2XGOA

Xcogt in complex with udp-s-glcnac
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
548
structure length
548
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
total genus 203
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgoA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgoA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgoA02
3GZ1A 2IYFA 2IV3A 2IFUA 3BDAA 2QLNA 4X7MA 3FP3A 1F0KA 5D00A 2AMVA 3ZCSA 2LSUA 3D0QA 4BQIA 1PYGA 2IV7A 3UPVA 5A6CA 3L79A 5D0OD 2FF5A 4J8FA 4MHOA 1JG7A 2FO7A 1QQEA 1LWNA 3RSCA 1P5QA 5TMBA 3S27A 3G2LA 3T3DA 1YA6A 3IAAA 5JJ7A 5JJ6A 3DD1A 3ASFA 4N5CA 2WQHA 3S2UA 2QN7A 3OT5A 2VGXA 1HZ4A 1QZ2A 1C8LA 2F3UA 1Y8MA 3G2IA 2X6QA 1Y6GA 4RG9A 4XI9A 2X6RA 3HBNA 2JZCA 3C48A 2AW3A 3VDMA 2VCHA 3MV3B 3MS7A 2YJNA 4LEIA 4AN4A 1M5RA 3VUFA 2DBAA 1WM5A 3CK9A 3GUHA 5G04C 3WC4A 3MEKA 3AMVA 4N9WA 3TG4A 5FT9A 4RENA 3ESKA 5EKQD 1NZDA 5KJLA 1L6IA 1K08A 4RIIA 2R5SA 2XPIA 3HBJA 5D0QD 4EL0A 4U07A 1C8KA 1XL1A 3VDNB 1NZFA 1GGNA 2C0LA 4J8DA 3CV0A 3QOUA 2AZDA 4MI9A 2Y4TA 4NC9A 5FTPA 4JL0A 4KQ1A 4A1SA 2YHCA 1P4JA 3CKBA 2JLBA 2VG8A 4CTOA 2XCIA 2XA9A 4I9EA 1XV5A 2GPNA 4UQYA 6GPBA 4I2ZA 2NC9A 1FS4A 2QRQA 2VGXB 3S0JA 3ASHA 2ZB2A 1EM6A 2AV6A 4GCNA 1WV0A 4AY6A 3Q3IA 2XCCA 2XA2A 3PDNA 3QKYA 4J8EA 4N39A 3ZCUA 5DLDA 4UI9K 2P6PA 3BEOA 3C4VA 1GPAA 4XI0A 3FFLA 1FC0A 4HLNA 4RIEA 1KTIA 4RIFA 3CK8A 1YA0A 5G05J 1NOJA 1PSWA 2GPAA 1E4OA 1EXVA 4H7YA 4HOQA 3BCUA 1WW2A 3MS2A 1ZBPA 3TSAA 4GZ3A 3CEHA 2QN9A 2G9VA 1WAO1 3CUWA 5HQ8A 4GA1A 2IW1A 4MHSA 2UY1A 5HI7A 5JJTA 1IIRA 2ACVA 4KQ2A 2VCEA 2P58C 3QWWA 4WNDA 2C9ZA 2X0DA 2PQ6A 3G2JA 4MI6A 1NA0A 2XEVA 2KCLA 3U3WA 3L7DA 4I2WA 4UI9J 3BCRA 2KATA 2V5FA 2WPVA 2QFCA 5M72A 1F6DA 2XGSA 2PYIA 2SKEA 3C4QA 4HORA 4X7RA 4UQZA 1FTYA 3N71A 4AY5A 3O3CA 3PE3A 1HXIA 3OXFA 3HYMB 2PZIA 1A8IA 3CUYA 2BUGA 4GCOA 2IUYA 3UQ3A 1L5SA 3NF1A 3S7JA 2GPBA 2QLMA 4YI5A 4YVOA 4GZ5A 5ARGA 4GZ6A 4X6LA 4ABNA 1ELRA 3CEQA 3WADA 1JG6A 3R9AB 1NVKA 7GPBA 2QN2A 2VSYA 3ZN3A 5BT1A 4M60A 1ELWA 1HH8A 2PRJA 3CV3A 4RELA 4EKYA 3BD8A 2UY1B 5EX3A 1H5UA 3E3NA 1L7XA 4G2TA 2SKCA 2YQ8A 2LNIA 1V4VA 3Q5MA 3PE4A 4J0UA 3UUXA 2QN3A 3ZHEA 2GJ4A 3MA5A 1WV1A 5DU2A 4AMGA 1WUTA 3OTGA 4NEQA 4UQXA 1P4GA 3ZCPA 1IXYA 2R66A 3RO3A 5DBKA 2XMPA 4BWRA 4YI3A 2GT1A 1NA3A 1W3BA 3LY9A 3KS2A 3AS5A 5JTTA 5FZQA 1XOIA 5ARFA 2QN8A 4Y6WA 3CUTA 2VGYA 4N3BA 1XC7A 4X7PA 1OUVA 1E96B 3TOVA 4KQMA 3SYRA 1IYGA 3K9IA 3Q3HA 1AXRA 3S7DA 2LSVA 3Q4AB 1NOIA 4EKEA 4WHMA 5DIZA 4EL5A 3T3HA 1JIVA 2E2EA 2WTXA 3CUUA 5GPBA 5TMEA 2VQ2A 3T3IA 4GYOA 4LEUA 4RIGA 9GPBA 2ECPA 3D1JA 2HO1A 3S7FA 1KLXA 3EDTB 2OOEA 2ACWA 5ENZA 4FZRA 1O6CA 3TG5A 1L5QA 2SKDA 2HR2A 4RIHA 2G9QA 2I6HA 3E4BA 3T3EA 4U0SA 3EBOA 1B89A 2ONDA 1XL0A 2XCBA 4G1TA 4KBQA 3ZCRA 1WUYA 2R68A 3RU0A 5KJMA 4G25A 4WNGA 1Y8ZA 5G04J 3SF4A 3D0RA 5HXAA 2GEJA 3L01A 1VGVA 5AYWD 3ASDA 1FCHA 3ZCTA 3COPA 3CVPA 5I45A 4JA7A 3OY2A 2J9QA 1HLFA 3HBFA 3IEGA 1Z62A 2UWJG 4BTBA 4AM9A 1NOKA 3MTBA 4EQFA 3G2NA 1ABBA 2C2LA 3LKUA 5LCWC 1FU4A 3TGOA 4BTAA 2XGMA 2C1ZA 5JTUA 2AVPA 3UYKA 1JIUA 5TMDA 2GW1A 3CEMA 3ASGA 1BX3A 4N3CA 3MT7A 4BQEA 4APOA 3QKWA 3O48A 2VYIA 1XKXA 5KJKA 3ZCVA 3S28A 4GA0A 3CUVA 3OTHA 3ZGQA 4CTMA 3QWPA 4AIFA 1GFZA 1YGPA 4GPKA 1FU8A 2C4MA 2FBNA 4G2VA 3E3OA 1FA9A 1L5RA 2FF4A 1GZ5A 4F96A 2HY7A 3AS8A 3OY7A 2PQRA 5C1DA 4WACA 4CDRA 1FU7A 2H1HA 1P2GA 2KCVA 4N2SA 4CGWA 4HOTA 3QDNA 3Q3EA 4QLBA 4O6FA 3L7AA 4GA2A 3GPBA 3L7CA 3CKCA 4XIFA 3H4TA 1B4DA 1J39A 1C3JA 2FI7A 2VSNA 1P4HA 4MICA 4W6QA 2IYAA 1GPBA 3Q49B 4FKZA 4REMA 3T3GA 4YVQC 4GPBA 1PNVA 4WNFA 3MT8A 3GYZA 4Z5XA 3CVNA 1L5VA 4RBNA 5CCMA 3NC4A 3RHZA 4NRHB 1K06A 3BD6A 3NPAA 1SXQA 3MBOA 1NZNA 2KC7A 3LY7A 1KT1A 4YNDA 1SXPA 2GEKA 3MRXA 4IN3B 2QLLA 3IA7A 4HWGA 3AS4A 1RRVA 3S7BA 5FZRA 1A17A 3MS4A 2QRMA 3OKPA 4NESA 2BFWA 5A7DB 1QM5A 4GYYA 4U0UA 3MRVA 5FZSA 2H1FA 2BGUA 2KCKA 2L6JA 5TVGA 1GPYA 5IKOA 3RJVA 4G23A 4F3VA 1L5WA 3OXGA 3KAEA 3OXLA 1NLMA 5KJNA 3MSCA 5LQDA 2QZSA 4NQ0A 3CK7A 2R4TA 2XCUA 3H4IA 2F9FA 4WUYA 3EBPA 3MTDA 3NP9A 1PN3A 1UZUA 2BISA 5CCLA 2QRGA 2O6LA 2F3PA 1ZU2A 4MI3A 3BEEA 4U0ZA 1Z6QA 2PQNA 3SZ7A 5CHEE 4JHRA 4WNEA 4KYOB 3CVLA 1LWOA 3FWVA 4PQGA 4BQFA 3S29A 3BCSA 4W9RA 5FJYA 3ZHEB 2FFRA 2QNBA 3BD7A 3MT9A 3NB0A 5G05C 3Q47B 2ASVA 3FROA 3VTYA 4L22A 3RT1A 3QHPA 1UQUA 2BGTA 2FETA 1XNFA 1JEJA 1E1YA 2X0EA 8GPBA 3CVQA 1JIXA 2IEGA 3GZ2A 1WW3A 2XA1A 3DDSA 3RO2A 2FEZA 1GG8A 2F3SA 3NP7A 2HYZA 1FTWA 3HBMA 3L7BA 2KS6A 4CTNA 4U04A 3U4TA 4I17A 4JA9A 4G26A 1C50A 3Q15A 2G9UA 2JJMA 3JYSA 3SYMA 4UI9C 3G2HA 4LDPA 3ZPJA 3OKCA 3GW4A 3VTXA 1Z8DA 4M83A 2IF4A 2QRHA 2Q7FA 4BFCA 4RG6A 2PRIA 4GYWA 3ULQA 2G9RA 1P2DA 1QKJA 5IKPA 3MV2B 3E3LA 5DXFA 3URZA 2MHKA 3LYAA 4N3AA 4G24A 4Y6CA 1P29A 4WADA 4I1AA 2ATIA 3DZCA 3T7DA 1Y6FA 4N2QA 3ZFWA 4HOSA 5BW8C 1AHPA 3NCHA 4F97A 4F9FA 2R4UA 4BT9A 2R60A 3MKRA 2GM9A 3CX4A 4I9CA 1UQTA 3LCAA 1PC2A 4YUAA 3RKVA 4HOUA 4MRAA 1IHGA 3TAXA 3KD7A 4ME2A 2QRPA 3VUEA 4EJ2A 5BNWA 1TJCA 1Z6PA 3MTAA 3NAZA 4KXKB 3ZCQA 5D01A 4M7PA 2PYDA 1P2BA 3DDWA 3T5TA 1KT0A 4BT8A 4CGVA 3OTIA 3CEJA 2X0FA 2IEIA 1RZVA 4H7XA 2Q6VA 2Y4UA 2PL2A 5LCWJ 3G2KA 4B94A 2C1XA 3MQFA 1FTQA 2XGOA 5EX0A 3LPZA 2C0MA 3QWVA 3UYLA 3OKAA 3MRTA 3RIBA 2OFFA 4AMBA 3WAGA 2F3QA 1RZUA 3LY8A 3RSZA 2QN1A 3WXXA
chains in the Genus database with same CATH superfamily
4BAGA 3I2IA 4NY1A 5HKBA 3KJHA 1ZGZA 4YBZA 1Z3IX 3DFZA 4W9NA 1Z38A 5FQNA 4UE6A 3JQ9A 3G2LA 4IZIA 3NALA 1XLUA 1IJEA 3OEWA 1JFSA 3G2IA 1OD6A 2FR8A 5AM4A 3QLUC 4CDGA 2BFCB 4K86A 2V6JA 4L3OA 5IC6A 2Q50A 5G3ZA 1T4MA 4PZYA 4RQBA 1K68A 4BFUA 3K20A 5FOSA 3CHRA 3CNQS 3RRXA 4XYMA 4HWSA 2VAWA 5EIHA 3ASHA 2DLCX 1ZOSA 2IHKA 3B7WA 2HQSA 2BHRA 2QTTA 3LGXA 1A71A 2DFKB 4KLRA 4XJSA 1EXDA 1UKYA 1P2VA 1S9DA 2CBXA 2VR1A 1N8KA 2DLNA 2VEOA 2MINA 3Q5GA 1NDQA 4CMCA 4ZDIA 1XU4A 3HCNA 1X7HA 4OFBA 2JDID 2R9VA 3PEYA 2QLMA 3WGOA 1Q95A 3APCA 2M63A 4B4VA 3NCTA 1VC2A 5EJ4A 3PNLA 2P9FA 5KSWB 1Z6TA 2UUCB 4PAMA 3PB3A 3I45A 1ZGHA 1TD9A 3AFIA 3CG4A 2VZEA 1RRKA 3GJ6A 1LK7A 3DT6A 5JV5A 4KQ6A 4DZTA 3JQFA 2J3MA 3P2MA 2WYVA 4Y0NA 1GTVA 1E96B 2G4LA 4DSTA 4K5QA 5KOYA 1TEXA 1NSYA 1EBUA 4I1UA 4D42A 5HCNA 1MFZA 5CRUA 2LGJA 4QDTA 3SY8A 3KDPA 3VH3A 3K1JA 1IN7A 2XCBA 4TV9B 3BAFA 3RSOA 5EMHA 3A4VA 3N6VA 2P9CA 4M1ZA 1OFVA 3UXGA 2VN8A 4KSYA 5T8IA 4ZAZA 2ZI4A 1L1RA 4M0EA 5KJKA 3ETLA 4MGIR 1FU8A 4HQDA 3E3OA 5KREA 1GZ5A 5EHNA 2E18A 5AR1A 4MB6A 5K4HA 4EYOA 3VOSA 2FN3A 1V8DA 3D81A 4JEUA 1JYEA 4C4ZA 4RD0A 2FKNA 1B4DA 1ZVVA 2XAUA 4HWPA 3HXBA 1M6EX 2QL5A 1ZRMA 3SYLA 3LKDA 1S2OA 4YNDA 2FFAA 1LH0A 3T94A 4F91B 4BMSA 4NESA 3ESDA 3WQBA 4OQFA 2SHKA 3O21A 2O8BA 5C1IA 4G8JA 1I2ZA 4U7PB 2WWHA 3FYTA 1QX4A 4MARA 1DQZA 2VJKA 1VJ5A 2QTNA 4BXOA 4J4TA 4X3CA 3LCVB 5EXXA 1NT4A 5HRAA 4TVOA 2HJ9A 5ERYA 2P9UG 1H2XA 1E9VA 4V0ME 3N0WA 4P0TA 3HCCA 3MUFA 4Z9XA 5COBA 1XEWY 2GM5A 4NIKA 5TEVA 1U3UA 4P4GA 2A67A 1PWHA 2XUPA 4KX5A 4ZU3A 4LDPA 2MJLA 4M83A 2VPYA 3UI2A 4KZPA 2IZ1A 2B78A 4N3AA 3S99A 2QVLA 2ATIA 3B7GA 1XR3A 2ZYUX 3PFHA 1M5UA 3OBBA 1N36B 5IX8A 4NBRA 3OF2A 1Y9DA 2IH5A 1SOAA 1DC8A 4I9HA 1TM1E 2XQKA 4G41A 1MB3A 4ZHSA 3NGMA 3GLHA 1A9YA 4FWTA 2QJWA 3FUDA 1Z0AA 5LP6A 3QI2A 5JZMA 1Y0BA 2Q0XA 4UAJA 5L3SA 4KT6B 5DBGA 3JSXA 3DYIA 3SR3A 5EP3A 1W94A 4BN0A 4ZJYA 3D0QA 4R3UC 2HYIC 3CM0A 4FHFA 3MRSA 3J5PA 2ERCA 3NLLA 4YVFA 4MVCA 3QX7A 2NVUA 2Q3HA 5K51A 2I2DA 1II8B 4XYBA 3HXKA 1R9NA 4LEIA 3S7ZA 1EDDA 2GNAA 1UBMS 5JCJA 2P62A 3FPKA 3RT9A 2WKQA 1RNLA 1MH9A 3PD7A 4LCJA 3EZLA 1VL8A 1ZGBA 4QJ4A 4CRWB 2BF4A 4TV3A 3FTXA 3BF7A 3DOHA 4QOIA 2QTHA 1G60A 4O63O 4CU2A 5CLFA 1EUQA 5IAGA 4CLOA 4RAQA 4IWYA 5CNKA 4L9PA 2X5XA 1BJTA 5JNWA 3GLQA 2ZYDA 1PSWA 1NNI1 4AF8A 2HCTA 1AV7A 4Z0NA 4EEZA 3DONA 2C7QA 2QENA 1IXVA 2WAXA 1J0AA 4DIDA 1A27A 4A73A 1M2EA 1IOZA 3ABME 4XJVA 3JQ6A 1B0ZA 1BVUA 1Z3YA 4GZ5A 5ISMA 1RM5A 3IUBA 1GRQA 3WLTA 4AMUA 2O8FA 2Z2JA 3WBBA 2I7XA 2GZHA 2I6SA 5HQTA 1A72A 3VNVA 2DHDA 4I5GA 4ZVOA 3ONWA 3WO0A 1NBIA 1SXGA 3V1TC 4UUMA 1IRIA 4O4IF 3NQ41 5C2JB 2VCYA 1MT0A 5SY6A 3K94A 1N1MA 3IDZA 2HYDA 2GM4A 4GXNA 3GAMA 4RSHA 5I8PA 1F9EA 3RIEA 4LY9A 4OGFA 1N1EA 4UNSA 2YJZA 3LC0A 1CS0A 5LSAA 4ZT3A 3SX0A 1IB6A 4FHDA 1U2DA 4I08A 2QUHA 4GGMX 5KJMA 4IG9A 4WNGA 2AXNA 3FPLA 1Y8ZA 4NABA 2O05A 4NBLA 2GRRB 1A77A 4L5YA 4KPFC 1VHDA 2WPDA 3PGJA 1I36A 3NW9A 4KAJA 3EUFA 4BNYA 4PY2A 5CB4A 2VDWB 3FKSA 4LI0A 2F8MA 1MAAA 2FF4A 2WC1A 4JP3A 4X24A 3AB7A 4DTCA 4GX2A 4JLOA 3PDWA 2RBKA 4EUFA 2BMJA 1QQAA 3BUSA 4KQWA 2KBEA 2B2XA 4OCZA 4FFNA 4S24A 3NC4A 1JG1A 1OZHA 2ZIXA 3EUVA 4DX5D 2UZ4A 2ZBFA 2E48A 1SCAA 3IE0A 2DHQA 5DTRA 3OOSA 1OCOE 1WMSA 2BM1A 2XMZA 4C1NA 4BNXA 3ECSA 4YMSA 1ADCA 4DCUA 1MFPA 5B12A 3KSLA 5BR8B 3PUZA 3T1QA 3LJKA 1M76A 3RK0A 4XXHA 2A78A 3U44A 3JATA 1M1ZA 3AW9A 4CI0B 4AUMA 4APFA 2CJWA 1RQRA 2IQ5A 3S29A 4JYMA 4TWBA 3EIXA 4DMFA 4Z4QA 1KJWA 5CFPA 2IEGA 1WW3A 3KTDA 2KZTA 1YCGA 1QCCA 2OCKA 4YP5A 5LD2C 2FN7A 1E6CA 1QORA 1IVSA 2FVYA 3A10A 1C1XA 1N9GA 4DXAA 2O2JA 3IEMA 2B5VA 4M53A 5CG1A 3IBEA 3HUFA 1LFDB 5DM70 4PZDA 3JTEA 1FDRA 2XCLA 1CUUA 4EGCB 2J6HA 5BY2A 5K3BA 5ED0A 2XZLA 3MTAA 3H1TA 4CEJB 1KT0A 4BT8A 3TFWA 3PC7A 4P29A 1W5SA 4XLTA 3PRZA 3TSWA 2YY6A 2WTUA 4M1OA 1OCCE 2ZI9A 3I6BA 4JLBA 1TAGA 3OZWA 1RP7A 3K3PA 2Z4TA 4YJ2F 2LE0A 3QG1A 3FHCB 1FXWA 1Z4PX 5BSUA 4B09A 2PMEA 5GOZA 4PNPA 4JD5A 4B4DA 3C5CA 3L1JA 4PSDA 2CDRA 2R3SA 2WD7B 3Q3GE 4O2AA 1H5QA 3D0OA 2OESA 2WWWA 3KYDA 2W6IA 4I6EA 3IAM6 1P7YA 4H6XA 4TZ6A 5CFOA 3J80A 4PC6A 4MYCA 4GM0A 1OLSA 1FJHA 4A15A 2WABA 4TYWA 1U8AA 1DLIA 2F1OA 3WE7A 1KKMA 4JLUA 3AV0B 2AX4A 4LXIA 4TKVA 1X1TA 1IAQA 2ORIA 3HKEA 5AJHA 1FDOA 1V1MB 1BZYA 3RS3A 3Q40A 1F5SA 4F84A 4OHUA 4TT3A 5ICEA 2AMYA 4B87A 1YASA 1VCIA 4GI7A 4S2EA 1Z5WA 2FN8A 2SCUA 3I3SR 4A63B 4GZ6A 1SOMA 2NT4A 2RGBA 1ZJ5A 3E9NA 2WTEA 2B6CA 3NBUA 2G5GX 2CV2A 4K40A 4PG6A 1JEOA 3E9ZA 3BWEA 5B3LA 2QT9A 3RDPA 4WZAB 3N7UA 3PDIB 4PSKA 4UM5A 2AN5A 3LJNA 3BMXA 4MV5A 5IVHA 3TBKA 1S4MA 3ZV5A 5M29A 8ATCA 1G4AE 1V7CA 3K4HA 4FEEA 1LGYA 4IRUB 3TXMA 5B1HA 1TN7A 3QRWA 1D6JA 3T3HA 3C16C 2W0SA 3SZUA 3PHJA 3UUEA 4U1RA 3L9WA 1ZCFA 5YASA 3QXJA 2Y27A 3IDQA 3O95A 3FWNA 1VYHA 3T1HB 2P75A 2HL6A 5CVUA 2XVMA 3JS5A 3PD0A 1V3QE 1AA6A 1NP6A 5FPHA 5FIOA 3S2ZA 3CSTA 3OEHD 5B3KA 5KOJA 1C1YA 3H13A 3LO8A 2BHTA 2FJPA 1JDVA 2XGMA 3HY6A 3LW8A 4JASB 1K7CA 3HYSA 1Y37A 5H59A 4LPSA 4RF3A 2BGGA 4H1WA 2C4MA 3A9UA 1TM5E 1L1EA 2IIBA 5FL7A 1VM6A 4AJIA 5CA1F 4D3XA 3B3JA 3EQ8A 1HDGO 3V2GA 3ADPA 2V45A 4HBZA 3KVVA 2KWIA 3OCWA 1U2PA 2QJOA 3PI7A 3PZ4A 2EBWA 5CJPA 1YB1A 4FDAA 5A02A 4TMKA 3ZV4A 3E9EA 5KTTA 1PJ2A 4L4RA 3HXPA 4JENA 3FCAA 2OGWA 4WDQA 2HRCA 3OIFA 1EFRA 1KWKA 4GOXA 4FEGA 4QUGA 1JFLA 2VYCA 3NEYA 1JHMA 4RD1A 2CLSA 3MTDA 2ATXA 5IWAB 4MMYB 3LK7A 4GQAA 4TLLB 1VG0B 3KJEA 4XWKA 4B2IA 3QVJA 3PQ6A 1TQ6A 3PNVA 2QQGA 1CY2A 4J94A 3K1ZA 1TI7A 5LDDC 2RB4A 4GI3A 5I8WA 8GPBA 3BE8A 3P9QA 4A2PA 1WEKA 2XGJA 2WK1A 4GHWA 3OJFA 3SFZA 3LYHA 1JJAA 4HEQA 3VYRB 2KM4A 3Q7TA 1RZ3A 1YB2A 2JI9A 4QYIA 2PZMA 2AOVA 1Q15A 4FZVA 3QFSA 5J2UA 2QROA 1WQ3A 2G6BA 1K4YA 4EY8A 1ORTA 1BNCA 4CFSA 5KYVA 4NWIA 1VHTA 1IWPB 5EXDA 2AGVA 1NXSA 1B26A 2IFTA 3CVYA 4LYGA 4HH3C 3DE3X 5HK8A 4YQEA 1QLHA 3V1KA 3JPYA 1WUHS 4GLBA 1PT6A 3M4JA 2XB9A 3WGQA 3B60A 3CR3C 4F8JA 2ZIFA 3D4LA 2LSUA 2MYOA 1EFHA 2FWAA 4BQIA 1VHWA 5BSHA 2Q49A 3DSUA 1L3BA 4MWSA 4B76A 1XG5A 3ZVRA 4RQAA 3E82A 4TKUB 4HEA6 2C29D 5ITZB 3H11A 1GA1A 2LAHA 4MB2A 1Z2NX 1DU4A 2Z6QA 2Q3CA 2PRKA 4TMXA 3WDKA 4V1CI 4MULA 5CURA 4ER0A 5CFMA 3MC1A 2HO4A 5TLSA 1OB2A 1LB1B 3F5FA 1VSBA 1DXQA 3RTAA 3Q75A 1ID1A 2A9QA 4Q3EA 1WZ2A 3QVVA 1WV0A 4JI8B 1B8PA 1FYEA 3D54D 1E98A 1FC0A 1KTIA 3W6OA 1SUIA 4RTOA 5K05A 1NOJA 2G4VA 2X6JA 1DWOA 4OM8A 1EJ0A 2O06A 1SOWA 3A9RA 1BGXT 1RQPA 4DIOA 3OLQA 2QFCA 4ANUA 4D56A 1A98A 2MYUA 3PPYA 1XFDA 3HU5A 1TO2E 3AJDA 1UADA 4WA7A 2JJ2A 2OCYC 1M1YA 3CWZA 5C35A 3RVOA 3DOIA 4MW9A 1AN9A 3MTJA 3N0XA 5KEIA 4Q1EA 2C95A 2PU7A 2E6UX 3WKDA 1BRMA 2AFIB 3JXEA 3MN1A 4R2HA 3PRJA 4PUCA 1WB4A 4L4XA 5EKUA 3WHPA 5I5GA 3ZHEA 2VRNA 2GERA 2F1RA 5A9TA 2QPLA 2QEQA 1GZ6A 5EHZA 1OH8A 2GT1A 1HA3A 5C32A 1W93A 4X7PA 2TECE 5HZHA 2W11A 5TF0A 1NC3A 1EFLA 1H65A 3FOEC 4U6SA 1RM0A 3ZQ4A 2C5EA 4RIHA 1B89A 4H15A 4B8WA 3MZ0A 2X0KA 3B7PA 1DINA 2YUTA 1LDGA 3ZCTA 3KUUA 1OA1A 4EB8A 1ZOLA 2EL9A 5BV1A 3QYJA 3CFYA 4M55A 3OZDA 2OK7A 3F3KA 5A5DA 4RVDA 3PQDA 4XEUA 1P5FA 1TU3A 1E1MA 5JAMA 3IIJA 3D7SA 3BL8A 5K20A 4EO7A 3B36A 2AMLA 1FW8A 1UOQA 4FNAA 2E5FA 1C4KA 3Q9UA 3IBYA 1GTMA 2G70A 1IOWA 5A0FA 4W5HA 1SIBE 2NXWA 2UZAA 4EFLA 2HK7A 1KPSB 3S2EA 3RYTC 1C3JA 2D2IA 2JBAB 4BO9A 3T3GA 2XDWA 2IODA 3L05A 2BKXA 3R3WA 1QS0B 3T38A 1RCTE 1K89A 3LUKA 4XGNA 2I4IA 5ALKA 4HNUA 2V0CA 3MS4A 1HYBA 2OGUA 5JEDA 3EFEA 1DOZA 5MF6A 1U02A 1E7MA 5IKOA 4XD7D 1L5WA 5ER9A 3UWDA 3JW8A 1DAIA 3N8HA 2XUAA 3R44A 2WJ3A 4GO1A 3EBPA 4ESEA 3LGSA 3L8YA 3ND9A 3AU8A 5B7QA 1W88A 2ZEJA 1U1DA 1CR2A 3D9JA 3DGEC 4BVBA 2X40A 5LQAA 2ZKLA 3K8YA 2W6OA 3D7KA 1Z22A 2Q0SA 1GILA 3WIEA 3FVTA 2RK6A 5EC8A 4RMHA 4RLSA 4F72A 1YIDA 4JB3A 1QVWA 1XD9A 2WSIA 1U5BB 4J6EA 2PV0A 1P29A 4LMAA 3Q7IA 3AVPA 1AHPA 4DE5A 4WFKA 4NOJA 1Q5PA 2RGWA 1WZNA 4R8MA 4LUCA 4DSZA 4EBFA 1J8MF 1HS6A 3B6IA 2DX7A 2C77A 2I4MA 5DYNA 2WWIA 3V9PA 1XEXB 3KFXA 5LCWJ 3WLAA 3KJGA 3MQFA 3GR6A 2WG2A 1A04A 2M1XA 1GYQA 2R59A 4CG3A 2ETVA 2OFWA 2G1AA 2K2QB 3L40A 4BZXA 1B6RA 5IS2A 1Z06A 4YRPA 3R3XA 1V1RB 5IABA 4DR3B 2D8MA 2BI8A 4D97A 2QJFA 4N6NA 1D7OA 4WLUA 4UU1A 4BEJA 1E2QA 4TQGA 2Q5EA 2OK8A 2H9AA 4IJUA 1J24A 2ZYWX 4DA0A 4YWJA 3L9TA 4YJGA 3KKQA 4R9SA 2B5WA 5REQB 4L2LA 1AF7A 4Z9BA 5ALSA 1IK4A 4H7KA 4WKGA 4OBEA 2CFUA 3S5JA 3IJEB 4KFUA 1UFOA 2FSFA 4P4TA 4HGRA 3CURA 4W8GA 2QL7A 4DIKA 1TEVA 4B6FA 1G5HA 4PHCA 1I4EB 3C6BA 4UMEA 3QLEA 4MNTA 2AW6A 4W5TA 1BDMA 4OHKA 3GLRA 5BXYA 3SN6A 2EZ8A 5IKXA 2UDPA 2XSZD 1H0SA 4TUYA 2BBTA 3WHKA 4HXEB 2R6HA 3L93A 2AWNA 1QTIA 3BA1A 1T1GA 3P32A 2WQ7A 4BUJA 1M3SA 4MWTA 4ASUA 3PEUA 4EHDA 3OC6A 4M0PA 1KP9A 2B8EA 1UM9B 2QE7A 3DD5A 4ARZB 3M1LA 1UAAA 3BTUA 4M7WA 1RAEA 4CTKA 3PEVB 1MIOB 3F8TA 2AN1A 4YY3B 2JRLA 4DIEA 4EFKA 1E79D 1TADA 1UMCB 3Q3HA 4C6TB 3BDIA 2YZ7A 3KYIB 2VDMB 2DWUA 2QI9C 1SRRA 4K26A 2IXGA 5BVHA 1K66A 2REOA 4TS1A 4DHEA 2Q1XA 4LQLA 3D6HA 3TFQA 1PX0A 5ALYA 3HSYA 3IP9A 1PR3A 4J0QA 1WUYA 3ESXA 2HRQA 1M6VB 4AZ0B 4R6XA 4M21A 3BJRA 3OY2A 1YVEI 2CSXA 4U2KA 1RLIA 4A8JA 3EIWA 3TZHA 1ZP6A 2O3UA 2R11A 2XGGA 4AOFA 3LP8A 3LUHA 1VYTA 3E03A 1MJNA 3K8QA 3ZGQA 3WLIA 4ND7A 1DL5A 3OEED 4TQ9A 4DMUB 1KP3A 4TV9F 1DCQA 3SO8A 3I9NA 4YJ2B 1C0IA 2O1XA 4TXQA 3ICCA 3D6UA 2EFGA 4CR8A 4BNNA 2MYPA 5AK5A 1I7PA 3TAUA 3UM9A 3ONLA 3PVSA 2CHVA 1PSZA 4AWBA 1F2DA 4OMCA 4XOIA 5CVDA 1Z5VA 3CLTD 1E2FA 5D2MC 4M88A 3RVQA 5MGBA 1TVEA 3LHIA 2XDQA 4GMDA 3ODPA 5JDIC 4NP6A 4NYMR 1D0IA 1JPNA 1I33A 2Q3JA 2V5AA 3UK1A 3DSTA 1YDHA 2QAGB 3AL0C 3F74A 5HF9A 3KT8A 4K3UA 5FPQA 1YR2A 1AZTA 1FZTA 4P84A 1PGJA 2DUJA 3VDQA 3A4TA 3CVWA 4LYYA 2BTDA 1ILEA 5CHEE 2DFNA 2HMTA 3U2QA 2I1QA 4S1WA 4PCUA 1VSQA 3NHRA 2V96A 1E9BA 2WM3A 3D5EA 3VTYA 4JT2A 1AK2A 5E1BA 2Z2YA 4B71A 4J1NA 4L0QA 1R4MB 4B32A 2J1LA 5A1TA 1LLUA 5EA2A 3DWEX 5JHBA 1IEWA 1ODLA 5B6PA 3M6MD 2IF4A 3ULQA 5B1YA 3M1IA 1Z0SA 1TR4A 1WKBA 1CDZA 2F8YA 2G6TA 2VBIA 1KRWA 5J2TF 5JG7A 3RYHA 1K8RA 3QXGA 4L9AA 1OTXA 1L3CA 1Y1SA 4UU0A 3HA7A 2EJCA 4JN6B 1SUBA 2ZJAA 1UBJS 3LXRA 2JKVA 1F4PA 3ASOE 5F4ZA 3E58A 3Q87B 3IE1A 2C3MA 1W5FA 2H00A 2PT7A 1IJKA 4JI0B 5ERXA 1J99A 4F9GA 2QIOA 4ZI3A 3W6PA 3CX6A 1NHWA 1UBTS 2Q1YA 2HNBA 5AJYA 2WAOA 4LV5B 3GUYA 1U0TA 4X9XA 5TMBA 1YU9A 1CZHA 1XXHA 4MV3A 5AYVA 4NS4A 4M8LA 4S1NA 3D9MA 3DV2A 4L7VA 1GCOA 2FPLA 4FYHA 5LMUB 2BFNA 1PU2A 4F7WA 1N0HA 5BSMA 2IHJA 1U0NA 2A9FA 2QT1A 1CYDA 3D3MA 1NL4A 5C53B 3B70A 2FHPA 4YJKA 4DDKA 1JWGA 4PG8A 4HDSB 3F46A 4J1SA 3N8IA 4A1SA 3UT0A 2VG8A 3N07A 3NOVA 4Z9AA 2O2DA 1AH2A 1LI4A 1IUNA 5CXSA 4ERXA 4ALJA 5AW7A 4C76A 2YY7A 3BEOA 3S5UA 1WMDA 1JS1X 5HE9A 4WPGA 4GZ3A 3D31A 2PNJA 4C4OA 3H5VA 5JJTA 3KU1A 4GYKA 4I8DA 1IZ7A 2UU9B 2GAFA 5B5SA 2NSHA 5LDGA 3QX3A 1QQTA 5A6SB 3C6XA 3I2JA 1B8NA 4NMMA 3SMVA 2I54A 2NXJA 4JVNA 3SBEA 5DW3A 1N5OX 1G3NB 1DB3A 3G0DA 3SJ7A 3KYCB 2LCIA 4KVOA 3GRAA 2B1IA 1F14A 1IZYA 1NU6A 3Q5MA 3DPSA 4N0QA 5AESA 4LHVA 2PT5A 1YT5A 1SKQA 2G04A 4ZKDA 3Q88A 4NL4H 5JXJA 4D44A 3UINC 4HRYA 5DXAA 4HLLA 1TM7E 1CRLA 3WB2A 4OHCA 2W98A 4D41A 3X2FA 1T2DA 5A9SB 5H3LA 4F04A 1RXCA 2IZ5A 1M2JA 1CYEA 2ZYTX 2X2EA 4ILKA 3TVDA 1TK2A 2MR5A 4Y2HA 2CUZA 4CFZA 7YASA 4XDZA 1UPFA 4GUAA 3NNSA 1CUGA 1KEZA 4AIRA 4TXHA 2OEPA 1YOVA 2WU3A 1Y8QA 4KXWA 4MTCA 2CXXA 2PS0A 3IUYA 4YO7A 1J90A 2POQX 3L54A 4KXQA 1ZJZA 4IEEA 3QHQA 5K6TA 5SYAA 1KEEB 5MN4A 3GG2A 2FY8A 2ZUDA 1TECE 2RHBA 3IPCA 3SZOA 4Z99A 1RXIA 1P9NA 3D4OA 2HF2A 3N3BC 4MQFA 5ALLA 4A16A 2DBRA 4CQNA 1IZZA 3EZYA 4A55A 2P0YA 3UHFA 4RVBA 5EE3A 4Z0TA 4BMVA 5TJHA 2ZTMA 3AHFA 1FSZA 1LLCA 3GC6A 4W7HA 3OJLA 3B3GA 3B1WA 3F7NA 4YRIA 1YL7A 4KO1S 1OH6A 3EHRA 4RWZA 2ZQ5A 1F60A 2XNCA 2QX4A 2Q5FA 3GEBA 1NVFA 1CUCA 1XRRA 3WQRA 1ETHA 1NXVA 1R00A 3B3FA 4ZVRA 1KK2A 1IXZA 4BVLA 1I10A 5AQ1A 2XUJA 2PQNA 1EYZA 2WTAA 3GFFA 3BCSA 1HNXB 4CLRA 3I92A 3IDFA 3PKIA 8LDHA 3M5WA 1T5LA 2HM8A 3GN2A 2F6RA 1DRKA 2VKQA 1XP8A 4Q7JB 1W0KA 4UI9C 1ZNXA 1HQKA 5UKDA 4O2BA 1GDTA 1NQUA 2O0JA 4AG5A 2WU4A 2BY4A 1RRMA 3DL4A 5BWBA 1MC4A 3IT0A 1C30B 2HNKA 4DANA 1KHTA 1LY1A 5B1BE 4PPNA 3MWKA 4NBUA 3PDJA 1JT9A 3SQMA 5C7OO 3DOEA 1O57A 4DF3A 3WO1A 3GRFA 1IDN1 5TPZD 5C5EA 1UH5A 1LS1A 2BTEA 4DWWA 4EG8A 1X1CA 3RIHA 1O95C 4HUJA 3ZEIA 2IIPA 1JHDA 2FP3A 3VI3B 4OLHA 4X7MA 3Q3CA 3EGVA 1XMQB 1UKBA 1WQ1R 2FLWA 2Y4NA 4G5SA 3APDA 1RFGE 1Y9AA 1T2FA 3CNHA 4JOCA 2E5LB 4LRWA 1Z6ZA 4PX5A 4GPMA 4BX9A 2I3DA 5K45A 2YJNA 1AQIA 3QVXA 3D3WA 4A6EA 2C31A 4LYFA 4R0MA 1MU0A 3CH6A 2XOXA 2ZUSA 3L8HA 1A9OA 3GAAA 2CL6X 3MGCA 4EDHA 2GFQA 3FTFA 3I1FA 2A9OA 2GAAA 1Q2ZA 1IIBA 3DTYA 4C08A 2JIMA 4RA6A 2BFBA 1OY3D 2JI4A 3BIFA 1NVAA 4Y3UA 4G4JA 4BFRA 1GZ3A 3O9MA 3AGPA 3BCUA 3U5TA 4J2TA 4M1MA 2B5OA 3ZIDA 1ULHA 3WJ7A 1U4NA 4OQ4A 1EESA 3SZ3A 3L8FA 1LW6E 3DXMG 5F76A 3AT1A 4LZLA 3A6KA 2UYOA 4RJ2A 2V74B 1HXIA 3HKDA 4OYSA 1W35A 1C0LA 4EPTA 3DXFA 2Q5OA 3K0AB 1YIAA 3OFNA 4I66A 4TV8F 1GHTA 3C5HA 3WBJA 1JI0A 2BEWA 1Q7RA 1WY6A 5CBPA 5CVJA 4DBVO 3TDNA 4RTLA 4AIIA 1TU0A 1LNZA 2QXTA 2ODAA 1QMGA 4W1QA 3WLRA 3ZY5A 5KJ1A 3OTGA 5ILGA 3O8CA 4WWNA 3RKRA 1SU6A 2QRUA 4OU5A 1MAHA 2FK8A 4H2DA 3CF4A 5LOVF 4IYPA 4ZOCA 3QXXA 4YLYA 4LZWA 4K6GA 4IFTA 4AJ2A 4ITVA 4WZAE 3KOXA 2G83A 1KI2A 4WRRA 4RY0A 4BUZA 3C5EA 3RVSA 2G25A 2Q5JA 1XZGA 2EKLA 4HQ0A 2NZUG 4DEYA 2FP4B 4YASA 3RK4A 4HFNA 4DADA 1SKAA 2O5EA 3A27A 2W90A 4HMPA 2WG1A 3G82C 4HNTA 5AQBA 3EF1A 1XB2A 3ZZMA 5KWSA 2IQIA 4Y98A 2NQ8A 3UT5A 1U2ZA 2PIAA 4BJ3A 3O90A 3WDLA 2RC5A 2YQZA 1N57A 1TF5A 1FL9A 3DMTC 1CP2A 2CDBA 5E3JA 4A3VA 2DWOA 1VKRA 4LX0A 3AI7A 5DNVA 3AVTA 1D04A 4HGZA 3L7JA 4TXMA 4DA8A 4ZGGA 3SHFA 1O1TA 1PT9A 1O58A 2PLWA 2ZJBA 1KDPA 1X1EA 2X9NA 2G72A 1JGTA 2TMDA 1PF7E 3P45A 4R0VA 5M7EA 2CXQA 2PZGA 4CVNA 3LX5A 3FSJX 3HU1A 1UKAA 1V16A 2CK3A 1TM3E 3CRQA 3KQVA 1HI9A 3DS8A 2RGXA 1NVVQ 5ENVA 1PFVA 3CK7A 4IIGA 4UBMA 3QLVC 3HJBA 1NN1A 2WBLC 1U2QA 2QMHA 1ACMA 4EY4A 5AARA 1W87A 4BGUA 4U0ZA 4MWDA 1AKEA 1G6HA 3QZUA 3BMCA 1ETUA 5I4KA 2QNBA 4NR0A 3F0TA 1RXVA 4YDQA 3Q9LA 3W9BA 3CN9A 2QQ5A 1JHRA 3DDSA 2Q2QA 4JK3A 2ZWVA 2QP4A 3C3CA 3ICEA 1IPFA 4MB0A 2P1DA 3I5AA 1SZPA 4ZQGA 2R8EA 1GCAA 3MV2B 4O4HB 1TF7A 2VHQA 3DZCA 2IBTA 1JDJA 4N03A 5D5QA 4RKEA 3UB4A 4Y1RB 1TNYA 2JL1A 3PXXA 2RJ3A 3EGXA 5JVDF 2XXJA 1N1GA 1JAYA 1IXKA 1O8CA 1AKMA 3ZV3A 3BEDA 5ITWA 3O47A 1M75A 3K0EA 3W3AD 3FNIA 3ZE7A 1XDGA 4J1TA 3FAZA 4EHIA 3ZDFA 1Z3CA 4FCVA 4L02A 4QTZA 3PDUA 2GUGA 5JW6A 2BR4A 2XKAA 1O0CA 4WXRA 3D3EA 2XNDD 4DT1B 1KTVA 5JRZA 4L4UA 3NUZA 3K35A 3PVCA 4U63A 1SULA 5CM8B 3HADA 3A2MA 3EGOA 4R6WA 1SA0A 3LRPA 5ITZF 2O3QA 4XI0A 4J75A 1MBZA 3O03A 5KUTA 4TPKA 4G0YA 2YYYA 4N7MA 3O91A 3FSRA 2XMGA 2PQ6A 5IT0A 1RCFA 4I36A 2SKEA 5LX8A 2HTEA 2Z6UA 4Q3AA 3HYMB 2I2XB 1E5VA 1IUKA 3IAS6 4EHFA 3AF0A 1P72A 1G8AA 2HO5A 3B13B 4IVRA 1VJTA 2O50A 5U4XA 2O7RA 4L8LA 3SBXA 5E2AA 5FTJA 3ZYMA 3ZDEA 2XB6A 521PA 1INLA 1N3BA 5GVRA 4Q4JB 1ORIA 3F73A 4I5DA 1SIOA 4CYMD 1TJFA 5ADVA 4EYSA 3TB6A 3Q6MA 1EM8B 1K2VN 1C14A 2NXPA 4KWHA 1ELKA 3ZWAA 3VOBA 3MCZA 1SVUA 1ISPA 4ZRNA 4IIEA 3T9CA 2IEJA 1X1BA 1IFXA 2AFIE 3NEJA 1EK1A 1I5EA 2I7CA 3RYCA 4KXNA 1TEHA 1V5EA 3KJIA 4W5QA 5GPBA 4MGZR 3IDAA 1EB9A 3VPHA 3PTAA 2OOEA 3L1HA 4G6ZA 4CMKA 5J2TB 1E9AA 2X4IA 2OZLA 4R9VA 3IMGA 3X1MA 1XNGA 5K3CA 1PK9A 3QKIA 4YRDA 4CM9A 3TD2A 3HA3A 3UAXA 2ZGGA 3GNSA 3O7MA 3CHYA 3WJ2A 1NVDA 1DAFA 3LBYA 3T7TA 4KBYA 2DYKA 5KMGB 1NUAA 1E5QA 4E30A 4HTFB 1Z37A 5I9IA 3QBTA 2D0DA 3OLXA 4CIAA 4K9DA 1Z5NA 3DXZA 4GWKA 3GQBB 1AVTA 4O6FA 3BA6A 2XKKA 2JARA 3LSTA 2ZIAA 1TC2A 3EHQA 1N2ZA 4MUHA 1DHTA 1Z33A 1DRUA 2IYAA 3NBMA 3LUFA 4BY9E 3X2EA 2XUHA 3AR7A 4BMCA 1RYZA 3CZQA 3ICQB 3K92A 1SZJG 2N3ZA 4MW1A 4NYIR 3WZMA 3BMNA 1YBHA 1OILA 1ACLA 2Z5GA 5AM1A 3I6QA 3T06B 1H19A 4KIGA 4IUCS 2TRSB 3F6RA 4MP3A 1EQ2A 3PLNA 1COWA 3LBHA 4I19A 1W75A 1PGQA 1TU4A 5EE1A 2J4DA 2O3JA 4TUMA 6REQA 2WMDA 1ESDA 3HU3A 1A9TA 4PO9A 1YZTA 3E33A 2V58A 3V7UA 3EUWA 3NB0A 4I6JA 5KINB 1V54E 1U80A 3G23A 4HDMB 4QO8A 2OKGA 4XM2A 2F3SA 2CHQA 3L84A 2WF6A 2FUG6 2PQ2A 1S2DA 3ZTYA 2O2GA 1C9DB 2HFKA 2V5QC 5FRDA 5AM0A 4MOWA 1SOVA 2Y0EA 1W44A 4P3NA 3BFKA 4FD2A 3X1XA 2I5PO 4F9EA 2BKVA 2ZE7A 1L4NA 2E49A 3RANA 1NMEA 1XVTA 1KJQA 3O8LA 4F9FA 1I3MA 1BE1A 4U02A 1N5IA 3VGJA 1YDGA 2I6QA 1NATA 2V4MA 3PNOA 3O4IA 3MELA 2X0FA 3Q9NC 2QKYA 3MJSA 1PJAA 2OXEA 5CAEA 5K09A 3EA0A 1ZUHA 3WV4A 5BN4A 3LY8A 4GQBA 2Z43A 4FN5A 5AW4A 1FIUA 4CE6A 4UPDA 3BDAA 4LK2A 2BFFB 1AUVA 1GPDG 2AMVA 3AOGA 5D0OD 4K6HA 2QU7A 1QRAA 1YI1A 1ODKA 5LWHA 3SNXA 4R1UA 1WO8A 5A4FS 1PSDA 1S6YA 1YSCA 3UIPC 1OFGA 3OJOA 2QR2A 3FB1A 3AMVA 1PNOA 3U6KA 3ZXUB 5LQUA 4RHYA 3OCYA 1E9FA 4U7GA 3PFGA 3QQPA 1QUFA 1LLFA 3NHYA 1L5GB 4L57A 3Q12A 3JYOA 1JLHA 3AR4A 3ON5A 1HM5A 1IZ8A 2JIZD 4UBJA 3TL3A 4EVIA 3EGIA 1G21A 2EDCA 1RI5A 4JHJA 2EKQA 4NMXB 2DWPA 1CNFA 2YMQA 2C8KA 2CLOB 2BHSA 2GEBA 2OG2A 4EUKA 2YS6A 4MVJH 4X97A 3TTXA 2I4NA 1TNZA 3KQPA 4DMLA 3CSFA 3Q4GA 5ENPD 2FAXA 1GKYA 3T7EA 4K5CA 4AMZA 3IESA 3DL2A 1T4CB 2ZWOA 2O54A 4Y67A 1P2TA 4X71A 2RHDA 3USZA 1JXOA 3O4JA 4KKVA 2CG3A 1ZD4A 3U62A 3IKMB 4HQLA 5JJKA 4EG5A 5J63A 1G19A 4R05A 4D9MA 4WOPA 2Z5VA 5GM2A 5J43A 3EPKA 2ORVA 2Q07A 1QTRA 4G9EA 2PM6A 3QH4A 1JWBB 4EJSA 2R44A 4FJYA 4NBTA 1EDOA 3JQRA 2BGKA 1KFEB 5BUCA 3OLCX 1PYOA 4JJ4A 4ZRMA 4KQMA 3LVFO 3AWDA 1OH5A 1IMOA 3JQCA 2WKWA 4ZJZA 1TCVA 5BOSA 1SZ9A 1ICEA 1YR8A 3I2KA 3L7LA 4I0WB 1XZCA 5ENTD 4BNKA 2ID8A 1VI6A 5KB3A 1XZLA 4CM3A 4LHEA 1RJGA 3AVYA 4RTKA 3O4ZA 2QYJA 2HRZA 1Q16A 4RD2A 1FYXA 1ZM4A 4LXYA 1BN7A 2WYIA 4QJBA 5BR7A 3SZRA 1WABA 3RTDA 4AXHA 4Z86A 3C24A 1PZNA 1EG2A 8AT1A 1R9JA 4DJAA 1ECLA 1DEKA 2BDUA 2IOQA 1F9AA 1SW6A 2W6MA 3DCJA 2LTAA 1E8NA 1MPTA 1Z39A 2AUTA 4QLBA 3VTKA 3CLUC 3INGA 1XZPA 3H4TA 2B82A 2HKIA 3FWZA 3U0BA 3Q49B 1R5OA 1EFUA 1JT2A 3ZHQA 4MRUA 4HWGA 3I8XA 2B8JA 4ROTA 2ZIVB 3NDJA 3PA8A 4MQBA 4GIBA 2YBEA 5ALDA 1SXJD 3ZU2A 3ZWNA 5CRVA 2J3EA 1V9CA 2V6GA 4E5UA 3KWFA 4CT4B 2Y0DA 2VTKA 2AFHB 1S2IA 1H0KA 5KQPA 4DLSA 1ILWA 2C9OA 3S3TA 2B83A 2JH9A 1RQNA 4CIVA 1PZEA 1KJNA 1R8SA 3VO2A 2YVAA 1FW6A 4JP5A 2DTXA 1JBQA 1I3KA 1EDUA 1DOAA 1NT2A 2ASVA 4LSZA 3R9WA 3N8KA 4E22A 1WRBA 1LD7A 4NQZA 2Q6IA 4F7AA 2FEZA 4DLQA 2IUFA 2P1ZA 1R0KA 3L7BA 2KS6A 3W5AA 3REFA 3U4TA 3OPYI 4BP3A 3WLKX 3EVCA 5IASA 4EYEA 3AEQB 1YS6A 2O59A 4GYWA 3UBMA 1IBRA 4DCPA 1BS9A 2NPOA 5IUKC 5DF1A 1L5HA 2BGJA 4JSTA 4TV8B 2GCGA 1ZMXA 1AZSC 4MVWA 2Y1KA 5FA5A 3VVMA 2BGWA 2OCGA 1DAGA 3BQOA 2ZR9A 1A4RA 1Z6PA 2JFWA 3AGQA 1T1SA 3T5TA 4QZVA 4DR4B 5ELMA 1AMUA 2X23A 3DQZA 5I3ZA 5LOVB 3AEUA 1ZSVA 4L07A 5D00A 5CEAA 1KYWA 2IYPA 5IMBA 4MVJA 3S27A 4D43A 2JJ8A 3UJ6A 4LDAA 13PKA 1N6HA 2HMYB 4PQYA 3MJVA 3VJKA 4IDBA 3L16A 5T4YA 1NW3A 3QNKA 2YHEA 3WMRA 1G291 3EVZA 3TG4A 3TRJA 4PLCA 1Y1TA 3TTSA 1UWKA 4PGMA 4AICA 2QPAA 3UN1A 2R8ZA 2F37A 3IULA 4B31A 3FKSD 1G6KA 2ZYIA 4PM4A 1LBTA 2DWQA 4IIYA 3WWPA 4WH0A 2HCJB 3OSUA 4X1OA 1XTBA 2CBZA 3CZCA 1YHZA 5H83A 4PYRA 4OMUA 2B9VA 1TW3A 1GPKA 1NF2A 3IKJA 1JEAA 1ZBPA 2RH9B 1C2TA 1WD7A 5EZSA 2H2IA 3DWLG 2NIPA 3FN4A 4RZSA 4L9RA 2XEVA 5J59A 2PRYA 3D02A 3I5YA 3MVEA 3B2QA 3FIUA 4MIOA 7REQB 1LRLA 4OQLA 4Z2YA 5F5NA 3IKTA 3WIOA 2HJGA 1PUIA 1LBHA 5EN5D 2BMFA 4FD3A 2NUTA 3TIXB 1CS4C 3BXPA 3IAM1 1BFKA 4EQ6B 4HAVA 1JSXA 3WWZA 3ZXPA 1DKNA 2DUWA 4LIPD 1PEKE 3S2FA 1IN1A 1V55E 4P5DA 3CW9A 3E8SA 5E6SB 4WVFA 2E21A 3PA6A 3ENQA 3ZHTA 2D2XA 3DLTA 3EZ6A 1CRQA 1U9IA 2C78A 2JFGA 1M54A 5CB4F 1X7WA 2VVTA 1UMBB 4EKEA 1R0LA 3DEHA 3NBFA 3JAMA 4GNKA 2C3OA 1U3WA 1XK6A 2VDKB 3UQYS 4ZI2A 4QQ8A 3V4ZA 1QCDA 2R6DA 3G8AA 3MUEA 4E33A 1Z88A 1ZWLA 2JPDA 3EQ6A 2GDJA 3EGDA 5L6LB 5CGQB 5JVDB 5LIRA 2AJDA 4F85A 4ITUA 2C7RA 3EOZA 1DWQA 3RFTA 1CJSA 2C1ZA 1AQYA 1JR2A 3D6AA 5FO0A 2JLAA 3HSKA 1GA4A 1QFZA 3VOTA 3THRA 4DG5A 1E0SA 4JQSA 4PNZA 3GA7A 3DM9B 2C7VA 3WIUA 4OPMA 3LO5A 1J33A 5IULC 5JAHA 1Q44A 2IDJA 3M3DA 2EGUA 1GN8A 5GINE 1IQ0A 3NVAA 2ZUCA 1H0AA 4UFPA 4ZCIA 2GFHA 1F0NA 1PJLA 5TEWA 2Y0CA 3X1JA 2BT4A 3IODA 1RE0A 3AEKA 2B1QA 2QRVA 1RRVA 5D3QA 5EMKA 4ZYWA 4Q16A 4OSEA 1T8SA 3IAFA 3OCXA 2P90A 1VHLA 3TNLA 2Q21A 1J56A 2YJ4A 3IB6A 2VHJA 3DLCA 1GNQA 1BQ3A 1WVIA 1LC0A 1GARA 4O0LA 3WRXC 5GZ3A 5LQMA 4B3DA 2G7ZA 2VP5A 3N6XA 2AEJA 1UZMA 4EENA 2FFJA 2VDUE 3UIOC 4I3FA 3BWDD 2WHRA 3FJOA 1U65A 3GO4A 5BR1A 2NO9A 4TT3D 5B7NA 2X6HA 4NH0A 3DHYA 3IEKA 5CECB 1RT9A 1FSFA 2XZTA 3KZKA 3V97A 4G24A 4EBAG 2DFLA 5EJ2A 4OK6A 4KSCA 2IP2A 4JP2A 5SZHB 3CHPA 4U8GA 3ZZ0A 4ZMSA 4OLBA 721PA 4G4SP 2BZGA 4GICA 4O2AF 1GUAA 2EBUA 3KLBA 3LHFA 4KOEC 1SCUB 3OM9A 2FSPA 2IE0A 2IOSA 2Z83A 5DHTA 4EGFA 5CK5A 2UYQA 2WFLA 3FLBA 4O1MA 2FUKA 4MRPA 5AW8A 3TJRA 2WR8A 4KODA 4GAEA 4YK7A 1NN3A 2CJFA 5JJBA 4BQQA 5EI5A 4BV3A 5CFQA 1TFUA 5A4JA 1ATZA 2AR7A 4NEGA 1BYUA 1QCZA 3HBNA 2IU1A 4CIBA 1XRSB 2NVBA 3UOAB 3DVAA 2JJ1D 4M9CA 1WLSA 1BHQ1 4WX2B 3HI6A 4R68A 5J5CA 1NLUA 4OJNA 4UZSA 1QYVA 2GI4A 4IGEA 2BRUC 5GY7A 2HF8A 1X9IA 1LQTA 2XCIA 2R8BA 4PLYA 2Q8PA 2FEWB 5FL7D 1YZNA 4FJZA 2YR0A 3SEAA 1Y6JA 4MQLA 4OO3A 1RHJA 2Y1GA 3HKBA 4A1FA 3FFLA 3WLFA 3F6SA 1OBCA 5LZ7A 4UOEA 2ILVA 1V6SA 4E5YA 4K9QA 4IZOA 4RL4A 2BGIA 4ZEXA 4Q34A 1R4AA 4JC0A 4HEA1 4QPDA 2IP1A 3BX1A 3QV2A 4R5HA 1KVSA 1J9EA 4N76A 2KATA 1S96A 5JQGA 1ZD9A 1ZIDA 4J9VA 1I1QB 4TTPA 4A8TA 3QEMB 2BEKA 1Z4NA 1EFRD 4PAGA 1CSEE 4MIKA 3QFFA 5ADUS 3A04A 1NNSA 2AG6A 3WADA 3WP1B 4F6LA 4GH5A 2I8AA 1UZAA 1JDNA 2D62A 2JFPA 1XAJA 2BFAA 1DKRA 4YP1A 3EG9A 4JUCA 2RHLA 4ZGBA 3UUXA 2BFMA 1E1CB 2BCJQ 2NUPA 2OMEA 4H7EA 4D1YA 9LDTA 2OGSA 2NYVA 3I42A 1DJQA 1SUPA 4CKXA 2G63A 4AO7A 4GMXA 2O14A 1HLDA 1G4HA 2Q0QA 2M6RA 1TNOA 1AS0A 3IUPA 4KPGA 1T0JB 4ZAYA 3O8DA 1UP6A 1K5DA 1PDVA 1QR6A 5AXAA 3CPSA 1ENZA 3B5JA 3L8CA 4ZI7A 1P7ZA 3KOUA 4R1MA 1UXIA 1CB0A 3AAAC 1Z73A 1CK4A 2W83A 2GOYA 2VWGA 3U4IA 5AUQA 4NLLA 1JTEA 1F3LA 2BUBA 4Z0HO 4CM5A 2M6SA 2X19A 2P9YA 2MSDB 3QNUA 4F5WA 1MEEA 3FWHA 5K1ZA 4PPYA 3N2YA 4K3VA 5IH3A 3KEFA 4GA2A 1WXDA 1L2TA 2JAOA 3OEYA 1M2VA 2HUNA 2WIFA 2Y1LE 4EZLA 2XI4A 1KZOA 2WWGA 4I1MA 4ZXPA 3S7BA 4YAIA 4P9NA 2MINB 1E1DA 2W2TA 6ADHA 4Y2TA 1E0DA 4EF6A 4H77A 1RRFA 1OJLA 5SY9A 3GLTA 3ITDA 4BDSA 2R2GA 2C0QA 5J2UF 4UXJA 3WP0A 1ZJ4A 2J3IA 4QHYA 1XTUA 5HGJA 4W9MC 5KPDA 4DC1A 2CFSA 1JSRA 2ZRPA 4QICA 4YXWA 2FA9A 2FKAA 4DMRA 1H2BA 1AWCB 3MLEA 2YC2C 4K87A 1WCIA 4MA0A 3KZOA 4C4PA 5T5QA 1R6XA 1YL5A 1PZHA 1QIJA 4QGBA 3ZDRA 3H9BA 2RHRA 4G26A 2QMOA 3NHUA 3I5UA 1XCJA 1YGYA 3C6MA 4U2FA 4OP1A 3PC4A 1KRHA 4OP3A 1ECPA 4X66B 3U3XA 1IHXA 3WFIA 1Q91A 4HWRA 1LBIA 4UHDA 1PFUA 2CNLA 3N6RA 2QVZX 3KDAA 4B44A 1V71A 4JEHA 2I71A 4YUWA 3BSYA 3PFFA 1BU9A 4XYLA 1GZUA 4QHTA 5CM2Z 2Z3ZA 4FYPA 3I5PA 3RM3A 3UK0A 5IY5E 3LPNA 1ZD8A 4O4HF 3CW2A 7GPBA 3EVAA 2DM6A 4AU1A 5CVEA 1NBMA 1D8EA 4DARA 4X1YA 4RZQA 1K63A 2PE5A 1RRPA 1NVWQ 3HZZA 5C51B 1JR6A 4W7IA 3B53X 4YDWA 4GP7A 5EN4A 2B9EA 3X43A 2B7CA 2IV2X 3EIHA 2GHRA 1SWWA 1YR9A 4DNOA 3DG9A 3G8YA 3I01A 1JZQA 1FUIA 2QM8A 4EMTA 1YV9A 2IHUA 2O8BB 5CX4A 1NQAO 2VPXA 4CF3A 3PJRA 4QREA 3U9LA 2PKCA 3P2KA 3AY3A 4BXOB 4GKVA 1UFVA 1T4DA 3ML8A 4S3MA 1OXJA 3S0JA 3I61A 4GCNA 2HPVA 5JS7A 3OOYA 5JMPA 4E09A 4URZR 2N75A 3W1EA 1EWKA 4F45A 3K70C 1W2HA 2IU4A 1PWEA 3N2NA 2K5UA 3COYA 3L7DA 3FZNA 3H42B 2XECA 3W1VA 2JGMA 2ZSIA 3EASA 2VT2A 1A5TA 4FP7A 3DO5A 4H3HB 4MRSA 4OLJA 2NPFA 5ALUA 2DJIA 5HTKA 4O1IA 4UVDA 3R9AB 1WXXA 3CR8A 1JIKA 2W58A 4KV9A 3VKFA 1K8YB 1UWCA 4Q3CA 4ARAA 2QLTA 4HNVA 1XMIA 4KDEA 2IPOA 1Q0PA 2JBHA 2AOWA 3GLHB 1FZQA 2PZFA 1PL0A 5DBKA 4O4JA 3T12A 2J0VA 2TS1A 5I7AA 4NCNA 2EGGA 4O8CA 1BVYF 1OF1A 4N0DA 4ZN6A 4IY1A 2NTJA 3D8RA 2I55A 3C1AA 5BSVA 1K1EA 1N7GA 4N48A 3W3ZB 4RSMA 5TXGA 1QB8A 4DJTA 2VQ2A 1HRKA 3KE8A 1JQDA 1CBUA 621PA 2Z04A 2DECA 5EWMA 3RYIA 2XXAA 2G06A 4TSFD 2C82A 3VNBA 5H81A 2GEJA 3ASDA 1L5LA 3WL8A 4IOKA 3G6WA 1P8JA 3N59A 4YAGA 1SXJB 1ORHA 1EVIA 1Z13A 1EFVA 4KAXA 3FYUA 1CZOA 3ENZA 3GCXA 4LJSA 5AMXA 1KQPA 2H7VA 4F96A 2V5VA 1PWYE 2VDRB 3TI7A 2B1RA 3HPRA 1JIQA 3JR7A 5FEMA 1IY1A 2APJA 4CLOB 4HOTA 3SIPA 3F6YA 3ASVA 3JVEA 4UXIA 3NYQA 3LXXA 1QU2A 3UWSA 3BTSA 1Q1NA 4WNIA 1QC5A 4QXQA 3RHZA 1JL3A 2TMGA 1SXPA 4AJLA 4ADSG 1KVQA 1Z2DA 2Q3FA 4B8AA 3L6AA 3Q79A 1G8YA 1WG0A 4MCHA 4PZ9A 4LQ4A 4NCAA 3C3MA 2JIBA 4FGSA 4UNQA 5K8VA 3OZSA 1GY8A 1IM5A 3ZNOA 4BESA 3RABA 5GAJA 1QHGA 2O8FB 5JBNA 1RE1A 3SZ7A 1BG6A 3M6AA 2VOJA 2Y69E 3SEQA 4AW9A 1DBRA 4PEVA 2C2HA 2W22A 1MEOA 1PJRA 4M49A 3A0RB 3PRYA 2OXRA 3MOGA 4HG2A 5MDHA 1W4AA 4Y6CA 3MLAA 1PYDA 1JZSA 3GFBA 5BW8C 3G0BA 5BUZA 4BP1A 5FV4A 3T3OA 4GVXA 3P71T 2I67A 5JFGA 2BKUA 1XZDA 3O93A 2AEMA 1FMTA 2NZYA 1HEIA 2C5LA 2C58A 4NCBA 1SPBS 2QE7D 2NP6A 3LX4A 3G2KA 1LU9A 1WIWA 1E3QA 4W6ZA 5ARBA 3AR9A 2ONYA 3H3JA 1U94A 1V7QA 5CB4B 3TLEA 4MEJA 5AXBA 4N40A 1SHJA 4D92A 5BQPA 3LPMA 4EW6A 2M6KA 1YBAA 5IW8A 3QYAA 5CW1A 1V95A 1QH8A 3GV0A 4X8HA 4XGKA 1M5RA 3DB1A 2AF3C 2ZIXB 3MEKA 1NJ6A 4TUYF 3ZQJA 4YAUA 4UXHA 2L19A 1J0CA 3C0KA 1ATIA 4WESA 3WIVA 1O08A 2HSZA 5H82A 3PC6A 2F64A 3HWX1 4I55A 5IDXA 3UH1A 3CG0A 5ED4A 5CXUA 3PV0A 3CXUA 5A4DA 3HCOA 3P0HA 5C5CA 3P5SA 2O7SA 4P6VF 1YAHA 3FFWA 2CJWB 3HJFA 2WVHA 3MM4A 3QFCA 4EARA 3HCEA 3T1NA 1CZNA 1VRVA 3DT8A 1TJYA 2KZTB 1NNUA 1SURA 4CODB 4K46A 2XUZA 4BOYA 4B73A 1C1XB 2YWJA 5JPCA 1N9GB 5AM2A 1S02A 1QQ7A 2EU8A 1UDRA 3ICPA 3BD9A 4G0NA 2AMJA 3TKYA 3DB2A 4FE3A 3AVQA 3OUUA 5F3RA 2O7VA 5FXMA 2RGNA 4JCOA 2VKTA 3QY0A 1DE0A 2AQ8A 5IDYA 5A5EA 3HABA 1P91A 2FEOA 4G5RA 1NRIA 3VZRA 5CCEA 2XS8A 1IOLA 1RQGA 3N2EA 2A4MA 5EUQB 3C98A 4HDCA 4LQDA 1TZBA 1A97A 1JQAA 2G1KA 5D1HA 1PL6A 4JYAB 3FUUA 1AXRA 2CBGA 1S5PA 1ZUNB 3C74A 3R7DA 5F9HA 3CUUA 4B35A 3OKFA 3UEOA 4C4AA 5BVGA 3QVKA 1SUCA 4HDKA 1JLSA 1OV4A 2AE1A 3EC1A 1DJPA 2EP7A 1S1CA 1VA4A 2B30A 3AI2A 1EBFA 2YDXA 4HWOA 4CN8A 5JD5A 4O2AB 4LHSA 2ZM5A 2BEUA 1I94B 4JA7A 1ZC3A 4WINA 4DM4A 3L22A 3MTBA 3FUWA 3GP8A 1R4NA 2ZBDA 2IZ0A 4G01B 3WYEA 1SKYB 4LJ6A 3EZ2A 3VDRA 4B1FA 1RAIA 4M0KA 1FA9A 3D64A 4AQYB 1OLSB 3Q3EA 3KQUA 4M8NE 3IFSA 1N2JA 4TKVB 1P6UA 3PYMA 2ZSJA 3HKEB 3D5QA 1UDWA 3OQPA 2CNWD 3O1IC 4ZQEA 2GEKA 1K7EB 2CDAA 3ZU7B 4I3GA 2P11A 5CIQA 1V3UA 5HFJA 4TKZA 2XCTB 1GUZA 3QPVA 4BFZA 4ANWA 3JVVA 2SCUB 3BRCA 4FYVA 4WEQA 5FBWB 3PQFA 3RGGA 1JQ5A 2RHWA 4ESOA 5JI3E 1YUMA 4JR0A 3LDHA 4QTXA 4AF7A 1IG0A 3VR2A 2C96A 2EILE 1LWOA 3B6JA 4BGEA 4AKIA 3QUCA 2PUAA 4OVVA 3B38A 1XD2A 3CVQA 2AFHE 4EMBA 3NATA 4J0DA 2HJSA 4DNPA 2G9UA 5AAOA 3VZDA 4TL6A 1B73A 1IBSA 1MJ5A 4MKHA 1BI7B 4NAUA 4FFPA 5FBVB 2EARA 4FSHA 1J00A 1YWGO 5L3QA 2A30A 3GT7A 1I13A 1V37A 5G55A 2UUAB 1P44A 4PF1A 2EFJA 1GTL1 3D9PA 2PX0A 3NV7A 1HOXA 2H1RA 2WM9A 3KFLA 4XQ0A 3NDPA 3LQ2A 2X6TA 4QXRA 2A88A 1TNDA 1NPDA 2AC4A 2R2AA 4WZ6A 2PAAA 4G0PA 1V4NA 2NTEA 5BW4A 4DQ0A 1F0KA 1JB1A 3ZW7A 4KO4S 2YMMA 4J16C 5J1SB 3DAOA 3V4RA 4MAAA 3FRIA 3PL1A 5AI5A 4I2NA 4HO1X 2HK9A 3MILA 1USVA 1FEZA 4D82A 4KR0A 1F20A 1EHCA 4R31A 4E5PA 2WQ6A 1GZSA 4ZEOA 3G0HA 3UO8B 3ZD9A 5JYDA 2BD0A 5LVAA 1IN5A 1QZZA 4EB6A 2I9KA 3FYSA 3PHBE 1UBEA 2JLXA 2GBIA 5D0QD 4ER7A 1OR8A 1E3IA 2JHFA 3TRHA 4AJOA 1O0BA 1LJLA 1CDOA 2QAJA 5T67A 2W42A 2P2NA 2WXGA 4L15A 1GPNA 1XHFA 1AKNA 1O54A 4NS1A 3LT0A 1QIHA 1KJYA 1RCUA 2C5SA 3FTYA 2Y1XA 4PX2A 1E62A 2LW7A 1Z8HA 2G9VA 4BNVA 3NHPA 5LM3A 3B85A 1X70A 4HLUA 2WSSA 2OVFA 1HNZB 1QK5A 2F7SA 2H18A 4AKGA 1HURA 4BJ6A 2D3WA 4MPDA 4QYIB 4M8SA 4Y6PA 3B1VA 2H63A 2NVWA 3F67A 2OZKA 3I9FA 3H2JA 4L75A 2YWCA 5J2UB 3IEIA 3QBJA 4S0XA 3S68A 2GBLA 4YQYA 3L06A 4A1GA 4IV5A 1RMQA 3T3NA 4QQFA 1OWPA 1XHEA 2JABA 4N3GA 2VSOA 3OOWA 4RY8A 5AHKA 3VYUB 2Q3DA 1P1FA 4CKCB 1W0KD 4F3YA 4JJGA 3THYA 4RKFA 3T3IA 1OT8A 5AXCA 2H3EA 3RKSA 3U3KA 4BWGA 4L28A 1K6IA 4MWZA 2FPKA 4KR9A 3HXEA 1ONOA 4CF7A 4PHFA 4A8PA 3L6RA 3H11B 4HLDA 2DVWA 4YR9A 2FUEA 4JXTA 2HHHB 2FW6A 3O2SB 2V0GA 3KP1A 4U9UA 1E8YA 4OUDA 1VE5A 2QTAA 4ARIA 1XWWA 3UTCA 1JN0A 2FXIA 1A5EA 5KVQA 3MGBA 4EELA 4O25A 5BUSA 2LXLA 5BYJA 1JJVA 4CJXA 3TLAA 2I87A 4GR4A 1JJIA 4GECA 2P2CP 4IL5A 2G3YA 5B58T 4GR5A 1KC3A 3BVPA 1KMQA 1NTRA 3CF0A 2PYZA 4F06A 4QPPA 3QNMA 2YIMA 1CKEA 2V8SE 1RAFA 4P83A 4EA6A 5I4CA 2EYUA 3FDIA 4MUKA 4ALLA 3A4NA 4R2LA 1QGYA 1PEAA 3LIIA 3PQ7A 4XJXA 2OOKA 3QVUA 4HL6A 4B82A 3RVKA 2HHLA 2FJUA 3PTZA 1I7SB 5IF3A 2SECE 2C4NA 4AJNA 1M1YB 5LQSA 1TKRA 4MUEA 1Z8FA 3HGTA 2OAGA 3UIEA 4QBHA 3NMUF 3CNNA 2CL0X 4DY4A 3T34A 4RQUA 3Q15C 1XK7A 5AN8A 4P5PA 3COVA 3O0TA 3O2NA 3F4KA 3ZHEB 1Q77A 2GB4A 2FX3A 2BTOA 5IAKA 5EJ9A 3P7MA 3SI5A 4WXPA 1EFTA 3AJ8A 4LISA 4CT5A 5FFMA 2W2KA 2LKDA 4YGYA 5EIFA 4JYZA 4IH9A 3OFND 1ZHFA 4X1IB 5DHQA 3D8UA 3DVLA 1K88A 3MKRA 3BK7A 2CEKA 5AVZA 4GSLA 5L45A 4HXGA 4PS7A 4KXKB 4EHHA 5AI0A 5EUMA 2OLJA 2ZE8A 3LLCA 2ODTX 5I9MA 3DP7A 3L4BC 3N76A 3QWVA 4YGXB 4H9GA 4JR2A 3AERB 3HM9A 1JECA 3TZQA 2ZG6A 1HWYA 2HIAA 4JI4B 3U7QB 3D2BA 4XQCA 2E3JA 3WYFA 4TRRA 3OT1A 3OSZA 5ER6A 3VM6A 4MKRA 2WQHA 1X86B 3DEOA 4B6QA 2GPSA 2VS1A 1Y8MA 1XJWA 4A2WA 1IUPA 3IIKA 2NYUA 3G9UA 2JFBA 3CT4A 1E3WA 2CVOA 4KVMA 3I2YX 1L6IA 3DA8A 3T9EA 4Q0MA 1BDJA 3R3UA 2Q1SA 5L4SA 4K03A 4U6QA 4EGSA 2C59A 3NB2A 4OJTA 4URWR 3ED1A 4EH1A 3FZQA 3R0VA 4QTUB 4JD2G 2A33A 2HCRA 3Q8KA 2GBCA 2CL5A 5EZYA 4E5KA 1W88B 1MB9A 2J5KA 2PX4A 2VWHA 2KHZA 3E2MA 2QAGC 2VYVA 4RLFA 3TSAA 1DADA 3ABQB 2VCEA 5IUNC 2D1TA 1PAUA 4V39A 5F73A 2JAPA 5E0KB 1KR2A 4CMIA 4AT1A 3ML9A 2CK3D 1CUFA 4X60A 2G1UA 2IY7A 2OV4A 1P5ZB 2DFTA 2JGFA 3V7WA 4FYIA 3UUFA 3U0VA 1K97A 3AUYA 3ORQA 3UANA 4G8DA 4OHYA 3H9EO 3WNQA 3V8VA 2OHFA 1W76A 2PH3A 3QOYA 4P33A 3ZWVA 1TK3A 1T9AA 5JZSA 2DZDA 3WTBA 4J0UA 4ZZ2A 1BXKA 2R05A 1NP7A 4RZ3A 1MC5A 2UZ3A 3W2EA 5IK2A 1NHGA 1I7QB 4XYEA 1U98A 2FN9A 4ANXA 2G8LA 4URHA 2YXBA 2HMWA 4WGGA 3W2GA 4WKOA 2R87A 1DAEA 1EHIA 1WY5A 3QBVA 3VISA 1CQXA 4TVBA 3IAS1 1ZB1A 2G1JA 4PS8A 3W6NA 3V1NA 3BJMA 3VPAA 3STHA 3CVVA 2WXOA 2ILRA 1NSFA 3G17A 1R5JA 2J3QA 3RVPA 4RVOA 2AIRA 3L5KA 4LY3A 3UUGA 4NPCA 1SKBA 4A7PA 1BXGA 1Z62A 1SZDA 1ODTC 1FNSA 4WASA 3NAWA 4PYMA 2Y0BA 1RYDA 5A3VA 4FMCF 1N3LA 4QATA 4WWPA 4G2VA 5EKTA 5FAKA 4AM8A 4P0PB 4PINA 2ZUBA 1VA5A 3FH5A 3GLIA 2H5LA 3Q3VA 2GA9A 1ST3A 3OZRA 4AX4A 4MCJA 1G64A 4PVDA 1KZYC 4Q9JA 1FQOA 1G9TA 1ADGA 3PGKA 2NZ8A 1GT6A 1P9WA 1WDTA 3HYCA 5FO1A 1U04A 5HYVA 3MT8A 4TKMA 2R6CA 3PEWA 3DO8A 1LQUA 1SXQA 4ACBA 3D9LA 3CO0S 1QVRA 2C98A 3TTWA 2X1LA 2C5AA 3KSMA 4TUYB 2OBBA 2QUAA 5FPYA 4P38A 5EQFA 5FA6A 1YACA 2YKGA 3BMOB 3A14A 1X8LA 2Z57A 2CF5A 2ZIEA 3JCKC 3I23A 2W48A 2XOKA 1H42A 1FP7A 1JPUA 5JNUA 3B8EA 3I4LA 1O97C 4YBRA 3E4CA 1BMFA 1PAQA 4JQCA 3AVOA 5IKMA 3CN7A 1VE3A 1CEEA 4JI3B 3A9TA 1PR5A 1B42A 4UTPA 1VKZA 3MGAA 1DAHA 4RNCA 3HYRA 2C2XA 1UBUS 2F67A 1E2PA 4XSGA 4GKBA 2QM0A 1AD2A 2V4UA 4D9KA 4OI2A 4JHKA 2QRHA 4D4KA 3OLYA 1QP7A 2ETAA 3EN0A 5U1PA 1VLQA 1ECFA 4I1AA 5BVHB 1OB5A 5CFLA 1W6RA 1YBFA 4NRDA 4WKNA 4RAOA 3K6RA 2MYNA 3B9BA 3HS3A 1KC1A 2YZKA 1CHNA 4IVQA 2OR3A 1BCRB 1VL2A 4JLVA 4NCJA 5EWJB 4OGKA 3BF8A 3S8EA 2AKEA 4H7PA 4A8JB 2RCNA 4O59O 3RNOA 4IOMA 1ZKDA 1RWKA 1MJGA 1W30A 3GLGB 4ZYTA 1RIIA 3BKXA 2Z5LA 5HF6A 3UAVA 3JRXA 4HDRA 1SO8A 2FUG1 1PZXA 4TRQA 1XMXA 2PU5A 3NKFA 1SHZA 2EF1A 4G67A 3FYHA 3OE1A 2R48A 3D2AA 4HNHA 3B9PA 2ZAIA 3AQ4A 1K4KA 1EWVA 4PXYA 1NV8A 3FLMA 4RK7A 4R8LA 4R3WA 2QYHA 2JKZA 1H6AA 2IELA 3WL6A 2R1VA 1P4JA 1R66A 5FHQA 3KQYA 2P79A 3UJDA 1XCPA 1PK8A 4RPJA 1Z26A 1Z2OX 2WXQA 1JP7A 1AO3A 4LTDA 3PF9A 3IIMA 4DBLE 4NMLA 2BM9A 1FE8A 3EHNA 1C3LA 1X7GA 4LV8B 3BGIA 2KLBA 2XKBA 2EX4A 3OZBA 2VJMA 4BVHA 3K9BA 3MIZA 1WSBA 3Q7PA 5KC9A 5E6RB 4P22A 4MKIA 3CY6A 4PZAA 3GJTA 1VLJA 2EGHA 1EWYA 1LX6A 1COWD 4KXXA 3BH6A 3EVFA 2GAJA 1C3EA 5CB8A 4ZVNA 3ULKA 2VJLA 5JRDS 1AG9A 3LCMA 1GPUA 2PBLA 2WUGA 2AD5A 1N6RA 3ONEA 4E6PA 1O4VA 2PO7A 1UMDA 2PS9A 1L7NA 1TB4A 3SYKA 5GWXA 5JCJD 4LERA 3UOGA 5IM5A 2XMPA 3G7NA 1QYCA 1W3BA 4KL8S 4LG6A 4EKNB 1HF3A 5LBTA 2VGYA 5AQ7A 3U19A 1G4UR 1Y6ZA 3ANSA 1JSZA 3ZU5A 4FC7A 2AC7A 4GZCA 4R40A 3ADCA 2L0IA 5K0TA 3GLHE 3KVNA 4RK5A 1EFCA 1XXHB 1VXOA 3DDUA 4ML3A 1JAIA 4MROA 4GVPA 3DM5A 3IR5A 5LP6F 4I2VA 1NY6A 3NZEA 4UWKA 3GT4A 1U3FA 2ZYGA 1KRXA 1MMFB 5B3JC 5K8UA 2GW1A 3MT7A 2BMDA 2PSHA 2J6BA 4ID9A 3V1YA 3DKIA 3FU0A 3G1UA 4RJIA 1JU9A 2X0NA 1GUFA 1TW2A 2ZRLA 3H3XA 1WVGA 1A7AA 1E8WA 4ZCRA 5TVKA 2X9VA 1EGHA 2RSLA 2FNAA 1SXJE 4G5YA 2G71A 3UMRA 2GQ0A 4M1QA 3RJTA 1XZEA 3OQ1A 1I30A 1X9GA 4C7VA 2Y1CA 4XQGA 1ADBA 3V7YA 1Z0IA 4FYMA 2PY6A 1Z7GA 4IKOA 3UMBA 3EQ7A 2VJAA 5JS8A 4Q3NA 5EESA 1NZJA 3GEHA 1HDCA 5KHLB 1PKEA 3FAKA 2YX1A 3OHMA 3HUDA 3KEGA 2P65A 2H9IA 4YIKA 4R2MA 1MVLA 3M3HA 5DE3A 4LJ5A 1U5CA 2H2WA 2R7AA 3VDXA 2XVXA 2WPDD 3R76A 5KTRA 1JPJA 4F71A 2AW5A 2YJ3A 3C14C 3IUEA 2H7YA 2JD2A 1NXTA 4EPRA 3NWBA 1RWQA 2VAPA 4CQLB 1RP1A 2I9CA 4TKLA 2HA5A 1CQPA 1BA2A 4BVKA 1FYWA 3FGOA 2DLDA 4AYXA 1Q0HA 1VMAA 1XMOB 4A91A 4XWYA 1SCDA 2AJCA 3CKMA 1NE7A 1P80A 4YPOA 3CCCA 1GKKA 4JFRA 3V2IA 1MORA 2HLPA 3RG2A 1Y8AA 3E35A 1YOVB 3PDHA 1T8WA 5T57A 4PQFA 4H0FA 1O87A 1ZRNA 4K9NA 4DRXA 4TX1A 3W5JA 4C22A 3KOOA 2JI7A 4LI3X 1HORA 3MBKA 2DHRA 4LWQA 3WMFA 5JJ6A 1LEHA 3OA0A 2O7QA 2LV8A 1A2KC 1GU0A 3TGWA 3PRHA 4L76A 4B6SA 2Q6TA 4P4SA 5FADA 2J3HA 4RVUA 4FE7A 3VAYA 4L2IB 1CJBA 1NXOA 1CDEA 4G1BA 4QXAA 1ESZA 4EZJA 4DDWA 5H5JA 5FV7A 4EUEA 2P4QA 4BIMA 3OX2A 4H0CA 1XU9A 4OXIA 2V8BA 1FJGB 1PTKA 1TGVA 2J5XA 4ZXFA 3QE3A 3E1SA 3AV3A 1OE0A 3LPLA 3LDGA 2ES4A 5LZ9A 3LDFA 3ZU3A 2YRFA 4JB2A 4RIEA 1MXFA 4R2WA 5KVCA 3CEHA 4L7TA 3LDAA 2H7XA 4CLRB 1R0SA 2JGIA 4V3IA 4PTYA 1DMSA 1BFDA 2PA3A 1EDZA 2AC2A 3L46A 5FLKA 2RHMA 5BXOA 3ZJ5A 1XYYA 3H2ZA 2VHZA 3UCEA 2B99A 1VLVA 4Y6SA 4YCBA 3LX8A 4O2BB 4BFTA 4PRKA 3HNOA 4KWEA 2Q5QA 3HVHA 5JY1A 2AHOA 5BPPA 2JF0A 1XJ0A 3T6KA 3GBSA 1PNTA 2ZE6A 3GDGA 5ESDA 3PUWA 4EY6A 4JGGA 4QDZA 3RG8A 1H05A 1GW6A 3AFGA 3TZEA 4FOPA 1J0EA 4J4HA 1KA9H 2W6ID 1E32A 1BH2A 4IP0A 1DKPA 4HFJA 4JUBA 2YHSA 3RRJA 1DIBA 1EFAA 1GLNA 4DV0B 1ISMA 1U7XA 3KSUA 4ZTUB 1ZKMA 4Q9AA 1JFVA 2JAUA 2XQ0A 2VP4A 5T7BA 3NDBB 4Q5IA 3NNDA 1CF4A 1LRKA 3PRKE 1RWPA 1NX6A 4EJ6A 3BFVA 4X6UA 5BW5A 4YLGA 1NW9B 3NXKA 1MHPA 3TG5A 3PE6A 4A0SA 2J30A 5JH7A 1Q3HA 4GPAA 1YBMA 2OAEA 2WTBA 4FDUA 1YO6A 1U8TA 3VJRA 3EXEA 3COPA 4ARVA 4B7XA 1YFZA 4JI5B 4KN8A 3U9TA 421PA 2X3FA 2DPXA 3OMXA 1W7AA 2O1WA 2KM1A 4TRNA 1BO6A 4ZAXA 3OPVA 2XD9A 4BO2A 4KMSA 2BV3A 1W4BA 3W1WA 1FXWF 3OWOA 1CNMA 2VPWA 1RADA 3JUIA 4EZBA 3PUVA 2VTEA 2E4WA 3EXFB 4FW8A 3RVRA 5L7TA 3LUAA 2Q2NA 4RA6B 5CYFA 2QGFA 3BG5A 4LYJA 4MVJD 1R6UA 2OFXA 5F3WB 1H2UA 4QG7A 1DAOA 1SKYE 1TC1A 4UHEA 3GLKA 4J76A 3SX2A 3OJWA 3A28A 1A9ZA 4OJMX 1SB9A 4G97A 5DB4A 1U2GC 3Q1LA 3EIQA 3AJIA 3B5EA 3K1AA 4HB2A 4OBWA 3ZH9B 3AKZA 4DLXA 1LBQA 3LWDA 3GNTA 4GX0A 3HKDB 2XEEA 1YNOA 3A1TA 3PR3A 4JXZA 1NURA 3DLIA 1CT9A 3GZNA 1TTTA 3KEMA 5GZ6A 3SHQA 1EE1A 1Y7HA 3FPJA 1SVOA 1ZRSA 5CBPB 1EH5A 1TGYA 3WK7A 1RZ4A 1KWGA 3MGGA 3ADOA 3IDOA 4M4SA 5EQJB 1IHUA 3KPVA 3T61A 1UJMA 3SSOA 2G5PA 2TYSB 3GPDG 2JGDB 2JG3A 2GKOA 2CMKA 5T64A 3OPMA 1P7PA 4JLDA 4UUPA 2CKMA 1C4XA 3PLAE 4Z4FA 2JGKA 3RGWS 3O73A 3IP7A 3P2OA 4I9FA 2ZTUA 3C43A 5TS2A 4MVJF 4ZYYA 2WOOA 3DTVA 1C1DA 2YN4A 2D2EA 4ZVVA 1K27A 4ENVA 3RRNA 3A7DA 1OMOA 4FS3A 2G9NA 1ST2A 1Z2PX 4IDFA 4FADA 4JBGA 1XT6A 4AZVA 1S8AA 4V0RA 1JJBA 3COZA 5NLLA 4KYTA 3R0QA 4EHNA 3UT5B 4CLEA 3MRTA 2GK4A 1PDOA 2NM0A 2IHTA 3CLTC 2JVKA 2SNIE 5H7PA 1JQEA 4UWHA 1LPSA 1SEVA 1C0KA 3FF4A 2M32A 5JFOA 3O3MB 2QXYA 2BJHA 5KWIA 1JCRA 2FPIA 2EP5A 4Y2GA 4HI8A 3GUHA 4Q3DA 1HU3A 5F77A 1BD4A 4HNAA 5FAXA 3V30A 5D5HA 5J4LA 2LXMA 4GOKA 4IS3A 1RZRA 2DBYA 1ZONA 3F3MA 4FMCB 2FZ4A 2IYLD 1JHQA 5DSZA 2O23A 1Y4ZA 5AJTA 1O5MA 2WA1A 4O5AA 1D8DA 4B6RA 2RCYA 3IPXA 4D8TA 4FB5A 1B7GO 4ZVTA 2GTPA 1G2QA 4DYVA 4MGKR 4BQRA 3FTPA 3U7RA 3BMCB 2PZLA 3MWLA 4X0EA 2QN9A 1MT3A 2BF7A 2ECFA 4YCDA 4IG4A 1B8VA 4KW7A 3WVNA 2X41A 4HBDA 2LPMA 1VYVA 2ZU0C 1DBVO 3ANTA 3K72B 3T1YB 2QUKA 3GI1A 4HQFA 1DC6A 4IIVA 4YRFA 2OHJA 4KIFA 2WJGA 4JB8P 4YB8A 1N75A 3LPCA 4L2YA 1HH8A 4F1KA 1LF8A 3KXKA 3QPUA 5ALZA 1DARA 1XVIA 3EDCA 3RUIA 1H5UA