2XGNA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 137
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xgnA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xgnA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xgnA02
2X02A 3G34A 3VSKA 4MLLA 4LV3A 4UA6A 4QD4A 5DTKA 4HEFA 2VGKA 3NY4A 2HDQA 2XQZA 1PW8A 3FKWA 4KQQA 1JTGA 4GD6A 1XP4A 4WMCD 1XX2A 4FSFA 1KDSA 4RYEA 3BYDA 4DE2A 4FD8A 1GCEA 4MBFA 4C6YA 4EWFA 3ZGAB 3NCKA 4N9KA 2G2WA 3HLGA 4XXRA 3V50A 3LY4A 2QPNA 3N8SA 1RP5A 5A93A 3OPRA 4BJPA 4B4ZA 4K91A 3G2YA 1C3BA 2ZJ9A 4BD0A 5D3OA 3LCEA 3WS4A 3IXGA 1WYCA 5HX9A 1MXOA 2J9PA 3BFFA 1G6AA 4K0XA 3A3EA 3HL9A 3OPHA 4Y7PA 5CRFA 5FQIA 2J7VA 1K38A 4PM8A 4ZJ3A 3NDEA 4MBKA 1QMEA 2CC1A 5FAQA 2XR0A 3C7VA 4U0TA 4X6TA 3SOIA 3VFFA 4E6XA 5CXWA 1IELA 1YM1A 4P6BA 1ALQA 2BG1A 2JBFA 3MKFA 4GDNA 1K55C 2FFFB 2QMIA 3G32A 4UA9A 5TR7A 4QY6A 4N1XA 3W8KA 5AQBA 2HP5A 1AXBA 3CJMA 2IWDA 3BLMA 3PBOA 5J8XA 2J9OA 3BECA 2E8IA 3IH9A 3ZDJA 1KGEA 1FCMA 3ZHHA 2WGVA 1LHYA 4LV2A 5CHUA 3GVBA 1ZC2A 3EQUA 4FH2A 3B3XA 1GHMA 4N92A 3PBNA 2WKEA 2HPBA 3TG9A 1YT4A 2ZQAA 4PM6A 3S4XA 1PWDA 4NK3A 3NI9A 3NBLA 3N6IA 4KZBA 5AQ9A 3ZVTA 2HDRA 1GHPA 1NXYA 4CPKA 1DJCA 4E3KA 4N1HA 1ESUA 2ZM8A 2JCHA 3IWIA 1YLWA 2XGNA 3W4PA 1MWUA 2JE5A 3LO7A 3MZFA 4OOLA 3VMAA 4B4XA 1PI4A 5AQ7A 4D2OA 2WGIA 2ZM2A 1CEGA 1BLPA 1K54C 1QMFA 5GLBA 5A91A 4GN2A 1YQSA 3BRMA 1YLZA 2EXAA 4IVKA 3OZHA 3M6HA 3Q81A 1K4FA 3Q7VB 5FAPA 3I7JA 1L2SA 2Y2JA 3HBRA 4EQIA 1YMXA 2C6WB 5E2GA 2V1ZA 1IYSA 3C5AA 5M19A 3WS5A 4Y0UA 4P0MA 4Y0TA 3WRTA 2WZZA 3TSGA 1LI9A 2P9VA 1KE0A 4JXSA 4RX3A 1JWVA 3IWOA 5CGWA 4OPQA 3FV7A 4BD1A 1EROA 4WZ5C 3RXXA 4KG2A 4HBTA 3NIAA 5FSRA 3C4OA 3PBQA 1IEMA 2WAFA 2WGWB 5IHVA 3SS4A 1K56D 4L0LA 5CGXA 1HVBA 2RCXA 2Y2MA 5EECA 1W7FA 5FI6A 1YLTA 1Y54A 1YLYA 2GDNA 2R9XA 4KZ7A 4PMAA 5FATA 4Q8IA 1BLHA 3P09A 4MBHA 3CG5A 4R3JA 1LL9A 2PU4A 4LCLA 1FR6A 5U47A 1ONHA 4GNUA 3OC2A 3VP1A 1MPLA 2WZXA 2X01A 4KQRA 2EX9A 3RJUA 1H8YA 4WEJA 3IF6A 1LLBA 2H0TA 1XGIA 3BFEA 1XPBA 5FQMA 2Y2PA 3QNBA 4WYYA 3IF6C 2XFTA 3D4FA 4JXWA 1LL5A 4QB8A 5KZHA 1G68A 5F82A 3WWXA 2A3UA 1OMEA 1FSWA 4BENA 4RVAA 5EVID 3W4OA 3MFDA 5AQAA 3FKVA 1KDWA 1Q2PA 2X71A 2A49A 3AGFA 3IH8A 1BLSA 2ZM0A 4WZ5A 4RX2A 5FQKA 4JKTA 5HW3A 3ITAA 4U3TA 5HAQA 1PW1A 2JC7A 3PAGA 4XUXA 4IBXA 2QZ6A 2DCFA 2Y2QA 3GRJA 1CEFA 2Z2LB 2XLNA 3Q7ZA 5CHMA 4IEDA 5TFQA 3TOIA 2V20A 5EOOA 5A90A 4GKUA 2EFXA 2ZQDA 1PIOA 2Y55A 3MBZA 5CECA 4GZBA 4JLFA 1ZG4A 4DKIA 3DWZA 5A92A 4WMCA 5EVIC 4BQMA 1N4OA 3UDFA 3O86A 2ZQ7A 4C75A 2DNSA 4C3QA 4KZAA 4OLDA 4DE0A 3OCLA 2PU2A 3WS0A 1DJAA 4H8RA 3MXSA 5GHZA 1L0FA 1K55A 3PBSA 5FI7A 3UPPA 3PBRA 3IXDA 4UA7A 3WS2A 1TVFA 2ZC4B 1FCOA 1NRFA 2J8YA 3UY6A 1KGGA 3VP2A 3ZVWA 3E2LA 3ZFZA 3BFGA 2Z2MB 5M1AA 4OQ0A 1S0WA 2ZC7A 1TEMA 3A3IA 3DWKA 3BLSA 3UPOA 3G2ZA 1NYMA 3CZDA 5E2FA 2EXBA 4JXGA 4DE3A 4S2IA 3ZCZA 3A3FA 1XKZA 1MY8A 3IF5A 3N7WA 3O3VA 5BOHA 2H5SA 3AGDA 2Y2OA 1M6KA 1WYBA 2G2UA 5DTSA 3WS1A 1W8QA 3OPLA 1MWTA 1PZOA 2EX6A 1I2SA 1O07A 2XK1A 3MZDA 4KG5A 4UHUA 1ERQA 2WYXA 4E3MA 4MNRA 4EBNA 1BT5A 3CMZA 4BLMA 4E3LA 1LI0A 4ZJ1A 3ZNTA 3N8RA 4EBPA 3M2JA 2ZMAA 3G31A 1MKIA 1K54A 1KE3A 2ZC6B 3V3SA 2R9WA 4OH0A 1BLCA 3HLEA 2EX2A 1BTLA 2WKIA 2XDMA 2IWBA 3UE0A 2P74A 3LY3A 4OKPA 3UDXA 1NY0A 3RXWA 4KG6A 5GLAA 1E25A 5JYPA 3NDGA 3V39A 3DW0A 4S2PA 3SS5A 1TDLA 5E43A 5HARA 4GOGA 4KZ3A 5F1FA 2XD5A 4E3JA 3HLWA 5GLCA 4YFMA 1PWCA 2OV5A 3SH9A 2OLUA 3PAEA 4IVIA 4A5RA 2ZQCA 4GD8A 4HESA 2Y2HA 4IBRA 1H8ZA 5DTTA 1JWPA 3ZG7B 5CEDA 4X69A 4CJNA 3VOZA 1RGZA 1CI8A 1ZG6A 1ES2A 4S2LA 1XGJA 5CGSA 2XD1A 4JXVA 1E3UD 2Y2IA 1ES3A 2XH9A 1I5QA 3ZG8B 4E3OA 3Q07A 5GL9A 3Q7VA 2PBYA 2P9VB 1K25A 5E2HA 3UN7A 2B5RA 5I94A 1MWSA 4U0XA 1BULA 1VM1A 3ISGA 1MWRA 4PPRA 2UWXA 2XFSA 5KSCA 3HUMA 3N8LA 4R3BA 4R23A 5HAPA 5M18A 5TGFA 2ZD8A 4PM9A 4WZ4A 1Z6FA 4WBGA 2H0YA 4BL2A 1PWGA 4S2JA 4Y0OA 3FYZA 3Q1FA 4JF4A 1J9MA 4KZ4A 4X68A 4S2NC 3WRZA 4LENA 1N9BA 4EBLA 5CTNA 4P87A 3V5MA 1FR1A 3C7UA 5E2EA 1NZOA 1HD8A 5EVIB 1VQQA 4K0WA 4LCMA 3HVFA 1E3UA 1SCWA 3M6BA 3GMWA 3P98A 1TDGA 1L0DA 2C5WB 3A3DA 3EQVA 1L0GA 1GHIA 2I72A 1HTZA 3UNWA 2FFYA 3AGEA 5JYOA 3V3RA 3IT9A 1BSGA 4KZ6A 4OVDA 1ES5A 4ZBEA 5F1GA 1DJBA 2Y2LA 3ZG9B 3GSGA 4DE1A 2Y4AA 3NC8A 3QNCA 5EOEA 4DF6A 1MBLA 3ITBA 3QHYA 1ONGA 5GHXA 2ZQ9A 3G35A 4FH4A 1PYYA 4WELA 1K57C 5EE8A 3GV9A 5EUAA 1JVJA 1H5XA 5GHYA 3UDIA 1YLPA 2IWCA 2OSUA 4S2MA 3HLDA 4DXCA 1K57A 5HAIA 1SDNA 1M40A 1CI9A 1NYYA 5DF8A 1YMSA 2HDUA 2VGJA 3LEZA 1O7EA 2ZLYA 4OQGA 5FQ9A 3JYIA 2WUQA 3HLBA 1RCJA 3HLFA 3N4IA 2ZC5B 1ES4A 3S1YA 1IKIA 2ZQ8A 1PI5A 1RGYA 4JF6A 4E3IA 2Y2KA 1U60A 5FA7A 5CEBA 4MEZA 1FOFA 5KSHA 4R4SA 3UE3A 3SH7A 3W4QA 4LV1A 4X53A 3SH8A 1GA0A 3VFHA 5F83A 4QU3A 3UPNA 3BM6A 5EVLA 1NJ4A 3GQZA 2DRWA 3MKEA 1XA1A 4OPYA 3VP3A 5FASA 4UAAA 2V2FF 4QHCA 5DF7A 4E3NA 1NZUA 4KENB 4ZJ2A 3BFCA 3O87A 3M2KA 2XF3A 1IYOA 1K4EA 1DY6A 1XA7A 2RL3A 2WGWA 1JWZA 3IWQA 1FSYA 1PZPA 4R4RA 4XUZA 1JTDA 5L2FA 4R1GA 4PM7A 3IHAA 3OPPA 3IXHA 1KVMA 1GA9A 4OONA 4Z9QA 5DF9A 3FZCA 3IQAA 2H10A 1K56A 4JPMA 1E4DA 4P85A 4RA7A 3C4PA 4ZAMA 1XXMA 4ZDXA 4OOYA 5HL1A 2EX8A 3HLCA 2HP9A 4JF5A 2ZC3B 4X56A 3VP0A 3ZG0A 3GTCA 1KE4A 1CK3A 4F94A 4S2KA 1EWZA 4KZ8A 4GDBA 2Q9MA 4YINA 3OCNA 4OPZA 1ZKJA 4B88A 1W79A 4QJGA 1ESIA 4EUZA 4E6WA 4OLGA 4PM5A 3SS3A 4M3KA 1EI5A 5DVAA 3G4PA 3UO9A 3S22A 4DRTA 1W8YA 3VOYA 4O7DA 4OQHA 1SHVA 4KQOA 4WEKA 1IYQA 3IHBA 4OOMA 4JBFA 3Q82A 1K6RA 3HREA 5FQQA 1FCNA 2Y2NA 3ZNYA 3MXRA 3PTEA 5CHJA 3O88A 5HFOA 4EV4A 1Q2QA 3HUNA 4NETA 5G18A 3VP4A 4BL3A 5EVIA 3IF6B 2WK0A 4OP8A 4X55A 3GR2A 1BUEA 3G30A 5EPHA 1S6RA 1K6SA 3HUOA 5KMWA 1YLJA 3VSLA 2WKHA 4R0QA 1BZAA 1ERMA 2EFUA 3E2KA 1IYPA 2WADA 4ID4A 4DDSA 1W5DA 5FAOA 1KGFA 4HBUA 3PBTA 1I2WA 2XEPA 1FQGA 5CERA 4S2NA 4DDYA 4GB7A 4KZ9A 2HDSA 1KVLA 3DTMA 4QY5A 5FDHA 5FQJA 3ZG5A 1SKFA 3UE1A 4OQIA 4DXBA 1HZOA 1SDEA 2WAEA 2HP6A 3A3JA 2BLSA 4LV0A 2Q9NA 4N9LA 4FCFA 4OP5A 4WM9A 3IXBA 3BEBA 3BFDA 4S2OA 1IKGA 1L0EA 3FWLA 2Y59A 5CTMA 2OLVA 4KZ5A 2Y91A 5FI2A 4ZTKA 3MZEA 5GLDA 2Y2GA 4OPRA 1WE4A
chains in the Genus database with same CATH superfamily
3FYDA 4AZFA 1PU4A 1B27A 1P3QQ 1DVDA 2VGKA 3NY4A 3NUVA 3N54B 4FD2A 1W5ZA 1PW8A 1IV9A 4LFAM 1RNBA 1JTGA 5EM1A 5EP3A 3RTYA 4GD6A 4QWOA 1QVF2 4RNAA 3FE3A 1UUWB 3BYDA 1TFKA 2O9UX 1XFNA 4MBFA 1BNGA 1ROAA 4XDVA 4EEPA 3P01A 1T3BA 4Y15A 3OPRA 4BJPA 1IY1A 2O9BA 4K91A 1AQZA 3G0KA 2WSFF 3LTDA 4JRFA 1C3BA 2ZJ9A 1NNJA 1QAKA 3LCEA 5HX9A 5DJUA 3C3DA 1HU9A 4LJ8A 2YFJB 2MROB 5DKKA 3H7WB 5CRFA 3K9OA 4LGYA 1FUSA 2C9CA 2ZMVA 3K5TA 4ZJ3A 5IW9A 1O7WB 3NDEA 4MBKA 4YOFA 3C7VA 3SOIA 2LHCA 1OQYA 5CXWA 1YM1A 3C30A 2STDA 5IG4A 3GP1A 4P6BA 1UWNX 1VEUB 3MKFA 1QUSA 1ZMWA 4GDNA 2FFFB 3G32A 3A0SA 1CQSA 2BNGA 1LL8A 4Z1WA 3W8KA 5AQBA 2HMNB 2HP5A 2CHCA 1YE9A 1GL7A 3E99A 1J09A 3M8CA 2IWDA 4H6JA 3T15A 3ZDJA 3TJZC 3AOGA 1FCMA 1N36M 2WGVA 3NHXA 3SHFA 2KZUA 5EVEA 3KOWE 1TS0A 1RCKA 4FVMA 1TH4A 2FFJA 2CP8A 4HI4A 3NECA 1OF5A 4GLQA 4NOOB 2CMNA 3GLFE 3S67A 2JXNA 4DUZM 1PWDA 3MSHA 4X1MA 5BR8M 3B74A 3N6IA 3A45A 3I0YA 2ZBBA 1GHPA 1C7YA 4L8RC 1GKIA 3IWIA 2YKHA 1YLWA 4L9GA 3BNBA 2LVPC 2CFWA 4OOLA 4DBGB 3GLGB 4R9KA 1JZOA 2MGWA 4M9ZA 1W4NA 4HH3A 4D2OA 2WOFA 3I4VA 4GHOA 2WGIA 2ZM2A 1NWWA 1W2B2 1N34M 1R4CA 3AKZA 3UB6A 1JBRA 2Y8HA 2R0IA 1MU5A 3PCSA 3CME3 1J3WA 2EXAA 5HSQA 4IBIA 4G4RA 3C3EA 3GLGE 1JNUA 4GEWA 5FAPA 2KZSA 4OW0A 4JI3M 2Y2JA 2EKFA 3QP4A 1K82A 1TP6A 4YY3M 3T1XA 1GYBA 2X8AA 3U60A 3E4QA 3WS5A 1O7MB 2WZZA 4H3UA 1KE0A 2JP7A 5CGWA 2K31A 3KX0X 4OPQA 1QUTA 1VQM3 4WZ5C 4DUYM 3EE1A 4IHQA 3C4OA 5HPFA 1IEMA 2WGWB 5IHVA 1NVMA 3FSDA 3UGJA 3T8NA 4QOSA 2WKQA 4Q0HA 4PEJA 1RN1A 1YHQ3 1W63M 5FI6A 1YLYA 2R9XA 2JWSA 6STDA 1N9JA 4RNZA 4HY8A 4MBHA 5ITYA 4O8SA 4K0KM 3EQQB 1FR6A 3I04M 1BAOA 4GNUA 3OC2A 1MPLA 1NJGA 2LYXA 3FRIA 1QAQA 3CF6E 4HP9A 2FZ0A 4YWZA 3FTCA 4L8PA 1H8YA 3WHKA 3AHSA 4HZ9B 3HJKA 2QIYA 3IF6A 1LLBA 1XPBA 4AQYM 1F5MA 1OT6A 3BIRA 1SXJC 3DY5A 4WHAA 4L9FA 3H82B 1W5TA 4JXWA 4QOZC 4ORLA 3FC7A 1TTEA 4LGQA 4L9EA 3HKPA 4JGQA 2PD8A 1RU3A 4MMXB 1OMEA 4HJ6A 4R38A 4RVAA 3ULFA 3T1YM 1N33M 3WA2X 5LC6A 3FKVA 3AGFA 2ML5A 3O8YA 3TE8A 4K61A 1E32A 2Y21A 5HAQA 2AHMA 1PJIA 1LNHA 4UN2B 3AOEC 3RGPA 1IQ8A 2Y2QA 1QAFA 1CEFA 1WMPA 2VV8A 2NQ8C 3LCVB 5TFQA 3W67A 2Y73A 5AIIA 2EFXA 5L10A 3KS4A 1T1AA 1RGHA 2FOIC 1TGUA 2DAKA 3A76A 5GSPA 3CAXA 3F8XA 3AGOA 3O86A 2ZQ7A 4O02B 5HL6A 2W56A 4B7HA 4KZAA 2WSCF 2YR0A 4HOHA 3D79A 2PU2A 4JYAM 4H8RA 3WS0A 3MXSA 3Q2PA 5HPIA 1K55A 5FTKA 2CFKA 1S66L 1TVFA 2D01A 3S7NA 4LSOA 1R5LA 3VP2A 3E2LA 1L2CA 3CPTA 3Q8XA 3HU1A 3KSGA 4MDZA 4ESPA 2Z2MB 5M1AA 4FOFA 4RF1A 1GS3A 1TEMA 3BLSA 3CI6A 3DAVA 3RFBA 2DWZB 2AVXA 2EWWA 4JF8A 1I94M 4JXGA 4DE3A 3ZCZA 3U6SA 1FZUA 1XKZA 3IF5A 2KCDA 2YX9A 3O3VA 4QPRA 3A0VA 2CEAA 3GQ4A 2H5SA 1OAOC 4HKVB 3BXWA 3AGDA 5J3WA 3IG8A 3FG4A 2G2UA 2OAP1 2D02A 1OGXA 3UB1A 3WS1A 2VZWA 3CMA3 3MZDA 2XK1A 1PGYA 1IXSB 1ERQA 2WYXA 2MR9A 4EBNA 2BMQB 3JR5A 3BNEA 4DV2M 4M0WA 4IPBA 2A24A 1I70A 3M0EA 3QRDA 2DAEA 1KE3A 3R7WA 3V3SA 3K63A 3U5ZB 4OH0A 3HLEA 2XDMA 1XJ4A 5ITQA 3UE0A 4AKHA 5G4YA 3L28A 1XMOM 1VEJA 1OTEA 4MMYB 3RXWA 4KG6A 4IIWA 1WA9A 5G4ZA 4NL4H 1FW7A 2AAEA 3NDGA 3GAXA 1TDLA 1K3XA 5C18A 1LXEA 4E3JA 2KDLA 4KT0F 1BGSA 3HLWA 1Z1SA 2B18A 2OLUA 1EKMA 2L0WA 4IVIA 3HIIA 4IBRA 1H8ZA 4EIWA 5CEDA 4NSOB 4X69A 3DXOA 2OQEC 4NHFA 2QBYA 3HZJA 1JN5A 3NBBA 1OGZA 1T1CA 2OTL3 3L27A 3J2PB 1IN4A 1ZMUA 3GQ5A 1NDOB 5J4EA 2DKLA 4B3TM 2HF6A 3NX0A 5EXXA 2XH9A 4BLCA 3GLIE 1Y4KA 2KOIA 2VF7A 3AGNA 2C99A 3ZC7B 4U0XA 3JVUA 3ISGA 1D6YA 4Q7JA 2Z6CA 2KDKA 1RDSA 2PBDP 2UWXA 2XFSA 2GZAA 3PFIA 4R23A 4J5GA 2Y79A 4CCVA 1Z6FA 7CATA 4O8GA 2BMOB 2ZDJA 3LR4A 4DJ2A 5IEOA 3VK7A 5STDA 3UNLA 4Y0OA 2KRUA 1J9MA 5A0OB 5LBRA 1XXHE 5CTNA 2P7JA 3T4SA 5E2EA 1IVXA 5I5LA 1HD8A 3J7AS 2CX0A 5EVIB 2KW0A 3C8CA 4GHIA 3B7ZA 1JRQA 2DAMA 2LBCA 2RBIA 3T4KA 3P98A 3T4QA 5HWVA 4R71A 4HM8B 3GLHE 2XA7S 3UK6A 3F1OA 1I0XA 3AGEA 1Z5AA 1LSXA 4MB7A 2R4IA 1BSGA 4ZBEA 2C98A 2R46A 2Y2LA 2ZOIA 1OIPA 3U5ZA 1OHSA 1Q3CA 3SYUA 2Y4AA 1WR1B 4DF6A 3ITBA 4GH9A 3WHOA 3KFQC 2ZQ9A 4E04A 4FH4A 1ZQ9A 1K57C 4WELA 3GV9A 1DP9A 5L09A 1TD5A 2QHKA 2FH5A 3K2NA 4CHTB 4DMZA 4LF4M 2WGQA 3UDIA 1HJPA 4LJ5A 2UUGC 4S2MA 3QWLA 1VG5A 4K90B 1IY0A 1OTBA 1K57A 3TE6A 1Y4OA 2VIIA 1NYYA 4D60A 2VGJA 1A5TA 1GY5A 3D72A 1O7EA 1DETA 4LRYC 2VDBB 3KDSE 3JYIA 2CWVA 2E8JA 1SPUA 3RGAA 3OX9A 2LTUA 4NXMM 1PI5A 1RGYA 2Y2KA 1YNVX 5FA7A 4LRTA 4HYZA 4FCVA 5KSHA 2DNAA 1FGTA 4KFDA 1K734 4R4SA 1AIPC 1FGRA 2OOBA 1GA0A 3U6QA 3VFHA 5F83A 4XT2B 1YGEA 1YJ93 5IT9S 3OXAA 1VZZA 3KFUG 1NJ4A 3BM6A 4QNMA 3GQZA 3PR6A 1MGWA 2K0BX 4UAAA 1SXJD 5HDCA 5F68A 3HJIA 2GEYA 1IM2A 5EP1A 1JB4A 4KENB 4LCBA 3BFCA 3MFXA 5HWWA 2XF3A 1BOXA 3H7WA 3IWQA 3KO6A 2JZ1A 1PZPA 3NBXX 2Z4RA 1D0KA 3IJEB 1GA9A 4IBKA 2O99A 4Z9QA 1Q9EA 2L7IA 3B7QA 4G4QA 1L1TA 4JPMA 4O01A 5F69A 3U2AA 1Q7HA 1AWIA 2HP9A 4JF5A 4X56A 2M1CA 2VGLM 1QDTA 4KZ8A 4H6JB 3PS8A 2Q9MA 5MC7A 1GVNA 3V99A 2VQEM 2E2UA 4ILFA 4X64M 4EUZA 4IUKA 2IA7A 3MJQA 3SS3A 3S22A 1DO0A 1W8YA 3KOZE 3Q1CA 3MMPA 2L4RA 2BU4A 3TWLA 2CFGA 3MG2A 3H4JA 4MMZB 3Q82A 3HY5A 3PHYA 3ZNYA 5CHJA 5IU1A 1KSFX 3AMOA 3HUNA 1LOXA 4NETA 2Z4SA 4BL3A 3GLHA 1SXJA 4CIZA 3IF6B 4EU0A 2I7NA 3IX4A 1W6CA 4I5QA 5BPVA 2OOAA 2EO2A 3HUOA 3U4LP 1YLJA 1W01A 3E4OA 2WKHA 4BTXA 4DDSA 2W1TB 1TR8A 2DAGA 4KFEA 1KGFA 3HHYA 1FQGA 3PYPA 3KCHA 1AV4A 4DV3M 2UXBM 1VQ1A 3RGSA 2D42A 1QYRA 1P9WA 5FDHA 1BRSA 2QWSA 4AKZA 4R3DA 4DXBA 1G0TA 3K7CA 3NM2A 4WYKA 1X1YA 2WAEA 1YKDA 4LV0A 3GRDA 4DR5M 3NOTC 3T8UA 4WWUC 5AIHA 3AHWA 3PXPA 2HMMB 4NXBA 1I2EA 1TRPA 3SVAA 3NULA 1GOVA 3M7GA 3ICYA 4G3WA 5IERA 1N75A 4HEFA 3UMDA 1GO5A 3ZQJA 2G3QA 4DV5M 2F5SA 4TUWA 2XR8B 2XZUA 4WMCD 1KDSA 1BSAA 1GY7A 4HM4B 4NC6A 3FLJA 3KSFA 3CNXA 3HI7A 3CXC2 4DE2A 1GMPA 1GCEA 1XHBA 4C6YA 4EWFA 4RKUF 3CGWA 3CNMA 3HLGA 3LY4A 2QPNA 1XMQM 3SYKA 4B4ZA 2VQFM 4HIAA 1OAIA 3BQAA 1N77A 1FUWA 2A2LA 4I3JA 4BD0A 3CLOA 3WS4A 3IXGA 1DMNA 2J9PA 1P9RA 2R41A 2WKPA 2R45A 1ZS7A 3A3EA 3T38A 3OPHA 4Y7PA 3L25A 3FUWA 2PD7A 1TUHA 1BRIA 3WDGB 1A2KA 1RN4A 2F4YA 2QZ4A 2CC1A 1Z59A 2XR0A 3KW6A 4Y5FA 3QP6A 4YNRA 3HHZA 3T4OA 1BU4A 1ALQA 2ZTCA 4MH0E 3Q8GA 4BBAA 2BG1A 3Q3FA 1IXZA 4M0DA 2J7NA 4REZA 4OU7A 2YFIB 3DTIA 4N1XA 3HJQA 2UXDM 2F86B 1AXBA 3BLMA 4MGKE 2CC3A 1OTAA 2J9OA 3D3LA 2OWJA 4Q53A 2E8IA 3AJIB 3DOAA 2XSZA 3OBFA 1NRJA 1L2BA 4FCJA 1LHYA 3CUEA 3GVBA 3HU2A 3KE7A 3CPOA 2BHMA 2LHGA 2L1MA 3VLFB 3B3XA 5HD5A 1STDA 3MQOA 1RGLA 3F92A 2QSFX 1GHMA 3ROBA 5EXPA 4WFOA 1FUTA 3PBNA 1JR3A 1YLAA 2DZOB 1BNRA 1N32M 2GU3A 3V92A 4NK3A 5H37D 2OAQ1 3NI9A 2CKFB 4GC5A 3NBLA 4FUWA 4ARZB 3U1WA 1GOUA 1NXYA 4E3KA 1V33A 2LWXA 2B95A 1D06A 5HWTA 3EN8A 4MN7A 2JCHA 2ZM8A 2HWJA 2MJ6A 4ITQA 3MZFA 1FNNA 1DO2A 3NV0A 4B4XA 3DMCA 1UCIA 4G4NA 4NSRA 1BLPA 3KN4A 1QMFA 1US1A 5GLBA 3SEDA 4GN2A 2QKPA 2F5OA 3OOVA 3SX1A 5IWAM 1YLZA 3EIHA 1BNFA 2YNMD 4IJGA 1RRLA 3LR3A 5AEWB 3D8LA 3Q7VB 3UJMA 4K08A 2VA0A 2D7HA 1I8VA 2NUTC 7GSPA 1H8MA 2XLJA 4PKYA 3C5AA 4GL6A 4ANRA 4N6V0 1RGFA 1MKMA 3J7Yd 2XSZD 4P0MA 1QVRA 2P9VA 6RNTA 3BQ8A 1LOYA 2KNVA 3IWOA 4RX3A 5IG0A 5CF1A 1S4RA 1ROVA 5ELJA 2LVAA 4AW4A 2F5QA 1TJDA 5CK6A 3G4S3 1N5HA 3KOXE 2ZTDA 3GQ3A 4FMDA 3EIEA 1T19A 3PBQA 2WAFA 3SS4A 1J2BA 3AOEA 4II7A 1R4GA 2RCXA 4EQ1A 2YKFA 5EECA 3QP8A 3C58A 1Y54A 1DE3A 2Y74A 4KZ7A 4GHIB 4Q8IA 1V58A 4LGMA 4MGYE 1OTDA 3P09A 4R3JA 3CG5A 1LL9A 4N6MA 2OOVC 2PU4A 5U47A 4JI4M 4EXOA 2HOHA 3BJNA 3VP1A 2WZXA 4HHDA 4BTYA 2X01A 1YAXA 3FGYA 3A98B 2EX9A 3R9XB 3RJUA 2UU9M 3E98A 2F98A 1MGRA 2XGLA 2H0TA 3HCYA 3LI9A 1FJGM 3BB9A 3UZUA 3PXGA 4FCMA 2DXIA 1IYYA 4HJ3A 3D4FA 1DGHA 5A2QS 2KX6A 4LF6M 4GS9B 3X3YA 5F82A 2Q2EB 2QPAA 5F5YA 4BENA 1NJFA 4FWGA 3KOYE 4D81A 1HR0M 1CH0A 4L8OA 3MFDA 1Q2PA 2A49A 5FQKA 1JJ22 3C38A 4RX2A 4WZ5A 2C5RA 4XUXA 3PAGA 1Z5BA 5FSWA 2BWBA 3PCRA 5G1LA 4IBJA 4K1VA 1ISKA 1SXJB 3JUQA 1M1XB 2HMKB 4IEDA 1TH3A 4FCWA 2JQ5A 2V20A 5EOOA 2J3WA 3ZH9B 3SAWA 5IF6A 3UMEA 4PDGA 2G8LA 1PIOA 1VETB 3A42A 4GZBA 1EUIC 4DKIA 5A92A 3DGLA 4WMCA 4JV5M 1JKGB 3SC3A 1N4OA 4LG2A 4C75A 4C3QA 1B20A 4OLDA 1RGCA 3OCLA 5F3WA 3FPVA 4IIAA 3MF0A 4FTXA 3NBIA 1ZV1A 3FF2A 1AVLA 4KFFA 1L0FA 4PKYG 3UPPA 2KXGA 3LI8A 4UA7A 3WS2A 4Q0IA 1NRFA 2J8YA 3WODG 3KSED 2CFDA 3DTEA 1YPRA 1IBMM 4R4KA 2HMOB 4JI5M 4OQ0A 2W04A 3RH8B 1S0WA 2ZC7A 3DWKA 1E97A 4LZIA 9RNTA 2Y20A 1IN6A 2Y0TA 3RE8A 3A3FA 4LLOB 5BOHA 3N8BA 1MJGM 3UB5P 2Z7AA 5IREB 1BIRA 4HM0B 1VEGA 1CYUA 2LB5A 3AV0A 5DTSA 1IT7A 3HX3A 2WKRA 1X1XA 2RFRA 1MWTA 1W8QA 4KG5A 4KT3B 3W2ZA 4UHUA 3GZXB 4E3MA 4MNRA 2M7VA 4M9SA 3CMZA 8CATA 4BLMA 1WMNA 3GRRA 3GO8A 3VE4A 3ZNTA 4IBGA 1ZMVA 2DAIA 3G31A 1MKIA 5CLKA 1K54A 1ACFA 4I39A 3U97A 4HM7B 4CQHA 4Y13A 2R9WA 3B8LA 2IWBA 3U61B 2WKIA 3LUQA 2L4EA 3F1PA 1L2DA 1X37A 3JUOA 3UDXA 1KD14 4CGYB 2ERCA 1E25A 5JYPA 3FZWA 2W1TA 2KRTA 1DP8A 3CITA 2BJVA 4FWHA 3B7NA 1M9GA 3SS5A 2HMJB 2W0QA 2QNJA 5GLCA 3OW22 3KP0E 5LC7A 4OVZB 2V1CA 3PXMA 2EJSA 3GRYA 1D6ZA 3T1RA 3S7OA 5BVBA 3ZG7B 4NXNM 3IX3A 2W27A 1EEJA 1CI8A 4XT2A 3FUTA 3U6DA 2ZL1B 5HZHA 1XB2B 4LGWA 1QZEA 2XD1A 4AKYA 3D9RA 1E3UD 4FMBA 1ES3A 1I5QA 4E3OA 1UFZA 3Q07A 4NKPA 1NNVA 2DWNA 1K25A 5E2HA 2UUBM 1VQN3 1UI8A 3ILKA 2W82A 1IT8A 1K41A 5TBMB 3F14A 4K1UA 1VM1A 3T1SA 1V9ZA 4KLNA 4LJ7A 3MG3A 3RGRA 3U60B 5KSCA 3LR5A 4R3BA 4BBTA 1B2MA 5K5BA 4MCWA 2OOLA 3BWLA 4IBBA 4WBGA 4HL4A 3IX8A 1UUGB 4MMNA 3OLOA 1SIIA 2F56A 3MG1A 1PWGA 2GX5A 3Q1FA 4KZ4A 4BWIA 1LOWA 4S2NC 1N9BA 1U5OA 3GPXA 4OVMA 2C96A 4NPBA 4K0WA 3JUMA 2ZMFA 3STDA 1OT9A 4HP4A 5HGRA 1YSQA 3GMWA 1ULJB 4LYLB 1L0DA 1V9YA 2XZFA 5AIFA 4LPZA 4B93A 3KSPA 5DJTA 2R6FA 3CU3A 3KSHA 5JYOA 2L2DA 1E94E 1DVCA 3QK9A 5D81A 3CPTB 4OVDA 1ES5A 4F3LA 4EC6A 2ML6A 3WR2A 2W3GA 4LJ6A 3GSGA 4JI8M 1BSEA 3MWZA 1MBLA 1ONGA 3LIDA 3R7WB 1NV9A 2DHYA 2QP9X 4LF9M 3CCS3 1B21A 2O0YA 5GHYA 2JY8A 1DV0A 3CCL3 2LXEA 1SZVA 1YLPA 3CWFA 3DGYA 3HZPA 1CI9A 3EGXC 2I9VA 1UW1A 5DF8A 3V67A 5F6AA 2OCTA 3LMMA 3ER7A 4STDA 1OHPA 2CH9A 5A8BA 2RGQA 2WUQA 3HLBA 1RCJA 5IG3A 2ZC5B 1GSVA 3HU3A 1IKIA 2ZQ8A 3IHPA 5IG5A 4JF6A 4EETB 2F5MA 5CEBA 4QWTA 1N9EA 2MF7A 4FMAA 3EC9A 2Z7JA 3SH8A 2JZ0A 2L7HA 1W6YA 5EVLA 3MKEA 1VDDA 2PNCA 1XA1A 4N6OB 4QHCA 3TRCA 2GNXA 1MNLA 5EP4A 1K0KA 1BUJA 4FCTA 4ZJ2A 3VGNA 3A46A 4DN0A 2RNTA 2PR6A 3O87A 1H3QA 1XA7A 4I38A 3IG5A 2ZL8A 1BSDA 2CG0A 3G6E3 2G7UA 1NLYA 2KRKA 1JTDA 4LJ9A 2CWBA 3KP1E 2OTJ3 1BUQA 2B02A 4MN5A 2BASA 1IFQA 1IU7A 3BNDA 3DGOA 1D7EA 3F1NA 3FZCA 5DF9A 4GHAA 1K56A 1B2ZA 2G5GX 1E4DA 1XXMA 1M904 3T1QB 4ZDXA 1SXJE 3AMOB 2EX8A 5HL1A 1M1K4 4LEHA 2L4FA 1AVKA 2XA7M 3ZG0A 2V1BA 4XDWA 2LQVA 3TWKA 1YI23 2C11A 4F94A 1FYSA 4EXRA 4RNYA 3OCNA 1SG9A 4OPZA 1ZKJA 4QJGA 1W79A 2IY2A 4OLGA 3LIEA 1EQKA 1EI5A 2JKFA 1JB2A 4GHLA 4HEOA 4O7DA 4OQHA 3LXUX 1G71A 4KQOA 5TGNA 3H9WA 1IYQA 2HV1A 2Z3XA 2WO0A 1K6RA 5EXSA 1FCNA 5KPZA 1I0VA 2QGUA 3MXRA 5HFOA 3O88A 3H4MA 4G1MB 5EXTA 3MSOA 5C5KA 3VP4A 5EVIA 3KSJA 4OP8A 1BUEA 5EPHA 5KMWA 1Q02A 4IBFA 1GJSA 4AKGA 1STFI 5DREA 3F8HA 3VSLA 1AUAA 4BU4A 1IYPA 3R8FA 5AYRB 4ID4A 3VFDA 4I4LA 1W5DA 3B4PA 4HBUA 3VOLA 3T1HM 3PBTA 2XEPA 3T50A 1ZAEA 3EN1B 2J8XB 3CCM3 3GECA 4X65M 4LF5M 3LGOA 4KZ9A 2KF3A 2HDSA 3DTMA 3K9MC 1LNIA 5AEUB 4QY5A 1SKFA 4B08A 3CD63 1F9IA 1HZOA 4Y3IA 1JV2B 1HLUP 3FG3A 5IS1A 4N9LA 1K3WA 2V1UA 4OP5A 4WM9A 4JN6A 1O7NB 3NOPC 3BEBA 2GBXB 3BFDA 4S2OA 3FWLA 2IA2A 2M7UA 2Y59A 3B4OA 1UGUA 2PT7A 3X3ZA 5FEFA 3KYQA 1XNQM 1RMSA 3K3CA 4DV0M 5GLDA 4LF8M 4GKKM 2X02A 3G34A 4KO8A 3SARA 1DMQA 4UA6A 2M5ZA 1PYLA 5DTKA 2XQZA 1TS8A 4PCZA 3FKWA 2W0NA 2QEX3 4KQQA 2V1AA 2VJWA 1XX2A 4RYEA 2F5NA 2CWTA 1UGIA 2ZBKB 3CCU3 4IBEA 4FD8A 4ETXA 5JI2E 4I81A 1IBKM 1EW0A 3ZGAB 4N9KA 2G2WA 4MEIA 5A93A 5KIZA 1C7HA 2PYPA 3PNVA 2R18A 4EW7A 2ZM6M 2PRFA 3GPUA 3G2YA 3LT9A 2P04A 4R7GA 3FTEA 5D3OA 5EV0A 1MXOA 1OPXA 3B42A 4RZMA 3LYXA 1QDRA 4BBVA 3HL9A 4XM4A 1RNTA 2LVQD 4Y2FA 1NWZA 5EJCA 3G8ZA 4JGPA 5JI3E 1W63Q 1Q864 3MQ0A 4PM8A 2QJ5A 4EBPA 1QMEA 4E6XA 4U0TA 4X6TA 2BJWA 3FTFA 4Z6YA 2M60A 1S5AA 2V8FA 2OQEA 1V57A 1C54A 1DMMA 2JBFA 5TR7A 1K55C 1LT0A 1NSFA 3LR0A 1HT2E 4CLCB 4CLCE 4ZRRA 1Q3BA 1Z6TA 1EE8A 1BNSA 1ZHHB 3CJMA 1W2ZA 3SLUA 1PM5A 4Q0JA 1T18A 1OHOA 3PBOA 3IS2A 2UX0A 1K9M4 3BECA 2BNKA 1LQMB 2EA9A 1TDZA 1GD3A 4EUVA 4AKIA 5KPTA 3LVVA 5CHUA 3CHWP 1PJTA 1UCLA 1NJI4 1HNZM 4GB5A 3EQUA 2HMLB 2JY6B 1IVWA 2FGTA 2BTFP 4WL9A 1OF5B 3FPWA 2IUJA 4CDLA 4Y17A 1TFOA 1TIJA 5KQDA 1YT4A 2HPBA 1WHCA 2WKEA 3TG9A 2JKTM 2VF8A 3S4XA 2CV0A 2DWMA 3GZYB 3E9SA 1VQO3 3CCJ3 1L5GB 5AQ9A 1OH0A 3LIAA 3ZVTA 3NXJA 1I2FA 4OVZA 1TU5A 3LW5F 2A5YB 4GIPA 1G59A 2C10A 1DJCA 4WF0A 4J5KA 3W4PA 3RNTA 3LO7A 2JE5A 1NV8A 3AFHA 4A3VB 2DWLA 1HZ1A 1SJWA 1PI4A 3S28A 1CEGA 3B9PA 2W3FA 1U8CB 2CFOA 1YQSA 1RGEA 2CE7A 3G16A 3KZTA 3L7HA 1RJOA 1SKOA 3OZHA 4DV1M 3UB8A 3Q81A 1K4FA 2OPFA 1L3LA 3I7JA 1L2SA 3HBRA 4LFCM 2CRUA 3G6OA 2C6WB 1Q7Y4 3TDGA 1ORYB 1IVUA 4LRSA 5E6JA 3X40A 2ZL1A 3T4JA 2D7GA 1ZGXA 2EA0A 3F1OB 4Y0UA 2K0MA 3WRTA 1IN7A 3TSGA 2UGIA 3UJNA 3B33A 2GBWB 3D5IA 3GLFB 3PZWA 3CCV3 1JWVA 2KF4A 4JXSA 3FV7A 4F1IA 2K6BA 1GD4A 1Q40B 3FKEA 1Q40A 3O5YA 4KG2A 1TH2A 1YJN3 1K56D 4R1KA 1JR3D 2OWPA 1E9RA 3U6OA 1HVBA 2Y2MA 2L09A 3PYJA 1YLTA 4PMAA 1UM8A 1RSNA 3D5GA 5EM0A 1BLHA 3BNCA 4WP5A 4X62M 1V34A 1ONHA 1BNIA 3QP5A 4D80A 2KLIA 4KQRA 3IS2B 2H5XA 1IXSA 4W5WA 3BFEA 3HIGA 4DR4M 1IK3A 2I9WA 4KQDA 5FQMA 2GSPA 2A24B 2M7OA 3QNBA 3I4YA 4WYYA 2Q0OA 4N6LA 3IF6C 2XFTA 2JNHA 2R4JA 2W6JH 5KZHA 1JKGA 2VLGA 5DRVA 3LQQA 1G68A 2JUJA 1L1ZA 2A3UA 2XRXB 4GCZA 3NM7A 5EVID 2W3DA 3W4OA 4L78A 5AQAA 1KSIA 2X71A 3IH8A 2ZM0A 1B2UA 4U3TA 2Q07A 3MYTA 2DCFA 3FRHA 3MHEA 1Z5CA 1HQCA 2N35A 3GRJA 1CQAA 3Q7ZA 4LJ4A 5CHMA 1D1JA 2HJEA 3TOIA 4EEUA 1TTOA 5A90A 3MPHA 4GKUA 2VGLS 2KF5A 2RCDA 2AADA 2P0XA 2OOVA 1IQXA 1STZA 2ZQDA 4HQAA 3S29A 5HD3A 4X25A 2Y55A 2PYRA 4JLFA 1OTRA 3VKGA 3CC73 1JN5B 5DFXA 3VKHA 3F9SA 5EVIC 2CUZA 3I01M 3KSIA 3UDFA 3WOEB 2J3TC 2DNSA 1S4SA 4FWDA 3DH2A 1J5EM 2RKOA 3HHXA 2XSSA 3FH1A 3PBRA 4BBUA 4KHPM 3SFZA 3UY6A 4MGIE 3IMAB 2PAVP 4XBYA 3GRUA 2F5PA 4ZPXA 3ZVWA 2HCBA 2IMJA 3ZFZA 1NB5I 2PR5A 2O01F 4R3AA 3FF0A 5DKLA 4F3LB 1X1WA 1GMQA 3VDUA 3A3IA 3UPOA 1IBLM 4J9AA 1VQ63 4G3OA 3G2ZA 3CZDA 2XSOB 4UQIM 5E2FA 5CX7A 1NB3I 1DGGA 4S2IA 1MY8A 3N7WA 3H3HA 1G6OA 3ZCBB 1IXRC 3SBJA 3CCE3 2Y2OA 3KIIA 5JPUA 5ITXA 1D2NA 4OPYA 1VQL3 1I2SA 1PZOA 2EX6A 3OPLA 4ETZA 4O2HA 4RBNA 2E2VA 1PRBA 1YSYA 3F7SA 1OTIA 4S12A 3N8RA 1HT1E 3OTOM 2Z8YM 1XC8A 3M2JA 5FTMA 1NU3A 2J5YA 5D83A 3JUNA 4N3VA 3BW6A 4NXEA 4HBRA 1N5PA 1BLCA 3FD9A 3SZTA 3U6LA 5I97A 1WNHA 2HHHM 5AIGA 3I563 2P74A 3SYLA 3DFZA 3LY3A 3K0ZA 4OKPA 3K8ZA 3ECFA 4DV6M 2ZAMA 5AYSC 4JI0M 4JI1M 1JNQA 3TPZA 4LY6A 5GLAA 3V39A 4X66M 5HDSA 1NY6A 3WOFB 1D0MA 4TX4A 1GL6A 1GLNA 4LMIA 4GOGA 3ZYTA 2XD5A 1XXHB 2QYBA 3D9YA 4IBDA 2OV5A 3FCSB 3D3OA 3PAEA 4HESA 1XNRM 2Y2HA 3LIFA 1B2SA 1JWPA 5DTTA 2HZ5A 2F99A 2MJ5B 3VOZA 5DFYA 3F1NB 5KO3A 4S2LA 2L1SA 1XGJA 3MJ5A 3FUVA 5CGSA 1XJ6A 4G3KA 1QVG2 8CHOA 4JXVA 1ODVA 1NHGC 1VDLA 2Y2IA 3B7CA 1YSPA 3ZG8B 3GSPA 2PBYA 2P9VB 3Q7VA 3MXQA 3D8BA 5I94A 2FE8A 1AY7A 1LVNA 3LIBA 3GPYA 3P7NA 1MWRA 4PPRA 4PDIA 4IJEA 3B47A 3HUMA 5M18A 5HAPA 1T43A 3Q90A 5TGFA 4WURA 4Z8XA 2ZD8A 5BXQA 4PM9A 4WZ4A 4D82A 3QP2A 2BWEA 4FW9A 3KSXA 2W2CA 4N6TA 2E2TA 2W3EA 1LQGC 2H0IA 4PHTA 3OV4A 1BRGA 2HKJA 1QQWA 5EQTA 1JBTA 4X68A 3WRZA 4NEED 4EBLA 1JB5A 4GSPA 1VQ93 1TF1A 4LENA 4AI6A 4P87A 3V5MA 2K9DA 1DP6A 3C7UA 1NZOA 2PHYA 2V0UA 1VQQA 1Y8GA 4LCMA 3WA3A 2KNZA 1WIVA 1UDII 4XBXA 2J80A 3M6BA 2DZNB 2K3DA 1D0LA 1WQLB 3FG8A 3A3DA 3BLZA 3EQVA 3T4LA 2KF6A 2J3TD 1HTZA 3UNWA 2V8CA 2LVOC 5FDSA 3IT9A 3HJ8A 4KZ6A 5F1GA 1DJBA 2UV0E 1T6OA 1WMOA 1LSWA 1MN3A 1QAOA 4DE1A 3NC8A 1GSPA 3QNCA 4I8OA 1N8R4 2LH0A 3K2LA 4ARZA 1TF0B 2B1XB 1EIJA 2C4BA 2PDRA 5EUAA 4PD2A 1OUNA 2CV1A 1JVJA 2W1RA 3PVSA 1H5XA 2X4AA 1YIJ3 2WZJA 1RTUA 2D7EA 3VF1A 2IWCA 2OSUA 2Z6DA 2ZANA 5FTLA 1JZDA 1R2ZA 4M9XA 3LQRA 3PNYA 3CCR3 3LEZA 1HYFA 2ZLYA 3LMLA 4OQGA 3DGMA 2MC8A 3TL4X 1MX0A 3B89A 4DR2M 3LTBA 1Q39A 3S1YA 4DR7M 1K8A4 4KZ1A 3H82A 2B24B 5ELUA 4B7GA 3W0LB 2BIRA 4L15A 2F5WA 3SH7A 3UE6A 3W4QA 4O0PA 3JPUA 3EWKA 4UEYA 1OFHA 4JGRA 3UPNA 4XBOA 1R2YA 2DRWA 3GLIB 2JY5A 5FASA 5DF7A 2R78A 5AI1A 1G3IA 2F4VM 4JI6M 1DGBA 4E3NA 1NZUA 3SW1A 2OWHA 1BSCA 1IY2A 3SOAA 4QHSA 1LRAA 3DM8A 1IYOA 1DY6A 1VQP3 1JWZA 3KS8A 3C2WA 1FSYA 5HOHA 3RFWA 4R1GA 3TWMA 4J8TA 1C1KA 1KVMA 3OPPA 4OONA 3EEAA 4L7KA 5FW5A 2H10A 4LRZE 2K2NA 1Z09A 1VHMA 2YQZA 2K7SA 3HLCA 3IBRA 1GSXA 2ZC3B 3VP0A 2KHHA 4L16A 2JKTI 1B2XA 3S7QA 1CK3A 1YGWA 2HAKA 2P05A 2ZHXB 4P6ZS 3E4PA 1EWZA 3L2AA 1ULIB 4YINA 5AVFA 5ITUA 4AG6A 3NOUC 3R4KA 3L26A 3SHGB 1ESIA 4E6WA 3KYZA 5JPPA 5DVAA 3X3XA 1MZUA 3UO9A 3VOYA 1OFIA 3FG1A 1SHVA 4WEKA 1OJLA 4LZJA 5KPRA 1IFYA 1PJSA 2YFLB 3QP1A 2J7OA 3E46A 4JBFA 2RGHA 3HREA 5FQQA 2OO9A 2Y2NA 3M6AA 5FLXS 3PTEA 3S27A 5CF2A 1Q2QA 4IUHA 4HVNA 2FH0A 3CF0A 6GSPA 5CXOA 2QHOB 2VV7A 1MOLA 1OJ5A 3GR2A 1HKXA 5FGOA 1S6RA 1VB6A 2D1WA 4P6ZM 2P5TA 2QJ7A 4JGOA 2CK3H 1BZAA 1ERMA 1T1BA 2EFUA 1S723 2WADA 1BNJA 4BIRA 5FAOA 1OKSA 1I2WA 5CERA 4DDYA 4R9LA 4I3AA 5IZ7D 4XBTA 1N9NA 1KVLA 5FQJA 2ACGA 3UE1A 4N6UA 2VV6A 1Q814 2HP6A 3H51A 7STDA 1VQ73 2BLSA 2Q9NA 1QAMA 2O9AA 4DJ3A 5ITXE 1A2PA 4NRWA 1WXQA 1UUVB 3NQZA 3CPW2 1Y28A 3IXBA 1IKGA 1H6UA 2ZAOA 1RN7A 5CTMA 1RGGA 4HZBB 1ASKA 4HM2B 1PFPA 2Y91A 5FI2A 4GMQA 4ZTKA 4B3MM 1VQ53 2Y2GA 4OPRA 1WE4A 2VKSA 2V6ZM 2INWA 4G6ZA 4MLLA 4LV3A 3VSKA 4QD4A 1RHLA 2HDQA 3J27B 1MC0A 1N78A 2VK3A 3BY9A 3RDEA 1FA3A 1RKYA 2KAAA 1PRQA 1XP4A 1I3FA 4FSFA 4WN5A 5KP1A 1TS6A 5D82A 3KXEC 3NCKA 4XXRA 3V50A 3FYCA 3N8SA 1RP5A 3OWSA 4IT7A 2JN7A 4AEQA 1W7CA 4L6V6 1CEWI 2SARA 1QJGA 1WYCA 1P0ZA 3BFFA 1G6AA 4K0XA 3HJSA 2C9OA 4IJFA 1YUBA 5FQIA 1V74A 2J7VA 2CG1A 4EBGA 1F2KA 1S67L 2QA43 2FS1A 1K38A 4UQIS 4MGZE 1BSBA 3MS6A 4HH2A 5FAQA 3VFFA 1BRHA 1IELA 1G8PA 3VE3A 1TS7A 2BT3A 1W00A 1G41A 2QMIA 4UA9A 3CCQ3 2CHGA 4QY6A 1CUKA 2DHRA 2O5RA 1SARA 1NY5A 5J8XA 3NQYA 3K9PA 3IH9A 3NHQA 1KGEA 1Q42A 1QANA 3ZHHA 1O7HB 4GITA 1NNUC 1OJGA 4LV2A 2A15A 1ZC2A 1G28A 4FR9A 4FH2A 1DYUA 5RNTA 3E21A 5DFLA 4L4UA 1VQ83 3KKGA 3A0RA 4N92A 3SMPA 2V1LA 1G5UA 3LZAA 2ZQAA 1PNEA 4PM6A 2HGVA 1S1YA 1BVIA 4RF0A 5HDDA 2H0HA 2BMRB 4IBCA 3U6CA 4KZBA 3LICA 5AJGA 3LVWA 3J81S 1UCKA 1A90A 2HDRA 3L29A 4CPKA 3TW8A 3HWSA 3JVCA 1ESUA 4N1HA 3DTKA 2XGNA 1MWUA 1W5SA 3VMAA 1RLSA 5EQLA 5AQ7A 5EFWA 2R4EA 1G4AE 1K54C 1BRJA 5A91A 4GC9A 1GABA 1XXHA 1RGAA 3BRMA 4KUKA 5L8MA 1X0OA 3VV4A 2XRNA 4IVKA 3J80S 1G96A 3M6HA 1SIHA 5KP4A 3JVVA 4AFIA 4DR3M 2LB9A 2Z77A 1A0KA 3MZEA 4EQIA 2APLA 1YMXA 5E2GA 2V1ZA 2DI0A 3V76A 5IEPA 2R44A 3LT8A 1IYSA 4M4XA 5M19A 1I3IA 4Y0TA 4WUJA 5C1BA 1BYWA 3GDIA 1LI9A 2JDIH 3AL0C 4JXJA 2Z76A 4NXGA 4BD1A 1EROA 4B9OA 5E26A 3RXXA 3NBJA 3SMSA 3SOYA 3NIAA 4HBTA 5FSRA 2RGOA 1IQYA 3GZBA 1RRHA 4L0LA 5CGXA 2HL7A 2IYJA 2QQ8A 1PY3A 2CIUA 1W7FA 4HM3B 2GDNA 5FATA 3EOIA 1HQYE 3GZRA 4EERA 4LCLA 4FCZA 3JUPA 8RNTA 3MR0A 1WJ7A 2JKGA 4WEJA 1GMRA 1F8NA 2V9AA 4JI7M 1XGIA 2CWUA 3W0FA 3DUKA 1R6BX 1N9OA 2Y2PA 1D6UA 4BTWA 3IBJA 1QMAA 2YFQA 3HX8A 4HM1B 4KVHA 1LL5A 3K3DA 3I51A 3LFVA 4QB8A 2XROA 4PAUA 4R80A 3SAUA 3WWXA 3UB9A 1YIT3 4Y28F 3DA1A 1FSWA 3DZLA 2O9CA 4GRIA 1O7PB 4MGHA 4H61A 2INXA 1KDWA 3SASA 1T2IA 5HW3A 1BLSA 1TDHA 3A5EA 3EBTA 3ITAA 4JKTA 1PW1A 2JC7A 4EW5A 5EEOA 4IBXA 2QZ6A 5JBSA 4ZM8A 3SAVA 1UGHI 2RSXA 3N9HA 2Z2LB 3LYGA 1BRKA 4OUQA 2XLNA 2JKRM 1JBSA 1IVVA 3V98A 1OCVA 2FNQA 2P38A 1GJTA 2O25A 3HHWA 4G4OA 2HJ9C 1YVSA 3MBZA 1EA2A 2RRUA 5CECA 1VETA 1ZG4A 3DWZA 1IN8A 5DYGA 4BQMA 1CF0A 3FKAA 4DE0A 3THGA 1PJJA 2W9QA 1DJAA 3GRVA 3S7PA 4MM3B 5GHZA 3PGBA 5IENA 1SQWA 5FI7A 3PBSA 3BOSA 4PT5A 2ZOHA 3BY8A 3IXDA 1FIKA 1FCOA 2ZC4B 3J7BA 1CYVA 5ITRA 4XK8F 2UXCM 2WGOA 1KGGA 3CC43 4MN6A 3S5CA 1P97A 3BFGA 1KOUA 2FXTA 4XB5A 4LFBM 1JR3E 3WHLA 1XJ2A 4U13A 4P16A 1NYMA 1VEUA 2EXBA 2PZVA 5DNYA 5L8RF 1SKOB 1RGKA 3T6PA 1EG9B 4HOIA 4EESA 2VEAA 3LEQA 2L4VA 3ZQ5A 1DRMA 7RNTA 4WW0A 4O3VA 3CTWB 3K92A 1M6KA 1WYBA 1H0MA 4LZZA 4P17A 1FGOA 1FILA 2GNOA 4X2OA 1PJQA 4WP2A 1O07A 4JI2M 1FGQA 2CW9A 2L6OA 5ITTA 4CLCA 1BT5A 3DBAA 4CJ6A 4E3LA 1LI0A 4RQ9A 4ZJ1A 2GQFA 5BU4A 3TQSA 4CLCC 2X49A 5KP3A 2OQ4A 2ZMAA 2ZC6B 3BBZA 1KQS2 1IQPA 2EX2A 1BTLA 3F1PB 2UUAM 1LSVA 3KYEA 3QYBA 4HJ4A 1F98A 1NY0A 2B3TA 4I5SA 4R70A 1IOUA 3GLGA 3BU4A 3DW0A 4S2PA 2V0WA 5E43A 1YJW3 5G1KA 2KNAA 5HARA 4KZ3A 2NUPC 3OWYA 5F1FA 4OX9M 2SBLA 4YFMA 1HNWM 1PWCA 3SH9A 4B3SM 2KXEA 3K1JA 1IV7A 1IN5A 1OACA 3MMHA 4A5RA 3MHVC 4HAAA 2ZQCA 4GD8A 3QYEA 1XJ3A 5KQ8A 1KFVA 2I7PA 4XGIA 5GKNA 5LMNM 1UI7A 3LCUA 4CJNA 3E0YA 2DMWA 4NRVA 1RGZA 5LMUM 1A67A 2O3OA 1E3VA 1ZG6A 3T4TA 1ES2A 3FUUA 1JQJC 3X42A 1GOYA 4DV4M 5DYIA 3F40A 1KYIA 3OWUA 1I4WA 3HGIA 3MKIA 3GWRA 3FTDA 5GL9A 5EP2A 3GLFA 3UN7A 2B5RA 1FGMA 1MWSA 4QHTA 3ALAA 1BULA 3T12B 2GXFA 4LFUA 4EV2A 3SATA 1LOVA 3HK4A 2CV2A 3N8LA 1IDPA 3VDPA 3MK6A 4EV5A 2QENA 2H0YA 2R62A 3NBRA 4GJ4A 4WLAA 4DV7M 3I553 2QBYB 4BL2A 4S2JA 4RNTA 2P08A 2W3HA 3FYZA 4JF4A 4LJAA 3G713 1FR1A 3VSYA 2VX8A 1E9SA 3HVFA 1E3UA 1SCWA 4KUOA 3HOHA 1QZMA 2JA2A 4AG5A 2CHVA 1TDGA 2C5WB 4LRXC 3IPTA 1L0GA 1GHIA 3GPPA 1BRNL 1T2HA 2I72A 1AR0A 2FFYA 1XFQA 4NXFA 3V3RA 5FTNA 1X1UA 2WOHA 4EYCA 1NO1A 3UL5A 1I2GA 3ZG9B 1T3TA 4HM6B 2DVWB 2JHEA 5EOEA 5L07A 3U61A 3EX9A 2GU1A 4WYKB 3QHYA 2QCUA 5FTJA 1BNEA 3GLHB 2Z6BA 4HLQA 5GHXA 3G35A 4B7FA 1PYYA 1V92A 2LNHC 2Y0QA 3CF2A 5EE8A 2UUCM 3D4AA 1B3SA 1WGNA 1VEKA 3CUEC 3HLDA 4DXCA 5HAIA 1SDNA 4YHHM 1R4YA 2BO9B 1W02A 2MH8A 1J7KA 1M40A 4BB9A 1ZTUA 2H0GA 1YMSA 2HDUA 3UB7A 3L0RA 1WGLA 1UWPX 5FQ9A 3EB8A 1N8QA 4KODA 3EEHA 1NHWC 3HLFA 3N4IA 5TJJA 1JB0F 1QALA 2W03A 1ES4A 5AVEA 3QAUA 2CHQA 1GSWA 2K47A 2GJ3A 4E3IA 3C9PA 1U60A 3MQQA 2DZLA 4MEZA 4F2LA 2CX1A 1FOFA 1DGHB 1YVBI 1XWIA 3UE3A 3LTAA 4DR6M 4LV1A 4X53A 4FMCA 1NLZA 4QU3A 1LV7A 4OK0A 2FNAA 1BANA 2W56B 3NV0B 3VP3A 2V2FF 4HM5B 5TBMA 2E5LM 3URPA 4I4KA 3T0UA 4QNRA 3FUXA 2IUKA 1K4EA 2RL3A 2WGWA 3M2KA 3F7XA 4LF7M 2JKRI 1S1ZA 2H28A 3EGDC 4R4RA 4XUZA 5L2FA 3EHCA 3E4RA 4PM7A 3LOYA 3IHAA 3IXHA 1BVSA 1WTHA 3JR4A 1K28A 1VQK3 2P09A 4P85A 2R65A 3IQAA 4RA7A 2P0MA 1OIZA 4GW9A 4ZAMA 2WSEF 1RCLA 3C4PA 3EJVA 2EWVA 3UMMA 3WMDA 1T5YA 4OOYA 3NWLA 2H1RA 3VK8A 1HNXM 2K54A 3GTCA 2XSHB 1KC84 4HNBA 1A2VA 1O7GB 1KE4A 2DENA 4S2KA 3JAMS 3EBYA 3GLIA 4GDBA 3IECA 1CJFA 1ZO2A 4X2HA 1LTMA 5FL3A 4B88A 1NO3A 4PM5A 4CISA 4M3KA 2JY7A 3G4PA 4R6LA 2EUCA 4DR1M 4B3RM 4GKJM 4DRTA 5IT5A 3SXXA 1PFLA 5G2GA 5FEGA 1S3SA 2GEXA 3IHBA 4MJDA 1E3RA 1TRQA 3CC23 4OOMA 4X1LA 4NG2A 3KVWA 4HJLB 1Q824 1EFUB 4EV4A 2EKKA 2KEBA 5G18A 5EVHA 2CFLA 1DGFA 2WK0A 1G02A 4X55A 3G30A 5BIRA 1K6SA 4CLCD 2ZA4A 1ZX2A 4R0QA 3E2KA 2LVNC 5J7EA 4BMWA 2W9PA 4G3VA 3X41A 3NJAA 4S2NA 3W68A 3U6PA 4GB7A 4ME4A 1VQ43 3ZG5A 3DZDA 1R7RA 1W6GA 3LH4A 2KA6B 4OQIA 4NREA 1SDEA 1N9LA 3A3JA 3L9KA 1OPYA 3EF8A 4I3IA 4GS9A 4FCFA 1GY6A 1KWIA 1F4IA 3DGNA 1L0EA 2OLVA 4KZ5A 3U6MA 3UL6A 3LTCA 4N6NB 1L8QA 3U6EA 1UCJA
chains in the Genus database with same CATH topology
3FYDA 4AZFA 1PU4A 1DVDA 2VGKA 3NY4A 3NUVA 3N54B 4FD2A 1W5ZA 1PW8A 1IV9A 4LFAM 1JTGA 5EP3A 4GD6A 1QVF2 4RNAA 1UUWB 3BYDA 1TFKA 2O9UX 4MBFA 4XDVA 1ROAA 3OPRA 4BJPA 1IY1A 4K91A 3G0KA 1C3BA 3LTDA 4JRFA 2ZJ9A 1NNJA 1QAKA 3LCEA 5HX9A 1HU9A 4LJ8A 2YFJB 5CRFA 4LGYA 2C9CA 3K5TA 4ZJ3A 5IW9A 1O7WB 3NDEA 4MBKA 3C7VA 3SOIA 5CXWA 1YM1A 2STDA 5IG4A 3GP1A 4P6BA 3MKFA 4GDNA 2FFFB 3G32A 1CQSA 2BNGA 3W8KA 5AQBA 2HMNB 2HP5A 2CHCA 1YE9A 1GL7A 3E99A 1J09A 3M8CA 2IWDA 3T15A 3ZDJA 3AOGA 1FCMA 1N36M 2WGVA 3NHXA 3SHFA 2KZUA 3KOWE 4FVMA 1TH4A 2FFJA 1OF5A 4NOOB 3S67A 4DUZM 1PWDA 5BR8M 3N6IA 3A45A 3I0YA 1GHPA 4L8RC 1GKIA 3IWIA 1YLWA 3BNBA 2CFWA 4OOLA 3GLGB 4R9KA 4M9ZA 1W4NA 4D2OA 2WOFA 3I4VA 2WGIA 2ZM2A 1NWWA 1W2B2 1N34M 1R4CA 3AKZA 1MU5A 3PCSA 3CME3 2EXAA 4IBIA 4G4RA 5FAPA 2KZSA 4OW0A 4JI3M 2Y2JA 1K82A 1TP6A 4YY3M 1GYBA 2X8AA 3U60A 3WS5A 1O7MB 2WZZA 4H3UA 1KE0A 5CGWA 4OPQA 1VQM3 4WZ5C 4DUYM 3EE1A 3C4OA 1IEMA 2WGWB 5IHVA 1NVMA 3FSDA 3UGJA 3T8NA 4QOSA 4PEJA 5FI6A 1YHQ3 1YLYA 2R9XA 6STDA 1N9JA 4RNZA 4MBHA 5ITYA 4O8SA 4K0KM 3EQQB 1FR6A 4GNUA 3OC2A 1MPLA 1NJGA 2LYXA 1QAQA 3CF6E 3FTCA 4L8PA 1H8YA 3WHKA 4HZ9B 3IF6A 2QIYA 1LLBA 1XPBA 4AQYM 1SXJC 3DY5A 4WHAA 1W5TA 4JXWA 4QOZC 4ORLA 4LGQA 3HKPA 4MMXB 1OMEA 4RVAA 3T1YM 1N33M 3WA2X 5LC6A 3FKVA 3AGFA 2ML5A 3O8YA 4K61A 1E32A 2Y21A 5HAQA 2AHMA 1PJIA 1LNHA 3AOEC 3RGPA 1IQ8A 2Y2QA 1QAFA 1CEFA 1WMPA 2NQ8C 5TFQA 2Y73A 5AIIA 2EFXA 3KS4A 2FOIC 1TGUA 3A76A 3F8XA 3O86A 2ZQ7A 4O02B 2W56A 4B7HA 4KZAA 2YR0A 2PU2A 3WS0A 4JYAM 4H8RA 3MXSA 3Q2PA 1K55A 5FTKA 2CFKA 1TVFA 4LSOA 3VP2A 3E2LA 1L2CA 3Q8XA 3HU1A 2Z2MB 5M1AA 4RF1A 1GS3A 1TEMA 3BLSA 2DWZB 4JF8A 1I94M 4JXGA 4DE3A 3ZCZA 3U6SA 1XKZA 3IF5A 2KCDA 2YX9A 3O3VA 2CEAA 3GQ4A 2H5SA 4HKVB 3AGDA 3IG8A 3FG4A 2G2UA 1OGXA 3UB1A 3WS1A 3CMA3 3MZDA 2XK1A 1IXSB 1ERQA 2WYXA 4EBNA 2BMQB 3JR5A 3BNEA 4DV2M 4M0WA 4IPBA 3M0EA 3QRDA 1KE3A 3V3SA 3K63A 3U5ZB 4OH0A 3HLEA 2XDMA 5ITQA 3UE0A 4AKHA 3L28A 1XMOM 4MMYB 3RXWA 4KG6A 4IIWA 4NL4H 3NDGA 3GAXA 1TDLA 1K3XA 5C18A 1LXEA 4E3JA 3HLWA 1Z1SA 2OLUA 1EKMA 4IVIA 3HIIA 4IBRA 1H8ZA 4EIWA 5CEDA 4NSOB 4X69A 3DXOA 2OQEC 4NHFA 2QBYA 3NBBA 1JN5A 1OGZA 2OTL3 3L27A 3J2PB 1IN4A 3GQ5A 1NDOB 4B3TM 3NX0A 5EXXA 2XH9A 4BLCA 1Y4KA 2C99A 3ZC7B 4U0XA 3ISGA 1D6YA 2UWXA 2XFSA 3PFIA 4R23A 4CCVA 1Z6FA 7CATA 2BMOB 2ZDJA 5IEOA 3VK7A 5STDA 3UNLA 4Y0OA 2KRUA 1J9MA 5A0OB 5CTNA 5E2EA 1IVXA 1HD8A 3J7AS 5EVIB 2KW0A 1JRQA 3P98A 4HM8B 3UK6A 3AGEA 1Z5AA 4MB7A 2R4IA 1BSGA 4ZBEA 2C98A 2R46A 2Y2LA 3U5ZA 1OHSA 1Q3CA 2Y4AA 4DF6A 3ITBA 4GH9A 3KFQC 2ZQ9A 4FH4A 1ZQ9A 1K57C 4WELA 3GV9A 4CHTB 4LF4M 2WGQA 3UDIA 4LJ5A 4S2MA 3QWLA 4K90B 1IY0A 1K57A 3TE6A 2VIIA 1NYYA 2VGJA 1GY5A 1O7EA 3KDSE 3JYIA 2CWVA 1SPUA 3RGAA 3OX9A 1PI5A 4NXMM 1RGYA 2Y2KA 5FA7A 4LRTA 4HYZA 4FCVA 5KSHA 4KFDA 1FGTA 1K734 4R4SA 1FGRA 1GA0A 3U6QA 3VFHA 5F83A 1YGEA 1YJ93 5IT9S 3OXAA 1VZZA 3KFUG 1NJ4A 3BM6A 4QNMA 3GQZA 4UAAA 1SXJD 2GEYA 1IM2A 5EP1A 1JB4A 4KENB 4LCBA 3BFCA 2XF3A 3IWQA 1PZPA 2Z4RA 3IJEB 1GA9A 4IBKA 4Z9QA 2L7IA 4G4QA 1L1TA 4JPMA 2HP9A 4JF5A 4X56A 4KZ8A 3PS8A 2Q9MA 1GVNA 3V99A 2VQEM 2E2UA 4EUZA 4X64M 2IA7A 3SS3A 3S22A 1DO0A 1W8YA 3KOZE 3Q1CA 3TWLA 2CFGA 3MG2A 4MMZB 3Q82A 3ZNYA 5CHJA 1KSFX 3AMOA 3HUNA 1LOXA 4NETA 2Z4SA 4BL3A 3GLHA 1SXJA 3IF6B 2I7NA 1W6CA 5BPVA 2EO2A 3HUOA 1YLJA 1W01A 2WKHA 4BTXA 4DDSA 1KGFA 4KFEA 3HHYA 1FQGA 1AV4A 4DV3M 2UXBM 3RGSA 2D42A 1QYRA 5FDHA 4AKZA 4R3DA 4DXBA 3K7CA 3NM2A 2WAEA 4WYKA 4LV0A 3GRDA 4DR5M 3T8UA 4WWUC 5AIHA 2HMMB 3SVAA 3M7GA 5IERA 1N75A 4HEFA 4DV5M 2F5SA 4TUWA 2XR8B 2XZUA 4WMCD 1KDSA 1GY7A 4HM4B 3FLJA 3CNXA 3HI7A 3CXC2 4DE2A 1GCEA 1XHBA 4C6YA 4EWFA 3CNMA 3HLGA 3LY4A 2QPNA 1XMQM 3SYKA 4B4ZA 2VQFM 1N77A 1FUWA 4BD0A 3WS4A 3IXGA 1DMNA 2J9PA 2R45A 3A3EA 3T38A 3OPHA 4Y7PA 3L25A 3FUWA 1TUHA 3WDGB 1A2KA 2QZ4A 2CC1A 1Z59A 2XR0A 3KW6A 3HHZA 1ALQA 4MH0E 4BBAA 2BG1A 1IXZA 4M0DA 2J7NA 4REZA 4OU7A 2YFIB 4N1XA 3HJQA 2UXDM 2F86B 1AXBA 3BLMA 4MGKE 2CC3A 2J9OA 3D3LA 4Q53A 2E8IA 3AJIB 3DOAA 2XSZA 1L2BA 4FCJA 1LHYA 3GVBA 3HU2A 3KE7A 3CPOA 2BHMA 3B3XA 3VLFB 1STDA 1GHMA 3ROBA 5EXPA 4WFOA 3PBNA 1JR3A 2DZOB 1N32M 2GU3A 3V92A 4NK3A 5H37D 3NI9A 2CKFB 4GC5A 3NBLA 3U1WA 1NXYA 4E3KA 2LWXA 3EN8A 2JCHA 2ZM8A 4ITQA 3MZFA 1FNNA 1DO2A 3NV0A 4B4XA 3DMCA 4G4NA 4NSRA 1BLPA 3KN4A 1QMFA 1US1A 5GLBA 3SEDA 4GN2A 2F5OA 3SX1A 5IWAM 1YLZA 3EIHA 2YNMD 1RRLA 5AEWB 3D8LA 3Q7VB 3UJMA 2D7HA 2XLJA 3C5AA 4GL6A 4N6V0 4P0MA 3J7Yd 2XSZD 1QVRA 2P9VA 4RX3A 3IWOA 5IG0A 5CF1A 1ROVA 5ELJA 4AW4A 2F5QA 5CK6A 3G4S3 1N5HA 3KOXE 3GQ3A 4FMDA 3EIEA 3PBQA 2WAFA 3SS4A 1J2BA 3AOEA 4II7A 2RCXA 5EECA 3C58A 1Y54A 2Y74A 4KZ7A 4Q8IA 4LGMA 4MGYE 4R3JA 3P09A 3CG5A 1LL9A 4N6MA 2OOVC 2PU4A 5U47A 4JI4M 3VP1A 2WZXA 2X01A 4BTYA 3FGYA 3A98B 2EX9A 3R9XB 3RJUA 2UU9M 2F98A 2H0TA 2XGLA 1FJGM 3BB9A 3UZUA 3PXGA 4FCMA 2DXIA 3D4FA 1DGHA 5A2QS 4LF6M 3X3YA 5F82A 2Q2EB 2QPAA 4BENA 1NJFA 4FWGA 3KOYE 4D81A 1HR0M 4L8OA 3MFDA 1Q2PA 2A49A 5FQKA 1JJ22 4WZ5A 4RX2A 2C5RA 4XUXA 3PAGA 1Z5BA 5FSWA 3PCRA 4IBJA 4K1VA 1ISKA 1SXJB 3JUQA 1M1XB 2HMKB 4IEDA 1TH3A 4FCWA 2JQ5A 2V20A 5EOOA 3ZH9B 3SAWA 5IF6A 4PDGA 2G8LA 1PIOA 3A42A 4GZBA 5A92A 4DKIA 3DGLA 4WMCA 4JV5M 1JKGB 3SC3A 1N4OA 4LG2A 4C75A 4C3QA 4OLDA 3OCLA 5F3WA 4IIAA 3NBIA 3FF2A 1AVLA 4KFFA 1L0FA 3UPPA 2KXGA 4UA7A 3WS2A 1NRFA 2J8YA 3WODG 3KSED 2CFDA 1IBMM 4R4KA 2HMOB 4JI5M 4OQ0A 2W04A 1S0WA 2ZC7A 3DWKA 1E97A 4LZIA 2Y20A 1IN6A 2Y0TA 3RE8A 3A3FA 5BOHA 3N8BA 2Z7AA 5IREB 4HM0B 1CYUA 3AV0A 5DTSA 1IT7A 2RFRA 1W8QA 1MWTA 4KG5A 4UHUA 3GZXB 4E3MA 4MNRA 4M9SA 3CMZA 8CATA 4BLMA 1WMNA 3GRRA 3GO8A 3ZNTA 4IBGA 3G31A 1MKIA 5CLKA 1K54A 3U97A 4HM7B 2R9WA 3B8LA 2IWBA 3U61B 2WKIA 1L2DA 1X37A 3JUOA 3UDXA 1KD14 4CGYB 2ERCA 1E25A 5JYPA 3FZWA 2KRTA 3SS5A 2BJVA 4FWHA 1M9GA 2HMJB 2W0QA 5GLCA 3OW22 3KP0E 5LC7A 4OVZB 2V1CA 3PXMA 3GRYA 1D6ZA 5BVBA 3ZG7B 4NXNM 1CI8A 3FUTA 3U6DA 2XD1A 4AKYA 3D9RA 1E3UD 4FMBA 1ES3A 1I5QA 4E3OA 3Q07A 2DWNA 1K25A 5E2HA 2UUBM 1VQN3 1UI8A 3ILKA 2W82A 1IT8A 1K41A 3F14A 4K1UA 1VM1A 4KLNA 4LJ7A 3MG3A 3RGRA 3U60B 5KSCA 4R3BA 4WBGA 4IBBA 4HL4A 1SIIA 3MG1A 1PWGA 3Q1FA 4KZ4A 4S2NC 1N9BA 1U5OA 3GPXA 4OVMA 2C96A 4K0WA 3JUMA 3STDA 5HGRA 3GMWA 1ULJB 1L0DA 2XZFA 5AIFA 3KSPA 3CU3A 5JYOA 1DVCA 1E94E 3QK9A 5D81A 4OVDA 1ES5A 4EC6A 2ML6A 4LJ6A 3GSGA 4JI8M 3MWZA 1MBLA 1ONGA 2QP9X 4LF9M 3CCS3 5GHYA 3CCL3 2LXEA 1YLPA 3HZPA 1CI9A 1UW1A 5DF8A 2OCTA 3LMMA 3ER7A 4STDA 1OHPA 2CH9A 2RGQA 2WUQA 3HLBA 1RCJA 5IG3A 2ZC5B 3HU3A 1IKIA 2ZQ8A 5IG5A 4JF6A 5CEBA 4QWTA 1N9EA 2MF7A 4FMAA 3EC9A 2Z7JA 3SH8A 2L7HA 1W6YA 5EVLA 3MKEA 1VDDA 2PNCA 1XA1A 4N6OB 4QHCA 1MNLA 5EP4A 4ZJ2A 4FCTA 3VGNA 3A46A 3O87A 1XA7A 3IG5A 2ZL8A 2CG0A 3G6E3 2KRKA 1JTDA 4LJ9A 3KP1E 2OTJ3 1BUQA 1IU7A 3BNDA 3DGOA 5DF9A 3FZCA 4GHAA 1K56A 2G5GX 1E4DA 1XXMA 1M904 4ZDXA 1SXJE 3AMOB 2EX8A 5HL1A 1M1K4 4LEHA 1AVKA 3ZG0A 4XDWA 2LQVA 3TWKA 1YI23 2C11A 4F94A 4EXRA 4RNYA 3OCNA 4OPZA 1ZKJA 4QJGA 1W79A 4OLGA 1EQKA 1EI5A 1JB2A 4GHLA 4O7DA 4OQHA 3LXUX 4KQOA 5TGNA 1IYQA 2Z3XA 2WO0A 1K6RA 5EXSA 1FCNA 5KPZA 2QGUA 3MXRA 5HFOA 3O88A 3H4MA 4G1MB 5EXTA 3MSOA 3VP4A 5EVIA 3KSJA 4OP8A 1BUEA 5EPHA 5KMWA 4IBFA 4AKGA 1STFI 5DREA 3VSLA 3F8HA 1IYPA 3R8FA 5AYRB 4ID4A 3VFDA 4I4LA 1W5DA 3B4PA 4HBUA 3T1HM 3PBTA 2XEPA 1ZAEA 3EN1B 3CCM3 4KZ9A 4X65M 4LF5M 2HDSA 3DTMA 3K9MC 5AEUB 4QY5A 1SKFA 4B08A 3CD63 1HZOA 1JV2B 3FG3A 4N9LA 1K3WA 2V1UA 4OP5A 4WM9A 4JN6A 1O7NB 3BEBA 2GBXB 3BFDA 4S2OA 3FWLA 2Y59A 3B4OA 3X3ZA 1XNQM 4DV0M 5GLDA 4LF8M 4GKKM 2X02A 3G34A 4KO8A 3SARA 1DMQA 4UA6A 2M5ZA 5DTKA 2XQZA 4PCZA 3FKWA 2QEX3 4KQQA 1XX2A 4RYEA 2F5NA 2CWTA 2ZBKB 3CCU3 4IBEA 4FD8A 5JI2E 4I81A 1IBKM 3ZGAB 4N9KA 2G2WA 4MEIA 5A93A 1C7HA 3PNVA 2R18A 2ZM6M 3GPUA 3G2YA 3LT9A 4R7GA 3FTEA 5D3OA 1MXOA 4RZMA 3HL9A 4XM4A 5EJCA 3G8ZA 5JI3E 1Q864 4PM8A 4EBPA 1QMEA 4E6XA 4U0TA 4X6TA 2BJWA 3FTFA 4Z6YA 2M60A 1S5AA 2OQEA 1DMMA 2JBFA 5TR7A 1K55C 1NSFA 1HT2E 1Q3BA 1Z6TA 1EE8A 3CJMA 1W2ZA 3SLUA 1PM5A 3PBOA 1OHOA 2UX0A 1K9M4 3BECA 2BNKA 1TDZA 1GD3A 4AKIA 5KPTA 3LVVA 5CHUA 1NJI4 1HNZM 4GB5A 3EQUA 2HMLB 1IVWA 2FGTA 1OF5B 2IUJA 4CDLA 1TFOA 1TIJA 5KQDA 1YT4A 2HPBA 2WKEA 3TG9A 3S4XA 2CV0A 2DWMA 3GZYB 3E9SA 1VQO3 3CCJ3 1L5GB 5AQ9A 1OH0A 3ZVTA 3NXJA 4OVZA 1TU5A 1DJCA 2A5YB 4GIPA 1G59A 2C10A 3W4PA 3LO7A 2JE5A 3AFHA 4A3VB 2DWLA 1SJWA 1PI4A 3S28A 1CEGA 3B9PA 1U8CB 2CFOA 1YQSA 2CE7A 3G16A 3KZTA 1RJOA 3OZHA 4DV1M 3Q81A 1K4FA 2OPFA 3I7JA 1L2SA 3HBRA 4LFCM 2C6WB 1Q7Y4 3TDGA 1ORYB 1IVUA 4LRSA 5E6JA 3X40A 2D7GA 2EA0A 4Y0UA 2K0MA 3WRTA 1IN7A 3TSGA 3UJNA 4JXSA 2GBWB 3PZWA 3GLFB 3CCV3 1JWVA 3FV7A 1GD4A 1Q40B 3FKEA 1Q40A 4KG2A 1TH2A 1YJN3 1K56D 4R1KA 1JR3D 2OWPA 1E9RA 3U6OA 1HVBA 2Y2MA 2L09A 3PYJA 1YLTA 4PMAA 1UM8A 1BLHA 3BNCA 4WP5A 4X62M 1ONHA 4D80A 4KQRA 4W5WA 3BFEA 3HIGA 4DR4M 1IK3A 2I9WA 5FQMA 2M7OA 3QNBA 3I4YA 4WYYA 3IF6C 4N6LA 2XFTA 2R4JA 2W6JH 5KZHA 1JKGA 5DRVA 3LQQA 1G68A 1L1ZA 2A3UA 2XRXB 3NM7A 5EVID 3W4OA 4L78A 5AQAA 1KSIA 2X71A 3IH8A 2ZM0A 4U3TA 2Q07A 3MYTA 2DCFA 3MHEA 1Z5CA 1HQCA 3GRJA 3Q7ZA 4LJ4A 5CHMA 3TOIA 5A90A 3MPHA 4GKUA 2RCDA 2P0XA 2OOVA 1IQXA 2ZQDA 3S29A 2Y55A 4JLFA 3VKGA 3CC73 1JN5B 3VKHA 3F9SA 5EVIC 2CUZA 3UDFA 3WOEB 2DNSA 4FWDA 1J5EM 2RKOA 3HHXA 3FH1A 3PBRA 4KHPM 3SFZA 3UY6A 4MGIE 3IMAB 4XBYA 3GRUA 2F5PA 4ZPXA 3ZVWA 2HCBA 2IMJA 1NB5I 3ZFZA 3FF0A 3A3IA 3VDUA 3UPOA 1IBLM 4J9AA 1VQ63 3G2ZA 3CZDA 2XSOB 5E2FA 1NB3I 1DGGA 4S2IA 1MY8A 3N7WA 3H3HA 3ZCBB 1IXRC 3SBJA 3CCE3 2Y2OA 3KIIA 5JPUA 5ITXA 1D2NA 4OPYA 1VQL3 1I2SA 1PZOA 2EX6A 3OPLA 4O2HA 4RBNA 2E2VA 1YSYA 3F7SA 4S12A 3N8RA 1HT1E 3OTOM 1XC8A 3M2JA 5FTMA 1NU3A 5D83A 3JUNA 4N3VA 4HBRA 1N5PA 1BLCA 3FD9A 3U6LA 5I97A 5AIGA 1WNHA 2HHHM 3I563 2P74A 3SYLA 3DFZA 3LY3A 3K0ZA 4OKPA 3K8ZA 3ECFA 4DV6M 2ZAMA 5AYSC 4JI0M 4JI1M 1JNQA 3TPZA 4LY6A 5GLAA 3V39A 4X66M 1NY6A 3WOFB 4TX4A 1GL6A 1GLNA 4LMIA 4GOGA 2XD5A 1XXHB 4IBDA 2OV5A 3FCSB 3PAEA 4HESA 1XNRM 2Y2HA 5DTTA 1JWPA 2F99A 3VOZA 5KO3A 4S2LA 1XGJA 3MJ5A 3FUVA 5CGSA 1QVG2 8CHOA 4JXVA 1NHGC 2Y2IA 3B7CA 3ZG8B 3Q7VA 2PBYA 2P9VB 3D8BA 5I94A 2FE8A 1LVNA 3GPYA 1MWRA 4PPRA 4PDIA 4IJEA 3HUMA 5HAPA 5M18A 3Q90A 5TGFA 4WURA 4Z8XA 2ZD8A 5BXQA 4PM9A 4WZ4A 4D82A 4FW9A 3KSXA 2W2CA 4N6TA 2E2TA 3OV4A 2HKJA 1QQWA 5EQTA 4X68A 3WRZA 4EBLA 1JB5A 1VQ93 4LENA 4AI6A 4P87A 3V5MA 3C7UA 1NZOA 1VQQA 4LCMA 3WA3A 4XBXA 3M6BA 2DZNB 1WQLB 3A3DA 3BLZA 3EQVA 3UNWA 1HTZA 3IT9A 3HJ8A 4KZ6A 5F1GA 1DJBA 1WMOA 1QAOA 4DE1A 3NC8A 3QNCA 4I8OA 1N8R4 2LH0A 3K2LA 2B1XB 5EUAA 4PD2A 1OUNA 2CV1A 1JVJA 3PVSA 1H5XA 2X4AA 1YIJ3 2IWCA 2D7EA 3VF1A 2OSUA 2ZANA 5FTLA 1R2ZA 4M9XA 3LQRA 3PNYA 3CCR3 3LEZA 2ZLYA 3LMLA 4OQGA 3DGMA 2MC8A 3TL4X 1MX0A 4DR2M 3LTBA 1Q39A 3S1YA 4DR7M 1K8A4 4KZ1A 2B24B 5ELUA 4B7GA 3W0LB 3SH7A 4L15A 3W4QA 1OFHA 3UPNA 4XBOA 1R2YA 2DRWA 3GLIB 5FASA 5DF7A 5AI1A 1G3IA 2F4VM 4JI6M 1DGBA 4E3NA 1NZUA 3SOAA 1IY2A 4QHSA 3DM8A 1IYOA 1DY6A 1VQP3 1JWZA 3KS8A 1FSYA 3RFWA 4R1GA 3TWMA 4J8TA 1C1KA 1KVMA 3OPPA 4OONA 4L7KA 5FW5A 2H10A 2YQZA 3HLCA 2ZC3B 3VP0A 4L16A 1CK3A 2P05A 1EWZA 3L2AA 1ULIB 4YINA 5ITUA 4AG6A 3L26A 3SHGB 1ESIA 4E6WA 5JPPA 5DVAA 3X3XA 3UO9A 3VOYA 1OFIA 3FG1A 1SHVA 4WEKA 1OJLA 4LZJA 5KPRA 2YFLB 2J7OA 4JBFA 2RGHA 3HREA 5FQQA 2Y2NA 3M6AA 5FLXS 3PTEA 3S27A 5CF2A 1Q2QA 4HVNA 3CF0A 5CXOA 1MOLA 3GR2A 1HKXA 5FGOA 1S6RA 2D1WA 2P5TA 2CK3H 1BZAA 1ERMA 2EFUA 1S723 2WADA 5FAOA 1I2WA 5CERA 4DDYA 4R9LA 5IZ7D 4XBTA 1KVLA 5FQJA 3UE1A 4N6UA 1Q814 2HP6A 3H51A 7STDA 1VQ73 2BLSA 2Q9NA 1QAMA 5ITXE 4NRWA 1WXQA 1UUVB 3NQZA 3CPW2 3IXBA 1IKGA 1H6UA 2ZAOA 1RN7A 5CTMA 4HZBB 1ASKA 4HM2B 1PFPA 2Y91A 5FI2A 4GMQA 4ZTKA 4B3MM 1VQ53 2Y2GA 4OPRA 1WE4A 2V6ZM 4G6ZA 4MLLA 4LV3A 3VSKA 4QD4A 2HDQA 3J27B 1N78A 3RDEA 1FA3A 1RKYA 1XP4A 4FSFA 5KP1A 5D82A 3KXEC 3NCKA 4XXRA 3V50A 3FYCA 3N8SA 1RP5A 3OWSA