIN 2
publication title Structure of the Micronemal Protein 2 (Mic2) A/I Domain from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Hydrolase
total genus 52
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2010-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2xggA00
4MMZB 4WK2B 4C29A 1JEYA 1CK4A 5KYUA 4HQNA 5KYXB 3K6SA 1M2VA 5HDBB 5E6RB 1M1UA 3BQNB 3ZDYB 1CQPA 1ATZA 2IUEA 1AUQA 2B2XA 2M32A 4MMYB 4UM8B 1N3YA 1U8CB 3EOBI 1JEYB 1IDN1 3EH2A 4FX5A 5KYWA 4A0QA 1NA5A 1V7PC 3ZQKA 3TVYA 2VDMB 3F74A 1Q0PA 1UEXC 3NIDB 1BHO1 1T0PA 4C2BA 3ZE0B 3EH1A 4F1JA 1MQ8B 3FCSB 1PCXA 1SQ0A 1AO3A 5E6RA 2ICAA 2VDOB 1TYEB 1JEQA 4IGIA 5HGJA 1RS0A 3PPWA 1FE8A 2VDNB 1ZONA 4M76B 1IJBA 4HQOA 4XW2A 2NUTA 1MQ9A 4JDUA 1RTKA 5BV8A 2I6SA 1JEQB 1AOXA 4UM9D 4WK4B 5E6UA 3PPXA 1N9ZA 2XWBF 1M2OA 5E6SB 3N2NA 4NEHB 3BN3A 1BHQ1 2NUTB 2ADFA 4DMUB 1FNSA 4CNBA 4WJKB 5E6UB 4F1KA 5LN1A 3EGDB 3RAGA 1U0NA 4O02B 4CN8A 1OAKA 1U0OC 3V4VB 4PN7A 1QCYA 1SHTX 1ZOOA 3Q3GE 3EOAI 4IXDA 3ZDXB 1PD1A 2XGGA 2WW8A 5KYYA 1XDDA 5E6SA 1XDGA 4NENB 3E2MA 2I91A 2NVOA 3IJEB 3TXAA 3EG9B 2VDPB 2VDRB 2XWJI 1PD0A 3VI3B 3HI6A 1RRKA 1MJNA 3EGDA 1ZOPA 2VDQB 3EFOB 5KYYB 3BQMB 1MF7A 3EGXB 4Z7NB 1QC5B 1SHUX 3ZE1B 4HQFA 3GXBA 1M10A 1MHPA 5HJ2A 2ODPA 1DGQA 1JLMA 3T3MB 4CN9A 3VI4B 2VDKB 1MQAA 4NENA 3FCUB 4G1EB 4WFQA 3K72B 3EG9A 1PT6A 2O7NA 2VDLB 1RD4A 3PPVA 1LFAA 2X5NA 3EFOA 2ODQA 1YVRA 1T6BY 2QTVA 4UM9B 3EGXA 4C2AA 3IBSA 5KYUB 1QC5A 3T3PB 3K6SB 1M2VB 2WINI 3TCXB 3HXOA 3ZDZB 2NUPA 3M6FA 3K71B 1IJKA 4Z7OB 2VC2B 3NIGB 3NIFB 5ES4B 3PPYA 1M1XB 3QA3E 4HQLA 3ZE2B 5KYWB 3HXQA 3V4PB 3TW0A 4WK0B 1DZIA 1L5GB 2NUPB 4Z7QB 1XUOA 1JV2B 4MMXB 5KYXA 1YVPA 4IHKA 1IDOA 5KYNA 3F78A 4G1MB 4BJ3A 4HQKA 2I6QA
chains in the Genus database with same CATH superfamily
3Q7TA 1S4MA 5TQVA 1IUPA 4QG3A 1RXYA 2CNLA 4ANFA 2DYKA 2VHCA 3LY7A 1C9DB 3OIYA 1NYTA 3I05A 4EW3A 2MMCA 4KZPA 3UA3A 1X7WA 2JEZA 4C4TA 3FNFA 4ED9A 2WWIA 2ZULA 5LQCA 4JVOA 3EXG1 1W0JA 2C3YA 3VO9A 5DBIA 1UP4A 3HLYA 1OLSA 3VMFA 4GT1A 3PZRA 4J2OA 2B69A 2XMZA 3PGKA 3KJNA 2MSKA 2XUPA 3GBVA 4V0QA 1DXQA 4G0UA 3VFDA 1UBFA 4YRKA 2QROA 1ZQ9A 3E6AA 2WFZA 1CUDA 2UUPA 3CNNA 3EASA 3PHCA 4YRQA 4XOUA 5AVSA 3N1UA 3P71T 1G66A 4M1OA 3STXA 7REQA 5EAIA 1JHPA 1TCVA 3ZQ6A 4OG2A 2O1WA 4JC0A 3BIOA 1GKUB 4Z0PA 3FSJX 2ZSJA 4ZT3A 1ZZGA 3D2BA 4YALA 4P0PB 2NUTA 3MWGA 4GVLA 4AIRA 4CIBA 2P4UA 1GILA 3BVPA 4ARBA 5IZCC 3GA5A 3CMMA 1FLDA 3FOCA 3QLEA 2CV1A 621PA 3FPAA 3KRTA 3KZMA 4OXIA 4RW0A 5DGCA 2YJNA 4LY0A 2XIQA 3U81A 2I2DA 2SCUB 1TYCA 1L5YA 1MABB 1MB2A 2ZIWB 4KMMA 1YFJA 1VHDA 4DRZA 3QELA 1JN0A 1GARA 4C6RA 3NGXA 5IHPA 1O9HA 4LTDA 5JSHA 1G7RA 4XXHA 3VU1A 4IIXA 2EFGA 3CH4B 5J2TF 4G26A 1NSYA 2IV2X 1UUFA 4R41A 3U5ZB 4OQEA 4E5PA 3QF7A 1TQ2A 4Q16A 2XVAA 4KC0A 1FQOA 2C92A 1AKRA 1ZK3A 2ATIA 2G1AA 3V1MA 1Z88A 2MSNA 3IEUA 4KEAA 4RV5A 4XCXA 4D9MA 1ZOPA 1CSEE 2AD5A 3MTAA 3FGNA 3D4OA 4WT7A 2XGMA 3NTLA 3IYLW 1T36B 2OGUA 4IQ8A 5FL7D 3RUEA 3GLUA 3W8EA 1Q20A 1L3CA 3EXHC 4BIMA 2VOJA 1V5EA 3KVVA 5FOVA 1Y81A 1Z8FA 1SVIA 2PGOA 2Z3VA 3W34A 3ZNOA 5J3JA 1IYZA 1F6DA 2RI0A 3F9CA 2VTVA 4C0JA 2PMFA 2Z4RA 3VHXB 3E81A 9ABPA 4DKJA 4BQNA 1XA0A 2C57A 4XOIA 4B3CA 1FBNA 4PCLA 1L8LA 4QOJA 5HF6A 5A71A 4B85A 5HVNA 3RAFC 3AETB 1ODFA 1H22A 3ZWXA 4LYHA 1F2UB 2AE1A 3EBLA 4RSGA 4BKOA 4MYHA 4JDPA 5LCXA 3WC4A 4OSPA 1SZCA 2GTHA 4AI6A 3B1JA 4R8SA 3DTVB 5E4YA 2ZR8A 3REFA 3IAM1 4Q4JA 3RK0A 3BK2A 1E92A 3JAKA 2JKZA 3K5HA 2HX1A 4DCOA 4ESHA 4UE6A 4B32A 3B70A 3NJRA 3PQ5A 1HORA 2XNSA 1XE3A 1I7SB 3BMCB 2VC2B 1GLVA 4YUYA 2FE1A 1B8UA 3AQ4A 3B1FA 3RF6A 5H1YA 1DAPA 1U3TA 1FMCA 3JSXA 3P96A 1CIJA 3NBUA 4RHYA 5LA6A 3WGGA 1NI3A 3X2SA 2ZATA 4FYYA 1IHXA 2CLKB 4XRGA 4TZKA 4U4AA 3W7BA 3IEIA 3K9WA 4FP9A 1REQB 4BLUA 5JU6A 4ABYA 3PXEA 1I4EB 2Z9DA 1ZH2A 4C6TA 5ABPA 2HJVA 3ABOB 2B7CA 2ZVPX 3GDWA 1ATZA 4RNDB 2AK2A 3KLOA 3VPFA 4PCUA 1MCZA 1GFIA 2YWRA 4W9NC 4EA9A 3IQXA 3QWFA 1G291 2VRNA 3IUMA 4E4RA 3DLIA 1RJ9B 4X24A 1ACJA 4XJSA 4B43A 5GONA 3U0BA 5JS6A 3CLKA 1J2EA 2NVUB 4ARUA 1UEXC 2QRLA 4UHCA 4RV9A 1L1FA 4COOA 4WNIA 3B36A 2X5OA 4FN5A 1XCLA 2Y66A 2ZRHA 4ND5A 4UD6A 1NVUQ 2EGGA 1C3EA 4OYLA 1AO3A 5CU7A 4IGIA 3S1LA 2I3ZA 5BYKA 3KE9A 1OIVA 1EXVA 3FOEC 4MVJI 1U02A 1RHQA 1VG1A 1Z13A 2HV9A 2PY6A 2UVQA 3FLEA 4X8MA 2YTZA 4ENUA 4WNCA 3UUFA 4Z8XA 3ZGYA 3H9BA 4Y98A 3W8RA 2G9NA 4BRWA 2XCTB 2RKOA 5H8WA 4K9DA 3UCFA 5KQSA 1KJ8A 1BH6A 1Y80A 3N2NA 1HH4A 5BN1A 3KBOA 2HHCA 1JB1A 2CSUA 2BEWA 1XCJA 2OBLA 2Q6IA 2SBTA 4FBMA 4KNWA 1SA0A 4PZEA 4A5SA 4UQLA 3IHWA 2WJ6A 3CPEA 4ZREA 2QA5A 1VCIA 4GQAA 4JKOA 4V2UA 4AUEA 1E63A 1QYVA 3N8IA 2PX3A 3P19A 2LZ0A 1VB3A 4FMPA 1AZTA 3FMIA 3A25A 1G2QA 5AHRA 2NYRA 4JCOA 5DFAA 2M6KA 2P0AA 4C05A 1J0BA 3E58A 3G17A 1J49A 1FTSA 3DXYA 4JQYA 4V39A 1XU4A 2WJZB 4FGLA 3U6KA 3U4HA 4E4TA 1H8EA 3K4HA 2ECFA 1Z2OX 1TO6A 4PQFA 1DX6A 3PNOA 1EUCB 3MERA 3GMSA 3QVGA 5H59A 2ZJYA 2CCKA 3GA7A 4BLVA 3SZOA 1AKTA 1ORTA 2F90A 1RNLA 2P11A 2YCBA 4ZQHA 2CJXA 4LN1A 3AGQA 5AI9A 4BDTA 1OA1A 1R0XA 3E84A 2ZRQA 5HZGA 1TFUA 2XE6A 2XMGA 3JVIA 3TM5A 2FA9A 3W3ZB 2O2DA 2O2YA 4YRMA 4H1UA 3P9QA 4H7EA 4RELA 1KKLA 1CULC 1IEXA 1OBCA 1T13A 4WDQA 4ZI7A 2OCLA 4M1SA 3FNQA 4XFDA 3DYVA 3WLTA 4F3KA 4P7JA 4RC9A 2FFBA 2PA0A 1ZGJA 1ZA2A 2NU7A 1QGOA 2V65A 1OGJA 2UAGA 3AP3A 1CUCA 3GUVA 4L78A 2WINI 1YSCA 4RDXA 4PV7A 1IVNA 4FONA 3RABA 2D5CA 2W6ZA 3HCFA 3ROPA 1IZ7A 1DQRA 2HSEA 1FSZA 2QLNA 2C5GA 2PV0A 3A6KA 5CP8A 1FW6A 4WLFA 3WNCA 4JBIA 4IW3B 1WPRA 1GFZA 4B81A 4DWWA 3D6MA 4KDEA 5BMOA 5DZSA 5LB2A 1WVGA 1FDOA 2P2LA 3WGUA 3PYMA 1YIOA 1GR0A 3QU2A 1V16A 4EENA 1S3FA 1CP2A 1P1HA 2BBOA 4KE8A 3ZBQA 2ZSDA 2EZ9A 4NE2A 3H5AA 4WGFA 3UY4A 2JFXA 1NURA 2HRCA 3THXA 1E8NA 2BFBB 1SKYE 2QRPA 2PH3A 1YZYA 4XARA 4R6XA 3GCZA 1PIWA 3NNDA 4B75A 5C5CA 5K0EA 2B34A 2CL5A 2E9SA 2ORWA 2PRYA 1F38A 2ORIA 3K3PA 4KTTE 3BTUA 3L7DA 5BSTA 3RVKA 1HYHA 1Z5GA 4CETA 2C1ZA 3H97A 3BWDD 3W7VA 3G5LA 2CJWB 2VP3A 5DI3A 5BVHA 1AG9A 3HJFA 1SVLA 1W0CA 2GTIA 1NVMB 1GRCA 2DUUA 3O1JC 5KBYA 3MQ2A 1ZMOA 1LPNA 3DAPA 3H5WA 5BR8B 2JGFA 3TDMA 3FDZB 4GIBA 2JARA 3ROMA 4HQRA 5JRJA 4KREA 4MUFA 4M21A 1RS0A 4BO0A 3CZPA 1JSRA 4IILA 5E4TA 3WTBA 1SB9A 1JHZA 3A4VA 4FKBA 1MAHA 2WWVD 4D0LB 4NBWA 3OWXA 3W2TA 1U11A 1UMBB 2OG1A 3DTVD 3IAS6 4V1CI 4O5OA 1P2TA 1Z07A 5I8ZA 1GSAA 4GZ5A 1OFTA 2HXGA 2PX2A 1OI2A 1YQUA 3F3SA 1RWPA 2G25A 3IEXA 2FPMA 4PHCA 4NQZA 4ZANA 4EO9A 2L42A 3CLHA 2VWQA 3OMXA 3HYCA 4A1FA 3M5DA 3MRXA 1ZFNA 1HSZA 2DH6A 2R1ZA 3FAKA 4C4YA 1VHLA 2RJOA 5KVCA 3B6JA 4DCJA 1V43A 1Q0RA 3N9IA 4P3XA 1Z56C 4PN7A 1N2JA 2QTMA 2VHVA 3ICWA 4N4AA 3NEAA 5IM5A 3ZX5A 2E82A 1CY0A 1E69A 1XDZA 1N2OA 3C1UA 4C6HA 4N7RA 5ETJA 3AVPA 2NLOA 4AN4A 3ZI4A 1A4XA 2RHOA 3DFKA 1FQJA 1KZ9A 1ACLA 1MOZA 4CM6A 1J7KA 1U9CA 4NENB 4ZVUA 3T3HA 4YRRA 1YZFA 2BFEA 4ZVPA 1SU7A 521PA 5HOQA 5I4BA 2GBPA 4BEJA 1KJIA 1S2MA 1GU0A 4JOCA 3RBVA 3QVOA 2OHXA 3NHUA 1JI0A 1R16A 2PL1A 4QYTA 2H9IA 3IQIX 1SBIA 1B0ZA 2F9LA 4DDWA 3V3KA 5JNVA 3H0EA 2CJYA 2BJHA 4PR0A 2CZQA 2O2IA 5SZIA 3ZE1B 1PG0A 3L6RA 3A3PA 1FFGA 5JRDS 3LIPA 1G5QA 2CMFA 5I9BA 2ZQ5A 4DREA 4YCSA 3AONB 3GLIA 3NBYC 1CJKC 1NRJB 2HYDA 2P0YA 4NY1A 1NXVA 4YQEA 5T3YA 2HJHA 3ZCSA 3UEOA 1UPUA 1JZQA 2XCOA 4CKXA 1FS5A 2EP5A 4EG1A 4HN4B 2V6JA 1J0EA 1O1YA 4PYLA 1IWOA 2CXTA 5AI6A 4FWTA 3CUYA 2H57A 3STHA 4XDYA 2O8DB 1KO1A 1LGYA 1M1YE 4QBFA 2C2WA 4U7PB 2B21A 4UTVA 6PFKA 5FX2A 3UENA 5EUMA 5T4EA 2NUPA 3PTZA 4GRAA 3X2EA 4WBNB 2XUAA 3HP4A 3M2PA 1MLDA 3VNSA 2Q5FA 2QD4A 4ZICA 2ETXA 1DTWB 5A5EA 3NVMB 1BC5A 1OZ0A 1U9ZA 4E32A 2QD5A 4EG5A 1QV7A 2QQFA 1E1NA 2YOFA 3TSYA 2QT1A 3KWLA 5F3RA 1DKUA 4DIOA 3OFSA 4QLAA 1QTQA 2H0AA 1HWYA 3H87A 1XDSA 3O8RA 4K2HA 3DONA 1SG0A 2WJAA 1G8FA 1Y3BE 4PBRA 4EHLA 1PKEA 2BR5A 4M1TA 1N6OA 3VDRA 2BGRA 4RIFA 1P4SA 3GLHB 1NUSA 4ID9A 3KTAB 1QE5A 3VR0A 1YD7A 1V8DA 2UV8A 3TF5A 3JPWA 4C3OB 4OFXA 3FUWA 1DJOA 3V6MA 1WDLA 4EA8A 5K0FA 3K09A 3IURA 3ZGVA 1XKTA 3QJYA 5KAMA 1PYOA 1H2YA 3ECAA 4X62B 2O8FA 4C06A 4UPVA 1D6MA 2P68A 3QJGA 1T8UA 5KYVA 4ZCQA 2DLDA 1C9NA 2QTTA 4RM2A 4OP2A 1SD1A 1C3LA 1ZXLA 4S12A 1P2BA 2E5WA 2OBXA 1SQ0A 2NYUA 5HGJA 4QFCA 5HK8A 2C07A 4JC8A 4D9FA 1QQ5A 1ECFA 2E1RA 3W6ZA 4M76B 4U7JA 1ZK2A 5LLSA 4J0GA 3DZCA 4MW6A 5ALOA 3B20A 1C0KA 1DC4A 3LA6A 2X1VA 1ZIPA 3KKOA 4FLMA 4FR2A 4L4RA 3FTNA 5DEIA 5ECYA 3W3AA 3MJ4A 2QKYA 1QZXA 3ILXA 1VXRA 3PPXA 2FMFA 3P0IA 3DL7A 3PDIA 3T35A 2PEYA 1CEQA 3JALA 1BKYA 1K8ZB 4BUCA 3FF4A 1PKXA 4FYHA 1U94A 5F3WB 1DIAA 2KQUA 2C9ZA 5LLTA 3PL1A 3KEQA 4ZO9A 4G0PA 3U49A 4BQIA 3QX8A 3X1WA 2VZ9A 1KE1A 1HDEA 3L0DA 3DOFA 1QFXA 3L1IA 2HK9A 2JLRA 5CW2A 1CY2A 4NCAA 1IN4A 2OXFA 3R5FA 4EEXA 2EX0A 1DT5A 4LS3A 4HK4A 3E2MA 1NRIA 1RADA 4HYTA 3CNLA 3SYNA 3B51X 4CHGA 4LRSB 4UEOA 1OT3A 1KYXA 4QXAA 4RQAA 1YMQA 2QRNA 2WJJA 4WJZA 1WMSA 1Q0LA 2QRKA 2DHRA 3FMOB 1CYEA 1LY1A 4M60A 2J30A 2FNAA 5CT5A 2EW2A 3DM5A 4XSGA 1G98A 1ITZA 2D7JA 2HQSA 5AMXA 5BSWA 5JCZA 4X41A 3MT7A 1QHHA 2W4MA 3PXDA 4BP3A 1MQAA 2MR5A 1HMPA 2WHPB 3EXEB 1U0FA 4HJRA 1U8XX 3CX4A 4P6VF 1OX4B 5MN6A 4BDSA 4F85A 2DJIA 1SCNE 2W7TA 3HMQA 4RAOA 2QLTA 2ZI7A 1CVLA 4PX5A 1VM6A 2HDOA 2WPDA 2CSXA 1KEEA 4BVFA 4BMYA 5FWXA 3O47A 1QPGA 4BASA 2X1MA 2D0IA 1Z15A 2YXPX 3C2QA 2PZ8A 4GWLA 1GZVA 2R8RA 1J9EA 4GGPA 4H77A 3T7KA 1I3LA 2E85A 4LECA 5REQB 3SFTA 4DQDA 4YACA 1L7OA 3FOWA 2PSSA 2XKBA 5IAKA 2QLBA 1S8OA 1TT5A 2CMKA 3DMNA 2CZCA 3JQAD 2H59A 2XTJA 4GI2A 4CMAA 4F6RB 5G02A 1FFCA 2YR0A 2B3TA 4DMGA 1KE2A 3DBLA 3OQPA 3OE7D 2FPRA 4X94A 3NWPA 3ZIAD 4GYYA 2EKQA 5KKCA 1BGWA 3A1TA 3W2FA 4DMCA 4P4GA 4UHFA 1XMVA 1F17A 3UOWA 2ET6A 3EGCA 4UMDA 3H6HA 2IW3A 2VRBA 4RCVA 5EZYB 2C7GA 3MPUA 3O8BA 2OKGA 3IIIA 2Z5FA 3OVMA 3EQ7A 2ANBA 4DJDC 5ICEA 3SWWA 4TM8A 2QXUA 2WVHA 1OWPA 2O1XA 4A0QA 3IUYA 3S8YA 2VJDA 2X3FA 2XBLA 4CWAA 5BUQA 5CLJA 3AKYA 2CLMB 2WIJA 2MSLA 3CR7A 4PX2A 3ULKA 1PNRA 3TMKA 1W4ZA 2VJMB 2NO1A 4QZVA 1YK0A 4BVJA 2ZT8A 3HB4X 4HX2A 3O3MB 5CEEA 3EFHA 3KQHA 2ETVA 2K5UA 1DAHA 2J4CA 4NV3A 1MB9A 4ZWNA 4HVCA 1Z63A 1CDZA 3AB3A 3KOYA 4ZT5A 2FUG6 2VJKA 4JK3A 2O8NA 1JEOA 3OJOA 4I1IA 3KR2A 3WK6A 1EXDA 1R5OA 1EDOA 3Q2OA 1P91A 4HYEA 1SUWA 3RS4A 3TQSA 4ZYVA 4IQGA 5KC8A 2I6SA 1ISIA 1O97C 3BM5A 1R5JA 1IB6A 2VEOA 4GGOA 4INPA 2NXCA 5TVKA 3WSWA 2FFHA 2XEXA 2XWBF 3OP4A 5SZKB 3UBTA 3NDPA 2IY7A 1A98A 1AY0A 1X7YB 2O5VA 3ASYA 1KZ6A 4N41A 3G85A 3B38A 1Z5UA 2A4KA 3V8VA 2RGUA 3B3JA 3ENKA 2V3WA 3SEAA 5K4GA 5LJLA 2AOTA 5DP2A 4P9NA 1NW3A 1PL0A 2XADA 4GBJA 4Y2VA 2BL4A 2R2GA 1XO1A 3LT4A 4X0EA 5IEJA 2IU3A 3IP6A 5D6OA 2OCIA 3EDQA 5C5DA 3AEKB 1XXHB 1L9KA 3G9QA 2JCBA 1NHGA 3K15A 5IASA 1ZJYA 5I7WA 5H82A 2VBIA 1D5WA 3F90A 4IG9A 1Z6TA 3FTFA 1GM5A 2FZWA 5I8PA 4FFWA 5CH8A 3RSSA 3K0SA 1RPAA 2GERA 5CH3A 2AG5A 3I37X 1V11A 1RAIA 2HA3A 2ON6A 5EE5B 5ICFA 3SX2A 3TGWA 2V4UA 3PC2A 1K89A 2I2AA 4X6XA 2OQIA 3CEPB 4E14A 2D06A 3BAZA 3D1LA 1M5TA 3IAS1 4RD2A 3DOJA 3SGLA 4LZPA 3P2JA 4EY7A 1A9OA 3S2ZA 2A1UA 4X44A 1KO8A 2Q4OA 5A02A 2Q5JA 1NW4A 2I8CA 4ADSG 1H65A 1D0VA 2ZYIA 4UHJA 1CPYA 1X15A 1ZISA 5K0ZA 1GAEO 2JVIA 5C4IA 4DUZB 2QW8A 2QGNA 2P78A 3JARB 5DLPA 3R7WA 2F48A 1GYPA 1SUBA 4JHXA 4L0CA 4ZA2A 2P79A 4KO1S 5FULA 1GZHB 2IYFA 2V7QD 4M0UA 3LTNC 1SKBA 5ES3A 3IAAA 2HSJA 3ZDZB 2WQZA 3SM9A 3E3LA 2C7PA 3GLFE 3OZAA 3C6QA 5KSOA 1U2PA 4DVGA 2CXRA 2TSYB 5T67A 3QSYA 4G5QA 2JFWA 1VL8A 2WYWA 2GILA 3MT9A 3S2YA 1TW3A 3I2KA 5JXJA 3BWYA 1B6RA 1C30B 2FUCA 2MSCB 2B4KA 1Q50A 4OBBA 3ZNQA 4BWGA 4NJEB 1PZGA 4MYDA 3QKTA 2XNDD 4ZDKA 1L7BA 1T9AA 2AN4A 3QU7A 1DC8A 5CM8B 1ZG3A 3TUIC 1JHDA 3HUEA 3VSAA 5ENVA 4G0OA 4Q6BA 3WL8A 2ZIXB 3L4SO 2BFCB 1NN0A 3D2LA 5K8LA 4BO1A 4C87A 5CDYA 2J3HA 1EHIA 2NQ2C 2X3YA 4MZDA 5B3LA 1N3BA 1MH1A 1OTXA 2Q9UA 1V95A 1UC8A 2EP7A 2CUNA 4NJOA 4DZRA 3FUVA 1ESEA 2BUCA 4KITB 4YMGA 3DKIA 5A9SA 4A4DA 2GFHA 4OJQA 1ZP6A 4W5NA 3K09C 1UAYA 4GVPA 4Z4QA 4K9SA 3O7WA 1C7EA 4JI5B 4RSHA 3M9WA 1XMQB 4OJKA 4M55A 3WP1B 3LYAA 4GM1A 4Y7CA 3UFXB 2G9QA 3WLEA 4ER5A 1X39A 5KNBD 1VL5A 3RS3A 3KPUA 2AUMA 2HT1A 4MJ3A 4ZHSA 4NWIA 4QHTA 4ZJZA 1IG0A 1JA9A 1UK7A 1VYHA 3AHHA 4Q3DA 1OJLA 2P6NA 4LRUA 5AKLA 2BJWA 5ERXA 4CIVA 3Q87B 5CB0A 3OTHA 2GOYA 1H94A 1EGVB 1G2OA 1T29A 1YQDA 2ABWA 2V8OA 2WFLA 3L92A 4AZVA 2A33A 1A2BA 1NVVQ 4C9BA 3ED1A 1L7XA 1TZKA 3IQGX 1P9WA 3O3CA 4MI3A 4C7OA 2I4OA 1PYDA 5FEMA 1Y6RA 3G2QA 1EFLA 4C03A 4KWCA 2ZSKA 3TXAA 1DEOA 5FJIA 1JR4A 4JQSA 3QJ5A 2GEKA 1OFIA 1MJNA 5ESRA 3M6AA 2QD3A 5JNSA 2RH9B 2CXUA 1AF7A 1MB0A 3GZ4A 4BV3A 4CM1A 1HOXA 3O5AA 2X58A 2WU4A 5FUWA 1X3LA 1FA9A 4I4TB 1UOPA 1JFLA 3ELWA 1XKQA 4RD4A 3WFIA 3T7CA 1E98A 1J1UA 2C7RA 2XPCA 1QORA 5I47A 4OQMA 2UZ4A 2DUNA 1SVUA 2YHAA 4Q12A 1DTEA 1C3XA 1C1XB 3CPSA 4JQZA 4Y6QA 5HIAA 3EGOA 2QUIA 4OJMX 3UMFA 4M8KA 4RDCA 2CE2X 1A7JA 4CM9A 4YPOA 4OGKA 2FW9A 3HB7A 3NLLA 2B30A 2PNJA 1SU4A 2Z2YA 1HG0A 4UM9B 1JMKC 2FETA 3KNZA 5BWOA 1WMDA 4E22A 4FZJA 4E3WA 2NP7A 1VBKA 3QEAZ 3BT7A 1DKMA 3LLSA 4LOAA 4WZBB 4TWIA 3BCRA 5E1OA 5THQA 3IMFA 3CJTA 2X9NA 4HLCA 4LXTA 3TW0A 4TLLB 3RVJA 4R01A 4R69A 3W5JA 1TJ3A 3NDBB 1Z0DA 2C99A 4RWZA 4TS4A 3P1JA 4LE1A 2JA2A 3NV9A 1MPXA 4OSOA 4J1NA 4CLOB 5HILA 4HAIA 3KCNA 5HCIA 1C1DA 3R3UA 4I1UA 3G82C 3MG9A 2Z58A 3I58A 2W4IA 4JASB 2GN8A 4TLDA 3CZQA 1YA6A 1RABA 2WG1A 3IJPA 2AF3C 5EFZA 2EP8A 4DN6A 2Q3HA 3I3OA 3TEMA 3HZOA 3C8MA 4F9FA 2IYPA 1SKAA 4F4DA 3CZ4A 3M4XA 5DASA 4DIKA 4WZAB 1W4AA 1A27A 1E3SA 3IR5A 5HQ3A 8MHTA 1F6WA 3U40A 2X2FA 3AY6A 4IINA 4JWKA 4R1QA 4FFVA 4TSFD 3WWCA 1ZQ1A 4BWYA 4CDNA 3RHFA 3EC7A 5LZ2A 4JX9A 1IN7A 1AE1A 1T0PA 2W98A 3EWSA 3ZDRA 2YZGA 4MP3A 2VH1A 2PKRA 2AB0A 3HVHA 3CIFA 2UZ3A 1UDCA 2B1IA 3OZVA 2VDOB 4PTLA 3DZ8A 2R47A 2JLSA 4LVUA 1FIUA 3G02A 1JVBA 2XQKA 3WKCA 5A62A 3D8NA 3DFFA 2IBTA 3RUFA 1WVMA 3C7AA 2X7HA 3L0CA 2ZBUA 3GJSA 3HDYA 4MR9B 4YMVA 3FZEA 3NHRA 4WY5A 2VPXA 3KVNA 2ZREA 4C2UA 2IYLD 2BI8A 1NDUA 1P0IA 3DO8A 1S2LA 1AZLA 2ZAMA 4MDYA 3DEKA 1FMLA 3EVAA 3ZK9A 1O54A 4X65B 4HNAA 1EK1A 1L7EA 1Z7WA 2WIDA 5DCWA 5C8VA 3DE5X 1MZVA 2EZ8A 1YI8A 3PXCX 4QFBA 3N8DA 3R5KA 1UZUA 1LNZA 4KQWA 1VKOA 3OCJA 5K99A 5E3HA 3R8FA 1ESCA 4MYRA 1TM2A 1RQLA 1TO1E 3DOHA 5FP0A 3V9PA 2ST1A 3BSWA 3C6KA 3RUDA 1JMYA 1VLLA 5HWSA 2EX1A 3VR5A 1U8YA 4OHRA 3RJ9A 3M70A 3STYA 4U2GA 2IP1A 2ZYUX 4LNAA 4Q47A 4Y67A 1LTQA 4I4LA 1VMDA 3VZDA 3G59A 4MAFA 3GJ5A 1BX3A 2WNSA 4BNWA 6ABPA 4UUAA 1JB9A 4JB0A 1NUTA 3WGLA 2FUG1 1FL9A 1NXXA 1JR3D 3MS2A 1HDIA 3AQIA 3HACA 3Q88A 4HWTA 1OIXA 4W6ZA 3V8QA 1BXGA 4UARA 2FP4A 3GAZA 1X7DA 4FT4A 3U61B 4DDMA 2C4UA 3IJRA 1BDHA 4OHWA 1KZYC 5IFKA 4NBKA 1NSFA 1DOZA 5A4JA 1GT91 4FDTA 1CRWG 2NZJA 4MPJA 4YFYA 5HEKA 4US2R 3HL4A 5AVVA 5FA8A 2R6GA 1XWWA 3UZUA 4V3CA 5HKLA 2IH2A 4ENWA 1JQ5A 4HGQA 3WGNA 2UZ1B 4LYFA 2R8YA 1T34A 3L9XA 1P8JA 3FB4A 3R4VA 4X00A 5JNRA 2RGRA 2D6FA 5K09A 4CU2A 1JZTA 3H05A 3WFJA 3RRZA 2H7YA 4G6ZA 2H1WA 2PL5A 3GGOA 3H1AA 3NG1A 3ICQB 4XR9A 2QX4A 4JC5A 3WGZA 2BR4A 4LBVA 4M7OA 1W85B 3DVRX 1JJBA 3B78A 4EZIA 1J42A 1JFFB 1KTIA 2WJGA 3DEIA 1SBYA 1MX3A 2G9ZA 2I6TA 3OZFA 1EUQA 4UTNA 2H1CA 1BGXT 1N9GA 3A70A 1YJAA 2IEGA 2QD2A 4TL8A 4I9HA 3A0RB 1I0ZA 1V1JA 2Q0SA 3PQEA 3V34A 2DFKB 2VAPA 3VPDA 4D4MA 3KKNA 2D7DA 1YJCA 1AA6A 1WPQA 1PAUA 2GVZC 4DY4A 1CQPA 3IUSA 2PHZA 3RUIA 3DLTA 3ZJ5A 3E1KA 8ABPA 2XXAB 4D4KA 1XKLA 1EFTA 2Y76A 2DB3A 5ESXA 3TINA 2Q28A 3KQSA 5L53A 2XWQA 3W5CA 1G19A 1RE1A 1LB1B 1V9SA 4X63A 5HBGA 4EX6A 2Q5CA 4I1VA 2LCFA 3M49A 4IWYA 1N75A 1Q0PA 4LRQA 2Q50A 1J09A 3RSOA 5CCEA 3M6WA 5LQSA 5JMTA 2SNIE 2ZWVA 3T94A 3U4MA 2ZTLA 5ER6A 4Q4AB 4BFYA 2ZRNA 3FCSB 1CUBA 4E13A 4WKBA 5ALIA 3NOOA 3KJEA 2AMYA 4EI7A 2AX4A 3DZHA 2WF7A 3HY6A 4F6CA 1KPIA 4Y2PA 4B3HA 3RSCA 2AEMA 3QW4B 4NG4A 4KLRA 3V5NA 4LOIA 5EIBC 2YVLA 3TR6A 4YROA 5ALNA 4UM9D 1RQRA 2EFCB 3R3YA 1ZZEA 4BL5A 1FEZA 4DLXA 1XZAA 3Q3IA 1HFWA 3NHBA 3EVCA 5IVKA 1RLMA 4M89A 1NX6A 3WZ2A 4G9EA 3ABZA 4TXLA 4X1KA 5H70A 4PLVA 5BWMA 2ZRKA 4ZOLF 1KKMA 4W7SA 4BO3A 5JAOA 3M33A 4TV8A 5M7EA 3THYA 1HFEL 1WULS 1XMSA 3D1JA 4XM0A 3WJ2A 5ICGA 1VYVA 1AHPA 2FPIB 1RKQA 2BKVA 1BX1A 1VYTA 3EMVA 2H2HA 5LWHA 3I28A 4HXEB 2PSHA 4OXYA 3THRA 2XVZA 2P6RA 4UNRA 3BH0A 1NY6A 3GGPA 3V8NA 4OX9B 4Q7KA 3UXMA 4ZAGA 3KSRA 3LU1A 3AVVA 4HLUA 4RTOA 1OI3A 1M1NB 3MMXA 3QU5A 3EZ9A 2DWUA 3EG9B 3X1KA 1KC3A 3E3OA 1C80A 1PD0A 2EJUA 3KPVA 3QVXA 5K6AA 2XI4A 3JR3A 3IL2A 1G18A 4BBJA 3VHLB 2W2QA 4A92A 3GCGA 4FWIB 5IC4A 1FTQA 5CITA 5LYJB 4YI5A 1OBVA 1LZLA 4RHUA 5BQFA 3FPJA 5F1PA 1OOEA 1KDRA 2Q6LA 1S8FA 2YNMA 1SULA 1VIAA 1E32A 3CLSD 3KB2A 4TLCA 2QR3A 1P9NA 2QN1A 1Q3KA 2ADMA 2J6BA 4JLUA 5BNTA 1XAGA 2C98A 2ZWOA 2A9VA 1E94E 2HL6A 2OLKA 4KX5A 3BJIC 3ID6C 3GFTA 1T3HA 5SY6A 1NONA 3UG7A 2QV7A 2X2PA 3VR6D 2YVAA 4LJSA 4MUHA 1FNMA 3CG0A 3B3GA 3O4VA 3OM1A 3RIEA 5KTTA 5KYUB 1I2ZA 3ZWAA 2ZBDA 2OO3A 3DDOA 2J9FA 3NHFA 2H07A 4QODA 1N8KA 1QYWA 2AJLI 3N05A 1NI4A 1PQYA 3QU4A 5AJYA 4BVKA 1TFRA 4WTOA 5JZMA 4JH0A 1IVYA 3SI7A 2ZB2A 4X7PA 2B9VA 3RI3A 2VWHA 3ZCPA 2PXAA 5CXXA 2HF9A 1G8GA 5JARA 3BREA 2QQGA 4R2LA 3REQB 1NMSA 1TLFA 1UJ5A 1YVPA 5GMOA 5HGXA 1Z6AA 4XTCS 2FXVA 3I2FA 1UXGA 4B9EA 3U4QB 1J56A 3WLSA 1PDWA 2AJCA 5JLJA 3FWNA 4TN5A 4ZT2A 1A9YA 3WADA 4EYOA 1T9GS 5GZ3A 4C4AA 5KWSA 1HT1E 3AUFA 1C81A 5NLLA 1UC4B 3UMCA 3NM5A 1GPH1 2K87A 3DDNA 2PX6A 3JTEA 3PHBE 4JLMA 3UJBA 4F8YA 3NR2A 4KX3A 2GR9A 2H1RA 3LTEA 1TJ4A 3QP9A 2I2WA 3LPNA 3MWDA 4W1SA 4X6YA 2IV3A 4YJGB 5B64A 3PTLA 1VL0A 1ZESA 2QAIA 3AB7A 3G2PA 3PUIA 1U6IA 4ILKA 3CZMA 1R4MB 1O0BA 1N78A 3UT6A 2NGRA 2IP2A 1FFBA 4Q7EA 4QSHA 2CNKA 2NUBA 4EHAA 4RIIA 2FDXA 3LVRE 2HIMA 2D2XA 1X0XA 4KQ6A 4N48A 4L27A 4EJSA 2ZZMA 1F12A 3F5QA 1ZUNA 4FHDA 1TJ5A 1ZDMA 4YO8A 1QFJA 5LYJF 4DOMA 1PZMA 4EPTA 1VKRA 1WTAA 1XTPA 4RHXA 4HPJB 5LXTA 2GVNA 3PFKA 2HHAA 1KDTA 3DKVA 5HE9A 3ZDQA 4LJAA 2PMDA 2TS1A 1XN1A 3QE3A 4O2AA 5CLFA 3ESRA 2HK8A 4F7DA 1ZL0A 3BA6A 5SY4A 5K8CA 1WP9A 3IE0A 3VVCA 2YWHA 4BKQA 4WJKB 3KJXA 1O58A 2WHRA 1SPXA 2F1RA 3L8HA 4M0DA 3TTUA 1U5AA 3CX6A 5TMBA 4L9WA 1IY1A 1NBME 1XZFA 2QIOA 3UCEA 1JSLA 4GI3A 2FPKA 5IH3A 2FEAA 1QDLB 4A8JA 4JI8B 5AKKA 2X6TA 3KPYA 1BW9A 1XI2A 2Y1EA 4IZHA 3QWBA 3WGIA 4WUTA 4KACA 2WKQA 2CVFA 4RFLA 3U13A 4ZVLA 4UKDA 3OQIA 2QM3A 1Q21A 3LNCA 2WSSA 2A9KA 3GLVA 1FX0A 2J3KA 3PV0A 3WJAA 2X1HA 4DAEA 5A1TA 1I2CA 1L7RA 2F3TA 1KBOA 1CS0B 1LQUA 3A6HA 1UQTA 2DUJA 2ODWA 2B1RA 2GZ3A 2FQWA 3DE3X 1T2AA 2PH1A 1TAGA 1MHPA 3MRTA 4ENRA 5ALVA 4QYWA 1IJFA 4YT4A 1YMVA 4FYXA 4LHXA 2C9OA 3DHYA 3H1PA 5FADA 1O87A 2BCJQ 2XMBA 1DADA 4G1EB 2C61A 3R20A 2OP1A 3VM6A 1XTKA 1X7ZA 1YI1A 2E55A 3WLRA 4DWVA 3WRVA 1RWBA 1VA4A 1AXGA 3D54D 3WTCA 1QHFA 1SKQA 3OZRA 2OK7A 4BAUA 1MT3A 1H2BA 3KUCA 1JQ3A 3SZMA 1C0EA 1IEVA 2X2OA 5JAQA 3ROQA 3RLFA 4M88A 1LCIA 2B37A 2CWDA 4GHWA 5LOVB 3LC2O 2GUGA 5AJHA 3O75A 2LDBA 1RZRA 4LHVA 3MBKA 4BLRA 1YBAA 2LR0A 2RK3A 1YQ9A 3AJ9A 3UKOA 3QHAA 3GVCA 1VL6A 3E7XA 3BH7A 3HY3A 4NZOA 4EKEA 3RNOA 3DNFA 3P9XA 5ALGA 4Z51A 5I7AA 4TWZA 3CW2A 3NM4A 1TF7A 3X1DA 1T9GR 4RK1A 3O1HB 1PR0A 4GEGA 2XZOA 3DULA 4DLLA 1K7YA 3WV5A 3KT0A 1VSBA 1DHRA 2HCTA 1LEHA 2BE7A 2VOEA 3FF1A 3KAPA 4HTFB 4REMA 3TIVA 1THTA 1AB6A 3BWBA 3WJ1A 4Q5IA 1L8XA 1H5UA 1ZN2A 2YIJA 4YCAA 3T0FA 2COEA 3EA5A 5D87A 1Y6FA 2IS1A 1SHKA 2JH3A 3AVYA 5B5SA 1XQYA 4MGIR 4EO7A 3H13A 4Q19A 3DBHB 1Q83A 2WBLC 1M7HA 2RAPA 2PGXA 3QEMB 1G6Q1 3PXGA 1E7SA 5K0JA 3I1FA 2PMWB 3LA8A 2RC6A 3VR3A 1NNUA 1X9HA 2X42A 3L0PA 1AQLA 1I13A 1LLQA 4PICA 1JHVA 2D0PB 3HLTA 4EELA 2XF8A 3GFVA 3H9GA 1MNQA 2XLCA 4ENPA 2VG8A 1R88A 4MYUA 3MC1A 4IS3A 4CDMA 5AUQA 3PGMA 1P5RA 4B73A 1P5ZB 1Y3AA 2GA9A 2XVYA 2G06A 4NFLA 2A9FA 4JCCA 4MZXA 2WU0A 2KJQA 4A6EA 3T8YA 2FWAA 4LZLA 1I4OA 4FR0A 1ADJA 4J0CA 5JFOA 4NCXA 4PC6A 4YJ2B 3VH2A 1A8SA 3IGFA 4J90A 4W9MC 3A4NA 3PIDA 2QUAA 2O9JA 2A86A 3B1YA 3IEPA 5EMNA 2D1RA 2PSFA 1RACA 4J2HA 5CB4F 2Q4EA 3GUHA 5KTNA 4WN9A 1E89A 4CF6A 1CIVA 1VKZA 1DV2A 3QG1A 4YFVA 5J5CA 3RFXA 3C45A 4MKGA 3EIWA 5LOVF 3BA1A 1Z0FA 2MJLA 1FMTA 4KV9A 3VYUB 1X9GA 1ZK1A 2H1IA 4HNSA 3RC1A 1Q92A 4K6KA 5IT5A 4QGSA 1OB5A 1CXZA 1QAMA 4O59O 5AK0A 3LLVA 5ALZA 2MYUA 4II2A 3RU7A 3HYSA 1NOKA 2XCSB 4AYTA 3RB8A 2FWNA 4M54A 4FFDA 2Y71A 5AHXA 4FJ1A 1AKQA 1YO6A 4MB0A 3UWPA 4BO5A 2ZRDA 1XZDA 3ORQA 4HLUC 1ISGA 4INZA 1PQWA 3K5IA 3EA4A 1Z0IA 3ZZNA 4ZEMA 5C3MA 3AX6A 5K6AC 5CXQA 3IVMA 5JSFA 2H08A 1GQSA 4E88A 1GEGA 1J25A 2VHJA 4N7JA 3QVWA 1YBFA 4X61A 2RIPA 4Q24A 1JVSA 2WHXA 5EFOA 1XNHA 4JNCA 1PL8A 4U7TB 2YNMC 4YP5A 2BW0A 3ZV7A 2NYVA 2C5FA 4N76A 1F6BA 1TTQB 3S7TA 3EZXA 2QTVA 2NXJA 4RZSA 3LT5A 2HF7A 5K0NA 4B4OA 3DUFB 4BKUA 2JW5A 1IG3A 1U7DA 2CB9A 2YXEA 3M81A 1Q19A 3MVEA 4XUDA 3U3MA 1IXRC 5E2IA 3FSGD 4LV8B 4X92A 4DCGA 1X7WB 3ET4A 4YAIA 3QA3E 2FRDA 1OH6A 1QGZA 3JQGB 5LU9A 1AU9A 2B8JA 3QVKA 4PGAA 5H9WA 1DMSA 4PXSA 3A1FA 3SDSA 4BEBA 4PLFA 4ICIA 1A96A 4Y0NA 3N2GA 1V2HE 2HMVA 4QRDA 2WV7A 1Z73A 5LQNA 4HF7A 2YH2A 4MLDA 4CDRA 5ECGC 5LIPA 4GLOA 2P9JA 3WMEA 4B47A 2REXB 3HFRA 1WQ3A 4XWTA 1TDJA 1MAVA 2PLAA 1Z5NA 2RI6A 1XGKA 3G2JA 3A1DA 1QH9A 3HSSA 4PAGA 2VSYA 1Y3IA 2ZVQX 1FS6A 2R79A 3MOSA 3FJ1A 2ODBA 4BBAA 1JTVA 1N2BA 1X1DA 2GCGA 1VLHA 1AZSC 2B3DA 4N49A 2VPWA 3EQ8A 1OHHA 2IDJA 1CNMA 2P4HX 3EQ2A 4FLFA 4U7FA 1RHMA 2IYYA 4MRSA 2R84A 1CS4C 3H18A 5MDHA 3CC8A 3G0GA 3QELB 3OURA 4UVGA 3ZE8A 1JPVA 4IGFA 1W88A 4RD1A 4M83A 5A0FA 4HT3B 4F06A 4LQCA 4MUAA 1ORHA 4LXHA 3NCHA 3IALA 3NTRA 4HNVA 4WK4B 5IMBA 2V7TA 2GTPA 3AVOA 3WZMA 2Q2VA 3BKWA 4LYDA 4KGXA 4EJSC 4OA5A 4YUZA 3QITA 3RIMA 1YTLA 2CVHA 1HURA 2ZAIA 2X9VA 1ZW6A 3EEFA 4WX2B 5L7YA 3KS9A 4OP1A 3HR8A 1FF9A 5ADWA 3BE6A 3TOSA 3OBIA 3PK0A 4L5CA 4OI2A 1UJMA 4O0MA 1JEJA 2X0DA 3F6RA 2WB2A 5LMUB 2NU8B 5JBQA 1JQLB 4MIKA 3AY0A 4NV1A 2JAXA 2NZVG 3AI3A 3G8DA 4ZVQA 4CMKA 2FVYA 1EBBA 2WJWA 5LD2C 1BNCA 3ZHUA 1NDQA 2RBKA 4LC9A 1JEDA 5D1HA 3VKUA 4NYMR 2UYCA 3DFZA 5DRYA 4AJLA 2ES4A 4A8JC 1KDOA 3I2JA 2JGMA 3LNTA 3MAGA 3NZEA 3SS9X 4Z4CA 4QIHA 1KWGA 4Q4JB 3NJ8A 4ZIRB 1JQAA 1N0HA 1V1MA 2FMUA 3CX8A 4WXHA 2YZKA 3DA8A 5M5BA 2GH1A 5C1OA 3ACDA 4I1PA 1OGYA 1Q1QA 3SBDA 1C2TA 4OHFA 1HNNA 4EYEA 3ZD6A 4GP6A 5L8VA 2ZYVX 1GSIA 4S2UA 3R0ZA 4MR8A 4RYDA 4QUDA 3SM3A 4GOKA 4PAOA 5I4KA 5L45A 2Y2VA 3MTIA 2ECKA 1SMKA 3N6RA 4QSMA 2VUUA 3ZWMA 1Q95A 1ZRNA 3HYTA 3GIWA 1A9PA 4HVTA 2I4MA 2F43B 2P69A 3EFOA 4MHOA 3TJZA 1JJAA 3A26A 3LXUX 3NXKA 5D8DA 2QLFA 3A31A 3TBHA 1C9JA 1VI6A 1VMKA 4C6TB 2FPGA 2R7KA 2ZW9A 4IIYA 4ZMBA 5L40A 3O03A 4BE4A 2X5KO 5IULC 2QTRA 2H11A 1GNTA 2I7XA 3NIGB 3B2EA 5KU7A 3FROA 1OXXK 2VHQA 4RM3A 4EPWA 3RRYA 5I8WA 1KJWA 5DNVA 2X9GA 2PUVA 5FBLB 2B4RO 4YLEA 3EUAA 4CF4A 4CKBA 2PKCA 2D1FA 1CY7A 3IKLA 3LXXA 3LCRA 4JI0B 1A04A 2B7LA 2PS0A 3KLBA 3EAGA 4KQGA 1FNDA 1FRQA 1GU1A 1U0EA 4PRKA 2N42A 5GONB 1EJ2A 2VZEA 5FUVA 2BZSA 3S7ZA 4DXDA 4B48A 1QGUA 5COBA 1FTNA 2ISQA 3ZK8A 5BQ5A 1EE1A 3WYDA 2VLBA 2PS3A 1DCKA 4TYQA 2W71A 1EYZA 3LUDA 4F96A 5JVDA 4WY8A 2I6FA 1EVEA 2XB4A 4JQCA 3TNJA 2AR0A 4DVJA 3U1BA 5KYWA 5IUNC 2ZS9A 4QJIA 2BGGA 2C0QA 3OF5A 1D1TA 4FFBB 3K5PA 1N5JA 4GI1A 2XYVA 4QASA 5TARA 3LHKA 4FZVA 1FXUA 3MINB 4H1HA 2EX4A 3FJYA 2BEWB 3GT0A 1CR4A 2CDAA 3QWHA 4DJAA 1WDKA 4ATNA 4CW7A 1SA0B 2B83A 3IP1A 3VTFA 4Y6LA 3TN7A 4B6PA 5HKKD 1HLPA 1OFVA 1LSJA 3EUEA 3TZLA 4R83A 3S5JA 3Q1KA 3TG2A 1G38A 4C2TA 3AU9A 4M99A 1SKYB 2CHEA 3KPWA 2TMDA 5JJLA 3JQFA 4IJWA 3HN6A 4IL5A 2RHBA 3KQMA 3UUGA 4A91A 3ND6A 2ZRIA 2PBLA 3QVLA 3TJMA 4GZMA 3D43A 2Q45A 1K27A 3H11B 3PCTA 5K8VA 5B6PA 5JCJD 1AUOA 5IH7A 1CUFA 4OGFA 2ZJ4A 2P6MA 4UNNA 4KPFC 3BFXA 3QVGB 1R64A 1JR2A 1VLVA 3K73O 4OHMA 3CT6A 2LV8A 3GJQA 3OZEA 2BGIA 1KRWA 5BYBA 1V4BA 1XRQA 2W43A 3SYTA 4DT1A 4F38A 3Q8MA 3T3OA 1LKZA 1OGIA 3G5AA 5AVOA 1VSTA 3E9EA 4JV5B 2A1TS 1QQ7A 3G5UA 4DUGA 4GNRA 5AESA 1E2EA 1ZIDA 4KXWA 4Z9YA 4OTZA 5DBHX 3T4PA 4FMDF 2ZSBA 4ZI7B 4EVIA 2PZMA 1EHYA 2GLTA 1D4AA 1ENYA 1GGEA 1NSTA 3ANXA 4XWYA 5FLEX 4D96A 1Z2CA 2W6JD 2X6RA 2J8ZA 2Y0EA 2GJSA 2WSBA 2IWRA 2P40A 4MXDA 4FB4A 1N32B 2ZANA 2NU7B 4P08A 5B2FA 1CY6A 2IHNA 1UODA 5DYNA 5GONF 1MAUA 3CRW1 5E3IA 1HE3A 4CCYA 3UGKA 3N70A 5ARCA 1TXGA 4WKGA 4AKTA 1XA3A 4D41A 1I7QB 5LUAA 2VPQA 2HJGA 4KK3A 3K8OE 1GQOA 3HO8A 4IJMA 1U8ZA 5IDYA 2XOKA 4B3JA 2WZQA 2XYQA 4CN9A 3KP1A 1QLHA 1CUAA 5LQJA 1Y89A 2IHBA 2EERA 3D8UA 5IDQA 1E9EA 1FSPA 1G3RA 2C5EA 2XA1A 1TZCA 1EGHA 2ODTX 3U4IA 3VNAA 2QEQA 1GITA 1UC5B 1V16B 1EJBA 2VJYA 3HGQA 1UBRS 4LDQA 3D2CA 4ALJA 2PWBA 2AQ8A 1NZDA 3OIGA 4K2AA 4P38A 4ND3A 1IXYA 3THOA 3Q3HA 5HIIA 1NXQA 3THXB 3FZGA 1W96A 4HDQB 2QJFA 3FAZA 4WVLA 3PEFA 4WXPA 2G8LA 4Y2TA 5K3DA 2VK4A 3PT9A 3HTXA 1GIAA 1TMYA 2EJVA 3OP1A 3EQZA 4HLDA 1XU9A 4Q4HA 1XZPA 3A1NA 3L8DA 4FFNA 4PPQA 5C4GB 5K8JB 1Y8CA 5CA0A 4OHBA 4G56A 4PYNA 3NBKA 3AOEA 4INJA 5DI3B 4ZC8A 2EKDA 4C7BA 3VBCA 2YY7A 2ISCA 4E1VA 2H0QA 3ZCTA 1M67A 2GD1O 1M8JA 2FRDC 4ZCSA 1NHWA 2HW8A 3C3DA 1M1YB 1QE0A 1C9KA 1QFYA 2FQYA 4OA8A 3VOBA 4DMRA 5AVXA 2O4CA 4L08A 2RHHA 4FC6A 3B7GA 1H5QA 1E6WA 2R6JA 3DTNA 4WFJA 1T6XA 2KLBA 2QAGA 4RKYA 1EFRD 1P7VA 4E11A 1PS9A 3PQ8A 2N1BA 4IZIA 3A1EA 1UXHA 5TQ2A 2Y9PB 1MG0A 2JD2A 1E1DA 4JB8A 4O29A 4Y2GA 4FI3C 5CVEA 3TGLA 4Q9HA 4ZI7F 9LDBA 4F2PA 3WNBA 4D3XA 1CUHA 2HTEA 1A5AB 5KNBH 1I10A 1W0KD 3DP9A 4MS1A 5A7GA 4BQRA 2ECPA 4E03A 4CEIA 1FDUA 1AT1A 1FRNA 3IB6A 4BP8A 3QWIA 3IDZA 4IFBA 2HWUA 2HSZA 1GL9B 1XVIA 2JZNA 2QTZA 4KQ9A 3RWBA 1BRMA 1QYXA 1T10A 2Y27A 2CBXA 5DNAA 4CTKA 1FDSA 1EQUA 1X7HA 3IUJA 5B57C 1IH8A 2BFEB 4Q21A 2OB2A 1QRTA 2P2NA 4OH7A 4GPZA 1R4ZA 2BONA 2NO7A 2P90A 2PO5A 2R6DA 3EUFA 4MWSA 3LK6A 1S2OA 3CNHA 2DRIA 3SBXA 3VV3A 2H5JA 4LF7B 2A1TR 1J99A 2X4LA 3V00A 3PS9A 1CUZA 1VJTA 3VKFA 1CRZA 4CIXA 1YL7A 2ACKA 5TX7A 1XFDA 4PGGA 2V3VA 2ZBFA 3L7MA 3TNFA 1PVOA 3NBFA 4AX4A 2HMAA 2Y1FA 4RQBA 3HU2A 3PEEA 1JLLA 5HJEA 1P6UA 1X94A 5INTA 1RWWA 6REQA 4OU4A 3V7WA 1V5FA 4GXQA 4MWDA 3K96A 2I4NA 3IIEA 2WPNA 2J7PD 2R00A 4GL4A 3HJUA 1XJCA 4JXJA 3L40A 4YONB 3LM8A 3TMYA 1TEZA 3WVNA 1QF7A 5FD8A 2G4CA 5CJ2A 4MSUA 1P2UA 2QZ4A 2X76A 1F9AA 1VXOA 2YHSA 3IIKA 5CDFE 1ZMBA 2G82A 2EL7A 1AQYA 1HE5A 1XRRA 1HEYA 2FPOA 4HH3C 4MW5A 1KK2A 2YQ4A 3NKLA 5TEWA 3W5IA 2QP4A 1F1JA 2QNIA 3RPEA 4FOPA 2FCAA 3SFZA 3SQNA 3UV6A 4KE9A 2BCEA 5EJ5A 4E5NA 4N3BA 4D57A 1YGYA 1UL1X 4GECA 1BKSB 1URPA 3L8FA 2BGLA 1YMUA 2P65A 4BHTA 1I3KA 3HJGA 1B23P 3ZBUA 3A1UA 1GG8A 1Y5MA 4GZ3A 4AMZA 2R1TA 3RC3A 4KXQA 1OLXA 3UK6A 2QVGA 3IAHA 1EK5A 1XEWY 1ZOSA 2SKCA 4XD7D 5EIOA 2OYRA 4F3CA 4J16A 2DQSA 5F23A 1N92A 2GYVA 1FNBA 3ZHSA 5AI0A 2XAUA 4Q4DA 4HHEA 2Y3IA 5KYGA 4Y7DA 1COWD 1ZIXA 1ZN8A 1RHUA 4OHCA 4MVWA 3CUUA 3M4JA 5KTOA 1OBHA 3DDZX 1HTTA 5IN5A 4DQLA 1KARA 4A16A 4P3PA 3VTZA 1E7RA 2ZYSA 1L5KA 4FW8A 4D3YA 1QWSA 4UNSA 4L5BA 2GPBA 3AF3A 1O08A 3EGIA 1FYWA 3ZDYB 3U5TA 1FJGB 3VKGA 1N3YA 3N75A 3ZY3A 3H17A 3R44A 3IKMB 4K6CA 5LNK6 3D6VA 3UPUA 1I36A 2Z6VA 3VGJA 5GV7A 3TTSA 3FB1A 4PSDA 1C3OB 3DDSA 2PPLA 5CRIA 1JBEA 1NVGA 3GEPA 3IDQA 3PDIB 4TS9A 3JALB 3T5PA 3PF9A 4MGEA 4MIOA 4O4LA 3U3JA 1MJ5A 3SVTA 3C7TA 3EARA 5JZ9A 2PMEA 1W36D 5HE8A 3V2GA 2VQ3A 2YW2A 3U4CA 1YWGO 1S3IA 2JH9A 3K2QA 1BGVA 3O1LA 4TGLA 3TUJC 2OCDA 1VP9A 3GEDA 4PSCA 5BT9A 1LDMA 1T1EA 4ZJPA 3TQCA 1VLMA 3BJRA 3G1UA 3I9KA 4OB6A 1WEKA 1G5HA 1RU3A 3WL5A 2VZLA 2G0TA 3AKEA 3HA7A 3MGKA 2GZMA 3L7AA 1QIKA 3PUYA 2FPSA 1M6VA 3NC4A 2I03A 3T0GA 4AN1A 2JFUA 3RS7A 1GVHA 3JQFC 5JSZA 5JPDA 3M1LA 3NT2A 1CYDA 3S1AA 5CEFA 2IWHA 3BMXA 2AC2A 4IQFA 1GQFA 2ONYA 3LS2A 4HL6A 1VPVA 2ZDHA 2OILA 2BPOA 4EEZA 2FSHA 4V0MA 3UATA 3K70B 3LCUA 3MTGA 4BVGA 4EZBA 2RGEA 1DRJA 4B4KA 4FFMA 2P3SA 1QOQB 4HQ0A 3FYHA 3C87A 3KFVA 1FSGA 3SJBA 4ACBA 1N5IA 1T3GA 4IGKA 3GIDA 2DKFA 4C0WA 4AP6A 1MO5A 5H4HA 2NMVA 3LKBA 1L5NA 1QHHB 4HSEA 2QT9A 1YV9A 2AS0A 4GO1A 2YS7A 2DPYA 5KSZA 3H65A 3ICPA 3UUEA 4ENTA 4Z4FA 3PWZA 4PCVA 3DEAA 2J48A 2P91A 1LPBB 2B8EA 3FCEA 3I6IA 1RI5A 3L82B 1KEEB 2Y0BA 3A10A 3RKSA 1A95A 3UMYA 3PUJA 1XTJA 2NO6A 2FG6C 1JYEA 1EVQA 5KYTA 4BVHA 4Z1MD 3H3XA 5BURA 1OZFA 2ZKIA 1E2NA 2JI9A 3EFBA 5CBKA 3GCWA 1Y42X 3K0BA 2J0VA 1YL5A 2OY0A 3BJZA 3OCWA 4UMVA 1ZH8A 3MWEB 4AO8A 1TT5B 2J3QA 4LXIA 2FZ4A 4DXAA 2ZJAA 2OXRA 4DC1A 4E5VA 1G5IA 1XMJA 3D8HA 4UZEA 5JXWA 2GPWA 3NHSA 4NI5A 3DBLB 1OXUA 2QBYA 2GZ1A 2QMZA 3EK2A 2FMHA 4G5OA 4YRCA 1SJ9A 4N0DA 2Q5IA 3GFRA 4PYOA 1Y5IA 2PFGA 3GG9A 3HCPA 4M8SA 2HRQA 2ZVJA 4ZEXA 4FFLA 2BCGY 1Z7YA 2GXAA 3WA6A 3DQZA 3LPAA 2R6HA 3AVTA 4RVNA 1BS9A 3I3SR 4LJ7A 3MELA 1OFUA 2IEDA 3LL4A 4NMLA 4X1IA 4XGNA 5DPMA 3PC8A 5DV9A 1EVIA 4EJFA 3HV0A 4BMXA 2GAIA 1NU6A 3T38A 5KQGA 3NWOA 1H9AA 2YFHA 3EJ6A 5ALWA 1J39A 2Z2XA 4P4NA 4ZOCA 5JIBA 1EK2A 5CJPA 2JFFA 4HDRB 1SXHA 4V0ME 2BKAA 6Q21A 1P1JA 1KYYA 2FFQA 4L8YA 4BVAA 2XUGA 3AOEC 4A3SA 5BXQC 1UADA 2B2NA 3FTCA 2CHFA 4JT8A 4MEBA 4TTIA 3BICA 2D3TA 3AUYA 3GLFB 5EWMB 2X1LA 2ZDQA 2N0SA 1GNPA 2B99A 3KR9A 4GPTA 1IBKB 3ZU3A 3L1KA 1IRIA 3NH6A 5IHXA 4MLZA 4MA5A 4P3YA 3DD5A 1KP9A 3G23A 3OQMA 4WNYA 4NR0A 4RH1A 1EB8A 3H8SA 3FTPA 2CK3D 3B13B 3B8EA 3HKDA 2PZAA 4KQXA 5HIJA 5GPBA 1ISSA 2G5TA 3MCVA 5DOZA 1T4CA 3R7NA 4C2BA 2QAGC 4BNLA 4LJRA 1L7PA 1Z26A 1E5TA 3OQOA 2AOTB 4N5MA 2I4IA 4UE3S 2FRVA 2F8SA 2CHQA 4GOOD 5K3SA 3DMFA 4RAQA 5EIFA 3S2FA 1SVSA 5CR9A 3WRYA 3X1ZA 5KJFA 3FR7A 3T7SA 1YXMA 4KSCA 3VDXA 4GDFA 1VZ2A 1U81A 1VJ5A 1Y7HA 2WAMA 3CH5A 4OY3A 4D8TA 3TQIA 2DSNA 4KDRA 3WGYA 1G8JA 3IP3A 3AINA 3I6ZA 2WKWA 1F51E 3VX4A 4BQFA 4HVAA 4YP0A 5CFNA 1P1FA 4PAQA 5IDVA 5B55A 5DB4A 3GN2A 1TK9A 1WZNA 3Q3VA 2AG0A 4GPAA 2UZ0A 4I8XA 5AIAA 6ADHA 2E5LB 2IXTA 1R6BX 4JP5A 1V11B 1GA6A 1NGSA 3BZBA 3V4SA 4CG1A 2FFAA 3KWFA 3VC3A 5GM2A 4AYXA 2YVQA 4N18A 1K5HA 4BV2A 4KIWA 3BXGA 5MFZA 2LKCA 2M9MA 3V8EA 3G79A 1C7JA 1TVCA 1E1LA 3W5VA 4WXYB 2A1UB 5CPBA 5I4IA 2OZPA 4D43A 5KPDA 2QPAA 4LF5B 4LI3X 4DR2B 7AT1A 3PVSA 4OXXA 2XBMA 2WIFA 4QWMA 4DYDA 5DN6A 2ZJ6A 4E6PA 5K0BA 5HQTA 3QTBA 4NVRA 4AMYA 4O6VA 1YBMA 4KVAA 1U0RA 2GA8A 3F6YA 3D3JA 2DWOA 3WGKA 3R9XB 2GM9A 1BDIA 4BCDA 5ARBA 3NHAA 4IZOA 3JATB 3MSCA 4F9TA 2OT3B 5J2UB 4H3KB 2J9ZB 2JEYA 1YB1A 3TQRA 2XQIA 2W2LA 4V03A 3VR6H 3MCTA 4WLOA 4R0VA 5KREA 5E2AA 1Q0UA 1YU9A 2CXSA 1NQOA 3EGVA 1NC3A 2XVMA 3KUXA 2R00C 4Q3EA 4GC9A 5DISB 2J0UA 5EZQA 4BNMA 4RTKA 4QREA 1ZJ4A 2IE8A 2G1UA 1M2KA 3AUXA 4FOOA 4ZOAA 4LPSA 2RB5A 1TMOA 1R8YA 5LWQA 1CY4A 4POAA 1SURA 1P2GA 3DE2X 3WYAA 4FWBA 4URWR 2CC2A 5K0SA 1IHOA 4QGAA 3CUWA 2FF5A 2JA1A 2O7RA 2PZBA 1J0CA 3ZHBA 3O82A 3K71B 4MW2A 1W35A 1YCFA 5ULLA 3SC3A 5G3YA 4XVCA 2OPHA 2GM5A 5AOBA 1JH9A 1K97A 3BJEA 4GH5A 3ZU2A 3K70D 1BXRA 1QK3A 4PO3X 3T9BA 1DFGA 1HZZA 2WV9A 3F2IA 1PFKA 1Z6QA 2IZ1A 2PZGA 5L3QA 2EL9A 2JFHA 4M6WB 4D0SA 4MAMA 3WK8A 3G0HA 1XAHA 4BMPB 1KDPA 3LF2A 4J16C 4YRBA 1JEYA 2BUAA 2CVQA 3CKLA 3DOOA 2QN3A 16PKA 3NPMA 5EHQA 2DOKA 2WSIA 4C7MA 1UP6A 3MUFA 5KQPA 4DM3A 2P9CA 2XE8A 1F4PA 2VUSA 3A4LA 3BERA 4R16A 1CERA 2LIPA 3GMIA 2VHXA 1Q77A 3CTPA 2WPDD 2XWPA 1SY7A 1MH9A 4LXGA 3FWZA 4N0MA 1RPZA 4EY4A 5JWHA 2PKXA 3VOAA 3QLJA 2J0EA 2JLCA 3V1YA 1HG1A 3GN1A 1IONA 4G65A 4FCCA 2C5LA 3ND8A 4UNIA 3R6LA 3EXAA 1R9MA 3ZE0B 4AMBA 5EXDA 1RRPA 4XQGA 1E3IA 4F46A 4UTRA 3L8EA 2PMKA 3KOXA 4FZRA 4YIKA 5LSAA 4NNOA 3KTDA 1E4EB 1Y1KE 3FHOA 4UBKA 1A9ZA 1EG2A 3JWPA 4K28A 4ENSA 2C59A 1A5SB 4FCVA 4PO9A 1CJCA 1CVRA 4JDUA 5A03A 1WZ2A 1ECJA 2DX7A 1LQTA 3DYIA 1VDMA 2J41A 5J2UF 3MJEA 3GRVA 1UIMA 4RTPA 4G5HA 4K6MA 5HZHA 2H2DA 2XYHA 3AZOA 1JDVA 4OHXA 3OZXA 3OOJA 2R86A 3AIKA 2W2OA 3KV1A 3C6ZA 4BOYA 1SXIA 1E2BA 1OAKA 1YKFA 5AK4A 5LNK1 2LE0A 5FLKA 1EP9A 1JXAA 3A3KA 2QTLA 2Q1SA 2HRBA 2XZDA 1PZNA 3AHDA 1DKPA 4FGZA 3E18A 1II9A 2Z1NA 1AGXA 8OHMA 3NTVA 2UZIR 1YBVA 2UVPB 3PXUA 5TV2A 2PDAA 5I9MA 1PTJA 3FRHA 2B8WA 4NZNA 4NYIR 2W0MA 2IOFA 2A5GA 5JFTA 4H35A 3TD9A 1B8PA 4P5DA 4C7XA 2GN4A 1D3AA 1TIBA 4DIEA 2BKEA 2PSJA 1SC4A 4QXPA 1XZEA 4OKSA 1QG6A 5AVKA 2V4ZA 2CW5A 3ZIUA 1SWWA 1T3LA 3RR2A 3WI7A 1EESA 1KI1A 2F2TA 2YV5A 1KSFX 2GEJA 2EJTA 3FDXA 3RNLA 2FHPA 3BZWA 2YHBA 1OTYA 1RKUA 1ZU4A 1XPJA 3T3MB 1LK7A 2BSQA 1YASA 4RTQA 4PFQA 1TT7A 1U4OA 2QYTA 3OOYA 4J0KA 4RDIA 4TOIA 1KI6A 1XWFA 4M7RA 3W4IA 2WJPA 1XJ0A 3QHPA 2AIRA 1DBSA 2QJOA 3QQPA 2NPIA 8ATCA 4UBLA 3MWJA 1M7BA 3BK7A 1I6KA 1PK9A 2E4WA 4PFSA 3DHWC 3SXJA 1L4YA 3RRXA 3QVTA 2AMVA 3JRXA 3L6OO 2VJLA 4RMIA 1Y9AA 4G81A 1DC7A 4MGZR 1T0JB 2EJBA 5BNWA 1H6DA 1XEWX 2COUA 4FOTA 4FYMA 4WXEA 4MV0A 1CR1A 2Z6AA 4Q4LA 4CJXA 1HV8A 2XDWA 4A6PA 2PSDA 2PXCA 1RCUA 2OAGA 2HMWA 3E35A 5HQ3B 1GPDG 1JLHA 2MOKA 4GRDA 3VISA 2J3JA 5E0OA 2DZDA 2F67A 2E89A 3WNDA 3FKQA 2IODA 3TRFA 3PC7A 3P52A 4ASUA 4F12A 1AXRA 1TA4A 4OHZA 5JC8A 4DSZA 5JROA 4D6PA 1ZYUA 1UBKS 3CFYA 1RW4A 1XOIA 3PC8C 2E87A 4MVJE 5D1NA 5FNVA 5GJCA 2RMKA 5FL7A 4PFJA 1DC3A 3CO0S 1D2RA 3NRJA 1V48A 3G89A 2VHUA 3KQPA 1B6SA 4GE3A 3AYZB 1QHSA 3T9CA 4GPIB 1V1RA 1H1TA 3D2AA 4JJFA 4RH0A 1UOQA 1PNTA 1NQXA 2F59A 3GZNA 5DGDA 1LRLA 4PZYA 5TS2A 3S28A 1Y4ZA 3OEEA 1AKMA 3AJAA 4RF2A 5B1HA 5H9VA 2A9PA 4J0QA 1H23A 3GFBA 3LBAA 4HNAB 1HC7A 3B3FA 4IMIB 1Z25A 3WMWA 1XHLA 2OL4A 4CFYA 3DT8A 1GKYA 1HI9A 3VXKA 4X1OA 1PUJA 3GJTA 2QE7D 4EFDA 4HBGA 4F2HA 3CH6A 1P0PA 3IT1A 3EWNA 4BLQA 4WAUA 5ALDA 2DT8A 4AK9A 4XLLA 1PR3A 1CEXA 4BUZA 1G8SA 3V80A 1XDBA 2CXQA 3CLVA 4EM6A 3TG8A 3I61A 1I7PA 3OICA 5B4UA 3WRYC 8AT1A 1G9TA 2C58A 1NVAA 3CWZA 3GV0A 1YKSA 4DMUB 1FQKA 2X4DA 5D01A 1JFSA 4YS6A 3D31A 1FMJA 5HIMA 4ZVRA 4TLBA 1E9CA 1P17A 4G0YA 2WRZA 2JPDA 2GMWA 4BN4A 3HEBA 3P2MA 4FMCB 5BNIA 3A7DA 5DNDA 2Z30A 2WVAA 3NCTA 1SHTX 2FP4B 3OT5A 2I4TA 3WDLA 4I36A 4V1CA 3C8ZA 3G68A 3OZBA 1NFQA 2GK3A 1XD2B 2ZIZA 1IQ0A 3UJPA 4BTEA 3C48A 5I5EA 5KUTA 1FMFA 2FCRA 5KDLA 1CFJA 4DRYA 3LD9A 5KTYA 3I1YA 3AEUA 1IZYA 1A3CA 5EGNA 3VVMA 3W2HA 2QXTA 4R1NA 2FPXA 3BGSA 1XG5A 2P9EA 4C1NA 4MV5A 1WXEA 2EEZA 4DM4A 5EJFA 4IUYA 1JG7A 4F71A 1Z4NA 1D0SA 1KJJA 1OFGA 2OZKA 3GAFA 1H4VB 1QVAA 3A9VA 3F9RA 5CX1A 5TPWA 3K9BA 4BLTA 4ZAXA 2I6XA 5KS2A 1W1UA 1KMNA 4DC0A 1PP4A 3VKWA 3QUQA 2PYIA 3PQDA 4ZKDA 1S6YA 2IX9A 2RHWA 3UXEA 1T2UA 1JKIA 3SHFA 4JR1A 2QM7A 3C5EA 3KKPA 2B5VA 4KYUA 2ZIAA 1SQGA 3IVGA 3OX3A 1AKVA 1L1RA 2FWBA 3MCWA 3RVSA 1KPHA 3S0JA 2R7NA 5BN3A 1YFKA 1SG6A 1N1GA 4EKGA 3U3OA 2KLHA 1TW2A 1N9GB 1WU7A 2QMEA 4UATA 3I9FA 4QX6A 3OX1A 3AI7A 2YICA 3ZWKA 3M34A 3GEBA 5FBWB 1QQBA 4LE0A 2OHOA 3AMVA 3T3PB 1MEJA 2OHGA 3M6FA 4PZ9A 1JW9B 3PR1A 1B14A 2LXNA 2O2JA 2PMBA 3RG2A 1AGPA 1J2UA 1DQSA 1PZXA 1NZJA 1GNRA 4P83A 2QMHA 3ZVRA 1KEKA 3LUHA 4AJEA 4CTMA 4UNPA 5EJ6A 2H5EA 4LCJA 1VMAA 2J07A 2ESRA 4HYYA 4Q9AA 4AMUA 1E5XA 5L4SA 1U6JA 2GLUA 2W2XA 4GW3A 4K03A 4KDFA 2DBYA 4XGKA 3GLKA 5A9TA 4L02A 5A2GA 4H4CA 4X95A 1EGAA 4XWGA 1LQ2A 1FU8A 1W4BA 3K1JA 5EJ7A 1JU4A 1V96A 1HZZC 1KFJB 3HJAA 4JI2B 3WHPA 2CDRA 1GTG1 3ANSA 3CF4A 5E7JA 4YQFA 4D92A 2IXFA 2K2WA 4FMCF 1O03A 1ZH0A 1T8TA 2Y1DA 4BNVA 5IAGA 4BQEA 3P9PA 4RVDA 4YI3A 5ERGB 5ILOA 4MJ7A 4DPLA 4QICA 3KTOA 1HTWA 1GCIA 1NQWA 2EFHB 2HHJA 2Q62A 3E3NA 4P2BA 4Q1FA 1WXFA 4X1KB 4B0OA 3M3DA 1Z83A 4TV8B 1DLIA 2C20A 2ZYHA 2P2DA 4GXNA 4IHJA 4QC2A 5CT8A 4HVLA 3THYB 3P7MA 4CCWA 4R9NA 3B9RA 1IWBB 1IFXA 2Y4NA 3PD0A 1XSEA 3BWCA 4OAOA 4BECA 1ZC3A 4R5MA 4ETNA 2RK4A 4WESB 2ZCUA 5BV8A 3ELBA 3S2GA 4EUHA 3OLVA 1KJQA 3AERB 2WKSA 5ESWA 5J4YA 2NV6A 1JHXA 1ISRA 3FM9A 4OQNA 2BELA 2JRCA 3R3SA 5EQTA 4GEKA 4DMHA 5LJIA 1IHYA 3TQHA 4QLBA 1FYXA 4KO4S 4GX1A 2CF5A 1E5VA 1KK1A 2LRHA 2RD2A 1JDBC 4LWPA 2FWRA 2NADA 4Q1EA 4EJ2A 3OTIA 3NANA 4ZAZA 1Q1NA 3KB6A 2C5AA 3GB9A 2NZXA 3ZWCA 3ZW7A 1P7ZA 4KB5A 1SHJA 2CMDA 2J4FA 3E82A 2ZE8A 3MXTA 3O1IC 4BMOB 5EHGA 3PNBA 1H2ZA 4D9JA 1FXWF 3WGQA 1IATA 3HCNA 2IEBA 2BGKA 4QNMA 1T36A 5AKIA 1ZSNA 4Z0TA 1AURA 2O0LA 1R6UA 1NT4A 4ZQEA 3QUAA 4ALNA 4EB6A 3OLZA 4JZKA 3TLAA 2VF8A 4BV8A 2SECE 2V9PA 3F46A 3H2KA 3K92A 2RKWA 3G9TA 3H19A 4TPKA 1W76A 3OMLA 5EZYA 5TXGA 3VHXA 2ZR9A 5IJ9B 1PTJC 4E5SA 2JL1A 3H6KA 4YT5A 2FYTA 2H65A 2J9FB 3ZJVA 3AETA 1M10A 3B12A 3QOWA 3HR7A 1CQWA 1K7CA 1YZHA 1F2UA 1H42A 1HYQA 1NI4B 1ZNYA 1QUEA 1UZMA 3IVCA 4YWHA 4I3HA 3AJ8A 3U2QA 3CXUA 5ESDA 4RZ2A 1JHMA 3BXZA 2AQKA 4GICA 1GLNA 3U62A 2WAOA 3HSYA 3DTVA 3RFCA 5AW0A 1OREA 4R1UA 4ER0A 2FJUA 2YN2A 5CDGA 3TGPA 1LJLA 2XGJA 4IDCA 2MU1A 3C1OA 4MRAA 5BW6B 1UT5A 2F17A 3K53A 8LDHA 1HMYA 2XCQA 4BQSA 3W1VA 2PT6A 3LKVA 5KHOC 1JIJA 1ESDA 1YCHA 5CNIA 3RS9A 1VE6A 1UIRA 2QSYA 3T5BA 3EIUA 1QIHA 4TV8F 4OGWA 3WMRA 4DRXB 5LLDA 5CUQA 1QOPB 1BCSA 3W2IA 2VPZA 3H3JA 3NORA 3T06B 1GO2A 3UUWA 3K7EA 1UWCA 4MO2A 4JI6B 4GRIA 2RSLA 4ITRC 1ONNA 4YV2A 3QEBZ 1X8XA 3PQ7A 2PUAA 2PGNA 2BBWA 3MWDB 4Q82A 1BVYF 2YJ3A 5FPKA 3FH0A 2IYSA 1JE1A 3ER6A 3WKDA 4YRLA 2IA5A 1JDJA 2Y6UA 4LSWA 3L84A 4Y1EA 5IXYA 2PAFA 3FPCA 5DTMA 4NATA 5L4NA 2O1SA 5FI0B 4ARVA 1Z47A 3UHFA 2CV0A 4AAYA 5CLGA 4EJSB 4ZT6A 1Z7GA 1ZH6A 2VYFA 4N3NA 3I2HA 2OVFA 3B85A 3RC7A 1JPNA 3DS8A 2OYSA 4KUGA 4B6OA 4DUPA 1DAMA 3ZD8A 2LVBA 4Q4CA 5L51A 4YY3B 4K9NA 1DX9A 1XIVA 2IZOA 2PRJA 3U60B 1S2IA 2ONKA 3DHVA 4P4UA 5CD1A 3Q3EA 2DHDA 3GGCA 4BNYA 2QMQA 2Q6TA 1V39A 3KKEA 5GM1A 1IPEA 2UDPA 4PYJA 3K1AA 5EIAA 3TTYA 1PS8A 2I7CA 4YT2A 4KO8A 1YRAA 3A14A 4LJ6A 5IEBA 1GGVA 4CV0A 2NQ8A 4JEUA 4MP8A 4MGHA 5LD2B 2IW1A 1WDTA 3NHLA 3DHEA 3T1TA 2XUQA 5AW8A 1RYHA 2AX3A 1E6UA 4A8JB 2HIAA 1R27A 1BW9B 1I8TA 2QHXA 1K7SN 3AM3A 4WDRA 2OENG 1RBYA 3EY9A 3N8HA 4AJ1A 3THWB 2G88A 4R2XA 2VP5A 2GN0A 4OQZA 2V54A 5DTIA 1KH2A 1NLUA 1GFWA 4GOLD 4PIVA 3UKJA 1XN4A 5C1DA 4PNPA 3MK31 5DHSA 2IHJA 3NTXA 4DA8A 1IU9A 2F55A 1FX0B 1GAJA 2XWSA 3F7OA 3A6EA 1W4LA 4EKIA 1NJ1A 3EBOA 4EABA 1Z39A 2Q49A 1Q7CA 4KIFA 1DXYA 3I9MA 4HDKB 1YB2A 3NYQA 2BAGA 4HZUA 5TGDA 3AR9A 4OO3A 1BWPA 2ZROA 1PR9A 3UG6A 1D1SA 1PT8A 3P97A 1ODIA 2B20A 1EUCA 3HPQA 3D1VA 3IP8A 4J0HA 2A8YA 1GRQA 4LPKA 1O0CA 3PFGA 1K8QA 3MT8A 3RVRA 5LQUA 4UXIA 1K4YA 4DHWA 1JLRA 1X7ZB 1SVOA 2ZRAA 1XYGA 4KN8A 4HB0A 2O2HA 2WJ4A 2VNSA 4BZXA 2CUKA 1H1LB 3X1XA 2G5CA 3OOHA 1N8TA 2G08A 2QPOA 3SHOA 4ZC1A 5DWQA 4L4ZA 3HVKA 4KXLA 4PZPA 5TGTA 4F04A 2EKZA 4B4VA 4AQYB 3ZN2A 4ETIA 1N57A 1CZLA 5DBGA 3HVRA 1ZA1A 3VI4B 2GCIA 5EJMA 5DW3A 2HHLA 2XUJA 4ENVA 2IEAA 4DJJA 2JI7A 4MKIA 5JD3A 2W37A 3SEQA 5I51A 1E0SA 4LEIA 4OMCA 3UJDA 1K06A 1Z5WA 2L18A 1C50A 3FNEA 4TS3A 4TMFA 3GH1A 4PAMA 4HFNA 1Z8NA 3TLGB 2O3RA 4RD3A 2Y0PA 2WOJA 2AN1A 4L50A 1M6EX 3P2KA 1Q0SA 3QE2A 1TTHA 5EE9A 1N1EA 2Q99A 1E2FA 1XZMA 2CFOA 4UVIA 1N5OX 3EXG2 4KVZA 4WKNA 3COPA 4J8PA 4XVUA 1OH7A 4G1UC 1TUBA 3OM9A 4B7CA 3FCOA 1D1PA 2BFBA 2YDYA 3AW9A 3HDQA 4QBTA 1CVIA 1N1MA 1MT0A 3B60A 5I9SA 3KETA 1IBSA 4FE3A 4BJ5A 4CYMA 3B2QA 4XEUA 4C1BA 1AS2A 1PFYA 1V6CA 4QO7A 4RACA 4U02A 5BV2P 5K8IA 3DO5A 1W5SA 4O5AA 3LRPA 2F3PA 2VXCA 1HLDA 1XZQA 2IDMA 2WY2D 3K05A 4RHFA 1UDRA 4C5AA 3UM9A 3B53X 1P3Y1 1PW7A 1Y7PA 2W9XA 2YN4A 3SZLA 3Q9LA 1NBMD 3FDZA 4O2LA 1MRNA 2RHRA 4F4HA 5FWDA 4I5EA 4P93A 1H2XA 5DM70 4AKIA 1X9IA 4DQXA 1OH5A 2RIRA 4G0WA 1I30A 4DM7A 3DW3X 2V5AA 1H93A 4OB8A 4C43A 4Q3BA 5E6RA 4E2FA 3P27A 4NOLA 5F73A 1G5TA 1ATIA 3DEJA 1WSBA 3N0RA 4PXYA 3H5TA 4WN9B 1NBIA 4OB7A 5CNJA 1ZCFA 3DH0A 3VH1A 3NM6B 5K8TA 1JWAB 4C0LA 1B2RA 4FFPA 5HJ7A 4RVHA 2PH7A 4GQBA 4F8EA 2O3UA 4M4SA 2R8XA 4LOLA 1VI5A 3OQHA 1KIAA 1SOUA 5H02A 4BFTA 1A9RA 4C89A 3IVRA 3TRIA 3KKLA 1X38A 3JQAA 4XZ3A 4CLDA 2FE4A 3FN4A 3KSBC 3AR4A 5L3ZA 1XK6A 1B42A 2CLFB 3OE7A 3IQWA 2QTBA 4UFOA 2YC4C 4H7PA 5EVCA 3USZA 4Y2UA 1TM3E 1K4KA 4Y9UA 4MARA 1WO8A 1DMRA 3H9UA 1O77A 4E5UA 4RGVA 5A9RA 3I1JA 3HK2A 3B6KA 1OQAA 4URUR 5CG1A 4UTPA 3O84A 3PQCA 4RMGA 1OZAA 2AI2A 2GBIA 2H00A 2HH9A 4KFSA 2H7CA 5G4KA 1BJKA 5B1SA 1O7JA 2AKAB 4RS4A 3T4UA 5K3OA 4U6SA 3TH5A 3MIIA 2DFPA 2OBYA 4BB9A 1C41A 1QXSA 3LWNA 1OKKA 2JATA 1SBTA 1ETHA 4J0EA 5CFZA 3EGWA 4QA9A 1T5HX 4EKYA 2QTVB 3WLJA 4TS1A 1ECBA 3HO6A 4MRMB 3TLMA 1GTJ1 3MW8A 4HJXA 4ZI3A 2CUZA 3GVIA 5F4ZA 3D5TA 3ZU5A 3Q9UA 3A6ZA 2DCUA 4AF8A 2VVTA 1MJFA 2ZT7A 4M1YA 3KAQA 4HUQB 4K8RB 1FCJA 1LNQA 2I66A 2WEKA 3KZOA 2M98A 2O8DA 4JGBA 5C52B 2WIBA 3ROGA 1M76A 1PJ2A 5J4KA 4I6GA 1NR7A 3N2GB 2P4EA 3AFOA 4DR5B 3C3WA 3ZDBA 4PZLA 3LRTA 4YRTA 1BE0A 3LFUA 4BZQA 4QE3A 1EUDA 1P5FA 2F1JA 4PG4A 4U9IS 1W44A 4A0HA 3NTQA 2F9FA 5CFQA 1KGSA 1TYAE 4NCIA 1PHRA 4CQLB 2OGSA 1D5CA 2NIPA 4QT4A 4P7FA 1P73A 4NICA 3I5YA 2ZR0A 4NU6A 1Y3CE 2CXHA 2J9XB 2OBBA 2PRZA 5B3KA 1Z22A 3CJQA 3PRKE 2C82A 4LZWA 4B45A 4LV6A 4TQAA 2CDBA 5I7VA 3H9CA 4LXUA 4PIPA 3HSKA 4U2CA 2QI9F 3WK9A 1UEJA 5EWJB 2DLNA 3U3DA 3GLHA 4C29A 4CFSA 2QX9A 1ZOLA 3QMWA 2GD6A 3T34A 3K6SA 3AL0C 4E21A 1W88B 5CM9C 3T7JA 5FTLA 1BU8A 3H6GA 2POQX 4N5DA 3KDPA 1DWPA 1MD9A 3RWOA 4DNPA 3ZVMA 4JBLA 4TKUA 3OPQA 1O6CA 4KQCA 4RK5A 5I45A 2ZAGA 1MVNA 5CGZA 3VZPA 3OIFA 2HHHB 4HGYA 4JP2A 1YUMA 3KBBA 4YMLA 2BGUA 4S05A 2V6IA 2PCJA 4EW6A 1QZTA 2GZ2A 4BGUA 4L4XA 4RL4A 4HLQB 1WUJS 1DZ3A 1EKXA 1NQVA 3OEHD 1GTL1 4H3HB 3SS7X 2AYYA 4MCIA 3QKSB 2OP0A 2G0NA 1Z5OA 2VJNA 4OMDA 4UVHA 2Q9AA 4R4JA 4V24A 1R10A 5EPUA 1BG6A 2V7QA 3HABA 3MUOA 3EJWA 4ZRMA 1UQRA 2D5LA 3EYAA 4C21A 1CRPA 2EJWA 2O59A 1SUSA 3BD7A 3PR3A 5EJ8A 4Z8YA 5F1OA 821PA 1BWSA 3Q7QA 1PJRA 5C8YB 4ACAA 4ZRDA 1CEYA 5TPZD 1JNYA 1C4KA 1JHUA 1Q12A 3OM0A 1FUYB 2A59A 3ZGZA 4Y1RA 3MWFA 1C9EA 3CQ9A 2CNDA 4AWBA 2XNDA 1JIKA 1ZN7A 4I3GA 2GZDA 4UU8A 1Q1ZA 1KAEA 3TD2A 5JBIA 1UBNA 2RHJA 2AYXA 2VATA 1CE8A 3A3YA 4NAUA 4M1QA 3ZQ4A 2QRMA 4MR8B 1NJ2A 1UC9A 3Q7SA 2HBQA 4P7KA