2XGNA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
427
structure length
420
Chain Sequence
b'VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 137
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xgnA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xgnA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xgnA02
1W8YA 1ES2A 4UAAA 3FZCA 4Z9QA 1IELA 5EVIB 1ERQA 4OPQA 3A3EA 1L0GA 3ZG0A 1PWGA 3BRMA 3EQUA 5KZHA 1HVBA 2HDRA 3HLWA 1IYPA 2FFYA 4K0XA 3TSGA 1SDEA 4N9LA 3PBNA 3WS4A 1H8YA 4R4RA 2XGNA 3BEBA 4FSFA 4R3BA 2ZM8A 4B88A 3NY4A 4HESA 4OOYA 1EI5A 2X01A 4ZDXA 3CZDA 3FKWA 4KZ6A 1RGZA 4U0TA 1MKIA 1PZPA 2OSUA 2Y2HA 3M6HA 5CGXA 1NZUA 1XA7A 5L2FA 5CGSA 2ZC6B 1I2WA 1ES3A 3IXGA 4H8RA 4KZ3A 3VSLA 3Q07A 4PMAA 3GR2A 5KSCA 4R0QA 2HP9A 4OPYA 4OQGA 4S2NC 1Z6FA 2I72A 4E3LA 3PTEA 1MWRA 4BD1A 2H10A 3SH8A 4HEFA 5AQ7A 1TVFA 2UWXA 2DRWA 5HAPA 4WYYA 1K54C 3PBSA 3UY6A 3W4PA 1GA9A 1ZKJA 3UE0A 3IWOA 2FFFB 5EECA 4LV3A 2Y4AA 1KDWA 5GLCA 3BFCA 1LHYA 3DW0A 4OQHA 5E2EA 1IKGA 3A3FA 2J7VA 1W8QA 4QU3A 5GLBA 3C4PA 1ONHA 5CTNA 3MXSA 4C6YA 4MEZA 5FI2A 2EX6A 1VM1A 2ZQAA 1MY8A 3C4OA 3VFFA 3VMAA 5CECA 5AQ9A 5FQIA 4GDNA 1IYSA 2P74A 1QMFA 3V3SA 4X68A 2WAEA 3G4PA 2ZQDA 3FV7A 4A5RA 4NK3A 1BULA 5M19A 1G68A 1K6RA 4KQQA 3O87A 3MKEA 4YINA 5I94A 5D3OA 4YFMA 1Q2QA 4Y0OA 3D4FA 1DJAA 1GHIA 2HP6A 3UE1A 1ES5A 4DRTA 1YLJA 1K56A 4GDBA 2Y55A 4R23A 1CI8A 2GDNA 5DF7A 4WBGA 1PIOA 4OP8A 1BTLA 1HD8A 2X71A 1XXMA 4X55A 4P87A 3VSKA 2Y2KA 4OOLA 1FR6A 5EVLA 4B4ZA 4BQMA 3S4XA 5BOHA 3E2KA 4HBTA 2A49A 2Z2LB 4KZ7A 3IF6C 2BG1A 4S2NA 5DTTA 5EPHA 5EOOA 5EE8A 3VFHA 5AQBA 3C7UA 2H5SA 4WEKA 4RA7A 1BZAA 3FKVA 4P85A 1K54A 4MNRA 5JYOA 2H0YA 3BFEA 4QHCA 3AGFA 3WRTA 5F82A 2WUQA 4U0XA 3BECA 4BLMA 1PWCA 2IWCA 5CXWA 4OPRA 2XQZA 4FD8A 4ZJ1A 4S2JA 4GB7A 3AGEA 3ZDJA 1O7EA 3CJMA 1KE3A 4EBLA 1LLBA 4IBRA 4IBXA 1L0EA 5A92A 3OCLA 3ZNYA 1E3UD 2XEPA 1U60A 3IXDA 1DY6A 5FI7A 2EFUA 2Y2JA 4FCFA 3FYZA 1ZC2A 3UDFA 4DE1A 3SH9A 4IEDA 3NDGA 3VP4A 3SS3A 1KVMA 1JTGA 5CEDA 3TOIA 2DNSA 2ZC4B 2RL3A 3BYDA 4JPMA 3OPRA 1J9MA 1ESIA 3ZVWA 1PW1A 3S1YA 5FQMA 3DWKA 4WZ5C 5GLDA 3N4IA 1K55C 2HDQA 2PU2A 1NYYA 1KDSA 2V1ZA 1NY0A 3A3JA 3P98A 5CGWA 5GHYA 3BLMA 2WGWA 1MWSA 2ZJ9A 1ERMA 3HLBA 3Q7ZA 5AQAA 5EVID 4S2KA 3NCKA 1KE0A 5E2FA 2J9PA 4R4SA 1ONGA 4S2LA 5F1FA 1PZOA 1E4DA 3LO7A 3IF5A 2Y2OA 2HP5A 5A91A 5CEBA 3G35A 4RX2A 2J8YA 3VP2A 3IF6A 1XPBA 2QMIA 3O88A 5DVAA 4X69A 1BLPA 3PBTA 3Q81A 2V20A 3IXBA 3P09A 4ID4A 5KMWA 3C5AA 1SDNA 1JTDA 4GD8A 4Q8IA 5HFOA 1YM1A 4P6BA 5M1AA 1DJCA 4WEJA 4QJGA 4DDYA 4NETA 2JC7A 4KZ9A 4X56A 1DJBA 3Q82A 4GNUA 1N4OA 3UDXA 4DXBA 3UPNA 2C5WB 3O86A 3VOZA 2JBFA 1OMEA 3LCEA 2ZD8A 3FWLA 1XX2A 4S2OA 2QZ6A 4S2IA 1FCMA 5FSRA 4UHUA 5EOEA 3MZFA 5FDHA 1MXOA 4L0LA 1NZOA 4GOGA 1KGEA 4RVAA 2EX8A 4KZ8A 5CHMA 5FQQA 1W79A 1Y54A 4LCMA 3LY4A 3A3DA 2Y2LA 4JKTA 2ZC3B 4WM9A 3Q1FA 5FAPA 3MBZA 3LY3A 2WADA 5HAIA 4MBFA 5FATA 5DTSA 4JBFA 4JF5A 1CI9A 3IWIA 4WMCD 4DE0A 3ZG9B 3EQVA 3G34A 3HLEA 2Y2IA 2J9OA 1NRFA 2ZLYA 3GTCA 5TFQA 3UDIA 1K4EA 1BLSA 1O07A 4WZ5A 4WZ4A 3WWXA 3VP3A 4BD0A 4EBNA 3ZCZA 3S22A 4Y0UA 2G2WA 1K55A 3W4OA 3PBQA 3RJUA 3E2LA 2XH9A 1SKFA 1NYMA 3WRZA 3HREA 4E6WA 2Y2MA 2Y2GA 2HDSA 4GN2A 2V2FF 3PBRA 5U47A 1WYCA 3CG5A 3OPLA 1MWUA 1AXBA 3NI9A 4JF6A 4N1HA 4FH4A 3GVBA 3JYIA 5FI6A 1HTZA 1LL5A 3IT9A 2XDMA 5HW3A 5E43A 3N7WA 3ZVTA 3GV9A 1FOFA 1K6SA 5E2GA 2ZQ9A 2XF3A 4ZBEA 3SS5A 3ZNTA 4KQOA 4EQIA 3AGDA 5CHUA 3ZGAB 1ALQA 1K38A 1SCWA 3TG9A 2PBYA 4LENA 2WGIA 1YT4A 1IYOA 3A3IA 4B4XA 3UN7A 3N8RA 3N8SA 4UA9A 4ZJ2A 1W7FA 3GMWA 4LV0A 1FSWA 2XLNA 2ZM0A 3IHBA 3GSGA 5KSHA 4KG6A 3UO9A 1XP4A 1I5QA 3M2JA 3ZG5A 2Y2NA 3UPPA 2XFTA 4O7DA 4CJNA 2WGWB 3ISGA 1NXYA 3OCNA 2EX9A 5A93A 5J8XA 3NBLA 1C3BA 2PU4A 3IH8A 2WYXA 1TDGA 3DTMA 4KZBA 5HARA 1N9BA 1LL9A 4OP5A 3WS5A 3SS4A 1IYQA 3HUMA 3N8LA 4BL2A 4M3KA 3HLCA 1MBLA 1ZG6A 3SH7A 1IEMA 3BLSA 4X53A 3UNWA 2X02A 3IF6B 1BUEA 1GA0A 4ZAMA 1FR1A 2R9WA 1VQQA 1I2SA 1WYBA 4MBKA 4XXRA 5EVIC 3N6IA 4DDSA 4UA7A 5M18A 3OPHA 4WELA 5EUAA 1KGGA 3OZHA 2QPNA 1S6RA 4LCLA 3VP1A 1NJ4A 1ES4A 1RGYA 1RP5A 2P9VA 3NDEA 5A90A 4XUXA 1JWVA 2DCFA 3G31A 4N92A 4UA6A 3HLDA 1XGIA 2ZM2A 3W4QA 3WS1A 1PI5A 5IHVA 3MKFA 5HAQA 4DF6A 1KGFA 2Q9MA 3ZFZA 1XA1A 3G32A 4X6TA 4E3IA 1EWZA 1CK3A 1FSYA 2ZC5B 3W8KA 4KZ4A 2R9XA 3ITAA 3Q7VA 4E3OA 4PPRA 1ESUA 1K25A 4DXCA 3PBOA 4RX3A 1YLPA 1RCJA 3MXRA 1W5DA 4CPKA 4FH2A 2ZQ8A 5GHZA 3G2YA 1E3UA 1PYYA 5HL1A 3B3XA 4JXSA 3IHAA 4KQRA 5HX9A 3ZG7B 2VGJA 4DKIA 4KG5A 2XK1A 1FQGA 3QNBA 4GZBA 3HUOA 4KG2A 4OQ0A 1GHPA 4JF4A 4KENB 1MWTA 5GHXA 2WK0A 4D2OA 4S2MA 4R3JA 1XGJA 5CRFA 4BJPA 2JE5A 1FCOA 3C7VA 3NC8A 5FQ9A 3HLFA 3IXHA 4HBUA 4JXGA 1MPLA 3BFGA 3CMZA 5DF8A 5FQJA 3WS0A 2JCHA 2H0TA 3PAGA 1G6AA 4LV1A 1K56D 1YLZA 4ZTKA 4QD4A 3SOIA 3IH9A 3MZDA 5CERA 4RYEA 1BLHA 2XR0A 1Q2PA 5EVIA 1L0DA 5GLAA 3HLGA 4BENA 4OLDA 5JYPA 2Y59A 3BM6A 4JXWA 4K0WA 1FCNA 3I7JA 4E3JA 5FAOA 2VGKA 4IVIA 4E3KA 4EV4A 4KZAA 5TGFA 4C3QA 5G18A 1L0FA 1HZOA 4C75A 3QHYA 4PM6A 1YMXA 3PAEA 1LI0A 2ZQ7A 3MFDA 4S2PA 4GKUA 2CC1A 4OH0A 3RXWA 5FASA 4QB8A 4N1XA 5DTKA 3OPPA 2OV5A 4MLLA 4GD6A 4OONA 2A3UA 2EXBA 1YQSA 3G2ZA 4U3TA 1YLYA 2RCXA 5CHJA 2G2UA 1H5XA 4OKPA 4E6XA 1PI4A 4P0MA 1K57C 1YLTA 2HDUA 2WZXA 1BT5A 1CEFA 4PM8A 5E2HA 1QMEA 3ZG8B 1GHMA 4KZ5A 2WKIA 3OC2A 1SHVA 4OQIA 5F1GA 4EBPA 4ZJ3A 1YMSA 4JXVA 4LV2A 1EROA 1TEMA 1LI9A 1JWPA 3RXXA 2C6WB 2WGVA 3IWQA 2IWBA 3UE3A 2EXAA 2P9VB 2XD1A 3GRJA 2WAFA 3LEZA 4E3MA 4Y7PA 2Z2MB 1JWZA 1CEGA 1TDLA 2ZMAA 3M2KA 3GQZA 2XFSA 4WMCA 4E3NA 1M6KA 3QNCA 5TR7A 3V39A 1GCEA 4OPZA 1ZG4A 4DE2A 4EWFA 1PWDA 2Y2QA 5FA7A 4EUZA 1KE4A 3VOYA 2WZZA 3IQAA 4XUZA 1BSGA 1S0WA 4Y0TA 4R1GA 2ZC7A 2Y2PA 4OLGA 1YLWA 4BL3A 3Q7VB 4K91A 5GL9A 3V50A 2EFXA 5F83A 3M6BA 2IWDA 3MZEA 4MBHA 1K4FA 2XD5A 4IVKA 4PM9A 4QY6A 3WS2A 1M40A 3VP0A 3HUNA 1JVJA 1L2SA 2WKEA 5CTMA 3ZHHA 3HBRA 3DWZA 3HVFA 4QY5A 2BLSA 3G30A 1H8ZA 3HL9A 4OVDA 3BFDA 2ZQCA 5FQKA 3BFFA 1IKIA 2Q9NA 4PM7A 1BLCA 1PW8A 2WKHA 2OLVA 1WE4A 2EX2A 2E8IA 4DE3A 4PM5A 3ITBA 3O3VA 5FAQA 3NIAA 3V5MA 4N9KA 4OOMA 4JLFA 1XKZA 3UPOA 1KVLA 4F94A 2OLUA 2B5RA 1K57A 5DF9A 1E25A 2HPBA 3V3RA 2Y91A
chains in the Genus database with same CATH superfamily
1W8YA 3FZCA 3SHGB 5EVIB 4GIPA 3ZC7B 1C7HA 3ZG0A 1PWGA 3A42A 3EQUA 2B3TA 4X64M 2XLJA 1KSIA 5FGOA 5IZ7D 3AGNA 1TP6A 2FFYA 3MQ0A 4K0XA 3A46A 1SDEA 3PBNA 3WS4A 3NHXA 1H8YA 1Y8GA 3CI6A 3MQOA 2BJWA 3L7HA 4R3BA 3M7GA 2CC3A 3OWSA 3SYUA 4ZDXA 1OPXA 3F92A 4KFDA 1RGZA 4U0TA 4N6UA 5IW9A 3FKAA 3EB8A 3M6HA 1IQPA 3GZYB 4MCWA 5CF2A 4LJ7A 1XA7A 4HJ3A 5CGSA 5AVFA 2ZC6B 1I2WA 1ES3A 3IXGA 3Q07A 4PMAA 1LNHA 4JI7M 1IN6A 3EEHA 2NUPC 3LIEA 4S2NC 2ZOHA 4E3LA 3HJ8A 3PTEA 1JZOA 1DETA 1V74A 2H10A 4HEFA 4WP2A 2UUAM 5EEOA 1RKYA 2UWXA 4HVNA 3UY6A 1G96A 1G4AE 3W4PA 1NY5A 4IIAA 2VDBB 1GA9A 4LEHA 1ZKJA 1PFPA 2EA9A 2FFFB 1NJGA 3HX8A 1D6YA 1VEGA 4Q7JA 5E2EA 3KIIA 5EP1A 3A3FA 4NRWA 3U60B 1W8QA 2CHGA 7RNTA 4IT7A 4QU3A 1BRNL 1ONHA 4GHAA 1PY3A 2L4EA 1P9RA 1GJSA 2DAMA 1E9SA 1MY8A 4HJ4A 3E21A 3EF8A 3GSPA 2P08A 2HHHM 4IBIA 4LRXC 3J2PB 4FWGA 2GEYA 1ZAEA 2BT3A 5BR8M 4KVHA 1MZUA 1CYVA 3ROBA 5D3OA 1Q2QA 1FW7A 1NWWA 1JR3E 3MG2A 4DRTA 2DAKA 3CF6E 1K56A 1AVKA 3CPOA 4R23A 4FUWA 1BVSA 3J7BA 1G71A 1M1XB 1PIOA 2H0IA 1TU5A 1BTLA 4G6ZA 3BNBA 2M7VA 4WFOA 1W6CA 1XXMA 4X55A 1QAFA 3ULFA 1ZGXA 2Y2KA 3LI9A 4OOLA 5EVLA 3VSKA 2XSSA 1FUTA 3PXPA 2F5WA 1MKMA 5FL3A 5FTLA 3LXUX 2P7JA 1Z5AA 2UV0E 3H3HA 2PYPA 2JWSA 1Q814 1JKGA 3HJSA 3IF6C 4S2NA 3VFHA 3FGYA 3T1XA 4QOSA 3GECA 4PKYG 2DAIA 1X1YA 4LFAM 1OFHA 3B4PA 1CF0A 4RA7A 3S7PA 2VV7A 4MNRA 2O0YA 3CPW2 1D06A 3BFEA 2ZBKB 3AGFA 1YSYA 1LVNA 3T4LA 1SKOB 3BECA 2IWCA 2VJWA 4OPRA 1I70A 2KOIA 4FD8A 3W0LB 4DV6M 4Z1WA 4GB7A 3AGEA 1S1ZA 3CJMA 3K92A 3I01M 1LLBA 4M4XA 4EBLA 5A92A 3OCLA 2KRUA 3QAUA 3UMDA 2PZVA 2L6OA 4PDGA 4AKZA 3T50A 3UDFA 2Y79A 4DE1A 3OBFA 1GD3A 3UK6A 4ILFA 3S5CA 1L1ZA 3CC43 4HH3A 1DO2A 2ZL8A 3CC23 1W6YA 1TRPA 4P6ZM 3OPRA 2H5XA 4HM5B 2JN7A 1D6ZA 3DWKA 3N4IA 1E94E 5GSPA 1KDSA 3GLFE 3B33A 3UZUA 3JUOA 1NDOB 2V1ZA 3IS2A 3LIBA 3GLIE 1UGIA 2WGWA 4JF8A 2J7OA 5AQAA 3W2ZA 4S2KA 3NCKA 2F5OA 3G16A 3T1SA 1ONGA 3T4SA 2KHHA 1A90A 3KSIA 2F4VM 2HP5A 3PNYA 2CW9A 1VG5A 3NQYA 4N3VA 3CC73 1XFNA 3VP2A 1W2ZA 3IF6A 3W68A 4PD2A 4RNAA 3Q81A 2V20A 3IXBA 2DHRA 4R71A 3HI7A 4ID4A 1D6UA 3GPYA 3FD9A 2W1TB 3NQZA 5JBSA 1SDNA 4GD8A 4NSRA 4G4OA 3EE1A 4NETA 1SARA 2JC7A 2E2UA 4HM6B 1DJBA 3Q82A 4GNUA 4DXBA 3FCSB 4GHLA 4EYCA 3F7SA 1Z5BA 5AIFA 1Q824 3FWLA 2L2DA 1XX2A 1YJ93 1SIHA 2QZ6A 4S2IA 4DV3M 5DJUA 4IJEA 5EOEA 5FDHA 3NWLA 3A45A 4JI6M 1PJQA 1BNFA 3LH4A 1KGEA 1NZOA 1S67L 3E4PA 4KZ8A 4RVAA 1Y54A 3BNCA 4G3VA 1KFVA 2BMRB 2XROA 1Y4KA 2DNAA 3T4JA 2ZC3B 3Q1FA 3KE7A 3LY3A 4GC5A 1RGFA 4G1MB 1VQ63 4I4KA 4HIAA 1V57A 1Q864 3EQVA 2K31A 1I2GA 2Y2IA 2ZLYA 3HX3A 3UDIA 3H4JA 1K4EA 1GOYA 3WWXA 4MMYB 3AMOA 4NOOB 4J5GA 2ZL1B 3S22A 4EBNA 3PBQA 1OT6A 2HMLB 4Y17A 3GLGE 4IIWA 2Y2MA 3HJIA 3CF2A 5U47A 3OPLA 2D7GA 2HMNB 1WGNA 2Z77A 2JA2A 5CXOA 4N1HA 1Q7HA 2CV2A 3LICA 3JYIA 1ZMWA 2XDMA 1RHLA 4ARZB 4HYZA 3CWFA 3ZVTA 1LSWA 1D0KA 1AQZA 3HCYA 4GJ4A 4LCBA 1LOWA 3GV9A 2A15A 2QPAA 2E8JA 2ZQ9A 4XT2B 1I2FA 4ZBEA 3SS5A 4MJDA 1NO1A 2O9UX 1AUAA 3LZAA 3ZGAB 1ALQA 2OOLA 2PBYA 4X66M 1FGTA 2BO9B 4LENA 3LW5F 1V34A 3UN7A 5ITXE 4UA9A 4ZJ2A 3T1QB 2EO2A 3NM2A 3GMWA 1N34M 1ROAA 1NO3A 4WHAA 4NG2A 4Q0HA 3TDGA 3U61B 3IHBA 3GSGA 1WA9A 1JBTA 3D4AA 2XSZD 2Y2NA 4O7DA 3KS4A 2QBYB 1NXYA 3GLHA 1GY6A 1MGWA 1HLUP 2JKTI 1TDGA 4W5WA 4HLQA 2OAQ1 4OP5A 3SS4A 1QYRA 2L4VA 4DUZM 4GHIA 4M3KA 3DXOA 3V99A 2CEAA 2H0HA 5L10A 3U2AA 1R2ZA 4JGPA 2HMOB 1T3TA 2MJ5B 1OJGA 1YE9A 1VQQA 2MC8A 2R78A 1RGKA 2B24B 3OWYA 4XXRA 5EVIC 3N6IA 2QSFX 2J3TC 4DDSA 5M18A 4WELA 3M6AA 1IBLM 2W04A 1OTAA 2QPNA 4LJ6A 1O7HB 2V0WA 4QHTA 1G02A 2Q2EB 1NJ4A 1OGXA 2W1RA 3FH1A 3ILKA 3FG4A 4H6JA 4BBVA 1O7PB 3CNMA 4N92A 4UA6A 4GL6A 3A0SA 5IHVA 3GRUA 3IG5A 5D81A 1OIPA 1KGFA 2J3TD 3LGOA 4RF0A 2BNGA 2E2VA 5D82A 1R7RA 3CGWA 1FGRA 3OWUA 1S723 1TS8A 1XC8A 2ZC5B 4MGHA 1OHOA 3PNVA 1O7MB 2R9XA 1X1XA 3ITAA 1O7GB 2KNVA 4JRFA 4U13A 4DXCA 3KOYE 1OF5B 1YLPA 4IHQA 1Q9EA 3MMPA 2X4AA 1AIPC 3BB9A 4WN5A 5FEFA 4FCZA 2K54A 1JV2B 2X8AA 2KXEA 3DTEA 5F3WA 3ZG7B 2BMOB 2DKLA 4LYLB 4DKIA 2HJEA 2W9PA 4EUVA 3UB9A 3LTAA 1ISKA 4HJ6A 4D2OA 3AL0C 5STDA 3S28A 4BB9A 2JE5A 1HNWM 2KEBA 4P17A 4HBUA 5FQJA 2PDRA 3AOEC 2B02A 1JB0F 4N6TA 4LFCM 1N9EA 1G6AA 4RYEA 3P7NA 3HU2A 5EVIA 1L0DA 3EEAA 4HNBA 3B74A 5JYPA 1QZMA 4BLCA 1RU3A 4K0WA 1NLYA 3K9PA 3KS8A 2JZ1A 2L1MA 3CMA3 4LF6M 4IVIA 2O01F 4L9GA 3VDPA 2CFWA 5EXPA 3GLFB 2L09A 1B20A 1HZOA 5L09A 5G2GA 3QHYA 4G4NA 4NHFA 1TS6A 1YMXA 2W3DA 2MROB 1RGAA 2F56A 1G5UA 4PDIA 2CHQA 3EHCA 3BQ8A 4RNZA 2DXIA 1DVCA 1VQ53 3NJAA 4XBOA 5G4ZA 5FASA 2JKRM 3LTBA 5G1KA 4X2OA 1S4SA 1BU4A 2A24B 4JI2M 3FF2A 4XM4A 5KP1A 1FGQA 3IBJA 2YFIB 3EBTA 3UB7A 3OW22 4RF1A 3F1PB 3A76A 3V76A 1YLYA 2RCXA 1QDTA 3QP1A 1JBRA 2G2UA 5CHJA 3PYJA 4OKPA 1IY2A 1YLTA 1J09A 2I7NA 4LJ9A 2HDUA 2R6FA 1UCLA 1FJGM 2JNHA 1KOUA 2D7EA 2F5PA 3IHPA 5CK6A 4AQYM 2N35A 1SHVA 4DV4M 1G28A 1T1BA 1VZZA 4ZJ3A 4X2HA 1YMSA 3CPTB 4LLOB 1M9GA 1TS7A 3QWLA 4J9AA 4BTYA 2C6WB 2WGVA 3IWQA 3UE3A 2F99A 1OIZA 5D83A 3SAWA 1TDLA 1K734 4E3NA 1YVBI 4R70A 1K3XA 5F68A 1IXSB 1GCEA 3PXGA 1ZMVA 3S27A 1V33A 2JKFA 3H82B 3U60A 1IN7A 1QAKA 1PJTA 3B7CA 3PVSA 1T2HA 3DTKA 3JVCA 4XUZA 2O5RA 4CLCE 3KYZA 3L28A 3JR5A 1TH4A 2O3OA 2JXNA 1I3IA 1B2SA 2RNTA 3GP1A 1CJFA 3ECFA 1HNZM 2D7HA 4EV2A 3HKPA 2XD5A 4IVKA 1H8MA 2WSCF 3WHOA 4F3LB 4TX4A 4DR7M 1FGMA 3T1HM 2CFKA 2CFGA 1M40A 3NOTC 4QY6A 2QZ4A 5CTMA 4JI3M 1PNEA 2JY6B 1LOYA 2WKEA 2ZM6M 5LMNM 3GLGB 1IFQA 2ZTCA 2FE8A 4I3JA 1UWPX 3BOSA 5ITQA 2ZHXB 1H8ZA 5KQDA 3B47A 4BWIA 1L2CA 3BFDA 4EC6A 5DJTA 2M1CA 1NVMA 1PW8A 2WKHA 5DYGA 6RNTA 1IVXA 1EFUB 4IBEA 2GU1A 5FAQA 4WUJA 3V5MA 4N9KA 3IG8A 3UPOA 3A0RA 3K1JA 1HJPA 1TS0A 4GKKM 2HPBA 3V3RA 3U6CA 1RGCA 1GMQA 1XFQA 4NXMM 3FF0A 3OOVA 5AI1A 1N32M 3SZTA 1QAOA 3A3EA 3HJKA 3NHQA 1BANA 5KZHA 2YFLB 1OTEA 4JGOA 3HLWA 2W2CA 4M9SA 1SKOA 1GY5A 4N9LA 1IT7A 1RLSA 1GJTA 4R4RA 2Y0QA 1OJ5A 2XGNA 3VK7A 1XNQM 4HESA 4KZ6A 1WR1B 4FWDA 3RE8A 1A2VA 3J7Yd 2W3EA 1MKIA 4I39A 1RNBA 5LC7A 1GL7A 3B42A 3FG3A 1NZUA 4G3WA 3U6LA 1OKSA 3CAXA 1JJ22 2RBIA 4KZ3A 4H8RA 4HOIA 3C30A 1BNIA 3SYKA 3F8XA 4DR5M 2YFJB 4K61A 1YVSA 4OQGA 5HDDA 3LCUA 1JB4A 5JPUA 2NQ8C 1QVG2 5MC7A 3SH8A 1QDRA 4DJ2A 1TVFA 2ZA4A 1I8VA 5HAPA 4H3UA 3LYXA 4WYYA 1K54C 3PBSA 3IMAB 3F14A 5LMUM 2WKPA 1WGLA 3EN1B 2R46A 3CXC2 3BFCA 3LR0A 1LHYA 4OQHA 2XZFA 2V1CA 2XA7M 3TWMA 2DVWB 2F4YA 1OTBA 2CMNA 4JGRA 2R0IA 5GLBA 2YKFA 4C6YA 3MXSA 4AG6A 2PHYA 2EX6A 2JDIH 3C4OA 1SPUA 3KN4A 2W1TA 3VFFA 1PJIA 2GBXB 4PAUA 4GDNA 5FQIA 1QMFA 1PYLA 1AY7A 3G4PA 4OX9M 5M19A 1BULA 3NXJA 1G68A 1N9NA 4NK3A 3MKEA 5I94A 4HH2A 2QKPA 4YFMA 5J3WA 4D81A 1BSEA 1DJAA 2PR6A 2HP6A 3IX3A 1E3VA 5G1LA 1N9LA 1CI8A 5DF7A 4M0DA 3S67A 4WBGA 3FUVA 2DMWA 2R4JA 3S7OA 4OP8A 1HD8A 1PM5A 4P87A 1BRSA 1W02A 1GSPA 2LXEA 1A5TA 1OCVA 4B4ZA 2I9WA 2W9QA 2I9VA 3DGYA 2LYXA 2A49A 1XMOM 5EOOA 5EE8A 2ZL1A 3X41A 1T1CA 2W3GA 2H5SA 3C7UA 1P97A 2RSXA 3F9SA 4WEKA 1V92A 1BZAA 2DI0A 4P85A 1K54A 3I04M 1WTHA 5JYOA 3L27A 2H0YA 1ZX2A 1YI23 2WUQA 2M60A 1DVDA 1WMPA 1IVUA 1IQ8A 3LYGA 3VLFB 2JKGA 2P0MA 3BY9A 2YNMD 1HQCA 4M9ZA 3GO8A 3K2NA 3KO6A 1WNHA 1VHMA 3D8BA 1O7EA 4IBRA 1PJJA 4ARZA 2ERCA 1DGBA 5KPRA 1GABA 1E3UD 5AEWB 1NWZA 5FI7A 3ZNYA 1BVIA 2KW0A 2C5RA 5DFXA 1GS3A 4FCFA 4XT2A 1ZC2A 1UW1A 1VETB 5G4YA 5LC6A 7STDA 2JUJA 1BRIA 2W0QA 3T1YM 1JTGA 4XBTA 3WOEB 1VDLA 2DNSA 2DZLA 3C38A 4X65M 4K90B 3BYDA 4JPMA 1RN7A 3VE3A 3T8NA 1J9MA 4HM0B 3MR0A 5FQMA 4DR1M 1UCIA 3MPHA 4P16A 3ZCBB 1GOVA 2JP7A 1NY0A 2O9CA 4OVZB 3NBBA 2IUJA 5GHYA 3BLMA 1R6BX 3OTOM 2QBYA 3RGSA 3Q7ZA 3VP0A 4O8SA 3EX9A 3CNXA 1VEUA 4O0PA 3MG1A 2J9PA 4R4SA 1DO0A 1LT0A 3DMCA 2HKJA 2K0BX 1RNTA 2QCUA 3LO7A 4R7GA 4Y2FA 1SZVA 5A91A 5CEBA 3AV0A 3CCU3 3G35A 1D0MA 3VKGA 4DR4M 1EG9B 3JUPA 3JVVA 1QJGA 2QMIA 5DVAA 3K5TA 3MHEA 2K47A 3PBTA 3PYPA 1OTIA 5I97A 3SARA 1T1AA 1YM1A 3OX9A 4P6BA 4DDYA 1E9RA 1OJLA 1SG9A 4GEWA 2J3WA 2GZAA 3EGDC 4X56A 1V9YA 4YWZA 3R7WB 4LF7M 3H4MA 1BGSA 4RNYA 3UPNA 3FTDA 3O86A 3SASA 2KRKA 4EQ1A 1DGGA 2CE7A 1NNVA 4GB5A 2PT7A 4LRTA 3GRRA 1FCMA 4UHUA 1UCKA 1QMAA 4QHSA 5FQQA 1WMOA 3LR5A 3U6MA 4LCMA 3LY4A 2QENA 2HL7A 4G4RA 3U5ZA 5HD3A 4JKTA 4WM9A 5IU1A 1SXJE 2F5SA 1OF5A 4JBFA 4XDVA 1N8QA 1RDSA 4DE0A 2P38A 2VGLS 1NV8A 3SLUA 3G34A 3HLEA 5TFQA 2C99A 1O07A 4FW9A 3CHWP 4HEOA 2LQVA 4BD0A 1Q40B 4Y0UA 2G2WA 5I5LA 2GNXA 5ELUA 1L1TA 3RJUA 4L4UA 1YJW3 1SKFA 3WRZA 5EV0A 4XK8F 4O3VA 3KXEC 3D3LA 1G8PA 4QWOA 2IMJA 1L8QA 1DMMA 1N9JA 3N9HA 2G7UA 3LQQA 2Q0OA 1NHGC 5EXXA 4QWTA 1HTZA 1QANA 2LVOC 5E43A 2Z76A 4FCJA 1FOFA 1C7YA 1K6SA 4O02B 2BASA 3ZNTA 4KQOA 3AGDA 2J5YA 5CHUA 1SCWA 3O5YA 3TG9A 1XHBA 2CUZA 5TBMB 2BHMA 1YT4A 1IYOA 4IBCA 3BNEA 2BWBA 3N8RA 1KYIA 4HM7B 3HGIA 3RGRA 4LV0A 2PR5A 2BJVA 1FSWA 4BBAA 5EM1A 1YGEA 2KCDA 2L7IA 1WIVA 5IG4A 2MH8A 3QK9A 4CGYB 3UO9A 2P5TA 4JI8M 1J7KA 2DAGA 3LEQA 1I5QA 4WP5A 3UPPA 2XFTA 2D02A 2K2NA 2CKFB 4R1KA 2QP9X 1EUIC 2EX9A 3NBLA 5AIIA 1C3BA 2OAP1 3HHXA 2PU4A 1EQKA 2A24A 4MDZA 5FTMA 4LF5M 1IDPA 1DGHA 3HUMA 3N8LA 1MBLA 1OFIA 3LIFA 2QA43 1I94M 4X62M 3A0VA 1IEMA 3BLSA 3SH7A 3FUXA 1BUEA 4ZAMA 1FR1A 1XXHB 4MBKA 3AJIB 1FA3A 3SBJA 4UA7A 4EEPA 1FNNA 3CPTA 1EEJA 2VKSA 3A5EA 1T18A 3VP1A 3U6QA 1Q39A 1IXRC 2EKFA 3QP4A 1VQP3 2UXDM 1RGEA 4F2LA 4I81A 1QVF2 3FRHA 2DCFA 3G31A 2OQ4A 1XGIA 5A0OB 3WS1A 1PI5A 1IXSA 2R65A 3NBRA 2V9AA 3UB1A 1US1A 2OTJ3 1XA1A 2R62A 2MJ6A 2V8CA 4X6TA 2DENA 1VDDA 1VQL3 2EJSA 1CK3A 5KP3A 2HV1A 1FSYA 4KZ1A 5KQ8A 4KZ4A 1YIJ3 4E3OA 1GMPA 5KP4A 4PPRA 5IT9S 1ESUA 5KPTA 1K25A 3K3CA 3MFXA 3PBOA 5CX7A 1IV9A 4J5KA 1FIKA 4CQHA 5HSQA 2CG1A 1D0LA 1OAOC 1G6OA 1UCJA 1A67A 3LUQA 4F3LA 2OO9A 1BSCA 5GHZA 3G2YA 3UB5P 3UJMA 1PYYA 3FKEA 3K9OA 4M9XA 3B3XA 2W6JH 3GLGA 2HZ5A 3H7WB 2VGJA 5IEOA 3HZJA 1VQN3 3QNBA 1RRLA 4Q53A 1RRHA 5DRVA 2INWA 4JF4A 3D9RA 2YQZA 1TIJA 5GHXA 2WK0A 4FMAA 4KFFA 1H6UA 4R3JA 3C8CA 1S66L 3U6DA 2RKOA 1CUKA 5CRFA 5EVEA 2XRNA 4BJPA 3NOUC 3C7VA 1L2BA 2XSOB 3IXHA 4D60A 1VEKA 4YY3M 3ICYA 1MPLA 5DF8A 3CMZA 5EVHA 3BLZA 2JCHA 1QZEA 3WA3A 1Q7Y4 3MSOA 1L2DA 3KCHA 4MMNA 1YLZA 4QD4A 3ALAA 2B18A 1BNSA 3LT9A 1C54A 3D5IA 3BM6A 3CUEC 2H1RA 4JI0M 3JVUA 1C1KA 4I5QA 4E3KA 2BNKA 2W82A 4KZAA 1FUWA 3NOPC 2RGHA 2Z4SA 1WJ7A 1YNVX 1Z59A 2G5GX 4Y15A 2GJ3A 4BBTA 3WA2X 1STDA 1IK3A 2CP8A 1J2BA 3OV4A 1BOXA 2W27A 4GKUA 3RXWA 2W0NA 4OU7A 1EW0A 4N1XA 3C2WA 4NRVA 2OTL3 2Y8HA 5FDSA 2QEX3 4ZRRA 4GD6A 4HQAA 2A3UA 2EXBA 2WSEF 5IT5A 3G2ZA 3Q1CA 1IBKM 1H5XA 1IY1A 4P0MA 3E46A 3E99A 1K57C 2FXTA 1HKXA 2IY2A 4KT3B 1BT5A 4PM8A 2KRTA 6STDA 1QMEA 1GHMA 2R4EA 3IX4A 2WKIA 1ZQ9A 1WHCA 2FZ0A 1A0KA 5EP3A 3TPZA 2IWBA 3H51A 3A98B 2P9VB 4UQIM 4WYKB 3GRJA 2HMJB 3KKGA 2WAFA 5TGNA 4E3MA 2JQ5A 3BBZA 4CIZA 2Z2MB 1CEGA 3V39A 3UL5A 4B3RM 4OPZA 3DGOA 1ZG4A 2ACGA 4EWFA 1PWDA 3F7XA 3ZQ5A 2Y2QA 5FA7A 3VOYA 2SBLA 5L8MA 2V0UA 1YLWA 5K5BA 4BL3A 2XZUA 4KUKA 4X1LA 4HZBB 4BBUA 2PYRA 3HU3A 1LRAA 3KSXA 3FUTA 1MNLA 3RNTA 3PS8A 3Q3FA 2EFXA 4AZFA 3CUEA 5F83A 4ESPA 3MZEA 1S3SA 3AKZA 2CIUA 2BTFP 2MF7A 3HUNA 1JVJA 1MC0A 5C1BA 3L25A 5HZHA 4R38A 2BLSA 2VF7A 3F8HA 4N6V0 3M8CA 1UWNX 3HL9A 3KP1E 1PFLA 3BFFA 3T4KA 3BJNA 1BLCA 1F4IA 2CWVA 1N77A 4JXJA 1WE4A 1IN4A 3VDUA 1T5YA 2E8IA 3MG3A 4I3IA 3W0FA 3O3VA 1W01A 3IPTA 2O9AA 4FCVA 4X25A 1JNUA 4Z8XA 4WWUC 2PD8A 1K57A 3T4TA 3UGJA 2LHGA 2Y91A 1TRQA 1B2UA 2F5QA 2XSZA 1ES2A 4UAAA 1VQO3 3GRVA 3K8ZA 1L0GA 3BRMA 1TH2A 3DBAA 1HVBA 2HDRA 4NKPA 3JR4A 1Q42A 4R4KA 4RZMA 1IYPA 3VSYA 3GQ4A 3TSGA 2Y0TA 5FSWA 4CLCD 1F2KA 3DAVA 5CLKA 3SMSA 3GLHE 3J81S 2W56B 1KWIA 4FSFA 1RN1A 2ZM8A 1CH0A 3NY4A 2QJ7A 3G4S3 4OOYA 1EI5A 3RTYA 2KDKA 3NBJA 3CU3A 1JB2A 2DZNB 1B21A 2Q07A 1PZPA 1VETA 2J7NA 3FTEA 3MK6A 4Y3IA 5CGXA 5HPIA 1JNQA 3HK4A 3FZWA 2GSPA 3E4OA 4Y5FA 4REZA 4HAAA 1XNRM 1PRQA 3EGXC 2CHCA 1UUWB 4R0QA 1G41A 1N78A 3MYTA 4B7HA 4OPYA 4K0KM 3OLOA 2HGVA 2I72A 1MWRA 4BD1A 2VV6A 3DGMA 4LGMA 5HGRA 1JB5A 2DRWA 1X1UA 4OVZA 4ZM8A 3CCQ3 2C9OA 5F5YA 4LF4M 3NBIA 1L5GB 1W7CA 1D7EA 2UGIA 4L8PA 3UE0A 2R45A 4R6LA 1UI7A 1EE8A 2D01A 4DV1M 3KSGA 2Y4AA 3GLIB 1IN5A 4DV0M 4GH9A 2WGQA 3DW0A 1IKGA 3V67A 2J7VA 2PBDP 4EV5A 2I7PA 1VQ73 1IQYA 1CYUA 4MEZA 2QNJA 4GLQA 5FI2A 4LJ8A 2WO0A 1VM1A 2ZAMA 3KYQA 1K41A 3GRDA 4B7FA 3V98A 1DMNA 1IVWA 4KFEA 2P74A 1KC84 2QHKA 2WAEA 2LTUA 3LTDA 2ZQDA 1LSVA 1LXEA 4X68A 2QJ5A 4KQQA 4HM3B 3O87A 2V1LA 5LBRA 3R7WA 4NPBA 2JY7A 3RFWA 1OPYA 7CATA 1GHIA 4KHPM 3UE1A 3SX1A 4NXNM 4GMQA 4GDBA 3GPPA 4HHDA 2GDNA 3MJQA 3SHFA 5ITTA 3Q2PA 5HD5A 1GOUA 2UXCM 1F5MA 3WDGB 3THGA 2Z4RA 3AGOA 5J7EA 3AOEA 4YHHM 3S4XA 3K63A 1TTOA 3E0YA 1TGUA 3HHWA 3TQSA 2Z2LB 3FRIA 3EOIA 3NULA 4KZ7A 4UN2B 1RGHA 5DTTA 5EPHA 2R18A 3FYDA 5FTNA 2RCDA 4GS9B 1Q40A 2INXA 5EM0A 3IX8A 1OQYA 2R41A 8RNTA 4QHCA 3WRTA 3B8LA 3GWRA 5F82A 1YUBA 1PWCA 2YKHA 5CXWA 2XQZA 2MGWA 2VK3A 1T43A 4IBDA 3CCS3 3B4OA 3QRDA 1I4WA 1B27A 1KE3A 2ZOIA 1L0EA 4MGYE 4H61A 3IXDA 2XEPA 1J3WA 5BXQA 1DY6A 1H0MA 3MXQA 3FYZA 3AHWA 1S5AA 3SOAA 2C10A 3SH9A 2KAAA 3W67A 4IEDA 4IBGA 1JN5B 3T12B 5TBMA 4RBNA 4FWHA 4PT5A 4R80A 5CEDA 3TOIA 3F1NB 4L7KA 2ZC4B 1IXZA 4Y13A 1W63Q 4GKJM 4MEIA 5EP2A 1S1YA 1ESIA 1PW1A 2OOAA 3S1YA 5GLDA 2AAEA 1FZUA 2K7SA 1K55C 1D1JA 5EXSA 1NYYA 1R4GA 1TD5A 3P98A 5CGWA 2W3HA 3CF0A 3KSPA 3CCE3 2Z6DA 4EIWA 1YSPA 2ZAOA 2FNQA 1KE0A 1BSAA 4FOFA 2Y73A 4L6V6 1BSDA 2J8XB 1LOVA 4PHTA 3LQRA 3EC9A 4N6OB 4S2LA 4WURA 1NY6A 2V1AA 1PZOA 1E4DA 5EP4A 5DNYA 4JI5M 1G0TA 5A2QS 1UGHI 3G0KA 4OVMA 3X3YA 1ACFA 4L9EA 3BQAA 1Q02A 1F8NA 2CWTA 1NJFA 2J8YA 1TJDA 3O88A 2D42A 5GKNA 4HM4B 4ME4A 1BLPA 4X69A 1XXHA 2GNOA 2CFLA 1JTDA 3FE3A 4EXRA 1TH3A 5IS1A 1Z6TA 1DJCA 4WEJA 3LIDA 1UUGB 2LHCA 1N4OA 3AOGA 4EW5A 1XJ4A 3BW6A 2BIRA 3EWKA 1XWIA 2JBFA 1PRBA 2ZD8A 5FSRA 4Y28F 2K3DA 3MZFA 1VQM3 1MXOA 3UL6A 4L0LA 1BYWA 2DWLA 3DH2A 2YX9A 4GOGA 5CHMA 3AHSA 4AKHA 1UUVB 3DOAA 4B3TM 2F98A 2Y2LA 5FAPA 3ZG5A 1B2XA 3I4VA 3MBZA 5KSCA 4MBFA 3HZPA 3UMMA 2L1SA 1CI9A 1XJ2A 3IWIA 4JF5A 4WMCD 5DFLA 2STDA 3ZG9B 3QP2A 1R2YA 2C9CA 2YR0A 2A2LA 3BWLA 1NRFA 1BUJA 3GTCA 3DGNA 4P6ZS 3K7CA 3EQQB 3ZCZA 4EXOA 1K55A 3R4KA 3H7WA 3E2LA 2VZWA 2FGTA 1HQYE 3L2AA 1W00A 1NYMA 3HHYA 2LWXA 3HIGA 3FG8A 4E6WA 2Y2GA 3SATA 5CF1A 2V2FF 3PBRA 3UB6A 1WYCA 4EERA 2C11A 1IOUA 3NI9A 1AXBA 3GLHB 4LG2A 3DY5A 4JF6A 4LRZE 1ZV1A 2JY8A 2RFRA 2UX0A 3GVBA 4FH4A 4YNRA 5FI6A 3CCJ3 3L29A 1LL5A 2W03A 3IT9A 3N7WA 4DR2M 3IJEB 4ETZA 4LSOA 2L0WA 4EQIA 1LTMA 3X42A 3RDEA 1NHWC 2FS1A 2ZTDA 3MMHA 3T4OA 4QNMA 4GRIA 1IT8A 3LT8A 3CCM3 5IG0A 4FMCA 3LI8A 2WGIA 4HI4A 3A3IA 5H37D 4L16A 3JUMA 1OTRA 2G3QA 4EW7A 3D79A 4B08A 1AR0A 4BIRA 1FUSA 2VQEM 3WODG 2JHEA 4KG6A 1SXJD 3BNDA 3M2JA 2LVPC 6GSPA 3D9YA 3TW8A 2Y20A 5IG3A 5A93A 5J8XA 2GBWB 3MWZA 3NV0B 4RNTA 3IH8A 2WOFA 1SJWA 2WYXA 2IUKA 3DTMA 3PR6A 4KZBA 1XB2B 1BNEA 3JUNA 2PRFA 3SXXA 4G3KA 3E4RA 3FG1A 2JKRI 3JAMS 4BL2A 3V92A 4Q0JA 4XBYA 4X53A 4HL4A 5HWWA 1K8A4 1JR3D 3PGBA 2K9DA 2HF6A 5HL6A 1I2SA 1WYBA 2FH5A 5BPVA 2JY5A 5EUAA 5IERA 2CV1A 4EETB 2M5ZA 1HYFA 1RGYA 5A90A 2P9VA 3U61A 3WMDA 1VQ83 4L78A 4WYKA 5AVEA 3KYEA 1JWVA 2VQFM 3B9PA 9RNTA 3HLDA 2CWBA 3HHZA 2ZM2A 2VX8A 4LZIA 2HCBA 4N6LA 3MKFA 5HAQA 1BNJA 2Q9MA 3SMPA 3ZFZA 2HJ9C 2CFDA 1A2KA 3I0YA 4E3IA 4MH0E 1EWZA 3E98A 1NLZA 2OWJA 3W8KA 2KF6A 4L8OA 2L4FA 1N9OA 1BRHA 3D3OA 4RX3A 4FCMA 3KVWA 4CLCB 1V58A 1RCJA 3MXRA 5TJJA 3D5GA 3MHVC 1IVVA 4CPKA 4NC6A 2MR9A 3FSDA 4XDWA 1OHPA 4FH2A 3BIRA 3B7NA 3SEDA 1E3UA 1ZHHB 4JXSA 3IHAA 2OOVC 5FTJA 4UQIS 1ROVA 4KG5A 5AEUB 1GD4A 4BMWA 3HUOA 1ZMUA 3FYCA 4FD2A 5BU4A 1GHPA 4KG2A 1RMSA 1MWTA 1BSBA 3H9WA 1UGUA 1JR3A 1B2MA 3LMLA 4S2MA 5DKKA 3MJ5A 3UJNA 2OWHA 1DP9A 2K6BA 3WHKA 1X37A 1FCOA 3SAUA 1LL8A 3NC8A 3S7NA 3HLFA 1W5ZA 1I0XA 4KLNA 2V8FA 4O2HA 2P04A 3BFGA 2QGUA 1W6GA 2B1XB 3PHYA 4QNRA 4LV1A 3HOHA 1QAQA 1K56D 2HMMB 4FMDA 4ZTKA 3SOIA 5AYSC 3MZDA 4D82A 3QP8A 1BLHA 5DREA 1Q2PA 2XR0A 3K2LA 3SOYA 4KO8A 3U4LP 2HAKA 2KNAA 4DMZA 1LNIA 4BENA 2Y59A 4JXWA 1FCNA 3I7JA 4HM2B 2VGKA 2UU9M 1UM8A 5EQTA 4EV4A 3LVVA 3NM7A 2W3FA 2BMQB 2SARA 2CV0A 1JRQA 1L0FA 3EIHA 3K0ZA 1OT9A 4AKIA 5IF6A 2W56A 4R9LA 3PAEA 4MGKE 2Z7AA 1B2ZA 1LI0A 2ZQ7A 1T2IA 2JKTM 3C58A 4S2PA 1VQK3 3BXWA 2CC1A 2V1BA 3RGAA 1GY7A 4CJ6A 4MGZE 5DTKA 1XJ6A 3OPPA 5L8RF 3EBYA 1N5PA 4MLLA 2ZBBA 1NV9A 5HPFA 3B7QA 1BRGA 3LTCA 4E6XA 1D2NA 1PI4A 1W5TA 1MJGM 3R9XB 2OQEC 1M904 5IENA 5BVBA 3ZG8B 2JZ0A 2UXBM 2OOVA 3VOLA 1IY0A 3CITA 4OQIA 4JGQA 1WXQA 4MM3B 2HOHA 4JXVA 4LV2A 1LI9A 1JWPA 3RXXA 2LVQD 3CTWB 3MQQA 3WR2A 2PNCA 3GLFA 2BWEA 4L15A 4DJ3A 2XD1A 3KX0X 1YGWA 3LEZA 1ZO2A 2XR8B 3GLIA 4Y7PA 4HBRA 2C96A 2XFSA 2M7OA 1M6KA 3GQZA 2NUTC 1O7WB 1ZS7A 3HWSA 4DE2A 2O25A 1W5SA 4MB7A 4HM1B 4EUZA 1KE4A 1DV0A 2OOBA 2IA2A 2WZZA 4Y0TA 1S0WA 4R1GA 1T6OA 2FH0A 2D1WA 2ZC7A 5IWAM 4DUYM 3Q7VB 4HP9A 1Q3BA 1IM2A 1V9ZA 3F1PA 8CHOA 4GC9A 2F5MA 2O99A 3GDIA 3J27B 4K91A 1DYUA 2LB5A 5GL9A 3C3DA 1MOLA 4WL9A 4NXFA 2IWDA 4PM9A 1RGLA 4LF9M 3WS2A 1L2SA 3KOZE 1TDZA 4MMZB 3ZHHA 4DN0A 2EWWA 3QYEA 3HVFA 4QY5A 2GX5A 1QUSA 1IN8A 5F69A 1STZA 4J8TA 4OVDA 5ITUA 4R3AA 2G8LA 3J7AS 3N54B 2ZQCA 5FQKA 3DA1A 1IKIA 3L26A 2Q9NA 2OLVA 4Q0IA 3I553 3LMMA 1BIRA 1JZDA 1RSNA 4DE3A 4F1IA 1YIT3 3H82A 3ITBA 2CX0A 3PZWA 2EWVA 2ZMFA 3MF0A 3NIAA 4OOMA 1GSWA 2UUBM 1KVLA 3F1OB 4F94A 2B5RA 5DF9A 1E25A 1TFKA 5BIRA 2Z3XA 3MKIA 4ORLA 2DWNA 3ZQJA 2OQEA 4LFBM 3KZTA 2LH0A 1N8R4 3I51A 1ULJB 3TWKA 1IELA 4GS9A 4LZJA 4Z9QA 2DZOB 3T1RA 1ERQA 4OPQA 2CH9A 1Z5CA 2CRUA 4MN7A 2PD7A 2C4BA 3RGPA 3T4QA 1PJSA 3DUKA 1GL6A 4NXGA 1S4RA 5DFYA 1F9IA 4LPZA 4DV7M 1I2EA 1GSXA 3BEBA 3KOWE 2DAEA 1T19A 2KX6A 3DZDA 3BU4A 4B88A 2EUCA 1MU5A 2X01A 1UFZA 2DWZB 2OCTA 3T0UA 3CZDA 3FKWA 1DGFA 1IYYA 2HMKB 2O9BA 2OSUA 4HJLB 2Y2HA 1JN5A 2WKQA 4NREA 5L2FA 3DM8A 2V1UA 1IBMM 1YKDA 3VSLA 2A5YB 4MGIE 4IJFA 2LVAA 1KSFX 3GR2A 3KSFA 4ETXA 4ZPXA 2LVNC 2UUGC 3LFVA 2Z8YM 4KUOA 3F1NA 4AKGA 1KQS2 2HP9A 4FCWA 2XSHB 1Z6FA 3GRYA 4S12A 5ITXA 5AQ7A 3R8FA 4MN5A 4L9FA 3KDSE 4RKUF 4ITQA 2B95A 3IWOA 5EECA 4LV3A 1BRKA 1KDWA 5GLCA 3HIIA 4G3OA 2VLGA 1SQWA 4JYAM 1YSQA 2PAVP 3TL4X 1YLAA 4NSOB 1MGRA 5L07A 3QP5A 1N36M 4CISA 1R5LA 4XGIA 1ASKA 2GXFA 3C4PA 5CTNA 4II7A 3CCR3 1KD14 3TRCA 1DMQA 2QWSA 3PFIA 4PEJA 2ZQAA 2OWPA 1Q3CA 3U6SA 5AQ9A 3VMAA 5CECA 1IYSA 1TDHA 1AVLA 3V3SA 4DBGB 3KP0E 3FV7A 4A5RA 3G8ZA 2KDLA 4DV2M 1XMQM 3MSHA 4I8OA 1MX0A 4JI1M 1K6RA 1G3IA 4YINA 4I3AA 4Y0OA 3SFZA 3D4FA 3D72A 1YPRA 1ES5A 5ELJA 1YLJA 1VQ93 1STFI 2L4RA 2Y55A 3FTFA 4WW0A 2QYBA 4HOHA 5KPZA 3KSHA 1CQSA 4LMIA 3X3ZA 1ULIB 2KNZA 3F40A 1O7NB 1TF0B 2X71A 2RGOA 2KZUA 4GITA 3TE6A 1FR6A 3Q90A 4Z6YA 1LV7A 3S29A 1L3LA 1BNRA 4BQMA 1NSFA 3E2KA 3I4YA 5BOHA 4HBTA 5DYIA 3E4QA 1SXJB 3MS6A 4HKVB 2BG1A 4LY6A 1B3SA 4JV5M 5AQBA 4AI6A 1HZ1A 1RCKA 2Z7JA 4L8RC 3FKVA 3FPWA 1K3WA 1HNXM 4AW4A 2M7UA 4GHOA 2KF3A 1MN3A 4U0XA 4OUQA 4BLMA 1ODVA 1GYBA 1K28A 4IUHA 1BRJA 1NU3A 4BTWA 4ZJ1A 1W63M 2GU3A 4S2JA 1QVRA 3ZDJA 3KSED 1VEUB 4A3VB 2CFOA 4IBXA 2XA7S 3TE8A 1U60A 4FMBA 2EFUA 3DZLA 2Y2JA 3FPVA 1HT1E 5AYRB 2WOHA 3G6E3 4IBJA 1ORYB 3NDGA 1RJOA 3ZH9B 4EESA 4GW9A 3VP4A 2H28A 3SS3A 1KVMA 4I5SA 2VGLM 4CLCC 2ML6A 1Z09A 2FOIC 3TWLA 3WOFB 3NX0A 2RL3A 1J5EM 4NXBA 4O01A 3ZVWA 3CD63 4WZ5C 5KIZA 1T3BA 2OPFA 4CCVA 2HDQA 3FUWA 2PU2A 2DHYA 3A3JA 2VV8A 1OUNA 1PGYA 3S7QA 3KSJA 1MWSA 4G4QA 2ZDJA 1ERMA 2ZJ9A 3HLBA 5EVID 3P01A 3NV0A 2AVXA 1JBSA 3U6OA 2BU4A 2VA0A 5E2FA 2E5LM 4LRSA 2LNHC 3U5ZB 3IF5A 2Y2OA 1FGOA 1W4NA 4K1UA 3GAXA 4EBGA 1EKMA 1LQGC 4NEED 4RX2A 3WHLA 4STDA 1QALA 1XPBA 4I38A 3EJVA 1Z1SA 1P0ZA 2F86B 1FILA 4LFUA 3P09A 5J4EA 5KMWA 5E26A 5C5KA 5A8BA 2Z6CA 3C5AA 1DE3A 1P3QQ 4Q8IA 4LGWA 5HFOA 1UDII 5M1AA 3T8UA 4LRYC 1A2PA 4QJGA 3T38A 3B89A 3VV4A 1E97A 3KFUG 4KZ9A 4IBBA 3UDXA 2C5WB 2Y21A 3VOZA 1OMEA 3LCEA 1NRJA 3B7ZA 3KW6A 4R9KA 4S2OA 2CWUA 5FEGA 1WQLB 3E9SA 1UI8A 1RCLA 4JI4M 2GQFA 3STDA 1K9M4 2EX8A 3TJZC 1W79A 5IREB 4FR9A 5C18A 3A3DA 5HAIA 5F1FA 2WADA 2R44A 3KFQC 5DTSA 5KO3A 5FATA 3D8LA 4CLCA 4E04A 4GCZA 1TFOA 5JI2E 5HWTA 1JKGB 3GQ3A 2J9OA 4MMXB 4FCTA 5EJCA 1BLSA 4WZ5A 4WZ4A 3VP3A 2UUCM 3W4OA 3LCVB 3VE4A 2R4IA 4IBFA 3VFDA 2XH9A 4BTXA 1DP6A 5E6JA 3HREA 4WF0A 2E2TA 4LZZA 2HDSA 4GN2A 1CEWI 3L0RA 1PU4A 3CG5A 1MWUA 1NB5I 4FTXA 3SYLA 3T6PA 3U6EA 3G6OA 4LGYA 2KXGA 5HW3A 1VQ1A 1YAXA 4CHTB 3C9PA 4K1VA 2RRUA 4LGQA 1AWIA 1DGHB 5E2GA 2XF3A 2Z6BA 1FYSA 4UEYA 2AHMA 3UMEA 1K38A 4DR6M 4NL4H 3KOXE 3RH8B 1N75A 2FNAA 3T15A 3OXAA 4ANRA 2P05A 8CATA 4B4XA 3CCV3 3N8SA 1TUHA 1W7FA 1OHSA 1TF1A 2XLNA 2ZM0A 3ER7A 4B9OA 3K3DA 5KSHA 1M1K4 3ZYTA 4LJ4A 1I0VA 1XP4A 3IS2B 4CJNA 2WGWB 3IECA 3IBRA 1P9WA 1Y4OA 3ISGA 1HU9A 3OCNA 4EU0A 4PKYA 3NBXX 4QOZC 1E3RA 3O8YA 3VKHA 1RTUA 4HY8A 2C98A 5HARA 1N9BA 3GPUA 1LL9A 3WS5A 3LOYA 4AFIA 3U1WA 1IYQA 3VF1A 1F98A 3HLCA 3BY8A 1ZG6A 3LVWA 3AFHA 1OH0A 3UNWA 2X02A 4I4LA 1AV4A 3IF6B 1GA0A 1R4CA 4IUKA 2ZANA 3QYBA 1I3FA 2HWJA 2R9WA 2IA7A 4HM8B 4O8GA 5F6AA 1VB6A 3OPHA 1KGGA 3OZHA 4XBXA 3LR3A 1VEJA 5FLXS 2VF8A 1GSVA 1S6RA 3GZRA 4LCLA 2YFQA 1IV7A 2VIIA 1W2B2 1ES4A 1RP5A 3NDEA 4K08A 4JN6A 1OGZA 5ITYA 3EIEA 4XUXA 5JPPA 3DGLA 1GKIA 4DR3M 2DWMA 1BUQA 1LSXA 1U5OA 5AIGA 2ZMVA 3C3EA 3DTIA 3W4QA 3GQ5A 3GPXA 4DF6A 1RGGA 1K82A 1GO5A 5IG5A 2IYJA 1K0KA 5AJGA 3G32A 2J80A 1HT2E 2EA0A 4IJGA 3NECA 3G713 5EXTA 4DV5M 3Q7VA 3EN8A 2XGLA 4LJ5A 1TTEA 4OK0A 4BU4A 1CQAA 4GSPA 4IPBA 3CCL3 1W5DA 3RFBA 4YOFA 2KLIA 2ZQ8A 1NB3I 1WMNA 3AMOB 3DFZA 1JQJC 1NNJA 5HL1A 4KQRA 5HX9A 1X1WA 3CME3 1FQGA 2XK1A 5HDSA 1OACA 4GZBA 3K9MC 4OQ0A 3L9KA 4KENB 4KT0F 4AG5A 3U97A 3I563 1NNUC 2F5NA 1XGJA 1U8CB 1H3QA 3SW1A 5FQ9A 5AIHA 1N5HA 3HU1A 4JXGA 4HP4A 3WS0A 5RNTA 3F1OA 3VK8A 2H0TA 3PAGA 3UNLA 4QPRA 3UB8A 3HJQA 2QHOB 3IH9A 4X1MA 5CERA 1Y28A 2P0XA 4KODA 5GLAA 3HLGA 4OLDA 3LIAA 4HZ9B 1IU7A 4E3JA 5FAOA 5DKLA 5HWVA 2CG0A 4MN6A 3HY5A 5TGFA 4C3QA 2P09A 4N6NB 5G18A 4N6MA 4C75A 1YJN3 4KQDA 4PM6A 4LF8M 1QAMA 3FC7A 3MFDA 2WZJA 4IBKA 1GVNA 1OTDA 3X40A 2VEAA 2V6ZM 4OH0A 4FVMA 3PCSA 4B3SM 4QB8A 1HR0M 2OV5A 4NXEA 3NUVA 2GEXA 4OONA 2APLA 3U6PA 1DRMA 4GHIB 5EFWA 1YQSA 2LB9A 4U3TA 4XB5A 1IQXA 2L7HA 2XRXB 1XXHE 3FTCA 5ITRA 3VGNA 1ZTUA 3FLJA 1N33M 2WZXA 1SXJC 1GLNA 1CEFA 5E2HA 3SAVA 4KZ5A 5F1GA 3OC2A 4EBPA 2Y74A 2KF4A 3SC3A 1G59A 1EROA 4LJAA 2RGQA 1TEMA 1TR8A 3PXMA 2EXAA 2ML5A 4H6JB 1VQ43 4AEQA 4WLAA 2EKKA 1RN4A 4WMCA 1JWZA 2ZMAA 1LQMB 1EA2A 2WKRA 3M2KA 2QIYA 3QNCA 5TR7A 4PCZA 3JUQA 4B7GA 1EIJA 5HOHA 2CHVA 2X49A 3IQAA 1BSGA 2WSFF 3J80S 2Y2PA 4OLGA 2WGOA 4AKYA 4D80A 3CLOA 5FTKA 1YHQ3 3V50A 2H0GA 5FW5A 7GSPA 1XJ3A 3M6BA 3URPA 4MBHA 2FFJA 2LBCA 1K4FA 1IFYA 4B3MM 1QUTA 3GZXB 3SVAA 4R3DA 1BAOA 1R4YA 3HBRA 3DWZA 3Q8GA 5JI3E 1E32A 2AADA 5IEPA 3G30A 1OAIA 3JPUA 4OW0A 3N8BA 3M0EA 4CDLA 3QP6A 3UE6A 2KZSA 4PM7A 3LR4A 3Q8XA 3X3XA 3GZBA 1X0OA 5HDCA 4B93A 2CX1A 2EX2A 2CK3H 4EEUA 3FUUA 4PM5A 1NJI4 4TUWA 1BNGA 4JLFA 1GMRA 2K0MA 1XKZA 5EQLA 1DP8A 2OLUA 1LOXA 1QQWA 4M0WA 1SXJA 1SIIA 3PCRA 2KA6B 2QQ8A 4RQ9A 2KF5A
chains in the Genus database with same CATH topology
1W8YA 3FZCA 3SHGB 5EVIB 4GIPA 3ZC7B 1C7HA 1PWGA 3ZG0A 3A42A 3EQUA 4X64M 2XLJA 1KSIA 5FGOA 5IZ7D 1TP6A 2FFYA 4K0XA 3A46A 1SDEA 3PBNA 3WS4A 3NHXA 1H8YA 2BJWA 4R3BA 3M7GA 2CC3A 3OWSA 4ZDXA 4KFDA 1RGZA 4U0TA 4N6UA 5IW9A 3FKAA 3EB8A 3M6HA 1IQPA 3GZYB 5CF2A 4LJ7A 1XA7A 5CGSA 2ZC6B 1I2WA 1ES3A 3IXGA 3Q07A 4PMAA 1LNHA 4JI7M 1IN6A 4S2NC 4E3LA 3HJ8A 3PTEA 1V74A 2H10A 4HEFA 2UUAM 5EEOA 1RKYA 2UWXA 4HVNA 3UY6A 1G96A 1G4AE 3W4PA 1NY5A 4IIAA 1GA9A 4LEHA 1ZKJA 1PFPA 2FFFB 1NJGA 3HX8A 1D6YA 5E2EA 3KIIA 5EP1A 3A3FA 4NRWA 3U60B 1W8QA 2CHGA 4IT7A 4QU3A 1ONHA 4GHAA 1E9SA 1MY8A 3EF8A 2HHHM 4IBIA 3J2PB 4FWGA 2GEYA 1ZAEA 2BT3A 5BR8M 4KVHA 1CYVA 3ROBA 5D3OA 1Q2QA 1NWWA 3MG2A 4DRTA 3CF6E 1K56A 1AVKA 3CPOA 4R23A 3J7BA 1M1XB 1PIOA 1TU5A 1BTLA 4G6ZA 3BNBA 4WFOA 1W6CA 1XXMA 4X55A 1QAFA 3VSKA 2Y2KA 4OOLA 5EVLA 5FTLA 3LXUX 1Z5AA 3H3HA 1Q814 1JKGA 3HJSA 3IF6C 4S2NA 3VFHA 3FGYA 4QOSA 4RA7A 4LFAM 1OFHA 3B4PA 4MNRA 3CPW2 3BFEA 2ZBKB 3AGFA 1YSYA 1LVNA 3BECA 2IWCA 4OPRA 4FD8A 3W0LB 4DV6M 4GB7A 3AGEA 3CJMA 3K92A 1LLBA 4EBLA 5A92A 3OCLA 2KRUA 3QAUA 2PZVA 2L6OA 4PDGA 4AKZA 3UDFA 4DE1A 1GD3A 3UK6A 3S5CA 1L1ZA 3CC43 1DO2A 2ZL8A 3CC23 1W6YA 3OPRA 4HM5B 1D6ZA 3DWKA 3N4IA 1E94E 1KDSA 3UZUA 3JUOA 1NDOB 2V1ZA 2WGWA 4JF8A 2J7OA 5AQAA 4S2KA 3NCKA 2F5OA 3G16A 1ONGA 1A90A 2F4VM 2HP5A 3PNYA 2CW9A 4N3VA 3NQYA 3CC73 3VP2A 1W2ZA 3IF6A 4PD2A 4RNAA 3Q81A 2V20A 3IXBA 2DHRA 3HI7A 4ID4A 1D6UA 3GPYA 3FD9A 3NQZA 5JBSA 1SDNA 4GD8A 4NSRA 4G4OA 3EE1A 4NETA 2JC7A 2E2UA 4HM6B 1DJBA 3Q82A 4GNUA 4DXBA 3FCSB 4GHLA 4EYCA 3F7SA 1Z5BA 5AIFA 1Q824 3FWLA 1XX2A 1YJ93 1SIHA 2QZ6A 4S2IA 4DV3M 4IJEA 5EOEA 5FDHA 3NWLA 3A45A 4JI6M 3LH4A 1KGEA 1NZOA 4RVAA 4KZ8A 1Y54A 3BNCA 1KFVA 2BMRB 1Y4KA 2ZC3B 3Q1FA 3KE7A 3LY3A 4GC5A 1VQ63 4G1MB 4I4KA 1Q864 3EQVA 2Y2IA 2ZLYA 3UDIA 1K4EA 3WWXA 4MMYB 3AMOA 4NOOB 4EBNA 3S22A 3PBQA 2HMLB 4IIWA 2Y2MA 3CF2A 5U47A 3OPLA 2D7GA 2HMNB 2Z77A 5CXOA 2JA2A 4N1HA 2CV2A 3JYIA 2XDMA 4HYZA 3ZVTA 4LCBA 3GV9A 2A15A 2QPAA 2ZQ9A 4ZBEA 3SS5A 4MJDA 2O9UX 3ZGAB 3LZAA 1ALQA 2PBYA 4X66M 1FGTA 2BO9B 4LENA 3UN7A 5ITXE 4UA9A 4ZJ2A 2EO2A 3NM2A 3GMWA 1N34M 1ROAA 1NO3A 4WHAA 3TDGA 3U61B 3IHBA 3GSGA 2XSZD 2Y2NA 4O7DA 3KS4A 2QBYB 1NXYA 3GLHA 1GY6A 1TDGA 4W5WA 4HLQA 4OP5A 3SS4A 1QYRA 2L4VA 4DUZM 4M3KA 3DXOA 3V99A 2CEAA 1R2ZA 2HMOB 1T3TA 1YE9A 2MC8A 1VQQA 2B24B 3OWYA 4XXRA 5EVIC 3N6IA 4DDSA 5M18A 4WELA 3M6AA 1IBLM 2W04A 2QPNA 4LJ6A 1O7HB 4QHTA 2Q2EB 1NJ4A 1OGXA 3FH1A 3ILKA 3FG4A 1O7PB 3CNMA 4N92A 4UA6A 4GL6A 5IHVA 3GRUA 3IG5A 5D81A 1KGFA 4RF0A 2BNGA 2E2VA 5D82A 1R7RA 1FGRA 3OWUA 1S723 1XC8A 2ZC5B 4MGHA 1OHOA 3PNVA 1O7MB 2R9XA 3ITAA 1O7GB 4JRFA 4U13A 4DXCA 3KOYE 1OF5B 1YLPA 2X4AA 3BB9A 4FCZA 2K54A 1JV2B 2X8AA 2KXEA 5F3WA 3ZG7B 2BMOB 4DKIA 2W9PA 3LTAA 1ISKA 4D2OA 3AL0C 5STDA 3S28A 4BB9A 2JE5A 1HNWM 2KEBA 4HBUA 5FQJA 3AOEC 4N6TA 4LFCM 1N9EA 1G6AA 4RYEA 3HU2A 5EVIA 1L0DA 5JYPA 1QZMA 4BLCA 4K0WA 3KS8A 3CMA3 4LF6M 4IVIA 3VDPA 2CFWA 5EXPA 3GLFB 2L09A 1HZOA 5G2GA 3QHYA 4G4NA 4NHFA 1YMXA 4PDIA 2CHQA 3EHCA 4RNZA 2DXIA 1DVCA 1VQ53 4XBOA 5FASA 3LTBA 4X2OA 4JI2M 3FF2A 4XM4A 5KP1A 1FGQA 2YFIB 3EBTA 3OW22 4RF1A 3A76A 1YLYA 2RCXA 5CHJA 2G2UA 3PYJA 4OKPA 1IY2A 1YLTA 1J09A 2I7NA 4LJ9A 2HDUA 1FJGM 2D7EA 2F5PA 5CK6A 4AQYM 1SHVA 4DV4M 4ZJ3A 1VZZA 4X2HA 1YMSA 1M9GA 3QWLA 4J9AA 4BTYA 2C6WB 2WGVA 3IWQA 3UE3A 2F99A 5D83A 3SAWA 1TDLA 1K734 4E3NA 1YVBI 1K3XA 1IXSB 1GCEA 3PXGA 3S27A 3U60A 1IN7A 1QAKA 3B7CA 3PVSA 4XUZA 3JVCA 2O5RA 3L28A 3JR5A 1TH4A 2O3OA 3GP1A 3ECFA 1HNZM 2D7HA 4EV2A 3HKPA 2XD5A 4IVKA 4TX4A 4DR7M 1FGMA 3T1HM 2CFKA 2CFGA 1M40A 4QY6A 3VP0A 2QZ4A 5CTMA 4JI3M 2WKEA 2ZM6M 5LMNM 3GLGB 2FE8A 3BOSA 5ITQA 1H8ZA 5KQDA 1L2CA 3BFDA 4EC6A 1NVMA 1PW8A 2WKHA 5DYGA 1IVXA 4IBEA 2GU1A 5FAQA 3V5MA 4N9KA 3IG8A 3UPOA 3K1JA 2HPBA 4GKKM 3V3RA 3U6CA 4NXMM 3FF0A 5AI1A 1N32M 1QAOA 3A3EA 5KZHA 2YFLB 3HLWA 2W2CA 4M9SA 1GY5A 4N9LA 1IT7A 4R4RA 2Y0QA 2XGNA 3VK7A 1XNQM 4HESA 4KZ6A 3J7Yd 4FWDA 3RE8A 1A2VA 1MKIA 5LC7A 1GL7A 3FG3A 1NZUA 3U6LA 1JJ22 4KZ3A 4H8RA 3SYKA 3F8XA 4DR5M 2YFJB 4K61A 4OQGA 5JPUA 1JB4A 2NQ8C 1QVG2 3SH8A 1TVFA 5HAPA 4H3UA 4WYYA 1K54C 3PBSA 3IMAB 3F14A 5LMUM 3EN1B 2R46A 3CXC2 3BFCA 1LHYA 4OQHA 2XZFA 2V1CA 3TWMA 2DVWB 5GLBA 4C6YA 3MXSA 4AG6A 2EX6A 2JDIH 3C4OA 1SPUA 3KN4A 3VFFA 1PJIA 2GBXB 5FQIA 4GDNA 1QMFA 3G4PA 4OX9M 1BULA 4NK3A 3NXJA 1G68A 5M19A 3MKEA 5I94A 4YFMA 4D81A 1DJAA 2HP6A 1E3VA 1CI8A 5DF7A 4M0DA 3S67A 4WBGA 3FUVA 2R4JA 4OP8A 1HD8A 1PM5A 4P87A 1W02A 2LXEA 1OCVA 4B4ZA 2I9WA 2W9QA 2LYXA 2A49A 1XMOM 5EOOA 5EE8A 3X41A 3C7UA 2H5SA 4WEKA 2RSXA 3F9SA 1BZAA 4P85A 1K54A 1WTHA 5JYOA 3L27A 2H0YA 1ZX2A 1YI23 2WUQA 2M60A 1DVDA 1WMPA 1IVUA 1IQ8A 3LYGA 3VLFB 2P0MA 2YNMD 1HQCA 4M9ZA 3GO8A 1WNHA 3D8BA 1O7EA 4IBRA 1PJJA 2ERCA 1DGBA 5KPRA 1E3UD 3ZNYA 5AEWB 5FI7A 2KW0A 2C5RA 1GS3A 4FCFA 1ZC2A 1UW1A 5LC6A 7STDA 2W0QA 3T1YM 1JTGA 4XBTA 3WOEB 2DNSA 4X65M 4K90B 3BYDA 4JPMA 1RN7A 3T8NA 1J9MA 4HM0B 5FQMA 4DR1M 3MPHA 4P16A 3ZCBB 1NY0A 4OVZB 3NBBA 2IUJA 5GHYA 3BLMA 1R6BX 3OTOM 2QBYA 3RGSA 3Q7ZA 4O8SA 3EX9A 3CNXA 3MG1A 2J9PA 4R4SA 1DO0A 3DMCA 2HKJA 2QCUA 3LO7A 4R7GA 5A91A 5CEBA 3AV0A 3CCU3 3G35A 3VKGA 1EG9B 4DR4M 3JUPA 1QJGA 2QMIA 5DVAA 3K5TA 3MHEA 2K47A 3PBTA 5I97A 3SARA 1YM1A 3OX9A 4P6BA 4DDYA 1E9RA 1OJLA 4X56A 4LF7M 3H4MA 3UPNA 4RNYA 3FTDA 3O86A 3SASA 2KRKA 1DGGA 2CE7A 4GB5A 4LRTA 3GRRA 1FCMA 4UHUA 1QMAA 4QHSA 5FQQA 1WMOA 3U6MA 4LCMA 3LY4A 2QENA 2HL7A 4G4RA 3U5ZA 4JKTA 4WM9A 1SXJE 2F5SA 1OF5A 4JBFA 4XDVA 1N8QA 4DE0A 2P38A 3SLUA 3G34A 3HLEA 5TFQA 2C99A 1O07A 4FW9A 2LQVA 4BD0A 1Q40B 4Y0UA 2G2WA 3RJUA 5ELUA 1L1TA 4L4UA 1YJW3 1SKFA 3WRZA 4O3VA 3KXEC 3D3LA 1G8PA 2IMJA 1L8QA 1DMMA 1N9JA 3N9HA 3LQQA 1NHGC 5EXXA 4QWTA 1HTZA 1QANA 5E43A 2Z76A 4FCJA 1FOFA 1K6SA 4O02B 3ZNTA 4KQOA 3AGDA 5CHUA 1SCWA 3TG9A 1XHBA 2CUZA 2BHMA 1YT4A 1IYOA 4IBCA 3BNEA 3N8RA 1KYIA 4HM7B 3HGIA 3RGRA 4LV0A 2BJVA 1FSWA 4BBAA 1YGEA 2KCDA 2L7IA 5IG4A 3QK9A 4CGYB 3UO9A 2P5TA 4JI8M 1J7KA 1I5QA 4WP5A 3UPPA 2XFTA 2CKFB 4R1KA 2QP9X 2EX9A 3NBLA 5AIIA 1C3BA 2PU4A 3HHXA 1EQKA 5FTMA 4LF5M 1IDPA 1DGHA 3HUMA 3N8LA 1MBLA 1OFIA 3SH7A 2QA43 1I94M 4X62M 1IEMA 3BLSA 3FUXA 1BUEA 4ZAMA 1FR1A 1XXHB 4MBKA 3AJIB 1FA3A 3SBJA 4UA7A 1FNNA 3VP1A 3U6QA 1Q39A 1IXRC 1VQP3 2UXDM 1QVF2 4I81A 2DCFA 3G31A 2OQ4A 1XGIA 5A0OB 3WS1A 1PI5A 2R65A 3NBRA 3UB1A 1US1A 2OTJ3 1XA1A 2R62A 4X6TA 1VDDA 1VQL3 1CK3A 5KP3A 1FSYA 4KZ1A 5KQ8A 4KZ4A 1YIJ3 4E3OA 4PPRA 5KP4A 5IT9S 1ESUA 5KPTA 1K25A 3PBOA 1IV9A 2CG1A 1A67A 5GHZA 3G2YA 3UJMA 1PYYA 3FKEA 4M9XA 3B3XA 2W6JH 3GLGA 2VGJA 5IEOA 1VQN3 3QNBA 1RRLA 4Q53A 1RRHA 5DRVA 4JF4A 3D9RA 2YQZA 1TIJA 5GHXA 2WK0A 4FMAA 4KFFA 1H6UA 4R3JA 3U6DA 2RKOA 5CRFA 4BJPA 3C7VA 1L2BA 2XSOB 3IXHA 4YY3M 1MPLA 5DF8A 3CMZA 5EVHA 3BLZA 2JCHA 3WA3A 1Q7Y4 3MSOA 1L2DA 1YLZA 4QD4A 3ALAA 3LT9A 3BM6A 2H1RA 4JI0M 1C1KA 4E3KA 2BNKA 2W82A 4KZAA 1FUWA 2RGHA 2Z4SA 1Z59A 2G5GX 3WA2X 1STDA 1IK3A 1J2BA 3OV4A 4GKUA 3RXWA 4OU7A 4N1XA 4NRVA 2OTL3 2QEX3 4GD6A 2A3UA 2EXBA 3G2ZA 3Q1CA 1IBKM 1H5XA 1IY1A 4P0MA 3E99A 1K57C 2FXTA 1HKXA 1BT5A 4PM8A 2KRTA 6STDA 1QMEA 1GHMA 2R4EA 2WKIA 1ZQ9A 5EP3A 3TPZA 2IWBA 3H51A 3A98B 2P9VB 4WYKB 3GRJA 2HMJB 3KKGA 2WAFA 5TGNA 4E3MA 2JQ5A 2Z2MB 1CEGA 3V39A 3UL5A 4B3RM 4OPZA 3DGOA 1ZG4A 4EWFA 1PWDA 3F7XA 2Y2QA 5FA7A 3VOYA 2SBLA 1YLWA 4BL3A 2XZUA 4HZBB 3HU3A 3KSXA 3FUTA 1MNLA 3PS8A 2EFXA 4AZFA 5F83A 3MZEA 1S3SA 3AKZA 2CIUA 2MF7A 3HUNA 1JVJA 5C1BA 3L25A 2BLSA 3F8HA 4N6V0 3M8CA 3HL9A 3KP1E 3BFFA 1BLCA 2CWVA 1N77A 4JXJA 1WE4A 1IN4A 3VDUA 1T5YA 2E8IA 3MG3A 3W0FA 3O3VA 1W01A 3IPTA 4FCVA 4Z8XA 4WWUC 1K57A 3UGJA 2Y91A 2F5QA 2XSZA 1ES2A 4UAAA 1VQO3 3GRVA 3K8ZA 1L0GA 3BRMA 1TH2A 1HVBA 2HDRA 3JR4A 1Q42A 4R4KA 4RZMA 1IYPA 3VSYA 3GQ4A 3TSGA 2Y0TA 5FSWA 5CLKA 3SMSA 3J81S 2W56B 1KWIA 4FSFA 2ZM8A 3NY4A 3G4S3 4OOYA 1EI5A 3NBJA 3CU3A 1JB2A 2DZNB 1PZPA 2Q07A 2J7NA 3FTEA 3MK6A 5CGXA 1JNQA 3HK4A 3FZWA 4REZA 1XNRM 2CHCA 1UUWB 4R0QA 1G41A 1N78A 3MYTA 4B7HA 4OPYA 4K0KM 2I72A 1MWRA 4BD1A 3DGMA 4LGMA 5HGRA 1JB5A 2DRWA 4OVZA 4ZM8A 3CCQ3 2C9OA 4LF4M 3NBIA 1L5GB 1W7CA 3UE0A 4L8PA 2R45A 1UI7A 1EE8A 4DV1M 2Y4AA 3GLIB 1IN5A 4DV0M 4GH9A 2WGQA 3DW0A 1IKGA 2J7VA 4EV5A 2I7PA 1VQ73 1IQYA 1CYUA 4MEZA 5FI2A 4LJ8A 2WO0A 1VM1A 2ZAMA 1K41A 3GRDA 4B7FA 3V98A 1DMNA 1IVWA 4KFEA 2P74A 1KC84 4X68A 2WAEA 3LTDA 2ZQDA 1LXEA 4KQQA 4HM3B 3O87A 2V1LA 3RFWA 1OPYA 7CATA 1GHIA 4KHPM 3UE1A 3SX1A 4NXNM 4GMQA 4GDBA 3GPPA 2GDNA 3SHFA 5ITTA 3Q2PA 2UXCM 3WDGB 3THGA 2Z4RA 3AOEA 4YHHM 3S4XA 3K63A 1TGUA 3HHWA 3TQSA 2Z2LB 4KZ7A 5DTTA 5EPHA 2R18A 3FYDA 5FTNA 2RCDA 1Q40A 2INXA 4QHCA 3WRTA 3B8LA 3GWRA 5F82A 1YUBA 1PWCA 5CXWA 2XQZA 4IBDA 3CCS3 3B4OA 3QRDA 1I4WA 1KE3A 1L0EA 4MGYE 4H61A 3IXDA 2XEPA 5BXQA 1DY6A 3FYZA 1S5AA 3SOAA 2C10A 3SH9A 4IEDA 4IBGA 1JN5B 4RBNA 4FWHA 4PT5A 4R80A 5CEDA 3TOIA 4L7KA 2ZC4B 1IXZA 4GKJM 4MEIA 5EP2A 1ESIA 1PW1A 3S1YA 5GLDA 1K55C 5EXSA 1NYYA 3P98A 5CGWA 3CF0A 3KSPA 3CCE3 4EIWA 2ZAOA 2FNQA 1KE0A 2Y73A 3LQRA 3EC9A 4N6OB 4S2LA 4WURA 1NY6A 1PZOA 1E4DA 5EP4A 5DNYA 4JI5M 4OVMA 5A2QS 3X3YA 3G0KA 1F8NA 2CWTA 1NJFA 2J8YA 3O88A 2D42A 5GKNA 4HM4B 4X69A 1BLPA 1XXHA 2CFLA 1JTDA 4EXRA 1TH3A 1Z6TA 1DJCA 4WEJA 1N4OA 3AOGA 1XWIA 2JBFA 2ZD8A 5FSRA 3MZFA 1VQM3 1MXOA 3UL6A 4L0LA 2DWLA 2YX9A 4GOGA 5CHMA 4AKHA 1UUVB 3DOAA 4B3TM 2F98A 2Y2LA 5FAPA 3ZG5A 5KSCA 3I4VA 3MBZA 4MBFA 3HZPA 3UMMA 4JF5A 1CI9A 3IWIA 4WMCD 2STDA 3ZG9B 1R2YA 2C9CA 2YR0A 1NRFA 3GTCA 3DGNA 3K7CA 3EQQB 3ZCZA 1K55A 3E2LA 2FGTA 1HQYE 3L2AA 1W00A 1NYMA 3HHYA 2LWXA 3HIGA 4E6WA 2Y2GA 3SATA 5CF1A 2V2FF 3PBRA 1WYCA 2C11A 3NI9A 1AXBA 3GLHB 4LG2A 3DY5A 4JF6A 2RFRA 2UX0A 3GVBA 4FH4A 5FI6A 3CCJ3 3L29A 1LL5A 2W03A 3IT9A 3N7WA 4DR2M 3IJEB 4LSOA 4EQIA 3X42A 3RDEA 1NHWC 4QNMA 4GRIA 1IT8A 3LT8A 3CCM3 5IG0A 4FMCA 2WGIA 3A3IA 5H37D 4L16A 3JUMA 4B08A 1AR0A 2VQEM 3WODG 4KG6A 1SXJD 3BNDA 3M2JA 2Y20A 5IG3A 5A93A 5J8XA 2GBWB 3MWZA 3NV0B 3IH8A 2WOFA 1SJWA 2WYXA 2IUKA 3DTMA 4KZBA 3JUNA 3SXXA 3E4RA 3FG1A 3JAMS 4BL2A 3V92A 4XBYA 4X53A 4HL4A 1K8A4 1JR3D 3PGBA 1I2SA 1WYBA 5BPVA 5EUAA 5IERA 2CV1A 2M5ZA 1RGYA 5A90A 2P9VA 3U61A 3WMDA 1VQ83 4L78A 4WYKA 1JWVA 2VQFM 3B9PA 3HLDA 3HHZA 2ZM2A 4LZIA 2HCBA 4N6LA 3MKFA 5HAQA 2Q9MA 3SMPA 3ZFZA 2CFDA 1A2KA 3I0YA 4E3IA 4MH0E 1EWZA 3W8KA 4L8OA 4RX3A 4FCMA 3KVWA 1RCJA 3MXRA 3MHVC 1IVVA 4CPKA 3FSDA 4XDWA 1OHPA 4FH2A 1E3UA 3SEDA 4JXSA 3IHAA 2OOVC 5FTJA 1ROVA 4KG5A 5AEUB 1GD4A 3HUOA 3FYCA 4FD2A 1GHPA 4KG2A 1MWTA 1JR3A 3LMLA 4S2MA 3MJ5A 3UJNA 3WHKA 1X37A 1FCOA 3SAUA 3NC8A 3HLFA 1W5ZA 4KLNA 4O2HA 3BFGA 2QGUA 1W6GA 2B1XB 4QNRA 4LV1A 1QAQA 1K56D 2HMMB 4FMDA 4ZTKA 3SOIA 5AYSC 3MZDA 4D82A 1BLHA 5DREA 1Q2PA 2XR0A 3K2LA 3SOYA 4KO8A 4BENA 2Y59A 4JXWA 1FCNA 3I7JA 4HM2B 2VGKA 2UU9M 1UM8A 5EQTA 4EV4A 3LVVA 3NM7A 2BMQB 2CV0A 1JRQA 1L0FA 3EIHA 3K0ZA 4AKIA 5IF6A 2W56A 4R9LA 3PAEA 4MGKE 2Z7AA 1LI0A 2ZQ7A 3C58A 4S2PA 1VQK3 2CC1A 3RGAA 1GY7A 4MGZE 5DTKA 3OPPA 3EBYA 1N5PA 4MLLA 3LTCA 4E6XA 1D2NA 1PI4A 1W5TA 3R9XB 2OQEC 1M904 5IENA 5BVBA 3ZG8B 2UXBM 2OOVA 1IY0A 4OQIA 1WXQA 4MM3B 4JXVA 4LV2A 1LI9A 1JWPA 3RXXA 3CTWB 2PNCA 3GLFA 4L15A 2XD1A 3LEZA 1ZO2A 2XR8B 3GLIA 4Y7PA 4HBRA 2C96A 2XFSA 2M7OA 1M6KA 3GQZA 1O7WB 3HWSA 4DE2A 1W5SA 4MB7A 4HM1B 4EUZA 1KE4A 2WZZA 4Y0TA 1S0WA 4R1GA 2ZC7A 2D1WA 5IWAM 4DUYM 3Q7VB 1Q3BA 1IM2A 4K91A 8CHOA 4GC9A 3J27B 5GL9A 1DYUA 1MOLA 2IWDA 4PM9A 3WS2A 4LF9M 1L2SA 3KOZE 1TDZA 4MMZB 3ZHHA 3HVFA 4QY5A 1IN8A 4J8TA 4OVDA 5ITUA 2G8LA 3J7AS 3N54B 2ZQCA 5FQKA 3DA1A 1IKIA 3L26A 2Q9NA 2OLVA 3I553 3LMMA 4DE3A 1YIT3 3ITBA 3PZWA 3NIAA 4OOMA 2UUBM 1KVLA 4F94A 2B5RA 5DF9A 1E25A 1TFKA 2Z3XA 3MKIA 4ORLA 2DWNA 2OQEA 4LFBM 3KZTA 2LH0A 1N8R4 3I51A 1ULJB 3TWKA 1IELA 4Z9QA 4LZJA 2DZOB 1ERQA 4OPQA 2CH9A 1Z5CA 3RGPA 3DUKA 1GL6A 4DV7M 3BEBA