2XGNA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 137
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xgnA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xgnA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xgnA02
4Z9QA 3UY6A 3P98A 1PYYA 5E43A 4FCFA 4QU3A 5A93A 1MY8A 2ZC5B 4LV2A 5A91A 3A3IA 1OMEA 3OPLA 2Y2MA 3HVFA 4OH0A 3SH7A 3BLSA 3WS2A 1ERQA 2ZC6B 3W4PA 1GHPA 3ZGAB 1KVMA 3BFCA 3IXGA 1H8YA 2Y2JA 1IKIA 2XGNA 4KZAA 3MZDA 3QNCA 3C7UA 2JC7A 2C6WB 2XQZA 2DRWA 5FQIA 3O3VA 3MKEA 5EVIA 3Q7ZA 2Y59A 3IQAA 5FSRA 4JPMA 1LL9A 4OQ0A 3WWXA 1RGYA 3O87A 4N1HA 4OQHA 5DF9A 2HP5A 5F82A 3FV7A 3IH9A 5CHMA 4E3MA 1K25A 2HDUA 1Y54A 5EOOA 4KQQA 3UDIA 4DE1A 3A3FA 2RCXA 2UWXA 3N8LA 4EBPA 1IEMA 4X55A 2G2WA 5CGSA 5CHUA 4OOYA 2R9WA 4C75A 3S22A 3N4IA 3TSGA 2HP9A 4JLFA 4OQGA 4XUZA 4P85A 5CHJA 5HX9A 4JXWA 4WYYA 2Y91A 4OOMA 1M40A 4EWFA 1MKIA 2WK0A 1Q2QA 2VGKA 3FZCA 1CK3A 1YMSA 3A3EA 3GVBA 2WUQA 1K54C 1XXMA 2B5RA 1JTGA 1W7FA 5CTMA 1QMEA 2Z2MB 5EPHA 3GTCA 1U60A 1NZOA 3AGDA 3IHBA 3N8SA 4WZ5A 3NBLA 5E2EA 5E2HA 3VSLA 3E2KA 3VP2A 2IWDA 1IYPA 2XF3A 5DTSA 5CEBA 2Q9MA 4GD6A 1N9BA 5JYPA 2JCHA 3FYZA 4X53A 4ZJ3A 1ES5A 2BG1A 4QHCA 1I2WA 2WKEA 4Y0UA 4ZAMA 4FH4A 1O07A 1G68A 3SOIA 4N92A 3HLFA 3PBSA 4KG2A 4KQOA 3OZHA 1HZOA 1JWZA 3PBRA 4JXGA 3WS1A 1XA7A 3GV9A 4DDSA 3V3SA 4U3TA 1IELA 3ZG5A 4K0XA 5FAQA 1S6RA 3B3XA 4ZJ1A 1ES4A 2Q9NA 3AGFA 2JBFA 5A92A 1CEFA 3HBRA 4A5RA 2XH9A 1Q2PA 5CEDA 4JF6A 2ZC3B 2FFYA 1EI5A 3DTMA 4FH2A 1TVFA 5EVIC 1XKZA 3IT9A 4S2OA 2WADA 3Q82A 1QMFA 3IF5A 3PBOA 4EBNA 2XD5A 3LEZA 1W79A 5TGFA 1E4DA 4JKTA 1K56D 1E3UA 1YMXA 2P9VB 2I72A 3CZDA 1FR1A 2P74A 1ONHA 2A49A 1KDSA 3BFDA 1K4EA 3VOZA 4QY5A 4ZDXA 3ZHHA 4UA7A 2Y4AA 3BFEA 1FQGA 3G30A 3UPNA 1K4FA 5FI6A 1E25A 1BSGA 4FSFA 4QB8A 4C6YA 2ZM2A 3HUOA 4GOGA 3PAEA 3PTEA 1YLJA 3M6HA 4NETA 1K57C 4X68A 3EQVA 3UNWA 3WS5A 3MZFA 4Q8IA 4WZ5C 1CEGA 1HVBA 1IKGA 4R3BA 2A3UA 2ZQAA 5EECA 4E6WA 2WZXA 4RYEA 2PU4A 3IWQA 3NI9A 4DRTA 3SS5A 1O7EA 2EX8A 1IYOA 2EX9A 4WMCD 1NXYA 3A3DA 3HLEA 5CECA 2Y55A 4E3OA 5DTKA 1BZAA 5F1FA 4KG5A 3OCNA 1WE4A 4LCMA 5KSHA 4OP8A 4BQMA 3CMZA 1YQSA 4QY6A 3C4PA 1GHMA 3IWIA 4QD4A 1MWRA 1NJ4A 4DKIA 1JVJA 3NDEA 5FAOA 1WYCA 2ZC7A 4N9LA 2ZC4B 3ZNYA 2ZQ9A 2CC1A 1FOFA 1YM1A 3UDXA 1BUEA 2ZM0A 5CGWA 3IXHA 2EXAA 1I5QA 4IVKA 4RX3A 3W8KA 1L0DA 1XX2A 3HLDA 2J8YA 1RCJA 1MPLA 4DE2A 1IYQA 1PI5A 2V1ZA 3IXDA 2EX2A 3ZG8B 5IHVA 1J9MA 4R1GA 4FD8A 3VFHA 2XFTA 3VOYA 1ESIA 1YLYA 1YLWA 1PZPA 4B4ZA 4JF4A 3OPPA 3RXWA 3RXXA 4DXBA 5KMWA 1KDWA 3HUNA 1XGIA 1ES3A 4E6XA 1C3BA 4N9KA 1TEMA 3N6IA 4OQIA 2Y2KA 1S0WA 4KZBA 2XR0A 3ZG0A 1MWUA 4B88A 3ZVWA 3WS0A 3V39A 3LY4A 2Z2LB 2WAFA 1L0GA 3GMWA 3C5AA 1TDGA 4S2LA 3VP0A 4LV1A 1KE3A 4OLGA 4NK3A 1FR6A 2OLUA 4C3QA 3E2LA 1PW1A 2H5SA 2ZQCA 3G4PA 3ITAA 4GDNA 4OPYA 5FI2A 2BLSA 5AQAA 4D2OA 3VP4A 4WBGA 4MBKA 3CJMA 4YFMA 4PM9A 5HAPA 2E8IA 4KQRA 1K57A 1RGZA 4ID4A 4U0TA 5FQ9A 4JXSA 2WKIA 1VM1A 3G31A 5FAPA 2ZM8A 1IYSA 2J9PA 1ZG6A 3PAGA 4R4SA 3WRZA 1N4OA 3ZDJA 1MXOA 5HL1A 3IH8A 3NDGA 3RJUA 2OSUA 2ZLYA 2XFSA 3PBNA 4BL2A 1YLPA 2X71A 4YINA 2H10A 5CERA 4HEFA 4P87A 4UAAA 2PBYA 5U47A 4EQIA 4E3LA 2Y2LA 3DW0A 5GLBA 2HDRA 1ZG4A 2QMIA 1KGFA 1PI4A 1BLHA 4GD8A 1I2SA 4R3JA 5E2FA 5E2GA 3EQUA 4RVAA 5J8XA 3M2KA 2PU2A 1YT4A 1GA0A 3M2JA 4IEDA 5FA7A 5GHXA 4R0QA 1ESUA 3AGEA 3PBQA 5GLAA 3Q07A 4BD0A 5GL9A 3UE0A 3G32A 3W4QA 4BJPA 2G2UA 4GZBA 2VGJA 2HPBA 1WYBA 4EBLA 1H8ZA 2RL3A 2XDMA 3BFFA 4PM5A 1JWVA 1KGGA 2Y2OA 4KZ4A 5JYOA 2ZQDA 4L0LA 1FCOA 2WGVA 3HLBA 4PM8A 3OCLA 3IF6B 4P0MA 1XP4A 4O7DA 5M18A 4OOLA 5FATA 2X01A 1NRFA 5TFQA 3IWOA 5KSCA 1HD8A 4B4XA 4X69A 2Y2IA 3A3JA 1FCMA 1DJCA 5D3OA 3MXRA 5TR7A 1SDEA 3UE1A 2EFXA 3BFGA 4DDYA 4CPKA 4IVIA 4E3KA 5F1GA 3M6BA 1L0EA 1K56A 3I7JA 1BTLA 2ZD8A 3FKVA 1GHIA 4JF5A 4S2KA 4MLLA 5CGXA 3ZCZA 4BL3A 4R23A 4UA9A 3IF6A 4OONA 3N8RA 1ERMA 4S2MA 2WKHA 4WM9A 5FASA 1NYMA 5GLCA 4OPQA 1FSWA 3LY3A 1NYYA 3BEBA 3Q7VB 4OLDA 4X6TA 5GHYA 3ZVTA 5A90A 1ALQA 3C4OA 1KGEA 3W4OA 3LO7A 3GQZA 1DJAA 5G18A 3SS3A 4S2NA 4MBHA 3SH9A 4OKPA 2WYXA 4PMAA 1BULA 3VP1A 3Q81A 3UPOA 3ISGA 4KZ5A 5EVLA 2H0TA 1HTZA 4JXVA 3SH8A 1SCWA 1Z6FA 4LENA 4OP5A 3N7WA 5HAIA 4DF6A 3BM6A 4P6BA 4WELA 3G35A 4WZ4A 3D4FA 4Y0OA 4WEKA 4WMCA 3UE3A 4CJNA 3V5MA 4E3JA 4E3NA 1VQQA 2EFUA 3Q7VA 5EVID 3VFFA 4X56A 4Y0TA 4PM7A 1DJBA 4ZBEA 4GN2A 3G2ZA 5CXWA 5DF8A 4DE0A 5M1AA 4PM6A 1PW8A 3WS4A 4OVDA 4BD1A 3S1YA 1K38A 1GA9A 4PPRA 3MXSA 4H8RA 1YLZA 4S2IA 3G2YA 1JWPA 4MBFA 4MEZA 4GB7A 1JTDA 4GKUA 5DTTA 2H0YA 5FQQA 1LHYA 4N1XA 2ZJ9A 5M19A 2QPNA 1PWGA 3HREA 3DWKA 3G34A 4DXCA 3GR2A 3QHYA 1ONGA 3BLMA 3SS4A 3OPRA 1LI0A 4JBFA 1XA1A 3V50A 5HFOA 4RX2A 2ZQ8A 1AXBA 5AQ9A 1PWCA 3NY4A 2DCFA 3IF6C 1LI9A 5AQBA 5HW3A 1K6SA 5CRFA 4ZTKA 2V20A 1K6RA 1FCNA 3MFDA 2XD1A 3UN7A 2C5WB 2EXBA 1BLSA 4LCLA 1KVLA 2Y2GA 4BENA 1MWSA 3UO9A 4S2NC 5KZHA 1K55A 2X02A 1KE4A 1NY0A 4U0XA 1PZOA 3O86A 5CTNA 3BRMA 3TG9A 3ZG9B 4BLMA 2XLNA 2WAEA 4MNRA 4GNUA 1DY6A 3BYDA 2HDQA 4KG6A 1YLTA 4IBXA 2WZZA 1EROA 4GDBA 5F83A 4ZJ2A 3HL9A 5EE8A 3OC2A 5DF7A 5EOEA 1H5XA 4KZ3A 5GLDA 2WGWB 5GHZA 4KZ8A 1W8QA 3GSGA 2XK1A 3JYIA 3P09A 1SHVA 4LV3A 5L2FA 1CI8A 1E3UD 2IWBA 5DVAA 3WRTA 4KENB 1BT5A 1SKFA 3BECA 3FWLA 3PBTA 3CG5A 3LCEA 5AQ7A 4IBRA 2OV5A 3MKFA 4KZ6A 3ZG7B 4OPRA 1MWTA 1CI9A 4Y7PA 2ZMAA 1XGJA 4OPZA 4HBUA 4WEJA 4XXRA 3MZEA 2V2FF 5FDHA 2WGWA 4KZ9A 3DWZA 2J9OA 1EWZA 1KE0A 1G6AA 1W5DA 3V3RA 3IHAA 3VMAA 3NCKA 2Y2NA 4QJGA 1W8YA 3NIAA 4LV0A 4E3IA 3HLWA 3IXBA 1TDLA 4K91A 1PIOA 2HDSA 2OLVA 3Q1FA 5HARA 3HUMA 2HP6A 4S2JA 1FSYA 3O88A 4RA7A 1BLPA 1ZKJA 5FQKA 4HESA 5FQMA 3UPPA 1BLCA 2GDNA 2ZQ7A 5FQJA 3HLCA 3UDFA 1K55C 2XEPA 2JE5A 3OPHA 1LLBA 4EV4A 1ES2A 4UA6A 1L0FA 3GRJA 4F94A 4XUXA 1L2SA 4UHUA 5HAQA 3ITBA 4DE3A 2Y2PA 2P9VA 2R9XA 3VSKA 4HBTA 1SDNA 5FI7A 3MBZA 2DNSA 3ZNTA 2IWCA 4EUZA 1M6KA 4S2PA 2QZ6A 1K54A 3S4XA 1MBLA 5BOHA 3ZFZA 1GCEA 1RP5A 1ZC2A 2Y2QA 5EUAA 2EX6A 3VP3A 2FFFB 3TOIA 3HLGA 1NZUA 2Y2HA 2J7VA 1PWDA 3NC8A 3QNBA 2WGIA 3C7VA 4R4RA 1XPBA 4M3KA 5EVIB 5I94A 4K0WA 3FKWA 4KZ7A 1LL5A
chains in the Genus database with same CATH superfamily
2H28A 1QAMA 1RGFA 1NJFA 2KXGA 2ZC5B 5BR8M 1DMNA 5A91A 5EJCA 1B2UA 5FTJA 1SJWA 1OMEA 2PR6A 3HVFA 3T4QA 4LRZE 2CP8A 1BRJA 1TFOA 1ERQA 3NV0B 1G02A 1QJGA 4J8TA 2LXEA 1GHPA 1OT9A 4CQHA 1A2KA 3VLFB 1LQGC 1OPYA 1IKIA 2BO9B 2QCUA 1H8YA 4KZAA 3MZDA 3QNCA 5HWWA 5L07A 3C7UA 3SMPA 2JC7A 2WKRA 1Q02A 3CCV3 2KDKA 2F4VM 3ICYA 1Y8GA 3LICA 4B3MM 2OOBA 2RBIA 2DWNA 3WWXA 4N1HA 3FV7A 3LIEA 1WA9A 2HDUA 3RFWA 4DR6M 3LXUX 1C1KA 3B47A 3UDIA 1GL6A 2KW0A 4Q7JA 4EBPA 2HJ9C 5STDA 1G6OA 3EB8A 1LV7A 3LR5A 4X64M 3CF6E 4LRYC 1OJLA 1QZMA 2Z6BA 3PHYA 4JLFA 2OWPA 4OQGA 4P85A 5CHJA 5HX9A 5J4EA 3JR5A 2OQEC 3MMPA 2LH0A 3NQZA 4OOMA 1M40A 4EWFA 2KRUA 1UGUA 3NXJA 1NU3A 5HD5A 1K54C 1S66L 1GSWA 2B5RA 1RHLA 3NM7A 3F1NB 1GY7A 3U60A 2L7IA 4ESPA 3M7GA 1VEUA 4LFAM 3EF8A 3CI6A 5E2EA 3N8SA 5E2HA 1TR8A 3KOXE 1ISKA 3VP2A 1ZV1A 2IWDA 2XF3A 2CV0A 5HWTA 4GD6A 1AY7A 5EP4A 2F5NA 2VQEM 2JCHA 4ZJ3A 4B3TM 4AI6A 1EQKA 1ES5A 4MGYE 4QHCA 1I2WA 4HL4A 3H9WA 1XJ3A 4ZAMA 3SOIA 2DMWA 3FG3A 4B3RM 2GSPA 1WJ7A 2K0MA 1JR3E 4KQOA 4X2HA 1UI7A 2Q07A 3FRHA 2FXTA 2RGQA 1XA7A 4DDSA 3HIGA 2ZBBA 2DWZB 4IBFA 4HHDA 1JNUA 3V3SA 3ZG5A 3S27A 4N6MA 1JJ22 2ZTDA 5EQLA 2JKRM 1BU4A 1I3IA 2V6ZM 2C99A 4N6LA 3LVVA 1CEFA 3LUQA 5EP2A 3TQSA 2MR9A 1Q2PA 2UUCM 5CEDA 2J3TD 4JF6A 3DTMA 4MGIE 1TH2A 3MG3A 5EVIC 1XKZA 2BJVA 2WADA 2Y73A 3M8CA 3IF5A 4EBNA 4GB5A 4LGQA 3S67A 2O9BA 1WR1B 4WL9A 5AJGA 2HAKA 3VF1A 3W2ZA 1N9EA 1K56D 1YMXA 2CHCA 2I72A 2BU4A 1EG9B 2W3DA 3LIBA 2A49A 1KDSA 2R78A 5AYRB 2FFJA 2WKPA 4ZDXA 2ZBKB 1N5PA 3DOAA 4BB9A 4LZIA 3BFEA 1AV4A 3G30A 4X1MA 1E25A 4FSFA 2I9VA 4GJ4A 3HUOA 3EBTA 1T3TA 4DR3M 1XMOM 1NNVA 4ETZA 1YLJA 4NETA 3EQVA 2RGHA 1ZX2A 3KSIA 4R3BA 5IEOA 1G59A 2WZXA 4H6JB 1RGLA 1S3SA 3SS5A 1MN3A 4DV0M 3KSPA 2D01A 1TP6A 1O7EA 2EX9A 1NJGA 1E94E 1ZAEA 4DV2M 4LG2A 3ILKA 3WDGB 2C9OA 2UUBM 2PD8A 2Y55A 3A0VA 5DTKA 2LQVA 3VDPA 2W56B 3T1XA 3OCNA 3GAXA 4M9XA 3D79A 3J7AS 4WLAA 2JKRI 3JUMA 3E4QA 4DKIA 4OVMA 1W6CA 3DTEA 1WYCA 2ZC4B 1YJ93 2ZQ9A 1FOFA 1YM1A 4L9EA 3UDXA 5CF2A 1BUEA 2ZM0A 5CGWA 2HMLB 3B89A 4IVKA 4EC6A 4RX3A 3K63A 1L0DA 5HWVA 1QANA 3HLDA 2J8YA 3CAXA 1Q3BA 1RCJA 2INWA 3IXDA 2EX2A 4EEPA 1J9MA 4R1GA 4FD8A 5F69A 4HM6B 4D80A 2R4IA 2JKTI 1OTIA 3EWKA 2VA0A 3K2NA 1GLNA 4BTXA 3RXXA 2DKLA 1KDWA 2VV7A 5IERA 5KMWA 4E6XA 1DP9A 3MKIA 2GNOA 3E4PA 3MWZA 3N6IA 1WTHA 2R0IA 1SIHA 3WHKA 1EKMA 4JI8M 1FUWA 1MWUA 1GSVA 1XXHB 2W03A 1Z5AA 5G1LA 3HOHA 5CK6A 2QJ5A 3GECA 1NB5I 2XLJA 1BRHA 4RBNA 2W3EA 5FDSA 2FH5A 4IUKA 4X2OA 4NK3A 2V1BA 1V9YA 2H5SA 3IHPA 3M0EA 3FGYA 3FLJA 4GDNA 2V1CA 4WUJA 4IBBA 5AQAA 5HDDA 4D2OA 4MBKA 5L09A 1IOUA 2G3QA 4KQRA 3HHXA 4ID4A 3RGRA 3LI9A 1C7YA 3IX4A 1ZG6A 4L78A 3PAGA 3D3LA 1GD4A 2KZUA 6GSPA 3RJUA 4JI3M 3PBNA 1VQ73 2XZFA 5TBMB 2GXFA 5J7EA 5CERA 4HEFA 2CKFB 5U47A 3FH1A 4EQIA 3U4LP 5ITUA 4XB5A 3DW0A 3FG1A 1F98A 1ZG4A 2QMIA 1KGFA 2EWVA 1FUTA 4LGYA 3KFQC 2X49A 1G0TA 1DO2A 1VQ1A 2O5RA 4GD8A 1L2DA 4R3JA 4BLCA 4YHHM 3M2KA 1O7NB 2YFJB 5GHXA 4XGIA 5KPRA 3ZYTA 1S4SA 2BTFP 3AGEA 3PBQA 5HD3A 4BD0A 4DV1M 2VK3A 1GSPA 1Y4KA 2FNAA 1YPRA 1GKIA 1Z6TA 2VGJA 2HPBA 5LMUM 3HGIA 1RCKA 1U8CB 5G4ZA 1PFLA 2IA2A 1STDA 3S7PA 1GJTA 1TS0A 2VZWA 3NBXX 3QK9A 1GOVA 1W5SA 4DJ2A 3H4MA 4OX9M 2C11A 2APLA 1XHBA 3KS4A 2CK3H 4MN7A 4PM5A 1S5AA 3V98A 2ZQDA 3EEAA 2HJEA 2HMJB 4PM8A 4HVNA 3UJMA 1WNHA 1QDRA 3LQRA 4OOLA 1PNEA 3S7QA 5FATA 1RGEA 1DV0A 2GU3A 1I0XA 1CF0A 1GJSA 5AIHA 3HX3A 1DJCA 1W5TA 3MXRA 1YVSA 1Q40A 3UE1A 2EFXA 3CCJ3 3SZTA 2L09A 1TS7A 3S28A 2ZMVA 3IX8A 4PKYG 4G4QA 1G28A 1NO1A 3O8YA 1YSYA 5AEWB 1K56A 3FKVA 1HNXM 2QYBA 1SKOA 1HKXA 2ZOIA 5ELJA 1YIT3 4MEIA 5FASA 1ERMA 2WKHA 3LT8A 2IMJA 3VV4A 5GLCA 1BYWA 1IXRC 2JP7A 4MCWA 2CFKA 1BNRA 2Q0OA 1FSWA 4X6TA 1NYYA 3ZVTA 5HPIA 1ALQA 4HAAA 4OVZB 4NXFA 1B3SA 3GRYA 4CLCB 5BPVA 1XJ4A 4S2NA 5AVFA 4MBHA 3SBJA 2CW9A 4OKPA 1M1K4 4GITA 4L6V6 3B8LA 5EVLA 1W7CA 7GSPA 3SH8A 1SCWA 5IWAM 1KSIA 2L4VA 5HAIA 3EQQB 1T1CA 3N7WA 4OP5A 3BM6A 1RLSA 2O3OA 2PRFA 4WELA 4DV5M 4Y0OA 2O01F 2QZ4A 2QEX3 3LH4A 1Z09A 4UEYA 3Q7VA 2CWUA 1OHSA 3VFFA 2V9AA 1EW0A 2L1SA 2O0YA 4GN2A 2DAEA 3FYCA 5CXWA 2GZAA 5AVEA 1R2YA 5DF8A 4PM6A 3FSDA 1NRJA 4MM3B 1K38A 2HF6A 1IY1A 4EUVA 3OWUA 2MJ6A 4S2IA 5G4YA 4IBGA 3G2YA 4B7GA 5AIIA 4GB7A 1JTDA 2VV8A 3LTBA 4GKUA 3LOYA 1BRIA 1LHYA 4LF4M 1GL7A 2ZJ9A 2W82A 5L8MA 1PWGA 1V57A 3QHYA 1UCLA 4ETXA 4LJ6A 1ONGA 5JI3E 4GKJM 2R6FA 5A8BA 1OTEA 5HFOA 2F5QA 2JA2A 2E5LM 3MG2A 3NY4A 2K3DA 1X37A 1CYVA 2GNXA 1K6RA 4ZTKA 3UN7A 2RRUA 4NSOB 2NQ8C 1HQCA 5ITRA 1IXSB 1KVLA 5L8RF 4WN5A 4I38A 3UO9A 1NHGC 1A2VA 1K55A 3HJ8A 3LTAA 2IUKA 1OPXA 3UB1A 3Q2PA 1OHOA 3CC23 3ZG9B 1OHPA 2J8XB 2C4BA 4H61A 2WAEA 3DGNA 4LZZA 2EUCA 2LHCA 1DY6A 4G4NA 3BYDA 4LRXC 2UUGC 4BU4A 1YLTA 3X3YA 2WZZA 4IBXA 4GDBA 5EFWA 1H5XA 3NULA 1X1UA 2WSEF 1OTRA 2YNMD 4LYLB 3NBJA 5GHZA 3GSGA 3STDA 2XK1A 1Z5BA 5EXSA 1Q814 4CLCC 2CE7A 1LRAA 1SHVA 2MROB 3KZTA 3CPTA 4KHPM 1SKFA 3BECA 3PBTA 1X1WA 3OW22 3CG5A 2R65A 5AQ7A 1G4AE 1VQN3 4IBRA 4AW4A 3SVAA 2OV5A 2KRTA 1YGWA 4OPRA 1MWTA 3C2WA 3GLGB 4WYKB 4RF0A 1LOWA 4PDGA 2W3GA 1L1TA 4NXMM 4KZ9A 3MQOA 2C5RA 5DRVA 3CD63 3K3CA 4HH2A 2P0MA 1NV9A 2DZNB 2Y2NA 3NCKA 4QJGA 3AOEA 3NIAA 4E3IA 3MHEA 3HLWA 4K91A 4GEWA 1F9IA 4MDZA 2HDSA 2OLVA 3R8FA 2L2DA 3MSHA 3E9SA 5FQMA 1ZKJA 2C9CA 5FQJA 1CQAA 3WHLA 3GRDA 3QP5A 3UDFA 2UX0A 4EQ1A 2JE5A 2W0NA 3KOWE 4G4OA 1IFQA 1TDHA 1PJQA 2WSFF 5KP4A 3FYDA 1BOXA 2RFRA 1X0OA 5HAQA 3V92A 1I0VA 3HK4A 2Y2PA 3VSKA 2Q2EB 4HJLB 3KYZA 3MBZA 1FNNA 2P04A 5D83A 1YI23 5F3WA 5LC7A 2KEBA 1PRBA 3F14A 5BOHA 4Q53A 2BMRB 4FWDA 1C7HA 4X62M 2E2TA 1SPUA 2HMOB 4GLQA 5FW5A 2Y2QA 3IECA 2EX6A 4WF0A 5EUAA 1T1AA 1R4GA 4GL6A 3HLGA 4IJGA 1OJ5A 3HHWA 1NZUA 2I9WA 2V0WA 2ZL1A 2CFDA 3NC8A 4R4RA 5DKLA 4M3KA 4G3OA 5I94A 4K0WA 1PY3A 2ZOHA 3GQ4A 2LBCA 5HGRA 4O02B 1P9RA 3E0YA 5E43A 2F86B 1IK3A 1OT6A 1BSAA 5CF1A 4GCZA 4NPBA 4LMIA 1DP6A 1VQK3 2ZC6B 2QIYA 2CV1A 2W04A 2OOAA 1T1BA 1RJOA 1KVMA 4LSOA 4EESA 2KOIA 1T5YA 3HCYA 4F3LB 3U6EA 4EERA 1D0MA 1YNVX 1Z5CA 1IBKM 2W1TA 1BVSA 3NWLA 2JWSA 2W56A 3QP6A 5FQIA 3NBRA 3O3VA 2WOFA 3MKEA 4DR1M 3UE6A 3IQAA 5FSRA 4KT3B 1LL9A 4JPMA 1RGYA 2C10A 3O87A 4HY8A 4O8SA 1N77A 4FD2A 1XJ6A 1K25A 1M904 4HM2B 3FTFA 4GRIA 2RCXA 4HM7B 2UV0E 3N8LA 1IN4A 5D82A 3KP0E 4QNMA 5EXPA 1IVVA 4J5KA 1RN7A 2VF8A 4QNRA 2W3HA 2SARA 3EN8A 1HJPA 3CME3 5EQTA 1IQPA 3K8ZA 4XUZA 3KX0X 2HZ5A 3WODG 3S7OA 1K3WA 1RMSA 4WYYA 2Y91A 3C58A 5IF6A 1JQJC 1DGHB 2VGKA 2BJWA 3WR2A 1XXMA 3B42A 4HIAA 6STDA 1B20A 3AMOA 3ZQ5A 2ZA4A 2L7HA 3GLFB 4NXNM 3PYPA 2DZOB 2LVPC 1NZOA 4B3SM 2R18A 3EN1B 2W6JH 1N9BA 4EV2A 2OOVC 1PRQA 3EX9A 2O9CA 4HI4A 1H6UA 1D2NA 3SHFA 4LLOB 4AKIA 5FLXS 4FH4A 4KFDA 3PXPA 4RNTA 3RGAA 3D3OA 4N3VA 3HLFA 1VEJA 3OZHA 4QHSA 1TRPA 4XT2A 1PM5A 3WS1A 4D60A 4G6ZA 2D7GA 2M7UA 2IYJA 2V8FA 4BBUA 1IELA 4K0XA 1ZMWA 3FUUA 1S6RA 3PS8A 4ZJ1A 3A42A 4JI2M 3CCL3 2FZ0A 2JBFA 3H82A 4ARZB 1IV7A 4EETB 4EXOA 2XH9A 2MJ5B 3KDSE 1EI5A 2INXA 5IW9A 3L27A 3I51A 3GLHA 1TF0B 1XB2B 3IT9A 4S2OA 5TBMA 3NX0A 4KQDA 1F4IA 3QYEA 2LWXA 2XD5A 3LEZA 2N35A 3E4OA 2JHEA 5TGFA 1E4DA 4NSRA 1K82A 2DAMA 1ODVA 1GMRA 3CZDA 2LNHC 4CHTB 5IG5A 5AYSC 3J2PB 3T8UA 3N8BA 3J27B 3X41A 2WKQA 3T4LA 4IJFA 1VQ53 3CCE3 1K4EA 3GRUA 4O8GA 4QY5A 4QOZC 4GHIA 1UUVB 3VOZA 3KO6A 1E9RA 3EGXC 3ZHHA 1JRQA 3EJVA 2OTL3 2GX5A 2C96A 5FI6A 3OBFA 2GEYA 4GOGA 1V58A 3TDGA 2OO9A 2CEAA 3M6HA 4HP4A 3GRVA 4N6UA 1P0ZA 3Q1CA 4WZ5C 1Q864 1YJW3 2CFOA 1CEGA 1IKGA 1HVBA 4E6WA 4RYEA 2CFLA 5A0OB 3GWRA 2V1AA 2HGVA 2EX8A 1MJGM 2K0BX 4G3WA 3LEQA 1I70A 3A3DA 3K9OA 3B4PA 3HLEA 4EIWA 1OGXA 2CV2A 3GLIB 2W3FA 1WE4A 2DENA 2Y21A 4I5SA 4GS9B 2VV6A 1ZO2A 4JI0M 4QD4A 1G71A 2UGIA 3U61A 2ZC7A 1OFHA 1L5GB 4A3VB 2M60A 2EA0A 3M6AA 4AZFA 1UDII 1I5QA 1R4YA 4L9GA 4Y15A 3W8KA 1NNUC 1N9JA 1XX2A 1DRMA 3BIRA 4HJ4A 4BBTA 2VIIA 4DE2A 1PI5A 3EE1A 2DHYA 4G4RA 3JUNA 3ZG8B 1LNHA 3I563 3C9PA 2CFWA 3L29A 4WURA 1YLYA 3SFZA 1YLWA 3OPPA 3UK6A 3CXC2 3RXWA 4HBRA 2MC8A 1YJN3 1XGIA 3HY5A 2QGUA 3MPHA 4JI1M 1N5HA 1MOLA 3GLHE 4OQIA 4B93A 1KQS2 1S0WA 4QPRA 1DE3A 3ZG0A 2XR0A 3UB9A 4B88A 3W0FA 1B2SA 1ORYB 4WFOA 4BBVA 2M7VA 3L2AA 3EEHA 3V39A 1L0GA 3IS2B 3GMWA 3SMSA 1TDGA 5ELUA 1I2FA 4S2LA 2GQFA 1KFVA 3GSPA 1FGMA 4Z1WA 3VP0A 4BWIA 1IN5A 4JV5M 3MF0A 2P5TA 2OLUA 3U6MA 4LFCM 3T15A 5TGNA 1PW1A 2ZQCA 3ITAA 3KSFA 5FI2A 1GMQA 4WBGA 2UXCM 4YFMA 5HAPA 3NHXA 3FRIA 1K57A 1RGZA 4LJ8A 2XR8B 2WKIA 1VM1A 3G31A 5FAPA 2ZM8A 1DYUA 2J9PA 3T1QB 2F5PA 2P08A 3FCSB 3OX9A 1H8MA 5HL1A 3NDGA 2ZLYA 2XFSA 4BL2A 2BMQB 2QJ7A 2X71A 4YINA 3CPOA 4UAAA 1VQP3 3K92A 5C18A 5FL3A 1RN1A 3UB8A 1L8QA 5GLBA 1WGLA 3BNBA 1PI4A 3CF2A 1N8R4 3TL4X 3LMMA 2PD7A 1I2SA 3K0ZA 3CUEA 2Z6DA 1K8A4 4O2HA 3SAUA 4K0KM 3CWFA 4WW0A 2DWLA 3D4AA 3HU2A 4IBEA 3G32A 4HLQA 3KSGA 5GL9A 1QVRA 4BJPA 1UGIA 1JKGA 3A0SA 2KZSA 1BNJA 2V8CA 4IIAA 3F1PB 4MB7A 1B27A 5BU4A 2G7UA 4ITQA 1BNIA 3PXGA 1Q824 3GRRA 3E98A 3Q90A 1JWVA 2Y2OA 1WIVA 4X25A 5JYOA 1LTMA 1OAOC 3BOSA 4NOOB 4L0LA 4QOSA 1G96A 2WGVA 3UMDA 1W2B2 2OWHA 3OCLA 3GZBA 2VGLM 4P0MA 4K1UA 1M9GA 2X01A 5TFQA 2KF4A 1HYFA 1HD8A 3C30A 3IWOA 3VFDA 2B1XB 2A2LA 4GMQA 2E8JA 2HOHA 3KSXA 5EP3A 5TR7A 1R4CA 3A46A 1UFZA 1LOYA 2AADA 2GJ3A 1E3VA 4LF9M 3SOAA 4GC5A 3DY5A 5JYPA 1BTLA 2R4EA 4S2KA 2VF7A 3CC43 3VE4A 2OTJ3 4UA9A 5JI2E 1VEKA 3EOIA 3K3DA 2WGQA 3IF6A 4S2MA 4WM9A 3UB5P 4KFEA 4GSPA 5DJTA 1UCJA 4HOHA 2AAEA 3GLGA 4OPQA 2XROA 3LY3A 5A90A 1B2ZA 1TTEA 2J7NA 2Z7AA 1J09A 4P16A 1EIJA 3LO7A 1D1JA 3WMDA 4NRVA 1DJAA 2BHMA 5G18A 2FS1A 2UU9M 2BNKA 3KVWA 1BNEA 1RGHA 4PMAA 1BULA 3Q81A 4K08A 3HU1A 2QKPA 3IX3A 3GPXA 1YGEA 2H0TA 4JXVA 3TW8A 2Y79A 1VETB 2LB5A 1OF5B 3EIEA 4DMZA 4E3JA 4FOFA 4E3NA 3JPUA 3KYEA 3CNXA 1DGBA 1VQQA 5EVID 2Z3XA 1SXJC 2KCDA 4X56A 2F99A 4Y0TA 3HHZA 4ZBEA 3G2ZA 3WA3A 2R62A 4DE0A 1NHWC 3SARA 5M1AA 4LRSA 1PW8A 4I4LA 1DP8A 3LR3A 4OVDA 4DR5M 2D02A 4Y17A 3ZQJA 2QHOB 1GA9A 4N6V0 4H8RA 3J7BA 1B2XA 2MH8A 4MEZA 1BAOA 3LTCA 1R6BX 1M1XB 3X40A 2H0YA 1LXEA 1STFI 4JGPA 1BSBA 5MC7A 2X4AA 3HREA 2K47A 3G34A 4RNAA 3R7WA 3GR2A 1L1ZA 4R9KA 1LI0A 1VQ83 1KD14 3V50A 4RX2A 2ZQ8A 1AXBA 1XJ2A 2JY6B 2DCFA 3RH8B 2WSCF 1YUBA 1FCNA 5DNYA 4IBIA 3TPZA 1JB5A 2HKJA 1TS8A 4F2LA 2VJWA 4GKKM 2Y2GA 3BNCA 8CHOA 1HNWM 1VHMA 2UUAM 3BXWA 2SBLA 3I0YA 4KUKA 3QP2A 3FE3A 3U5ZA 1T43A 2JKGA 5EM1A 3CPW2 2X02A 4R71A 3FG4A 1NY0A 2ZAOA 4U0XA 1PZOA 4AG5A 1EEJA 2DAIA 3GLGE 3BRMA 4BLMA 1Q7Y4 4D81A 1QAKA 3MSOA 4O0PA 3JR4A 4I5QA 5FGOA 3H7WB 2ML5A 1XC8A 3L28A 3T4TA 3SEDA 1AUAA 5F83A 2L0WA 3F40A 3UMMA 1BNSA 2QBYA 5JBSA 1JBTA 4R1KA 4EW7A 4R80A 5GLDA 1QVG2 2WGWB 2XRXB 2OOLA 4FCMA 3JYIA 5IENA 2F5OA 4CDLA 3AGNA 1E3UD 2IWBA 2M7OA 5HDSA 1O7HB 3H4JA 3WRTA 4M0DA 4ZRRA 1BT5A 2XSZD 3FWLA 3CGWA 4REZA 3UGJA 1MC0A 1ZQ9A 5IZ7D 3LCEA 3CMA3 1Y28A 3BNDA 4FMBA 3VSYA 3A76A 1KSFX 4HM1B 1UCKA 3MKFA 4KZ6A 4B7HA 4XM4A 5FTKA 3DM8A 3T4SA 1CI9A 3FG8A 5F68A 5FTMA 1AVKA 4WEJA 1BRGA 2KA6B 2MF7A 3F1OB 1TTOA 4FCZA 3U6OA 2PDRA 1D7EA 4L16A 3UL5A 1W00A 4PHTA 3HJSA 3V3RA 3IHAA 1JV2B 4FMDA 4HM5B 1W8YA 3FC7A 2R44A 1BNFA 3K9PA 2WGOA 3B7NA 2O99A 3DAVA 1QAOA 1PIOA 3IXBA 3QP8A 3Q1FA 5I5LA 4S2JA 4JF8A 4I3AA 1R7RA 3D72A 1QUTA 3L9KA 4P6ZM 2ZQ7A 2Z6CA 1N9OA 1RDSA 3IG8A 4UA6A 4F94A 4XUXA 1X1XA 2OQEA 5G1KA 4PDIA 3FUTA 3T1YM 2XA7M 2IUJA 1SDNA 1NLYA 5C5KA 1YSQA 1M6KA 8CATA 1IU7A 1K54A 3S4XA 1UUGB 3WA2X 2QENA 1MZUA 1UWPX 1ZC2A 3VP3A 3PCRA 2W0QA 3BLZA 1V92A 1EA2A 1MNLA 3SX1A 3TOIA 4R9LA 2J7VA 2KX6A 5DYGA 4MMYB 4XBTA 2WGIA 3K7CA 3C7VA 3FUXA 3SHGB 2CRUA 3G713 4KZ7A 2PBDP 2CHGA 1CYUA 1NVMA 4NHFA 3P98A 4Z9QA 2GBXB 2VDBB 2Z76A 4FR9A 1IQXA 1MY8A 1YAXA 3OPLA 2Y2MA 1OQYA 3HZJA 5IG4A 3WS2A 4Z6YA 4R6LA 1JN5A 3ZGAB 3BFCA 3IXGA 2Y2JA 2JUJA 5D81A 4JYAM 3FUWA 1NWZA 2NUTC 3LIAA 4LGWA 4YNRA 3F7XA 1E3RA 2C6WB 3CCQ3 2DRWA 4KODA 5EVIA 2F4YA 1T2HA 4IT7A 3QP1A 2LVQD 4OQ0A 2JY7A 5DF9A 4OQHA 2HP5A 1YHQ3 5F82A 2EJSA 2DAKA 1TDZA 3GDIA 3U60B 5CHMA 3TRCA 2ZL8A 1VEUB 4DR4M 1G41A 1P97A 2JDIH 4DE1A 2ACGA 4MN5A 4FCJA 3CLOA 3NV0A 2XZUA 2RCDA 1IEMA 4L4UA 2G2WA 3JVVA 4X55A 4DJ3A 5CGSA 5CHUA 4OOYA 2R9WA 2E2UA 4GW9A 3S22A 3TSGA 2HP9A 2M5ZA 2GEXA 6RNTA 4JXWA 1T2IA 3I553 1SZVA 7STDA 1J2BA 3AV0A 1MKIA 2WK0A 2BWEA 4IIWA 3UJNA 2JKFA 1YMSA 4DR7M 3A3EA 3GVBA 2WUQA 2JXNA 3W67A 5AIFA 1GSXA 1W7FA 4S12A 5CTMA 4EBGA 3TE6A 2JY5A 3NBLA 4J5GA 3E2KA 4LJ5A 3DH2A 5DTSA 3ECFA 1IYPA 1IV9A 3F8HA 3L7HA 4X53A 4LF8M 1BANA 2B95A 2WKEA 5IU1A 4N92A 2R46A 4KG2A 3LQQA 1JWZA 4JXGA 2DAGA 3GV9A 3BB9A 1R2ZA 4IPBA 4U3TA 1ASKA 4P17A 1N34M 5FAQA 1IVWA 3G16A 2F5SA 4U13A 3GPUA 3HHYA 3B3XA 2K2NA 3F1NA 2CHVA 2HWJA 5KP1A 1A90A 5A92A 1N9NA 3HBRA 1BNGA 4A5RA 5CLKA 2BT3A 3L0RA 3KSHA 1WMNA 1TVFA 4JI5M 3Q8XA 1H0MA 3N54B 1QQWA 3Q82A 1QMFA 4MMNA 3T4JA 5BXQA 3NBIA 1O7MB 1TS6A 1VQ93 3AKZA 1W79A 3CC73 4NXGA 1DGGA 2NUPC 1E3UA 2P7JA 4JXJA 1ROVA 2P9VB 3H82B 1FR1A 2XSZA 1ONHA 1PJTA 4AKGA 1XFNA 2Y8HA 4ILFA 1RGKA 4HM8B 1VG5A 3IBRA 2V1UA 1NSFA 1KYIA 4OU7A 4HM4B 3ZC7B 2Y4AA 1NNJA 1HU9A 4IBDA 2ZM6M 5EEOA 2R4JA 3KFUG 5DYIA 2BMOB 1BSGA 2ZM2A 4NXBA 3V67A 4C6YA 2KF6A 4EEUA 4DV3M 3KE7A 1A0KA 2XSOB 3PAEA 3DXOA 3PTEA 1DVCA 4NEED 3UNWA 3MJ5A 1K57C 4Q8IA 3WS5A 3MZFA 2YFQA 4WP5A 4L9FA 3RFBA 3KOYE 1J7KA 3U6PA 2ZQAA 5EECA 4CIZA 4MJDA 4DRTA 3NI9A 3LYGA 3ULFA 4ZM8A 4WMCD 1NXYA 5CECA 3J81S 5JPUA 2XRNA 5HL6A 4KG5A 2A24B 1NJI4 1NO3A 4LCMA 1BRKA 4BQMA 2UXDM 3U6QA 1RRLA 4CLCD 3SAWA 3IWIA 2KNZA 3DBAA 1MWRA 5LC6A 3NDEA 1N9LA 3A0RA 1XWIA 3ZNYA 2YKFA 3FPVA 2CC1A 3U6CA 4NC6A 1B21A 4Q0IA 3RGPA 2EXAA 1I4WA 1W4NA 4H6JA 4Y5FA 1UW1A 3E46A 1IYQA 5KQDA 2LYXA 3LT9A 5IHVA 4LF7M 2F98A 4FW9A 3VFHA 1RNTA 5J3WA 3VOYA 4B4ZA 1PZPA 1RRHA 3NECA 4IBJA 4DXBA 5EXTA 5EVEA 1ES3A 4PAUA 1FYSA 4UQIM 3DFZA 3EBYA 4LZJA 1JB2A 3LYXA 2Y2KA 4CGYB 4LF6M 1WHCA 4FCWA 4MMXB 1LSXA 4KZBA 4O01A 2KAAA 3MFXA 1VQ63 1BSEA 2Z2LB 1B2MA 2AHMA 3S7NA 3C5AA 4HZ9B 4P6ZS 3LCUA 1BRSA 4EXRA 1F2KA 4OLGA 3UB6A 3SYLA 2Y20A 1OJGA 1RGCA 1FR6A 1NV8A 2JY8A 1SQWA 2GU1A 1LVNA 3G4PA 2BASA 3GO8A 3FKEA 2E8IA 2B02A 2EKKA 4MH0E 1R5LA 1NY6A 1VQL3 1W6GA 2KF5A 1XXHA 4R4SA 1D6UA 4LEHA 1N4OA 3WRZA 3IH8A 2OSUA 2G5GX 4NXEA 3PVSA 2H10A 5IEPA 1QUSA 3KN4A 2PBYA 1JB4A 1CH0A 2VEAA 4MMZB 4AQYM 1BLHA 4GHLA 4PCZA 5ITXA 1GO5A 1TJDA 4OK0A 1TD5A 5E2FA 5E2GA 1HT1E 1NB3I 4JI7M 5J8XA 1CJFA 3MYTA 1DVDA 3HWSA 1GA0A 3DA1A 3KW6A 2PU2A 3M2JA 5FA7A 2HL7A 3N9HA 4R0QA 1OFIA 2B18A 5GLAA 4E04A 3Q07A 1O7GB 1ACFA 2LVAA 4KZ1A 1RNBA 1HNZM 1Q40B 1WYBA 2OCTA 4X65M 4EBLA 1MGWA 2HV1A 1H8ZA 3NOPC 1IY0A 1X1YA 2RL3A 1TIJA 5BIRA 3BFFA 1FUSA 3MQQA 3T50A 3LFVA 1SKOB 1N33M 4X1LA 3FTEA 5DFLA 4JI6M 1UWNX 1BVIA 1W6YA 1Z59A 1LOXA 2CG1A 1NRFA 3LR4A 3MR0A 5DREA 1A5TA 3U2AA 3VK8A 3LIDA 1D0LA 5KSCA 3JUQA 2CHQA 1FCMA 5D3OA 3I04M 1ZS7A 1SDEA 1S723 4G3VA 3BFGA 3PNYA 4CPKA 1RGAA 3M6BA 3NJAA 1L0EA 5IT9S 2DXIA 2ZD8A 3U6SA 3ZCZA 4R7GA 4BL3A 4R23A 5FSWA 5CX7A 3I4VA 3LW5F 1PJSA 3LZAA 1YIJ3 3B7QA 3RDEA 1V34A 4OONA 1YE9A 3PZWA 3N8RA 1LL8A 3EIHA 3FZWA 1NYMA 3IPTA 3FKAA 1VQO3 3EGDC 3Q7VB 3T4KA 5GHYA 4OLDA 2V1LA 3JAMS 1D6ZA 1BGSA 2DHRA 2RSXA 3G4S3 5DKKA 4TUWA 2MGWA 3DGLA 1HR0M 3SS3A 3THGA 1Q7HA 1XXHE 3B7ZA 3PYJA 4JGQA 3SH9A 3ALAA 3MJQA 3MK6A 3UPOA 3ISGA 4ANRA 1S1ZA 1GYBA 3T38A 3C3DA 3LTDA 2HMKB 1HLUP 5ITQA 1QVF2 3T8NA 4EYCA 3IG5A 3Q3FA 4P6BA 3G35A 4WEKA 4WMCA 1OUNA 5ITXE 4CJ6A 2EFUA 1S67L 1K0KA 2YFIB 1RTUA 5LMNM 4OVZA 1NY5A 2Z4SA 3HJQA 1O7PB 1Y4OA 4LFUA 4CLCA 1UM8A 4F1IA 4N6TA 1E9SA 2JNHA 1W2ZA 3VGNA 3WS4A 4BD1A 3S1YA 3W0LB 2O9AA 4L7KA 1CEWI 3TWMA 4YWZA 1HQYE 3MXSA 1YLZA 4FMCA 3B4OA 3QAUA 1N8QA 1JWPA 2J3TC 4MBFA 1F8NA 4PKYA 2IY2A 4ORLA 3J7Yd 2K6BA 4KUOA 4I3JA 3I01M 5FQQA 2QNJA 4L15A 4N1XA 2F56A 4X66M 1Q42A 1IVUA 4HKVB 2QWSA 4LJ9A 3K1JA 1IBLM 1VEGA 4FVMA 3DWKA 5IG3A 1E32A 4B7FA 2PZVA 2J7OA 4AKZA 3SS4A 4FUWA 2B24B 4JGOA 2QSFX 3HKPA 5KQ8A 3SATA 1PWCA 5AQ9A 3RE8A 5A2QS 1LI9A 5AQBA 5HW3A 1K6SA 2F5WA 3NOUC 4DV7M 3T1SA 3MFDA 1JB0F 2XD1A 3URPA 3P01A 2BNGA 2XSSA 2EWWA 1BLSA 1G8PA 4BENA 3D5GA 2DI0A 7CATA 2KHHA 4MGHA 1ZHHB 4S2NC 5KZHA 3CPTB 4LFBM 1QDTA 1SXJB 2EO2A 4KO8A 3O86A 1I8VA 3C8CA 2XLNA 3CHWP 1DMQA 4PT5A 1K9M4 4GNUA 4RKUF 1FGTA 2YX9A 4ZJ2A 5EE8A 3OC2A 3ROBA 2OAP1 1V33A 1IXSA 2L6OA 1W8QA 4KZ8A 3BBZA 4Y3IA 3D8BA 3QRDA 1STZA 1IN6A 5FEFA 5DVAA 5ITTA 4KENB 4NL4H 4R3AA 4K1VA 2EA9A 2CWBA 1I2EA 1BSCA 4UQIS 1UCIA 4BIRA 5KO3A 3ZG7B 4JRFA 1T18A 2E2VA 4Y7PA 4OUQA 1XGJA 4LPZA 4NG2A 3SC3A 4HBUA 2PYPA 4OPZA 4CLCE 5FEGA 2V2FF 1RKYA 4HZBB 4I81A 2A15A 4I3IA 3DWZA 3S5CA 1L3LA 2J9OA 3TE8A 1S1YA 2OWJA 3OXAA 1KE0A 1G6AA 4HM0B 5F5YA 5GSPA 2FOIC 1FZUA 1D0KA 4LV0A 1K3XA 1LNIA 1TDLA 1OH0A 1FJGM 1F5MA 3L26A 2JKTM 2ERCA 1FSYA 3O88A 5FQKA 2BIRA 4HOIA 4HESA 1AQZA 3U97A 3UPPA 5EM0A 2FE8A 2L4FA 2ZL1B 7RNTA 3LVWA 4EU0A 4WYKA 1D06A 2J3WA 1IT8A 3NHQA 1K55C 2XEPA 1AR0A 2M1CA 3ER7A 2YQZA 3OPHA 1US1A 3EC9A 2Z7JA 1ES2A 4EV4A 3JVUA 3GRJA 1IM2A 1QYRA 2KDLA 1L2SA 3BQAA 2Z4RA 2KLIA 4UHUA 3LR0A 4HJ3A 1MGRA 2P9VA 1RCLA 2R9XA 4HBTA 5FI7A 2DNSA 4G1MB 4R70A 4XK8F 3K2LA 4WP2A 3T1HM 2IWCA 2QZ6A 4LJ4A 5EXXA 1W02A 3KSJA 3RGSA 3H51A 3WOEB 3U1WA 1RP5A 4AKYA 2PYRA 1U5OA 2W1TB 1CUKA 2FFFB 4AKHA 2Y2HA 2DZLA 4RNYA 5KPTA 3AHWA 3BJNA 2OOVA 3LI8A 1I3FA 1LL5A 3HJKA 5KP3A 3UY6A 5A93A 1PYYA 4FCFA 4QU3A 4KT0F 3FD9A 4LV2A 3A3IA 4R3DA 3SH7A 2PNCA 4OH0A 2LTUA 3BLSA 4R4KA 1KWIA 3W4PA 1TF1A 2UXBM 2K54A 3OV4A 2XGNA 5BVBA 2DNAA 4IHQA 3FTCA 3GZXB 3D8LA 1GY5A 3U6DA 1WGNA 2XQZA 2A24A 1XMQM 2JQ5A 4I39A 4JGRA 1I2GA 3AOEC 2Y59A 3Q7ZA 3LCVB 4FCTA 4MN6A 4II7A 2RNTA 1JZDA 2W2CA 1TH3A 3AMOB 3IH9A 1W63M 4CISA 4E3MA 1Y54A 5EOOA 2F5MA 4KQQA 3VDUA 4J9AA 3A3FA 3SASA 2UWXA 3HJIA 3GPYA 1J3WA 1SARA 3TJZC 1FGQA 4F3LA 4Y2FA 4C75A 3DTIA 3CF0A 2CFGA 3N4IA 3MS6A 5DFXA 1DGFA 3DGOA 3AHSA 2QPAA 4DUZM 2CC3A 4XT2B 2HMNB 1SIIA 2J80A 3DMCA 1Q2QA 3T12B 3FZCA 4LCBA 1CK3A 1IN7A 5AI1A 4Q0HA 2W1RA 2KNAA 3Q8GA 2QP9X 1N32M 1JTGA 2FH0A 3SAVA 1QMEA 3IMAB 1IYYA 1LOVA 2Z2MB 3GTCA 1U60A 3AGDA 3IHBA 5EPHA 3KCHA 4WZ5A 1HZ1A 3VSLA 1JZOA 1ROAA 4RZMA 5CEBA 5RNTA 2Q9MA 3GLHB 4B08A 2H0HA 3FYZA 1K41A 5EVHA 3BQ8A 1RU3A 2BG1A 1A2PA 5IG0A 2RGOA 1GOUA 4Y0UA 4R38A 1O07A 1G68A 1YSPA 3E99A 4Q0JA 4XDVA 1SXJD 1OTDA 4AG6A 2W27A 3PBSA 1HZOA 3PBRA 1T19A 2OQ4A 2W9PA 1DGHA 3NM2A 2CWVA 3JUOA 3CCS3 1ES4A 2Q9NA 4GHIB 1Q39A 1NWWA 3AGFA 1PJIA 3JUPA 1IFYA 3GLFA 1TGUA 1OACA 1QZEA 2O25A 2ZC3B 2FFYA 1OTBA 4FH2A 3IJEB 2Z77A 3V76A 5GKNA 1P3QQ 1G5UA 3OWSA 1YVBI 3PBOA 3UL6A 1LQMB 1BRNL 2PR5A 4JKTA 3JVCA 1J5EM 3SOYA 3MXQA 4LGMA 2P74A 1UUWB 1JBSA 3BFDA 2CH9A 1MU5A 4XBOA 3RNTA 4ME4A 3K5TA 4ARZA 4UA7A 2LVOC 2KF3A 1FQGA 3UPNA 1K4FA 2CX0A 3GZYB 2JN7A 4QB8A 3UMEA 2V0UA 3VE3A 3U61B 1ZMVA 3H3HA 3G6OA 1LT0A 1N78A 4HYZA 4X68A 4QHTA 2R41A 3B9PA 5HOHA 2EKFA 2A3UA 1IXZA 3GPPA 1PGYA 1IT7A 2PU4A 3IWQA 2YKHA 1QMAA 1UGHI 1IYOA 2CUZA 2G8LA 2LHGA 3UNLA 4E3OA 5TJJA 3FF0A 1BZAA 5F1FA 4BTWA 3FF2A 5KSHA 3LIFA 4OP8A 3CMZA 9RNTA 5IT5A 1YQSA 4QY6A 3C4PA 1FGRA 1GHMA 3AJIB 1NJ4A 1JVJA 5FAOA 4YY3M 4N9LA 4XDWA 1BUJA 3IXHA 2PT7A 2VQFM 2OPFA 3QP4A 4FMAA 3D5IA 2QHKA 2VGLS 1MPLA 4UN2B 3SLUA 2P09A 2V1ZA 3DZLA 1W63Q 2LB9A 1BIRA 2KNVA 3T0UA 2XFTA 1PJJA 5CXOA 3GLIA 4DV4M 1W5ZA 1WXQA 3F7SA 1ESIA 4I8OA 4GS9A 4Y13A 4JF4A 4JI4M 1JNQA 3GLFE 3C38A 5LBRA 1K28A 3NUVA 3HUNA 4Y28F 2R45A 3BY8A 2A5YB 2JZ1A 4HEOA 3F8XA 1C3BA 4N9KA 1TEMA 2ZTCA 4D82A 2WOHA 3A5EA 3VKGA 3RTYA 3ZVWA 4GC9A 1MX0A 2C98A 5C1BA 1WMOA 3CCU3 3WS0A 3LY4A 3P7NA 3T1RA 4XBXA 2WAFA 3KOZE 2ZMFA 5JPPA 2WO0A 4STDA 8RNTA 2J5YA 3SW1A 5F6AA 1YLAA 4LV1A 1VDDA 1TUHA 5I97A 1KE3A 4FTXA 1FW7A 1QAFA 3J80S 3A98B 1T3BA 4N6NB 3WOFB 4C3QA 3E2LA 4OPYA 4M9SA 1V74A 1UI8A 4DXCA 3GQ5A 2BLSA 3DGYA 3QYBA 3VP4A 3CJMA 4PM9A 4IJEA 4G3KA 2VKSA 4U0TA 2JZ0A 4MGZE 3V99A 3NOTC 4JXSA 5FQ9A 5AIGA 1NLZA 1IYSA 3FUVA 4ZPXA 2DWMA 4B9OA 2P0XA 4LRTA 1OGZA 4XBYA 1V9ZA 1JKGB 3ZDJA 4QWOA 1MXOA 5K5BA 2QA43 3A45A 1N75A 1IVXA 1YLPA 3IS2A 2K7SA 4TX4A 1KOUA 3CITA 4P87A 2HCBA 1GVNA 1HT2E 3E21A 1OKSA 4E3LA 1Q9EA 2Y2LA 4DN0A 4Z8XA 1IQ8A 1PYLA 2HDRA 4K90B 3C3EA 4GHOA 3VKHA 4GH9A 3PGBA 3EHCA 1AVLA 3EQUA 4RVAA 3HIIA 1S4RA 3KXEC 1YT4A 4MGKE 4RNZA 4IEDA 1ESUA 2XSHB 3AFHA 3UE0A 4H3UA 4LJAA 3W4QA 3L25A 1GS3A 2IA7A 1ZTUA 2G2UA 4GZBA 4IUHA 3B33A 1IN8A 3CNMA 4DBGB 4PD2A 4HQAA 3FPWA 1K734 3DZDA 2XDMA 2L4RA 1SXJA 1OIZA 4N6OB 1TU5A 1JBRA 3R4KA 4DV6M 1KGGA 1WMPA 5HDCA 4KZ4A 2ZANA 1PFPA 3PFIA 2CG0A 2HHHM 3SYUA 1FCOA 3HLBA 1YKDA 3BWLA 3FTDA 3IF6B 5HPFA 3GLIE 4L8OA 1XP4A 4GIPA 1QALA 5M18A 4O7DA 1W01A 3GP1A 1FGOA 3MG1A 1IDPA 4YOFA 1H3QA 4X69A 4B4XA 2Y2IA 3A3JA 1OTAA 2H1RA 1DMMA 4W5WA 4KFFA 5FTLA 4AEQA 4DDYA 4CCVA 4E3KA 4IVIA 3F1PA 5F1GA 1RSNA 1BSDA 3LMLA 4JN6A 4LF5M 1GABA 3I7JA 3IBJA 4JF5A 1GHIA 5CGXA 4MLLA 2PHYA 1JR3D 2WZJA 3SXXA 5EV0A 3B74A 3T6PA 3I4YA 1FILA 3CU3A 3PCSA 3VOLA 4BBAA 4EW5A 3KYQA 3BEBA 2LVNC 2ZAMA 4K61A 3BNEA 1KGEA 3C4OA 4AFIA 3W4OA 4NRWA 3ZH9B 2Z8YM 5ITYA 1FA3A 3GQZA 1IBMM 3BU4A 3CUEC 3D9RA 3F92A 2I7NA 2WYXA 3VP1A 4M0WA 1AWIA 4KZ5A 1LSWA 4M4XA 2B3TA 4RQ9A 1EUIC 1ZGXA 3AGOA 3X3ZA 1HTZA 5HSQA 2H0GA 1Z6FA 3TWKA 1QAQA 4LENA 4DF6A 2ZDJA 4WZ4A 3UE3A 3D4FA 4CJNA 1VDLA 2XGLA 5HZHA 3V5MA 3KIIA 1KC84 1VB6A 2KRKA 3R7WB 4LJ7A 3UZUA 2STDA 1DJBA 1GY6A 3SYKA 3OLOA 3LGOA 4PM7A 1SG9A 1L2CA 2FNQA 2D7EA 3DTKA 1AIPC 2CMNA 3MQ0A 4IBCA 4I4KA 4FWHA 2L4EA 1GOYA 3D9YA 4PPRA 4LY6A 2VX8A 1ULJB 4L8RC 4RF1A 1SXJE 1VETA 5AEUB 1XNRM 3KKGA 5DTTA 2P38A 1OF5A 1T6OA 3ZCBB 3U5ZB 3FKWA 3OOVA 5M19A 2QPNA 1BUQA 1D6YA 5EP1A 1VQM3 4FWGA 3WHOA 1I94M 3BLMA 3OPRA 3PNVA 4JBFA 3B7CA 1XA1A 1Z1SA 3X42A 2OAQ1 3BW6A 2H5XA 1OIPA 3IF6C 3T4OA 1XFQA 2XA7S 2PAVP 5CRFA 2V20A 3AL0C 4WWUC 3S29A 3G8ZA 2C5WB 2QBYB 2EXBA 2DVWB 3CCM3 4LCLA 1DO0A 1P9WA 1OCVA 5FTNA 1MWSA 3PR6A 3CTWB 2W9QA 2Y0QA 1WQLB 1TH4A 3HU3A 1DETA 1KE4A 3DUKA 4QWTA 5CTNA 2CIUA 2FGTA 3TG9A 4IBKA 4HM3B 2KXEA 3HZPA 3E4RA 3UB7A 5DFYA 4MNRA 2HDQA 2VLGA 1E97A 3NBBA 4KG6A 3HX8A 1EROA 3PXMA 2YFLB 3HL9A 5EOEA 5DF7A 4KZ3A 2CWTA 4KVHA 3KS8A 4OW0A 4DUYM 3P09A 1ULIB 2D7HA 2K31A 4LV3A 5L2FA 2ZHXB 1CI8A 4NKPA 2I7PA 2YR0A 3F9SA 1G3IA 4HNBA 3U6LA 4DR2M 1L2BA 3BY9A 5IS1A 3KP1E 1Q3CA 5E6JA 3H7WA 2RKOA 2ZMAA 4L8PA 4XXRA 3OTOM 3MZEA 1TRQA 2H0IA 1A67A 5FDHA 2WGWA 4BTYA 1O7WB 3OWYA 3MMHA 3DGMA 5G2GA 1EWZA 1W5DA 5KPZA 3VMAA 1XNQM 1CQSA 1RN4A 2HMMB 4WHAA 1LSVA 3AOGA 3R9XB 2X8AA 4M9ZA 1EFUB 5HARA 2D42A 3HUMA 2HP6A 1MKMA 1RGGA 4RA7A 1BLPA 4KLNA 1TFKA 4FCVA 2Y74A 3QWLA 1NDOB 4BMWA 1BLCA 4PEJA 4O3VA 2GDNA 1FIKA 3HLCA 1PU4A 3HI7A 5H37D 2CX1A 2ML6A 3KSED 4HH3A 1GMPA 3X3XA 2D1WA 1LLBA 5E26A 3F1OA 2QQ8A 3GQ3A 1EE8A 1L0FA 3ITBA 1ZMUA 4DE3A 3O5YA 1GD3A 2AVXA 2BWBA 1JN5B 3ZNTA 2P05A 5KIZA 4EV5A 1N36M 3G0KA 4EUZA 4S2PA 3NQYA 1VQ43 1MBLA 1C54A 3ZFZA 1JR3A 3CCR3 4GHAA 1GCEA 2L1MA 3MHVC 3W68A 1IQYA 1VZZA 3GZRA 5DJUA 2K9DA 1OAIA 3K9MC 4NREA 1PWDA 3QNBA 5IREB 3TWLA 2GBWB 3G6E3 1XPBA 4HJ6A 5EVIB 2Y0TA 1IY2A 3VK7A 2O9UX 4HP9A 5L10A
chains in the Genus database with same CATH topology
1QAMA 1NJFA 2KXGA 2ZC5B 5BR8M 1DMNA 5A91A 5EJCA 1SJWA 5FTJA 1OMEA 3HVFA 1TFOA 1ERQA 3NV0B 1QJGA 4J8TA 2LXEA 1GHPA 1A2KA 3VLFB 1OPYA 1H8YA 1IKIA 2BO9B 2QCUA 4KZAA 3MZDA 3QNCA 3C7UA 3SMPA 2JC7A 3CCV3 2F4VM 4B3MM 2DWNA 3WWXA 4N1HA 3FV7A 2HDUA 3RFWA 4DR6M 3LXUX 1C1KA 3UDIA 1GL6A 2KW0A 4EBPA 5STDA 3EB8A 1LV7A 4X64M 3CF6E 1OJLA 1QZMA 2Z6BA 4JLFA 4OQGA 2OWPA 5HX9A 4P85A 5CHJA 3JR5A 2OQEC 2LH0A 3NQZA 4OOMA 1M40A 4EWFA 2KRUA 3NXJA 1NU3A 1K54C 2B5RA 3NM7A 1GY7A 3U60A 2L7IA 3M7GA 4LFAM 3EF8A 5E2EA 5E2HA 3N8SA 3KOXE 1ISKA 3VP2A 2IWDA 2XF3A 2CV0A 4GD6A 5EP4A 2F5NA 2VQEM 2JCHA 4ZJ3A 4B3TM 4AI6A 1EQKA 1ES5A 4MGYE 4QHCA 1I2WA 4HL4A 4ZAMA 3SOIA 3FG3A 4B3RM 2K0MA 4KQOA 4X2HA 1UI7A 2Q07A 2FXTA 2RGQA 1XA7A 4DDSA 3HIGA 3V3SA 2DWZB 4IBFA 3ZG5A 3S27A 4N6MA 1JJ22 5EQLA 2V6ZM 2C99A 4N6LA 3LVVA 1CEFA 5EP2A 3TQSA 1Q2PA 2UUCM 5CEDA 4JF6A 3DTMA 4MGIE 1TH2A 3MG3A 5EVIC 1XKZA 2BJVA 2WADA 2Y73A 3M8CA 3IF5A 4EBNA 4GB5A 4LGQA 3S67A 3VF1A 1N9EA 1K56D 1YMXA 2CHCA 2I72A 1EG9B 2A49A 1KDSA 5AYRB 2FFJA 4ZDXA 2ZBKB 1N5PA 3DOAA 4BB9A 4LZIA 3BFEA 1AV4A 3G30A 1E25A 4FSFA 3HUOA 3EBTA 1T3TA 4DR3M 1XMOM 1YLJA 4NETA 3EQVA 2RGHA 1ZX2A 4R3BA 5IEOA 1G59A 2WZXA 1S3SA 3SS5A 4DV0M 3KSPA 1TP6A 1O7EA 2EX9A 1NJGA 1E94E 1ZAEA 4DV2M 4LG2A 3ILKA 3WDGB 2C9OA 2UUBM 2Y55A 5DTKA 2LQVA 3VDPA 2W56B 3OCNA 3GAXA 4M9XA 3J7AS 3JUMA 4DKIA 4OVMA 1W6CA 1WYCA 2ZC4B 1YJ93 2ZQ9A 1FOFA 1YM1A 3UDXA 5CF2A 1BUEA 2ZM0A 5CGWA 2HMLB 4IVKA 4EC6A 4RX3A 3K63A 1L0DA 1QANA 3HLDA 2J8YA 1Q3BA 1RCJA 3IXDA 2EX2A 1J9MA 4R1GA 4FD8A 4HM6B 4D80A 2R4IA 1GLNA 4BTXA 3RXXA 1KDWA 5KMWA 5IERA 4E6XA 3MKIA 3MWZA 3N6IA 1WTHA 1SIHA 3WHKA 1EKMA 4JI8M 1FUWA 1MWUA 1XXHB 2W03A 1Z5AA 5CK6A 1NB5I 2XLJA 4RBNA 4X2OA 4NK3A 2H5SA 3M0EA 3FLJA 3FGYA 4GDNA 2V1CA 5AQAA 4IBBA 4D2OA 4MBKA 4KQRA 3HHXA 4ID4A 3RGRA 1ZG6A 4L78A 3PAGA 3D3LA 1GD4A 2KZUA 3RJUA 4JI3M 3PBNA 1VQ73 2XZFA 2GXFA 5CERA 4HEFA 2CKFB 5U47A 3FH1A 4EQIA 5ITUA 4XB5A 3DW0A 3FG1A 1ZG4A 2QMIA 1KGFA 4LGYA 3KFQC 2X49A 1DO2A 2O5RA 4GD8A 1L2DA 4R3JA 4BLCA 4YHHM 3M2KA 1O7NB 2YFJB 5GHXA 4XGIA 5KPRA 3AGEA 3PBQA 4BD0A 4DV1M 1Y4KA 2FNAA 1GKIA 1Z6TA 2VGJA 2HPBA 5LMUM 3HGIA 1U8CB 1STDA 3QK9A 1W5SA 3H4MA 4OX9M 2C11A 2CK3H 1XHBA 3KS4A 4PM5A 1S5AA 3V98A 2ZQDA 2HMJB 4PM8A 4HVNA 3UJMA 1WNHA 3LQRA 4OOLA 5FATA 2GU3A 5AIHA 1DJCA 1W5TA 3MXRA 1Q40A 3UE1A 2EFXA 3CCJ3 2L09A 3S28A 4G4QA 1K56A 3O8YA 1YSYA 5AEWB 3FKVA 1HNXM 1HKXA 5ELJA 1YIT3 4MEIA 5FASA 1ERMA 2WKHA 3LT8A 2IMJA 5GLCA 1IXRC 2CFKA 1FSWA 4X6TA 1NYYA 3ZVTA 1ALQA 4OVZB 3GRYA 5BPVA 4S2NA 4MBHA 3SBJA 2CW9A 4OKPA 1M1K4 4GITA 3B8LA 5EVLA 1W7CA 3SH8A 1SCWA 5IWAM 1KSIA 2L4VA 5HAIA 3EQQB 3N7WA 4OP5A 3BM6A 2O3OA 4WELA 4DV5M 4Y0OA 2QZ4A 2QEX3 3LH4A 3Q7VA 2CWUA 1OHSA 3VFFA 4GN2A 3FYCA 5CXWA 1R2YA 5DF8A 4PM6A 3FSDA 4MM3B 1K38A 1IY1A 3OWUA 4S2IA 4IBGA 3G2YA 4B7GA 5AIIA 4GB7A 1JTDA 3LTBA 4GKUA 3LOYA 1LHYA 4LF4M 1GL7A 2ZJ9A 2W82A 1PWGA 3QHYA 4LJ6A 1ONGA 5JI3E 4GKJM 5HFOA 2F5QA 2JA2A 2E5LM 3MG2A 3NY4A 1X37A 1CYVA 4ZTKA 1K6RA 3UN7A 4NSOB 2NQ8C 1HQCA 5ITRA 1IXSB 1KVLA 3UO9A 1NHGC 1A2VA 1K55A 3HJ8A 3LTAA 2IUKA 3UB1A 3Q2PA 1OHOA 3CC23 3ZG9B 1OHPA 4H61A 2WAEA 3DGNA 4LZZA 2EUCA 1DY6A 3BYDA 4G4NA 1YLTA 3X3YA 2WZZA 4IBXA 4GDBA 1H5XA 2YNMD 3NBJA 5GHZA 3GSGA 3STDA 2XK1A 1Z5BA 5EXSA 1Q814 2CE7A 1SHVA 3KZTA 4KHPM 1SKFA 3BECA 3PBTA 3OW22 3CG5A 2R65A 5AQ7A 1G4AE 1VQN3 4IBRA 4AW4A 3SVAA 2OV5A 2KRTA 4OPRA 1MWTA 3GLGB 4WYKB 4RF0A 4PDGA 1L1TA 4NXMM 4KZ9A 2C5RA 5DRVA 3CD63 2P0MA 2DZNB 2Y2NA 3NCKA 4QJGA 3AOEA 3NIAA 4E3IA 3MHEA 3HLWA 4K91A 2HDSA 2OLVA 3R8FA 3E9SA 5FQMA 1ZKJA 2C9CA 5FQJA 3WHLA 3GRDA 3UDFA 2UX0A 2JE5A 3KOWE 4G4OA 1TDHA 5KP4A 3FYDA 5HAQA 2RFRA 3V92A 3HK4A 2Y2PA 3VSKA 2Q2EB 4HJLB 3MBZA 1FNNA 5D83A 1YI23 5F3WA 5LC7A 2KEBA 3F14A 5BOHA 4Q53A 2BMRB 4FWDA 1C7HA 4X62M 2E2TA 1SPUA 2HMOB 5EUAA 5FW5A 2Y2QA 2EX6A 4GL6A 3HLGA 3HHWA 1NZUA 2I9WA 3NC8A 4R4RA 2CFDA 4M3KA 5I94A 4K0WA 3GQ4A 5HGRA 4O02B 5E43A 2F86B 1IK3A 5CF1A 4LMIA 1VQK3 2ZC6B 2QIYA 2CV1A 2W04A 1RJOA 1KVMA 4LSOA 1T5YA 3U6EA 1Z5CA 1IBKM 3NWLA 2W56A 5FQIA 3NBRA 3O3VA 2WOFA 3MKEA 4DR1M 3IQAA 5FSRA 4JPMA 1LL9A 1RGYA 2C10A 3O87A 4O8SA 1N77A 4FD2A 1K25A 1M904 4HM2B 3FTFA 4GRIA 2RCXA 4HM7B 3N8LA 1IN4A 5D82A 3KP0E 4QNMA 5EXPA 1IVVA 1RN7A 4QNRA 3EN8A 3CME3 5EQTA 1IQPA 3K8ZA 4XUZA 3WODG 1K3WA 4WYYA 2Y91A 3C58A 5IF6A 1JQJC 1DGHB 2VGKA 2BJWA 1XXMA 6STDA 3AMOA 2L7HA 3GLFB 4NXNM 2DZOB 1NZOA 4B3SM 2R18A 3EN1B 2W6JH 1N9BA 4EV2A 2OOVC 3EX9A 1H6UA 1D2NA 3SHFA 4AKIA 5FLXS 4FH4A 4KFDA 3RGAA 4N3VA 3HLFA 3OZHA 4QHSA 3WS1A 1PM5A 4G6ZA 2D7GA 1IELA 4K0XA 3FUUA 1S6RA 3PS8A 4ZJ1A 3A42A 4JI2M 3CCL3 2JBFA 1IV7A 2XH9A 3KDSE 1EI5A 2INXA 5IW9A 3L27A 3I51A 3GLHA 3IT9A 4S2OA 3NX0A 2LWXA 2XD5A 3LEZA 5TGFA 1E4DA 4NSRA 1K82A 3CZDA 2LNHC 4CHTB 5IG5A 5AYSC 3J2PB 3T8UA 3N8BA 3J27B 3X41A 4IJFA 1VQ53 3CCE3 1K4EA 3GRUA 4QY5A 3VOZA 4QOZC 1UUVB 1E9RA 3ZHHA 1JRQA 3EJVA 2OTL3 2C96A 5FI6A 2GEYA 4GOGA 3TDGA 2CEAA 3M6HA 3GRVA 4N6UA 3Q1CA 4WZ5C 1Q864 1YJW3 2CFOA 1CEGA 1IKGA 1HVBA 4E6WA 4RYEA 2CFLA 5A0OB 3GWRA 2EX8A 3A3DA 3B4PA 3HLEA 4EIWA 1OGXA 2CV2A 3GLIB 1WE4A 2Y21A 4I5SA 1ZO2A 4JI0M 4QD4A 3U61A 2ZC7A 1OFHA 1L5GB 4A3VB 2M60A 2EA0A 3M6AA 4AZFA 1I5QA 3W8KA 1NNUC 1N9JA 1XX2A 2VIIA 4DE2A 1PI5A 3EE1A 4G4RA 3JUNA 3ZG8B 1LNHA 3I563 2CFWA 3L29A 4WURA 1YLYA 3SFZA 1YLWA 3OPPA 3UK6A 3CXC2 3RXWA 4HBRA 2MC8A 1YJN3 1XGIA 2QGUA 3MPHA 4JI1M 1N5HA 1MOLA 4OQIA 1KQS2 1S0WA 2XR0A 3ZG0A 4B88A 3W0FA 4WFOA 1ORYB 3L2AA 3V39A 1L0GA 3GMWA 3SMSA 1TDGA 5ELUA 4S2LA 1KFVA 3VP0A 1FGMA 1IN5A 4JV5M 2P5TA 2OLUA 3U6MA 4LFCM 3T15A 5TGNA 1PW1A 2ZQCA 3ITAA 5FI2A 4WBGA 2UXCM 4YFMA 5HAPA 3NHXA 1K57A 1RGZA 4LJ8A 2XR8B 2WKIA 1VM1A 3G31A 5FAPA 2ZM8A 1DYUA 2J9PA 2F5PA 3FCSB 3OX9A 5HL1A 3NDGA 2ZLYA 2XFSA 4BL2A 2BMQB 2X71A 4YINA 3CPOA 4UAAA 1VQP3 3K92A 5C18A 1L8QA 5GLBA 3BNBA 1PI4A 3CF2A 1N8R4 3TL4X 3LMMA 1I2SA 3K0ZA 1K8A4 4O2HA 3SAUA 4K0KM 4WW0A 2DWLA 5GL9A 3HU2A 4IBEA 3G32A 4HLQA 1QVRA 4BJPA 1JKGA 2KZSA 4IIAA 4MB7A 4ITQA 3PXGA 1Q824 3GRRA 3Q90A 1JWVA 2Y2OA 5JYOA 4NOOB 3BOSA 4L0LA 4QOSA 1G96A 2WGVA 1W2B2 3OCLA 3GZBA 4P0MA 4K1UA 1M9GA 2X01A 5TFQA 3IWOA 1HD8A 3VFDA 2B1XB 4GMQA 3KSXA 5EP3A 5TR7A 1R4CA 3A46A 1E3VA 4LF9M 3SOAA 4GC5A 3DY5A 5JYPA 1BTLA 2R4EA 4S2KA 3CC43 2OTJ3 4UA9A 5JI2E 2WGQA 3IF6A 4S2MA 4WM9A 4KFEA 3GLGA 4OPQA 3LY3A 5A90A 2J7NA 2Z7AA 1J09A 4P16A 3LO7A 3WMDA 4NRVA 1DJAA 2BHMA 5G18A 2UU9M 2BNKA 3KVWA 4PMAA 1BULA 3Q81A 3HU1A 3GPXA 1YGEA 2H0TA 4JXVA 1OF5B 3EIEA 4E3JA 4E3NA 3CNXA 1DGBA 1VQQA 5EVID 2Z3XA 1SXJC 2KCDA 4X56A 2F99A 4Y0TA 3HHZA 4ZBEA 3G2ZA 3WA3A 2R62A 4DE0A 1NHWC 3SARA 5M1AA 4LRSA 1PW8A 4I4LA 4OVDA 4DR5M 1GA9A 4N6V0 4H8RA 3J7BA 4MEZA 3LTCA 1R6BX 1M1XB 3X40A 2H0YA 1LXEA 1STFI 2X4AA 3HREA 2K47A 3G34A 4RNAA 3GR2A 1L1ZA 4R9KA 1LI0A 1VQ83 1KD14 3V50A 4RX2A 2ZQ8A 1AXBA 2DCFA 1YUBA 1FCNA 5DNYA 4IBIA 3TPZA 1JB5A 2HKJA 4GKKM 2Y2GA 3BNCA 8CHOA 1HNWM 2UUAM 2SBLA 3I0YA 3U5ZA 3CPW2 2X02A 3FG4A 1NY0A 2ZAOA 4U0XA 1PZOA 4AG5A 3BRMA 4BLMA 1Q7Y4 4D81A 1QAKA 3MSOA 3JR4A 5FGOA 2ML5A 1XC8A 3L28A 3SEDA 5F83A 3F40A 3UMMA 2QBYA 5JBSA 4R1KA 4R80A 5GLDA 1QVG2 2WGWB 2XRXB 4FCMA 3JYIA 5IENA 2F5OA 4CDLA 1E3UD 2IWBA 2M7OA 1O7HB 3WRTA 4M0DA 1BT5A 2XSZD 3FWLA 4REZA 3UGJA 1ZQ9A 5IZ7D 3LCEA 3CMA3 3BNDA 4FMBA 3VSYA 3A76A 1KSFX 4HM1B 3MKFA 4KZ6A 4B7HA 4XM4A 5FTKA 3DM8A 1CI9A 5FTMA 1AVKA 4WEJA 2KA6B 2MF7A 4FCZA 3U6OA 4L16A 3UL5A 1W00A 3HJSA 3V3RA 3IHAA 1JV2B 4FMDA 4HM5B 1W8YA 2WGOA 3IXBA 1QAOA 1PIOA 3Q1FA 4S2JA 4JF8A 1R7RA 2ZQ7A 3IG8A 4UA6A 4F94A 4XUXA 2OQEA 4PDIA 3FUTA 3T1YM 2IUJA 1SDNA 1M6KA 8CATA 1IU7A 1K54A 3S4XA 3WA2X 2QENA 1ZC2A 3VP3A 3PCRA 2W0QA 3BLZA 1MNLA 1EA2A 3SX1A 3TOIA 4R9LA 2J7VA 5DYGA 4MMYB 4XBTA 2WGIA 3K7CA 3C7VA 3FUXA 3SHGB 3G713 4KZ7A 2CHGA 1CYUA 1NVMA 4NHFA 3P98A 4Z9QA 2GBXB 2Z76A 4FR9A 1IQXA 1MY8A 3OPLA 2Y2MA 5IG4A 3WS2A 4Z6YA 1JN5A 3ZGAB 3BFCA 3IXGA 2Y2JA 5D81A 4JYAM 3FUWA 3F7XA 1E3RA 2C6WB 3CCQ3 2DRWA 4KODA 5EVIA 4IT7A 4OQ0A 5DF9A 4OQHA 2HP5A 1YHQ3 5F82A 1TDZA 5CHMA 3U60B 2ZL8A 4DR4M 1G41A 2JDIH 4DE1A 4FCJA 3NV0A 2XZUA 2RCDA 1IEMA 4L4UA 2G2WA 4X55A 5CGSA 5CHUA 4OOYA 2R9WA 2E2UA 3S22A 3TSGA 2HP9A 2M5ZA 2GEXA 4JXWA 3I553 7STDA 1J2BA 3AV0A 1MKIA 2WK0A 4IIWA 3UJNA 1YMSA 4DR7M 3A3EA 3GVBA 2WUQA 5AIFA 1W7FA 4S12A 5CTMA 4EBGA 3TE6A 3NBLA 3E2KA 4LJ5A 5DTSA 3ECFA 1IYPA 1IV9A 3F8HA 4X53A 4LF8M 2WKEA 4N92A 2R46A 4KG2A 3LQQA 1JWZA 4JXGA 3GV9A 3BB9A 1R2ZA 4IPBA 4U3TA 1ASKA 1N34M 5FAQA 1IVWA 3G16A 2F5SA 4U13A 3GPUA 3HHYA 3B3XA 2CHVA 5KP1A 1A90A 5A92A 3HBRA 4A5RA 5CLKA 2BT3A 3L0RA 1WMNA 1TVFA 4JI5M 3Q8XA 3N54B 1QQWA 3Q82A 1QMFA 5BXQA 3NBIA 1O7MB 1VQ93 3AKZA 1W79A 3CC73 1DGGA 1E3UA 2P9VB 4JXJA 1ROVA 1FR1A 2XSZA 1ONHA 4AKGA 4HM8B 2V1UA 1NSFA 1KYIA 4OU7A 4HM4B 3ZC7B 2Y4AA 1NNJA 1HU9A 4IBDA 2ZM6M 5EEOA 2R4JA 3KFUG 5DYIA 2BMOB 1BSGA 2ZM2A 4C6YA 4DV3M 3KE7A 3PAEA 2XSOB 3DXOA 3PTEA 1DVCA 3UNWA 3MJ5A 1K57C 4Q8IA 3WS5A 3MZFA 2YFQA 4WP5A 3KOYE 1J7KA 3U6PA 2ZQAA 5EECA 4MJDA 4DRTA 3NI9A 3LYGA 4ZM8A 4WMCD 1NXYA 5CECA 3J81S 5JPUA 4KG5A 1NJI4 1NO3A 4LCMA 4BQMA 2UXDM 3U6QA 1RRLA 3SAWA 3IWIA 1MWRA 5LC6A 3NDEA 1XWIA 3ZNYA 2CC1A 3U6CA 3RGPA 2EXAA 1I4WA 1W4NA 1UW1A 1IYQA 5KQDA 2LYXA 3LT9A 5IHVA 4LF7M 2F98A 4FW9A 3VFHA 3VOYA 4B4ZA 1PZPA 1RRHA 4IBJA 4DXBA 5EXTA 1ES3A 3DFZA 3EBYA 4LZJA 1JB2A 2Y2KA 4CGYB 4LF6M 4FCWA 4MMXB 4KZBA 1VQ63 2Z2LB 2AHMA 3C5AA 4HZ9B 4EXRA 4OLGA 3SYLA 2Y20A 1FR6A 1SQWA 2GU1A 1LVNA 3G4PA 3GO8A 3FKEA 2E8IA 4MH0E 1NY6A 1VQL3 1W6GA 1XXHA 4R4SA 1D6UA 4LEHA 1N4OA 3WRZA 3IH8A 2OSUA 2G5GX 3PVSA 2H10A 5IEPA 3KN4A 2PBYA 1JB4A 4MMZB 4AQYM 1BLHA 4GHLA 4PCZA 5ITXA 4OK0A 5E2FA 5E2GA 1HT1E 1NB3I 4JI7M 5J8XA 3MYTA 1DVDA 3HWSA 1GA0A 3DA1A 3KW6A 2PU2A 3M2JA 5FA7A 2HL7A 3N9HA 4R0QA 1OFIA 5GLAA 3Q07A 1O7GB 4KZ1A 1HNZM 1Q40B 1WYBA 2OCTA 4X65M 4EBLA 1H8ZA 1IY0A 2RL3A 1TIJA 3BFFA 1N33M 3FTEA 4JI6M 1W6YA 1NRFA 1Z59A 1LOXA 2CG1A 5KSCA 5DREA 3VK8A 3JUQA 2CHQA 1FCMA 5D3OA 1SDEA 1S723 3BFGA 3PNYA 4CPKA 3M6BA 1L0EA 5IT9S 2DXIA 2ZD8A 3U6SA 3ZCZA 4R7GA 4R23A 4BL3A 5FSWA 3I4VA 3LZAA 1YIJ3 3RDEA 4OONA 1YE9A 3PZWA 3N8RA 3EIHA 3FZWA 1NYMA 3IPTA 3FKAA 1VQO3 3Q7VB 5GHYA 4OLDA 2V1LA 3JAMS 1D6ZA 2RSXA 2DHRA 3G4S3 4TUWA 3DGLA 1HR0M 3SS3A 3THGA 3PYJA 3SH9A 3ALAA 3MK6A 3UPOA 3ISGA 1GYBA 3T38A 3LTDA 2HMKB 5ITQA 1QVF2 3T8NA 4EYCA 3IG5A 4P6BA 3G35A 4WEKA 4WMCA 1OUNA 5ITXE 2EFUA 2YFIB 5LMNM 4OVZA 1NY5A 2Z4SA 3HJQA 1O7PB 1UM8A 4N6TA 1E9SA 1W2ZA 3VGNA 3WS4A 4BD1A 3S1YA 3W0LB 4L7KA 1CEWI 3TWMA 1HQYE 3MXSA 1YLZA 4FMCA 3B4OA 3QAUA 1N8QA 1JWPA 4MBFA 1F8NA 4ORLA 3J7Yd 5FQQA 4L15A 4N1XA 4X66M 1Q42A 1IVUA 4HKVB 4LJ9A 3K1JA 1IBLM 4FVMA 3DWKA 5IG3A 1E32A 4B7FA 2PZVA 2J7OA 4AKZA 3SS4A 2B24B 3HKPA 5KQ8A 3SATA 1PWCA 5AQ9A 3RE8A 5A2QS 1LI9A 5AQBA 5HW3A 1K6SA 4DV7M 3MFDA 2XD1A 2BNGA 1BLSA 1G8PA 4BENA 7CATA 4MGHA 4S2NC 5KZHA 4LFBM 1SXJB 2EO2A 4KO8A 3O86A 2XLNA 1DMQA 4PT5A 1K9M4 4GNUA 1FGTA 2YX9A 4ZJ2A 5EE8A 3OC2A 3ROBA 2L6OA 1W8QA 4KZ8A 3D8BA 3QRDA 1IN6A 5DVAA 5ITTA 4KENB 4NL4H 4K1VA 5KO3A 3ZG7B 4JRFA 2E2VA 4Y7PA 4OUQA 1XGJA 4OPZA 3SC3A 4HBUA 2V2FF 1RKYA 4HZBB 4I81A 2A15A 3DWZA 3S5CA 2J9OA 3OXAA 1KE0A 1G6AA 4HM0B 2FOIC 4LV0A 1K3XA 1TDLA 1OH0A 1FJGM 3L26A 2ERCA 1FSYA 3O88A 5FQKA 4HESA 3UPPA 3U97A 2FE8A 3LVWA 4WYKA 1IT8A 1K55C 2XEPA 1AR0A 3ER7A 2YQZA 3OPHA 1US1A 3EC9A 2Z7JA 1ES2A 4EV4A 3GRJA 1IM2A 1QYRA 1L2SA 2Z4RA 4UHUA 2P9VA 2R9XA 4HBTA 5FI7A 2DNSA 4G1MB 3K2LA 2IWCA 3T1HM 2QZ6A 4LJ4A 3H51A 5EXXA 1W02A 3KSJA 3RGSA 3WOEB 3U1WA 1RP5A 4AKYA 1U5OA 2FFFB 4AKHA 2Y2HA 4RNYA 5KPTA 2OOVA 1LL5A 5KP3A 3UY6A 5A93A 1PYYA 4FCFA 4QU3A 3FD9A 4LV2A 3A3IA 4R3DA 3SH7A 2PNCA 4OH0A 3BLSA 4R4KA 1KWIA 3W4PA 2UXBM 2K54A 3OV4A 2XGNA 5BVBA 3FTCA 3GZXB 3D8LA 1GY5A 3U6DA 2XQZA 1XMQM 2JQ5A 3AOEC 2Y59A 3Q7ZA 4FCTA 4II7A 2W2CA 1TH3A