2XGNA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 137
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xgnA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xgnA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xgnA02
4OVDA 2ZQ9A 2CC1A 3A3IA 3BRMA 5EVLA 3NC8A 3G35A 5GLDA 1KGFA 3WWXA 5EOEA 4O7DA 5EUAA 1BLSA 5FSRA 5EVIA 1J9MA 5I94A 1KGEA 2ZLYA 1TDGA 3SS3A 3O3VA 5J8XA 3A3FA 1K56D 5HFOA 1LL5A 3IQAA 5E2EA 3A3EA 3SH8A 1NJ4A 1K56A 1BLCA 3HLFA 1NXYA 4OPZA 2C5WB 3CJMA 4MBHA 1W79A 4DXCA 1W8QA 4E3OA 4MEZA 1IYSA 3S4XA 4WZ5A 3LCEA 2XQZA 5L2FA 2XGNA 4OKPA 4XUXA 3SH9A 5HW3A 3S1YA 4OP8A 4Z9QA 3VP1A 5HAQA 3N8RA 4MLLA 2PU4A 1BZAA 1KGGA 4GDNA 1VM1A 1XGJA 1PWDA 4U0XA 5E43A 1SDNA 2EX9A 4EBLA 5KZHA 4JF5A 4NETA 3G30A 3ITBA 3Q81A 1MWUA 3BLSA 3EQVA 3N8LA 1N9BA 2Q9MA 2X02A 4DDSA 3GSGA 3N7WA 1CI8A 5AQ7A 5DTKA 1ERQA 3V39A 1BLHA 3FWLA 3HBRA 3PBOA 3MFDA 4R0QA 4QY5A 5CGWA 4CJNA 4GB7A 4GZBA 2ZC7A 1PW1A 4OONA 4QHCA 4HBTA 3UE1A 3ZG0A 1JWPA 4EV4A 1EI5A 2EFXA 3RJUA 4DRTA 2GDNA 1PIOA 2ZM0A 3VSLA 4A5RA 2FFFB 1IYPA 1PZPA 1CK3A 2HDUA 1FCNA 3C7VA 3HLWA 1LI0A 3IHAA 3V50A 3VP2A 1BTLA 4RX2A 2Z2LB 1KE0A 1I2SA 3G4PA 4KZ9A 5GHXA 3VFFA 1K55C 5HAIA 3IXBA 4PPRA 4QB8A 3P98A 3MXRA 3GMWA 5DF9A 1NYYA 4DE3A 1GCEA 1BSGA 4GD8A 2XR0A 2Y2LA 1MPLA 2VGJA 3M6BA 3AGDA 1LI9A 1IKGA 1FQGA 4K0WA 1XP4A 4GKUA 3FKVA 1K54C 3A3DA 3W8KA 2UWXA 1TDLA 4R4SA 2V20A 3MKEA 2Y2GA 4ZBEA 4OQGA 3PTEA 4BL2A 4P85A 2RL3A 2JCHA 5CEDA 4Y0TA 2WYXA 4OLDA 5FA7A 4IEDA 2A3UA 4B4XA 2ZQ7A 4ZAMA 2WZZA 3RXXA 5A90A 2WUQA 2DCFA 3UPNA 1RCJA 1YLJA 3V5MA 1ZG4A 4E3NA 1JWVA 4E3MA 3UO9A 3UDFA 2XFTA 5EECA 5DTSA 3ZVWA 3PBRA 4BD1A 2J7VA 3WS4A 2XH9A 5M18A 3BEBA 2EXBA 3LY4A 4DF6A 2ZM8A 5GL9A 3HREA 4R4RA 4S2PA 2WKIA 2EX8A 4IBXA 4WEKA 1JVJA 4KZ4A 4JPMA 3NIAA 2HP6A 3FZCA 3IHBA 4R1GA 3C4OA 3LEZA 1MWTA 2HPBA 3HUNA 3DWZA 4Y0UA 5FQJA 4WZ4A 1PWGA 1ONGA 1NY0A 3OCLA 3N4IA 3O86A 4OQHA 5F1GA 5FQQA 1MBLA 4WMCA 2XF3A 5D3OA 4EQIA 3PAGA 1PZOA 3BFFA 3MKFA 2Y2OA 4KQQA 3QHYA 3UPPA 3VFHA 4DE2A 3ZGAB 5FI6A 2HDRA 2XD5A 1YT4A 3I7JA 4IVKA 1MWSA 3BFEA 1YM1A 1W5DA 4KZ3A 4BJPA 2H5SA 2DRWA 1BLPA 3B3XA 1L0FA 5FAPA 1Z6FA 4JXVA 1YLPA 5GLAA 1WE4A 3G2YA 3BYDA 3FYZA 2OSUA 4E3LA 1SDEA 3GRJA 4KZAA 1G6AA 4RA7A 4YFMA 4FCFA 3G31A 4ZJ3A 3MXSA 5HX9A 4K91A 3G2ZA 3MZEA 4HESA 2JBFA 5CERA 2WGVA 5A92A 1K55A 2Y2QA 3IXGA 3VSKA 1W7FA 1ES3A 1SCWA 4C6YA 5AQAA 4OPQA 2JC7A 1E25A 4WM9A 1KDSA 2V1ZA 1G68A 1CI9A 2ZMAA 4JF6A 1KDWA 2EX6A 5FAQA 3LY3A 4EBNA 4N9LA 4GN2A 1VQQA 2EX2A 2H10A 1CEFA 3MZDA 3ZG9B 1H8YA 2C6WB 3IWIA 2XK1A 4UA9A 1XA1A 1YQSA 3PBNA 4OQ0A 5HARA 1K57C 1NRFA 4BD0A 4LCLA 3C5AA 3CG5A 4DE1A 5FI7A 4E3KA 2QMIA 1RGYA 4E6WA 5EVIB 1ALQA 4U3TA 3LO7A 1GHMA 4FSFA 1ZG6A 2B5RA 3G32A 5JYOA 1IEMA 3IF6A 2J9OA 3IH9A 4OP5A 4P0MA 2Y2NA 4S2IA 2XD1A 3NCKA 2ZD8A 4MBFA 3TG9A 2DNSA 1L0GA 3IF6B 4OPYA 4X6TA 3NBLA 3NDEA 5FQ9A 1JTDA 3WS0A 5FQKA 1JTGA 4EUZA 1Y54A 4L0LA 5FDHA 3IF6C 1Q2QA 5EOOA 4R3JA 3PBQA 4DDYA 4UA6A 1L2SA 1E3UD 4YINA 3SS5A 1MKIA 5EPHA 5CGSA 5AQBA 4PM6A 5TR7A 1XXMA 3JYIA 4JXGA 1S0WA 2RCXA 1YLWA 3IT9A 2J8YA 3N8SA 5GHZA 5GLBA 2PBYA 5CGXA 1PI5A 5DTTA 1E4DA 3ZNYA 1ES2A 1YMSA 3DWKA 1EWZA 4N92A 5G18A 3C4PA 5E2HA 1NZOA 4F94A 2WK0A 4ZJ2A 1YMXA 5FQMA 3IWQA 2BG1A 1SHVA 4X69A 5FQIA 3E2KA 1I2WA 3OZHA 4FD8A 1QMEA 2XEPA 1OMEA 1L0DA 5FAOA 3ZG7B 1BUEA 1U60A 1ES4A 2P9VB 4JLFA 2V2FF 3S22A 4Q8IA 3CMZA 1XA7A 4DE0A 1IYQA 3M6HA 2VGKA 5E2GA 1K6SA 2Y59A 4S2OA 4N1XA 1IKIA 5FASA 5M1AA 2XFSA 3BLMA 3AGEA 3VOZA 1PW8A 4C3QA 1IELA 2I72A 4KQOA 4OOLA 3Q7ZA 2H0YA 1MXOA 4PM9A 2OLUA 1BT5A 3QNCA 3ZFZA 5M19A 5EE8A 2WADA 1HZOA 3PAEA 4EWFA 5AQ9A 3MZFA 3OC2A 1FSYA 1H8ZA 2WAEA 3ITAA 4LV3A 4B88A 3HUOA 1WYCA 4KQRA 4DXBA 1KE4A 2BLSA 3E2LA 5KSHA 5TFQA 3IF5A 4WYYA 4OOMA 3UNWA 4BENA 4JXSA 3EQUA 3VP0A 4K0XA 3UDXA 3D4FA 4S2JA 3DTMA 4KZ6A 2FFYA 4GOGA 1XGIA 4OQIA 4KG2A 4XUZA 1L0EA 1TVFA 4WELA 1DJBA 4PM5A 1MY8A 2G2WA 1LL9A 2Y2PA 3IH8A 5CTNA 1DY6A 4LENA 3M2KA 4OPRA 3Q7VB 4LV0A 4U0TA 5CHJA 1IYOA 1EROA 1K54A 1DJCA 1ESIA 3HVFA 4S2KA 1K4EA 5E2FA 5GHYA 2E8IA 3NI9A 2WZXA 3WS5A 3HL9A 4WZ5C 1TEMA 2PU2A 4Y7PA 2OLVA 2ZC4B 1M6KA 5DF7A 3IXDA 3VP3A 4DKIA 1CEGA 3Q1FA 3W4PA 5BOHA 1FR6A 4P87A 2Y55A 2ZC3B 1XX2A 4UHUA 1ES5A 5HL1A 3SH7A 3IWOA 4KENB 4WEJA 3BFGA 2WGWB 1DJAA 2Y91A 3HLDA 3RXWA 4BL3A 2P74A 3V3SA 3GV9A 3UY6A 3A3JA 3ZG5A 2WKHA 1KVLA 4Y0OA 5EVIC 5EVID 1GA0A 2WGWA 2XDMA 2ZQAA 2Y2JA 1O7EA 1BULA 4KZBA 5CTMA 2ZM2A 5F83A 3HLCA 4E3JA 3WRZA 2Y2KA 3G34A 3OPPA 2IWDA 2WAFA 4N1HA 2XLNA 3HLBA 1FOFA 4R3BA 1HD8A 3W4OA 2Y2IA 3Q07A 4IVIA 4M3KA 3C7UA 5U47A 3BFCA 4RVAA 5JYPA 1N4OA 1ERMA 2ZC6B 1AXBA 3ISGA 3Q82A 4ID4A 5KSCA 1K4FA 3CZDA 3TOIA 5CHMA 2Z2MB 3OCNA 4QY6A 4JXWA 1FCOA 1HVBA 3P09A 2R9WA 1H5XA 3O87A 4OH0A 1PI4A 3NDGA 2HDQA 3PBSA 3Q7VA 3OPHA 4KZ7A 4MBKA 4PMAA 4FH4A 3ZNTA 1HTZA 4OLGA 2HP5A 4OOYA 4P6BA 3W4QA 4EBPA 4JBFA 1NZUA 4C75A 3N6IA 4KZ8A 2EFUA 3TSGA 2H0TA 4UAAA 2ZQDA 4KG5A 1KE3A 4WMCD 3OPRA 3ZVTA 2ZJ9A 3GR2A 3O88A 2JE5A 3NY4A 2Y4AA 4S2NC 3WS2A 2R9XA 4LV1A 3QNBA 1GHPA 4PM7A 1QMFA 5DVAA 4ZJ1A 3AGFA 1M40A 1C3BA 1YLYA 4H8RA 4KZ5A 4S2NA 3HLGA 1ZKJA 4R23A 3ZDJA 3VOYA 3HLEA 3FKWA 1Q2PA 3M2JA 3UDIA 1KVMA 4LCMA 4ZDXA 1YLTA 1YLZA 2J9PA 1O07A 2ZQCA 5A93A 1SKFA 4MNRA 4LV2A 3VMAA 1S6RA 2G2UA 5HAPA 5CHUA 3V3RA 4E3IA 2QZ6A 4BLMA 5IHVA 4HEFA 1RGZA 5DF8A 2OV5A 2HP9A 3MBZA 5KMWA 2QPNA 1LHYA 1FCMA 3PBTA 1JWZA 4FH2A 4CPKA 4WBGA 3OPLA 4XXRA 3GQZA 1K57A 4N9KA 1K38A 3BECA 3GTCA 3VP4A 1WYBA 3ZCZA 4B4ZA 1MWRA 4QJGA 2P9VA 4X53A 3SOIA 2A49A 4PM8A 4D2OA 1ESUA 4HBUA 2WKEA 1XKZA 4E6XA 4NK3A 4KG6A 3SS4A 1PWCA 4JKTA 3UE3A 2IWBA 5GLCA 1XPBA 1ZC2A 2ZC5B 3HUMA 4QU3A 1GA9A 3GVBA 5CEBA 1GHIA 1FSWA 1K6RA 4ZTKA 2WGIA 1RP5A 2HDSA 1PYYA 1I5QA 3BFDA 4GNUA 4JF4A 5CRFA 3WS1A 2X01A 4GD6A 3WRTA 5CECA 4QD4A 2Q9NA 1LLBA 5CXWA 4IBRA 1W8YA 3IXHA 4BQMA 3BM6A 1ONHA 4X56A 5FATA 4X68A 4RX3A 3UPOA 3DW0A 3ZHHA 1K25A 2Y2HA 4UA7A 1NYMA 4S2LA 4GDBA 1E3UA 2EXAA 4X55A 5FI2A 2IWCA 2X71A 3FV7A 2Y2MA 5F1FA 1FR1A 5F82A 4RYEA 5TGFA 2ZQ8A 3UN7A 4S2MA 5A91A 3UE0A 3ZG8B
chains in the Genus database with same CATH superfamily
3UJNA 4GS9A 4IBKA 2QYBA 2QQ8A 1LSXA 4NPBA 1YPRA 2CC1A 3T4OA 3JUOA 2LH0A 2RRUA 1DRMA 5EOEA 1IN7A 1XNRM 1IBMM 1BLSA 5EUAA 1J9MA 1KGEA 1TDGA 4CLCC 1BNRA 4DJ2A 4DV6M 3A3FA 3B7QA 2DAGA 5J8XA 1X37A 3LT9A 5HFOA 3IQAA 2FNQA 3SH8A 1NJ4A 4N6LA 3LCUA 1BLCA 1WGLA 2AADA 1NXYA 2C5WB 4MBHA 3V92A 1RGHA 3E98A 1WGNA 3O5YA 7RNTA 4E3OA 3S4XA 1OUNA 1Q7Y4 2OOAA 4I5QA 4L4UA 3CNMA 3LCEA 2AVXA 2JN7A 1B20A 5L2FA 3T4SA 4O8GA 5F3WA 1OQYA 3NBBA 1GKIA 1QQWA 3S1YA 1T3TA 1S4RA 4OP8A 3TJZC 4XBXA 4L78A 5ITUA 1GS3A 2O9UX 1D0LA 2HMLB 4GDNA 2WZJA 1G8PA 3E4QA 3EN1B 1PWDA 3IX4A 2F5WA 1RGFA 4BWIA 4NETA 4EBLA 5C1BA 4DV0M 2JKTI 3G30A 1Q3BA 2H28A 2IUJA 1EE8A 3JAMS 3F1PA 1AIPC 1YI23 3N8LA 3LIDA 4I3JA 4LZJA 4QWTA 2Q0OA 3GSGA 4LPZA 5DTKA 3B8LA 3KOXE 3FWLA 1WMNA 2PD8A 3FUVA 3EC9A 5J7EA 3PBOA 5KIZA 5CGWA 1NNVA 2WKRA 3UMDA 1R4CA 2Q07A 4QHCA 3HJKA 3D5GA 2K31A 1IXRC 1WA9A 4PKYG 4MMZB 3LZAA 2ZM6M 2QIYA 4GHLA 3RJUA 1IXSB 2GQFA 3MSHA 5FTLA 4P16A 2HDUA 3C7VA 3HU2A 3TWKA 2VQEM 4OW0A 1X1UA 3URPA 4G3WA 2JP7A 1CYVA 3MYTA 1K55C 4GW9A 3VFFA 5HWWA 4QB8A 3P98A 4XBYA 1FA3A 2CV2A 4GC9A 5AI1A 4LG2A 3G6OA 4X25A 1JR3D 1N33M 3TE6A 3I553 2MC8A 4X2OA 2Y2LA 3HU1A 2VGJA 4G6ZA 4Y28F 1FQGA 4HM1B 4GKUA 2L4FA 3NUVA 2XSZD 6RNTA 1K54C 3THGA 1LRAA 3MQOA 1IBLM 4R4SA 3ULFA 1NHGC 4BL2A 3VDPA 1H3QA 3PTEA 2KRKA 4P85A 3QYBA 2R46A 1E32A 3FSDA 2DXIA 1L2BA 3H4MA 2WGQA 2O01F 4J9AA 5LC6A 1KFVA 2P09A 1QVG2 3RXXA 2KOIA 1GOYA 4E3MA 4AKZA 3IPTA 1JWVA 3D9YA 4E3NA 4DUYM 3UO9A 2W3DA 1QMAA 3CC73 3CHWP 4R9KA 3WS4A 2JY8A 2XH9A 2GXFA 1XWIA 3AOEC 2XZUA 1JJ22 3LY4A 2LVOC 5KPZA 1RGAA 4OVZB 3PNYA 5EJCA 4S2PA 1NVMA 1VEJA 3VSYA 3U1WA 2CFOA 3X41A 3MJQA 3PHYA 4KFFA 3MF0A 1FNNA 3NULA 2AHMA 3I4YA 1OPYA 1JVJA 1B2XA 2VEAA 1T3BA 3SAWA 2V8FA 3QP1A 2DENA 3IHBA 3L28A 3C4OA 3RH8B 3LEZA 4TUWA 1A2PA 1UCIA 3EQQB 1F9IA 4DR2M 4DJ3A 1MN3A 4HQAA 5FQJA 1VQL3 1ONGA 1W2ZA 3N4IA 5F1GA 2QHOB 1MBLA 3ER7A 5EP2A 3UNLA 4DBGB 5HPIA 3UPPA 4KQQA 2GNXA 5FI6A 1JZDA 4MMXB 2XD5A 2BIRA 1YT4A 3CC43 3I7JA 1MWSA 1PNEA 3EN8A 1PRQA 1W5DA 4IT7A 4KZ3A 3IMAB 7GSPA 1DP8A 1RGGA 1TGUA 1BLPA 3AGOA 4FMDA 4AEQA 3F92A 4F2LA 3FYZA 2MGWA 2KX6A 1G6AA 3SASA 4YFMA 4BBTA 3T4QA 3T38A 4QNRA 3S29A 1JBTA 3FRHA 1XMOM 2JBFA 1SQWA 5CERA 4NRVA 5FW5A 2GJ3A 4BBVA 4EW7A 3PZWA 4X62M 4EEPA 2Y2QA 1PYLA 2P0MA 2UUAM 1ES3A 3Q3FA 4LF4M 3SHGB 1E25A 4JI5M 4WM9A 3KFQC 1G68A 1HQCA 3L0RA 3JVVA 5EQTA 4N9LA 1HQYE 4GN2A 1J5EM 3X3YA 1K9M4 2EX2A 2H10A 3UB7A 5FTMA 3RGRA 1EG9B 1V9ZA 3IWIA 3U6LA 2XK1A 2F5NA 3HIGA 2F99A 5HARA 1K57C 1NRFA 1BSEA 4JI3M 1JB5A 3AL0C 1NDOB 1D6ZA 1NB5I 1AVKA 3KYEA 4KQDA 4U3TA 4O02B 5IG5A 3V98A 5HD3A 3SXXA 5DFYA 1HNZM 1XB2B 2CG1A 1ZG6A 1XJ3A 3A0VA 3OWUA 1IEMA 3IF6A 4P0MA 1GMPA 4HH2A 1ODVA 3K3DA 2ACGA 4MBFA 3B4OA 3GLIA 3IF6B 2P7JA 3UGJA 2LQVA 3UMEA 4XBOA 1G28A 3NBLA 3FUTA 4EUZA 1JTGA 3CMA3 4J8TA 4CLCB 1OFHA 3JUQA 1N9NA 4AI6A 4R3JA 3PBQA 3L29A 1R2YA 2QBYA 5EVEA 2VF7A 1YIJ3 1MKIA 5EPHA 4L7KA 4NREA 5AQBA 1GY6A 1AVLA 4YHHM 4RF0A 4JXGA 1OFIA 2RCXA 2JDIH 5ITTA 4LRTA 3IT9A 2J8YA 3CC23 1Q9EA 1N9LA 4KLNA 3EB8A 4R80A 2PBYA 2Z7JA 5J3WA 4YWZA 1ES2A 4IBDA 1EWZA 3H7WA 2EA0A 3S28A 2RGOA 1L3LA 2WK0A 4LF8M 4GKJM 4HAAA 2NUTC 1AR0A 2BG1A 3JPUA 5FL3A 5HPFA 4NG2A 3OZHA 1STZA 1L0DA 4GHIA 5TBMA 2F4VM 1OTIA 3S22A 4Q8IA 3U61A 4MN7A 1LOXA 1QDTA 5FGOA 3R7WA 4K0KM 4N1XA 3HY5A 1NY6A 2IMJA 6GSPA 3VOZA 1OF5A 1C7YA 2LB5A 1FGOA 4BIRA 4KQOA 1NU3A 4DR6M 2E2VA 2FXTA 4G3VA 1MXOA 2I9WA 2ZMVA 1BRHA 5EE8A 3S67A 2WADA 1BU4A 1HZOA 1R4YA 1WQLB 3VFDA 3ITAA 1VZZA 4LV3A 3GRUA 5C18A 3KIIA 4HLQA 3HUOA 3VV4A 3LI8A 4ZM8A 1VETB 4X1MA 4KUKA 2BLSA 3D9RA 2W03A 5TFQA 4RNTA 4OOMA 4F1IA 3I04M 1O7PB 5IG0A 3KOZE 2HJ9C 3VP0A 4K0XA 2CEAA 4KZ6A 4GOGA 1XGIA 3NHXA 3PCSA 3FKAA 3LYGA 2JKFA 3CF6E 3KOYE 4KVHA 1I2EA 4AG5A 3GP1A 4YNRA 1DVDA 1LL9A 2OOVA 3LVVA 7CATA 3E9SA 3DTIA 3FPWA 5FTNA 3BNBA 2HL7A 3HX3A 3H3HA 1DMMA 4LEHA 5I5LA 4M0WA 3UMMA 2E8IA 3HHXA 2ML5A 1BOXA 1L5GB 1VQ83 3WS5A 1NNJA 4WZ5C 4FCVA 3GWRA 4LY6A 1KOUA 2OLVA 3UB9A 1UUGB 2ZBKB 3BNDA 5HDDA 5H37D 2UUCM 2VV6A 4IJEA 4DKIA 2J5YA 1NB3I 1CEGA 2WSEF 5IEPA 5BOHA 3CPW2 4R3AA 1XX2A 1ES5A 2NQ8C 3J80S 5AEUB 1OIZA 3BU4A 4HM0B 2L7HA 3HLDA 4CCVA 4BL3A 3GV9A 4JV5M 1IN4A 2GX5A 3ZG5A 2WKHA 2ZOHA 1KVLA 3W0LB 2GSPA 1T19A 2WGWA 2XDMA 4E3JA 5F83A 1BULA 1RU3A 5DNYA 4G1MB 3HLCA 2HMMB 2Y2KA 1RRHA 5KQDA 2WAFA 3ZYTA 5L8MA 3PXGA 3F8XA 3K2LA 4R71A 2F86B 4IBFA 3DMCA 4RNZA 1YSPA 2Y2IA 3K9PA 1IV9A 3GSPA 4LF9M 5U47A 1GOUA 8CHOA 4ID4A 4IBIA 2BNGA 3CZDA 4WYKA 3NJAA 2E2TA 1V74A 5STDA 5CHMA 1QUTA 2Z2MB 3CWFA 3CCE3 3NBJA 1JNQA 3UB1A 3EEAA 4OH0A 3PBSA 3Q7VA 4KZ7A 2W82A 4FH4A 1N34M 1QUSA 1HTZA 4OLGA 5EXSA 2LVAA 1KQS2 4P6BA 3W4QA 1NZUA 3MXQA 2LB9A 3N6IA 2K2NA 2KAAA 2ZQDA 5IT5A 3OPRA 3ZVTA 2R18A 2ZJ9A 1UWNX 4QOZC 3GR2A 1MJGM 1YJN3 4LV1A 3QNBA 3VKGA 1GHPA 2D02A 1SIIA 2M7OA 1FGMA 5CK6A 3D4AA 2ZOIA 3P01A 3LR4A 5DVAA 3AGFA 2LVQD 2VV8A 1ZKJA 4LFCM 1QZEA 4R23A 4L16A 3VOYA 3MHEA 4NSOB 1IXZA 3UDIA 1Q2PA 4ZDXA 1OTEA 2O3OA 1YLZA 2J9PA 5ITXE 3VGNA 2KRTA 4LV2A 2G2UA 5TJJA 3V3RA 2DZNB 5IHVA 4HEFA 1RGZA 4M9XA 2J80A 2HP9A 2OV5A 1BRJA 4XDWA 5I97A 1F2KA 2QPNA 1FCMA 3PBTA 3T6PA 1HNWM 2KXEA 1K41A 1VQK3 2QNJA 2WOHA 2EWVA 1IDPA 3GQZA 4HBRA 1OGXA 3ZCZA 1IU7A 4KT0F 3C30A 3SOIA 4GS9B 4GHOA 1RKYA 2PD7A 2A49A 3BQ8A 1ESUA 1S67L 4HZ9B 3BIRA 4GH9A 1OTBA 1XKZA 4QPRA 4E6XA 4NK3A 3UE3A 1PWCA 2HOHA 3EX9A 4HI4A 2JA2A 3L27A 1O7WB 3U6SA 2KA6B 3B7NA 2ERCA 3FF0A 3Q1CA 1GA9A 1W01A 4I5SA 4GEWA 2MJ5B 2XZFA 1FSWA 2VA0A 3T1YM 1RP5A 1PYYA 2HDSA 4WURA 5IWAM 5DYGA 2L7IA 3BFDA 1DVCA 3G4S3 4GD6A 2R45A 3WRTA 1N8QA 4QD4A 3JUMA 1VQ93 3GO8A 1L1TA 1QJGA 3O8YA 4FUWA 4HNBA 3PXMA 4IBRA 3R9XB 2LHGA 4NXNM 1LXEA 5KPRA 1CQAA 2YX9A 4X56A 5FATA 4M9ZA 1N77A 4LF6M 2CHGA 3DW0A 4EQ1A 3FTEA 2CFDA 4K61A 3NQZA 2EXAA 5FI2A 3MWZA 5EM0A 4GIPA 4Y17A 2Y2MA 4CLCD 5F1FA 5F82A 5TGFA 2ZQ8A 4N6OB 4S2MA 5A91A 1EA2A 3MHVC 1SARA 1G0TA 2UXDM 3BJNA 5KP3A 3RNTA 3A3IA 3BRMA 3G35A 4L9GA 5EVLA 5GLDA 5CX7A 4O7DA 4LFBM 4K90B 1NV8A 5EVIA 1BAOA 5I94A 2R4IA 3O3VA 1K56D 3F14A 1JV2B 5BXQA 1LL5A 3CLOA 2QP9X 2GBWB 4PT5A 4N6UA 3Q2PA 2APLA 4OPZA 3B9PA 2CH9A 3CJMA 1UCJA 3IG5A 3NX0A 5AJGA 2Z8YM 1ZMUA 3H82A 1IYSA 3W68A 2WKQA 3FGYA 4WZ5A 2HWJA 1T18A 1GSPA 3F8HA 5HW3A 3BBZA 5EXXA 2W3EA 3KSFA 1S3SA 4OK0A 4L9FA 4Z9QA 5LBRA 2FNAA 4GL6A 5HAQA 2I7NA 1W6GA 4MLLA 3N8BA 1BZAA 1B21A 3UL6A 3OLOA 1K82A 2OOBA 3QK9A 3U2AA 4EXOA 7STDA 2K6BA 3S7NA 5KZHA 2EX9A 3S7PA 3BLSA 1XMQM 2DWMA 1FUSA 4ORLA 2P38A 5CLKA 2YKFA 1CI8A 2O5RA 5AQ7A 1T2HA 3F1NA 4HIAA 3V39A 3HBRA 5F68A 2CWTA 5G4ZA 3KS8A 2MROB 3MFDA 4D60A 1JN5A 4CJNA 1IY2A 1PJTA 4B7GA 5IREB 4N3VA 4CISA 3NV0B 5CF1A 4EV4A 4GC5A 3JVCA 1HKXA 2GDNA 1NWZA 1PIOA 4NXGA 1TS8A 3C38A 1PZPA 4JXJA 1FCNA 3DAVA 2J7OA 3V50A 1FUTA 2KHHA 1I2SA 3G4PA 3IXBA 4PPRA 4WWUC 3F1OB 3GMWA 3A5EA 1NYYA 4RQ9A 1L2CA 1JB2A 1G02A 1CYUA 3FUXA 3WA3A 3G713 1MPLA 5E6JA 3NBXX 3SAUA 2ZAOA 2XRXB 2Z77A 1LI9A 1TRQA 2L09A 1OHOA 4NXEA 1Q3CA 3A3DA 3EHCA 4UQIM 3W8KA 3FUWA 4KZ1A 1TDLA 1OHPA 3SAVA 5MC7A 2LWXA 1TS0A 3LIAA 3FG4A 4ZBEA 2Z6CA 1F8NA 3LIFA 1Y8GA 5CEDA 1JKGA 1XJ4A 4Y0TA 1IOUA 3HJIA 3LFVA 4ZAMA 2WZZA 2CX1A 1RCJA 1YLJA 1ZG4A 2IY2A 2XFTA 5EECA 4K1VA 3QWLA 3PBRA 2KDKA 1IT7A 2P05A 3BY8A 4RBNA 1B27A 5M18A 2EXBA 3BEBA 3QP8A 2C99A 4DF6A 3U6DA 5AEWB 3HCYA 4HJ6A 2OTL3 1WXQA 1NSFA 4XT2B 4KO8A 3F1OA 4WEKA 4MGYE 4JPMA 4GITA 5FTJA 2HP6A 3FZCA 1WNHA 2L1SA 2EO2A 3I51A 4LF5M 4Y0UA 4B7FA 3UZUA 1PWGA 1NY0A 4GMQA 1SKOB 3EGXC 3SMPA 1T1CA 3BLZA 1S5AA 3A0RA 4EQIA 1TRPA 1PZOA 4DE2A 2FS1A 2W1TA 1SIHA 4L8PA 3KSGA 3OBFA 3ZGAB 2CW9A 4JI7M 4CDLA 2ZDJA 3IECA 4EV5A 1MX0A 1PGYA 3AOGA 1AV4A 3BFEA 3F1NB 4BJPA 4WHAA 2H1RA 1W63M 4DR3M 3TE8A 1ROVA 3T1HM 2H5SA 4MMNA 5FAPA 1DV0A 1QAKA 1Z6FA 1YLPA 3G2YA 4QHTA 3BYDA 4EBGA 1I70A 3LTDA 4KZAA 3UB5P 2UXBM 3KDSE 1Z5BA 4NRWA 4RA7A 1ORYB 5HX9A 4R38A 1Z59A 3ZQJA 1ZS7A 3GZXB 3EOIA 3MZEA 5TGNA 4HESA 4BBAA 1K55A 2CV1A 1FJGM 4RNAA 3T8UA 1OTRA 1D06A 1DO0A 5AQAA 4OPQA 1PJSA 2R65A 5AIFA 1KDSA 2RCDA 1CI9A 2ZMAA 3CPOA 2EX6A 5HD5A 2Z4SA 1OGZA 1IQYA 1VQQA 3VLFB 2BWEA 4JI2M 3BW6A 1W6YA 1V9YA 3A98B 3SMSA 2C6WB 4UA9A 3T4JA 2XSHB 4OQ0A 3CG5A 1Q864 3OW22 1Z5AA 1YJ93 2OOLA 1RGYA 2QMIA 4E6WA 5EVIB 1YUBA 4OX9M 1GHMA 4FSFA 3U5ZA 3SC3A 1I94M 5JYOA 4S2IA 4MCWA 3S7QA 1D6UA 1N5PA 3CF0A 3GPUA 4HM4B 2XD1A 5BPVA 3NCKA 5HDCA 4X65M 1R4GA 1L1ZA 2DNSA 1L0GA 1YNVX 3JR4A 3EEHA 4Q7JA 3MR0A 4U13A 4X6TA 2A24B 3C3EA 2KDLA 1JTDA 3WS0A 2UXCM 1GY5A 1PJIA 1Q2QA 4K08A 4DDYA 4UA6A 5EXPA 3SS5A 5FSWA 1IQXA 2CWBA 5EQLA 5TR7A 5KP4A 3JYIA 2OQEC 1TTEA 1YLWA 3VF1A 1H8MA 4B3MM 2XR8B 2CV0A 3N8SA 4Q0IA 3FLJA 4WLAA 2DHRA 1J2BA 2OO9A 1E4DA 4HM6B 2MR9A 1YMSA 4HM2B 3Q90A 3OXAA 2CUZA 5G18A 3C4PA 2EA9A 1CQSA 2RKOA 2PNCA 2ZHXB 3IWQA 1IFQA 1J3WA 2LBCA 1SHVA 4ZRRA 2HF6A 1DP6A 1R5LA 1T1AA 1BUEA 3FZWA 1RLSA 4AKGA 3GLHE 4EC6A 3CMZA 4DE0A 3T50A 3WR2A 5E2GA 2Y59A 1BRKA 3T1QB 1IKIA 5FASA 5M1AA 3AGEA 2I7PA 1W00A 1BRSA 4C3QA 4EXRA 4OOLA 4X2HA 2W1TB 3AMOB 3QNCA 3TRCA 2GBXB 4LCBA 4NC6A 3RE8A 4LJ7A 3MZFA 2MH8A 1O7NB 1XHBA 1FSYA 3D72A 4B88A 1PM5A 1LSWA 1GSXA 1W63Q 1WYCA 4AKHA 1UWPX 3KYQA 3MQ0A 5F5YA 4BMWA 1KE4A 3E2LA 4RNYA 3EWKA 3U4LP 1XXHA 2J7NA 3IHPA 1IVVA 1RN1A 4HM3B 3EQUA 4XM4A 3CGWA 4DR4M 1BRNL 1UM8A 1IYYA 3MS6A 3FTFA 1SXJE 2FFYA 4L6V6 3DZDA 1UGHI 3J7Yd 1IY0A 1L0EA 2P5TA 2BMQB 4WELA 1MY8A 1HT2E 3IH8A 2C11A 3E4RA 3CAXA 3MQQA 3S27A 3CD63 4XB5A 3TL4X 1GMQA 3Q7VB 4LV0A 3V67A 2KW0A 1KD14 3AKZA 1ZGXA 1OKSA 3VK8A 4S2KA 4WF0A 2KNVA 2VF8A 4LZIA 4BTYA 2WZXA 4HM5B 3HL9A 1TEMA 2PU2A 4IBCA 1O7MB 1OT6A 1M6KA 2L2DA 3AGNA 3IXDA 1GSWA 1TU5A 2M5ZA 3GLFA 3A76A 2NUPC 4JN6A 3NBIA 3Q1FA 2D7HA 2CWVA 1F4IA 3LYXA 5DKKA 1RJOA 3BFGA 4MGHA 3TWMA 1DGFA 1WHCA 5CXOA 2Y91A 4WUJA 2P74A 3BB9A 4AZFA 3C3DA 4II7A 3LXUX 2HKJA 4KZBA 4EWFA 1TS6A 2QENA 1I3IA 1MNLA 1N9JA 2UX0A 1BYWA 3G34A 2BWBA 1IFYA 2K9DA 3ILKA 2UGIA 4WFOA 4N1HA 3NWLA 1W4NA 1NLYA 4D82A 4O2HA 3CCJ3 1E94E 1GMRA 3KSPA 4M3KA 1N5HA 3U6MA 3NOTC 4RVAA 5JYPA 5KSCA 3ISGA 3J7BA 2QSFX 2L1MA 3ECFA 1EQKA 3TOIA 1HR0M 4EYCA 3OCNA 2B02A 4QY6A 3RDEA 4OUQA 4JXWA 2JKRM 2R9WA 2CG0A 2KZSA 1PFPA 1PI4A 4JGOA 2BO9B 3ZNTA 2BU4A 1CUKA 2KF3A 4LSOA 3ROBA 4EBPA 1X0OA 3LTCA 4JBFA 4Z1WA 1E9RA 3FCSB 4C75A 3AHWA 4J5KA 3U6OA 4GB5A 2EFUA 3VOLA 4IUKA 1JBSA 1V92A 2DI0A 3LTAA 3GLGB 1KE3A 4UAAA 1YKDA 4WMCD 4Y2FA 1N75A 4IHQA 5IS1A 2M60A 2Y4AA 2XSZA 2R9XA 3G8ZA 4FW9A 4LJ6A 1O7GB 4G4QA 5L10A 1VETA 3DGNA 4IIWA 4ITQA 2K0BX 3J7AS 3I01M 2HMNB 3H82B 3M2JA 3TWLA 1KVMA 1YLTA 2ZQCA 5A93A 3SLUA 3CNXA 2KEBA 5HAPA 4MGZE 4E3IA 3B7ZA 1I8VA 2H5XA 4Y3IA 4L15A 4CJ6A 1A2VA 1OF5B 5DF8A 1BVIA 3AFHA 3EBYA 1TUHA 3MBZA 1T43A 4FD2A 4PHTA 3MMPA 1LHYA 4FH2A 4CPKA 3OPLA 2HAKA 4RF1A 3R7WB 2JY5A 2CWUA 3HJSA 3U61B 4B4ZA 4B3TM 1W5TA 1D0MA 2V1UA 3HHYA 3P7NA 3DH2A 2L0WA 2F5QA 2VLGA 3MMHA 3VDUA 2WKEA 4GRIA 1AY7A 4KG6A 1V33A 5AYRB 4JKTA 1TF0B 2CC3A 2IWBA 4AFIA 4GCZA 2YKHA 1H6UA 1ZC2A 3H7WB 4DV7M 2XSSA 4JI1M 3DZLA 2WGOA 3CCR3 1OHSA 4BLCA 5CEBA 3GRYA 1K6RA 1I5QA 4JF4A 1MC0A 2X01A 2W2CA 2PDRA 1K8A4 2Q9NA 1LLBA 4L9EA 5F69A 2M7VA 3R4KA 4LFUA 1W8YA 2DAMA 3LTBA 4M9SA 4K1UA 4LJ5A 3JUNA 4E04A 3UPOA 1JBRA 3IBJA 2W9QA 3L25A 2H0HA 3KN4A 4ETXA 3BWLA 1K25A 1X1YA 3GLHB 4KUOA 3SATA 3DOAA 4UA7A 1UGIA 1E3UA 2O9AA 1JQJC 4Q0JA 3FV7A 2F4YA 2K7SA 1CEWI 3UE0A 4LGWA 1TH3A 1P9RA 2OAP1 3ZG8B 4B7HA 4OVDA 2D42A 1GSVA 1MZUA 3H4JA 1N32M 1E9SA 1RNTA 1V57A 3L9KA 3NC8A 2W0NA 3WWXA 5FSRA 3HU3A 3GLFE 3K3CA 2ZLYA 3M0EA 1QVRA 1YGWA 4HP4A 1MGWA 4AKIA 3A3EA 1RGKA 3CCS3 1K56A 3LW5F 3GZRA 3CITA 2X4AA 3EJVA 2J3WA 1QAOA 3LH4A 3I0YA 3WHKA 2W56A 3F9SA 4LRZE 1W8QA 2ZTCA 1QAQA 4JI4M 2EWWA 2CE7A 2YFQA 2JKGA 4HEOA 3B74A 1FGRA 3F7XA 5CF2A 2V1BA 2Y0QA 1RMSA 4XUXA 3SH9A 3LT8A 4LGQA 1A5TA 1BVSA 2OPFA 4H61A 4IPBA 1VM1A 5K5BA 4U0XA 5ITRA 1VEGA 3K92A 1C7HA 2ZBBA 1NHWC 1F98A 1XFQA 1S66L 1ISKA 3EQVA 2K47A 2HMKB 5EP1A 3BNCA 1D1JA 2M1CA 1SG9A 1N9BA 4DDSA 2DWLA 1RTUA 2B18A 3N7WA 1G59A 5KP1A 2DMWA 1BLHA 4ARZA 1QANA 3MK6A 2CIUA 3TPZA 3CCM3 4PEJA 3U6QA 4EU0A 2LHCA 4GKKM 1TR8A 4WYKB 4R0QA 3MFXA 4GB7A 5EFWA 2O9BA 1PW1A 3TW8A 4HBTA 3UE1A 2AAEA 3QP6A 3CME3 1YIT3 1EI5A 2EFXA 1TTOA 4LGMA 3SYLA 2CFKA 4DRTA 4BU4A 2ZM0A 3MSOA 2D7GA 1IYPA 3IHAA 1CK3A 3T1XA 4KFDA 3CCQ3 2W3HA 3UK6A 2C4BA 1BTLA 1KE0A 1VG5A 4KZ9A 5HAIA 2EKFA 3J2PB 5IF6A 1Q42A 3RGPA 3A45A 5HOHA 1BNSA 3KVWA 1GCEA 2QHKA 1BSGA 4B93A 3HKPA 1NRJA 1YE9A 3DXOA 4K0WA 3FG8A 1B2ZA 1MU5A 1XP4A 2O99A 3E0YA 3KCHA 2CFLA 1OJ5A 2UWXA 3SHFA 3MKEA 2Y2GA 3E4PA 1FGQA 3T1SA 4OQGA 4DV1M 1C54A 2V8CA 2CRUA 1HNXM 5LMUM 4Z8XA 1QZMA 3B89A 2GEYA 4OLDA 4B4XA 3KW6A 4MB7A 5A90A 3M6AA 2WUQA 3V5MA 3B7CA 2CP8A 3EIEA 3LUQA 3ZVWA 4IBJA 5DREA 3DA1A 2JKTM 1P9WA 4CLCE 5BVBA 5EP4A 2VGLS 2ZM8A 3UE6A 1G5UA 5GL9A 1RGLA 3C58A 4X64M 2INXA 2EX8A 5FTKA 4IBXA 2HMJB 4ILFA 1OTDA 1ZHHB 1GABA 4AW4A 2VGLM 2B95A 3L26A 5G1KA 4G3OA 3SX1A 4FWHA 4G4RA 3HZJA 4KHPM 1VQ63 1IT8A 4PDGA 3GRRA 3SEDA 3SVAA 3DWZA 3WODG 2Y79A 1DE3A 2KF5A 5EP3A 1VEUB 1JR3E 3O86A 3JUPA 1MOLA 4OQHA 1GVNA 3LVWA 4CHTB 5D3OA 2XF3A 3R8FA 4STDA 4DV3M 4IBEA 1VDDA 1IN6A 3Q8GA 3BFFA 2Y2OA 3ICYA 5F6AA 2IYJA 4ARZB 2R4EA 2CKFB 2YQZA 2HV1A 4IIAA 4WP2A 1TS7A 4O8SA 1YM1A 4BTWA 1PJQA 4B9OA 4R70A 3B3XA 3F1PB 1DGBA 3SYKA 4FMCA 4JXVA 1WE4A 2OTJ3 5TBMB 1NY5A 2OSUA 4GHIB 5C5KA 1SDEA 3GRJA 5DJUA 4E3LA 2OQ4A 3UB8A 1K734 4FCFA 1R2ZA 3PS8A 1F5MA 2PHYA 3LMLA 3BY9A 5HDSA 4ZJ3A 4K91A 1B3SA 1G71A 3G2ZA 4LRSA 3RGSA 2V1AA 3LI9A 1R7RA 3VE4A 3EE1A 3EBTA 2QKPA 2FZ0A 2WGVA 2HZ5A 5A92A 3KO6A 1VDLA 3E21A 1W7FA 1FZUA 1GOVA 5E26A 3CF2A 1SCWA 1T1BA 1I3FA 1KYIA 1VQ1A 1ASKA 2WOFA 3VK7A 3WDGB 2P08A 4N6TA 3KP0E 2HGVA 3U60B 3M8CA 5KO3A 2W56B 1KDWA 5FAQA 2KNAA 3LY3A 4ETZA 1BGSA 3N54B 4ZPXA 4I81A 5JI3E 3SOAA 2GNOA 2CHQA 4Z6YA 1OH0A 1CEFA 3OWSA 3ZG9B 5D82A 2Y73A 1XA1A 2YR0A 5G2GA 3X3XA 1UGUA 3PBNA 2UU9M 4BD0A 1YGEA 3D8LA 1LL8A 3C5AA 1NO3A 4NEED 4E3KA 1KWIA 4XDVA 1ALQA 2F98A 3A46A 5HWTA 1N9OA 1DMNA 4DUZM 3HK4A 1UUWB 1EEJA 4HYZA 1K28A 2HCBA 2B5RA 5LC7A 2VK3A 1ZTUA 2J9OA 3GLIB 3IH9A 1CF0A 2Y2NA 3WHLA 3MKIA 5IU1A 2J3TD 3G0KA 2W04A 2K0MA 4PD2A 2ZANA 1SXJA 1OT9A 1IK3A 1D6YA 2WKPA 4HZBB 5IERA 4OPYA 1I0XA 3NXJA 1J09A 5EXTA 1OACA 5ELUA 3NDEA 4EW5A 5FQ9A 2CHVA 3WOEB 4J5GA 1Y54A 4L0LA 3MG2A 2M7UA 5EOOA 4X1LA 1G3IA 4I38A 1E3UD 5CGSA 5FDSA 2R62A 3K1JA 4PM6A 3L2AA 1BRGA 1PRBA 3KSIA 4BTXA 5AIGA 4MDZA 3U60A 1P3QQ 1W5SA 5BU4A 5A8BA 5GHZA 5GLBA 1CJFA 2D1WA 1HU9A 5CGXA 1PI5A 3KP1E 1OIPA 2KLIA 3KSED 1MKMA 4EETB 3DGYA 2VKSA 3B42A 3SZTA 3ZNYA 2YNMD 3DWKA 1HZ1A 4L8RC 2VJWA 1FIKA 1EW0A 5E2HA 4ZJ2A 1RCLA 1YMXA 1SJWA 3PXPA 1OCVA 5FQIA 2KF4A 2W6JH 2QEX3 1I2WA 8CATA 4FD8A 2XEPA 3ZG7B 1U60A 2P9VB 4JLFA 2V2FF 5ITYA 2W9PA 1IYQA 2W3FA 1GO5A 2C9OA 5IT9S 2GEXA 1RGEA 1PW8A 4LFAM 3H51A 4R4KA 1N8R4 3VKHA 1IELA 2I72A 3GDIA 3LEQA 4NKPA 2C96A 4EUVA 3WA2X 1GD4A 2OLUA 3PNVA 4AKYA 3MPHA 4JGPA 3Q8XA 1DYUA 5AQ9A 1VEUA 3DFZA 1JB4A 2Y20A 1H8ZA 2WAEA 4KQRA 4DXBA 4JYAM 4A3VB 2Z76A 3D3OA 5KSHA 1W6CA 1VHMA 1E3RA 4WYYA 2BHMA 3UNWA 4LLOB 4JXSA 3D4FA 1A90A 1IQPA 5ELJA 4QWOA 3K9OA 4OQIA 4KG2A 4XUZA 1TVFA 1RN4A 1DJBA 1L2DA 2L4VA 4PM5A 4OVZA 3KFUG 5L8RF 3PYJA 2Y2PA 1I4WA 4L8OA 2GU1A 4LENA 4FCZA 2FH0A 3K7CA 5DRVA 1IQ8A 3RFBA 2OCTA 1IYOA 2P04A 3GQ3A 3ZCBB 2A5YB 1EROA 1VQ43 2GU3A 1SXJC 3DGOA 1G41A 3HVFA 5HZHA 4PAUA 1SXJD 1K4EA 5GHYA 5L09A 3NI9A 1RRLA 2LTUA 2DWZB 2MF7A 2E2UA 2ZAMA 4FWGA 3GQ4A 1K3XA 1T5YA 4NHFA 5DFLA 2F56A 3IX3A 4IBBA 4HOHA 3VP3A 4KFEA 2G5GX 2QZ4A 3DGLA 4P6ZS 3W4PA 1IV7A 3NM2A 4P87A 1BANA 3HX8A 2ZC3B 3T12B 1WMOA 3IWOA 5DYIA 4GHAA 4WEJA 3GRDA 1DJAA 1OJLA 3RXWA 3ALAA 3V3SA 4UEYA 1X1WA 1H0MA 4Y0OA 1M904 3JVUA 5CTMA 2Y2JA 1B2UA 1O7EA 2OAQ1 5AVFA 4JF8A 1XJ6A 3WRZA 4HM8B 1QDRA 1L8QA 3H9WA 2IWDA 2XLNA 1J7KA 5FEGA 1IXSA 4R3BA 1HD8A 3Q07A 5JI2E 3FE3A 3J81S 3C7UA 4AG6A 2JUJA 1IY1A 3Q82A 1FYSA 4M0DA 2XGLA 1HLUP 1FCOA 5BR8M 5IZ7D 1MGRA 2C98A 2QGUA 3CPTA 3O87A 1R6BX 2V1CA 3NDGA 3S7OA 4PMAA 2G8LA 1EUIC 3UJMA 4QHSA 2VX8A 2DAEA 1UDII 4OOYA 2ZL8A 2ZTDA 1Q824 3C9PA 2K54A 4NXBA 2BMOB 3TSGA 3BNEA 1W7CA 2H0TA 4ME4A 4BB9A 3IX8A 4WN5A 3HHWA 3FPVA 2JKRI 3O88A 3E99A 2PYPA 1GD3A 1XC8A 4S2NC 1XXHB 4H6JA 1Q40A 5DFXA 4FWDA 3K8ZA 4I39A 4ANRA 3CI6A 4P6ZM 1M40A 2Y21A 1YLYA 4H8RA 4S2NA 1E97A 2UUBM 3DTKA 4BBUA 2LYXA 4EV2A 3OWYA 4LCMA 3HZPA 3A0SA 1YJW3 3T4KA 4CGYB 2UV0E 3NOUC 1G96A 1S6RA 1P0ZA 4GJ4A 4I4KA 3S5CA 3KSXA 1S1YA 5KMWA 3IG8A 1GJSA 4WBGA 4I4LA 4XXRA 1K57A 3HJ8A 1NNUC 4DR5M 3VP4A 4QJGA 1MWRA 4DV4M 4X53A 3I4VA 3J27B 4NSRA 4D2OA 1QAMA 1M1K4 3HI7A 3U6PA 3B47A 4IJGA 1GLNA 1NWWA 1GJTA 3LR3A 3DUKA 2KNZA 5AYSC 2FH5A 1XPBA 3DBAA 4M4XA 3AOEA 4LYLB 3HUMA 2ZC5B 1RSNA 3A42A 1ROAA 2KZUA 3TQSA 4D81A 3GLHA 1HJPA 5JPPA 1B2MA 3GVBA 4LRXC 4XGIA 2QA43 1GHIA 1LOYA 2F5OA 3MG3A 5L07A 4BLMA 2RFRA 3PVSA 1TD5A 3WS1A 1ZMWA 3G16A 4DMZA 5CECA 1HT1E 4O0PA 5CXWA 1Q7HA 2EUCA 4H3UA 4BQMA 3X42A 1RNBA 2R6FA 1DGGA 5KQ8A 1ONHA 3NOPC 4RX3A 1LQGC 5DJTA 4DV5M 3ZHHA 3NHQA 2GZAA 1NYMA 1BSBA 1LQMB 5ITQA 4GDBA 1Z5CA 2LVPC 2R0IA 3FTCA 2X71A 4G3KA 4EEUA 2O9CA 3ZH9B 4LZZA 3MG1A 4RYEA 1U5OA 1D2NA 3BOSA 1G6OA 3E4OA 3UN7A 4QOSA 4R3DA 1VQN3 3QP5A 3HJQA 3AGDA 2ZQ9A 2IA7A 3DGMA 3U5ZB 2Q2EB 1M9GA 5GSPA 4LJ9A 2RBIA 1WR1B 1EKMA 1KGFA 4ESPA 1WJ7A 3T15A 3DY5A 1N9EA 1VQM3 3SS3A 1ULJB 4IBGA 3CUEC 2HJEA 3HGIA 2JY7A 1TP6A 4HVNA 9RNTA 5E2EA 2YFJB 1JB0F 2FE8A 4FCWA 2PT7A 1WIVA 3DM8A 3HLFA 2ZA4A 1W79A 2WO0A 3KKGA 3LOYA 4DXCA 2WSCF 2PBDP 3W67A 2JZ0A 3FD9A 3SOYA 3HIIA 4MEZA 2QCUA 4FMAA 5A0OB 2OWPA 4FR9A 2J3TC 4NXMM 2XQZA 2VDBB 2XROA 3BXWA 2XGNA 3T4LA 4Y15A 1Q814 4OKPA 2ML6A 3TDGA 1TJDA 2LXEA 1YHQ3 3LIBA 2JWSA 1BNIA 3VP1A 3N8RA 2PU4A 4WW0A 4FCTA 1KGGA 3FC7A 4KODA 3GLGA 3CUEA 1US1A 4B3SM 3F40A 1XGJA 3NBRA 2Y74A 5EEOA 5E43A 4PCZA 1SDNA 4JI6M 4JF5A 4G4OA 3U6CA 2ZMFA 3ITBA 3Q81A 4OU7A 2X8AA 1K3WA 1MWUA 1RCKA 2OQEA 1TF1A 2VV7A 2Q9MA 4NXFA 1TDZA 2X02A 3GRVA 3GQ5A 1ERQA 4P17A 5FLXS 1LSVA 3PFIA 1T2IA 3QP2A 1LOWA 1OAOC 2J8XB 3JR5A 4QY5A 1Y4OA 4GZBA 2ZC7A 4OONA 3LIEA 2WSFF 1UW1A 3ZG0A 1W2B2 1JWPA 1QYRA 1A2KA 4MM3B 3CCU3 4R6LA 1SKOA 1VQ53 2D7EA 1BNEA 2R41A 3KSJA 3VSLA 4A5RA 2FFFB 3M7GA 3VP2A 3HLWA 1LI0A 3AV0A 1XNQM 4RX2A 4WL9A 2Z2LB 5GHXA 1JR3A 1IM2A 3MXRA 5DF9A 3FYDA 1OTAA 4DE3A 5ITXA 3GZYB 4Q53A 1BNFA 1T6OA 1JNUA 1RN7A 4GD8A 3GPPA 2XR0A 5JPUA 3M6BA 3RGAA 1IKGA 1ZQ9A 1C1KA 2RGHA 1U8CB 4HKVB 1NJGA 4AQYM 3KE7A 4RZMA 3FKVA 4W5WA 4GLQA 2BJWA 4MN6A 3IBRA 3STDA 3GLFB 2W3GA 4XK8F 2V20A 2ZL1A 4PKYA 3GLGE 1N36M 4DV2M 1DGHB 2C10A 4HJ4A 1I2FA 1JKGB 1IN8A 2RL3A 1D7EA 2JCHA 1O7HB 4I8OA 2WYXA 1DGHA 5FA7A 3C2WA 4IEDA 2A3UA 2ZQ7A 4UQIS 2K3DA 2F5MA 2ZL1B 3F7SA 3UPNA 2DCFA 3SARA 3UDFA 3QYEA 3SYUA 5DTSA 5HGRA 2J7VA 4BD1A 1NV9A 1YSQA 5G4YA 1ZMVA 2DAKA 3HREA 1YVSA 5BIRA 4R4RA 2WKIA 5IW9A 4F3LA 2XSOB 1IVWA 1GYBA 1UFZA 3WOFB 2V9AA 4KZ4A 3NIAA 5AIHA 4R1GA 5GKNA 4MEIA 3HOHA 4HY8A 2L4RA 4HM7B 1MWTA 4NOOB 3T8NA 1LT0A 4GSPA 2HPBA 1G4AE 3KZTA 3HUNA 2HMOB 4WZ4A 3OCLA 4MMYB 3OOVA 5FQQA 1GY7A 4WMCA 2Z4RA 1I0VA 3AMOA 3PAGA 2YFIB 3MKFA 3VFHA 2B24B 2V0UA 2EKKA 1KSFX 1GL6A 3QHYA 3WHOA 2HDRA 4DN0A 3LICA 2V6ZM 2N35A 4IVKA 3X3ZA 3B33A 2CHCA 3K63A 3DTEA 4R9LA 1OPXA 5GLAA 2DRWA 1L0FA 2PR5A 1STFI 4EESA 3NECA 2Z7AA 4RKUF 2B3TA 4HJ3A 2RSXA 3PR6A 1RDSA 3G31A 2W0QA 3K5TA 3MXSA 1YLAA 2JZ1A 4HOIA 4N6V0 2BJVA 1BSCA 3GLIE 1IVXA 3I563 3ZC7B 1DO2A 4O3VA 1AUAA 1UCLA 3IXGA 3VSKA 2PAVP 3AHSA 1A0KA 1VEKA 5DKLA 4C6YA 2JXNA 4WP5A 2JC7A 2VIIA 1STDA 4UN2B 2H0GA 4MGKE 4XBTA 2V1ZA 2FOIC 2DZOB 4JF6A 3IS2B 4LJAA 4N6MA 4EBNA 1YVBI 4I3IA 1XJ2A 2IA2A 2W27A 3RTYA 4REZA 3OV4A 3MZDA 1H8YA 4LJ8A 1AQZA 1LNIA 1M1XB 1YQSA 3T1RA 4DE1A 2H0IA 4LCLA 1V34A 2Z3XA 1B2SA 5FI7A 3B4PA 3GAXA 3QAUA 3LO7A 2A24A 3KX0X 2RGQA 2MJ6A 1ZV1A 3G32A 4OP5A 2PYRA 4G4NA 2QPAA 5FEFA 3GECA 3UL5A 2ZD8A 3TG9A 3EF8A 1HYFA 1DP9A 3KOWE 4NL4H 5FQKA 1EIJA 3FRIA 3SFZA 3D8BA 2CFGA 3FKEA 5FDHA 1W02A 3IF6C 4DR7M 1LNHA 1SZVA 1ULIB 1IN5A 3MJ5A 1L2SA 4JI8M 4N6NB 4YINA 1NLZA 5J4EA 2VZWA 4S12A 3V99A 1XXMA 3X40A 2JHEA 4B08A 4MN5A 1S0WA 2QJ7A 3IS2A 1LOVA 5HSQA 4FVMA 1LV7A 2XLJA 1UI8A 5DTTA 2DAIA 1EFUB 5G1LA 2VQFM 4N92A 1VB6A 3NQYA 4KT3B 2OOVC 4HHDA 1NZOA 4F94A 5FQMA 3SBJA 5A2QS 4X69A 2D01A 2HHHM 3E2KA 1QMEA 4YOFA 1OMEA 5FAOA 3G6E3 1ES4A 2PR6A 1YSYA 2IUKA 2I9VA 3OX9A 1Q39A 1XA7A 2C5RA 3M6HA 2F5PA 2VGKA 1K6SA 4S2OA 5AVEA 3UB6A 3LCVB 2DWNA 1BRIA 2XFSA 2OWJA 3BLMA 1Y28A 4Y5FA 3ZQ5A 1FUWA 1Y4KA 2SARA 3D3LA 2CFWA 5EVHA 3Q7ZA 2H0YA 1QAFA 2O0YA 4PM9A 1I2GA 4MJDA 3ZFZA 5M19A 1BT5A 3FTDA 4EIWA 2R4JA 4HJLB 3T4TA 3HWSA 3PAEA 1OAIA 3BQAA 3OC2A 4MGIE 2L4EA 2O25A 3E46A 1WMPA 3IF5A 1VQ73 1UI7A 1Q40B 4H6JB 4BENA 4FCJA 3PCRA 2R78A 2CK3H 3UDXA 3FYCA 1WTHA 1UCKA 3DTMA 4S2JA 4HP9A 3KYZA 4XT2A 3SW1A 3K2NA 1LVNA 2YFLB 1QVF2 4F3LB 5LMNM 4OVMA 1N78A 2G2WA 5CTNA 1DY6A 1BUQA 1TH4A 4B3RM 3U6EA 1P97A 3EIHA 3M2KA 4OPRA 5D83A 5CHJA 4U0TA 1S4SA 3C8CA 3CCL3 3CPTB 2DNAA 4LMIA 3LR0A 2XRNA 2G7UA 1ZAEA 4LGYA 1K54A 1DJCA 1ESIA 1DETA 3K0ZA 5E2FA 2JQ5A 1S1ZA 1TH2A 4HL4A 1BNGA 1GL7A 2V0WA 3QP4A 4Q0HA 3HHZA 4Y7PA 2ZC4B 2OWHA 2BNKA 3GPYA 1UUVB 5DF7A 2Y8HA 2BT3A 1BUJA 2QJ5A 1FR6A 2Y55A 4UHUA 1NJFA 3L7HA 3CTWB 1BSAA 1KC84 4IUHA 4KENB 1YAXA 3SH7A 5HL1A 1XFNA 2W1RA 2WGWB 2BMRB 4D80A 2CX0A 3UY6A 3A3JA 4Y13A 2V1LA 2F5SA 5EVIC 5IEOA 5EVID 1GA0A 2ZQAA 2BTFP 2A15A 2ZM2A 2QWSA 2KF6A 1AWIA 3OPPA 5EM1A 3HLBA 2PZVA 1FOFA 2LNHC 4FCMA 3W4OA 3NV0A 4IVIA 4FMBA 3V76A 4LRYC 4X66M 1RGCA 2CMNA 3BFCA 1N4OA 1ERMA 2ZC6B 1IVUA 1AXBA 1DMQA 1JN5B 1K4FA 2FGTA 2JNHA 4IJFA 1HVBA 3P09A 1H5XA 2FFJA 2C9CA 2KRUA 5KPTA 2HDQA 1LTMA 3FF2A 3OPHA 4MBKA 3WMDA 1IBKM 2EJSA 1Z09A 1NO1A 2DVWB 3CU3A 2HP5A 1E3VA 3N9HA 2KXGA 3LGOA 4JRFA 3NM7A 4KZ8A 3LR5A 3RFWA 1BIRA 4KG5A 1NJI4 3LQQA 3D79A 4PDIA 4LF7M 4R1KA 2STDA 1TFOA 2JE5A 3NY4A 3WS2A 5IG4A 1SPUA 4PM7A 1FW7A 3KSHA 1QMFA 4ZJ1A 1X1XA 3GPXA 4KZ5A 1C3BA 3ZDJA 1Q02A 3HLGA 4DR1M 1Z6TA 3LQRA 2A2LA 4CQHA 2X49A 2Z6BA 2BASA 3FKWA 3HLEA 3EGDC 4JGQA 3U97A 1RHLA 3CXC2 1O07A 1SKFA 4MNRA 3VMAA 6STDA 2L6OA 4HH3A 3W0FA 5HL6A 1PJJA 1FGTA 3D5IA 5CHUA 4YY3M 2QZ6A 4MH0E 4LJ4A 3LMMA 2B1XB 1QALA 1Z1SA 1TFKA 4O01A 5IENA 1JWZA 5EV0A 2INWA 1PU4A 3K9MC 3PGBA 2Y0TA 4N9KA 1K38A 3BECA 3GTCA 3FUUA 1WYBA 4TX4A 2P9VA 4I3AA 5D81A 4PM8A 5RNTA 4HBUA 1OJGA 1W5ZA 4QNMA 1PY3A 1FILA 2DKLA 3SS4A 3PYPA 1ACFA 3QRDA 1KSIA 5GLCA 1TDHA 1K0KA 3GZBA 1TIJA 1CH0A 2XA7M 3VE3A 1S723 2JY6B 4QU3A 1VQP3 4R7GA 4ZTKA 1BSDA 1PFLA 2WGIA 5CRFA 4GNUA 8RNTA 3W2ZA 4JI0M 1D0KA 1ZO2A 5JBSA 3IXHA 2KCDA 2DHYA 2RNTA 2Z6DA 3BM6A 4FTXA 2PRFA 4X68A 2G3QA 1V58A 2QBYB 2E5LM 3FG1A 2R44A 5HWVA 3T0UA 2Y2HA 4CLCA 4S2LA 2E8JA 4X55A 4JGRA 3OTOM 3KS4A 3AJIB 2IWCA 4CIZA 5AIIA 1BNJA 3KXEC 1JZOA 2UUGC 2LVNC 3FG3A 1VQO3 1FR1A 2XA7S 4EERA 1XXHE 2DZLA 3FH1A 1SXJB 1JRQA 1ZX2A 2P0XA 3IJEB 5IG3A 4FOFA 2SBLA 3CCV3 1A67A
chains in the Genus database with same CATH topology
3UJNA 4IBKA 2CC1A 3JUOA 2LH0A 5EOEA 1IN7A 1XNRM 1IBMM 1BLSA 5EUAA 1J9MA 1KGEA 1TDGA 5J8XA 4DV6M 3A3FA 1X37A 3LT9A 5HFOA 3IQAA 2FNQA 3SH8A 1NJ4A 4N6LA 1BLCA 1NXYA 2C5WB 4MBHA 3V92A 4E3OA 3S4XA 1OUNA 1Q7Y4 4L4UA 3CNMA 3LCEA 5L2FA 5F3WA 3NBBA 1GKIA 1QQWA 3S1YA 1T3TA 4OP8A 4XBXA 4L78A 5ITUA 1GS3A 2O9UX 2HMLB 4GDNA 1G8PA 3EN1B 1PWDA 4EBLA 4NETA 5C1BA 4DV0M 3G30A 1Q3BA 2IUJA 1EE8A 3JAMS 3N8LA 1YI23 4LZJA 4QWTA 3GSGA 5DTKA 3B8LA 3KOXE 3FWLA 1WMNA 3FUVA 3EC9A 3PBOA 5CGWA 1R4CA 2Q07A 4QHCA 1IXRC 4MMZB 3LZAA 2ZM6M 2QIYA 4GHLA 3RJUA 1IXSB 5FTLA 4P16A 2HDUA 3C7VA 3HU2A 3TWKA 2VQEM 4OW0A 1CYVA 3VFFA 3MYTA 1K55C 4QB8A 3P98A 4XBYA 1FA3A 2CV2A 4GC9A 5AI1A 4LG2A 1JR3D 1N33M 3TE6A 3I553 2MC8A 4X2OA 2Y2LA 3HU1A 2VGJA 4G6ZA 1FQGA 4HM1B 4GKUA 3NUVA 2XSZD 1K54C 3THGA 1IBLM 4R4SA 1NHGC 3PTEA 3VDPA 4BL2A 2KRKA 4P85A 2R46A 3FSDA 1E32A 2DXIA 1L2BA 3H4MA 2WGQA 4J9AA 5LC6A 1KFVA 2P09A 1QVG2 3RXXA 4E3MA 4AKZA 3IPTA 1JWVA 4E3NA 4DUYM 3UO9A 1QMAA 3CC73 4R9KA 3WS4A 2XH9A 2GXFA 1XWIA 3AOEC 2XZUA 1JJ22 3LY4A 5KPZA 4OVZB 3PNYA 5EJCA 4S2PA 1NVMA 3VSYA 3U1WA 2CFOA 3X41A 4KFFA 1FNNA 2AHMA 3I4YA 1OPYA 1JVJA 3SAWA 3IHBA 3L28A 3C4OA 3LEZA 4TUWA 3EQQB 4DR2M 5FQJA 1VQL3 1ONGA 1W2ZA 3N4IA 5F1GA 1MBLA 3ER7A 5EP2A 3UNLA 3UPPA 4KQQA 5FI6A 4MMXB 2XD5A 1YT4A 3CC43 3I7JA 1MWSA 3EN8A 1W5DA 4IT7A 4KZ3A 3IMAB 1TGUA 1BLPA 4FMDA 4AEQA 3FYZA 1G6AA 3SASA 4YFMA 3T38A 4QNRA 3S29A 1XMOM 2JBFA 1SQWA 5CERA 4NRVA 5FW5A 3PZWA 4X62M 2Y2QA 2P0MA 2UUAM 1ES3A 4LF4M 3SHGB 1E25A 4JI5M 4WM9A 3KFQC 1G68A 1HQCA 3L0RA 5EQTA 4N9LA 1HQYE 4GN2A 1J5EM 3X3YA 1K9M4 2EX2A 2H10A 5FTMA 3RGRA 1EG9B 3IWIA 3U6LA 2XK1A 2F5NA 3HIGA 2F99A 5HARA 1K57C 1NRFA 4JI3M 1JB5A 3AL0C 1NDOB 1D6ZA 1NB5I 1AVKA 4U3TA 4O02B 5IG5A 3V98A 3SXXA 1HNZM 2CG1A 1ZG6A 3OWUA 1IEMA 3IF6A 4P0MA 4MBFA 3B4OA 3GLIA 3IF6B 3UGJA 2LQVA 4XBOA 3NBLA 3FUTA 4EUZA 1JTGA 3CMA3 4J8TA 1OFHA 3JUQA 4AI6A 4R3JA 3PBQA 3L29A 1R2YA 2QBYA 1YIJ3 1MKIA 5EPHA 4L7KA 4NREA 5AQBA 1GY6A 1AVLA 4YHHM 4RF0A 4JXGA 1OFIA 2RCXA 2JDIH 5ITTA 4LRTA 3IT9A 2J8YA 3CC23 4KLNA 3EB8A 4R80A 2PBYA 2Z7JA 1ES2A 4IBDA 1EWZA 2EA0A 3S28A 2RGOA 2WK0A 4LF8M 4GKJM 1AR0A 2BG1A 3OZHA 1L0DA 2F4VM 3S22A 4Q8IA 3U61A 1LOXA 5FGOA 4K0KM 4N1XA 1NY6A 2IMJA 3VOZA 1OF5A 1FGOA 4KQOA 1NU3A 4DR6M 2E2VA 2FXTA 1MXOA 2I9WA 5EE8A 3S67A 2WADA 1HZOA 1WQLB 3VFDA 3ITAA 1VZZA 4LV3A 3GRUA 5C18A 3KIIA 4HLQA 3HUOA 4ZM8A 2BLSA 3D9RA 2W03A 5TFQA 4OOMA 5IG0A 1O7PB 3KOZE 3VP0A 4K0XA 2CEAA 4KZ6A 4GOGA 1XGIA 3NHXA 3PCSA 3FKAA 3LYGA 3CF6E 3KOYE 4KVHA 4AG5A 3GP1A 1DVDA 1LL9A 2OOVA 3LVVA 7CATA 3E9SA 5FTNA 3BNBA 2HL7A 3H3HA 1DMMA 4LEHA 4M0WA 3UMMA 2E8IA 1L5GB 3HHXA 2ML5A 1VQ83 3WS5A 1NNJA 4WZ5C 4FCVA 3GWRA 4LY6A 2OLVA 2ZBKB 3BNDA 5H37D 2UUCM 4IJEA 4DKIA 1NB3I 1CEGA 5IEPA 5BOHA 3CPW2 1XX2A 1ES5A 2NQ8C 3J80S 5AEUB 4HM0B 2L7HA 3HLDA 4CCVA 4BL3A 3GV9A 4JV5M 1IN4A 3ZG5A 2WKHA 1KVLA 3W0LB 2WGWA 2XDMA 4E3JA 5F83A 1BULA 5DNYA 4G1MB 3HLCA 2HMMB 2Y2KA 1RRHA 5KQDA 2WAFA 3PXGA 3F8XA 3K2LA 4RNZA 3DMCA 2F86B 4IBFA 2Y2IA 1IV9A 4LF9M 5U47A 8CHOA 4ID4A 4IBIA 2BNGA 3CZDA 4WYKA 2E2TA 1V74A 5STDA 5CHMA 2Z2MB 3CCE3 3NBJA 1JNQA 3UB1A 4OH0A 3PBSA 3Q7VA 4KZ7A 2W82A 4FH4A 1N34M 1HTZA 4OLGA 5EXSA 1KQS2 4P6BA 3W4QA 1NZUA 3N6IA 2ZQDA 3OPRA 3ZVTA 2R18A 2ZJ9A 3GR2A 4QOZC 1YJN3 4LV1A 3QNBA 3VKGA 1GHPA 1SIIA 2M7OA 1FGMA 5CK6A 5DVAA 3AGFA 4R23A 1ZKJA 4LFCM 4L16A 3VOYA 3MHEA 4NSOB 1IXZA 3UDIA 1Q2PA 4ZDXA 2O3OA 1YLZA 2J9PA 5ITXE 3VGNA 2KRTA 4LV2A 2G2UA 3V3RA 2DZNB 5IHVA 4HEFA 1RGZA 4M9XA 2OV5A 2HP9A 4XDWA 5I97A 2QPNA 1FCMA 3PBTA 1HNWM 2KXEA 1K41A 1VQK3 2WOHA 3GQZA 1IDPA 4HBRA 1OGXA 3ZCZA 1IU7A 3SOIA 1RKYA 2A49A 1ESUA 4HZ9B 4GH9A 1XKZA 4E6XA 4NK3A 3UE3A 1PWCA 3EX9A 2JA2A 3L27A 1O7WB 2KA6B 3U6SA 3FF0A 3Q1CA 2ERCA 1GA9A 4I5SA 2XZFA 1W01A 1FSWA 4ZTKA 3T1YM 1RP5A 1PYYA 2HDSA 4WURA 5IWAM 5DYGA 2L7IA 3BFDA 1DVCA 3G4S3 4GD6A 2R45A 3WRTA 1N8QA 4QD4A 3JUMA 1VQ93 3GO8A 1L1TA 1QJGA 3O8YA 4IBRA 3PXMA 3R9XB 4NXNM 1LXEA 5KPRA 2YX9A 4X56A 5FATA 4M9ZA 1N77A 4LF6M 2CHGA 3DW0A 3FTEA 2CFDA 4K61A 3NQZA 2EXAA 5FI2A 3MWZA 4GIPA 2Y2MA 5F1FA 5F82A 5TGFA 2ZQ8A 4N6OB 4S2MA 5A91A 1EA2A 3MHVC 2UXDM 5KP3A 3A3IA 3BRMA 5EVLA 3G35A 5GLDA 4O7DA 4LFBM 4K90B 5EVIA 5I94A 2R4IA 3O3VA 1K56D 3F14A 1JV2B 5BXQA 1LL5A 2QP9X 2GBWB 4PT5A 4N6UA 3Q2PA 4OPZA 3B9PA 2CH9A 3CJMA 3IG5A 3NX0A 1IYSA 3FGYA 4WZ5A 3F8HA 5HW3A 5EXXA 1S3SA 4OK0A 4Z9QA 2FNAA 4GL6A 5HAQA 2I7NA 1W6GA 4MLLA 3N8BA 1BZAA 3UL6A 1K82A 3QK9A 7STDA 5KZHA 2EX9A 3BLSA 1XMQM 2DWMA 4ORLA 2P38A 5CLKA 1CI8A 2O5RA 5AQ7A 3V39A 3HBRA 2CWTA 3KS8A 3MFDA 1JN5A 4CJNA 1IY2A 4B7GA 5IREB 4N3VA 4CISA 3NV0B 5CF1A 4EV4A 4GC5A 3JVCA 1HKXA 2GDNA 1PIOA 1PZPA 4JXJA 1FCNA 2J7OA 3V50A 1I2SA 3G4PA 3IXBA 4PPRA 4WWUC 3GMWA 1NYYA 1L2CA 1JB2A 1CYUA 3FUXA 3WA3A 3G713 1MPLA 5E6JA 3SAUA 1LI9A 2ZAOA 2XRXB 2Z77A 3AGDA 2L09A 1OHOA 1Q3CA 3A3DA 3EHCA 3W8KA 3FUWA 4KZ1A 1TDLA 1OHPA 3SAVA 2LWXA 3FG4A 4ZBEA 1F8NA 5CEDA 1JKGA 4Y0TA 4ZAMA 2WZZA 1RCJA 1YLJA 1ZG4A 2XFTA 5EECA 4K1VA 3QWLA 3PBRA 1IT7A 2P05A 4RBNA 3BEBA 5M18A 2EXBA 4DF6A 2C99A 3U6DA 5AEWB 2OTL3 1WXQA 1NSFA 4KO8A 4WEKA 4MGYE 4JPMA 4GITA 5FTJA 2HP6A 3FZCA 1WNHA 2EO2A 3I51A 4LF5M 4Y0UA 4B7FA 3UZUA 1PWGA 1NY0A 4GMQA 3SMPA 3BLZA 1S5AA 4EQIA 1PZOA 4DE2A 1SIHA 4L8PA 3ZGAB 2CW9A 4JI7M 4CDLA 2ZDJA 4EV5A 1MX0A 3AOGA 1AV4A 3BFEA 4BJPA 4WHAA 2H1RA 4DR3M 1ROVA 3T1HM 2H5SA 5FAPA 1QAKA 1Z6FA 1YLPA 3G2YA 4QHTA 3BYDA 4EBGA 3LTDA 4KZAA 2UXBM 3KDSE 1Z5BA 4NRWA 4RA7A 1ORYB 5HX9A 1Z59A 3MZEA 3GZXB 4HESA 5TGNA 4BBAA 1K55A 2CV1A 1FJGM 4RNAA 3T8UA 1DO0A 5AQAA 4OPQA 2R65A 5AIFA 1KDSA 2RCDA 1CI9A 2ZMAA 3CPOA 2EX6A 2Z4SA 1OGZA 1IQYA 1VQQA 3VLFB 4JI2M 1W6YA 2C6WB 3A98B 3SMSA 4UA9A 2XSHB 4OQ0A 3CG5A 1Q864 3OW22 1Z5AA 1YJ93 2QMIA 1RGYA 4E6WA 5EVIB 1YUBA 4OX9M 1GHMA 4FSFA 3U5ZA 3SC3A 1I94M 5JYOA 4S2IA 1D6UA 1N5PA 3CF0A 3GPUA 4HM4B 2XD1A 5BPVA 3NCKA 4X65M 2DNSA 1L1ZA 1L0GA 3JR4A 4U13A 4X6TA 1JTDA 3WS0A 2UXCM 1GY5A 1PJIA 1Q2QA 4DDYA 4UA6A 5EXPA 3SS5A 5FSWA 1IQXA 5EQLA 5TR7A 5KP4A 3JYIA 2OQEC 1YLWA 3VF1A 4B3MM 2XR8B 2CV0A 3N8SA 3FLJA 2DHRA 1J2BA 1E4DA 4HM6B 1YMSA 4HM2B 3Q90A 3OXAA 2CUZA 5G18A 3C4PA 1CQSA 2RKOA 2PNCA 3IWQA 1SHVA 1BUEA 3FZWA 4AKGA 3CMZA 4EC6A 4DE0A 5E2GA 2Y59A 1IKIA 5FASA 5M1AA 3AGEA 2I7PA 1W00A 4C3QA 4EXRA 4OOLA 4X2HA 3AMOB 3QNCA 2GBXB 4LCBA 3RE8A 4LJ7A 3MZFA 1O7NB 1XHBA 1FSYA 4B88A 1PM5A 1WYCA 4AKHA 1KE4A 3E2LA 4RNYA 1XXHA 2J7NA 1IVVA 4HM3B 3EQUA 4XM4A 4DR4M 1UM8A 3FTFA 1SXJE 2FFYA 3DZDA 3J7Yd 1IY0A 1L0EA 2P5TA 2BMQB 4WELA 1MY8A 1HT2E 3IH8A 2C11A 3E4RA 3S27A 3CD63 4XB5A 3TL4X 3Q7VB 4LV0A 2KW0A 1KD14 3AKZA 3VK8A 4S2KA 4LZIA 2WZXA 4BTYA 4HM5B 3HL9A 1TEMA 2PU2A 4IBCA 1O7MB 1M6KA 3IXDA 1TU5A 2M5ZA 3GLFA 3A76A 4JN6A 3NBIA 3Q1FA 2D7HA 2CWVA 1RJOA 3BFGA 4MGHA 3TWMA 1DGFA 5CXOA 2Y91A 2P74A 3BB9A 4AZFA 4II7A 3LXUX 2HKJA 4KZBA 4EWFA 2QENA 1MNLA 1N9JA 2UX0A 3G34A 3ILKA 4N1HA 4WFOA 3NWLA 1W4NA 4D82A 4O2HA 3CCJ3 1E94E 3KSPA 4M3KA 1N5HA 3U6MA 4RVAA 5JYPA 5KSCA 3ISGA 3J7BA 3ECFA 1EQKA 3TOIA 1HR0M 4EYCA 3OCNA 4QY6A 3RDEA 4OUQA 4JXWA 2R9WA 2CG0A 2KZSA 1PFPA 1PI4A 2BO9B 3ZNTA 4LSOA 3ROBA 4EBPA 3LTCA 4JBFA 1E9RA 3FCSB 4C75A 3U6OA 4GB5A 2EFUA 4UAAA 3LTAA 3GLGB 1KE3A 4WMCD 1N75A 2M60A 2Y4AA 2XSZA 2R9XA 3G8ZA 4FW9A 4LJ6A 1O7GB 4G4QA 3DGNA 4IIWA 4ITQA 3J7AS 2HMNB 3M2JA 3TWLA 1KVMA 1YLTA 2ZQCA 5A93A 3SLUA 3CNXA 2KEBA 5HAPA 4MGZE 4E3IA 4L15A 1A2VA 1OF5B 5DF8A 3EBYA 3AFHA 1TUHA 3MBZA 4FD2A 1LHYA 4FH2A 4CPKA 3OPLA 4RF1A 2CWUA 3HJSA 3U61B 4B4ZA 4B3TM 1W5TA 2V1UA 3HHYA 2F5QA 3VDUA 2WKEA 4GRIA 4KG6A 5AYRB 4JKTA 2CC3A 2IWBA 1H6UA 1ZC2A 4DV7M 4JI1M 3DZLA 2WGOA 3CCR3 4BLCA 1OHSA 5CEBA 3GRYA 1K6RA 1I5QA 4JF4A 2X01A 2W2CA 1K8A4 2Q9NA 1LLBA 1W8YA 3LTBA 4M9SA 4K1UA 4LJ5A 3JUNA 3UPOA 2W9QA 3L25A 3KN4A 1K25A 3GLHB 3SATA 3DOAA 4UA7A 1E3UA 1JQJC 3FV7A 1CEWI 3UE0A 1TH3A 3ZG8B 4B7HA 4OVDA 2D42A 1N32M 3NC8A 1E9SA 3WWXA 5FSRA 3HU3A 2ZLYA 3M0EA 1QVRA 4AKIA 3A3EA 3CCS3 1K56A 3GZRA 2X4AA 3EJVA 1QAOA 3LH4A 3I0YA 3WHKA 2W56A 3F9SA 1W8QA 1QAQA 4JI4M 2CE7A 2YFQA 5CF2A 1FGRA 3F7XA 2Y0QA 4XUXA 3SH9A 3LT8A 4LGQA 2OPFA 4H61A 4IPBA 1VM1A 4U0XA 5ITRA 3K92A 1C7HA 1NHWC 1ISKA 3EQVA 2K47A 2HMKB 5EP1A 3BNCA 1N9BA 4DDSA 2DWLA 3N7WA 1G59A 5KP1A 1BLHA 1QANA 3MK6A 2CIUA 3TPZA 3CCM3 4PEJA 3U6QA 4GKKM 4R0QA 4WYKB 4GB7A 1PW1A 4HBTA 3UE1A 3CME3 1YIT3 1EI5A 2EFXA 2CFKA 4LGMA 3SYLA 4DRTA 2ZM0A 3MSOA 2D7GA 1IYPA 3IHAA 1CK3A 4KFDA 3CCQ3 3UK6A 1BTLA 1KE0A 4KZ9A 5HAIA 3J2PB 5IF6A 1Q42A 3RGPA 3A45A 3KVWA 1GCEA 1BSGA 3HKPA 1YE9A 3DXOA 4K0WA 1XP4A 1MU5A 2CFLA 2UWXA 3SHFA 3MKEA 2Y2GA 1FGQA 4OQGA 4DV1M 5LMUM 1HNXM 4Z8XA 1QZMA 2GEYA 4OLDA 4B4XA 3KW6A 4MB7A 5A90A 3M6AA 2WUQA 3V5MA 3B7CA 3EIEA 3ZVWA 4IBJA 5DREA 3DA1A 5BVBA 5EP4A 2ZM8A 5GL9A 3C58A 4X64M 2INXA 2EX8A 5FTKA 4IBXA 2HMJB 4AW4A 3L26A 3SX1A 4FWHA 4G4RA 4KHPM 1VQ63 1IT8A 4PDGA 3GRRA 3SEDA 3SVAA 3DWZA 3WODG 5EP3A 3O86A 3JUPA 1MOLA 4OQHA 1GVNA 3LVWA 4CHTB 5D3OA 2XF3A 3R8FA 4STDA 4DV3M 4IBEA 1VDDA 1IN6A 3BFFA 2Y2OA 2R4EA 2CKFB 2YQZA 4IIAA 1YM1A 4O8SA 4BTWA 3B3XA 1DGBA 3SYKA 4FMCA 4JXVA 1WE4A 2OTJ3 1NY5A 2OSUA 4E3LA 1SDEA 3GRJA 2OQ4A 1K734 4FCFA 1R2ZA 3PS8A 4ZJ3A 3LMLA 4K91A 3G2ZA 4LRSA 3RGSA 1R7RA 3EE1A 3EBTA 2WGVA 5A92A 1W7FA 1SCWA 5E26A 3CF2A 1KYIA 3WDGB 1ASKA 2WOFA 3VK7A 4N6TA 3KP0E 3U60B 3M8CA 5KO3A 2W56B 1KDWA 5FAQA 3LY3A 3N54B 4ZPXA 4I81A 5JI3E 3SOAA 2CHQA 4Z6YA 1OH0A 1CEFA 3OWSA 3ZG9B 5D82A 2Y73A 1XA1A 2YR0A 5G2GA 3X3XA 3PBNA 4BD0A 2UU9M 1YGEA 3D8LA 3C5AA 1NO3A 4E3KA 1KWIA 4XDVA 1ALQA 2F98A 3A46A 1DMNA 4DUZM 3HK4A 1UUWB 4HYZA 1K28A 2HCBA 2B5RA 5LC7A 3IH9A 2J9OA 3GLIB 2Y2NA 3WHLA 3MKIA 3G0KA 2W04A 2K0MA 4PD2A 2ZANA 1SXJA 1IK3A 1D6YA 4HZBB 5IERA 4OPYA 3NXJA 1J09A 5EXTA 1OACA 5ELUA 3NDEA 5FQ9A 2CHVA 3WOEB 1Y54A 4L0LA 3MG2A 5EOOA 1G3IA 1E3UD 5CGSA 2R62A 3K1JA 4PM6A 3L2AA 4BTXA 5AIGA 3U60A 1W5SA 5GHZA 5GLBA 2D1WA 1HU9A 5CGXA 1PI5A 3KP1E 3KSED 3ZNYA 2YNMD 3DWKA 4L8RC 5E2HA 4ZJ2A 1YMXA 1SJWA 1OCVA 5FQIA 2W6JH 2QEX3 1I2WA 8CATA 4FD8A 2XEPA 3ZG7B 1U60A 2P9VB 4JLFA 2V2FF 5ITYA 2W9PA 1IYQA 2C9OA 5IT9S 2GEXA 1PW8A 4LFAM 3H51A 4R4KA 1N8R4 3VKHA 1IELA 2I72A 2C96A 3WA2X 1GD4A 2OLUA 3PNVA 4AKYA 3MPHA 3Q8XA 1DYUA 5AQ9A 3DFZA 1JB4A 2Y20A 1H8ZA 2WAEA 4KQRA 4DXBA 4JYAM 4A3VB 2Z76A 5KSHA 1W6CA 1E3RA 4WYYA 2BHMA 3UNWA 4JXSA 3D4FA 1A90A 1IQPA 5ELJA 4OQIA 4KG2A 4XUZA 1TVFA 1DJBA 1L2DA 2L4VA 4PM5A 4OVZA 3KFUG 3PYJA 2Y2PA 1I4WA 4L8OA 2GU1A 4LENA 4FCZA 3K7CA 5DRVA 1IQ8A 2OCTA 1IYOA 3GQ3A 3ZCBB 2A5YB 1EROA 1VQ43 2GU3A 1SXJC 3DGOA 1G41A 3HVFA 1SXJD 1K4EA 5GHYA 3NI9A 1RRLA 2DWZB 2MF7A 2E2UA 2ZAMA 4FWGA 3GQ4A 1K3XA 1T5YA 4NHFA 4IBBA 3VP3A 4KFEA 2G5GX 2QZ4A 3DGLA 3W4PA 1IV7A 3NM2A 4P87A 3HX8A 2ZC3B 1WMOA 3IWOA 5DYIA 4GHAA 4WEJA 3GRDA 1DJAA 1OJLA 3RXWA 3ALAA 3V3SA 4Y0OA 1M904 5CTMA 2Y2JA 1O7EA 4JF8A 3WRZA 4HM8B 1L8QA 2IWDA 2XLNA 1J7KA 4R3BA 1HD8A 3Q07A 5JI2E 3J81S 3C7UA 4AG6A 1IY1A 3Q82A 4M0DA 2XGLA 1FCOA 5BR8M 5IZ7D 2C98A 2QGUA 3O87A 1R6BX 2V1CA 3NDGA 4PMAA 2G8LA 3UJMA 4QHSA 4OOYA 2ZL8A 1Q824 2K54A 2BMOB 3TSGA 3BNEA 1W7CA 2H0TA 4BB9A 3HHWA 3O88A 3E99A 1GD3A 1XC8A 4S2NC 1XXHB 1Q40A 4FWDA 3K8ZA 1M40A 2Y21A 1YLYA 4H8RA 4S2NA 1E97A 2UUBM 2LYXA 4EV2A 3OWYA 4LCMA 3HZPA 1YJW3 4CGYB 1G96A 1S6RA 4I4KA 3S5CA 3KSXA 5KMWA 3IG8A 4WBGA 4I4LA 4XXRA 1K57A 3HJ8A 1NNUC 4DR5M 3VP4A 4QJGA 1MWRA 4DV4M 4X53A 3I4VA 3J27B 4NSRA 4D2OA 1QAMA 1M1K4 3HI7A 3U6PA 1GLNA 1NWWA 3DUKA 5AYSC 1XPBA 3AOEA 3HUMA 2ZC5B 3A42A 1ROAA 2KZUA 3TQSA 4D81A 3GLHA 5JPPA 3GVBA 4XGIA 2QA43 1GHIA 2F5OA 3MG3A 4BLMA 2RFRA 3PVSA 3WS1A 3G16A 5CECA 1HT1E 5CXWA 2EUCA 4H3UA 4BQMA 3X42A 5KQ8A 1DGGA 1ONHA 4RX3A 4DV5M 3ZHHA 1NYMA 4GDBA 5ITQA 1Z5CA 3FTCA 2X71A 3ZH9B 4LZZA 3MG1A 4RYEA 1U5OA 1D2NA 3BOSA 3UN7A 4QOSA 4R3DA 1VQN3 3HJQA 2ZQ9A 2IA7A 3DGMA 3U5ZB 2Q2EB 1M9GA 4LJ9A