2XGLA

The x-ray structure of the escherichia coli colicin m immunity protein demonstrates the presence of a disulphide bridge, which is functionally essential
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
EDKGPACYQVSDEQARTFVKNDYLQRMKRWDNDVQLLGTEIPKITWEKIERSLTDVEDEKTLLVPFKAEGPDGKRMYYGMYHCEEGYVEYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN-M IMMUNITY PROTEIN
publication title X-Ray Structure and Site-Directed Mutagenesis Analysis of the Escherichia Coli Colicin M Immunity Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Antibiotic
total genus 24
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13995 YebF YebF-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.300 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xglA00
2LQVA 2XGLA 4AEQA
chains in the Genus database with same CATH superfamily
1I2EA 4XBTA 1UDII 4XBYA 5BVBA 4X2HA 1I0VA 2CK3H 1BNEA 1NB3I 3HOHA 1O7NB 2AADA 2FGTA 3PS8A 4BL2A 1UUGB 1O7PB 4AKZA 3OWUA 1BNSA 3FG1A 5RNTA 3B4OA 2KF4A 1YJW3 1U8CB 4IT7A 3LT9A 3BNBA 3WOEB 4BU4A 1ROVA 5IEPA 2XR8B 2XSHB 3DGLA 3ZG0A 2CC3A 3U1WA 7RNTA 1CEWI 1RGEA 2CH9A 1LOYA 1BRKA 1MWSA 3EE1A 5ELJA 1JBSA 1FGQA 2KF6A 3GRDA 2FNQA 1RGHA 3EBTA 5DRVA 1UUWB 1GMRA 2KRTA 1WMPA 3MWZA 3ROBA 4J5KA 2QEX3 2SARA 3WDGB 1AQZA 1IVVA 3K63A 3LXUX 1PY3A 1OGXA 1FUSA 3MPHA 5CK6A 3F14A 3LTCA 5BU4A 6STDA 1N8R4 1JKGA 2RNTA 2Z7AA 1RGFA 3UNLA 1W2ZA 1W5ZA 4KFFA 5KP3A 4EV5A 3F8XA 3OWYA 2LYXA 3FG3A 1VQO3 3FSDA 3OXAA 4FMDA 3AGNA 1C54A 1RCLA 4CCVA 1RJOA 4HM1B 2IA7A 3L0RA 2A15A 5CF1A 1EKMA 1RKYA 1B2SA 1M9GA 3Q1CA 3F40A 2W2CA 1TRQA 3MYTA 3N54B 2OTL3 1Q864 3PXMA 3VGNA 1QAFA 2ML5A 1HYFA 3S28A 1VQ63 2AAEA 4WYKB 1FGMA 1VQL3 2RSXA 3V98A 2BMRB 4WWUC 1QVG2 1LQGC 1A90A 1DMMA 5AEUB 1KD14 1BUQA 1X1UA 4BIRA 4WP5A 3KSED 3SYUA 1PU4A 3T8NA 3EC9A 3OWSA 1MNLA 2Y74A 3F9SA 4BL3A 1CYUA 3OW22 1RHLA 1SIIA 2P38A 2YX9A 3FG4A 4LMIA 5STDA 1O7GB 1LOXA 4N6OB 1IQ8A 1BNFA 2KCDA 1Q9EA 3GSPA 1KSIA 3SOYA 2L1SA 1A2PA 1STDA 3GZBA 1FGRA 1O7MB 4H61A 4MMXB 1K734 1BSBA 3JUQA 2I9WA 3KFQC 3FF2A 2O9UX 1N5HA 1UGIA 3HIIA 1OHOA 1Q42A 1TJDA 5HOHA 1TTOA 2UGIA 1BNRA 3WMDA 3EQQB 2W04A 2JQ5A 2ZHXB 3STDA 1NB5I 4DKIA 5D83A 3EX9A 3BU4A 3I563 3NV0A 4J9AA 4KFEA 1V58A 4HZ9B 4HM5B 1OF5B 5EQLA 1Q7HA 1I8VA 1W7CA 1DVDA 1RGLA 4L8PA 2P09A 1MGWA 2W6JH 2UX0A 4RNZA 3RNTA 1IK3A 2CG0A 4J8TA 2CIUA 3HIGA 3NBRA 4KZ1A 2Z77A 1BAOA 3RDEA 2GSPA 4K90B 4N6LA 5IEOA 1GY6A 3NQZA 6RNTA 4N6TA 2YFLB 3ER7A 4KVHA 3CCM3 3E99A 4HM3B 1KWIA 3IJEB 1R4CA 5FW5A 3A5EA 2M7OA 3GZYB 4X2OA 4MMYB 4K1VA 2P0XA 2E2VA 2CFGA 3KSPA 5AIGA 5AYSC 2IY2A 1DETA 2OQEA 1A67A 3EBYA 2H0HA 1ROAA 2CWVA 5CXOA 3G713 2F99A 4XBXA 3VF1A 3CC73 3CNMA 1LQMB 2P0MA 4I5QA 2BO9B 5AIIA 3EB8A 3WA2X 1SPUA 1AVLA 1BOXA 3HX8A 2HMLB 4GHOA 1JNQA 1CQSA 1DYUA 2GU3A 3B8LA 4GL6A 2F5MA 4NHFA 1RN7A 2XSOB 3GWRA 3MHEA 4OUQA 4R9KA 4HAAA 1T5YA 1MWRA 2Z76A 4LGQA 3LTAA 1W00A 1OUNA 4MJDA 1JBRA 5IG0A 1MOLA 3HK4A 5IG4A 3K5TA 1AY7A 1US1A 1PFPA 1Q40B 1OCVA 2OWPA 2R4IA 3NQYA 1F8NA 3WHOA 1YVBI 1ULJB 1GYBA 2CFLA 1OHPA 2STDA 4HZBB 1N8QA 6GSPA 1N9EA 2K54A 1E3VA 1X1YA 2OCTA 4ZM8A 1TRPA 3NBJA 3M8CA 1BRSA 3G6E3 1IT8A 4CPKA 3NM2A 1A2KA 1CYVA 1OHSA 1IVWA 2LQVA 3MKIA 3NBBA 3CME3 1M904 3KE7A 1N9JA 1BU4A 3BB9A 5IF6A 4FCJA 4LZIA 5M1AA 1EA2A 4GB5A 4K1UA 1ASKA 1YNVX 4CDLA 1JJ22 3ECFA 1GOYA 4KT3B 2CKFB 5AIHA 2MC8A 2MF7A 5BXQA 4I4KA 2JDIH 1GY5A 3AGOA 3EJVA 3PCRA 1VQ53 3DUKA 3NX0A 1B2ZA 4Q53A 4RNYA 4ILFA 4AKYA 1GMPA 1ULIB 3BLZA 1AR0A 2Z6BA 5D81A 2INXA 4O02B 3V92A 1QJGA 3F7XA 1RRHA 3AMOA 4N6NB 2W56A 3S67A 1RRLA 3CCE3 2HMKB 2WGOA 4R9LA 3NUVA 3BIRA 3NM7A 3Q3FA 2XH9A 2CHCA 5G1LA 5AI1A 2HMMB 1BSDA 1D6ZA 4JF8A 2BIRA 1NWWA 3DMCA 3H3HA 3X3ZA 4HM8B 1YI23 1G0TA 1WQLB 1I3IA 3S27A 1RN1A 3RGAA 3VSYA 1MWTA 4N6V0 2XFTA 4HM6B 4JRFA 1T2IA 2V1LA 1RTUA 1EUIC 4CJNA 3CPOA 1LRAA 2BMQB 2OOVC 5IERA 1K9M4 3MG1A 8CHOA 4EW5A 1GD4A 3PYJA 3F8HA 2W0QA 1JN5B 4N6UA 2B24B 3DGYA 1LNHA 3I553 1IDPA 5EEOA 1JZDA 2D1WA 4IIAA 1ZGXA 2XEPA 2WO0A 2ML6A 1W02A 3A76A 2CX1A 3URPA 4HYZA 5LC7A 1BGSA 4FMAA 5G2GA 4OK0A 1IQXA 4O2HA 4EYCA 3CU3A 3BNCA 3K0ZA 3QK9A 4KFDA 1VQ73 2RBIA 3LTBA 3HI7A 1B21A 5KP4A 1NU3A 3SX1A 2K0MA 2IYJA 3X40A 2Q07A 3JUPA 4AEQA 3S29A 3G16A 3LZAA 5FGOA 1L5GB 4EC6A 2XGNA 4TX4A 1IYYA 2O3OA 1DMQA 1OGZA 1NNVA 1GOVA 2BHMA 3D9RA 3CMA3 1ISKA 1VQ43 3JUNA 4GSPA 1HKXA 1TFOA 1T3BA 1ZO2A 2WOFA 3DGOA 1GMQA 2W9QA 1W6YA 3O8YA 1ZS7A 1MWUA 1BNGA 2FXTA 2HMOB 3AHWA 3SEDA 3T0UA 4BTWA 4XDVA 1DVCA 4EXRA 1KC84 1QALA 3IMAB 2WOHA 2CFKA 1RGCA 3JUMA 3LMLA 1FUWA 4XB5A 3CCQ3 2BT3A 2F5WA 1NDOB 1PYLA 5CLKA 1WNHA 1OACA 3LTDA 3CCS3 1BSCA 5KP1A 1BRGA 2XRXB 4NPBA 3CC43 1TU5A 1K8A4 1X1WA 1HZ1A 2HOHA 4EV2A 2RGQA 4WYKA 1R4YA 3S5CA 1FW7A 1JKGB 2HMNB 3DXOA 2GU1A 3KN4A 3WA3A 1JB4A 1VQN3 2C10A 1BSEA 2H0GA 2GEYA 1EG9B 5IENA 1GSPA 5A0OB 5JBSA 1BANA 1SIHA 1C7HA 1EQKA 2IMJA 1LOWA 3DGNA 5AIFA 1IV7A 2YFJB 5AEWB 8RNTA 1JB2A 4BTXA 4J5GA 3B4PA 4PEJA 3UL6A 1UCKA 5CF2A 3X42A 2B1XB 1RSNA 2K3DA 1E3RA 1W6GA 1UCJA 5EVHA 1RNBA 3EN1B 1UI8A 1UUVB 1M1XB 3FGYA 3UL5A 1IV9A 2KF3A 3EN8A 1I0XA 1RDSA 1RGKA 4RBNA 3CCU3 3CCV3 1T2HA 3DM8A 3CXC2 1W2B2 4O3VA 1JBTA 2GEXA 1Z1SA 3CCR3 1E97A 2F86B 3K9MC 1I3FA 1FGOA 1IVXA 1SQWA 3FH1A 4N3VA 2E2TA 4LSOA 3SVAA 1AVKA 1LOVA 9RNTA 5HGRA 1RGGA 2QGUA 1J2BA 3G4S3 3D3LA 1EEJA 2F4YA 2RCDA 2GXFA 5ELUA 1B20A 1BIRA 1OF5A 4QWTA 2CFWA 2QIYA 1X1XA 3KCHA 3DZLA 4BTYA 3G8ZA 1TFKA 5I97A 4FMCA 1RNTA 4LEHA 2W03A 3GAXA 1BSAA 2GBWB 2RFRA 3F7SA 3GZXB 2J8XB 1D6YA 3GZRA 3RGRA 1BRIA 2BU4A 2ZDJA 4IPBA 1O7WB 4R4KA 3LYGA 4RNTA 1FA3A 5LC6A 1D6UA 1JZOA 3FCSB 2OOVA 4L8OA 1WTHA 1STFI 2KF5A 1B2UA 4HKVB 3NV0B 4U13A 1S723 1VQ83 1U5OA 4R1KA 2E2UA 1BNJA 1RCKA 3D5IA 1WMOA 4MEIA 4HM2B 2F98A 3ZFZA 1YIJ3 1RN4A 4STDA 1QMAA 2CX0A 2Y73A 5M18A 3K7CA 1V74A 2ZA4A 3N8BA 4FCMA 1W4NA 1N5PA 2D42A 3NHXA 1LNIA 3D5GA 5IW9A 3DY5A 3CD63 1I2GA 3X3YA 2CW9A 5DREA 1DE3A 1FGTA 2IUJA 3SXXA 1LVNA 3B7CA 1LXEA 5D82A 1B3SA 1I70A 2KXGA 3N9HA 3H51A 4EBGA 1Q7Y4 3BNEA 1YGWA 2WGQA 1TIJA 1G02A 2XGLA 3D4AA 3WR2A 1YGEA 1OH0A 1TUHA 4ORLA 7STDA 1JRQA 2UUGC 3WOFB 1O7HB 4K61A 4R80A 2CWTA 4HVNA 3PGBA 1IT7A 1Q40A 2CWUA 3EHCA 4FR9A 5G1KA 1OPYA 1FUTA 4G1MB 1I2FA 2KAAA 1YJN3 1B2XA 2XFSA 1VQQA 4H3UA 1SARA 4HBRA 1VZZA 2PZVA 1ZX2A 3UB1A 3AHSA 5JPPA 1RMSA 5AYRB 5IG5A 3EF8A 3DGMA 5BIRA 3JUOA 2PNCA 3MG2A 3PZWA 3JVCA 3HZPA 1TP6A 1S5AA 5IG3A 3MG3A 1IQYA 1W01A 2ZL8A 7GSPA 5M19A 1Q814 5TGNA 1WMNA 1VQM3 3DH2A 2SBLA 1FZUA 3Q2PA 2C11A 3I0YA 1BRNL 4N6MA 4WHAA 1RGAA 1VQK3 3LOYA 1JV2B 1UGHI 3X41A 3X3XA 2P05A 2H0IA 3CPW2 1NJI4 3D79A 4O8SA 3NXJA 1GS3A 1YHQ3 1GD3A 3WODG 4HJLB 1BVIA 1QAKA 3ALAA 2OTJ3 1K28A 3IPTA 2C4BA 3MSOA 3CNXA 3U97A 4RZMA 2BNGA 1B27A 1V57A 4FMBA 4HM4B 1BRJA 2W9PA 1YIT3 1BRHA 1HU9A 5GSPA 1A2VA 1RLSA 1CH0A 2F56A 3SOAA 4NREA 3CC23 3OX9A 1KQS2 3LT8A 3SLUA 1Y4KA 3KIIA 1YJ93 3AMOB 1B2MA 4LYLB 1SJWA 2W56B 3KZTA 1BUJA 1NO3A 2GBXB 2QA43 4MMZB 1G96A 3KKGA 4HM0B 4L7KA 2CFDA 1K41A 3FLJA 1YVSA 3CCL3 1DMNA 1JN5A 2BMOB 2IUKA 3FF0A 3LH4A 4XM4A 1VQP3 3TDGA 1UW1A 1MGRA 4WFOA 1UCIA 3G0KA 1FYSA 1QVF2 1UI7A 2HMJB 3FZWA 1W6CA 2L4VA 3PCSA 2XF3A 4HM7B 3T8UA 3J7Yd 1VQ93 4XDWA 3V99A 1Q824 1IVUA 1BNIA 4FCZA 3FKAA 4OVMA 3OV4A 3QRDA 1GY7A 1M1K4 2YFIB 3UJMA 1JB5A 3ZG5A 2OQEC 2R41A 1IU7A 2CG1A 4HOHA 3BNDA 3CCJ3 1GOUA 1AV4A 1UCLA 3Q90A 5JPUA
chains in the Genus database with same CATH topology
4XBTA 4XBYA 5BVBA 4X2HA 2CK3H 1NB3I 1O7NB 2FGTA 3PS8A 1O7PB 4AKZA 3OWUA 3FG1A 3B4OA 1YJW3 1U8CB 4IT7A 3LT9A 3BNBA 3WOEB 5IEPA 1ROVA 2XR8B 2XSHB 3DGLA 2CC3A 3U1WA 1CEWI 2CH9A 3EE1A 5ELJA 1FGQA 3GRDA 2FNQA 3EBTA 5DRVA 1UUWB 2KRTA 1WMPA 3MWZA 3ROBA 2QEX3 3WDGB 1IVVA 3K63A 3LXUX 1OGXA 3MPHA 5CK6A 3F14A 3LTCA 6STDA 1N8R4 1JKGA 2Z7AA 3UNLA 4EV5A 1W2ZA 1W5ZA 4KFFA 5KP3A 1VQO3 3F8XA 3OWYA 2LYXA 3FG3A 3FSDA 3OXAA 4FMDA 4CCVA 1RJOA 4HM1B 2IA7A 3L0RA 2A15A 5CF1A 1EKMA 1RKYA 1M9GA 3Q1CA 3F40A 3MYTA 3N54B 2OTL3 1Q864 3PXMA 3VGNA 1QAFA 2ML5A 3S28A 1VQ63 4WYKB 1FGMA 1VQL3 2RSXA 3V98A 2BMRB 4WWUC 1QVG2 1A90A 1DMMA 5AEUB 1KD14 1BUQA 4WP5A 3KSED 1PU4A 3T8NA 3EC9A 3OWSA 1MNLA 2Y74A 3F9SA 1CYUA 3OW22 1SIIA 2P38A 2YX9A 3FG4A 4LMIA 5STDA 1O7GB 1LOXA 4N6OB 1IQ8A 2KCDA 1KSIA 3SOYA 1STDA 3GZBA 1FGRA 1O7MB 4H61A 4MMXB 1K734 3JUQA 2I9WA 3KFQC 3FF2A 2O9UX 1N5HA 3HIIA 1OHOA 1Q42A 3WMDA 3EQQB 2W04A 2JQ5A 3STDA 1NB5I 5D83A 3EX9A 3I563 3NV0A 4J9AA 4KFEA 4HZ9B 4HM5B 1OF5B 5EQLA 1W7CA 1DVDA 4L8PA 2P09A 2W6JH 2UX0A 4RNZA 1IK3A 2CG0A 4J8TA 2CIUA 3HIGA 3NBRA 4KZ1A 2Z77A 3RDEA 4K90B 4N6LA 5IEOA 1GY6A 3NQZA 4N6TA 2YFLB 3ER7A 4KVHA 3CCM3 3E99A 4HM3B 1KWIA 3IJEB 1R4CA 5FW5A 2M7OA 3GZYB 4X2OA 4MMYB 4K1VA 2P0XA 2E2VA 2CFGA 3KSPA 5AIGA 5AYSC 2OQEA 1A67A 3EBYA 1ROAA 2CWVA 5CXOA 3G713 2F99A 4XBXA 3VF1A 3CC73 3CNMA 2P0MA 2BO9B 5AIIA 3EB8A 3WA2X 1SPUA 1AVLA 3HX8A 2HMLB 1JNQA 1CQSA 1DYUA 2GU3A 3B8LA 4GL6A 4NHFA 1RN7A 2XSOB 3GWRA 3MHEA 4OUQA 4R9KA 1T5YA 2Z76A 4LGQA 3LTAA 1W00A 1OUNA 4MJDA 5IG0A 1MOLA 3HK4A 5IG4A 3K5TA 1US1A 1PFPA 1Q40B 1OCVA 2OWPA 2R4IA 3NQYA 1F8NA 1ULJB 1GYBA 1YVBI 2CFLA 1OHPA 2STDA 4HZBB 1N8QA 1N9EA 2K54A 1E3VA 2OCTA 4ZM8A 3NBJA 3M8CA 3G6E3 1IT8A 3NM2A 1A2KA 1CYVA 1OHSA 1IVWA 2LQVA 3MKIA 3NBBA 3CME3 1M904 3KE7A 1N9JA 3BB9A 5IF6A 4FCJA 4LZIA 1EA2A 4GB5A 4K1UA 1ASKA 4CDLA 1JJ22 3ECFA 2CKFB 5AIHA 2MC8A 2MF7A 5BXQA 4I4KA 2JDIH 1GY5A 3EJVA 3PCRA 1VQ53 3DUKA 3NX0A 4Q53A 4RNYA 4AKYA 1ULIB 3BLZA 1AR0A 2Z6BA 5D81A 2INXA 4O02B 3V92A 1QJGA 3F7XA 1RRHA 3AMOA 4N6NB 2W56A 3S67A 1RRLA 3CCE3 2HMKB 2WGOA 4R9LA 3NUVA 3NM7A 2XH9A 2CHCA 5AI1A 2HMMB 1D6ZA 4JF8A 3X3ZA 1NWWA 3DMCA 3H3HA 4HM8B 1YI23 1WQLB 3S27A 3RGAA 3VSYA 4N6V0 2XFTA 4HM6B 4JRFA 2V1LA 5IERA 1K9M4 3CPOA 2BMQB 2OOVC 3MG1A 8CHOA 1GD4A 3PYJA 3F8HA 2W0QA 1JN5B 4N6UA 2B24B 1LNHA 3I553 1IDPA 5EEOA 2D1WA 4IIAA 2XEPA 2WO0A 2ML6A 1W02A 3A76A 4HYZA 5LC7A 4FMAA 5G2GA 4OK0A 1IQXA 4O2HA 4EYCA 3CU3A 3BNCA 3K0ZA 3QK9A 4KFDA 1VQ73 3LTBA 3HI7A 5KP4A 1NU3A 3SX1A 2K0MA 3X40A 2Q07A 3JUPA 4AEQA 3S29A 3G16A 3LZAA 5FGOA 1L5GB 4EC6A 2XGNA 4TX4A 2O3OA 1DMQA 1OGZA 2BHMA 3D9RA 3CMA3 1ISKA 1VQ43 3JUNA 1HKXA 1TFOA 1ZO2A 2WOFA 3DGOA 2W9QA 1W6YA 3O8YA 2FXTA 2HMOB 3SEDA 4EXRA 3T0UA 4BTWA 4XDVA 1DVCA 1KC84 1QALA 3IMAB 2WOHA 2CFKA 3JUMA 3LMLA 1FUWA 4XB5A 3CCQ3 2BT3A 1NDOB 5CLKA 1WNHA 1OACA 3LTDA 3CCS3 5KP1A 2XRXB 3CC43 1TU5A 1K8A4 4EV2A 2RGQA 4WYKA 3S5CA 1JKGB 2HMNB 3DXOA 2GU1A 3KN4A 3WA3A 1JB4A 1VQN3 2C10A 5IENA 2GEYA 1EG9B 5A0OB 5JBSA 1SIHA 1C7HA 1EQKA 2IMJA 3DGNA 5AIFA 1IV7A 2YFJB 5AEWB 1JB2A 4BTXA 3B4PA 4PEJA 3UL6A 5CF2A 3X42A 2B1XB 5EVHA 1E3RA 1W6GA 3EN1B 1UI8A 1UUVB 1M1XB 3FGYA 3UL5A 1IV9A 3EN8A 3CCU3 4RBNA 3CCV3 3DM8A 3CXC2 1W2B2 4O3VA 2GEXA 1Z1SA 3CCR3 1E97A 2F86B 3K9MC 1FGOA 1IVXA 1SQWA 3FH1A 4N3VA 2E2TA 4LSOA 3SVAA 1AVKA 5HGRA 2QGUA 1J2BA 3G4S3 3D3LA 2RCDA 2GXFA 5ELUA 1OF5A 4QWTA 2CFWA 2QIYA 4BTYA 3DZLA 3G8ZA 1TFKA 5I97A 4FMCA 4LEHA 2W03A 3GAXA 2GBWB 2RFRA 3F7SA 3GZXB 1D6YA 3GZRA 3RGRA 2ZDJA 4IPBA 4R4KA 1O7WB 3LYGA 1FA3A 5LC6A 1D6UA 3FCSB 2OOVA 4L8OA 1WTHA 1STFI 4HKVB 1VQ83 4U13A 3NV0B 1S723 1U5OA 4R1KA 2E2UA 1WMOA 4MEIA 4HM2B 2F98A 1YIJ3 4STDA 1QMAA 2Y73A 3K7CA 1V74A 3N8BA 5IW9A 4FCMA 1W4NA 1N5PA 2D42A 3NHXA 3DY5A 3CD63 3X3YA 2CW9A 5DREA 1FGTA 2IUJA 3SXXA 1LVNA 3B7CA 1LXEA 5D82A 2KXGA 3N9HA 3H51A 4EBGA 1Q7Y4 3BNEA 2WGQA 1TIJA 2XGLA 1YGEA 1OH0A 1TUHA 4ORLA 7STDA 1JRQA 3WOFB 1O7HB 4K61A 4R80A 2CWTA 4HVNA 3PGBA 1IT7A 1Q40A 2CWUA 3EHCA 4FR9A 1OPYA 4G1MB 1YJN3 2XFSA 4H3UA 4HBRA 1VZZA 2PZVA 1ZX2A 3UB1A 5JPPA 5AYRB 5IG5A 3EF8A 3DGMA 3JUOA 2PNCA 3MG2A 3PZWA 3JVCA 3HZPA 1TP6A 1S5AA 5IG3A 3MG3A 1IQYA 1W01A 2ZL8A 1Q814 5TGNA 1WMNA 1VQM3 3Q2PA 2SBLA 2C11A 3I0YA 4N6MA 4WHAA 1VQK3 3LOYA 1JV2B 3X41A 3X3XA 2P05A 3CPW2 1NJI4 4O8SA 3NXJA 1GS3A 1YHQ3 1GD3A 3WODG 4HJLB 1QAKA 3ALAA 2OTJ3 1K28A 3IPTA 3MSOA 3CNXA 3U97A 4RZMA 2BNGA 4FMBA 4HM4B 2W9PA 1YIT3 1HU9A 1A2VA 3SOAA 4NREA 3CC23 3OX9A 1KQS2 3LT8A 3SLUA 1Y4KA 3KIIA 1YJ93 3AMOB 1SJWA 2W56B 3KZTA 1NO3A 2GBXB 2QA43 4MMZB 1G96A 3KKGA 4HM0B 4L7KA 2CFDA 1K41A 3FLJA 3CCL3 1DMNA 1JN5A 2BMOB 2IUKA 3FF0A 3LH4A 4XM4A 1VQP3 3TDGA 1UW1A 4WFOA 3G0KA 1QVF2 1UI7A 2HMJB 3FZWA 1W6CA 2L4VA 3PCSA 2XF3A 4HM7B 3T8UA 3J7Yd 1VQ93 4XDWA 3V99A 1Q824 1IVUA 4FCZA 3FKAA 4OVMA 3OV4A 3QRDA 1GY7A 1M1K4 2YFIB 3UJMA 1JB5A 2OQEC 1IU7A 2CG1A 3BNDA 3CCJ3 1AV4A 2W2CA 3Q90A 5JPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQV A;  2XGL A;  4AEQ A; 
#chains in the Genus database with same CATH topology
 1I2E A;  4XBT A;  1UDI I;  4XBY A;  5BVB A;  4X2H A;  1I0V A;  2CK3 H;  1BNE A;  1NB3 I;  3HOH A;  1O7N B;  2AAD A;  2FGT A;  3PS8 A;  4BL2 A;  1UUG B;  1O7P B;  4AKZ A;  3OWU A;  1BNS A;  3FG1 A;  5RNT A;  3B4O A;  2KF4 A;  1YJW 3;  1U8C B;  4IT7 A;  3LT9 A;  3BNB A;  3WOE B;  4BU4 A;  1ROV A;  5IEP A;  2XR8 B;  2XSH B;  3DGL A;  3ZG0 A;  2CC3 A;  3U1W A;  7RNT A;  1CEW I;  1RGE A;  2CH9 A;  1LOY A;  1BRK A;  1MWS A;  3EE1 A;  5ELJ A;  1JBS A;  1FGQ A;  2KF6 A;  3GRD A;  2FNQ A;  1RGH A;  3EBT A;  5DRV A;  1UUW B;  1GMR A;  2KRT A;  1WMP A;  3MWZ A;  3ROB A;  4J5K A;  2QEX 3;  2SAR A;  3WDG B;  1AQZ A;  1IVV A;  3K63 A;  3LXU X;  1PY3 A;  1OGX A;  1FUS A;  3MPH A;  5CK6 A;  3F14 A;  3LTC A;  5BU4 A;  6STD A;  1N8R 4;  1JKG A;  2RNT A;  2Z7A A;  1RGF A;  3UNL A;  1W2Z A;  1W5Z A;  4KFF A;  5KP3 A;  4EV5 A;  3F8X A;  3OWY A;  2LYX A;  3FG3 A;  1VQO 3;  3FSD A;  3OXA A;  4FMD A;  3AGN A;  1C54 A;  1RCL A;  4CCV A;  1RJO A;  4HM1 B;  2IA7 A;  3L0R A;  2A15 A;  5CF1 A;  1EKM A;  1RKY A;  1B2S A;  1M9G A;  3Q1C A;  3F40 A;  2W2C A;  1TRQ A;  3MYT A;  3N54 B;  2OTL 3;  1Q86 4;  3PXM A;  3VGN A;  1QAF A;  2ML5 A;  1HYF A;  3S28 A;  1VQ6 3;  2AAE A;  4WYK B;  1FGM A;  1VQL 3;  2RSX A;  3V98 A;  2BMR B;  4WWU C;  1QVG 2;  1LQG C;  1A90 A;  1DMM A;  5AEU B;  1KD1 4;  1BUQ A;  1X1U A;  4BIR A;  4WP5 A;  3KSE D;  3SYU A;  1PU4 A;  3T8N A;  3EC9 A;  3OWS A;  1MNL A;  2Y74 A;  3F9S A;  4BL3 A;  1CYU A;  3OW2 2;  1RHL A;  1SII A;  2P38 A;  2YX9 A;  3FG4 A;  4LMI A;  5STD A;  1O7G B;  1LOX A;  4N6O B;  1IQ8 A;  1BNF A;  2KCD A;  1Q9E A;  3GSP A;  1KSI A;  3SOY A;  2L1S A;  1A2P A;  1STD A;  3GZB A;  1FGR A;  1O7M B;  4H61 A;  4MMX B;  1K73 4;  1BSB A;  3JUQ A;  2I9W A;  3KFQ C;  3FF2 A;  2O9U X;  1N5H A;  1UGI A;  3HII A;  1OHO A;  1Q42 A;  1TJD A;  5HOH A;  1TTO A;  2UGI A;  1BNR A;  3WMD A;  3EQQ B;  2W04 A;  2JQ5 A;  2ZHX B;  3STD A;  1NB5 I;  4DKI A;  5D83 A;  3EX9 A;  3BU4 A;  3I56 3;  3NV0 A;  4J9A A;  4KFE A;  1V58 A;  4HZ9 B;  4HM5 B;  1OF5 B;  5EQL A;  1Q7H A;  1I8V A;  1W7C A;  1DVD A;  1RGL A;  4L8P A;  2P09 A;  1MGW A;  2W6J H;  2UX0 A;  4RNZ A;  3RNT A;  1IK3 A;  2CG0 A;  4J8T A;  2CIU A;  3HIG A;  3NBR A;  4KZ1 A;  2Z77 A;  1BAO A;  3RDE A;  2GSP A;  4K90 B;  4N6L A;  5IEO A;  1GY6 A;  3NQZ A;  6RNT A;  4N6T A;  2YFL B;  3ER7 A;  4KVH A;  3CCM 3;  3E99 A;  4HM3 B;  1KWI A;  3IJE B;  1R4C A;  5FW5 A;  3A5E A;  2M7O A;  3GZY B;  4X2O A;  4MMY B;  4K1V A;  2P0X A;  2E2V A;  2CFG A;  3KSP A;  5AIG A;  5AYS C;  2IY2 A;  1DET A;  2OQE A;  1A67 A;  3EBY A;  2H0H A;  1ROA A;  2CWV A;  5CXO A;  3G71 3;  2F99 A;  4XBX A;  3VF1 A;  3CC7 3;  3CNM A;  1LQM B;  2P0M A;  4I5Q A;  2BO9 B;  5AII A;  3EB8 A;  3WA2 X;  1SPU A;  1AVL A;  1BOX A;  3HX8 A;  2HML B;  4GHO A;  1JNQ A;  1CQS A;  1DYU A;  2GU3 A;  3B8L A;  4GL6 A;  2F5M A;  4NHF A;  1RN7 A;  2XSO B;  3GWR A;  3MHE A;  4OUQ A;  4R9K A;  4HAA A;  1T5Y A;  1MWR A;  2Z76 A;  4LGQ A;  3LTA A;  1W00 A;  1OUN A;  4MJD A;  1JBR A;  5IG0 A;  1MOL A;  3HK4 A;  5IG4 A;  3K5T A;  1AY7 A;  1US1 A;  1PFP A;  1Q40 B;  1OCV A;  2OWP A;  2R4I A;  3NQY A;  1F8N A;  3WHO A;  1YVB I;  1ULJ B;  1GYB A;  2CFL A;  1OHP A;  2STD A;  4HZB B;  1N8Q A;  6GSP A;  1N9E A;  2K54 A;  1E3V A;  1X1Y A;  2OCT A;  4ZM8 A;  1TRP A;  3NBJ A;  3M8C A;  1BRS A;  3G6E 3;  1IT8 A;  4CPK A;  3NM2 A;  1A2K A;  1CYV A;  1OHS A;  1IVW A;  2LQV A;  3MKI A;  3NBB A;  3CME 3;  1M90 4;  3KE7 A;  1N9J A;  1BU4 A;  3BB9 A;  5IF6 A;  4FCJ A;  4LZI A;  5M1A A;  1EA2 A;  4GB5 A;  4K1U A;  1ASK A;  1YNV X;  4CDL A;  1JJ2 2;  3ECF A;  1GOY A;  4KT3 B;  2CKF B;  5AIH A;  2MC8 A;  2MF7 A;  5BXQ A;  4I4K A;  2JDI H;  1GY5 A;  3AGO A;  3EJV A;  3PCR A;  1VQ5 3;  3DUK A;  3NX0 A;  1B2Z A;  4Q53 A;  4RNY A;  4ILF A;  4AKY A;  1GMP A;  1ULI B;  3BLZ A;  1AR0 A;  2Z6B A;  5D81 A;  2INX A;  4O02 B;  3V92 A;  1QJG A;  3F7X A;  1RRH A;  3AMO A;  4N6N B;  2W56 A;  3S67 A;  1RRL A;  3CCE 3;  2HMK B;  2WGO A;  4R9L A;  3NUV A;  3BIR A;  3NM7 A;  3Q3F A;  2XH9 A;  2CHC A;  5G1L A;  5AI1 A;  2HMM B;  1BSD A;  1D6Z A;  4JF8 A;  2BIR A;  1NWW A;  3DMC A;  3H3H A;  3X3Z A;  4HM8 B;  1YI2 3;  1G0T A;  1WQL B;  1I3I A;  3S27 A;  1RN1 A;  3RGA A;  3VSY A;  1MWT A;  4N6V 0;  2XFT A;  4HM6 B;  4JRF A;  1T2I A;  2V1L A;  1RTU A;  1EUI C;  4CJN A;  3CPO A;  1LRA A;  2BMQ B;  2OOV C;  5IER A;  1K9M 4;  3MG1 A;  8CHO A;  4EW5 A;  1GD4 A;  3PYJ A;  3F8H A;  2W0Q A;  1JN5 B;  4N6U A;  2B24 B;  3DGY A;  1LNH A;  3I55 3;  1IDP A;  5EEO A;  1JZD A;  2D1W A;  4IIA A;  1ZGX A;  2XEP A;  2WO0 A;  2ML6 A;  1W02 A;  3A76 A;  2CX1 A;  3URP A;  4HYZ A;  5LC7 A;  1BGS A;  4FMA A;  5G2G A;  4OK0 A;  1IQX A;  4O2H A;  4EYC A;  3CU3 A;  3BNC A;  3K0Z A;  3QK9 A;  4KFD A;  1VQ7 3;  2RBI A;  3LTB A;  3HI7 A;  1B21 A;  5KP4 A;  1NU3 A;  3SX1 A;  2K0M A;  2IYJ A;  3X40 A;  2Q07 A;  3JUP A;  4AEQ A;  3S29 A;  3G16 A;  3LZA A;  5FGO A;  1L5G B;  4EC6 A;  2XGN A;  4TX4 A;  1IYY A;  2O3O A;  1DMQ A;  1OGZ A;  1NNV A;  1GOV A;  2BHM A;  3D9R A;  3CMA 3;  1ISK A;  1VQ4 3;  3JUN A;  4GSP A;  1HKX A;  1TFO A;  1T3B A;  1ZO2 A;  2WOF A;  3DGO A;  1GMQ A;  2W9Q A;  1W6Y A;  3O8Y A;  1ZS7 A;  1MWU A;  1BNG A;  2FXT A;  2HMO B;  3AHW A;  3SED A;  3T0U A;  4BTW A;  4XDV A;  1DVC A;  4EXR A;  1KC8 4;  1QAL A;  3IMA B;  2WOH A;  2CFK A;  1RGC A;  3JUM A;  3LML A;  1FUW A;  4XB5 A;  3CCQ 3;  2BT3 A;  2F5W A;  1NDO B;  1PYL A;  5CLK A;  1WNH A;  1OAC A;  3LTD A;  3CCS 3;  1BSC A;  5KP1 A;  1BRG A;  2XRX B;  4NPB A;  3CC4 3;  1TU5 A;  1K8A 4;  1X1W A;  1HZ1 A;  2HOH A;  4EV2 A;  2RGQ A;  4WYK A;  1R4Y A;  3S5C A;  1FW7 A;  1JKG B;  2HMN B;  3DXO A;  2GU1 A;  3KN4 A;  3WA3 A;  1JB4 A;  1VQN 3;  2C10 A;  1BSE A;  2H0G A;  2GEY A;  1EG9 B;  5IEN A;  1GSP A;  5A0O B;  5JBS A;  1BAN A;  1SIH A;  1C7H A;  1EQK A;  2IMJ A;  1LOW A;  3DGN A;  5AIF A;  1IV7 A;  2YFJ B;  5AEW B;  8RNT A;  1JB2 A;  4BTX A;  4J5G A;  3B4P A;  4PEJ A;  3UL6 A;  1UCK A;  5CF2 A;  3X42 A;  2B1X B;  1RSN A;  2K3D A;  1E3R A;  1W6G A;  1UCJ A;  5EVH A;  1RNB A;  3EN1 B;  1UI8 A;  1UUV B;  1M1X B;  3FGY A;  3UL5 A;  1IV9 A;  2KF3 A;  3EN8 A;  1I0X A;  1RDS A;  1RGK A;  4RBN A;  3CCU 3;  3CCV 3;  1T2H A;  3DM8 A;  3CXC 2;  1W2B 2;  4O3V A;  1JBT A;  2GEX A;  1Z1S A;  3CCR 3;  1E97 A;  2F86 B;  3K9M C;  1I3F A;  1FGO A;  1IVX A;  1SQW A;  3FH1 A;  4N3V A;  2E2T A;  4LSO A;  3SVA A;  1AVK A;  1LOV A;  9RNT A;  5HGR A;  1RGG A;  2QGU A;  1J2B A;  3G4S 3;  3D3L A;  1EEJ A;  2F4Y A;  2RCD A;  2GXF A;  5ELU A;  1B20 A;  1BIR A;  1OF5 A;  4QWT A;  2CFW A;  2QIY A;  1X1X A;  3KCH A;  3DZL A;  4BTY A;  3G8Z A;  1TFK A;  5I97 A;  4FMC A;  1RNT A;  4LEH A;  2W03 A;  3GAX A;  1BSA A;  2GBW B;  2RFR A;  3F7S A;  3GZX B;  2J8X B;  1D6Y A;  3GZR A;  3RGR A;  1BRI A;  2BU4 A;  2ZDJ A;  4IPB A;  1O7W B;  4R4K A;  3LYG A;  4RNT A;  1FA3 A;  5LC6 A;  1D6U A;  1JZO A;  3FCS B;  2OOV A;  4L8O A;  1WTH A;  1STF I;  2KF5 A;  1B2U A;  4HKV B;  3NV0 B;  4U13 A;  1S72 3;  1VQ8 3;  1U5O A;  4R1K A;  2E2U A;  1BNJ A;  1RCK A;  3D5I A;  1WMO A;  4MEI A;  4HM2 B;  2F98 A;  3ZFZ A;  1YIJ 3;  1RN4 A;  4STD A;  1QMA A;  2CX0 A;  2Y73 A;  5M18 A;  3K7C A;  1V74 A;  2ZA4 A;  3N8B A;  4FCM A;  1W4N A;  1N5P A;  2D42 A;  3NHX A;  1LNI A;  3D5G A;  5IW9 A;  3DY5 A;  3CD6 3;  1I2G A;  3X3Y A;  2CW9 A;  5DRE A;  1DE3 A;  1FGT A;  2IUJ A;  3SXX A;  1LVN A;  3B7C A;  1LXE A;  5D82 A;  1B3S A;  1I70 A;  2KXG A;  3N9H A;  3H51 A;  4EBG A;  1Q7Y 4;  3BNE A;  1YGW A;  2WGQ A;  1TIJ A;  1G02 A;  2XGL A;  3D4A A;  3WR2 A;  1YGE A;  1OH0 A;  1TUH A;  4ORL A;  7STD A;  1JRQ A;  2UUG C;  3WOF B;  1O7H B;  4K61 A;  4R80 A;  2CWT A;  4HVN A;  3PGB A;  1IT7 A;  1Q40 A;  2CWU A;  3EHC A;  4FR9 A;  5G1K A;  1OPY A;  1FUT A;  4G1M B;  1I2F A;  2KAA A;  1YJN 3;  1B2X A;  2XFS A;  1VQQ A;  4H3U A;  1SAR A;  4HBR A;  1VZZ A;  2PZV A;  1ZX2 A;  3UB1 A;  3AHS A;  5JPP A;  1RMS A;  5AYR B;  5IG5 A;  3EF8 A;  3DGM A;  5BIR A;  3JUO A;  2PNC A;  3MG2 A;  3PZW A;  3JVC A;  3HZP A;  1TP6 A;  1S5A A;  5IG3 A;  3MG3 A;  1IQY A;  1W01 A;  2ZL8 A;  7GSP A;  5M19 A;  1Q81 4;  5TGN A;  1WMN A;  1VQM 3;  3DH2 A;  2SBL A;  1FZU A;  3Q2P A;  2C11 A;  3I0Y A;  1BRN L;  4N6M A;  4WHA A;  1RGA A;  1VQK 3;  3LOY A;  1JV2 B;  1UGH I;  3X41 A;  3X3X A;  2P05 A;  2H0I A;  3CPW 2;  1NJI 4;  3D79 A;  4O8S A;  3NXJ A;  1GS3 A;  1YHQ 3;  1GD3 A;  3WOD G;  4HJL B;  1BVI A;  1QAK A;  3ALA A;  2OTJ 3;  1K28 A;  3IPT A;  2C4B A;  3MSO A;  3CNX A;  3U97 A;  4RZM A;  2BNG A;  1B27 A;  1V57 A;  4FMB A;  4HM4 B;  1BRJ A;  2W9P A;  1YIT 3;  1BRH A;  1HU9 A;  5GSP A;  1A2V A;  1RLS A;  1CH0 A;  2F56 A;  3SOA A;  4NRE A;  3CC2 3;  3OX9 A;  1KQS 2;  3LT8 A;  3SLU A;  1Y4K A;  3KII A;  1YJ9 3;  3AMO B;  1B2M A;  4LYL B;  1SJW A;  2W56 B;  3KZT A;  1BUJ A;  1NO3 A;  2GBX B;  2QA4 3;  4MMZ B;  1G96 A;  3KKG A;  4HM0 B;  4L7K A;  2CFD A;  1K41 A;  3FLJ A;  1YVS A;  3CCL 3;  1DMN A;  1JN5 A;  2BMO B;  2IUK A;  3FF0 A;  3LH4 A;  4XM4 A;  1VQP 3;  3TDG A;  1UW1 A;  1MGR A;  4WFO A;  1UCI A;  3G0K A;  1FYS A;  1QVF 2;  1UI7 A;  2HMJ B;  3FZW A;  1W6C A;  2L4V A;  3PCS A;  2XF3 A;  4HM7 B;  3T8U A;  3J7Y d;  1VQ9 3;  4XDW A;  3V99 A;  1Q82 4;  1IVU A;  1BNI A;  4FCZ A;  3FKA A;  4OVM A;  3OV4 A;  3QRD A;  1GY7 A;  1M1K 4;  2YFI B;  3UJM A;  1JB5 A;  3ZG5 A;  2OQE C;  2R41 A;  1IU7 A;  2CG1 A;  4HOH A;  3BND A;  3CCJ 3;  1GOU A;  1AV4 A;  1UCL A;  3Q90 A;  5JPU A; 
#chains in the Genus database with same CATH homology
 4XBT A;  4XBY A;  5BVB A;  4X2H A;  2CK3 H;  1NB3 I;  1O7N B;  2FGT A;  3PS8 A;  1O7P B;  4AKZ A;  3OWU A;  3FG1 A;  3B4O A;  1YJW 3;  1U8C B;  4IT7 A;  3LT9 A;  3BNB A;  3WOE B;  5IEP A;  1ROV A;  2XR8 B;  2XSH B;  3DGL A;  2CC3 A;  3U1W A;  1CEW I;  2CH9 A;  3EE1 A;  5ELJ A;  1FGQ A;  3GRD A;  2FNQ A;  3EBT A;  5DRV A;  1UUW B;  2KRT A;  1WMP A;  3MWZ A;  3ROB A;  2QEX 3;  3WDG B;  1IVV A;  3K63 A;  3LXU X;  1OGX A;  3MPH A;  5CK6 A;  3F14 A;  3LTC A;  6STD A;  1N8R 4;  1JKG A;  2Z7A A;  3UNL A;  4EV5 A;  1W2Z A;  1W5Z A;  4KFF A;  5KP3 A;  1VQO 3;  3F8X A;  3OWY A;  2LYX A;  3FG3 A;  3FSD A;  3OXA A;  4FMD A;  4CCV A;  1RJO A;  4HM1 B;  2IA7 A;  3L0R A;  2A15 A;  5CF1 A;  1EKM A;  1RKY A;  1M9G A;  3Q1C A;  3F40 A;  3MYT A;  3N54 B;  2OTL 3;  1Q86 4;  3PXM A;  3VGN A;  1QAF A;  2ML5 A;  3S28 A;  1VQ6 3;  4WYK B;  1FGM A;  1VQL 3;  2RSX A;  3V98 A;  2BMR B;  4WWU C;  1QVG 2;  1A90 A;  1DMM A;  5AEU B;  1KD1 4;  1BUQ A;  4WP5 A;  3KSE D;  1PU4 A;  3T8N A;  3EC9 A;  3OWS A;  1MNL A;  2Y74 A;  3F9S A;  1CYU A;  3OW2 2;  1SII A;  2P38 A;  2YX9 A;  3FG4 A;  4LMI A;  5STD A;  1O7G B;  1LOX A;  4N6O B;  1IQ8 A;  2KCD A;  1KSI A;  3SOY A;  1STD A;  3GZB A;  1FGR A;  1O7M B;  4H61 A;  4MMX B;  1K73 4;  3JUQ A;  2I9W A;  3KFQ C;  3FF2 A;  2O9U X;  1N5H A;  3HII A;  1OHO A;  1Q42 A;  3WMD A;  3EQQ B;  2W04 A;  2JQ5 A;  3STD A;  1NB5 I;  5D83 A;  3EX9 A;  3I56 3;  3NV0 A;  4J9A A;  4KFE A;  4HZ9 B;  4HM5 B;  1OF5 B;  5EQL A;  1W7C A;  1DVD A;  4L8P A;  2P09 A;  2W6J H;  2UX0 A;  4RNZ A;  1IK3 A;  2CG0 A;  4J8T A;  2CIU A;  3HIG A;  3NBR A;  4KZ1 A;  2Z77 A;  3RDE A;  4K90 B;  4N6L A;  5IEO A;  1GY6 A;  3NQZ A;  4N6T A;  2YFL B;  3ER7 A;  4KVH A;  3CCM 3;  3E99 A;  4HM3 B;  1KWI A;  3IJE B;  1R4C A;  5FW5 A;  2M7O A;  3GZY B;  4X2O A;  4MMY B;  4K1V A;  2P0X A;  2E2V A;  2CFG A;  3KSP A;  5AIG A;  5AYS C;  2OQE A;  1A67 A;  3EBY A;  1ROA A;  2CWV A;  5CXO A;  3G71 3;  2F99 A;  4XBX A;  3VF1 A;  3CC7 3;  3CNM A;  2P0M A;  2BO9 B;  5AII A;  3EB8 A;  3WA2 X;  1SPU A;  1AVL A;  3HX8 A;  2HML B;  1JNQ A;  1CQS A;  1DYU A;  2GU3 A;  3B8L A;  4GL6 A;  4NHF A;  1RN7 A;  2XSO B;  3GWR A;  3MHE A;  4OUQ A;  4R9K A;  1T5Y A;  2Z76 A;  4LGQ A;  3LTA A;  1W00 A;  1OUN A;  4MJD A;  5IG0 A;  1MOL A;  3HK4 A;  5IG4 A;  3K5T A;  1US1 A;  1PFP A;  1Q40 B;  1OCV A;  2OWP A;  2R4I A;  3NQY A;  1F8N A;  1ULJ B;  1GYB A;  1YVB I;  2CFL A;  1OHP A;  2STD A;  4HZB B;  1N8Q A;  1N9E A;  2K54 A;  1E3V A;  2OCT A;  4ZM8 A;  3NBJ A;  3M8C A;  3G6E 3;  1IT8 A;  3NM2 A;  1A2K A;  1CYV A;  1OHS A;  1IVW A;  2LQV A;  3MKI A;  3NBB A;  3CME 3;  1M90 4;  3KE7 A;  1N9J A;  3BB9 A;  5IF6 A;  4FCJ A;  4LZI A;  1EA2 A;  4GB5 A;  4K1U A;  1ASK A;  4CDL A;  1JJ2 2;  3ECF A;  2CKF B;  5AIH A;  2MC8 A;  2MF7 A;  5BXQ A;  4I4K A;  2JDI H;  1GY5 A;  3EJV A;  3PCR A;  1VQ5 3;  3DUK A;  3NX0 A;  4Q53 A;  4RNY A;  4AKY A;  1ULI B;  3BLZ A;  1AR0 A;  2Z6B A;  5D81 A;  2INX A;  4O02 B;  3V92 A;  1QJG A;  3F7X A;  1RRH A;  3AMO A;  4N6N B;  2W56 A;  3S67 A;  1RRL A;  3CCE 3;  2HMK B;  2WGO A;  4R9L A;  3NUV A;  3NM7 A;  2XH9 A;  2CHC A;  5AI1 A;  2HMM B;  1D6Z A;  4JF8 A;  3X3Z A;  1NWW A;  3DMC A;  3H3H A;  4HM8 B;  1YI2 3;  1WQL B;  3S27 A;  3RGA A;  3VSY A;  4N6V 0;  2XFT A;  4HM6 B;  4JRF A;  2V1L A;  5IER A;  1K9M 4;  3CPO A;  2BMQ B;  2OOV C;  3MG1 A;  8CHO A;  1GD4 A;  3PYJ A;  3F8H A;  2W0Q A;  1JN5 B;  4N6U A;  2B24 B;  1LNH A;  3I55 3;  1IDP A;  5EEO A;  2D1W A;  4IIA A;  2XEP A;  2WO0 A;  2ML6 A;  1W02 A;  3A76 A;  4HYZ A;  5LC7 A;  4FMA A;  5G2G A;  4OK0 A;  1IQX A;  4O2H A;  4EYC A;  3CU3 A;  3BNC A;  3K0Z A;  3QK9 A;  4KFD A;  1VQ7 3;  3LTB A;  3HI7 A;  5KP4 A;  1NU3 A;  3SX1 A;  2K0M A;  3X40 A;  2Q07 A;  3JUP A;  4AEQ A;  3S29 A;  3G16 A;  3LZA A;  5FGO A;  1L5G B;  4EC6 A;  2XGN A;  4TX4 A;  2O3O A;  1DMQ A;  1OGZ A;  2BHM A;  3D9R A;  3CMA 3;  1ISK A;  1VQ4 3;  3JUN A;  1HKX A;  1TFO A;  1ZO2 A;  2WOF A;  3DGO A;  2W9Q A;  1W6Y A;  3O8Y A;  2FXT A;  2HMO B;  3SED A;  4EXR A;  3T0U A;  4BTW A;  4XDV A;  1DVC A;  1KC8 4;  1QAL A;  3IMA B;  2WOH A;  2CFK A;  3JUM A;  3LML A;  1FUW A;  4XB5 A;  3CCQ 3;  2BT3 A;  1NDO B;  5CLK A;  1WNH A;  1OAC A;  3LTD A;  3CCS 3;  5KP1 A;  2XRX B;  3CC4 3;  1TU5 A;  1K8A 4;  4EV2 A;  2RGQ A;  4WYK A;  3S5C A;  1JKG B;  2HMN B;  3DXO A;  2GU1 A;  3KN4 A;  3WA3 A;  1JB4 A;  1VQN 3;  2C10 A;  5IEN A;  2GEY A;  1EG9 B;  5A0O B;  5JBS A;  1SIH A;  1C7H A;  1EQK A;  2IMJ A;  3DGN A;  5AIF A;  1IV7 A;  2YFJ B;  5AEW B;  1JB2 A;  4BTX A;  3B4P A;  4PEJ A;  3UL6 A;  5CF2 A;  3X42 A;  2B1X B;  5EVH A;  1E3R A;  1W6G A;  3EN1 B;  1UI8 A;  1UUV B;  1M1X B;  3FGY A;  3UL5 A;  1IV9 A;  3EN8 A;  3CCU 3;  4RBN A;  3CCV 3;  3DM8 A;  3CXC 2;  1W2B 2;  4O3V A;  2GEX A;  1Z1S A;  3CCR 3;  1E97 A;  2F86 B;  3K9M C;  1FGO A;  1IVX A;  1SQW A;  3FH1 A;  4N3V A;  2E2T A;  4LSO A;  3SVA A;  1AVK A;  5HGR A;  2QGU A;  1J2B A;  3G4S 3;  3D3L A;  2RCD A;  2GXF A;  5ELU A;  1OF5 A;  4QWT A;  2CFW A;  2QIY A;  4BTY A;  3DZL A;  3G8Z A;  1TFK A;  5I97 A;  4FMC A;  4LEH A;  2W03 A;  3GAX A;  2GBW B;  2RFR A;  3F7S A;  3GZX B;  1D6Y A;  3GZR A;  3RGR A;  2ZDJ A;  4IPB A;  4R4K A;  1O7W B;  3LYG A;  1FA3 A;  5LC6 A;  1D6U A;  3FCS B;  2OOV A;  4L8O A;  1WTH A;  1STF I;  4HKV B;  1VQ8 3;  4U13 A;  3NV0 B;  1S72 3;  1U5O A;  4R1K A;  2E2U A;  1WMO A;  4MEI A;  4HM2 B;  2F98 A;  1YIJ 3;  4STD A;  1QMA A;  2Y73 A;  3K7C A;  1V74 A;  3N8B A;  5IW9 A;  4FCM A;  1W4N A;  1N5P A;  2D42 A;  3NHX A;  3DY5 A;  3CD6 3;  3X3Y A;  2CW9 A;  5DRE A;  1FGT A;  2IUJ A;  3SXX A;  1LVN A;  3B7C A;  1LXE A;  5D82 A;  2KXG A;  3N9H A;  3H51 A;  4EBG A;  1Q7Y 4;  3BNE A;  2WGQ A;  1TIJ A;  2XGL A;  1YGE A;  1OH0 A;  1TUH A;  4ORL A;  7STD A;  1JRQ A;  3WOF B;  1O7H B;  4K61 A;  4R80 A;  2CWT A;  4HVN A;  3PGB A;  1IT7 A;  1Q40 A;  2CWU A;  3EHC A;  4FR9 A;  1OPY A;  4G1M B;  1YJN 3;  2XFS A;  4H3U A;  4HBR A;  1VZZ A;  2PZV A;  1ZX2 A;  3UB1 A;  5JPP A;  5AYR B;  5IG5 A;  3EF8 A;  3DGM A;  3JUO A;  2PNC A;  3MG2 A;  3PZW A;  3JVC A;  3HZP A;  1TP6 A;  1S5A A;  5IG3 A;  3MG3 A;  1IQY A;  1W01 A;  2ZL8 A;  1Q81 4;  5TGN A;  1WMN A;  1VQM 3;  3Q2P A;  2SBL A;  2C11 A;  3I0Y A;  4N6M A;  4WHA A;  1VQK 3;  3LOY A;  1JV2 B;  3X41 A;  3X3X A;  2P05 A;  3CPW 2;  1NJI 4;  4O8S A;  3NXJ A;  1GS3 A;  1YHQ 3;  1GD3 A;  3WOD G;  4HJL B;  1QAK A;  3ALA A;  2OTJ 3;  1K28 A;  3IPT A;  3MSO A;  3CNX A;  3U97 A;  4RZM A;  2BNG A;  4FMB A;  4HM4 B;  2W9P A;  1YIT 3;  1HU9 A;  1A2V A;  3SOA A;  4NRE A;  3CC2 3;  3OX9 A;  1KQS 2;  3LT8 A;  3SLU A;  1Y4K A;  3KII A;  1YJ9 3;  3AMO B;  1SJW A;  2W56 B;  3KZT A;  1NO3 A;  2GBX B;  2QA4 3;  4MMZ B;  1G96 A;  3KKG A;  4HM0 B;  4L7K A;  2CFD A;  1K41 A;  3FLJ A;  3CCL 3;  1DMN A;  1JN5 A;  2BMO B;  2IUK A;  3FF0 A;  3LH4 A;  4XM4 A;  1VQP 3;  3TDG A;  1UW1 A;  4WFO A;  3G0K A;  1QVF 2;  1UI7 A;  2HMJ B;  3FZW A;  1W6C A;  2L4V A;  3PCS A;  2XF3 A;  4HM7 B;  3T8U A;  3J7Y d;  1VQ9 3;  4XDW A;  3V99 A;  1Q82 4;  1IVU A;  4FCZ A;  3FKA A;  4OVM A;  3OV4 A;  3QRD A;  1GY7 A;  1M1K 4;  2YFI B;  3UJM A;  1JB5 A;  2OQE C;  1IU7 A;  2CG1 A;  3BND A;  3CCJ 3;  1AV4 A;  2W2C A;  3Q90 A;  5JPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...