2XGGA

Structure of toxoplasma gondii micronemal protein 2 a_i domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
147
Chain Sequence
GTNQLDICFLIDSSGSIGIQNFRLVKQFLHTFLMVLPIGPEEVNNAVVTYSTDVHLQWDLQSPNAVDKQLAAHAVLDMPYKKGSTNTSDGLKACKQILFTGSRPGREHVPKLVIGMTDGESDSDFRTVRAAKEIRELGGIVTVLAVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Micronemal Protein 2 (Mic2) A/I Domain from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Hydrolase
molecule keywords MICRONEME PROTEIN 2
total genus 52
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2010-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 2xggA00
1U0OC 1YVRA 1FE8A 2VDKB 5KYNA 1Q0PA 3F78A 1U0NA 1MQ8B 4A0QA 3TW0A 3EGXB 2M32A 5E6UB 1N9ZA 1PD0A 2IUEA 1ZONA 1PCXA 1N3YA 3EFOB 1JEYA 1AO3A 3EH2A 1U8CB 4F1KA 1YVPA 4C2AA 4C2BA 5KYYA 4G1EB 4IGIA 4NENB 2VDLB 1CK4A 1QC5B 5KYWB 1RD4A 1UEXC 2VDOB 1IJKA 5E6SB 3TVYA 5KYUA 3PPVA 5HDBB 1MQ9A 2WW8A 4PN7A 1MQAA 5E6RB 5E6SA 1PD1A 3EGXA 2QTVA 3IBSA 4NENA 1IDOA 4IXDA 3PPYA 4MMXB 4XW2A 3V4VB 3TXAA 1XUOA 3EFOA 3M6FA 1JEYB 1ATZA 1IDN1 3EG9A 1SHUX 4F1JA 3HI6A 3BQMB 3ZDXB 4CN9A 2I91A 1NA5A 1MJNA 3NIFB 3ZQKA 4UM9D 4Z7QB 3TCXB 2VDMB 3PPWA 4G1MB 3EOBI 5KYYB 1XDGA 1T0PA 2NVOA 1MHPA 2XWJI 3EGDB 3EOAI 4HQKA 3K6SB 2NUTA 1DGQA 1JEQA 1TYEB 1AOXA 4C29A 3ZDYB 1FNSA 1SQ0A 1JV2B 2I6SA 5KYXA 3IJEB 1ZOPA 1AUQA 1RRKA 3HXQA 1M1XB 1RTKA 2NUPA 3FCSB 4M76B 4HQFA 4MMZB 3K6SA 3V4PB 2NUTB 4Z7OB 3FCUB 3EH1A 4HQLA 1M2VB 3QA3E 2ODQA 1MF7A 3GXBA 3K72B 4IHKA 4WK0B 4WJKB 3ZE0B 2XWBF 3BN3A 4UM8B 4FX5A 3T3MB 5HJ2A 1CQPA 2XGGA 3E2MA 4WFQA 3K71B 1IJBA 1RS0A 2ODPA 1JEQB 1T6BY 4MMYB 1BHQ1 3VI3B 5BV8A 2B2XA 3PPXA 3ZDZB 1BHO1 2VDNB 2VDQB 3RAGA 1PT6A 2VDPB 2I6QA 4NEHB 1L5GB 3N2NA 5ES4B 5KYUB 1M2OA 2X5NA 3BQNB 3NIGB 1M2VA 1OAKA 4BJ3A 4UM9B 5KYXB 2ICAA 1ZOOA 1LFAA 5E6RA 3VI4B 4DMUB 5LN1A 1V7PC 2NUPB 4HQNA 1XDDA 1JLMA 4CNBA 2O7NA 3EGDA 3HXOA 3ZE1B 4WK2B 4O02B 1M10A 1QC5A 4CN8A 5KYWA 2VC2B 3NIDB 4WK4B 1M1UA 1QCYA 5E6UA 1SHTX 2WINI 5HGJA 4HQOA 3EG9B 1DZIA 4JDUA 2VDRB 3ZE2B 3Q3GE 4Z7NB 3T3PB 2ADFA 3F74A
chains in the Genus database with same CATH superfamily
3UOWA 3ACCA 1QFYA 3CX3A 3UJPA 4KW7A 4IHJA 1EWYA 3HWSA 2GN0A 2CW5A 4DMRA 1RHMA 1NN1A 5ALUA 2XDQB 2IQ5A 1PG0A 4FLMA 2FPGB 3BC1A 5I7WA 1UFOA 2F55A 4FJ2A 4G0QA 4J0GA 1J0BA 4CT4B 5T64A 1GAJA 3AT1A 2VP4A 5D3MB 3WRXA 3VZCA 2XYRA 3P5BA 5F3RA 3BJEA 4AD8A 3R7WB 1LI4A 2W83A 3HVHA 2FN3A 2J4DA 4ND1A 1SBIA 2OR3A 4QBTA 4RK4A 3WIBA 2X5XA 4NCBA 1Y8QA 3EEBA 5AKZA 5NLLA 2H1SA 3QVKA 4XIGS 4BO2A 4TRJA 3FI0A 1O6GA 3RYCB 1IH8A 2GSDA 1QLJA 1MAHA 2OO3A 5DX0A 3UMJA 4QGSA 3IBSA 5A06A 3WMFA 2WYHA 4GHWA 1YUMA 5LMCA 2ST1A 1RACA 1NYQA 3L6RA 3NCTA 1U8YA 2Q3DA 3DR5A 1ECCA 3MOGA 4ZI3A 4LF7B 3B6IA 1SXQA 1AKMA 2IOFK 5KYKA 2PQ6A 1W5TA 1IBCA 1UKYA 2F67A 2PV7A 4PPQA 4AKEA 1E66A 1DUSA 3Q7PA 1T8SA 3GBVA 4WASA 1TB4A 4PC2A 3CC8A 5JDCC 1P7ZA 2BJWA 1WTAA 4I0WB 3OJXA 3E61A 4I1RA 9ABPA 3R0VA 2C8JA 3DZJA 5IAKA 2CHQA 3F2VA 3HDTA 3NWOA 5JPDA 1J00A 3Q8XB 1OLOA 1PUIA 3OQ1A 1LPOA 2V6JA 1MA0A 3I01M 2IDJA 3DOOA 4H6WA 4HFNA 5KO2A 4BRSA 3O8OA 4KWHA 4MUNA 1SZDA 3ZE7A 1O8CA 1Y5IA 4TYPA 4UE6A 4B7CA 1IXZA 2CNOA 2QP4A 3M81A 3KO8A 2P62A 1R5BA 2W2KB 1F3OA 2WAMA 3DLPX 3ZR4B 1YK1A 2FUNB 3GT4A 4B8ZA 3ICPA 2GEDA 5B1DA 2QL7A 3NWEA 1COZA 4AXXA 5IHPA 4ZXFA 3M33A 4L95C 4WJKB 5KOYA 4GKVA 2H59A 2J9RA 1SEVA 2WG1A 4OFZA 4D4KA 4FBMA 4QDOA 1KY2A 2E4WA 3KPWA 2IH4A 3GDGA 1Y48E 1E79D 4FFPA 4LY0A 1ZAYA 2PUDA 4O2BA 1K8ZB 5ED0A 2BHSA 3AIIA 4YAJA 3PQ2A 5CAEB 2RHGB 1IOLA 3PI7A 2WUWE 4KSCA 1EH5A 2YL2A 4JK3A 4TKVB 4EI9A 5IJ9B 1OLXA 2W0SA 3FYDA 4ODIA 4R98A 4ZVSA 1M2OA 3JD0A 3QM1A 2FPWA 1SPBS 1RAEA 4PANA 3O38A 4PAMA 4WLEA 1WBBA 1C7IA 5K4GA 2FLKA 4R1QA 4QT0A 2X19A 3GH1A 1MX1A 4LMAA 3WGTA 1Z0ZA 2Y8EA 4WNYA 1I7DA 4ZT3A 1K86A 1I4OA 2JBHA 2AMFA 1GKYA 1NW7A 3A1WA 3TXYA 3L0OA 1TOAA 4H3KB 1ESNA 4CETA 1N8SA 4QYXA 2C96A 4QASA 4DAEA 3TXXA 1KP3A 1QHSA 2PL3A 4HQOA 3AJDA 3DDZX 4IMIB 4EY4A 3ENVA 5GM2A 3GLFB 2BBSA 3DDNA 1UJBA 2QJWA 2ZVPX 4M8NE 4ND8B 4AROA 3WAJA 4PY2A 2RFLA 1PSDA 2Q1XA 4P4GA 2AGVA 3ESRA 3IIIA 1Z75A 3R6WA 1PG2A 2XR1A 4IL5A 2PT5A 3RIYA 5JV5A 5JJIA 1L8XA 3BZWA 1EK1A 4W5TA 5D3KA 2VNHA 1YZFA 1U94A 2QR5A 1GV0A 1FFGA 2XJ4A 1U8CB 1Z0AA 1DDGA 2H4YA 2R66A 1COWA 1QGUA 3WWDA 1I32A 1XA4A 2J1LA 3GLHB 5JCJA 1PR4A 1MOQA 3GR6A 4QRDA 3SXUA 3GLKA 3UK2A 3W34A 3ZXXA 1QE0A 1CJCA 4M3NA 4JBLA 2YJTD 1M2FA 4P2GA 1LVGA 4KE7A 2YMPA 2YYAA 4DM4A 1KFCB 2LE0A 2QYHA 1L5KA 4AWBA 3RHZA 1RM3A 2C8VA 3PE6A 1YCDA 1EM8B 4D98A 3AZPA 4MVJE 4YAEA 1NBEA 1UFKA 1OLSB 4EZIA 1NOIA 1IXSB 1RWBA 2FQQA 3HNRA 4LC9A 4OGWA 3SHQA 5IXJA 4WFJA 2IP2A 3QX3A 3IUMA 5JH7F 3NV9A 1X7XB 2A78A 3GOQA 1UK7A 1VHLA 2DQ4A 3EULA 3VKWA 1QTQA 1VL6A 2MDTA 1R15A 4QNNA 1ICEA 1J7KA 4JSRA 1SHLA 421PA 3CO0S 1H2FA 2D1QA 1KS9A 4LSMA 3TCXB 1BIFA 5CVTA 3UWOA 5FTMA 2EG9A 3LD9A 3QVGB 4R0NA 4WKNA 4ALIA 1BFDA 5ALVA 5EN4A 1TE2A 3U7GA 2OZLA 3Q6NA 3F96A 3EAFA 2XUDA 2JHGA 4FEAA 3RC1A 4IQ8A 3B38A 1OWMA 2H3EA 4GZMA 5F4BA 4UOQA 5H7XA 2TYSB 5B3JA 3K9LA 3SICE 3SG0A 2ZDHA 1DC7A 1KDVA 3FJYA 5TR9A 2ZT6A 2CCKA 1OC2A 2WNHA 5CA0B 3ZTTA 3U16A 2JCBA 3L3BA 3L7OA 3L4JA 3IEKA 4DBLC 1QPZA 1UM9A 1H1TA 1IEVA 3RV3A 3E3OA 4E5DA 1R18A 1CB0A 4YDSA 5I7FA 3ZI0A 1A4IA 1RC8A 3GPDG 2D0OB 4QM6A 2Q0QA 2DPMA 4Y0NA 1YRHA 3QW4B 5HJ2A 1U2DA 1I4EB 1KJNA 1DNPA 2BWJA 4NBTA 2AFHE 1DCTA 2X22A 4MMYB 5BW8A 3UB3A 1K7SN 5J3JA 1M6WA 2HRQA 2HQ1A 1UP7A 2PD4A 4HAUA 5DNYB 1C9NA 2P6PA 1UDWA 1UP4A 4QX6A 2XZTA 4F60A 5I3ZA 4TWIA 3D3NA 3OM0A 4CRWB 4BVAA 1BHJA 2H6EA 4NG5A 4UU7A 3LYHA 3SVZA 5AVVA 3VNVA 4UQOA 1CF2O 1TT5B 4AKTA 1XDBA 1UT5A 3CKYA 1GA4A 3FYCA 1GSOA 3KOOA 1TF7A 2QP9X 1Y8RB 1V11A 3E2PA 4EVRA 2QX9A 4OQNA 4JHLA 4LXUA 3IEVA 1CNFA 4UDNA 4V2IA 1DL5A 2O0JA 3H9EO 5K3FA 3L92A 3UXMA 1VL8A 2PMEA 3FPAA 1CP3A 2BGWA 4LRQA 3NIBA 1WL8A 1ESZA 3ZEIA 1PJTA 1YZQA 1E4YA 3HUUA 3DBHA 3QEAZ 4EPXA 2OG1A 1LS6A 3T95A 1ZH4A 5FWDA 1QH1B 1WM1A 3Q3IA 3PIRA 4D0RA 2Q5EA 3F78A 5D1HA 2F3QA 3DNMA 3JQ8B 1Z26A 4HAZA 3GWGA 4P4UA 4BTEA 2NVWA 2QRHA 1LF0A 5JH7A 3M9WA 1KGDA 1U5CA 4MB2A 5ECWA 4OQ4A 4LXQA 3ETNA 4G24A 3EA5A 4BQEA 4YHHB 1W96A 2RGGA 3U60B 1EGVB 4DHEA 2VUSA 4D42A 5KHLB 1F6BA 1RXSA 1CK4A 2JFGA 3VH3A 1TADA 2JEYA 4NV3A 2DH5A 5CA0F 4EZBA 2ZYHA 3AVPA 3ED5A 3HVIA 2CZGA 1D6JA 2CJWB 4PRKA 4HYTA 4AUNA 3V48A 1UBNA 4ALJA 4EGFA 1ZH6A 2Z57A 5JCZA 3FH0A 4CQLB 3UK0A 3LT0A 4Y2RA 1X74A 2ZGVA 3ABZA 3RVPA 4IXNA 2VAPA 5CD9A 3C70A 1P7PA 4K9PA 4HAIA 4PC6A 3A6GA 3B6KA 5KJFA 2WC1A 1SG9A 3NYRA 3LLCA 3X44A 2HY7A 2IUYA 2K2WA 2XE4A 2FOLA 3E84A 3BAFA 2J9GA 2XYGA 5CVEA 1XZJA 3H4MA 4G84A 2MSCB 4G85A 4J7XA 5H0IA 2IX3A 5CXSA 4H1TA 2R11A 1KOJA 1ORTA 3UWDA 3WLOA 2EFEB 4XWOA 3WGHA 2ODWA 5KYYB 1XZPA 2EBUA 2YVQA 1JDTA 1U8UA 3BXHA 2XVAA 4QA9A 5TY0A 1KFJB 1OJ7A 4AJNA 1VCNA 1ZD9A 5C52B 3HSKA 1O94C 1UBFA 2Z56A 4RV9A 4CFSA 1T2NA 1R3DA 5FBZA 5CB4A 4OLAA 4MEBA 1M1XB 4FYVA 3MJRA 3LOPA 4NCXA 1UMBA 4RA6B 2OORC 1FP6A 4MYUA 1NQOA 2OZLB 1BROA 4K9LA 2ZI6A 4YAGA 3RRJA 3B6JA 2BCJQ 1JSXA 4GRAA 3UW1A 5JAZA 4BO1A 3JQAB 2M6SA 2PMKA 1XU7A 9MHTA 1ZRNA 2I1VB 4XGQA 4X90A 1T5OA 2XGGA 4EG8A 5EKSA 3A28A 4G1BA 2DC1A 1P9WA 2C4MA 5HQTA 2QRJA 4JDPA 4H16A 1X94A 3UJCA 1C8KA 5FORA 4RHUA 1H22A 4D9EA 2REQA 2WF5A 3CS3A 2DRIA 3O5AA 1A5ZA 3HEAA 1Y3FE 1V8DA 3U39A 3FCYA 4MTLA 2QVYX 4DQDA 4ZEMA 3OQMA 2HRCA 2IEZA 1MR3F 1NU6A 4RD2A 4RZSA 4ENUA 1YIAA 5HOQA 5KNCD 1KWKA 1BW9A 4L8WB 4JEIA 1N1MA 4LMRA 4CMBA 3EGEA 3KQVA 2R8XA 1E2JA 3RBXA 3MILA 4JEHA 3B36A 4RHEA 1XZAA 1BWQA 3G5UA 4MWSA 2EX1A 3D2CA 1SVKA 2WK1A 3H5AA 3JWPA 3K92A 4WQMA 4XWWA 1SUFA 2OD9A 3BIFA 3KQQA 4FZVA 2HMWA 4P7BA 2XXAA 4EIWA 3GLHE 4UDXX 3LWNA 4R0VA 2G0AA 3VJLA 3GX1A 3FW1A 1EX6A 4J7AA 1MNQA 3DBVO 4UUMA 4JLAA 4IKPA 5T67A 1NV8A 1N4AA 3AMVA 2ADMA 3AI1A 4L28A 2R5WA 4KQ2A 5LUBA 3PNKA 1RVV1 5HM8A 3ZHTA 2CV1A 1LTKA 4D8TA 2OBNA 4ZYUA 4IIVA 1DC3A 1EP3B 5BORA 1WB5A 2R79A 3FIUA 4G4GA 4OMDA 2AW3A 3DBOB 1P0FA 2Y1KA 1BKDR 1Z0DA 2QW0X 1YVPA 1ELOA 2P2YA 4R69A 3R0IA 5CGZA 3RVMA 3USZA 1W36C 3STVA 4MI6A 4FOSA 1KI1A 2FR8A 2PT6A 3KJIA 3KVNA 3X1YA 3W7AA 1ZP6A 2X2EA 1ETUA 3B9RA 3A4NA 4AURA 1LI5A 3DAFA 1F2VA 4E4TA 5JSFA 1NP6A 1RBQA 1JJFA 4C6HA 5AM3A 4I9NA 3H16A 2WUVA 2PJUA 2J08A 3NPAA 1FW8A 2B2NA 3VV3A 4ED9A 4KPYA 1AUVA 1ULSA 5DTIA 1SAYA 3HEBA 4LOHA 1UBLS 1NN5A 1DO8A 2VHVA 2ZCVA 3PPYA 4KQGA 4LKOA 2VRBA 4L7QA 4KV9A 4IG4A 4QBHA 4X71A 1ARZA 5K0JA 3SJZA 1UM9B 1NW6A 2FPIB 1A5BB 1GT6A 1ZSYA 2VYVA 3KZXA 4EECA 2Q2WA 4HH1A 4CUKA 1EXNA 5EJFA 1D07A 4V24A 2GN4A 2H17A 2Z5VA 3GDWA 3IXLA 3GP8A 3NXSA 2FTKE 2OC4A 3HFRA 4C76A 3B5JA 3NETA 1K0FA 4HBGA 1N5OX 5G40A 1NL3A 1VSTA 2A9OA 3HSYA 2VYQA 2ZU6A 2WVHA 3QWBA 4QIHA 1C9YA 1R0SA 3D9QX 3LYUA 4YVFA 5LYYA 3TR0A 1Q1QA 3Q7TA 3HG7A 1XRSB 3ET4A 5EJMA 1JXOA 2A7QA 5BWCA 1NSTA 1A8SA 4U2FA 2ASVA 4N6OA 5AHOA 3O1JC 4IDOA 3VPGA 1Q44A 1MV5A 2O57A 4EYGA 1XHEA 2VWPA 1E8NA 4P8RA 2R4QA 5BN4A 2OCIA 2NUTB 3L46A 3L01A 1PJ2A 3L82B 2PZGA 3RVLA 3WLNA 5C8YF 3VMFA 1XAJA 2H1FA 2P9YA 4ALMA 2PH7A 3QE3A 3UC9A 5KDLA 1HK7A 3KSAC 1ZM9A 3GXBA 1I0LA 5DOVA 5J1SB 2E4ZA 4LHEA 3RADC 3OZ7A 3GJ4A 4QNMA 1MX3A 1N5LA 3PB3A 4MQUA 3TSWA 3JZAA 4BQSA 2QHXA 4FHDA 3WBKA 3M89A 4UVIA 2IPXA 1V48A 2D59A 2PLAA 4UHEA 4DV1B 1E1YA 3C7DB 4JUFA 4M0MA 4YFYA 1TJ4A 1N2SA 5DHTA 1FC0A 5HIMA 3V5NA 2GD1O 2VDQB 3F90A 4CCYB 5I6DA 1CJVC 3F6PA 1RP1A 4BU1A 2XVMA 4MX8A 4TLLB 2DF8A 3A4VA 1EGMB 3SXUB 1QRSA 2I8AA 3NM6B 3HFSA 3KJXA 4AWAA 1CDEA 4CT0A 2O8CA 1FFSA 4FFBB 1DQZA 5MGNA 2DE0X 2CNLA 2QLLA 4R8SA 4IG9A 4RCYA 3DKKA 1R74A 2QTAA 3EZYA 1VE7A 2EBWA 3G13A 1MENA 3KEOA 2F62A 4IGKA 5TEWA 1Z22A 1ZL0A 2I3ZA 1P9NA 4Z0PA 4O02B 5EHZA 2XA2A 2FJPA 2QBYA 1ZKMA 1Z0FA 1I33A 3Q85A 3EIOA 1SU7A 2FEKA 4EW6A 1N2XA 1ZU4A 3HJBA 3RLFA 5D8DA 2PA3A 4URUR 2GCPA 2XDQA 2VTKA 1XD2A 2XBLA 7MDHA 4AJ9A 3I72A 5HKBA 5A5FA 1NE7A 1PQYA 1SC1A 3H4IA 5BNZA 4E1VA 2WHRA 3OZUA 3CNQS 1V3UA 4QDKA 2W48A 1UKZA 2CLLB 1XQWA 5DX1A 3V32A 3OE7D 3CFYA 2G06A 4Y2JA 3PUVA 1IBSA 5IT5A 1OVGA 5KQGA 3QEBZ 1N5JA 4F5WA 2RGDA 2X3FA 1WCIA 5CXUA 2QTGA 5CTAA 1GTZA 2BGRA 3TFOA 4KIJA 1QK5A 2AFIA 4Z8YA 5FNZA 1H2EA 4FE7A 3EUEA 5BMOA 3ELUA 3TB6A 4PX9A 3WX0A 1E5VA 3IQZA 2I99A 1MT0A 3ITKA 4FEGA 2WA2A 3E22A 1MB2A 4L74A 4X8HA 5LZ5A 3LVQE 3CZ4A 2DXIA 2FSHA 4RKYA 4ZVTA 1YR9A 3KV1A 1SCJA 3SZ3A 4OB6A 4G1FA 3RSHA 1NKVA 1BMQA 4C7OA 3HYRA 2D0IA 5JD3A 2EKBA 4CQMA 1GYRA 2C0PA 4G01B 1L5RA 1L5VA 1G60A 3E9CA 5D5HA 1QYDA 2C5GA 4X20A 1OKKD 5ALWA 4QSMA 3Q3CA 3JQFA 1JKXA 2GS9A 4PLGA 4GMKA 4RVUA 2JVJA 2C1ZA 5LA6B 4OX9B 4YS6A 3AXSA 1QHGA 3IQEA 1GZUA 3NJ4A 5KSZA 3SNHA 1Q0UA 2VK1A 3UGJA 1RAFA 4KITB 1QZ3A 2UVQA 4KR7A 4KX5A 2JGMA 5P21A 3VPCA 3N8HA 4JI7B 2Q3HA 1PK9A 3MB5A 3MYRA 3PP8A 4IVNA 4MI3A 4X7MA 5JRZA 4U7GA 3QYPA 2VZLA 4MITA 4BLOA 3GGSA 3UA4A 1JFFA 1I1HA 4YV0A 2REQB 2F3TA 2HZBA 3O95A 1LVHA 2Z5GA 5HMMA 1O8BA 2XT0A 4X84A 1LBIA 3RSSA 2ECOA 2ZIGA 1E1QA 1E1KA 4Y0AA 5I48A 1QAMA 4BKMA 1ORRA 3N70A 1VKJA 4TUYF 2Q5LA 1MF7A 5EKTA 1ZUNA 1O97D 1FNMA 1U2EA 1Y1PA 2VQ6A 2Z2IA 4LXIA 1M2JA 5FNVB 3WNCA 1RE1A 4HF7A 1ZWLA 2YIVX 1W75A 1ZL2A 3HN6A 3ZC3A 2J9FB 3ZDZB 1JWBB 2ZYTX 5K09A 3B52X 3KR1A 3L84A 4D9GA 1T9KA 4YRLA 5EJ7A 1L5GB 3LX6A 2VYND 5FLKA 3JAWA 4ZQEA 5FADA 2HRBA 4J8PA 1FF9A 2PMDA 1GKLA 1JG1A 4QGAA 4RMJA 4GMFA 5FHRA 3JR7A 5ALRA 5GAJA 1OA0A 1ZAKA 5ERXA 4L2IA 2IOQA 1F60A 3IO3A 3G2JA 4REOA 5GP1A 2CEKA 5TMDA 2GGSA 2DPYA 4DJEC 1U3FA 3KS9A 2GBCA 3TCKA 5BP7A 5AKLA 4NF2A 2VHTA 5CK4A 3SM3A 1KEEB 2O2HA 3PU6A 1ZLYA 2R7LA 3DT9A 1E2PA 1G6OA 4Q3DA 1VYUA 2H1IA 4OBBA 1MAWA 1YE8A 4H31A 4Q9DA 3KTAB 5EIFA 1H2ZA 1KORA 1EFKA 3KWLA 4WERA 5AJYA 2BTOA 2HUPA 2H2FA 2OCAA 2WA1A 3LHIA 4TYQA 1UEIA 1XPJA 3K96A 4FYHA 3TLGB 5K8LA 1LVUA 1IZ7A 3WLFA 2Z6AA 5CEFA 2QP3A 3MMPA 3AJ9A 3SC4A 1MD9A 1Z0JA 1DAGA 3O3MB 4B6EA 5F23A 5AI6A 3RSZA 1X2BA 3PXEA 3NHKA 1W4CA 3Q3EA 5F1YA 4DSUA 3N0WA 1CHDA 5EMKA 2ZSEA 3RG8A 3H1GA 4O2LA 721PA 1OAOC 2B5OA 3K53A 3BMOB 4YP9A 5BQ5A 2ZJOA 3IE0A 4ZCTA 4PG7A 1D7OA 4KIFA 1M7BA 1SCUB 2VP2A 1LLFA 1TM1E 2MWMA 1VTKA 2OWEA 2P0YA 3B3FA 3DXZA 4ND5A 2PR2A 4QRIA 1E1NA 1E4EB 1FTNA 4UZSA 5B3AA 4EO9A 1G2QA 1HDXA 2HK9A 3SE7A 5JYCA 5K45A 2EATA 1K6MA 1F2DA 3AI3A 3JWEA 4RJ2A 1N0HA 1UK9A 2AC4A 3ON5A 5CNMA 3QF7A 7REQB 1KYTA 5BSEA 3GFFA 4PR0A 5F7ZA 2A6PA 4BBAA 3DBHB 1HKHA 3LL4A 1OFUA 2XQVA 2OGTA 5HZGA 3GLUA 3HUFA 2WR8A 4D81A 2YKGA 1V47A 1GXSA 3IKLA 2Q1WA 2ZJAA 3S0JA 5EEHA 1PWZA 4Q1AA 4TLCA 2G67A 2GYVA 3MAJA 5TXGA 2BFFB 1QHEA 4J16C 3VJMA 2O3QA 2RK3A 4EPRA 4JKYA 4W5OA 3ZLJA 1FDVA 5KNDD 5IH3A 1R6DA 2HMSA 4HAVA 4ND3A 4EY6A 1FOEB 2XTAA 4JYCA 3HHPA 2PDAA 4OMUA 5JMPA 3ZYCA 2ATXA 3CJRA 4NJOA 1T5SA 4CV3A 1PNQA 1RLUA 5BQOA 3FOZA 2BH2A 3QJGA 1UAYA 2QGNA 1BJRE 4HNAB 5COAA 2ZRJA 3CSDA 3KPUA 1Z34A 1WX1A 3WV5A 1IBKB 2J7PD 1Z28A 4OFBA 1QCZA 1JQJC 1XAIA 3F7MA 2PVSA 4FSDA 1EP2B 4X66B 1VG9B 4RQAA 1OAAA 4E22A 4DV0B 2R65A 4RQBA 4A7PA 4QSHA 2I5PO 1FDIA 2FSGA 2I6UA 5J9FA 2YV5A 3C5HA 3TZEA 4BMDA 6ADHA 3D4LA 4TYMA 4ZREA 5KINB 5CT6A 2I2XB 1E5TA 4UULA 3BCRA 4GXNA 4QTZA 3EGWA 4X0EA 4B33A 2FCRA 2V4UA 3QLUA 4FCTA 1VG8A 2XF2A 3LQ2A 4KSYA 2NU9A 4YC7A 3AB8A 3T7SA 2GJ8A 1DE0A 3PV0A 1CR2A 5SZHB 4P83A 4OLHA 1EA5A 3WADA 1QX4A 3DJFA 1DRKA 1GL6A 3M5DA 4DXHA 3Q8MA 3KVRA 4EHJA 2C9OA 1KI6B 4DG9A 5K3AA 4TL7A 3UM9A 5KPJA 1G3RA 3WSWA 1B93A 4UFNA 1R0YA 2CBXA 5KYUB 4Y7DA 1PUXA 4S0ZA 4YJ2F 1NVMB 2B83A 1K98A 2OM6A 1RI4A 2VXOA 1TLFA 3EC7A 4RIFA 2VJQA 4O33A 1Q2UA 4DV3B 3UJHA 5FWAA 4QD3A 2C8LA 3ZWDA 4EMTA 3LNCA 3INNA 4KQWA 2VG8A 1FNNA 3A2NA 2G88A 2Q5FA 1AKYA 3TTTA 2Q9UA 3BE8A 1BJKA 1O9HA 1Y1KE 3SIRA 3WK5A 1H1LA 2PSEA 3QEKA 2NTJA 4KAAA 4U9HS 1BCRB 5BSUA 2HR1A 1G55A 2ZJBA 4IX1A 3NYWA 4GX1A 4WKCA 4C1BA 3SMQA 3P0IA 1QQBA 3VZQA 3NG1A 3NAGA 4KSBA 5ERGB 4HTFB 1EM8A 1CDOA 3JALB 6Q21A 4RWZA 2IZ6A 4I1SA 4TSFA 1TKAA 1T34A 3GMSA 1FQWA 1CR0A 6ABPA 4LF9B 4ZZ2A 1JAZA 1AKUA 1IRXA 3B3QA 1MKYA 2XITA 4AMYA 1E32A 4F8EA 2ZYWX 5BVHA 4IJ5A 2AQHA 4LYEA 1AK1A 4ANFA 4POAA 3QQPA 4B79A 1JBEA 1QRDA 2GEKA 2EFYA 3WJ2A 4URZR 4CJXA 3BDAA 3MGKA 4Y2QA 1R5OA 2W5UA 3BYZA 1I4TD 1ZOIA 1HZZA 4YYZA 4PINA 3ASVA 3OA2A 4XQGA 3F4LA 3E58A 3O8CA 4AY5A 1MQAA 3H5IA 2C7QA 2ZW9A 4ZZIA 3N0TA 3UG7A 1P91A 3LUPA 1DKQA 2H4XA 1T1JA 4FKBA 1WW3A 4C5CA 3GFGA 2CV2A 1MP0A 1O3YA 4F3CA 2FWRA 3OIGA 1FVFA 3OSUA 4H1UA 4IPTA 4NBUA 1CZNA 4P35A 4ZRDA 3FOCA 3HMKA 2O06A 3I9V6 3SQLA 5BRJA 4EUSA 1SHUX 2VH1A 5GONB 1Q6YA 3HNOA 3UANA 4PQFA 5AVSA 4CEHB 3IEIA 4YQFA 4GVLA 3NT4A 4DPLA 3IQDB 2FSPA 2KBFA 2W6ID 1P7VA 1O95D 3OZGA 1WOYA 1H4VB 3PFKA 2ZR8A 1YRWA 4QPCA 3B1YA 3ZJ4A 1H23A 2QMOA 3OHSX 4A0GA 1GILA 1NQUA 1PDVA 4MINA 1GWNA 2NYAA 1Q3HA 1LY1A 1D2GA 1J09A 1KI7A 3DDUA 1KIAA 3GRAA 1ULTA 1DJOA 3H1EA 1P2SA 4L4SA 4PSKA 1NC1A 5EHNA 3U2QA 5DB4A 2ISCA 4OSPA 4G5FA 4FFMA 3FJ1A 1VJDA 4HWTA 3IMEA 4PV7A 4QLAA 3TGPA 4DA7A 5JAHA 1YZKA 3GUZA 1XA0A 2PS3A 1G8PA 4BFSA 1TQ4A 2ZIXB 3G59A 4QPNA 1GGHA 4DZZA 2YHBA 2QW1A 3KHSA 3TAHA 1H6BA 3VBEA 4Y2XA 3UENA 4BTVA 1FNBA 4GLOA 4WZAE 2YJ3A 1TK2A 3KOUA 1E64A 4GU5A 1O77A 5DGHA 2JGNA 1W6UA 1T6BY 3L2OB 5JVDA 1P74A 4DDVA 4TKVA 4Y8VA 1L1FA 4LF5B 1N7JA 3JR3A 2AXQA 1YZLA 3IX7A 4HDKB 1Y5NA 1XZNA 3ZIAA 3STWA 1EA7A 1R10A 1TPZA 2X13A 3HKCA 3HJUA 3LY9A 1SELA 4NCJA 3ME5A 2HWKA 3MGAA 3LA6A 4XYMA 3BRCA 5TS2A 5HJ7A 3N0RA 2O8EA 1T2EA 3EVTA 3AR8A 2V8BA 2ERYA 2JNWA 3ELYA 3LO8A 1F14A 2EJWA 4OATA 4UVGA 4D80A 5HHTA 1NI4B 2B7CA 3BZUA 4EA7A 4EKNB 4F2WA 5B58T 3TTVA 1SCNE 3FTDA 3IVRA 1Q16A 2P8JA 5A6SB 2RKOA 2VOEA 2FUEA 2O3RA 3HXPA 4KTVE 3KQKA 2RI0A 2A2ZA 2DPHA 1N8TA 1I94B 4YY3B 2B5VA 4UEWA 2X86A 1MVOA 2YXDA 4ZEVA 2PO5A 4XSVA 4BFWA 2EDCA 5G2OA 2V0NA 2AVNA 1CEYA 1FSZA 4JJ6A 1NMZA 3L7DA 1RWXA 1MU0A 1DTWB 2J31A 4KDRA 2O6HA 4RF2A 1RZVA 1XSEA 3GRRA 5KJCA 3K0HA 2BC9A 1UDCA 7ADHA 3RUFA 1YOVB 4BX8A 1JXMA 3O74A 4JZYA 1T5LA 4MH0R 3ILSA 4QDXA 2YWFA 4Q3LA 3U4QB 1SKAA 1QOPB 1XFAA 2I7CA 4WADA 4ZQFA 1IHPA 1XZCA 3HY4A 4L16A 3A2MA 3OFSA 4OHWA 4YWHA 4LHZA 4C4XA 1OTXA 1VCHA 1YZHA 5LQCA 3MFYA 2XWPA 5DBFA 1VHWA 4BNLA 3ZKAA 2R86A 3S28A 1UZMA 3AUSA 4LOJA 4JR1A 4Z9YA 2CWWA 2H57A 2J5XA 2DPLA 3LP5A 4QHTA 4OI1A 4CR6A 1Y0BA 5EI5A 3ENWA 1YS1X 1LA2A 3PC7A 4D8YA 2V7XA 3PK0A 4DLVA 4HS4A 2X3YA 5IT0A 4Q4HA 1SA0A 3UMRA 4CEJB 1YONA 4MVJA 5FA8A 5B2ZA 4BB6A 1A95A 2XVXA 1J1ZA 1ONPA 2I33A 3QMVA 4XGKA 4C3VA 4RZIA 3NRCA 1TCCA 3GVHA 4NNOA 1MAUA 2PXCA 4F9FA 1CJTC 3R44A 2UU9B 2WWTA 1DAPA 3JSXA 2ZRNA 2C54A 3R3JA 4J29A 4CBVA 3DH0A 4KRGA 5G4KA 2F9MA 1HOTA 4KFUA 1GDDA 1GFWA 2OWDA 3EDOA 4X8OA 1K9SA 1NXPA 2WHYA 1N5DA 2VAVA 5DI3A 4B3CA 4U2KA 4XDHA 1YFJA 4PPNA 4R9UC 2PUVA 5M04A 1X1BA 5TQVA 5EQJB 4FMCB 5DNWA 4CKBB 5BPFA 1CC1S 5EHQA 3ZZNA 5IT9A 5ENDA 3JQDA 1U1FA 3ECSA 3R5SA 1MFPA 1XZDA 3I83A 4MYSA 3JRNA 3FR7A 3FGOA 5A7GA 3QFSA 1HETA 3BHNA 2GZAA 4ZEXA 2WWFA 2OBXA 4RH3A 4TYWA 1KZ9A 2IPLA 3O92A 5BNTA 1VECA 3EIEA 4KE8A 1BHQ1 2Q4BA 3EHDA 3IP3A 4DSAA 1BN6A 1XMJA 1RXWA 4RJJA 1FTWA 3OQOA 4D82A 3QTBA 2LCFA 4F3NA 5DM2A 2GCGA 3IH5A 5JYDA 5EWJA 1D2NA 3L7MA 1GPKA 2IPOA 2QQGA 3OUTA 3WLIA 2QGZA 3AWIA 4UHHA 2I3AA 4BNIA 1KKMA 1JG4A 5FXMA 1O4VA 2A0YA 1L5HA 3ZW8A 4ZHQF 1MHTA 1CUZA 4Q1CA 4Z8XA 5TSDA 1KWGA 4H7EA 2J32A 4JLJA 5BMVF 3VTAA 1K08A 1J9EA 1AK2A 5HKKA 3P20A 2DBRA 3EZXA 1AMNA 3UOAB 2GILA 2OVFA 3B9BA 4XIJA 5LL6P 1VP3A 4QJBA 1W1IA 1UPBA 3M34A 4P6VF 3MCUA 5MN5A 2W2MA 1YR1A 2OV8A 3ZCQA 1FFDA 2EKQA 3X2EA 1I9GA 3IEMA 4LSWA 1DBPA 3EXG2 2FWAA 3RS5A 4EGQA 4E46A 4UUBA 1UR5A 1ODTC 3AVOA 3OPVA 1F8XA 2IY8A 3GYGA 4QUJA 5JRDS 3FNEA 4B0OA 1YZTA 1UOQA 2AR9A 3N39C 3QE4A 5DEOA 5ALHA 2MYTA 3COYA 1H3NA 2P67A 4CGYA 1ZQ9A 5A4JA 5COQA 1JEOA 2X42A 2JHAA 3JQGB 4I9HA 3S8EA 3MBIA 1PI3A 4IIJA 1OYWA 4QLOA 4INAA 4HVAA 1J8MF 4ETMA 3GI1A 1S2DA 1GLVA 3C3DA 4WCDA 4L6CA 1QF6A 1T91A 3TR6A 2GESA 1TFRA 2A86A 3ESCA 2XSZA 4UVHA 4ND8A 3T1NA 2AUNA 5IUJC 1ZJWA 1QQAA 5D7NA 3DOHA 2YWHA 4TYYA 3T1HB 2IGTA 1P1JA 2EQ5A 3T5PA 2I6TA 1BA2A 3OZXA 2CZCA 3PXCX 4EB6A 3GP3A 3CVXA 2POQX 4P92A 5DWVA 5DV9A 3MJHA 2JI8A 3U0VA 3UTDA 2EV9A 1JHVA 2HGSA 4ARZA 1DAOA 3CF4G 3G1TA 4JSYA 1VXOA 4BLSA 1JB1A 5LOVF 1GGMA 3W5SA 5I9NA 4HJXA 3TIGA 4PCUA 4D57A 1PYOA 3O90A 5B1HA 1EK2A 4FPXA 4L9RA 4KXYA 1Y1SA 3M1IA 5I45A 1KJ8A 3DONA 3D5EA 3FNFA 3AEQB 3WDKA 1X92A 1F20A 1JYSA 1XT6A 4K6GA 3NBUA 4L4UA 1TUIA 4A36A 3MRTA 2DFKB 1D6MA 1GV1A 5CJJA 4POOA 4BMNA 1U2TA 1U0TA 3AZOA 3K1AA 4HUJA 3KAKA 4IHJF 2GAAA 5HIJA 5KDDA 2PX6A 3IV9A 3FLAA 2CLDX 4B7ZA 4NAHA 1JU3A 1S8AA 1A8IA 1T8WA 3KK0A 5JMOA 3ZY4A 4LAFA 5HTKA 2YHIB 3KYJB 2QLBA 2CMDA 4ENSA 3T6KA 2PFKA 1F9AA 5IVHA 3WZMA 2BKEA 4UNQA 1YVEI 2I55A 2FEMA 1P7YA 4HPJB 2ODQA 4EK9A 1N25A 4Q05A 1DRJA 5L8VA 2ZI5A 3ZE0B 3U13A 3PRYA 3LRPA 4J3FA 4DMFA 4KR0A 2I34A 2VXCA 3H04A 5AIAA 3FCEA 2VZ8A 3EGCA 4PGMA 2HJVA 3ZXIA 3BFXA 3MWDA 4AC9A 2NU8A 4EEZA 1IB0A 1TDJA 4C6RA 2HLDD 3PJFA 1C7RA 1PFQA 4LY3A 4OKSA 1C1DA 4I2NA 1PT8A 2DFNA 4D3YA 1O0BA 5LPNA 1C0IA 3BTUA 3M5CA 4GZ6A 1V5GA 2J5QA 2JFWA 5AVOA 1YJAA 3KAQA 4MS3B 2EERA 3VJRA 1A3CA 2XB8A 3M1LA 3EDMA 4WCFC 3ZNNA 3ZJVA 1AH2A 3JYOA 4B4OA 4NXNB 1PFUA 4A0FA 3TSCA 5EIEA 5EPOA 3E8SA 4GAEA 3OT4A 4P1ZA 4YJ3F 1G2PA 4DLRA 4ZCRA 1WETA 3LLMA 4R2JA 3G9XA 4BP8A 5IBPA 2YOHA 4HK4A 1D1TA 4G0NA 1CIVA 3TJZA 3DWEX 3V7UA 3W04A 1EKXA 1IL0A 1N3BA 4R8KA 2QJRA 5LQRA 2X8JB 5LOVB 2FZ5A 4XWKA 2HHHB 1IVYA 4MRNA 4UFOA 3DEAA 2BBWA 2JD1A 3URMA 4CQJA 2C57A 3DEKA 4RVGA 3RS9A 2FW1A 3DF9A 3KQMA 5DHQA 4HX9A 1C30A 1SBTA 1IZZA 3HWRA 4O2BF 4P82A 2PCLA 3O1HB 4GDFA 4FHGA 2BMWA 4Q66C 1PWHA 2ILVA 3H2GA 3P0FA 4IQ0A 1W35A 1ADFA 2VJKA 3CX7A 1NE2A 1PV2A 3OD5A 4Q3KA 3UMSA 2Q3JA 1E0DA 4JI3B 1Q1EA 1LJ8A 4LYDA 2R6FA 3M4JA 4MK4A 4UTPA 1A97A 2KBEA 1ZUD1 2GN1A 2F1JA 3OJ0A 1UFRA 4RK0A 1N1EA 3TE6A 3WB0A 4BNZA 2AEEA 3AUAA 2OCYC 2RGEA 5CHEA 2VP5A 3AQIA 5BUZA 2IU4A 2OCXA 4EG6A 3AHHA 2WTXA 1RHRA 3N2GB 4QATA 5BV1A 3ILHA 1PEAA 1Q1NA 1SKUA 2FWMX 1IIBA 3OI7A 4F4FA 3EIQA 2IEYA 2PL5A 3MBKA 3QTLA 5EIAA 3DSRA 3N3AC 3GD7A 5KNDA 5LIRA 2I03A 1YCHA 2QTFA 5CVUA 4CLDA 3ZWWA 2FPSA 4LMPA 1EDOA 5DHRA 4ZO4A 1E1RA 3BQMB 1FB5A 2PVPA 2VJDA 5ALSA 2YJZA 1SOAA 3UB4A 3MCVA 2ID8A 4E88A 5CX4A 2A9PA 4H60A 4I1OA 4N7BA 3UN1A 5T6MA 3K8QA 4MPRA 3MBOA 4UPVA 4UHKA 1EK5A 4ZARA 3UH0A 1NW3A 3EFHA 4IX9A 3H5OA 2D1YA 4FFBA 4G4IA 5ITZB 1RQ2A 1CX9B 2ARKA 2QE7A 4MRMA 5T6BA 4BHTA 2FP4B 2I80A 4HLUC 4MCHA 1E18A 1HDOA 2OFXA 4A8PA 3T7AA 3FMVA 4QYIA 3B6MA 2PKWA 1BKSB 2J85A 3E81A 4I1UA 5DH9A 4D3ZA 3P2IA 3EXHC 4EHFA 4RXMA 3PXGA 5M34A 1IYZA 1QG6A 2FN9A 2VBFA 3NAQA 3ZDRA 2BH9A 5AM2A 3AR5A 1SB9A 3B7PA 2EL9A 2HMAA 2B61A 3BHMA 3BWCA 2R00C 5IXYA 2ZROA 1QOQB 4O25A 1JMYA 1N2BA 3RVSA 1YB1A 5GGXA 2EJBA 2VPWA 1TXGA 1NUQA 3FZYA 1GTSA 5JWOA 2Z9CA 5D7BA 2A1UA 1T13A 1SURA 2V9CA 4UD2A 3FUTA 1P4HA 3ZWPA 1AT1A 1YE3A 3DE4X 1JEQB 4M36A 3IUBA 3K0FA 4V38A 2RB5A 3RKUA 3ZWXA 4F4IA 1KY4A 4OHBA 3HVUA 1HEUA 2VDPB 2YNMC 4LECA 5E4JA 2Y27A 3QTTA 1MO5A 2VT3A 2PMBA 4I6EA 2HHCA 2CMKA 4LCJA 4NH4A 5FI5A 4B75A 2OO7A 4RL4A 1ENPA 1V8ZA 5CNJA 1MN6A 2EKZA 4ENTA 5DXAA 2WSIA 1K88A 4BO8A 3GJ5A 3TECE 5GJBA 2Z2ZA 3LECA 3RRFA 3OZSA 4OB7A 4AKGA 4TS3A 4D9BA 3ZZ1A 2YMQA 1N2CB 1TRHA 1Z16A 1YS9A 4GPEA 4GQAA 5BW5A 3UFBA 4AI6A 3VR4A 2BDTA 3WFJA 3GLSA 1DMSA 2HPHA 2FMTA 4D9KA 2IQIA 2WINI 2C2XA 4YAWA 1TO2E 1LRKA 4NZNA 4UD6A 3VM6A 4QT4A 3U19A 5KNLA 3DOJA 5E1BA 3LKZA 3PD0A 1NI3A 2X0RA 3CW2A 3JVEA 3NGXA 2ODAA 1EBUA 4BN4A 3BWEA 3QELA 5D1NA 3A1CA 1C0PA 3G0BA 1EFUA 1M6VA 4D43A 4PR3A 3OY7A 4H2DA 1AQNA 2PS0A 1TZKA 3HVKA 5IWCA 2VYNA 2FSSA 3IDZA 5I5GA 3Q3HA 2DT5A 1AUOA 2WM9B 3ANXA 4GL4A 4RK5A 3TQCA 3W05A 3ND5A 2JBAA 4EWLA 4J3NA 3GVPA 4TMZA 1RYBA 4BKQA 3ROKA 3A37A 1XX6A 4Z9XA 2QK4A 4MO2A 5K01A 5KNBD 1RWKA 4K28A 1MTZA 3FB4A 1R3UA 3SJBA 1BO6A 3JQ9A 3KYCA 3PDJA 4X3CA 3RB8A 3UICA 1ZGCA 5I7AA 2HXGA 3O26A 4UEQA 2J3MA 3QKRB 4DXAA 3BTSA 3SLGA 4PTZA 4UTVA 3M5WA 4JOBA 1Q0HA 5BWOA 2Q9AA 5BYAA 3NHJA 1XK7A 2ROQA 3BDIA 1WXQA 3KE9A 1GA6A 3P32A 3QPVA 4G89A 5FUXA 3DTYA 3G6KA 1LLCA 2HF2A 2PLWA 3DAGA 4HMQA 4TROA 1EJ2A 1KJYA 2AF4C 3U1TA 2PU5A 4ZMRA 1J20A 1TF5A 1A9XB 2WIJA 1TECE 2WE8A 1Y8CA 3HXKA 1BU5A 4I55B 5K05A 2I71A 3ZD8A 4CI0B 3MUEA 4F38A 4ZV4A 5CX1A 3HJTA 4MP8A 4P3KA 4U2CA 3W6NA 2H4JA 1YFLA 2AZXA 1BOFA 3R5JA 4IZ6A 4PLZA 3STYA 4FDLA 2G7ZA 5ER6A 1TUGA 1JR3A 4WOCA 1HURA 4FUQA 3PUIA 4MI1A 4MSUA 5EZSA 5BWLA 4CLOA 3O93A 3DF7A 3A31A 3F8WA 1WKVA 3FMOB 3JQQA 4M21A 1AY0A 3H84A 4MPJA 3ZWNA 1KYVA 1NYRA 1KGSA 4A2WA 4E6PA 3GCDA 1B2RA 1HGXA 1MORA 2D0PB 4RV5A 3VZDA 5EZYA 4TZ6A 1T5DX 4L4ZA 2H5EA 3FCUB 4RTQA 3PS9A 2ES4A 4ZO8A 1Z5UA 3UKOA 1EUCA 3WLRA 1V1MA 2OCDA 1NVUQ 4MW6A 1XJCA 2XGOA 4WACA 3UAWA 1YJXA 4RQUA 2PKEA 3E4CA 1NRXA 2W6ZA 4NXMB 1JJBA 1O54A 1MEEA 2PWAA 1J33A 1IJBA 1A72A 5DU2A 2FUKA 3TOVA 4C0LA 2VLBA 4NDNE 2B2XA 1CS0A 1GPJA 5FR1A 5KIAA 1BHO1 4MUJA 4AM8A 3SAJA 3KETA 4P5DA 3O82A 1WF3A 4BCCA 2I4RA 1NULA 2V7PA 2ZR7A 3H2BA 5A7HA 2PRIA 3ZU3A 1UIRA 3OOJA 1AQJA 1BEZA 2LTAA 4LZWA 2F4VB 1R8SA 3C6MA 1DOHA 2CB9A 4FFDA 3BIWA 5FL7D 3A0RB 1DRUA 1X42A 3GJ7A 3MJVA 5BQPA 5CDFA 3VH2A 2HF9A 4KB5A 4W5QA 4AJ4A 4P4LA 5JLJA 3PEFA 1B7GO 3HCRA 4W99A 1U0EA 4V3BA 2P3QA 2QRUA 3CH5A 1ZJ6A 1MABB 4X1YB 1FXSA 4NQZA 2IGBA 4TMWA 1I30A 4PC1A 1WDLA 1WMEA 2Q27A 1NYTA 2CFOA 2HKIA 3E0QA 5B1IA 1BAPA 3N07A 2HA4A 3WNDA 3HDHA 4QO8A 4DCJA 1BGXT 1T25A 1J2JA 2BE9A 4MVJF 1I13A 3SE0A 2ZJ6A 1HQKA 2FETA 4EJSC 3AOEC 5JECA 1ZN9A 2VNJA 1IHUA 1QFMA 2XRYA 1AS3A 3HWX1 2VPXA 4ZRNA 2C4WA 1P1HA 1AC5A 3D43A 3F6SA 3G2LA 3IC5A 4ETNA 2C9YA 1E9SA 1E9FA 1DKRA 2X0DA 5BYJA 2VZ0A 1XEWX 4M9UA 4GX0A 4Y1FA 4DV5B 1SXPA 2FHSA 3ZDEA 1T0UA 2ZWVA 2UVDA 4O2AA 5K2MA 1DIRA 2DLNA 3KR2A 3BD7A 1Y34E 4B09A 4ZYLA 4J1SA 3G0IA 4MYDA 1CZLA 4M89A 3WK8A 4AO6A 2YJGA 1JR2A 4JASB 2FWIA 2EFHB 1NURA 3KG2A 2DFVA 1SC3A 3GY0A 4Q4JA 3TW4A 3ETCA 4RPJA 4FZJA 5DT2A 3UGQA 4EMSA 3TG8A 2NU7B 4ARCA 1U6JA 1W9MA 3FKQA 1R0LA 3KZMA 3PHLA 3OG9A 4JIGA 4REMA 1DDOA 3ZWQA 4NZZA 2JA2A 4URXR 2PKYX 3IVAA 1CJUC 4HDNA 4E4YA 4M2LA 4YH1A 3NBAA 1ZEJA 3QJ5A 4N8SA 1SKMA 1Y1QA 3FGPA 3FUXA 4LV5B 4QM7A 3DB2A 2G77B 3WXMA 4JJEA 4NARA 3NYQA 1MTOA 3GZNB 1PR5A 4Q7LA 3VSBA 1D03A 2C7GA 4GECA 1GPDG 1JQ3A 2EWWA 5FNVF 5KQPA 3OLZA 1KK3A 2FXVA 4TTTS 2D2XA 3CZRA 4FMBB 2H7XA 3PRJA 5ENVA 5IYZB 4EOGA 3CF4A 2YQ4A 3GJ0A 5ILOA 4IDCA 2H9AA 7ABPA 5JASA 3RE1A 1B8UA 5BSMA 4QFBA 4BNFA 2QRNA 1Z38A 4GMGA 1LQUA 3G9ZA 1SPXA 2J48A 3BTVA 3ZTWA 4DVJA 2BUBA 3FWNA 2O6LA 1NNUA 3LW7A 1X38A 4NYIR 4P86A 2C3MA 2KI5A 2OHOA 3I05A 4HDMA 4JL6A 4WY5A 3EXFB 4PXSA 4LI3X 4E94A 1WMAA 3I2HA 3M82A 5LP6A 3GLGA 4ZC1A 4BKOA 3HA7A 1Q0RA 1ZGAA 3MWJA 4IDNA 4FZ5A 5FPTA 4OM8A 1Q7GA 2Q41A 3DOFA 4KC0A 3SF0A 2PTGA 2G71A 4JT8A 4JIMA 2WOOA 4L85A 2R8ZA 4C4SA 5CB0A 1CUIA 1F0PA 1G66A 1PJZA 3I9NA 4PW0A 4XVUA 5B1EA 4XLZA 1RPZA 4OBEA 1NR5A 2HF7A 3UATA 3HBMA 3CLRC 4BWVA 1SOWA 2PXHA 1QDLB 4Q48A 2BGMA 3RS3A 1GA1A 2G8LA 2PO7A 1JDZA 4H59A 4CMEC 2K5UA 3HXTA 3TTUA 3TDNA 2WF7A 3F9IA 2VJOA 3ZGYA 4A5SA 3WYGA 1YQQA 4OLFA 3U3XA 3HCDA 5SZIA 2CSXA 1F4VA 2VYVD 1CNMA 1RMYA 3PXBA 4LISA 1USGA 4UBJA 5T41A 2P9JA 4KN8A 5REQB 1G19A 3GJQA 3HCPA 3KFLA 2JVKA 5EWMA 3BEOA 2WFMA 2WZQA 4CN8A 2VC2B 4C01A 3VTKA 3B3GA 4TVSA 2G82A 5KUTA 2ZCJA 2X41A 1FBNA 1O6FA 2MIIA 4GD3Q 3SQXA 1SHTX 2XOKA 2Q6VA 2KQUA 1BMTA 2HSWA 1T36B 3MRXA 3DT6A 3ILYA 2G0NA 2P9HA 4K9DA 5TV2A 2PJRA 2XB2A 2QZ9A 3UIEA 2QX4A 3AEUB 1PJ8A 3CISA 4LDZA 3UV7A 4EJ0A 4KODA 2CNWA 5IC4A 2FZVA 2QVLA 1WHTA 4OYHA 5LYJB 1FFAA 1Y3AA 3EEOA 4DM7A 2HU7A 4PO3X 1BWRA 2Z9BA 1KZHA 2IBTA 2HW8A 3USCS 3PNVA 4EKGA 3EY9A 1WLSA 4TTSA 4G86A 1JA9A 3FG9A 1WPQA 1DO0A 2ACVA 2JGJA 1M2NA 4ISBA 1YR6A 1TVEA 1NW5A 2NAPA 2F8LA 2GNPA 2VUUA 3WLPA 2VJMA 4C87A 2EJTA 1W93A 4GX2A 3GJ6A 4Y2PA 5KKCA 3QY0A 2JLYA 3ZX5A 1AGNA 1F4PA 5G02A 3KWJA 1I80A 1VLZA 4QEZA 2BV3A 3D6TB 3RT7A 1EFLA 2HFJA 4KQ6A 4A91A 5C4MA 4DWOA 3QUTA 3A6KA 3GRCA 4C6TA 1R4NB 5A4IS 1EXVA 3B5EA 3KLMX 2GRJA 3DQZA 3PRHA 4LK2A 1EXDA 3O9VA 2XZLA 2C2HA 3C3JA 1D0VA 1SBYA 4HB0A 5HTOA 1U7DA 4NYJQ 5CU7A 3QVJA 1MJHA 4AS1A 1DWPA 4PZLA 1RWMA 4DABA 2I4IA 4JYMA 1GGJA 1X80B 2WILA 1WMSA 4ND4A 3GLRA 4HXGA 2Z09A 3SYLA 5A3QA 3E1GA 3RSFA 4HTFA 1NXWA 3TBKA 1QVZA 3C8HA 3SXJA 5K4HA 2R1VB 4OG2A 4HEQA 3GZ4A 5ALTA 1Q19A 521PA 5LU8A 4Q03A 5CLFA 1C80A 1NJ1A 2YHUA 5KPDA 4RVOA 1Y1LA 2CT8A 3II6X 4Y6RA 2PV0A 1GNQA 3O31A 4TLBA 4YDHB 3ZW9A 1EB9A 1DXQA 5H3HA 1BDHA 1NIJA 3G7UA 3Q0IA 3D0QA 2BELA 5JBNA 3JARA 2AXPA 1Y8ZA 1UKVY 4OQDA 1JB9A 5IDYA 3EDYA 3VU3A 5EJ9A 4ZZ0A 1PLJA 1M6YA 5ICEA 2ZIEA 2C4UA 3KYCB 4A6XA 2LV8A 1E89A 2GH1A 4BX0A 3SQMA 3ZKWA 3UJ6A 3IODA 1XZQA 3OE5A 2PKRA 1ODFA 5SYMA 1F4LA 4CMCA 4XVRA 4EENA 4XRGA 1V7ZA 3MWDB 2IIQA 3CPSA 3D31A 1KI6A 3K5HA 4MVCA 4Z99A 3ND9A 1XKQA 4A6DA 4ENWA 1JEDA 1DEXA 1KBZA 1NATA 1OI3A 5D01A 2GTHA 3IOEA 2PBFA 3PSAA 3DLTA 4DJ5X 1SC9A 3RFTA 5IKXA 3P9YA 3LRTA 5K6TA 4N7RA 4YALA 5SZKB 4JENA 1FIUA 3ZBUA 2W58A 2WU0A 1W36B 3NVKI 3AETA 2ZXUA 2J3JA 2IYWA 1ACLA 2CLKB 2ZYRA 3MG9A 2NZ2A 1Y9EA 1W25A 4JT4A 4BDSA 3MELA 1J23A 4BO3A 4N41A 1EBFA 1EEHA 3IOCA 1RJEA 5IAJA 2NO1A 3AHJA 4HZUA 1KPIA 1ULAA 3MCAA 4O08A 2DKFA 4DDMA 1M6HA 5DMHA 4DIOA 1W47A 3L8FA 3OQIA 1P0MA 2RGWA 1M2HA 4H4CA 1Y98A 3EISA 1E4OA 2V45A 1GGVA 4UPDA 1S6YA 1Q1AA 1EGAA 2AXNA 5IUNC 5JD5A 3HNPA 4G41A 4INZA 4US2R 3ZDQA 4U7DA 3GW8A 4DB4A 1JG7A 2X5JO 1MIOA 2FG5A 4TVBA 4MR9A 2H18A 4WY8A 4B76A 5AFSA 3ABOB 1CRWG 2AHOA 5IDQA 3KOYA 4YUAA 3ZCUA 2PZKA 1OQAA 4XI9A 1K5DA 5HVNA 2XB9A 3KKOA 2Z6QA 2OFWA 3EZ9A 3CY6A 4J2OA 5HUJA 4AZSA 1ULUA 1A9TA 4EB6B 3U48A 2FJ0A 1RYHA 2GZ3A 3RYCA 4XAQA 3WKBA 5I7HA 1RXVA 4MJLA 2D3WA 2V54A 1CUXA 1KF0A 3N2ZB 4JCCA 3QEJA 4J0HA 4A6EA 2QPLA 4R41A 2NTVA 1Z2EA 2W4MA 3RUCA 3MT9A 8GPBA 5IKPA 1J8YF 2Z43A 3IPLA 4W5JA 3I45A 3LK7A 4FSXA 3P19A 4URYR 3AM1A 1YBMA 1W4ZA 1ZUHA 3NWBA 4GSKA 2LDXA 4Y0VA 1ZJZA 2CUNA 3IBYA 5AKIA 4DLZA 5I9MA 4RA9A 1KOFA 2R85A 1M34A 3BX1A 2MR5A 3KVVA 2V9PA 3L93A 3TJRA 1ULHA 3GCGA 1RBZA 3PHHA 1QO9A 1CJMA 2GBPA 2DHCA 3MQ2A 4ESEA 3F71A 1ADJA 3QNUA 5AKJA 2YN4A 4RWEA 3A2KA 2FEOA 1EP1B 2RGXA 1GTL1 1KYYA 3G8AA 1C8VB 3JQ8A 1VPVA 3I5UA 3W8NA 2OXEA 2DPGA 4RORA 2A4KA 5ALEA 3ZX4A 1WDMA 5C81A 1KQGA 4QUIA 5TVGA 1ZCAA 3KQYA 3QZUA 3A10A 1YAHA 3R09A 3TLMA 3ZHBA 4C0QC 4F1JA 3A36A 4BN0A 1Q50A 4L8FA 2ZPTX 4WLNA 4F5YA 4LY9A 4QREA 1IQ0A 3GT7A 3AFMA 3BICA 4UM9D 2IH2A 2XGJA 3SC3A 2GZDA 2XI4A 2R2AA 2GCNA 2X4DA 2ZJ8A 3M70A 5JHGB 5JXHA 3ND8A 2Q2QA 1JJIA 1Y8RA 2G8NA 4QWMA 4EI8A 1ZCJA 3FETA 3SS8A 5CEEA 3NBXX 2H9YA 3DV0B 3WE7A 3OPYB 1A77A 3B1JA 2QVZX 3W9UA 4LF8B 1PP4A 1SBCA 3B3JA 3IV7A 3VPXA 2PXXA 2WV7A 4KYVA 4NBSA 5DSZA 4D74A 4DR1B 5ITSA 4TV9B 4DRYA 2NSLA 1Z17A 1THTA 5KAMA 1TTHA 2ZIAA 3FBTA 5MFPA 4W5NA 2F3PA 4CMEA 3ENZA 4R9SA 1QWSA 4TS9A 5GJVC 5JNVA 2G1UA 3R0JA 2BW0A 2SICE 2BHTA 4K8OA 3P2OA 3J80A 1EHYA 5KYVA 2IXAA 2X1MA 4QXRA 4RFVA 1M2EA 2Y77A 5C8YB 5LZ2A 3TFQA 5IM4A 5HSGA 4LGVA 3ADDA 2E0IA 2QDKA 2YMMA 1EX1A 1BFUA 3DD5A 3DEZA 4IH9A 4PLFA 3VI3B 1CUWA 3VVBA 4YV1A 1Z6QA 1P33A 1Q22A 2CLCX 3W79A 5AUNB 5AHWA 1ZN8A 4BTLA 3NB0A 5C2JB 1NUSA 1ZUNB 3SY8A 5K20A 1K4YA 5DI3B 1G18A 2Z6UA 3TD2A 2NXNA 2Z08A 5IBRA 3ZGXA 5TF0A 5INTA 3UBMA 4A0RA 2QSUA 1XALA 1MQSA 2GRUA 2I2CA 2ZAGA 3DOEA 3LL7A 2BKAA 3GN2A 1YB5A 5J2TB 5DHFA 3LWDA 1PF7E 3BE5A 4GGMX 5BNIA 4NZOA 2O5CA 3BK7A 4DT1A 4DQVA 1CQJB 1JFLA 4HVLA 4MJ3A 3NUQA 4ZP1A 4KQMA 1S3IA 4CPDA 4QUKA 2RHTA 1V1MB 4FN4A 3FPEA 6GPBA 3O94A 3PGJA 4GR9A 2JAXA 5HRUA 4YV7A 1FX0B 3F6YA 3LGXA 5HRAA 2BMAA 1WZUA 1QBGA 3ROEA 4LV8B 4MJ7A 4YMSA 1PQPA 1CUAA 1F06A 4AIRA 3CLVA 3OBIA 1SQGA 4IMRA 3B1KA 1NPYA 5IN4A 2DFLA 1MZPA 4IJQA 4H0NA 4FHFA 4PFSA 4V0NA 5CM9C 3CLUC 9LDTA 4MPDA 1O6CA 3MMXA 2AQ8A 2GJKA 3MCTA 4BLRA 2BR3A 1KVRA 3L7YA 2C82A 3JPWA 4ICIA 4TZ0A 1MB9A 1W2HA 4EYSA 1Q14A 4ENRA 1DKNA 4ZMSA 1KZ7B 1LNQA 2IWHA 3DTNA 5EKXA 3K0AA 3KOZA 2P4SA 4U3JA 4RLSA 1GCIA 4D96A 4W5RA 2C1XA 2II6A 3GBPA 4DAOA 1B0AA 2WF6A 4Q16A 4EZEA 2X0IA 3QU4A 2P0AA 3VR1A 1VMEA 1S2OA 2AVDA 5M29A 1OLUB 1ZFNA 2NU6B 4IVPA 4FZRA 4MB0A 1NNLA 3F5SA 3G0GA 4XW2A 5DULA 3S99A 3R9WA 1QMPA 3GIWA 2XT6A 1B16A 1JHYA 4I99A 3M6FA 4XPIA 3ICEA 2HO4A 5DP2A 3RABA 5PNTA 4N0PA 2R97A 1TF2A 2IHUA 7GPBA 3TTSA 2XRZA 4LJRA 5E3IA 2CYCA 4UCQA 2EZ8A 2WP8J 4HUQB 5THKA 3VJKA 4PQRA 4H7IA 1KI8A 1U8TA 2Z8ZA 3MA0A 1FBTA 1F8UA 3T52A 2PCJA 3G79A 5EIBD 1D2EA 2D3TA 2C94A 1H2WA 2FMKA 2FMHA 4IUCS 3ZV5A 4QOFA 1EFCA 2GEJA 2VJPA 1NTRA 5EYPB 3SYMA 4M0UA 4AO8A 8ABPA 1U2GC 1CD5A 3Q9NA 2O8BA 4LF4B 2AE1A 2QLTA 4QTUB 5F76A 3IJEB 2ZSUA 3T3IA 4DF3A 1WXFA 4IZOA 5I4CA 3DDWA 3SYKA 2GVDC 1I14A 4LRTB 1AKEA 2EEPA 2I22A 3NTOA 3DO6A 4IY1A 2XUHA 4DPKA 3K9NA 3DT8A 1ZBQA 3DZBA 1YB4A 3KELA 5FUWA 4XH9B 1FFWA 4YP1A 3K0AB 1Z12A 5AWFC 2OGZA 4RD1A 1XKTA 4BGVA 2F8MA 5ADVA 1QCDA 1E9VA 5JI3E 2LGJA 3GBSA 2QTCA 3I8OA 3KWMA 4JJ4A 1JR3D 2H63A 4F9TA 3CZAA 1S02A 2C9CA 4D0GA 2XEXA 4F71A 1WMBA 1IVSA 2V74B 4MW9A 4AG5A 1JE1A 1T5HX 1CUGA 4G65A 1P4SA 2V3CC 2QG9A 3WGJA 3MSCA 4IZIA 1D8AA 1XWIA 1AMOA 3N74A 2Q9CA 4Q3BA 1YUBA 2UVPB 2JVIA 4PF1A 4BQRA 5IXSA 1XVAA 1AQLA 4YCCA 4ZAWA 1NW4A 1CDZA 1U8EA 5DLYA 1SCQA 2HJSA 1TEHA 1U2ZA 2JEOA 2D5IA 1ORVA 4S1NA 2ZU0C 4ETIA 3TRKA 4V02A 2ZB2A 5F9MA 3DFMA 2DB3A 2REBA 3KTFA 4I9FA 1CUHA 2FR1A 5TNXA 3RF7A 4DJAA 4EI2A 5KS2A 2HBRA 3KP1A 1W4AA 3ZW7A 4CT5A 1IBRA 2NO7A 5AI4A 3I4LA 3D7SA 1W94A 2JATA 1LNSA 2LKCA 3M9XA 4NFYA 5T4BA 1CZUA 1LBHA 3SFTA 5GVRA 3QNMA 2MSDB 2RHDA 4TMXA 5DM70 3M4YA 5BR8B 2ZAOA 2VFAA 1JN0A 5DNCA 1RQRA 4ML3A 3FUCA 1J22A 5T4FA 4KR3A 1Z6XA 1N6PA 5HR5A 2DY1A 1BC5A 1Z5NA 1BVUA 1KZ1A 1JF8A 1WE2A 4FR2A 5EWJB 3CNLA 4BQPA 4D5EA 2J30A 3T9CA 1M6EX 2HNAA 2Z95A 2Z2XA 2V7QD 4BAZA 3HM9A 3KYIB 3I3OA 4ZQGA 2OCKA 4JS0A 4KN5A 1QFXA 2CXTA 2E7ZA 3RYIA 1E0JA 3JCZA 4MW2A 3SPXA 4S1OA 1J70A 2OZVA 5KWSA 4P80A 4C2BA 2J5KA 4DIFA 5A9SA 1ZO8A 5KTRA 3ELBA 2FPMA 1VCMA 3WQQA 2FRVA 1H1DA 4YJ3A 3PVCA 5EP1A 2P79A 1APBA 4HFJA 1XVTA 3S4YA 3U3RA 1DDIA 2OGWA 3C5WP 2OYCA 4JNKA 8AT1A 2CHVA 1AQYA 2GM9A 1QKKA 3E3LA 5E0OA 3CG0A 4QJ5A 1UBOS 3WSVA 2C1EA 3I1JA 4RDCA 4TV9A 3PQDA 5AOCA 3KZCA 3SX0A 1WY5A 3MLAA 2FEAA 3TDMA 2FCAA 1FA9A 3NNSA 4O4LB 3Q7QA 4K6CA 1XRPA 5B3KA 4B74A 3W5AA 4W9RA 4FFSA 4N5HX 4FEEA 1AKNA 1VSVA 3H18A 3FROA 3Q7SA 3TKYA 2I4OA 4U2GA 1JEAA 2BEUB 5LJIA 4AY4A 1EFVA 2AD5A 2WMDA 3O2QB 4LFBB 2OILA 1OXSC 2RAFA 3ISTA 1ML4A 1NF8A 3OKAA 5EEGA 4EG5A 3LKDA 2Q6LA 2IYNA 2OBLA 4EY3A 2X7JA 2GJ9A 1RZUA 2AG0A 4J6FA 4PPFA 1HUQA 4RO0A 13PKA 4ATNA 1JR6A 4B4KA 1Y3CE 2IJGX 3JYNA 4ZRMA 4CF4A 4PFQA 1Z25A 2HTEA 2B8TA 1RAAA 4L3OA 4OSEA 3IQIX 1DBRA 2OHHA 3C45A 1XYYA 2IE8A 4EG3A 2ZATA 4QJ3A 1E9BA 1IK4A 4K9KA 1ZICA 1YH3A 2QZPA 1BE8A 4NMLA 4V39A 3SSNA 4B4VA 3ESDA 3UGKA 4TT3A 1NP3A 5HF8A 2X23A 3FRHA 1USKA 2G0TA 4IUDS 1ZC4A 3W6OA 4OUDB 3NORA 4LWZA 3TNYA 3I9KA 1V1RA 5AR1A 3TRIA 1GL3A 1WQ4A 1W85A 3C4QA 1B00A 2Y05A 1N5MA 2WB4A 4RTNA 3SQWA 3H9JA 3NOQA 4F91B 5AQEA 1XLVA 3ZZTA 3KV3O 4ETWA 2PUGA 3JAMA 3ROPA 4DJFC 2AF3C 1TM4E 5IK2D 2INGX 4W1QA 5BSVA 1IHDA 1O2DA 3GGOA 1NBOA 2DTXA 2Q4DA 4YRCA 4DKXA 3HWWA 1P1RA 4WECA 2YW9A 2VF4X 2ZTSA 3PL5A 4K9RA 2HK8A 2VVTA 4Y67A 5HFNA 2QYOA 3I6QA 2O8DB 4JP2A 3C8MA 2NPIA 1KR5A 2OXRA 1A71A 1HMYA 2ZETA 4PIMA 3VDQA 3EF0A 3SN6A 4ADSG 2JLUA 4LYGA 4BV3A 4NFHA 5HW0A 3UWPA 4O4HA 4YTEA 1EHCA 4PO1A 4BFXA 3LU1A 4G9BA 1KJ9A 3H11B 5LC1A 1GARA 2H2IA 2BGUA 5F78A 2FR0A 3VYSB 1GQFA 3MD9A 1KMCA 1T0IA 1W46A 4N76A 1GGEA 4GICA 1QIDA 3ETDA 2IY7A 3OZTA 4G37A 3GEIA 1F2UA 3CGGA 2VF2A 1TAQA 1QUEA 3K20A 3NWPA 2IYSA 1U8AA 3S2IA 4F4HA 2O8FB 3CMMA 1BD4A 1CRQA 1PQ4A 4GEGA 4IDPA 4ACAA 4C22A 4DMKA 1W88B 3ODPA 3OD1A 3PR3A 1YU6A 3I23A 5IJAA 1FFEA 5EHXA 1N9ZA 1GZ7A 1ICIA 3T4PA 2YRWA 4KHZA 2YYYA 2G9NA 1C5KA 3T1YB 4TN5A 1XNHA 1QH0A 2AQIA 2O0MA 3BMCA 3RS8A 3KAJA 3S8MA 1F17A 1C7FA 3MK31 4ZVLA 2WJJA 3QPUA 4OBXA 2ZP1A 1RD4A 5KYWB 1L4HA 1C14A 1MFZA 3TNFA 2CF6A 3LLSA 5TPWB 4EJSB 4IFEA 3Q9LA 2IYAA 1Z36A 5CITA 1BVHA 5BXQC 3FUUA 4JMPA 5IZCA 2CUTA 5EIWA 3HA3A 4QBIA 3TZHA 2GQ0A 3C98A 3OAAA 3BB3A 2QVCA 3QX7A 4QUAA 2CK3D 3QKSB 2WSSD 4PG8A 3EEFA 4YMLA 1GL7A 1X9IA 1XQ1A 3DMRA 1EAMA 3LOUA 4KPFC 1SFRA 1QYVA 3QV2A 3FVQA 5B3JC 2QJOA 3BBPA 4P4TA 3BMXA 1M34E 4CE6A 2KJQA 1HY3A 3SOPA 5JH7B 4BQFA 1OX4B 2Q4TA 4UHJA 3RKRA 4N0QA 1QAQA 5AVJA 3ZJUA 1JHPA 1BYUA 1Y7IA 2F7SA 2NXWA 3FTEA 1NVVQ 1DS6A 1DWQA 1YR3A 1QH1A 3C43A 3GFBA 4D9MA 3IKMB 5CA1F 5K5EA 1SNYA 4G0ZA 3MUFA 2W6OA 3H6KA 1PGOA 5LIPA 3OUUA 3KXPA 2J33A 4RENA 4I3HA 1Z9BA 2E1RA 2JH3A 1CZRA 1LUAA 1U2GA 2PQ2A 5GIPE 2BF7A 2GD6A 3FRIA 1FNSA 5A5EA 2XKAA 3TW6A 3QA9A 4MCAA 5J4YA 1RJ9A 4QVIA 1LNZA 1KRXA 3RD5A 4BJ1A 1G8KA 3ADBA 2DEUA 4PRYA 2Y68A 1NUPA 2OV6A 3RTEA 2CXUA 3RTCA 2I2BA 1U3CA 2P6MA 2FZLA 1O97C 2ZQYA 1SXGA 2PGDA 3MJEA 1FLVA 3RVQA 4WNAB 2AQKA 2HHLA 2ZRDA 1OZHA 1S9DA 2KS6A 5FFNA 1RCUA 2P4UA 3PTLA 4Q9KA 3E70C 4G8DA 2AEFA 4L7VA 1HLPA 1OB2A 1S9HA 4FWIB 5HE9A 3IDSA 1G5PA 4C0KA 1K8YB 4X6LA 4DQUA 5JY6A 4YCAA 1XFDA 5C37A 1E7MA 3D6JA 4CEIA 1TVKA 4FGKA 3E48A 2BDEA 2AC2A 2O50A 4IWYA 1HE3A 3GMDA 4WLVA 4MEAA 2H4HA 3ZY3A 5BSWA 3NFRA 2CD9A 3AEUA 2D6FA 2Y0CA 1A9SA 5TPZA 2XWQA 4KIWA 4KTTE 1IUNA 1CPYA 3TBFA 5CLJA 4RY0A 4ENPA 5HQ3B 5K6AA 3DPUA 2QB5A 1BCRA 4KAFA 4B0PA 1JMVA 3MIIA 3M6MD 3K6JA 1WB4A 2PZBA 1XLUA 4C0AC 1YCFA 1BJTA 4KPGA 4DCOA 2EZUA 1IJFA 1DBVO 2BGKA 1TMKA 2GLUA 1KERA 4M9QA 5F2OA 1DELA 2Q49A 3ABIA 1Y6JA 4NK4A 3ZH2A 1JNXX 4EY7A 1TCAA 3CE9A 4F04A 3LPNA 2AOTA 5KNBH 121PA 2ECFA 3R1IA 4Q21A 1VL5A 3L0ZA 1RQNA 3CXRA 3ZE2B 4GWLA 3I9OA 5B58C 3DD1A 4X20B 3U7IA 4U6QA 2OCBA 4EGCB 2ZJ3A 3E18A 3KXLA 2YVKA 1QAOA 3LG2A 4QUGA 3H2ZA 4NECA 1GTMA 2M6KA 1SHJA 3V6MA 1QB7A 4LVOA 4ZN6A 5JG7A 1JHZA 4W4TA 5IMSA 2PMWB 3OMWA 4WMLA 3FZEA 2GRAA 3VQTA 3B2EA 2ZWIA 1SKYB 3CJTA 3E2IA 4HNGA 4J75A 5FFMA 4J0JA 3AG5A 4JP3A 3AFGA 4JOSA 1CR4A 2IYZA 4GLBA 4GPBA 4BP3A 3D8TA 1CY7A 1T15A 2PRJA 1IOWA 2EW2A 3GFOA 2PMFA 2Y92A 2HBZA 1IY8A 2WIGA 1ZWKA 1OD6A 3R4CA 2GJSA 3V8VA 3SDZA 3OH8A 3PI6A 3V46A 1BD3A 1ZXLA 4L0CA 3CEPB 1O9GA 4FINA 1ID1A 2NO5A 1FS6A 3BEDA 3T9AA 2YOGA 2C7BA 4DWWA 4EYKA 5A4MS 2VPPA 5AKYA 5H82A 3K0SA 1PL0A 3DMTA 3KKNA 3D1JA 2J0UA 3VR5A 3EUAA 1TQDA 3A58B 5LP6F 2WYOA 4AB1A 1NUAA 5L4NA 5CB4F 3BK2A 1F5NA 4Q6WA 2O2YA 1UZLA 3AJEA 4LA4A 2DHDA 1N2CE 1ST2A 1B73A 2Y9MB 3OCUA 4P81A 2QN1A 3EG9A 4A9AA 1RRMA 2WKSA 5JAQA 1IAVA 2RJNA 2DBVO 1JALA 2D00A 1P31A 3RYFB 5TLSA 3RRXA 1NQVA 3BGIA 2A1TR 1HZZC 2YZMA 1L4YA 2IEBA 1GRQA 1EQAA 5K1ZA 4XGNA 4JQSA 1RAIA 3TTXA 1YOVA 2W6QA 2WYUA 3N0VA 1RXEA 2LD4A 3OKCA 1JA0A 2PNJA 4NZ9A 4JWTA 3CCBA 4RVDA 3OPNA 5HX7A 3U4DA 2FQ1A 4RIIA 1DU4A 1PYGA 1SN7A 2N1BA 3HO8A 4QHSA 1SUEA 5BSTA 3VISA 1D4AA 4C05A 3K70C 5HA5A 4MYHA 3L8GA 2RC6A 4DC1A 4O3FA 4EHLA 3WY9A 1YAJA 1M2OB 4IIYA 4D3SA 2IS6A 4KK4A 4RZQA 1M2VB 5LB4A 1VL0A 2I2AA 2YNMD 4PNZA 4WK0B 4DSNA 2DMRA 2H85A 2YFHA 3W4IA 4IWXA 3CRVA 1F2TA 2XDAA 5CCXA 4AX4A 2FI1A 3HHEA 4CL8A 3IHWA 2F1OA 4G5GA 4WCVA 1RLJA 1IUKA 3H6HA 2IYFA 2JFHA 3JZIA 1I24A 1ML3A 2FG6C 2O8EB 2GR9A 3R0XA 4ERXA 1TZCA 3O8QB 3PDIB 4DUGA 3C7AA 1NY6A 3HKEB 4S04A 3X0DA 4WTOA 4YPVA 3RFVA 4B3TB 2R1UA 1L1QA 1UJCA 3B6ZA 3F98A 2ZUTA 3I8SA 1NJFA 1ZOOA 5CH3A 1R9MA 4RUKA 2A33A 1MW9X 3UHOA 4QPZA 1UMKA 1QVWA 3GOHA 1T1RA 1XCGB 1VLLA 3I4CA 3LLVA 3L8CA 1YKFA 3NKFA 1MOSA 2XYPA 2AOUA 5J58A 2IYRA 1EBBA 1I1OA 2GPJA 2PAFA 3K70B 3ZKWB 3BRWD 1IATA 4H7DA 1E3QA 3BMQA 3UPUA 5C1PA 3A1VA 2B36A 3IKJA 5EZ6B 4DR2B 1GCUA 3H9GA 2HCTA 3VPFA 4B32A 2Q5CA 3B8EA 4D1YA 2XMSA 2A94A 4ZT7A 2VSQA 2VP0A 1KEKA 4ZZ3A 4XIFA 3C6ZA 2KM1A 5ARCA 3TZCA 3ICOA 1U5BB 1A4RA 1XJWA 1M8KA 2JHCA 5IHXA 4NBLA 1PR1A 1VI5A 2QRVB 3NW9A 3MFQA 4JC4A 4YPOA 4TV8A 2G5TA 3G7SA 1ZR4A 4IIFA 5DFAA 3A6PC 1YS2X 4UTOA 5G1PA 4B46A 1WULS 5TE9A 4OF4A 2OXTA 3T4XA 1EJ0A 1E2MA 5KVVA 2HCBA 1Z08A 3IT2A 1CFJA 2EFJA 3B85A 3ITDA 4RS4A 1KZYC 2ID7A 1ZMXA 2C5AA 2CHGA 3BIOA 4TKMA 1JE0A 1GUYA 1R0KA 2PHZA 4N6GA 3ISVA 5CRIA 1MV8A 4KVGA 4M8KA 2OOSA 3QIVA 4OHKA 4CMKA 2COEA 4Y2TA 3AR4A 3L05A 4PZCA 1E9DA 1A50B 1G9SA 4TWJA 3DHYA 3DV2A 4YJHB 2CZQA 5KOIA 1Y6ZA 4WNAA 1WCWA 1YS6A 1HL3A 3T5DA 3UEOA 3FBGA 1ACMA 2WHXA 3KPYA 4JLUA 5LUAA 3KKQA 4CN9A 1IXKA 5FWNA 4RMNA 3ZQ4A 4O59O 4X97A 1SUCA 1WO8A 3H3FA 3W90A 2HIAA 3AVQA 1F12A 4BFLA 2R8YA 1P17A 2VO1A 1CERA 4K2HA 1K4MA 3H3JA 3ZG6A 1O0SA 2F17A 4MCJA 2Q6TA 4WW0A 1FVHA 3NFYA 3EFBA 1UBRS 5CYPA 4JUAA 1PWEA 4E07A 3U7EB 2FPPA 2I54A 4W9MC 4X6XA 3A6EA 2VXYA 5CW2A 1N7HA 3IAHA 1DG9A 4R1UA 4CQMB 5G3YA 1EUDA 4ND6A 1UWVA 3WIEA 3HXQA 3RARA 2Q8QA 2IT1A 4L6AA 4YECA 3SSMA 4CMIB 4CTKA 5JCJD 2EBFX 4L4YA 4RHTA 1E1CA 1VYHA 2PD3A 3OPYI 1QRUA 4L4RA 2I87A 2UUOA 4UFPA 2Q99A 3LS2A 4PX2A 1VE9A 1W2GA 4ZVKA 5EE5B 1GGKA 1OPXA 3H13A 2FZGA 4YFVA 5GV8A 2BEWA 2VNSA 4ASUA 2TRSB 1XMVA 3H5TA 1Z4IA 3KL4A 4A23A 5DNEA 2GO7A 1QFZA 1ZU5A 3NCHA 3RS2A 1LKZA 1WCIB 4I46A 3S5JA 2JLBA 4AJHA 3H4TA 4KL8S 4Z4CA 5IP5A 1RLTA 4DV7B 3OZFA 2XCRB 3MD0A 3DHVA 3SC2A 1P1IA 4DA4A 2CV0A 1EZ4A 4X24A 4TTRA 1UMBB 1QBKC 4NEHB 4QUEA 4HRVA 4RA6A 3PGLA 3V80A 1GAXA 2ZI9A 4X63A 1TQ2A 5FYDA 1ODSA 3IIJA 3L1JA 2UYGA 3LZCA 1ZVVA 1C9KA 3I62A 1TU0A 1U1DA 1BVRA 2W98A 2Q2VA 5E95A 3NDRA 3W78A 4RTSA 1NWHA 5JPCA 2VBGA 3W2EA 5LKAA 2BI8A 4CMAA 1JPVA 4LJAA 2CKDA 4NI5A 1QGAA 1USWA 1CIJA 1HE4A 3OEHD 4IW3B 2FPOA 2SCUB 1VJ5A 3IHKA 4PCVA 5E38A 1W7AA 2JD0A 3KSRA 4EPVA 1RAHA 3MM4A 5HEKA 1JEYA 3I53A 2QX8A 1IHXA 2IKSA 3QWAA 3WLLA 3UHFA 1ESCA 2EU8A 2J67A 1U2SA 3QGMA 5ABPA 3NANA 1UPXA 2QMHA 2OYSA 2NSHA 3WDLA 1NMSA 5FL3A 3SM9A 4L0DA 1W0CA 1AS2A 1SULA 3HDGA 5G4LA 5A2QA 1WDTA 3UUGA 5FDFA 4B3RB 5AJWA 5JR3A 4YJ2A 4PYJA 3NDBB 2V1XA 2YXPX 3EA0A 4ER6A 1Q0LA 1WD7A 2JJ1A 4LYAA 3FE2A 3P52A 4X94A 1DKPA 3U31A 1XZBA 3C7TA 5E2IA 3UCXA 1KBOA 4MQFA 3K0FB 4TL9A 4DUYB 4H6VA 1U0RA 4BB5A 1PNVA 1DEKA 2J7KA 2B3TA 3KEGA 4Q47A 1GM5A 3CEHA 3N7AA 4M9ZA 3Q1LA 2BYTA 3AVXA 3UJ8A 2WUEA 5EE3A 4P3XA 4QOSA 3SDSA 2IELA 3C3WA 2BGNA 2VPZA 4O2AF 1SZPA 4UJ5A 3WRYC 2BE7A 4Y2HA 2CUZA 1T4GA 4M88A 2WU4A 1OGIA 2IPNA 3L1UA 2WJPA 4R40A 1RPAA 2JFFA 4PG5A 2VF7A 4AJJA 3K1TA 3M8KA 2IS4A 1B8VA 4K6FA 1MRNA 1RZ3A 3ZWVA 3IB3A 3HVJA 5K6RA 1NXTA 1ZIOA 1GDTA 2GAJA 5TQJA 4H18A 3T35A 1K7EB 2RBKA 3VZPA 3LBYA 3RVDA 4C6SA 1Y82A 5AW7A 2B6HA 1BDBA 4ZAGA 4DBVO 4LVNA 3JD2A 4IGAA 1IK6A 3EXEA 3QJYA 4K5QA 4WINA 2NGRA 4M46A 5CR9A 5ALDA 5DYWA 3GCXA 2AOVA 1EVZA 1FU8A 1IN7A 3ANNA 3KR0A 2JH9A 2IVFA 2PBRA 2BFMA 3N2YA 3A14A 1G16A 1WSWA 3THXB 2MINB 5BPHA 3EPRA 1DWOA 2VRNA 1RJGA 3OQ6A 2CEAA 5CVJA 4FKZA 2GLTA 4D8VA 5HP4A 2E6UX 1EVJA 2Q1YA 3KEFA 3MNFA 1IN4A 2P3LA 3KSMA 3R3HA 4MI9A 2V03A 4NL4H 4TZTA 3UAZA 3DE3X 3S8YA 3A9RA 4LQ4A 4MWGA 1KE1A 1JIVA 1N9KA 1VA5A 1F8GA 1BXGB 1P81A 4YXWA 4CFZA 4ZOLB 5FP0A 3RVRA 2GETA 5E1MA 4HQLA 1NJ6A 4B3XA 2ZRQA 5I8PA 2FLVA 2H08A 4WXPA 1CR6A 4EFLA 1Z2NX 2R7NA 4ZKEA 4U2BA 1QS0A 2WYWA 2WFLB 3P4UA 3PITA 3SSOA 2O48X 5F1OA 3JV7A 1XZKA 5DT9A 4YJHA 4G0VA 16PKA 3P27A 4K9OA 4LYJA 4C30A 4CF5A 2B6NA 1DINA 2NZJA 1QVAA 3QFRA 3RREA 2GUGA 3G5TA 3CONA 1QHYA 1YRBA 1G17A 2D54A 3N2LA 4N3GA 4BMPB 2MYNA 3E4DA 3S27A 1LF5A 4ZQHA 4Q3NA 1GZVA 5D51S 2R84A 1Z62A 1UKBA 4KQIA 4CR8A 1F6DA 2BRUA 4JKIA 3MS4A 1JFTA 1OFGA 3WIDA 3X1XA 3KX2A 4BKUA 1WXEA 4RAQA 4GQIA 4UMEA 3R9XA 4XCVA 3C1TA 1S2GA 5KDOA 4DANA 3DEYX 4M9SA 4UARA 2NXEA 5EIHA 5CIYA 1KIMA 1TVCA 3P2YA 5CLLA 2KMLA 3EF3A 4RY8A 3HP4A 4I5GA 4JP5A 4Q01A 5G1NA 4ENQA 3AF0A 2J0EA 5CG2A 1USIA 2H1HA 1TLTA 3IBTA 3DDSA 4I5DA 1FP7A 4CKEB 2CLEB 2HDHA 1JPJA 2VDRB 3DDOA 4MS1A 4UAGA 4XYGA 5CW1A 1E6LA 2DFTA 4O8ZA 1HLFA 1G21A 3OFVA 5T3YA 3PLAE