2XGNA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 137
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xgnA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xgnA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xgnA02
3DW0A 5HAIA 1Q2PA 1BLCA 1K4FA 4E6XA 2IWDA 1XGIA 1PYYA 5CHUA 4N1XA 1FSWA 1KDSA 1YQSA 4IVKA 5TGFA 4KG6A 1PWCA 4IEDA 5CGXA 5F83A 4UA6A 4GNUA 4D2OA 1BULA 2HDQA 2OLVA 3Q07A 2ZC4B 4R1GA 1I2SA 4MBKA 4QY5A 3W4QA 3VP2A 2B5RA 4DE0A 1XA7A 5EVIC 1C3BA 3OZHA 4RX2A 3HUNA 4S2MA 1BT5A 5FSRA 2HP5A 3DTMA 4OQ0A 4R3JA 1FCOA 1IYSA 3ZCZA 1KE0A 3IQAA 5GLBA 3G31A 4XUXA 5F1GA 2RL3A 3IWQA 5FAOA 3SS3A 1H5XA 5DF8A 4BD1A 4DXCA 3M2KA 1HVBA 4QJGA 1XPBA 1RGYA 3DWKA 4UAAA 4UA9A 2ZQAA 1JTDA 1L0EA 3VP4A 1ZG6A 4BLMA 1LHYA 1ZC2A 3Q1FA 3G2YA 2XD1A 4PMAA 2JC7A 4EBPA 2J7VA 5M1AA 4GN2A 4LV1A 5G18A 5CGSA 5E2GA 1H8YA 2WZXA 4OOLA 2BG1A 2XFSA 1FQGA 4BD0A 1MKIA 1CI8A 3A3IA 3HL9A 2EXBA 1HD8A 5AQ7A 4JF6A 3VOYA 5EVIB 1ESUA 2DCFA 2FFYA 3QNCA 5HX9A 2X02A 4FH2A 4JKTA 3ZHHA 2G2WA 5FASA 2Y2LA 3VSLA 2OLUA 4JXGA 5FQJA 2WYXA 5CTNA 2IWBA 3IXDA 1K57A 1ERMA 3BECA 5I94A 4BL3A 1E3UD 2PU4A 3OPPA 4KQRA 4PM7A 4ZJ1A 4IVIA 4PM8A 1NXYA 3SS4A 4E3KA 4KG2A 3IF5A 1EWZA 4QY6A 3N8LA 2H5SA 3IF6A 1IYQA 2XH9A 1ZG4A 1PWGA 1Z6FA 2EX2A 3OCNA 4EWFA 4X55A 3A3EA 4KENB 1IKIA 4R0QA 4WELA 1PI5A 1S0WA 4KZ3A 5AQBA 4MNRA 3ITBA 4E3IA 4U3TA 4P0MA 4BL2A 1GCEA 1ALQA 1BUEA 3ZG9B 4S2KA 4NETA 1YMSA 1ONGA 2Y2NA 2RCXA 4JLFA 2QPNA 1LI9A 1YLJA 4EBNA 1N4OA 1NYYA 4PM5A 3MZEA 5FQKA 1M6KA 3C4OA 4KZ4A 1KVLA 4DF6A 1YT4A 1Y54A 2CC1A 4HEFA 5FQMA 5CERA 4WZ5A 4ID4A 1SDEA 3HUMA 1BLSA 2XD5A 4JF5A 4WZ4A 3ZG8B 5HAQA 4P87A 5F1FA 3P09A 2P9VA 5FA7A 1FSYA 1VM1A 3HUOA 4B88A 1KVMA 1BLHA 2XDMA 2ZQCA 1PW1A 4FH4A 5IHVA 1LL5A 3OPRA 4L0LA 1M40A 3VP3A 3FKVA 3GRJA 5KSHA 1XGJA 4GOGA 2ZQDA 4R4RA 5A92A 4IBRA 3W8KA 1TEMA 3MKEA 4GKUA 1LL9A 3SH9A 4LV0A 4RA7A 2P74A 3AGEA 2A49A 5DVAA 3Q82A 1N9BA 5KMWA 2EX6A 4OPZA 4S2NA 3GVBA 4WMCA 4E3OA 5J8XA 2XGNA 2GDNA 3TOIA 1BLPA 1K57C 2DRWA 4HESA 4IBXA 4ZTKA 4EQIA 3ITAA 3ZNYA 4GDNA 4LCMA 3BYDA 2ZC7A 1MWSA 5FDHA 4EV4A 4LV2A 4N9LA 2Y2GA 3NC8A 4KQQA 3DWZA 5DTSA 1XXMA 3IF6C 3JYIA 4LV3A 3LO7A 3CZDA 1K56A 3VFHA 4LENA 1ONHA 4E3LA 1DY6A 4OQGA 4GD8A 3Q7VB 1K6RA 1PZPA 1IELA 3ZG0A 2R9XA 4OPQA 4S2JA 3SS5A 4B4ZA 3ZVWA 2ZJ9A 3UE1A 2ZC5B 3MFDA 5FI6A 3S4XA 1GHMA 3FKWA 3ZG5A 5CRFA 3EQVA 3MZDA 3ZNTA 5KSCA 2Z2MB 1NYMA 4R4SA 5U47A 2WGVA 1KGFA 5FQQA 5JYOA 2FFFB 1CI9A 3C5AA 2XF3A 4X56A 3UO9A 3O88A 4X69A 4WZ5C 2WK0A 3NDGA 1YLTA 3UY6A 3V39A 1CK3A 3HLEA 5DTTA 2EXAA 3FWLA 3PTEA 2WAEA 1DJCA 2ZC6B 3D4FA 3P98A 4FD8A 1CEGA 5HW3A 1KE4A 3Q7VA 4P6BA 4LCLA 1FCNA 4DE1A 1ES3A 4U0XA 5E2HA 1MY8A 2X01A 4QB8A 3VFFA 3N6IA 4JPMA 3TG9A 4DDYA 3W4PA 1DJAA 3IXBA 3C7VA 1GA9A 1KGGA 5EOEA 3IF6B 4X68A 2EX8A 1YLWA 4ZJ2A 2ZQ7A 3HBRA 4RVAA 5GLDA 2HPBA 3V3SA 2J8YA 2Q9NA 1TDGA 1NZOA 4S2NC 1OMEA 3Q81A 3MZFA 5EVID 4JXVA 4HBTA 3OPLA 1ES5A 1AXBA 4OPYA 3M6HA 4YFMA 3M2JA 5FI7A 5A91A 2G2UA 1ES2A 2WAFA 4MEZA 4PM6A 1KE3A 1MWTA 1O7EA 3GQZA 4JXSA 1E4DA 3MXSA 3BLMA 4QU3A 2Y2MA 3IH8A 5CEDA 3NI9A 5KZHA 2XR0A 5DF7A 4C6YA 1YMXA 2EFXA 1S6RA 4N1HA 2QMIA 3HLGA 3PBSA 3VP1A 1LLBA 2Y2HA 4Y0OA 4K0WA 4Y0TA 1BSGA 4OPRA 2XK1A 2J9PA 2P9VB 3N8RA 4KG5A 4EUZA 5M18A 4DRTA 4K91A 3G2ZA 2C5WB 2Y55A 5EE8A 3TSGA 2OSUA 3UN7A 4P85A 4K0XA 1SCWA 1G6AA 1WYBA 4Z9QA 1K55A 3HREA 3ZFZA 1YM1A 5AQ9A 2Y2PA 1PZOA 3M6BA 3PBRA 2Y2QA 1XX2A 1HTZA 4HBUA 5CTMA 5GLAA 3BFFA 1PI4A 2E8IA 3OPHA 4WEJA 2Y4AA 4S2IA 1KDWA 5CECA 3UPNA 3LY3A 5CGWA 4BQMA 1YLPA 3RXXA 3BFDA 3G30A 3MXRA 3QNBA 4E3JA 1TDLA 1L2SA 2DNSA 1MBLA 1RP5A 3AGFA 4Y7PA 3GTCA 1EROA 2V1ZA 3NIAA 3WS2A 3ZVTA 5E2FA 3UE0A 3Q7ZA 4N9KA 1JWPA 4MBFA 4XUZA 4ZDXA 5DF9A 4OQHA 3IXHA 4GDBA 1MXOA 4UA7A 1E3UA 1JWZA 1K25A 5E2EA 3HLCA 4E6WA 4JF4A 1JVJA 5HFOA 1VQQA 4CJNA 1DJBA 1IEMA 4OVDA 1YLYA 1W79A 4S2LA 2WKHA 5FQIA 2WGIA 3NCKA 1MWUA 3N7WA 2HDRA 1G68A 4OLDA 4YINA 1NJ4A 2A3UA 4B4XA 4BENA 5A90A 3SH8A 4C75A 3BLSA 3O87A 4KZ8A 1FR6A 2BLSA 2Y59A 2H0YA 3VSKA 5D3OA 1K54A 5HL1A 4OLGA 1RCJA 2Y91A 3A3FA 5EECA 1I2WA 2EFUA 2XEPA 2ZD8A 4MBHA 3WRZA 2HP6A 3C7UA 1E25A 2WKEA 2J9OA 2ZM2A 2ZMAA 2H0TA 4H8RA 2Q9MA 3BM6A 5F82A 1L0GA 4WBGA 2H10A 4KZAA 2IWCA 1SDNA 3UDXA 2VGKA 1KGEA 1Q2QA 3N4IA 4NK3A 1GA0A 1ESIA 1K55C 4ZBEA 3RJUA 5AQAA 4JXWA 3HLBA 2EX9A 4BJPA 1PW8A 1W7FA 3EQUA 5JYPA 3WS1A 3UNWA 3LEZA 3V3RA 5GLCA 3IXGA 5E43A 1GHIA 4RYEA 5GHZA 5FAPA 1K38A 1PWDA 4GB7A 3IWIA 5CHMA 3FYZA 3CG5A 2Y2KA 4N92A 4UHUA 5CEBA 2R9WA 3IWOA 2Y2IA 4OONA 3N8SA 1MWRA 1BZAA 4XXRA 3ZGAB 5FAQA 1FR1A 3C4PA 1XKZA 1JWVA 3G35A 2ZC3B 2XFTA 1K4EA 1YLZA 3OCLA 3PBTA 3CJMA 2C6WB 4QD4A 2UWXA 4GZBA 4PM9A 2ZLYA 4OKPA 3VOZA 1MPLA 5EPHA 4WM9A 3VMAA 3UPOA 2JE5A 1I5QA 3G34A 3QHYA 3UE3A 1ERQA 3I7JA 4OQIA 3WWXA 3NDEA 4E3NA 3SOIA 3UDIA 4MLLA 1IKGA 2WUQA 4FSFA 1HZOA 4KZ7A 1SKFA 4WEKA 4KZ5A 4KZ9A 1LI0A 5L2FA 5EVLA 4Q8IA 3A3DA 3FZCA 4A5RA 4JBFA 1IYOA 1K54C 3HLFA 1TVFA 3ISGA 3UDFA 3CMZA 3HLDA 1K6SA 1GHPA 4KQOA 1W8YA 5TR7A 1BTLA 2HDUA 5CHJA 3BRMA 5DTKA 2HDSA 4WYYA 5TFQA 3G4PA 4ZJ3A 2WKIA 1XP4A 2VGJA 1ZKJA 2ZQ8A 3LCEA 1J9MA 3BFGA 5BOHA 3AGDA 3BFCA 2V2FF 5EUAA 2Y2JA 3RXWA 4E3MA 2Z2LB 2XLNA 3HLWA 3MBZA 3PBNA 3BFEA 2XQZA 3FV7A 3PAEA 4C3QA 3GSGA 4DE2A 1WE4A 3ZG7B 4OP8A 1W5DA 2JCHA 3PBOA 1FCMA 1L0FA 1L0DA 1XA1A 3S1YA 1JTGA 2I72A 2QZ6A 1EI5A 4EBLA 5A93A 3IHBA 5GL9A 4ZAMA 3B3XA 4CPKA 3GV9A 3G32A 5GHYA 3IT9A 1PIOA 4O7DA 2WGWB 1FOFA 4OP5A 5EVIA 4FCFA 3ZDJA 1ES4A 3O86A 4R3BA 4WMCD 5HAPA 2PBYA 2HP9A 4DKIA 4R23A 4KZ6A 2WZZA 3GMWA 3HVFA 3SH7A 2Y2OA 3VP0A 5HARA 2WADA 5CXWA 2V20A 3OC2A 1CEFA 5GHXA 3V5MA 3E2LA 3UPPA 5EOOA 4DE3A 2X71A 5FQ9A 1K56D 4OOYA 4F94A 3S22A 4M3KA 3W4OA 4DDSA 1SHVA 4X53A 2ZM0A 4Y0UA 1U60A 3MKFA 3PAGA 3BEBA 2PU2A 1O07A 3LY4A 4S2PA 3E2KA 4OH0A 4QHCA 1W8QA 2WGWA 3NY4A 2JBFA 5FATA 1NRFA 3WRTA 4OOMA 1IYPA 1QMFA 1WYCA 4RX3A 5M19A 5FI2A 3IH9A 2OV5A 4S2OA 3GR2A 1NZUA 3A3JA 4KZBA 3WS0A 2ZM8A 3V50A 3IHAA 3WS5A 1NY0A 1RGZA 4PPRA 3PBQA 3WS4A 1QMEA 3NBLA 2ZQ9A 4GD6A 3O3VA 1H8ZA 4X6TA 4DXBA 4U0TA
chains in the Genus database with same CATH superfamily
1JZDA 3VV4A 2W2CA 2WSCF 1N9LA 2BNKA 1ZAEA 3HU3A 4HM0B 1G0TA 1YQSA 5IG4A 1PWCA 2QEX3 1XB2B 4GC5A 2Y0TA 5HOHA 4GNUA 1BULA 2HDQA 1KSFX 2ZC4B 2DAIA 1GY5A 4R7GA 2VEAA 4MBKA 2F98A 3VP2A 4DE0A 1XA7A 1IN7A 3AOEA 4QWOA 4RX2A 1NVMA 3A45A 1WNHA 3HUNA 5TBMA 4S2MA 1BT5A 3IG8A 2ZDJA 4OQ0A 1FCOA 1Q39A 1U5OA 3IS2B 1FGQA 3ZCZA 3A0VA 1OIPA 4F1IA 3C58A 4IPBA 3EB8A 2SBLA 3FTCA 1R2YA 3G6OA 1W5TA 4CLCC 4BD1A 2A2LA 1HVBA 1IN8A 4HYZA 4I39A 1E9SA 1PFPA 4UAAA 2LVPC 4DN0A 5F6AA 1JTDA 5G1LA 3HJ8A 1VQN3 3VP4A 4OVZB 5IT5A 1LSVA 1HU9A 1LHYA 3Q1FA 1VQ73 1PM5A 4G4RA 3UE6A 2J7VA 5M1AA 4LJ6A 3EX9A 4FTXA 5AVEA 3ZQ5A 4BTYA 5CGSA 2WZXA 3B4PA 4HOIA 2BG1A 3GLIE 2XFSA 2V6ZM 1A2VA 2WZJA 3J2PB 1QQWA 1MKIA 3EN1B 3S27A 5EXPA 2EXBA 1HD8A 2LVNC 2M7OA 2VDBB 4PCZA 4ITQA 3RFBA 1ESUA 3FUUA 3QNCA 5HX9A 3LYGA 1KYIA 4FH2A 4JKTA 1VETB 2FXTA 2G2WA 5FASA 3VSLA 2CV1A 2NUTC 4JXJA 1XXHE 3E9SA 1ZS7A 4IUKA 5CTNA 5F5YA 3GECA 3LIDA 5KP1A 4CLCB 1FGOA 1E3UD 3OPPA 4R6LA 1XFNA 5DKKA 5AIHA 1FUWA 4KG2A 4QOZC 2DWNA 1EWZA 4QY6A 4JGOA 1IYQA 2XH9A 4EC6A 3LMMA 4IBFA 4WYKB 4L8RC 1OQYA 4KQQA 3IMAB 1JBSA 5A8BA 3HWSA 1B21A 1E32A 2QBYB 4HZBB 8CHOA 3MJ5A 3GZXB 2RSXA 3T1HM 2VF8A 3SBJA 1YMSA 4J8TA 2IA7A 4EYCA 2RFRA 4L16A 1GOUA 1YLJA 3NQYA 2K0MA 3C8CA 3K92A 3HI7A 2AAEA 3JUOA 4F3LB 2LXEA 1Q42A 2ZOIA 4KZ4A 4GCZA 1GJTA 2OQ4A 1YT4A 3NBBA 5CERA 2HCBA 4WZ4A 2XD5A 2KXEA 1YJW3 4KQDA 3ZG8B 5HAQA 5FL3A 5FA7A 1G59A 1CF0A 1FSYA 5C5KA 4JI2M 3HJQA 3LGOA 4R71A 1T2HA 3A42A 1KVMA 1BLHA 3GRVA 3S7PA 3OPRA 5FSWA 4L0LA 3X3ZA 4FWDA 4G1MB 4FCWA 4MGIE 2VV6A 3L27A 3CF2A 3MKEA 2Y79A 5DJTA 1BVSA 3W0FA 1SJWA 4GKUA 1LL9A 3BY8A 4LRXC 1US1A 2P74A 3SH9A 3AGEA 1J3WA 2CFGA 4LEHA 3SMPA 1N9BA 5HGRA 5KMWA 1C1KA 2PT7A 4WMCA 3RNTA 3IECA 1UCLA 2GDNA 4HESA 4ZTKA 4M9SA 2VV7A 3L7HA 1OGZA 3ITAA 1ZMVA 5EFWA 2F5OA 1MWSA 1BYWA 2VA0A 3JUNA 3SYLA 3T12B 3GLHE 3K63A 3ER7A 4H61A 1TF0B 1XXMA 2J3TD 3IF6C 1D6UA 1GMPA 2WSEF 4LV3A 2O25A 1T3TA 1AQZA 2HMMB 2V1CA 1V34A 3C30A 2K0BX 4GD8A 1L1TA 2H1RA 3OBFA 1PZPA 3ZG0A 1VQ53 2R9XA 3PR6A 3QP6A 4OPQA 4HJLB 1YIT3 4FMDA 3MFDA 5DFXA 3CNMA 3OXAA 3E21A 3GLIB 3E4OA 3FKWA 5F69A 1UWNX 3PYPA 2XLJA 4XBYA 1N5PA 1AVLA 4R4SA 2QGUA 3CITA 2JHEA 4CHTB 1X1YA 2CKFB 3UO9A 3DGLA 2DI0A 1YSYA 3QP4A 4NEED 5DRVA 3NDGA 2W1RA 3FG8A 5BPVA 2L4EA 5LC6A 1XXHB 3FWLA 4LF7M 2D1WA 3D4FA 3PTEA 4FD8A 2PBDP 3IBRA 3FPVA 4LCLA 1I3FA 1DVCA 2JY6B 4U0XA 3N6IA 3KE7A 1Q3CA 2XRNA 2VZWA 3TG9A 2JQ5A 3AHWA 1ASKA 1DJAA 1GA9A 3G4S3 3IF6B 1RN1A 3HHXA 1YLWA 3LFVA 2FE8A 3FRIA 3I553 4RVAA 5AYSC 1GLNA 2J8YA 1GABA 3V98A 2Q9NA 4HHDA 1TDGA 4QOSA 2CIUA 1OMEA 5HPFA 4JXVA 4CISA 1MC0A 4HBTA 3OPLA 2Q2EB 1ES5A 5MC7A 4AKZA 4I4LA 3M0EA 4OUQA 4AKYA 2OOVC 3M2JA 4YFMA 2JZ0A 1OACA 1VZZA 2WAFA 4MEZA 1O7EA 4JXSA 3MXSA 4R1KA 1IT7A 1BRJA 2D01A 3H7WA 3IH8A 4G3KA 4EV5A 1YJ93 5DF7A 2OCTA 3PXPA 2VK3A 1JZOA 4CLCD 3PBSA 4LRTA 3E4QA 1OFHA 4I5QA 2CEAA 1D06A 4DRTA 4K91A 3G2ZA 3DY5A 2PAVP 2G8LA 3FLJA 5EE8A 1MJGM 2LYXA 2Y55A 3F1PB 1Q40B 2CG1A 4K0XA 1JR3D 3K2NA 3HREA 3ZFZA 1YM1A 1V9ZA 2J8XB 3TQSA 2O9UX 2Y2PA 3STDA 3M6BA 4JGRA 1UW1A 4EEUA 5GLAA 4L6V6 1MNLA 4WEJA 2E8IA 1Z1SA 3UMMA 3ALAA 4X55A 3LY3A 5RNTA 3CUEA 1CH0A 3LR3A 4E3JA 2GJ3A 2K7SA 4B7GA 1TDLA 5ITYA 1QAOA 1IXSB 1BSEA 3NBIA 1L2SA 3F1OB 4P6ZM 2UX0A 1MBLA 3EOIA 2W6JH 5ITTA 3FUVA 3IX4A 4NKPA 4Y7PA 2QENA 3T4KA 1QZMA 3NIAA 2SARA 2IY2A 1OGXA 3GSPA 1GSWA 3U61B 2E2TA 3Q7ZA 1IQXA 3B47A 4XUZA 4TX4A 3GLHB 3TE6A 1FIKA 1MXOA 3WR2A 3RH8B 4UA7A 5A2QS 1JWZA 1BNFA 1SKOB 4HQAA 4E6WA 4U13A 4AQYM 5HFOA 3DM8A 4HEOA 2QSFX 1YLYA 3LR5A 3F9SA 4G3VA 1B2MA 3CPTA 4MN6A 5AEUB 1R2ZA 4L8PA 3N7WA 4B4XA 2ZL1A 1Z5CA 3RGSA 4YY3M 1N5HA 3SH8A 1XWIA 4C75A 3O87A 4XT2A 1YIJ3 1M1K4 3MHVC 1YSQA 2PR5A 1ULJB 1BRGA 3VSKA 4DR5M 4HZ9B 4QWTA 1K54A 4KLNA 3L26A 4HJ4A 4OLGA 3T0UA 4EBGA 2Y91A 1IBLM 5IREB 1IBMM 3A3FA 2UXBM 2HJ9C 5AVFA 3H82B 2XEPA 2ZD8A 3GLHA 3BNEA 4BB9A 2OAQ1 3H4JA 5EJCA 3C7UA 4HP9A 1KOUA 3R7WB 1HZ1A 1VG5A 1Q9EA 3FG4A 5BU4A 2ZM2A 2ZMAA 3UMDA 3Q8GA 3IPTA 3SYUA 2H10A 4KFFA 4ETZA 2WKRA 3BW6A 3I01M 3RJUA 1Q2QA 1ESIA 3T1SA 2PYRA 1V9YA 2DKLA 3NULA 2EX9A 3LQRA 3HJKA 1DRMA 1VQ63 4IBBA 3UB9A 2XA7M 3T6PA 1J09A 5KPTA 3QP8A 1TDZA 1W4NA 1VEJA 5GLCA 1OHPA 3IXGA 5A0OB 1GHIA 3C9PA 3DZDA 4HI4A 1P9WA 1Q864 5FAPA 4JI6M 1B2XA 4RF0A 1K38A 3KO6A 1K28A 3G0KA 5CHMA 4STDA 1GJSA 1E3RA 4UHUA 2Y2KA 1UGUA 5CEBA 2W0QA 3CCV3 3MSOA 4OONA 2F99A 4GL6A 5D82A 3DTKA 1NJFA 1HNZM 2FNQA 1XKZA 4OK0A 3VOLA 3MG3A 2ZC3B 2XFTA 3BXWA 3LIBA 2XROA 1EIJA 4UQIS 3WHOA 3BOSA 2ZLYA 4OKPA 1BRHA 1ZMWA 1MPLA 3N9HA 1DGHB 3VMAA 3KXEC 1Z5BA 3G34A 3QHYA 2N35A 1S3SA 4OQIA 4NHFA 5EVEA 2M60A 1MGRA 5FW5A 3FSDA 2WOHA 4GC9A 1DGFA 2KRTA 4N6TA 4I5SA 3FC7A 4KZ5A 4KZ9A 4OX9M 2QZ4A 2NQ8C 3HY5A 5EVLA 4DV5M 5J4EA 5GKNA 3BIRA 2DZLA 4LJAA 1IYOA 3HLFA 2VQFM 3ISGA 3J7AS 2KF5A 1GHPA 1K6SA 3LTAA 1MN3A 5TR7A 1HT1E 1FJGM 1BTLA 1BUJA 5DTKA 1T5YA 1G5UA 4DV6M 3K9MC 2OO9A 4DR6M 2E5LM 1DGHA 3NXJA 4ZJ3A 1XP4A 1GSXA 2O99A 2XZFA 1F2KA 1WHCA 3VE4A 1S5AA 4Q0HA 4XBOA 1XNQM 2KRKA 1OF5A 3FH1A 3G6E3 1VHMA 4NSRA 8RNTA 2PYPA 3IX8A 3KSJA 1LRAA 4WF0A 4E3MA 1OTBA 2OQEC 3MWZA 2I9VA 3H9WA 3HLWA 3MBZA 3PBNA 3PAEA 2KHHA 2EA9A 1TTOA 3J27B 1WE4A 1FNNA 3KS4A 3QP1A 1BRKA 4LF9M 3EIEA 3BU4A 1CJFA 1L0FA 1XA1A 2PR6A 1QAKA 4HM8B 5GL9A 3PXGA 4KUKA 3U60A 3LR0A 1P9RA 4BMWA 2C98A 4DBGB 3IT9A 3ZDJA 2WGWB 4OP5A 4FCFA 3DFZA 3T8UA 1W5ZA 1ES4A 4R3BA 1QAMA 4R23A 2WZZA 1WMPA 3HVFA 4HM7B 4LRZE 1BUQA 1T6OA 4G4OA 5HARA 3UB1A 2A24B 3B7QA 4PDGA 4DR7M 1I4WA 1PGYA 3THGA 2GBXB 2F5QA 2I7PA 2UUCM 3U6DA 4M3KA 5L07A 2B24B 3CU3A 3KOXE 2ZBBA 2ZM0A 2X8AA 4Y0UA 2BT3A 1N9OA 3BEBA 2PU2A 1GSPA 4AG5A 4S2PA 1K41A 3E2KA 1NB5I 1W8QA 2WGWA 4ZPXA 3F92A 2VGLS 2WKQA 3NY4A 4H6JA 1X0OA 1VB6A 3WRTA 4DR1M 4NXNM 4MN5A 5M19A 4IBDA 2YQZA 1W6GA 1B27A 3IH9A 2OV5A 2GSPA 1IN4A 2ZM6M 1CYUA 1NZUA 4KT3B 4KZBA 4GEWA 3WS5A 4PD2A 2A24A 3O5YA 1CYVA 4EUVA 3I4YA 4ZRRA 1DGGA 4BLCA 3DTIA 4PPRA 3WS4A 1QMEA 1LT0A 1ZHHB 2W0NA 1QDTA 1WJ7A 3O3VA 2DZNB 2FOIC 2YFJB 1NHGC 1JKGA 3UNLA 1Q2PA 2ML5A 4PKYA 2IWDA 2ZMFA 1FSWA 4IVKA 4CQHA 4UN2B 3R8FA 4IBKA 3EGDC 2VJWA 1I2SA 3EWKA 2FNAA 1RGFA 1TUHA 3JVUA 2BNGA 3OW22 2GEXA 3D79A 1QMAA 1O7HB 1C3BA 2CHVA 1BNIA 1FUTA 1W01A 5J7EA 4L15A 1AV4A 1NDOB 4PT5A 2HP5A 4WL9A 1OKSA 1N33M 3KDSE 1XHBA 1KE0A 2L7IA 3B42A 3TW8A 1TR8A 3I563 5E6JA 2P09A 3IWQA 3UJMA 1CQSA 5FAOA 1BRSA 1DMQA 1BU4A 1H5XA 3PHYA 5DF8A 3M2KA 1IXRC 4QJGA 1XPBA 1RGYA 3KCHA 3OWUA 4LZIA 1RNTA 1ZC2A 3NJAA 1PRQA 3G2YA 2BWEA 3UL6A 1N9NA 4DJ2A 1MZUA 1LOYA 2ERCA 3V76A 2JC7A 2OAP1 4EXRA 4B93A 2CFDA 1FILA 2WSFF 1RDSA 3D4AA 1N75A 1FQGA 3O8YA 4BD0A 4O02B 4ARZA 1CI8A 3SW1A 2RCDA 3A3IA 2FH5A 3LIFA 2ACGA 5HD3A 7CATA 1RN7A 2R4IA 1BNEA 1RCKA 4JF6A 3VOYA 4M9XA 3B7ZA 1W5SA 4DV0M 3UB5P 4LGMA 3T1YM 1FZUA 5D83A 3ZHHA 2G3QA 3K3CA 3LH4A 2OTL3 1NLZA 1TD5A 2J7OA 1T1AA 4N6LA 4Q0IA 1E97A 2OLUA 2CV2A 1JN5B 5ITUA 5FQJA 3DGYA 1G6OA 2PRFA 1K57A 1ERMA 4AFIA 2A5YB 1E9RA 1N9EA 2LB5A 2F4YA 4BL3A 5LC7A 1KQS2 4IVIA 1XMOM 5E26A 4B7FA 1CEWI 1UCIA 4GB5A 1NXYA 4E3KA 3DGOA 3AOEC 3BNDA 1ULIB 1ZG4A 1FUSA 3E4PA 2Y20A 4EWFA 4JI3M 3QK9A 4R0QA 4G4QA 1IV7A 5HWTA 5AQBA 1IFYA 2YFIB 1VQ43 1TS0A 4NREA 3IBJA 4MNRA 3T4TA 1YGWA 4E3IA 1ZX2A 1LXEA 4BL2A 4ESPA 1ZMUA 3ZG9B 4JYAM 2KRUA 3WHKA 1Z09A 1ONGA 2JN7A 1IOUA 4X66M 1V58A 2GU1A 3U6SA 1U8CB 3LI8A 4KHPM 1N4OA 3F1NB 1AVKA 1Z6TA 4YHHM 4IIAA 5FQKA 3C4OA 4HOHA 5IG3A 4IJGA 3MG2A 1Y54A 2CC1A 1PJTA 1BLSA 4HH3A 4JF5A 3HU2A 1L8QA 3L2AA 2P9VA 2KA6B 1VM1A 4JN6A 2H0GA 3KVWA 4M4XA 4IBEA 4NOOB 1E3VA 2VLGA 4LJ7A 3EEHA 1ZQ9A 4JF8A 1NO1A 4FCVA 3TWMA 1OIZA 3VP3A 3FUWA 1YNVX 4GOGA 3N8BA 2ZQDA 4R4RA 1T43A 4IBRA 5TBMB 3W8KA 3F40A 1CQAA 1JNQA 4PDIA 4LV0A 3KFUG 3S5CA 3NOPC 4RA7A 3RDEA 3KZTA 3T4SA 5DVAA 2LHGA 4K08A 4NL4H 4KFDA 4S2NA 4E3OA 2XGNA 2QHKA 3TOIA 1BLPA 2E2VA 2Z77A 4EQIA 3U6LA 1F8NA 4PKYG 4GDNA 3ZNYA 2G5GX 2VKSA 5FDHA 2DHYA 1R4CA 3CHWP 4GRIA 5HZHA 1V92A 5AIGA 3DWZA 4FMBA 3BY9A 3LO7A 3CZDA 5FLXS 1K56A 4LENA 4NSOB 4RKUF 3NBRA 1IVWA 1EW0A 5C1BA 3C3EA 5EP3A 1OTDA 4S2JA 3SS5A 2Y21A 4B4ZA 1UGHI 1W6YA 3EC9A 5EEOA 2ZC5B 3PBOA 4HNBA 1GHMA 1BOXA 1TF1A 3Q3FA 5FGOA 3EQVA 5JPPA 1A67A 2K47A 3TDGA 2WGVA 1RGHA 5FQQA 2AADA 5JYOA 2FFFB 3C5AA 2XF3A 4QHTA 5DFYA 2D02A 2WK0A 3UY6A 1YLTA 3V39A 3J7Yd 1UFZA 2HKJA 3CCS3 2R45A 5KQDA 1XJ3A 1N77A 4O01A 5DTTA 2WAEA 2O9CA 1CEGA 3NBJA 3S28A 3SVAA 4LF4M 1HNWM 5HW3A 5AIIA 1FCNA 3RGAA 4DE1A 2C9OA 2W04A 5E2HA 2I9WA 4EXOA 4QB8A 4L4UA 3FUTA 3QWLA 1RGAA 2MC8A 2YR0A 2ZAMA 3E46A 3W4PA 3IXBA 4MCWA 4WP5A 4BIRA 1TRPA 3NM7A 3KSPA 2MJ6A 6RNTA 1DE3A 2KZUA 1D1JA 3D9YA 4FMAA 3TJZC 4XDVA 3U97A 3FGYA 4LG2A 3NUVA 4HM5B 3Q81A 3LEQA 4IT7A 3RFWA 2F4VM 3QP2A 2CV0A 4X2OA 2W9QA 5AIFA 1BNJA 3V92A 4XBXA 1YPRA 2HV1A 2XSSA 5EM1A 4OPYA 1W63M 3EHCA 3VF1A 5FI7A 2R6FA 4N6OB 2G2UA 3GQZA 3KYZA 2DENA 4FD2A 3LQQA 2R4EA 4QU3A 1NJI4 3L29A 2Y2MA 5CEDA 3NI9A 4L8OA 3G713 4J9AA 3ILKA 5KPZA 2PNCA 1XJ4A 5KPRA 5HSQA 3WHLA 2PDRA 2L4RA 4K0WA 1UCKA 1ISKA 1BSGA 3BNCA 1XMQM 5KP4A 3FF2A 2KLIA 3MXQA 1NNJA 1WQLB 2J9PA 2O01F 3N8RA 3QP5A 4EUZA 3MHEA 4OVMA 2K3DA 3TSGA 2ZBKB 2LVOC 2M1CA 3D9RA 4P85A 4GHAA 4NPBA 1G6AA 1SCWA 4MGKE 3GRDA 2KF3A 1K55A 1BIRA 4JI0M 2FFJA 1SARA 3KSIA 3PNVA 2Y2QA 4I38A 3NM2A 3BFFA 1PI4A 1QVRA 4S2IA 1KDWA 3T1RA 1S4RA 3PCSA 3UPNA 5JI2E 2KCDA 3EE1A 3MXRA 1K3XA 3B33A 3H51A 3MKIA 3SARA 3PVSA 2OOBA 3AGFA 2K31A 2GZAA 3U6EA 3GTCA 1EROA 1YVSA 3UE0A 3EBTA 3LW5F 4N9KA 5IS1A 1G8PA 4MBFA 4Y28F 1VDDA 4WWUC 1S4SA 2DWMA 3IXHA 1O7NB 3W0LB 1VQP3 5E2EA 1D2NA 3AOGA 4JF4A 3FD9A 4W5WA 3D8LA 1VQQA 2IUJA 4OVDA 4S2LA 1W79A 2CW9A 1LNHA 2J80A 3OTOM 2WGIA 3LYXA 3NCKA 4EESA 1AR0A 3FE3A 1RTUA 2O3OA 3CCE3 1DP9A 2CWUA 2A3UA 1UUGB 3BLSA 4KZ8A 4DJ3A 2JWSA 2V0WA 1C7HA 2H0YA 3GP1A 1AIPC 2Y74A 2INWA 5HL1A 2LTUA 2EUCA 3SMSA 4LJ9A 1EFUB 2EFUA 1J7KA 2O9AA 3MMHA 4MBHA 2XSZA 2P0XA 2DAEA 2VIIA 3HIIA 3FPWA 2HWJA 1IV9A 2EJSA 2J9OA 1ZO2A 2WKEA 4X25A 5F82A 4KZAA 3UDXA 2RKOA 4NK3A 3NBXX 2R18A 4X64M 5KP3A 4I8OA 5AQAA 4JXWA 4BBAA 2JA2A 4BJPA 2RGQA 1GVNA 1KC84 5JBSA 3AKZA 4EW7A 3V3RA 1IU7A 4NRWA 1A5TA 3SFZA 4HVNA 4LJ8A 1RKYA 3CUEC 5GHZA 5EP1A 2JXNA 2CG0A 5HL6A 3FYZA 1I0VA 5EM0A 4N92A 4FOFA 1MKMA 2Y2IA 3IWOA 5AI1A 1JB4A 1M9GA 3NECA 3UB8A 3H7WB 3G35A 4Y2FA 1K4EA 3PBTA 4QD4A 2XR8B 2BMRB 5DYGA 5IEPA 2W3EA 2JKRM 4I4KA 3VLFB 4JI8M 3DUKA 5EPHA 2QNJA 3PS8A 2MGWA 1I5QA 2LH0A 3FTEA 5DKLA 3I7JA 5EVHA 2M7UA 1F98A 2HL7A 3NDEA 1XC8A 1BSCA 2BU4A 4IJEA 4WEKA 4FSFA 1HZOA 1T19A 2EA0A 2W3DA 2Z6CA 2HMNB 3CWFA 3A3DA 3EEAA 4A5RA 3VKHA 5L8MA 1K54C 4AW4A 1TVFA 2R65A 1BAOA 3HLDA 4KQOA 3H4MA 3S7NA 2ZMVA 3L9KA 4M0WA 3VDPA 2R4JA 2BHMA 5EP4A 2Z7AA 2WGOA 3QAUA 2HDSA 2QQ8A 4JRFA 7RNTA 3G4PA 3GPXA 3NHXA 1IXZA 2VGJA 3EF8A 1G28A 3T4OA 5F3WA 3CXC2 4LYLB 3VDUA 2V2FF 3OOVA 2Y2JA 2RGHA 2O9BA 4LJ4A 4LCBA 2XLNA 3P01A 3U4LP 1Z59A 2H5XA 1O7PB 1NRJA 2K2NA 1LOXA 4KFEA 3GSGA 2JKTM 4WP2A 1GMRA 4GHIA 1LVNA 2YFLB 4OP8A 3CD63 1NWWA 1NY6A 3CC23 3CPOA 1DO2A 3GLFA 4L78A 3S1YA 1JTGA 4EBLA 2QZ6A 3CPTB 5A93A 3CC43 3IHBA 4GHOA 1Q824 5STDA 3BNBA 2ZL1B 3GV9A 3G32A 5GHYA 2W1TB 3KSXA 5EVIA 1B20A 1CUKA 3B9PA 3KOZE 4XT2B 4WMCD 4QNMA 5DYIA 4B3TM 2PBYA 3LR4A 1DO0A 2HP9A 1BVIA 1LQMB 4KODA 1HKXA 3U5ZA 1OTEA 2V20A 3OC2A 5CF2A 4X1LA 2OTJ3 3KP1E 4QNRA 1CEFA 4K1VA 5HWWA 2KNVA 4CGYB 3E2LA 3UPPA 4HBRA 4DE3A 2X71A 2MJ5B 4OOYA 4IBJA 3S22A 4DDSA 3C2WA 5KO3A 3K7CA 1H0MA 4D80A 5FTLA 2CFLA 2P38A 3LY4A 1JBTA 2W1TA 4OH0A 4QHCA 1G96A 4ETXA 1TH4A 1Y8GA 2R41A 3LXUX 1IYPA 1QMFA 1GL7A 1RRLA 2Y8HA 4GS9A 3A3JA 3WS0A 3V50A 1QUTA 1RGKA 5G4ZA 3LIEA 3QYEA 3K9PA 2CHCA 3ECFA 2Z8YM 3QYBA 3BJNA 3MQQA 4I81A 4IBIA 4MH0E 3EGXC 4WFOA 1QALA 1XFQA 4GD6A 1IM2A 1FYSA 3CCM3 4DXBA 1OTAA 4U0TA 3DW0A 3KX0X 5HAIA 4E6XA 1D6ZA 1OHSA 1XGIA 1PYYA 5CHUA 1KDSA 3EBYA 4HLQA 3LCVB 4HM6B 4KG6A 2OOVA 4IEDA 5F83A 4UA6A 3KOWE 4Y15A 2KZSA 3C38A 2OLVA 2UUAM 2PD8A 1UGIA 3OX9A 4R1GA 1QAQA 1N9JA 4EETB 3PGBA 2PZVA 3OZHA 2W9PA 2HHHM 2BTFP 3OWYA 2L1SA 2VGLM 5FTJA 3H3HA 3E0YA 3KKGA 5J8XA 2K54A 2HF6A 1WXQA 3R9XB 4RZMA 3JVCA 2C11A 2W56A 2DHRA 4G3WA 4XUXA 1K734 2RL3A 2DWZB 1UM8A 4HM2B 3SS3A 4WUJA 1V33A 1ROVA 4Z8XA 4KUOA 2DAKA 4UA9A 1UWPX 1M904 2MR9A 1OF5B 3SXXA 1L0EA 2ZQAA 3BQAA 1ZG6A 1OPYA 1G71A 5IENA 3HHWA 4DV4M 3BQ8A 3MF0A 2BJWA 3F8HA 2W3HA 4Y13A 3U6QA 2XD1A 3IHPA 4R9KA 2V1AA 4EBPA 1IN5A 4LMIA 4GN2A 4LV1A 2DWLA 3GZYB 1HJPA 4CDLA 5E2GA 1H8YA 4Q53A 1QDRA 2JY7A 1YAXA 1DMNA 2ZANA 1QAFA 2XSHB 3U60B 5F68A 2X4AA 2L1MA 5AQ7A 2F56A 5IG5A 2FS1A 4BTWA 3R4KA 1IBKM 3WDGB 1YUBA 2L09A 4H3UA 2L7HA 3IG5A 1FGRA 3CPW2 4MB7A 5GSPA 4LF6M 2Y2LA 3K3DA 3NWLA 4P6ZS 4ILFA 3HJSA 2UUGC 2V0UA 3D72A 5FTKA 3VFDA 2DMWA 2IWBA 3IXDA 2ZHXB 3BECA 2NUPC 5IZ7D 1QYRA 3HZJA 1EA2A 1IFQA 4ANRA 3SS4A 4PM8A 1XJ2A 1RRHA 6GSPA 3IF5A 1NSFA 3MYTA 5E2FA 5EXTA 2P7JA 4XK8F 1SXJA 2V8FA 3K2LA 3A3EA 3ZC7B 4IBGA 2KF4A 3DA1A 4O2HA 4H6JB 4KENB 4KT0F 3WMDA 1D0LA 1PI5A 3RGPA 1S0WA 4WELA 1Q814 4DV1M 1D0KA 3LT8A 1RGGA 3G8ZA 1TGUA 3I51A 3PNYA 4LLOB 1ALQA 1BANA 3HJIA 4NETA 3M7GA 4LFUA 4G3OA 3G16A 3HX8A 2Y0QA 3LTCA 2RCXA 4JLFA 4EBNA 1NYYA 5BXQA 2P04A 1GYBA 1UI8A 3MZEA 3PXMA 1M6KA 4EIWA 1KVLA 4N6NB 4HEFA 1JKGB 3LZAA 4WZ5A 4WN5A 1SDEA 1I0XA 1NV9A 2ZTDA 1DGBA 3WA2X 2CP8A 5F1FA 3P09A 4BTXA 1VDLA 4LSOA 5JI3E 3KIIA 3EN8A 4B88A 5DREA 1VQ83 2XDMA 4FH4A 1PW1A 3K1JA 4K0KM 5IHVA 1LL5A 3HZPA 4EU0A 2XA7S 3KYEA 1XGJA 4L9GA 5KSHA 5G4YA 3A5EA 4PAUA 4GH9A 3LVWA 3UMEA 3KW6A 1TEMA 2LVQD 5FTNA 1YI23 2D7GA 4OPZA 3GZRA 1DETA 1K57C 2DRWA 2MROB 3GPPA 3SASA 4M0DA 3OWSA 3BYDA 4EV4A 3EQQB 4LV2A 3GLGA 1ODVA 3NC8A 1VQ93 3LIAA 3AL0C 5G1KA 4P16A 1GY7A 3FKEA 1DY6A 4OQGA 3CLOA 3Q7VB 1K6RA 1IELA 4IJFA 4JI7M 2W3FA 2ZJ9A 3UE1A 1TDHA 1A2KA 3ZG5A 4AEQA 3MFXA 3CME3 3CI6A 2EWVA 3UK6A 5CRFA 3MZDA 3ZNTA 4ARZB 5KSCA 2Z2MB 5U47A 3NQZA 3GRRA 1KGFA 4O8SA 1IVUA 3GAXA 1HT2E 3OLOA 3KSED 1CI9A 4GIPA 3KFQC 4X69A 3A98B 3E4RA 1CK3A 2XGLA 4Q0JA 3HLEA 3D5IA 2MH8A 4HM3B 3P98A 2HMJB 3Q7VA 1K9M4 4P6BA 1B2UA 3CCQ3 2X01A 5KQ8A 5LMUM 3VFFA 2L4VA 2MF7A 3LI9A 2IYJA 4JPMA 5EXXA 3CMA3 4DDYA 4MGZE 3C7VA 3CNXA 5EOEA 5TJJA 3LCUA 2CHQA 4OW0A 3TRCA 3AMOA 3X3YA 4X68A 2EX8A 3UZUA 4J5KA 1BSBA 1TRQA 1A2PA 2YFQA 1Q3BA 3HKPA 2B02A 2HPBA 3HBRA 5GLDA 3DH2A 3V3SA 3A46A 5K5BA 3K5TA 4FCJA 1IDPA 1A0KA 4YOFA 1A90A 4S2NC 1C7YA 3MZFA 2CFKA 2GXFA 4NRVA 2B1XB 1RMSA 2XRXB 2KF6A 2RGOA 4IIWA 1JV2B 3NV0B 3QRDA 1BNRA 2DAMA 3SYKA 1AXBA 3E98A 3M6HA 3MJQA 5A91A 1ES2A 4PM6A 1KE3A 3CGWA 4R3DA 2P05A 4B7HA 5IWAM 3BLMA 3E99A 3X42A 2Z6DA 2WOFA 2XR0A 3JPUA 5FDSA 1J2BA 2EFXA 4LF5M 5CXOA 1S66L 4LY6A 1IT8A 4N1HA 2QCUA 3VP1A 4Y0OA 5ELUA 2OWPA 4RNZA 4KO8A 1Z5AA 4CIZA 1MU5A 1HYFA 2QA43 2XK1A 2LQVA 2P9VB 4KG5A 3LVVA 3K0ZA 1I2EA 2JY8A 3V67A 1OT6A 2C5WB 1OAIA 3Q90A 3ULFA 3GPYA 2V9AA 1WYBA 1GL6A 3LMLA 1SIHA 3NV0A 3RE8A 2V1BA 4MDZA 5AQ9A 3DBAA 3PBRA 1PZOA 1BNGA 1NY5A 2UGIA 1PJJA 4HBUA 5CTMA 3WOFB 2H0HA 1S67L 1ZV1A 2HAKA 3GPUA 2K6BA 2Y4AA 5CECA 3SHGB 4O0PA 1VQL3 3OV4A 4FCTA 4L9FA 3BFDA 3G30A 1OTRA 4GKKM 4UEYA 1X37A 1STDA 2Z4SA 2KXGA 1O7WB 1BNSA 4LZJA 4G6ZA 2DNSA 4D81A 3KS8A 1SZVA 5DFLA 1W7CA 2V1ZA 3ZVTA 4R3AA 1FW7A 1JWPA 4ZDXA 2C96A 2YKHA 3WA3A 1EKMA 1I94M 3GRUA 4XB5A 1DP8A 2FZ0A 4GDBA 4NXBA 4RNAA 3URPA 1QVF2 1E3UA 5IEOA 3HLCA 1V57A 1JVJA 4CJNA 1IEMA 4LF8M 2D42A 2WKHA 5FQIA 1LQGC 1H3QA 1VQ1A 3T1QB 4S12A 3UJNA 2HDRA 5A90A 4BENA 5CLKA 3SEDA 2EO2A 2IA2A 2DVWB 3T4LA 1FR6A 4GHLA 3DGNA 2WKPA 1XNRM 2UV0E 3NX0A 3KSHA 3DOAA 4X65M 3VKGA 3JUPA 1B3SA 1YJN3 4I3JA 1Y4OA 4GJ4A 5KIZA 4LFAM 1R4YA 3WRZA 2HP6A 3T8NA 1PNEA 4B3MM 3SZTA 2H0TA 3JUQA 1EUIC 1D7EA 2Q9MA 3DZLA 3SLUA 5ITQA 2VGKA 1X1WA 1KGEA 3IX3A 1GA0A 5AEWB 1K55C 4JGQA 4FW9A 3HLBA 3HOHA 1R5LA 2WO0A 3CCU3 1PRBA 3MG1A 4JV5M 3CF0A 5IERA 1PW8A 1W7FA 3EQUA 3WS1A 5JYPA 3FTFA 1EG9B 2CWTA 3LEZA 5E43A 4RYEA 4HIAA 1OUNA 1T18A 1PWDA 1WTHA 8CATA 2JUJA 2OOAA 4LRSA 3B8LA 2M7VA 3UL5A 1T1BA 2KEBA 1TTEA 3CG5A 1NLYA 2R9WA 1V74A 1MWRA 4HM1B 1BZAA 1YGEA 3N8SA 3JR4A 5G2GA 4ZM8A 3ZGAB 4RNTA 3C4PA 4K61A 1JWVA 1I3IA 3OCLA 1YLZA 2UWXA 1SG9A 1IYYA 1GSVA 4BBUA 2VF7A 2QHOB 4WM9A 3PYJA 1YLAA 4L7KA 4X2HA 1LSWA 1WA9A 3P7NA 2JE5A 2QKPA 5TGNA 3UE3A 2KW0A 2CH9A 4F2LA 1ZTUA 3TWKA 4LPZA 3FTDA 3SAVA 1IVVA 1IKGA 4KZ7A 2CX1A 1SKFA 5ITXA 3JAMS 1LI0A 2P08A 4Q8IA 2M5ZA 4DR3M 3FZCA 1GD3A 3CMZA 1UDII 3IS2A 1DMMA 1X1XA 1W8YA 2LB9A 1MGWA 3HX3A 4WW0A 2HDUA 5CHJA 3BRMA 4R4KA 1C54A 5HDDA 5BR8M 1UUVB 1VQM3 1E94E 5TFQA 3CF6E 1FGTA 2WKIA 1ZKJA 1SQWA 2JKRI 1J9MA 1L2DA 5BOHA 3AGDA 3VSYA 1FGMA 3LOYA 3X40A 5EUAA 4ME4A 1AWIA 4OVZA 4YWZA 4FUWA 4GLQA 4O8GA 2RNTA 3BFEA 2XQZA 4LFCM 2AVXA 3FV7A 3T15A 1STZA 2W27A 1S723 5I97A 1PJIA 3ZG7B 1TU5A 2JCHA 1Y28A 3GLFE 4IBCA 1FCMA 2OWJA 2CFWA 1Q02A 5CK6A 2E8JA 4MEIA 4ZAMA 4NXGA 3B3XA 2OWHA 4CPKA 2HJEA 1PIOA 2QPAA 5JPUA 1FOFA 4N6MA 5HAPA 3O86A 3S29A 4DKIA 4IHQA 1VETA 3SH7A 3KYQA 5CXWA 3UB7A 5FEFA 1K3WA 4EW5A 2CWBA 2F5NA 1ACFA 2J3WA 3S7QA 3L28A 2EWWA 1VEUB 5FQ9A 2R46A 1K56D 4CLCA 3W4OA 4LGWA 3PZWA 2JKTI 3FF0A 4X53A 4GITA 4A3VB 3MKFA 3CAXA 4WYKA 4I3AA 1K8A4 2X49A 3JUMA 1K0KA 2HOHA 1UUWB 2JZ1A 2JBFA 3T50A 5H37D 1JR3A 2KDLA 1WYCA 4RX3A 1PU4A 2QBYA 4MMZB 1NNVA 4K1UA 4N6V0 2HGVA 1HR0M 4RNYA 3I04M 2ZM8A 2R62A 1NB3I 3UGJA 1N34M 5EQLA 1PFLA 3D8BA 1IY0A 1B2ZA 1NO3A 2QIYA 1OHOA 2APLA 1VEUA 1JB0F 3NHQA 3V99A 2GQFA 1LNIA 1YSPA 3TL4X 4F3LA 1H8ZA 3BBZA 4MGHA 1DP6A 3J7BA 5DNYA 2BO9B 1BLCA 1K4FA 5D81A 4N1XA 4JI1M 4NC6A 2YX9A 5TGFA 1H6UA 1TJDA 5CGXA 4RF1A 4D2OA 3VK7A 2IMJA 1OFIA 3Q07A 3S67A 5LBRA 4QY5A 4I3IA 2VQEM 3W4QA 3MPHA 2B5RA 1PJSA 2ZAOA 5EVIC 4X62M 3T4JA 1TS6A 5FSRA 1N78A 2Z4RA 3DTMA 4R3JA 1R4GA 1NHWC 1IYSA 4XM4A 3IQAA 5GLBA 3G31A 4FR9A 2L6OA 2VX8A 5F1GA 4JI5M 1RU3A 4LZZA 3BWLA 4DXCA 3CTWB 2BMOB 4MM3B 4DV7M 1JJ22 3DWKA 2F86B 5HWVA 1B2SA 3MMPA 4BLMA 2UUBM 2G7UA 2B3TA 4WHAA 3GDIA 4PMAA 4GHIB 3B7NA 2ZTCA 1N8R4 1BRNL 1P3QQ 2C99A 5G18A 4EERA 4OOLA 3BLZA 2E2UA 3GLIA 3GLFB 3FKAA 4R80A 2DXIA 2UXCM 1BGSA 2DNAA 4R70A 4X1MA 3A0SA 1R6BX 2KAAA 3HL9A 5FEGA 3FRHA 2QWSA 2JDIH 5C18A 2C4BA 3T38A 2DCFA 1DV0A 2FFYA 5EVIB 3FYDA 1IY2A 3U6PA 2X02A 1ROAA 2HZ5A 2A15A 5I5LA 1NNUC 1OPXA 3U5ZB 1XXHA 4JXGA 4UQIM 4HKVB 1D0MA 2WYXA 1ZGXA 1H8MA 1TH3A 3U6CA 4MN7A 3CCL3 2GNOA 5I94A 3HK4A 2C9CA 5IG0A 4D82A 1KWIA 4J5GA 2PU4A 4KQRA 4PM7A 4ZJ1A 3W2ZA 3N8LA 2H5SA 3IF6A 1HQCA 1SXJE 4DUYM 2V1UA 1PWGA 1Z6FA 2EX2A 1JQJC 2PHYA 3OCNA 2DAGA 3L25A 2Z3XA 3B7CA 4Y3IA 2CWVA 1IKIA 4LGYA 4FCMA 4MMXB 4KZ3A 3ITBA 1DYUA 2F5PA 3SATA 5L09A 4U3TA 4P0MA 2KX6A 3DAVA 3W68A 3ZH9B 1EQKA 1D6YA 1BUEA 1GCEA 4S2KA 3FZWA 1QZEA 1OH0A 3Q8XA 5LMNM 4GS9B 2Y2NA 1GY6A 2QPNA 1LI9A 3F7SA 3D5GA 1ORYB 2XSZD 1HLUP 1L5GB 2CUZA 1TS8A 1FA3A 1R7RA 2J7NA 4PM5A 2GBWB 2WGQA 1P0ZA 1UCJA 1NWZA 4DF6A 1L2BA 5FQMA 2I7NA 4GKJM 1S1ZA 4ID4A 3FYCA 2C5RA 1T2IA 3U6OA 3HUMA 4RQ9A 3ZYTA 4P87A 2O5RA 4WLAA 4LRYC 1RHLA 1N8QA 3HUOA 4IUHA 3MK6A 2GU3A 3GQ4A 2ZQCA 1L1ZA 1I70A 3F1PA 1Q40A 3CCR3 1LL8A 1M40A 3M8CA 3FKVA 4G4NA 3GRJA 3FG3A 3Q1CA 2XSOB 5A92A 4JGPA 4HAAA 3WOEB 2PD7A 2Q07A 2K9DA 2ZL8A 1WMNA 2A49A 3Q82A 1T1CA 5FTMA 2XZUA 2EX6A 1Y4KA 1TFOA 3GVBA 1RSNA 2J5YA 2CRUA 1SPUA 1IXSA 3PFIA 4DUZM 1IQYA 1X1UA 2W56B 3X41A 3SC3A 2Q0OA 3F1OA 4AKGA 4IBXA 4B08A 1GO5A 4LCMA 2ZC7A 3GLGE 4B3RM 3MR0A 3U61A 5ITRA 2EKFA 3EJVA 2Y2GA 4N9LA 5DTSA 1JRQA 1OT9A 4XBTA 3JYIA 1SXJC 3I4VA 3VFHA 1TFKA 5BIRA 3AGOA 2JNHA 1ONHA 3AV0A 1PJQA 1IVXA 1SKOA 4QPRA 4E3LA 1I2GA 4Q7JA 4DR4M 1QANA 5DJUA 1KD14 2D7HA 2FH0A 5IF6A 3ZVWA 3AJIB 4GW9A 3ZCBB 5FI6A 3S4XA 1O7MB 1MOLA 2GX5A 1GKIA 2Z76A 3MS6A 2W03A 4KVHA 2L4FA 2B18A 4ORLA 5AYRB 1NYMA 3TE8A 3AHSA 1GMQA 1GOYA 4N6UA 4X56A 1OCVA 3TPZA 1O7GB 3O88A 2H0IA 3DMCA 4NXMM 3H82A 4WZ5C 5IW9A 3AFHA 3CC73 3R7WA 2EXAA 3D3OA 1DVDA 1DJCA 2ZC6B 1TIJA 3FCSB 2Z7JA 1W02A 3FUXA 2IUKA 1G41A 1I8VA 3GWRA 1KE4A 4HH2A 1ES3A 3KP0E 1MY8A 2JKGA 3U6MA 4BBVA 1UI7A 1IY1A 3B4OA 2ZA4A 1KGGA 4R38A 3GRYA 4B3SM 1VEGA 4ZJ2A 1SXJB 1WR1B 2ZQ7A 4LGQA 4R9LA 4EV2A 1F4IA 1NZOA 2KNAA 5EVID 3A76A 2UU9M 3S7OA 3X3XA 4MMYB 3B74A 2Z6BA 1RGCA 2OPFA 4Y0TA 1MWTA 2V8CA 1E4DA 4II7A 4MJDA 1WIVA 4N3VA 1XJ6A 5KZHA 1JB5A 2UXDM 3UB6A 4C6YA 3ZQJA 1YMXA 1S6RA 3FG1A 1RJOA 2QMIA 3HLGA 1W2B2 1LLBA 2Y2HA 3RTYA 2V1LA 1KFVA 4OPRA 4D60A 2LNHC 4AZFA 4FWHA 4Y5FA 5HDCA 2CX0A 5M18A 1WGLA 3HGIA 1EEJA 3EIHA 5CF1A 2CMNA 1Q7Y4 2OSUA 3UN7A 4Z9QA 2FGTA 2KNZA 4TUWA 3RGRA 1XX2A 3M6AA 1HTZA 3CCJ3 1W2ZA 3OPHA 3BB9A 3J80S 4L9EA 1KSIA 1YKDA 5CGWA 3HU1A 4BQMA 1HNXM 3LTBA 1YLPA 3SX1A 9RNTA 3QNBA 3RXXA 2JP7A 4MGYE 3F7XA 2CE7A 2QJ5A 1RP5A 3I0YA 2BJVA 2BIRA 3WS2A 3GQ5A 2YNMD 3HHZA 3VK8A 3GLGB 4RBNA 5DF9A 1W00A 4Z1WA 4OQHA 3MQOA 1LV7A 4KZ1A 1K25A 3JR5A 2W3GA 4HY8A 5HPIA 4DMZA 1GD4A 4FMCA 1DJBA 3U2AA 2D7EA 4DV3M 2H28A 2QP9X 1LOVA 4LJ5A 1MWUA 4B9OA 5EV0A 1G68A 4OLDA 4YINA 1NJ4A 3LICA 2GEYA 1RNBA 1N32M 1Q7HA 1J5EM 2BLSA 3DXOA 2Y59A 4AG6A 3ROBA 1TS7A 5D3OA 1LOWA 1PYLA 3VGNA 1RCJA 5EECA 4CJ6A 4PHTA 1I2WA 1YHQ3 3IJEB 2P0MA 1OTIA 3KSGA 3LTDA 1E25A 1RN4A 2HMLB 3HIGA 2JKFA 4H8RA 1L0GA 4FWGA 3BM6A 4WBGA 3U1WA 1T3BA 2IWCA 1SDNA 3D3LA 3PCRA 4ZBEA 5L8RF 2F5MA 3N4IA 4BBTA 1G3IA 3N54B 2STDA 2CHGA 5HDSA 1GOVA 3AMOB 2LVAA 3A0RA 2OQEA 1QJGA 1OJLA 1L2CA 3KOYE 1WMOA 3UNWA 4FVMA 2ML6A 1IN6A 3AGNA 2YKFA 4HJ6A 3DTEA 6STDA 3T4QA 4AI6A 3K8ZA 4GB7A 1K82A 3IWIA 2W82A 3F8XA 3SAWA 1JBRA 1YVBI 1TP6A 1VQO3 2GNXA 2EKKA 4XXRA 1IQ8A 7GSPA 2F5SA 4EEPA 5FAQA 1FR1A 3K9OA 1G02A 4NXEA 3Q2PA 1OJGA 1LTMA 4HM4B 3KN4A 1W63Q 2C6WB 3CJMA 2KOIA 4GZBA 5EP2A 4GSPA 4PM9A 3VOZA 2C10A 2BWBA 3NOUC 4YNRA 1L3LA 3UPOA 2ZOHA 2QJ7A 1NJGA 3C3DA 3W67A 1ERQA 4NG2A 3WWXA 4DR2M 3LUQA 4E3NA 4CCVA 1SXJD 3SOIA 3UDIA 4MLLA 5ITXE 2CC3A 2WUQA 3JVVA 5L2FA 2INXA 2L2DA 1GS3A 4FCZA 4BU4A 1F9IA 1HQYE 3HCYA 4JBFA 3SOYA 3UDFA 5L10A 4P17A 4Z6YA 2HMKB 5AJGA 3HHYA 4XGIA 1JB2A 4REZA 1N36M 2LHCA 1AUAA 1IK3A 1S1YA 4WURA 4E04A 4DV2M 2BASA 4BWIA 1MX0A 2RBIA 3DGMA 1NU3A 4WYYA 3L0RA 1QUSA 2ZQ8A 3LCEA 1RCLA 2R78A 1P97A 3BFGA 3BFCA 3GQ3A 1OJ5A 4M9ZA 3MQ0A 4GMQA 3RXWA 2HMOB 4HP4A 3SHFA 1OAOC 4LFBM 2Z2LB 2OOLA 1BSDA 3GO8A 4C3QA 1RGLA 3T1XA 4DE2A 5BVBA 1W5DA 2B95A 1QVG2 2BMQB 2QYBA 3TWLA 1L0DA 1EE8A 2JY5A 2I72A 3KSFA 1EI5A 1I2FA 1RGEA 3GZBA 3J81S 2P5TA 4HL4A 2RRUA 5ELJA 4O7DA 5IU1A 1IQPA 3VE3A 1TH2A 1VQK3 4O3VA 2F5WA 4XDWA 1JNUA 5J3WA 2CK3H 4KZ6A 3GMWA 2KDKA 2DZOB 2Y2OA 2O0YA 3VP0A 3SAUA 2WADA 1PY3A 2LBCA 1JN5A 2J3TC 5HD5A 5GHXA 4QHSA 1G4AE 1AY7A 2VV8A 3V5MA 4CLCE 1NV8A 2LWXA 5EOOA 5CX7A 4F94A 3ICYA 3B89A 4JI4M 1SHVA 2Y73A 1U60A 3WODG 2AHMA 3PAGA 1BSAA 4Y17A 1O07A 4AKIA 5EQTA 1LSXA 7STDA 1JR3E 2R0IA 4K90B 4PEJA 1F5MA 1NRFA 3NOTC 4OOMA 5FATA 5IT9S 1M1XB 4EQ1A 4OU7A 5FI2A 3LT9A 4S2OA 4AKHA 3GR2A 1BRIA 1VEKA 3IHAA 1W6CA 1NY0A 3F14A 3SOAA 1RGZA 1STFI 4NXFA 3F1NA 3PBQA 4MMNA 3NBLA 2ZQ9A 1WGNA 1YE9A 2L0WA 1SIIA 4X6TA 4HJ3A 3MSHA 1RLSA 2CFOA 5EXSA 2R44A
chains in the Genus database with same CATH topology
2W2CA 2BNKA 1ZAEA 3HU3A 4HM0B 1YQSA 5IG4A 1PWCA 2QEX3 4GC5A 2Y0TA 4GNUA 1BULA 2HDQA 1KSFX 2ZC4B 1GY5A 4R7GA 4MBKA 2F98A 3VP2A 4DE0A 1XA7A 1IN7A 3AOEA 4RX2A 1NVMA 3A45A 1WNHA 3HUNA 4S2MA 1BT5A 3IG8A 2ZDJA 4OQ0A 1FCOA 1Q39A 1U5OA 1FGQA 3ZCZA 3C58A 4IPBA 3EB8A 2SBLA 3FTCA 1R2YA 1W5TA 4BD1A 1HVBA 1IN8A 4HYZA 1E9SA 1PFPA 4UAAA 1JTDA 3HJ8A 1VQN3 3VP4A 4OVZB 1HU9A 1LHYA 3Q1FA 1VQ73 1PM5A 4G4RA 2J7VA 5M1AA 4LJ6A 3EX9A 4BTYA 5CGSA 2WZXA 3B4PA 2BG1A 2XFSA 2V6ZM 1A2VA 3J2PB 1QQWA 1MKIA 3EN1B 3S27A 5EXPA 2EXBA 1HD8A 2M7OA 4PCZA 4ITQA 1ESUA 3FUUA 3QNCA 5HX9A 3LYGA 1KYIA 4FH2A 4JKTA 2FXTA 2G2WA 5FASA 3VSLA 2CV1A 4JXJA 3E9SA 5CTNA 5KP1A 1FGOA 1E3UD 3OPPA 5AIHA 1FUWA 4KG2A 4QOZC 2DWNA 1EWZA 4QY6A 1IYQA 2XH9A 4EC6A 3LMMA 4IBFA 4WYKB 4L8RC 3IMAB 3HWSA 1E32A 2QBYB 4HZBB 8CHOA 3MJ5A 3GZXB 2RSXA 3T1HM 3SBJA 1YMSA 4J8TA 2IA7A 4EYCA 2RFRA 4L16A 1YLJA 3NQYA 2K0MA 3K92A 3HI7A 3JUOA 2LXEA 1Q42A 4KZ4A 2OQ4A 1YT4A 3NBBA 5CERA 2HCBA 4WZ4A 2XD5A 2KXEA 1YJW3 3ZG8B 5HAQA 5FA7A 1G59A 1FSYA 4JI2M 3HJQA 3A42A 1KVMA 1BLHA 3GRVA 3OPRA 5FSWA 4L0LA 3X3ZA 4FWDA 4G1MB 4FCWA 4MGIE 3L27A 3CF2A 3MKEA 3W0FA 1SJWA 4GKUA 1LL9A 3SH9A 1US1A 2P74A 3AGEA 2CFGA 4LEHA 3SMPA 1N9BA 5HGRA 5KMWA 1C1KA 4WMCA 2GDNA 4HESA 4ZTKA 4M9SA 1OGZA 3ITAA 2F5OA 1MWSA 3JUNA 3SYLA 3K63A 4KQQA 3ER7A 4H61A 1XXMA 3IF6C 1D6UA 4LV3A 1T3TA 2HMMB 2V1CA 4GD8A 1L1TA 2H1RA 1PZPA 3ZG0A 1VQ53 2R9XA 4OPQA 4HJLB 1YIT3 4FMDA 3MFDA 3CNMA 3OXAA 3GLIB 3FKWA 2XLJA 4XBYA 1N5PA 1AVLA 4R4SA 2QGUA 4CHTB 2CKFB 3UO9A 3DGLA 1YSYA 5DRVA 3NDGA 5BPVA 5LC6A 1XXHB 3FWLA 4LF7M 2D1WA 3D4FA 3PTEA 4FD8A 4LCLA 1DVCA 4U0XA 3N6IA 3KE7A 1Q3CA 3TG9A 2JQ5A 1ASKA 1DJAA 1GA9A 3G4S3 3IF6B 3HHXA 1YLWA 2FE8A 3I553 4RVAA 5AYSC 1GLNA 2J8YA 3V98A 2Q9NA 1TDGA 4QOSA 2CIUA 1OMEA 4JXVA 4CISA 4HBTA 3OPLA 2Q2EB 1ES5A 4AKZA 4I4LA 3M0EA 4OUQA 4AKYA 2OOVC 3M2JA 4YFMA 1VZZA 1OACA 2WAFA 4MEZA 1O7EA 4JXSA 3MXSA 4R1KA 1IT7A 3IH8A 4EV5A 1YJ93 5DF7A 2OCTA 3PBSA 4LRTA 1OFHA 2CEAA 4DRTA 4K91A 3G2ZA 3DY5A 2G8LA 3FLJA 5EE8A 2Y55A 2LYXA 1Q40B 2CG1A 4K0XA 1JR3D 3HREA 3ZFZA 1YM1A 2O9UX 3TQSA 2Y2PA 3M6BA 3STDA 1UW1A 5GLAA 1MNLA 4WEJA 2E8IA 1Z1SA 3UMMA 3ALAA 3LY3A 4E3JA 4B7GA 1TDLA 5ITYA 1QAOA 1IXSB 1L2SA 3NBIA 2UX0A 1MBLA 2W6JH 5ITTA 3FUVA 4Y7PA 2QENA 1QZMA 3NIAA 5E2FA 1OGXA 3Q7ZA 3U61B 2E2TA 4XUZA 1IQXA 4TX4A 3GLHB 3TE6A 1MXOA 4UA7A 5A2QS 1JWZA 4E6WA 4U13A 4AQYM 5HFOA 3DM8A 1YLYA 3F9SA 5AEUB 1R2ZA 4L8PA 3N7WA 4B4XA 1Z5CA 3RGSA 4YY3M 1N5HA 3SH8A 1XWIA 4C75A 3O87A 1YIJ3 1M1K4 3MHVC 1ULJB 3VSKA 4DR5M 4HZ9B 4QWTA 1K54A 4KLNA 3L26A 4OLGA 3T0UA 4EBGA 2Y91A 1IBLM 5IREB 1IBMM 3A3FA 2UXBM 2XEPA 2ZD8A 3GLHA 3BNEA 4BB9A 5EJCA 3C7UA 3FG4A 2ZM2A 2ZMAA 3IPTA 2H10A 4KFFA 3RJUA 1Q2QA 1ESIA 2EX9A 3LQRA 1VQ63 4IBBA 1J09A 5KPTA 1TDZA 1W4NA 5GLCA 1OHPA 3IXGA 5A0OB 1GHIA 3DZDA 1Q864 5FAPA 4JI6M 1K38A 4RF0A 1K28A 3G0KA 5CHMA 4STDA 1E3RA 4UHUA 2Y2KA 5CEBA 2W0QA 3CCV3 3MSOA 4OONA 2F99A 4GL6A 5D82A 1NJFA 1HNZM 2FNQA 1XKZA 4OK0A 3MG3A 2ZC3B 2XFTA 3BOSA 2ZLYA 4OKPA 1MPLA 3N9HA 1DGHB 3VMAA 3KXEC 1Z5BA 3G34A 3QHYA 1S3SA 4OQIA 4NHFA 2M60A 5FW5A 3FSDA 2WOHA 4GC9A 1DGFA 2KRTA 4N6TA 4I5SA 4KZ5A 4KZ9A 4OX9M 2QZ4A 2NQ8C 5EVLA 4DV5M 5GKNA 4LJAA 1IYOA 3HLFA 2VQFM 3ISGA 3J7AS 1K6SA 1GHPA 3LTAA 5TR7A 1HT1E 1FJGM 1BTLA 5DTKA 1T5YA 4DV6M 3K9MC 4DR6M 2E5LM 1DGHA 3NXJA 4ZJ3A 1XP4A 2XZFA 1S5AA 4XBOA 1XNQM 2KRKA 1OF5A 3FH1A 3G6E3 4NSRA 3KSJA 4E3MA 2OQEC 3MWZA 3HLWA 3MBZA 3PBNA 3PAEA 3J27B 1WE4A 1FNNA 3KS4A 3PBOA 4LF9M 3EIEA 1L0FA 1XA1A 1QAKA 4HM8B 5GL9A 3PXGA 3U60A 2C98A 3ZDJA 3IT9A 2WGWB 4OP5A 4FCFA 3DFZA 3T8UA 1W5ZA 1ES4A 4R3BA 1QAMA 4R23A 2WZZA 1WMPA 3HVFA 4HM7B 1BUQA 4G4OA 5HARA 3UB1A 4PDGA 4DR7M 1I4WA 3THGA 2GBXB 2F5QA 2I7PA 2UUCM 3U6DA 4M3KA 2B24B 3CU3A 3KOXE 2ZM0A 2X8AA 4Y0UA 2BT3A 3BEBA 2PU2A 4AG5A 4S2PA 1K41A 3E2KA 1NB5I 1W8QA 2WGWA 4ZPXA 3NY4A 3WRTA 4DR1M 4NXNM 5M19A 4IBDA 2YQZA 1W6GA 3IH9A 2OV5A 1IN4A 2ZM6M 1CYUA 1NZUA 4KZBA 3WS5A 4PD2A 1CYVA 3I4YA 1DGGA 4BLCA 4PPRA 3WS4A 1QMEA 3O3VA 2DZNB 2FOIC 2YFJB 1NHGC 1JKGA 3UNLA 1Q2PA 2ML5A 2IWDA 1FSWA 4IVKA 3R8FA 4IBKA 1I2SA 2FNAA 1TUHA 2BNGA 3OW22 2GEXA 1QMAA 1O7HB 1C3BA 2CHVA 1W01A 4L15A 1AV4A 1NDOB 4PT5A 2HP5A 1N33M 3KDSE 1XHBA 1KE0A 2L7IA 3I563 5E6JA 2P09A 3IWQA 3UJMA 1CQSA 5FAOA 1DMQA 1H5XA 5DF8A 3M2KA 1IXRC 4QJGA 1XPBA 1RGYA 3OWUA 4LZIA 1ZC2A 3G2YA 3UL6A 2ERCA 2JC7A 4EXRA 2CFDA 1N75A 1FQGA 3O8YA 4BD0A 4O02B 1CI8A 2RCDA 3A3IA 7CATA 1RN7A 2R4IA 4JF6A 3VOYA 4M9XA 1W5SA 4DV0M 4LGMA 3T1YM 5D83A 3ZHHA 3LH4A 2OTL3 2J7OA 4N6LA 1E97A 2OLUA 2CV2A 1JN5B 5ITUA 5FQJA 1K57A 1ERMA 2A5YB 1E9RA 1N9EA 4BL3A 5LC7A 1KQS2 4IVIA 1XMOM 5E26A 4B7FA 1CEWI 4GB5A 1NXYA 4E3KA 3DGOA 3AOEC 3BNDA 1ULIB 1ZG4A 2Y20A 4EWFA 4JI3M 3QK9A 4R0QA 4G4QA 1IV7A 5AQBA 2YFIB 1VQ43 4MNRA 4NREA 4E3IA 1ZX2A 1LXEA 4BL2A 3ZG9B 4JYAM 2KRUA 3WHKA 1ONGA 4X66M 2GU1A 3U6SA 1U8CB 4KHPM 1N4OA 1AVKA 1Z6TA 4YHHM 4IIAA 5FQKA 3C4OA 5IG3A 3MG2A 1Y54A 2CC1A 1BLSA 4JF5A 3HU2A 1L8QA 3L2AA 2P9VA 2KA6B 1VM1A 4JN6A 3KVWA 4IBEA 4NOOB 1E3VA 4LJ7A 1ZQ9A 4JF8A 4FCVA 3TWMA 3VP3A 3FUWA 4GOGA 3N8BA 2ZQDA 4R4RA 4IBRA 3W8KA 3F40A 1JNQA 4PDIA 4LV0A 3KFUG 3S5CA 4RA7A 3RDEA 3KZTA 5DVAA 4NL4H 4KFDA 4S2NA 4E3OA 2XGNA 3TOIA 1BLPA 2E2VA 2Z77A 4EQIA 3U6LA 1F8NA 3ZNYA 4GDNA 2G5GX 5FDHA 1R4CA 4GRIA 5AIGA 3DWZA 4FMBA 3LO7A 3CZDA 5FLXS 1K56A 4LENA 4NSOB 3NBRA 1IVWA 5C1BA 5EP3A 4S2JA 3SS5A 2Y21A 4B4ZA 1W6YA 3EC9A 5EEOA 2ZC5B 1GHMA 5FGOA 3EQVA 5JPPA 1A67A 2K47A 3TDGA 2WGVA 5FQQA 5JYOA 2FFFB 3C5AA 2XF3A 4QHTA 2WK0A 3UY6A 1YLTA 3V39A 3J7Yd 3CCS3 2HKJA 2R45A 5KQDA 1N77A 5DTTA 2WAEA 1CEGA 3NBJA 3S28A 3SVAA 4LF4M 1HNWM 5HW3A 5AIIA 1FCNA 3RGAA 4DE1A 2C9OA 2W04A 5E2HA 2I9WA 4QB8A 4L4UA 3FUTA 3QWLA 2MC8A 2YR0A 2ZAMA 3W4PA 3IXBA 4WP5A 3NM7A 3KSPA 2KZUA 4FMAA 4XDVA 3U97A 3FGYA 4LG2A 3NUVA 4HM5B 3Q81A 4IT7A 3RFWA 2F4VM 2CV0A 4X2OA 2W9QA 5AIFA 3V92A 4XBXA 4OPYA 3EHCA 3VF1A 5FI7A 4N6OB 2G2UA 3GQZA 4FD2A 3LQQA 2R4EA 4QU3A 1NJI4 3L29A 2Y2MA 5CEDA 3NI9A 4L8OA 3G713 4J9AA 3ILKA 5KPZA 2PNCA 5KPRA 3WHLA 4K0WA 1ISKA 1BSGA 3BNCA 1XMQM 5KP4A 3FF2A 1NNJA 1WQLB 2J9PA 3N8RA 4EUZA 3MHEA 4OVMA 3TSGA 2ZBKB 3D9RA 4P85A 4GHAA 1SCWA 1G6AA 4MGKE 3GRDA 1K55A 4JI0M 2FFJA 3PNVA 2Y2QA 3NM2A 3BFFA 1PI4A 1QVRA 4S2IA 1KDWA 3PCSA 3UPNA 5JI2E 2KCDA 3EE1A 3MXRA 1K3XA 3H51A 3MKIA 3SARA 3PVSA 3AGFA 3U6EA 3GTCA 1EROA 3UE0A 3EBTA 4N9KA 1G8PA 4MBFA 1VDDA 4WWUC 2DWMA 3IXHA 1O7NB 3W0LB 1VQP3 5E2EA 1D2NA 3AOGA 4JF4A 3FD9A 4W5WA 3D8LA 2IUJA 1VQQA 4OVDA 4S2LA 1W79A 2CW9A 1LNHA 3OTOM 2WGIA 3NCKA 1AR0A 2A3UA 2O3OA 3CCE3 2CWUA 3BLSA 4KZ8A 1C7HA 2H0YA 3GP1A 2Y74A 5HL1A 2EUCA 3SMSA 4LJ9A 2EFUA 1J7KA 4MBHA 2XSZA 2P0XA 2VIIA 3HIIA 1IV9A 2WKEA 2J9OA 1ZO2A 5F82A 4KZAA 3UDXA 2RKOA 4NK3A 2R18A 4X64M 5KP3A 4I8OA 5AQAA 4JXWA 4BBAA 2JA2A 4BJPA 2RGQA 1GVNA 1KC84 5JBSA 3AKZA 3V3RA 1IU7A 4NRWA 4HVNA 3SFZA 1RKYA 4LJ8A 5GHZA 5EP1A 2CG0A 3FYZA 4N92A 3IWOA 2Y2IA 5AI1A 1JB4A 1M9GA 3G35A 1K4EA 3PBTA 4QD4A 2XR8B 2BMRB 5DYGA 5IEPA 4I4KA 3VLFB 4JI8M 3DUKA 5EPHA 3PS8A 1I5QA 2LH0A 3FTEA 3I7JA 5EVHA 2HL7A 3NDEA 1XC8A 4IJEA 4WEKA 4FSFA 1HZOA 2EA0A 2HMNB 3A3DA 4A5RA 3VKHA 1K54C 4AW4A 1TVFA 2R65A 3HLDA 4KQOA 3H4MA 4M0WA 3VDPA 2R4JA 2BHMA 5EP4A 2Z7AA 2WGOA 3QAUA 2HDSA 4JRFA 3G4PA 3GPXA 3NHXA 1IXZA 2VGJA 3EF8A 5F3WA 3CXC2 3VDUA 2V2FF 2Y2JA 2RGHA 4LJ4A 4LCBA 2XLNA 1Z59A 1O7PB 1LOXA 4KFEA 3GSGA 1LVNA 2YFLB 4OP8A 3CD63 1NWWA 1NY6A 3CC23 3CPOA 1DO2A 3GLFA 4L78A 3S1YA 1JTGA 4EBLA 2QZ6A 5A93A 3CC43 3IHBA 1Q824 5STDA 3BNBA 3GV9A 3G32A 5GHYA 3KSXA 5EVIA 3B9PA 3KOZE 4WMCD 4QNMA 5DYIA 4B3TM 2PBYA 1DO0A 2HP9A 4KODA 1HKXA 3U5ZA 2V20A 3OC2A 5CF2A 2OTJ3 3KP1E 4QNRA 1CEFA 4K1VA 3E2LA 4CGYB 3UPPA 4HBRA 4DE3A 2X71A 4OOYA 4IBJA 3S22A 4DDSA 5KO3A 3K7CA 4D80A 5FTLA 2CFLA 2P38A 3LY4A 4OH0A 4QHCA 1G96A 1TH4A 1IYPA 1QMFA 3LXUX 1GL7A 1RRLA 3A3JA 3WS0A 3V50A 2CHCA 3ECFA 4I81A 4IBIA 4MH0E 4WFOA 1QALA 4GD6A 1IM2A 3CCM3 4DXBA 4U0TA 3DW0A 5HAIA 4E6XA 1D6ZA 1OHSA 1XGIA 1PYYA 5CHUA 1KDSA 3EBYA 4HLQA 4KG6A 4HM6B 2OOVA 4IEDA 5F83A 4UA6A 3KOWE 2KZSA 2OLVA 2UUAM 3OX9A 4R1GA 1QAQA 1N9JA 3PGBA 2PZVA 3OZHA 2W9PA 2HHHM 3OWYA 5FTJA 3H3HA 3KKGA 2K54A 1WXQA 3R9XB 4RZMA 3JVCA 2C11A 2W56A 2DHRA 4XUXA 1K734 2RL3A 2DWZB 1UM8A 4HM2B 3SS3A 1ROVA 4Z8XA 4UA9A 1M904 1OF5B 3SXXA 1L0EA 2ZQAA 1ZG6A 1OPYA 5IENA 3HHWA 4DV4M 2BJWA 3F8HA 3U6QA 2XD1A 4R9KA 4EBPA 1IN5A 4LMIA 4GN2A 4LV1A 2DWLA 3GZYB 4CDLA 5E2GA 1H8YA 4Q53A 1DMNA 2ZANA 1QAFA 2XSHB 3U60B 2X4AA 5AQ7A 5IG5A 4BTWA 1IBKM 3WDGB 1YUBA 2L09A 4H3UA 2L7HA 3IG5A 1FGRA 3CPW2 4MB7A 4LF6M 2Y2LA 3NWLA 3HJSA 5FTKA 3VFDA 2IWBA 3IXDA 3BECA 5IZ7D 1QYRA 1EA2A 3SS4A 4PM8A 1RRHA 3IF5A 1NSFA 3MYTA 5EXTA 1SXJA 4X55A 3K2LA 3A3EA 3ZC7B 4IBGA 4O2HA 3DA1A 4KENB 3WMDA 4WELA 1PI5A 1S0WA 3RGPA 1Q814 4DV1M 3LT8A 3G8ZA 1TGUA 3I51A 3PNYA 1ALQA 4NETA 3M7GA 3G16A 3HX8A 3LTCA 2Y0QA 2RCXA 4JLFA 4EBNA 1NYYA 5BXQA 1GYBA 1UI8A 3MZEA 3PXMA 1M6KA 4EIWA 1KVLA 4N6NB 4HEFA 1JKGB 3LZAA 4WZ5A 1SDEA 1DGBA 3WA2X 5F1FA 3P09A 4BTXA 4LSOA 5JI3E 3KIIA 3EN8A 4B88A 5DREA 1VQ83 2XDMA 4FH4A 1PW1A 3K1JA 4K0KM 5IHVA 1LL5A 3HZPA 5KSHA 1XGJA 4GH9A 3LVWA 3KW6A 1TEMA 5FTNA 1YI23 2D7GA 4OPZA 3GZRA 1K57C 2DRWA 3GPPA 3SASA 4M0DA 3OWSA 3BYDA 4EV4A 3EQQB 4LV2A 3GLGA 3NC8A 1VQ93 3AL0C 4P16A 1GY7A 3FKEA 1DY6A 4OQGA 3Q7VB 1K6RA 1IELA 4IJFA 4JI7M 2ZJ9A 3UE1A 1TDHA 1A2KA 4AEQA 3ZG5A 3CME3 3UK6A 5CRFA 3MZDA 3ZNTA 5KSCA 2Z2MB 5U47A 3NQZA 3GRRA 1KGFA 4O8SA 1IVUA 3GAXA 1HT2E 3KSED 1CI9A 4GIPA 3KFQC 4X69A 3A98B 3E4RA 1CK3A 2XGLA 3HLEA 4HM3B 3P98A 2HMJB 3Q7VA 1K9M4 4P6BA 3CCQ3 2X01A 5KQ8A 5LMUM 3VFFA 2L4VA 2MF7A 4JPMA 5EXXA 3CMA3 4DDYA 4MGZE 3C7VA 3CNXA 5EOEA 2CHQA 4OW0A 3AMOA 3X3YA 4X68A 2EX8A 3UZUA 2YFQA 1Q3BA 3HKPA 3HBRA 2HPBA 5GLDA 3V3SA 3A46A 3K5TA 4FCJA 1IDPA 1A90A 4S2NC 3MZFA 2CFKA 2GXFA 4NRVA 2B1XB 2XRXB 2RGOA 4IIWA 1JV2B 3NV0B 3QRDA 1AXBA 3SYKA 3M6HA 5A91A 1ES2A 4PM6A 1KE3A 4R3DA 2P05A 4B7HA 5IWAM 3BLMA 3E99A 3X42A 2WOFA 2XR0A 1J2BA 2EFXA 4LF5M 5CXOA 4N1HA 4LY6A 1IT8A 2QCUA 3VP1A 4Y0OA 5ELUA 2OWPA 4RNZA 4KO8A 1Z5AA 1MU5A 2XK1A 2QA43 2LQVA 2P9VB 4KG5A 3LVVA 3K0ZA 2C5WB 3Q90A 3GPYA 1WYBA 1GL6A 3LMLA 1SIHA 3NV0A 3RE8A 5AQ9A 3PBRA 1PZOA 1NY5A 4HBUA 1PJJA 5CTMA 3WOFB 3GPUA 2Y4AA 5CECA 3SHGB 1VQL3 3OV4A 4FCTA 3BFDA 3G30A 4GKKM 1X37A 1STDA 2Z4SA 2KXGA 1O7WB 4LZJA 4G6ZA 2DNSA 4D81A 3KS8A 1W7CA 2V1ZA 3ZVTA 1JWPA 4ZDXA 2C96A 3WA3A 1EKMA 1I94M 3GRUA 4XB5A 4GDBA 4RNAA 1QVF2 1E3UA 5IEOA 3HLCA 1JVJA 4CJNA 1IEMA 4LF8M 2D42A 2WKHA 5FQIA 4S12A 3UJNA 2HDRA 5A90A 4BENA 5CLKA 3SEDA 2EO2A 2DVWB 1FR6A 4GHLA 3DGNA 1XNRM 3NX0A 3DOAA 4X65M 3VKGA 3JUPA 1YJN3 4LFAM 3WRZA 2HP6A 3T8NA 4B3MM 2H0TA 3JUQA 2Q9MA 3DZLA 3SLUA 5ITQA 2VGKA 1KGEA 1GA0A 5AEWB 1K55C 4FW9A 3HLBA 2WO0A 3CCU3 3MG1A 4JV5M 3CF0A 5IERA 1PW8A 1W7FA 3EQUA 3WS1A 5JYPA 3FTFA 1EG9B 2CWTA 3LEZA 5E43A 4RYEA 1OUNA 1PWDA 1WTHA 8CATA 4LRSA 3B8LA 3UL5A 2KEBA 3CG5A 2R9WA 1V74A 4HM1B 1BZAA 1MWRA 1YGEA 3N8SA 3JR4A 5G2GA 4ZM8A 3ZGAB 3C4PA 4K61A 1JWVA 3OCLA 1YLZA 2UWXA 4WM9A 3PYJA 4X2HA 4L7KA 2JE5A 5TGNA 3UE3A 2KW0A 2CH9A 3TWKA 3FTDA 3SAVA 1IVVA 1IKGA 4KZ7A 1SKFA 5ITXA 3JAMS 1LI0A 4Q8IA 2M5ZA 4DR3M 3FZCA 1GD3A 3CMZA 1DMMA 1W8YA 4WW0A 5CHJA 2HDUA 3BRMA 4R4KA 5BR8M 1UUVB 1VQM3 1E94E 5TFQA 3CF6E 1FGTA 2WKIA 1ZKJA 1SQWA 1J9MA 1L2DA 5BOHA 3AGDA 3VSYA 1FGMA 3LOYA 3X40A 5EUAA 4OVZA 3BFEA 2XQZA 4LFCM 3FV7A 3T15A 1S723 5I97A 1PJIA 3ZG7B 1TU5A 2JCHA 4IBCA 1FCMA 2CFWA 5CK6A 4MEIA 4ZAMA 3B3XA 4CPKA 1PIOA 2QPAA 5JPUA 1FOFA 4N6MA 5HAPA 3O86A 3S29A 4DKIA 3SH7A 5CXWA 1K3WA 2F5NA 3L28A 5FQ9A 2R46A 1K56D 3W4OA 3PZWA 3FF0A 4X53A 4GITA 4A3VB 3MKFA 4WYKA 1K8A4 2X49A 3JUMA 1UUWB 2JBFA 5H37D 1JR3A 1WYCA 4RX3A 1PU4A 2QBYA 4MMZB 4K1UA 4N6V0 1HR0M 4RNYA 2ZM8A 2R62A 1NB3I 3UGJA 1N34M 5EQLA 3D8BA 1IY0A 1NO3A