2XGOA

Xcogt in complex with udp-s-glcnac
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
548
structure length
548
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 203
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgoA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgoA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgoA02
3MS7A 4EQFA 4I17A 2V5FA 5DXFA 2KATA 4CTNA 3OXGA 2AW3A 1HH8A 3OTHA 2GEJA 1NVKA 2KS6A 4ME2A 2IEIA 4KQ2A 4PQGA 2F3QA 1QKJA 3HBJA 3CUVA 4YUAA 1Y8MA 1XKXA 4MI3A 3BCUA 1SXQA 1IIRA 3SF4A 2PYIA 4LDPA 2XMPA 3PDNA 4Z5XA 5G04C 3LPZA 5G05J 2BGUA 3GYZA 4NEQA 2XPIA 4GYOA 2QRGA 3CK9A 2IYFA 4J8FA 3EBOA 4GPBA 1V4VA 1ZBPA 2F3SA 2G9VA 3URZA 4N5CA 3AS4A 2YQ8A 4N3BA 2VSNA 2HR2A 4KQMA 2GEKA 3MEKA 4NESA 3NF1A 2MHKA 1FU4A 1P2BA 3D1JA 3VTXA 3OKCA 1L5VA 1OUVA 5TMBA 3GZ2A 2FFRA 2XA2A 3GPBA 3U3WA 2JJMA 1JIUA 4G25A 5D00A 2ATIA 3TG5A 1AXRA 4W9RA 2VCEA 3BCSA 1AHPA 3QOUA 2YJNA 5FT9A 2PQNA 2VGYA 1XV5A 1NZDA 3S27A 1HLFA 3OXFA 4EKYA 3T3DA 1P4GA 1WW2A 2QN1A 1WV1A 1GPYA 3FP3A 1GGNA 2WTXA 3G2HA 4UI9K 3Q3HA 3ASGA 5D0QD 3OXLA 2QLNA 3QWVA 3Q3EA 2BGTA 3MRTA 3Q47B 3WC4A 1NLMA 3DZCA 2KC7A 7GPBA 1L5QA 5EKQD 4MRAA 4FKZA 3QWPA 3JYSA 1NOIA 5D01A 3IAAA 3CVLA 1RZUA 3CV3A 4KQ1A 5FZSA 1FU7A 1HXIA 2HYZA 4YVQC 1YA0A 5JTUA 4U0SA 3VTYA 5JJ7A 1B4DA 4RBNA 2OOEA 3G2LA 2YHCA 4HOSA 5LQDA 3L01A 3NP7A 4RIFA 2P58C 3MS4A 3ZCVA 4UI9J 4KBQA 1NA3A 3RSCA 2ONDA 4YNDA 1PC2A 2QN7A 1GFZA 3D0RA 2PZIA 3EDTB 2R66A 3C48A 3OY2A 4WNFA 4G23A 3G2IA 3RJVA 1KLXA 3CX4A 2VCHA 3MV3B 3T7DA 4UQYA 2PQ6A 3LY8A 1WUYA 4HOQA 2SKEA 4LEUA 3BD6A 3T3HA 3RO3A 3AMVA 2SKCA 1WM5A 3MKRA 3CEQA 1WAO1 3FWVA 3CEMA 3GUHA 5KJMA 3G2JA 2IEGA 4N2SA 3HBNA 1WW3A 3BDAA 1JEJA 2QRPA 2FETA 2VGXB 2QZSA 4U07A 5A7DB 2FBNA 4G24A 5HQ8A 3TGOA 3U4TA 4N9WA 1FTWA 4J0UA 2VSYA 4UQZA 1F6DA 2IYAA 2AZDA 2QN9A 2GM9A 2R5SA 4CDRA 5BW8C 4AY5A 4G1TA 1HZ4A 3SYMA 4WHMA 3UYKA 3L7AA 5TMDA 2XCUA 4HOTA 3Q5MA 2PRIA 2PL2A 3GZ1A 1PYGA 2QN2A 1E1YA 1E4OA 3NC4A 1P2DA 2C4MA 4FZRA 4I2ZA 2QLMA 3T3GA 3ZCUA 4M60A 1JIXA 3Q15A 4BQFA 1NZFA 1TJCA 2GW1A 4MHOA 5KJKA 1P4JA 1BX3A 3KD7A 1IYGA 1L5SA 4GCNA 5KJNA 3CEHA 2JLBA 4MI6A 2IFUA 3T3IA 3T5TA 3VUFA 3GW4A 3R9AB 3S7JA 2KCVA 2GPNA 3CV0A 3ZCRA 1Y6GA 4L22A 3CKCA 3BEOA 3FFLA 5IKPA 4NQ0A 3VUEA 4F96A 3RHZA 1PN3A 3ZCTA 3ASDA 4W6QA 4RIIA 5HI7A 3IA7A 1QM5A 1A8IA 2XEVA 3MA5A 4U04A 3MSCA 4MHSA 1KT0A 2FO7A 2H1HA 3ULQA 3RSZA 5M72A 1GPBA 4HOUA 1H5UA 3UPVA 3ZFWA 4WNDA 3S28A 2XGMA 4BWRA 5ARGA 5D0OD 4MICA 5FZRA 4X7MA 3LY7A 1C8LA 2X6QA 1C50A 4RG6A 3AS8A 4XIFA 5JJTA 5KJLA 2AVPA 3BD8A 3C4VA 3MBOA 1KT1A 1UZUA 2NC9A 4HLNA 8GPBA 2IV7A 4J8EA 3SYRA 4EKEA 1Z6PA 3Q4AB 2ZB2A 4EL0A 5C1DA 2C0MA 3ZHEA 5EX3A 2HY7A 3NCHA 4BT9A 1FC0A 2C2LA 2PQRA 2LNIA 2C0LA 2OFFA 4I1AA 5G04J 3CVPA 3VDNB 2XGSA 3LKUA 1O6CA 1L5RA 4CGVA 1GPAA 4ABNA 3MT8A 1Y6FA 1QQEA 1RZVA 3OKAA 5EX0A 2QLLA 3CVQA 1W3BA 3S0JA 4GZ5A 1L7XA 2E2EA 3ZCPA 1Z8DA 3QDNA 3MS2A 5TVGA 1QZ2A 3RIBA 3C4QA 2BFWA 1EM6A 2R60A 2GPAA 4NC9A 3L7BA 3TOVA 3E4BA 2ACWA 2G9QA 4CTOA 1Z6QA 1FA9A 1FTQA 1ABBA 5LCWJ 3S7FA 3SZ7A 1XC7A 4N3CA 2QRQA 4YI5A 3ASFA 4RENA 4F9FA 2LSVA 3O48A 2AV6A 5BT1A 3DDWA 4EL5A 4RIGA 2UY1A 3OTIA 3QWWA 1L5WA 1ELWA 2VG8A 3BCRA 3COPA 1C3JA 2IF4A 4X7RA 4GZ3A 4BT8A 4WNGA 1Z62A 4U0ZA 4I9CA 1P5QA 1L6IA 4H7XA 2G9RA 4RIEA 4YI3A 1C8KA 3LY9A 1K06A 1A17A 3H4IA 5ENZA 4GCOA 4CGWA 3CEJA 2FI7A 1UQUA 4RG9A 4N39A 3FROA 4NRHB 1FCHA 2XA1A 4UQXA 3WAGA 1NOJA 2FEZA 2BISA 4HWGA 3L7CA 4M7PA 4HORA 3ZN3A 1XL1A 1FU8A 2G9UA 1UQTA 4BTBA 3WXXA 1VGVA 3MRXA 3N71A 3L79A 4GA1A 3S7DA 3D0QA 1LWNA 3NAZA 5CCLA 4WUYA 5FZQA 1KTIA 2XCIA 3L7DA 4WNEA 4UI9C 3RO2A 2QFCA 2X0EA 3E3LA 5AYWD 6GPBA 4JA9A 4BQEA 4O6FA 4RIHA 2PRJA 4G2VA 1JG6A 3OTGA 2KCLA 2X0DA 4QLBA 3MV2B 3ZHEB 3CUUA 4YVOA 3ASHA 4X6LA 2ASVA 4WACA 1GG8A 4G2TA 4BTAA 3MT7A 3Q3IA 2XGOA 1P29A 4BFCA 1F0KA 5FJYA 5FTPA 3G2NA 3MTAA 3OKPA 3S29A 3CK7A 3ZPJA 2JZCA 5TMEA 3HBFA 5LCWC 2GT1A 4I2WA 3HBMA 5GPBA 3ESKA 4JA7A 5CHEE 3AS5A 1FTYA 3CVNA 2QRHA 2VYIA 2I6HA 1NZNA 2Y4UA 1ZU2A 3DD1A 5DLDA 4GPKA 1PNVA 3H4TA 1K08A 2P6PA 1IXYA 3QHPA 1M5RA 2UY1B 1JIVA 2ECPA 2X0FA 3VDMA 3DDSA 4AN4A 2LSUA 2QNBA 3S7BA 3UQ3A 4CTMA 4F97A 3ZCQA 2XCBA 2XCCA 3OY7A 3TG4A 2R4UA 3CUYA 2AMVA 1XL0A 3LCAA 4APOA 3CUTA 3UYLA 1IHGA 4GYWA 3ZCSA 5A6CA 3TAXA 2J9QA 4N3AA 4GYYA 2F9FA 3T3EA 2Y4TA 1PSWA 3IEGA 2GPBA 5ARFA 2IW1A 5DIZA 2QRMA 4GA0A 3QKYA 2R4TA 5JTTA 2C1ZA 3WADA 4MI9A 4AMGA 1ELRA 3NB0A 2Q7FA 4EJ2A 5HXAA 3RKVA 4WADA 5JJ6A 3BEEA 3RU0A 3CUWA 2XA9A 4REMA 2F3UA 3PE4A 2QN8A 2Q6VA 2WQHA 3MT9A 4F3VA 4G26A 4I9EA 1B89A 2KCKA 3QKWA 4U0UA 2F3PA 2WPVA 2BUGA 1P4HA 4RELA 1GZ5A 2IV3A 3Q49B 5DU2A 3MRVA 2UWJG 2X6RA 2C9ZA 1P2GA 3G2KA 4GA2A 4KXKB 4A1SA 3TSAA 2QN3A 2IUYA 1WV0A 3CK8A 3E3NA 3MTBA 5IKOA 4AIFA 3K9IA 5CCMA 1NA0A 3NP9A 2HO1A 4LEIA 2DBAA 4J8DA 1YGPA 1WUTA 3MTDA 4AMBA 3O3CA 4JHRA 1FS4A 3KAEA 2VGXA 1NOKA 3KS2A 3MQFA 4IN3B 4KYOB 3UUXA 3ZGQA 1LWOA 1RRVA 1XOIA 5BNWA 1XNFA 4M83A 2PYDA 5G05C 3OT5A 1EXVA 2ACVA 3E3OA 2GJ4A 4Y6WA 2SKDA 2H1FA 4N2QA 3CKBA 3PE3A 1J39A 3BD7A 3HYMB 5I45A 1Y8ZA 3RT1A 4AY6A 2O6LA 3LYAA 4JL0A 5DBKA 4Y6CA 3NPAA 4XI9A 3S2UA 4AM9A 3EBPA 1SXPA 2VQ2A 2FF4A 4B94A 4X7PA 4XI0A 9GPBA 1E96B 1YA6A 4GZ6A 2FF5A 4H7YA 2C1XA 1JG7A 2L6JA 2R68A 4BQIA
chains in the Genus database with same CATH superfamily
1F3OA 2IFTA 2Q1XA 1WEHA 1P1HA 3QU7A 5CEAA 1F2UA 3OJOA 4DY4A 2QUJA 3MJFA 4DHEA 2VTVA 2AW3A 3KP1A 2H18A 3KAKA 1UXIA 4GZDA 1MEEA 2BFEB 2CFIA 1VKOA 2PK3A 5AVKA 2YC4C 2AYYA 5AW6A 1Y8ZA 3G2UA 5TGDA 1E0SA 1QKJA 4NZYA 5G41A 3QMMA 1WHSB 5G02A 2EFCB 2RG8A 1F12A 3IVGA 5KZMB 4I43A 1NT2A 3ELWA 4UU7A 3WJAA 1FFSA 3LCJA 5C7YA 4D9BA 4P32A 2ZT6A 3U4QB 1VMDA 2Y1KA 5LZ8A 3DA8A 3S2ZA 4JJ7A 4B81A 1P81A 3ZWQA 4N3BA 3O95A 1NX9A 2XB6A 2RSLA 5HUHA 2O19A 4FHEA 2FOIA 4MCIA 4BMXA 5HE9A 2FSVA 4JOSA 3A4NA 1JBEA 4BN0A 1W581 4FP7A 5A2QA 3R44A 1ACLA 5HNKA 3ZEIA 2LDXA 1TK9A 1T5SA 3QXHA 3GPBA 4UE6A 4YCSA 3DE0X 5TPWB 4H6VA 5FWDA 3UHAA 3L17A 3IVAA 1SWWA 1PNQA 2DPYA 3F5MA 4XIJA 2QROA 2WYUA 2OBLA 4BECA 2PKQP 1IZ0A 3S2YA 3TG5A 2VCEA 1I14A 1TM7E 3NW9A 5ADVA 3DEIA 1VP3A 1P1IA 1L5YA 2A58A 1EUCA 2DE0X 5J5VA 4FTWA 3K0FA 5KPDA 2DFVA 3O4GA 1K63A 3USZA 2DUWA 4V02A 2A35A 4CHTA 3SZUA 3RIMA 3DCYA 4ROTA 3DBRA 4F12A 1EFDN 2UVPB 1GUBA 3PWKA 1O2DA 3JQ9C 5LQUA 4AJIA 4UI9K 1RI4A 2GVDC 1I7NA 2DFTA 4ANVA 3GROA 5KCMA 1FZTA 3DZCA 3UPTA 3IEXA 4LXYA 4UU8A 4D2IA 2JAOA 3IHVA 1U5AA 2FZGA 2C2ZA 4MRAA 1SD1A 2C5BA 1X92A 3FRIA 3RR2A 3TLAA 4WEQA 3JYSA 5L45A 1N25A 1H4VB 1YC2A 5AOCA 4JLOA 3BPSA 2YNQA 3OEEA 2J3KA 5AM1A 3V4FA 3W04A 3W0LB 4YB8A 4E0BA 5C32A 1A4IA 4NNPA 4J75A 1CJUC 4P36A 5AVZA 3LDHA 5HQ3B 4HOSA 5AENA 1XAJA 1VLLA 1WCIB 3W7AA 1M10A 3S2SA 2IV2X 4DCJA 4IRUA 5KYYA 1P62B 5I7UA 3RNLA 4YMGA 4RTSA 1IXZA 1Y6RA 4KBQA 4FDUA 4PYJA 4KT6B 1G6OA 1H93A 4K8RB 4BJHB 4UM5A 3Q7SA 4KFCA 2QT9A 1G8HA 1JU4A 3RROA 5HKKD 2WTEA 4ZZ2A 3ENWA 4G8JA 5DRYA 4A3SA 2WSSA 4GMXA 3EEYA 1II9A 3FKQA 4UDXX 2XMCA 3HRHA 3LBYA 3RYHB 4E6PA 4CKCB 3KDAA 2ZT5A 4G37A 2ZDGA 3A1CA 4C0LA 1DRVA 3DUWA 3GFFA 3IBTA 2SBTA 5CTJA 7REQB 4L4RA 3RRMB 1T34A 3G0DA 4XVQA 1HM5A 1LA2A 4I0WB 3RYIA 3LH5A 1BXGB 4B3RB 4RJIA 1K4MA 5YASA 3BTOA 1TX4B 3BWBA 3ZQ6A 1R66A 3OZUA 2WJJA 5JXWA 4HLQB 3G9TA 4IUBS 1A7KA 2X0RA 4OHVA 4RVGA 4WA8A 2R7LA 2FPKA 4YJHB 2R25B 2Y1XA 2E3JA 2I91A 4GMJA 2BN4A 4MUYA 3H75A 1U4OA 4K05A 1IAVA 3WGLA 3I8OA 2H2HA 3CLTD 1P0MA 3PKJA 1PD1A 4KLZA 2FMKA 3BIJA 1O03A 1TNYA 2R8EA 3F6BX 5DNVA 4CIYA 3HXKA 3WQSB 1ES9A 2CB0A 1GFSA 5LNK1 3NIGB 1OXTA 2LVBA 3QF7A 2P4EA 3T9FA 1J20A 2E37A 3U4AA 4NOJA 3AEUA 2ZUVA 5CW1A 1H2BA 3D4BA 3G1UA 3OOYA 4N9WA 4JUFA 1CEYA 5I9LA 1CUAA 3BGVA 2VSYA 3I6YA 3ZIDA 3IEMA 4QECA 2ES4A 2X0IA 4R40A 1B0UA 4PHCA 1Z9BA 2R5SA 1ZW6A 4Y18A 2VYNA 4UEOA 5K8JB 2R1VA 3G7NA 2EBFX 5AESA 2QXUA 1XTIA 2HA6A 2W2PA 4H17A 4DV4B 4ZKEA 3W77A 3MJWA 1BVUA 3GZ1A 1E3SA 2X4LA 5JNSA 1LTQA 4O2AF 1X8XA 1Q84A 1R00A 3GLIA 4IGFA 2VHJA 1MAHA 5DBOA 16PKA 1B6SA 2FE4A 1E7QA 2QTHA 2JI6A 1Z2EA 3EARA 5EJ5A 5HQTA 2CXTA 5ECGC 5EKTA 4NURA 1W36C 2XBMA 4DX1A 1P4JA 2NTVA 3V2OA 2AJBA 4N0EA 2QA5A 4QXPA 3EQ2A 3FWPA 2DYSE 4YP7A 3MYVA 4Z7NB 1Y6IA 4OU5A 2X9GA 4YLGA 1T9ZA 1GDHA 1RP1A 1UKCA 1GNRA 2AFIE 1VSQA 3I72A 3VTAA 1CFJA 1ZAKA 5MFZA 2VDWB 1RXEA 2P4QA 3A1WA 2POQX 1DTEA 3SEAA 3IUPA 3UHJA 3ONDA 3ZLBA 2HUNA 2PN1A 3B6EA 3NOXA 3HLYA 4I9UA 4MLPA 2P3QA 3KXLA 4FDMA 4M0KA 3O91A 3HSKA 2X3MA 2O3QA 4QBIA 3U80A 4M99A 1N7JA 5AJHA 3VPAA 2QRNA 1ZNQO 1WMFA 3QJ5A 5JJKA 4WWNA 1UEXC 1FLNA 4I8XA 3UXYA 4A0HA 1WJGA 3VLEA 3ZKAA 1KPSB 5JAHA 2UUOA 1H5QA 1KT0A 3UCXA 3ULQA 1L7DA 1H5UA 2BUAA 3PDJA 3UPVA 2ADOA 4JUAA 2ZTUA 4EAAA 4QSHA 1IN1A 2REOA 4A63B 2Z4RA 3NXKA 4DQDA 1JFFA 1NU6A 4BZZA 4Z0NA 5EAIA 2CVHA 3LVRE 3G1TA 1W76A 1W49A 2Q45A 2I7CA 3GLKA 4I3HA 3BRSA 1OAOA 1HZJA 1W96A 2D7CA 2A59A 3D2AA 4J03A 4DIUA 1NHGA 1V9SA 3SBTB 5KJEA 1DFIA 1W36B 3IBYA 3NBMA 4QGBA 4YBZA 4CR7A 3U4DA 5LQKA 2ZJAA 4TZ0A 1VMEA 4CCWA 4AF7A 2WDZA 4R51A 3R7WA 3WKEA 3AOGA 8GPBA 1UEJA 3GJ4A 2OO5A 1QHEA 3PENA 4K9KA 1FFXA 4TSFA 1Z7EA 1R0YA 2EU8A 3Q4AB 4J2OA 5AR1A 2Q7DA 1R5JA 3DM5A 3EVBA 1KI4A 1YHZA 2GN0A 2QG6A 2J1LA 5EX3A 5LFAA 1G4HA 4OAUC 2YHUA 4YALA 8LDHA 1EK5A 1QX3A 4JY7A 1U2ZA 3COSA 5TQ0A 4BFLA 4G9EA 5BQ3A 4W7HA 3DEFA 4LOAA 3T7EA 2VH5R 3E9DA 4JB2A 4MQLA 3SOZA 3GDFA 1GHTA 3U7RA 4F9GA 3GNTA 2OCGA 3PFKA 5TMPA 1DGQA 3ZD8A 1PFGA 4FZVA 1HE1C 3TNJA 1Q0ZA 4JJGA 1YJBA 3VAAA 4C4RA 2QKYA 1U4NA 4U6SA 1WBDA 5BP7A 4L2IB 1D2AA 3G8AA 4WK4B 4JH0A 5EE0A 1C1XA 4PVCA 1ZZEA 2O7SA 5K4GA 5L6LB 4KG7A 5F1KA 1PJ3A 2VWQA 5C8YF 2J9ZB 1CQZA 2VP0A 1AXEA 3DDCA 4AUKA 2VDRB 1H8HA 3SX0A 5GV7A 4QYSA 3L7BA 3ICCA 3D6FA 3NORA 3PX7A 4N5QA 1DSSG 1G17A 1A5EA 4P4LA 4G5SA 2CK3A 3KB6A 4CNBA 1ZCJA 1EXMA 3EH1A 1E2KA 1MF7A 3IDAA 2W11A 3U13A 3BQ9A 4BO8A 4ZAVA 5BOSB 2QRQA 3WNZA 1U8EA 3T61A 1V2HE 3IXEA 4F9FA 2NUPA 5A4JA 4JU9A 1I80A 4ARIA 1U5BA 3UM0A 4OX9Y 1LTKA 4MAFA 2DB3A 4NJMB 1V4BA 4G11A 3DZJA 4WA7A 5BSUA 2DHQA 1ELWA 2CJWB 2VG8A 1Z8HA 1I5OA 2WWFA 3E6AA 3R0IA 4Y6SA 2Q7OE 4RTQA 2VXBA 5IY5E 4NDNE 4ADSG 3E2MA 4BMZA 2R48A 2VGEA 1G8AA 2JCXA 4GZ3A 2CGEA 1P80A 2CXUA 5AN8A 4BEPA 2NLOA 2XHEA 2RI6A 3PEUA 3NYRA 4O4JA 4V2UA 1Y9JA 1Y8QA 3QI2A 1K2WA 4TTAA 2JPDA 1HWYA 1UMBB 4ZYYA 4WY5A 4JYBA 1BW9B 2PA3A 3N0VA 3QJZA 1IZYA 4MKZA 4W9NA 3IKVA 4KR0A 3NRJA 2OYRA 3LL4A 3FFBA 1T4BA 2FEZA 2R751 2BDTA 1QNLA 5BR7A 4IOJA 1HG5A 3HCDA 2IY7A 4MWOA 5JEEA 1PAQA 1TC1A 1XLVA 5EHQA 1TB4A 3NFYA 2QE6A 5FLEX 4NYMQ 2VN8A 1X6VA 2ST1A 3HKCA 5CX4A 2IQCA 1II8A 1PBTA 1V6SA 1GITA 2QQFA 3FSGD 1H42A 1DAPA 3FTDA 2BZ1A 2XXAB 1FMTA 4WN9B 4AJPA 4NH0A 1A88A 3AY0A 3RRJA 3WL5A 3K1AA 2BEUA 2GF0A 4WUYA 3RQSA 2IH2A 3VZBA 3ICWA 2PTGA 2QUHA 4JXKA 3ACCA 1RZ3A 1YB5A 1YE8A 3ZWOA 4WPGA 1GL3A 1WLSA 1TL7C 1YZLA 2JJ2D 3LJ3A 4L7VA 1YHYA 2H1RA 2PT5A 1RR6A 1AN9A 1MXFA 1U5CA 3R5JA 2PRJA 1MC4A 2QQ5A 3OTGA 2WWXA 5CG1A 1FFYA 4NBNA 3GGJA 3ETGA 3ZIAD 3I6ZA 4PAMA 3ORRA 4DGQA 4W5OA 3ZBTA 2X0KA 1O6GA 3AF2A 1QZTA 3KXIA 3CWCA 3ASHA 4X6LA 1MFZA 1HG1A 4HDRA 1FFAA 5LOZA 3L84A 3RC1A 2GXUA 3FUUA 2ZBFA 4O4LB 1E9FA 3PBKA 5G3ZA 3IOMA 4H9GA 3I30X 4QRDA 3ZPJA 2WMOB 4KN8A 4CMGA 3IJ5A 4B7ZA 3CE6A 3TWSA 2GZ1A 2C5AA 3OPQA 4HAWA 3GLFB 5L51A 5B1AE 4PIMA 5BR4A 2H52A 2X15A 4CCYB 1WY7A 3EW9A 3I9JA 4ZOLA 4UWFA 3DH0A 1SVWA 2P8SA 3IHWA 3V31A 3WGTA 4CKBA 1JPLA 1GRNA 1LS1A 4Q21A 1CNEA 3RYFA 5U9CA 3DD1A 3CH5A 4HTAA 4PRKA 5JFTA 1JSZA 1U80A 4I5FA 1W0KA 2J9FB 1DXQA 5C52B 1N6RA 3WGYA 2QAGA 3DSWA 3FI0A 4BNUA 1Q7BA 1C7FA 1J07A 1ECPA 3JR3A 4DMGA 5CCXA 2RGXA 5I9TA 1TO6A 2XNHA 4E15A 1RHQA 2ZS9A 3H8VA 3WB1A 4KPYA 1CDZA 3D9LA 3U64A 5KCZA 3NRBA 5FULA 2WM3A 1MBZA 1PZEA 4O2AA 1FJHA 1ULAA 1ISSA 2E4AA 2FQXA 4TLCA 4TROA 4UBNA 3E37A 4ARCA 3A7DA 3ZCQA 3PNKA 1QU3A 1PDVA 1VJDA 2L18A 2R4UA 2TYSB 2FF7A 3O2QB 4TYWA 1FRZA 1YACA 2KBFA 1G6Q1 1FK8A 1P1FA 4IBOA 1NW7A 3RUEA 2EFGA 2Y1LA 4S1WA 2WIDA 4WFKA 2VAWA 3D9MA 1JYSA 4F4CA 3WDLA 1KOJA 1WB9A 3CHMA 3QVUA 3GCDA 4IJKA 3UXMA 1T2UA 1VPVA 3QU2A 3WRXC 4RK7A 4WBNB 1P0QA 1KS9A 3ZIAA 2F7SA 1UJ5A 1OAKA 1HXHA 2P5SA 3A70A 3EVNA 4EG3A 5SY6A 1Q1GA 2FG5A 2PLWA 2FLKA 2VFAA 2BOVA 3OHPA 4FNOA 4EG7A 3BEEA 2A0XA 5KX5B 4DXHA 2IOQA 4D8WA 1DAHA 2DFNA 1BHSA 2ZPAA 4ZIRB 3AESB 2G17A 2FRXA 4G0PA 1S9HA 5K6AA 2W9XA 2EERA 2ZIXB 4IEIA 1K75A 3AERA 2QBYA 3JPYA 1T0UA 3A4TA 3C3OA 5I48A 5KVVA 3IVCA 2J5BA 3FYTA 4LNUA 4U7DA 2R1ZA 2QBYB 3R9WA 5AI0A 2WG2A 1OU4A 1EP9A 4UQPA 4QOFA 2NU9A 2ZJ2A 5KS2A 5C1IA 3LWNA 1PFQA 2ANBA 3N0RA 3IKJA 4URFA 1CYDA 3FUEA 2WHYA 3ZE9A 1C1DB 4XRGA 4TYYA 4KN5A 5LA6A 1Z18A 3NASA 2XUIA 5J63A 3V9AA 5AVTA 4JDUA 1KDZA 4HYYA 2W2KB 2ZTHA 3GOHA 4DNPA 4D3ZA 1KZPA 3B6JA 4J8DA 4U95D 1YGPA 2NO1A 2B82A 2FQQA 1VDMA 3D4OA 3RC7A 3URMA 1NMXA 1Y7PA 1ZOOA 1T8SA 1CC1S 3T0IA 2WYHA 4JROA 3K9LA 4WCFB 4CUKA 5IJ0A 1V5EA 3WGOA 3SK0A 3BMCA 3OT1B 2GN6A 3TIXB 2FEAA 3NNSA 4EYEA 2PYDA 3JS5A 1K9VF 2XT0A 2CUZA 3PFNA 1TN6A 2Y0BA 4OAVB 1UZAA 3L1KA 5AHKA 3PI7A 4UARA 2P5YA 4MPJA 1WVGA 3QOYA 3VSAA 1T9BA 3NIWA 1XTRA 4ZO8A 5ESRA 4B2PA 3DZKA 2J31A 4MW0A 1OV4A 4P5EA 4CMAA 2WXGA 2HJRA 3CX7A 2OXIA 3CUEF 3EW7A 4GX5A 3QYPA 3IPAA 2O0LA 3EIUA 3CXUA 4ZGBA 1HX7A 2FRDA 4YDEA 3EFOB 1XCGB 4EHIA 4WMLA 5JVDF 4JYAB 2YMPA 3H18A 5A3RA 1MT0A 1SKUA 4ZI5A 2AOUB 2QY6A 3KJNA 4ACLA 2B4RO 3EIHA 2G9ZA 2VZ8A 3N2KB 5BYBA 3WKAA 5A4KA 4DR6B 4FFVA 1R9JA 2JI8A 2BFBB 3K09A 1S3FA 3TR5A 2KHZA 4ZOLB 1L8QA 4CCYA 1WAMA 2Z0MA 2YNMC 1RTTA 3PCRB 1N6PA 4C5BA 3DYVA 1S8FA 3ND8A 4E07A 1U3UA 5LP6A 4RX1A 1ZN8A 3U6BA 1GZDA 3GY0A 3H2JA 5AICA 1VBNA 1ZSNA 5EWJA 4Z0HO 5DTJA 1TAGA 3VH2A 4B2YA 1VCIA 2WJHA 3EFHA 4AT1A 3U0BA 1HBJA 1KU0A 4QE3A 1E4YA 1T5LA 3AF4A 1F48A 4MRMA 3UNXA 1AS3A 1VI6A 4NMXB 1QH1B 3WGMA 1J5EB 3EUVA 1BN7A 1WKVA 3R9XB 2IZ0A 2D6FA 3D4NA 3H3JA 3SF4A 1JDTA 2DPGA 3LC0A 3EGDA 3G0HA 1YVEI 2A5JA 5FLYA 2Q0SA 2O3SA 3PGVA 4EDHA 2IBTA 3U2QA 4RESA 5I9IA 2EJVA 3FPHA 1THZA 4LOHA 1L7VC 3RVMA 1J9GA 2E85A 1G21E 2I1JA 3H16A 4H0CA 2P77A 2PS9A 4RMHA 3LO8A 2XXAA 3LCVB 1P2BA 1MX9A 4DI3A 3P9CA 1R64A 5SYNA 4ALJA 1BMFA 1MCZA 3BE6A 4WN3A 1PV4A 2H48A 2PVCA 1IDN1 4HQLA 4IJWA 3NT2A 1XPJA 3QVOA 1LB1B 3AG1E 4LDAA 2F1KA 2V9ZA 5EVJA 1AZLA 1D1SA 1LPNA 1LPMA 1T0BA 2D5IA 3B8EA 4HAOA 4NG4A 2F1HA 4G25A 2BGRA 3MCXA 4FB5A 5K8LA 1N8SA 4BTVA 3KJQA 4KDEA 4IVRA 4KH0A 4ATNA 4WEOA 3LUAA 3TLBA 4B09A 4W9RA 4EX6A 5KTOA 2X4IA 4DPKA 1VSVA 3OLZA 3CRZA 4PXYA 2P9ZA 3NHZA 4P2BA 5IVIA 3OUZA 4DREA 1TVEA 2O2EA 1NZDA 3ESBA 3M2TA 4FNAA 4KLRA 1E5TA 5K6RA 2QN1A 2VO1A 1ESNA 2DLDA 3A7EA 1PFYA 1NTRA 3HV0A 4M0PA 3U44A 2R8XA 3B52X 1GD1O 1HDCA 3MJRA 3TLYA 1G1AA 2PM6A 5D0QD 1Z07A 2HJHA 5EY5B 3ZZMA 4D6PA 3UI2A 3E4DA 1TAHA 2VJCA 3C8DA 1U8CB 4NR0A 3E5MA 2H9AA 5D5QA 4GM0A 5IUNC 2F00A 2WSIA 1L5MA 3PNLA 4RPLA 1HNWB 1A9TA 1ZD5A 2WFAA 1KO5A 3L8HA 4V1CB 3FMOB 1I2ZA 5FTMA 3ETCA 1V1MB 1VSBA 4ZCTA 4BY6A 3OE5A 3F7OA 4WGFA 3WOHA 2IS4A 3TJRA 4EARA 1DCQA 2OOEA 3EDRA 1EYHA 5D7NA 4NRDA 4XPZA 3FBGA 4CIWA 1Z4QA 3EUEA 3E1GA 3BRWD 2PQ2A 4QXQA 2F4NA 3WWZA 1R8XA 3M1LA 3DTNA 1Y4AE 2RJ3A 1YASA 2CC2A 3HDGA 3HKDB 1P3DA 3C70A 3CNEA 3PUHA 4LHYA 4QUKA 2R66A 4PYRA 4RM2A 4WNFA 3I0ZA 4FR2A 4LRWA 3IEUA 4R9RA 3U17A 5HOQA 2FW0A 3O8RA 4C6HA 1TEZA 1LVUA 2J4FA 4GLFA 3V30A 3W6UA 3AT1A 2E6KA 3S99A 1MB4A 1PLJA 1WD5A 2CVQA 2GHTA 4BNYA 4G3XA 1PVVA 3SF8B 3T4EA 3QK7A 5GJCA 3KKEA 2RD0A 4YRSA 2DQYA 4F11A 3E22B 4CV3A 2P6NA 4D9GA 3QKTA 4Z4IA 1P7YA 2C92A 4RYLA 3HV2A 2AXVA 1KPHA 2J9YB 3BRQA 3PG5A 5FJIA 2FGKA 3SGHA 3CSUA 2OO3A 3FHOA 1VIVA 3PFIA 1GN9A 4CG2A 4HB5A 1BS1A 3JCZA 3GUUA 4LOKA 2ZSJA 1BDBA 5KNDH 4OGWA 5J4VA 5LOVF 4UD6A 1ZC3A 3VDXA 2D2EA 4WI1A 3A1NA 2ZG6A 2BH9A 2O20A 5HKBA 3KKOA 1T2CA 2WU1A 1I30A 2P78A 4B3DA 2HU5A 3OAAD 3OOWA 2O2IA 1O1RA 4FJ2A 1JFFB 1ZJZA 2INGX 3QGMA 1M2KA 1XDGA 4ID9A 1X2BA 4O8CA 2AMJA 2H4FA 2YIDA 4DLRA 4J0UA 1CUGA 1C7IA 1S2GA 1NU8A 3T5VA 3B1KA 4GR9A 4O0LA 4QEKA 4UHCA 521PA 5ESDA 4ZZIA 3N8NA 1O4WA 4UMEA 3TINA 4D0NA 5HGXA 2ZITA 3ZY2A 2JGJA 3VMFA 2XUPA 4TWZA 4CXMA 5BW6B 3INYA 1PTJA 1C5KA 1BX0A 2IYSA 5COBA 1SBNE 3IVXA 5FB3A 1IUPA 4CDMA 4B17A 2FV8A 1YRLA 1I32A 2OUKA 1NVDA 1NASA 2AE2A 2I6GA 3NC4A 4FZRA 3AR3A 3F8WA 3T3GA 2IV7A 2ZIWB 3W4IA 4LG1A 1D9XA 4H7EA 3ZCUA 1XLUA 1QKKA 3PWTA 4OFZA 5IM4F 3H9JA 5B30A 1PG0A 4RHYA 3K9CA 4YQFA 4DJJA 1J49A 1IPEA 4P93A 5EERA 3I4CA 2JGNA 2JIDA 3G2MA 5MN6A 4CU2A 3T8KA 3QUCA 4DCPA 3NHUA 1M2OA 2IZ7A 3T5TA 3VUFA 3GW4A 1E2FA 1YXMA 1C3OB 2DH6A 3GBVA 1TJPB 3PEVA 1TD9A 2ID4A 2WOJA 3DSRA 3LDAA 1XK7A 3MYRA 4G5OA 4KN6A 4IGKA 4LE2A 8ADHA 2NYVA 4L22A 5LZ7A 3ZW3A 1E8XA 3ICOA 2V8SE 5HS0A 3AIIA 3DZHA 1SU8A 3QVKA 4PSKA 1QWSA 4J0CA 4JXJA 4B89A 2VNSA 2JI9A 5AW9A 3RRZA 1QHGA 4G67A 3JATB 3EIWA 1A9PA 4JENA 1Z63A 4QX6A 2GR9A 5MFPA 5ERGB 4HQOA 1XVLA 4X66B 1VOTA 4OUDA 1A8IA 4QYTA 5LCXA 1H2EA 4YJ2B 3JWEA 2P65A 1KI9A 3HZOA 1F2TA 2OV4A 1OCOE 4OMUA 2ZTSA 1PJTA 2NQTA 2ZRAA 4OQZA 2PJZA 3KJHA 3LQ1A 3WFJA 3D6MA 3TGPA 1MX5A 2XGMA 1RKUA 1RPAA 2JBAA 3GCXA 4KV9A 3TOZA 4E70A 2WF5A 1QANA 4MICA 1IG3A 2NXJA 4AS2A 3PGKA 3VPCA 2NU8A 1KJNA 3SSNA 3NH6A 2J49A 2PX4A 2NO5A 4WZBA 4AYTA 2KJQA 1G98A 3ROEA 4P84A 4DIEA 1NM5A 1TF7A 5CXUA 2R4QA 3L4EA 2QDXA 2FE1A 3FYUC 1MQAA 4C48B 2ZR0A 2QVXX 3L8FA 2XEEA 3MF4A 4I1OA 3DAOA 3HDVA 3APCA 2LKCA 2ZSHA 3NHWA 3SYRA 2QX7A 1HFAA 1GQFA 3H2ZA 1NW5A 3DKKA 3K2EA 3NCHA 2Q3LA 1HURA 1S4QA 4W9NC 1P8AA 2NSHA 1Z6AA 2RGAA 2HGSA 4TMXA 3WLPA 3I2YX 2YH2A 4APFA 4MGEA 2OGTA 4UBOA 5CK4A 2XGSA 2Q2OA 3KTAA 5A3VA 2CG3A 2CXQA 3JAKB 1G4AE 4K9QA 4KFTA 1LBSA 1LLCA 2GS9A 2F0YA 4AF8A 5DGTA 5B6PA 2YRFA 4YAOA 3ZVNA 2G8LA 2JEOA 2ZI4A 3E5RA 3TSOA 3O0TA 3U60B 3E61A 4MK4A 2ATXA 3H1EA 4ZOLF 3TEMA 1ZM7A 3OTQA 2PIDA 1XLTA 1ULTA 5DGCA 3H2BA 3V8EA 4QBTA 1DAIA 2ALJA 3P9KA 3EYWA 4B1FA 4CMHA 5AXCA 1TW3A 4L4XA 3K30A 2UUPA 4TQ9A 5D5HA 1A71A 3RFFA 2R6FA 1R8SA 2NZUG 2AD1A 2BKEA 2V8OA 3F5DA 3H05A 4G09A 5DIFA 5IC6A 1N4AA 1NBMA 3S7ZA 1QLWA 3UHFA 4ZU1X 5GZ1A 3IA2A 5LCWJ 2LO6A 1QFJA 3GXOA 2WIGA 1KH1A 1LTXA 2ORVA 2WD7A 4OSPA 4ITVA 3WGZA 1SEVA 1V45E 1UBFA 4ZU6X 1DHRA 3ED5A 3L4JA 4LOIA 3TE7A 2OM2A 4RIGA 3TRKA 4C0WA 4PHTA 2DWZA 3WB2A 4QGSA 1R9NA 4EL5A 1BSVA 1UXHA 3B6ZA 2CJYA 1A5TA 1JJ7A 1W4RA 2BMVA 3D8RA 5IVHA 1ZVVA 3ZPXA 3D4IA 5DGXA 1LPSA 1N2IA 3DBRB 3GWZA 3L6CA 4QXMA 3TR6A 1V11B 4L4YA 3KKPA 4AG5A 2P41A 3PIRA 5JCOC 2XADA 1CERA 2C2YA 2R7AA 2FEKA 1NVMB 3GJ3A 3K0FB 3ONLA 4ANFA 2YYYA 3TLXA 2XZTG 1MABA 3FTQA 4BV8A 5J4KA 1OBVA 1YGYA 2P9CA 1NOJA 1X1CA 2JLCA 4WXHA 4YRQA 1KTVA 2P2NA 3SQDA 2Q5JA 1ZIPA 4M7PA 2EV9A 1Q12A 1DIBA 2BJVA 1W0JD 2EFHB 1WMBA 5IZ4A 2Q50A 4KVMA 2RAUA 4BKQA 4Z68A 3O90A 4L08A 3EZGA 3VLDA 4J1QA 5HA5A 2NYUA 4H2DA 1R18A 1E99A 1E9VA 2MSEB 2WRZA 2Y1CA 4B6QA 2WJZB 1C3OA 1K8ZB 5TSDA 3O4IA 3G0IA 4ZHSA 3VA7A 2F4VB 2EXXA 2Q4TA 2WBLC 4Y9TA 1Q7EA 3TDMA 4UI9C 1LKZA 2WP8J 3AJEA 3BXZA 3D1LA 4JB0A 4BLRA 2XYVA 1XCOA 2J4BA 1X7XA 3SZOA 4R8VA 4BBPA 2MT9A 2PVSA 3QP9A 2G08A 3MILA 3B48A 1EXDA 1WE2A 2Y9PB 4BLQA 1FX0B 2OHHA 1QP7A 3C87A 2EEPA 3EAQA 2Q07A 3ZHXA 2Q5EA 3M5WA 1YL7A 1S63A 4WWHA 1OR8A 2ISSD 4CM1A 2CXSA 1YB6A 2ETBA 2O2HA 4WASA 3TLGA 3CX8A 4G2TA 2IEAA 3TZBA 4CKXA 3Q8MA 4B80A 1B6TA 5DNYB 4FBLA 3HDHA 4CMJA 3PXEA 3VU9A 1JMVA 4MARA 1BEUB 4GQIA 4YROA 5AUOB 2A5EA 5L3SA 4LRQA 1BE0A 1P17A 4RD6A 3I8SA 2Y6VA 3FDZA 1N33B 1PI3A 1G16A 3ASOE 4NTZA 4RF4A 1W7AA 4D6XA 3ABOB 3BMOB 1ECCA 5GOZA 3EJWA 3V2IA 1P2VA 3MMSA 4MCHA 3AVVA 1F0PA 3WJ7A 3NHRA 3EHRA 5IFKA 1WRBA 1CK4A 4CYMD 3H4TA 3FF4A 3OE4A 4ECEA 3R5KA 3C7CB 4QOJA 1JQDA 1ZGAA 3RKUA 3Q0TA 3SFVA 4CNQA 3AB8A 4UBMA 1VP9A 3AP1A 2V1XA 1AF4A 2GZ3A 4AP6A 4EHNA 3JU3A 3GEGA 5KJFA 3UGJA 1PVOA 1WKCA 2XVYA 1MZPA 2PRKA 2ZAMA 3M83A 4QFBA 3SFTA 1Z38A 3VPFA 4EKDA 2ANCA 3CH6A 3UMJA 2W71A 4JUCA 2J7PA 3QLJA 3OY7A 3B60A 1KZ6A 1UM9A 4G0WA 1GPDG 2WVJA 4YXFA 4F3KA 5A6CA 5A6VA 1X80A 3H4MA 2WHEA 4QJIA 2GO1A 1CE8A 1M5TA 1P61B 2CMHA 4AC9A 3GLGE 1Y8RB 1XXHB 1W25A 1Z26A 2W2LA 1DEOA 2AG5A 4IDCA 1L5JA 1OFGA 2L69A 2Q27A 3ND5A 2GLUA 2V45A 4I2VA 3RU7A 3WG9A 5CA0F 4FMCF 3OIVA 1ODJA 4IP0A 4PFJA 1MORA 4B48A 5TQJA 1D07A 1Y4ZA 3VU1A 2W7TA 2YFQA 3UWOA 4I1YA 3I9FA 4WADA 3OM9A 2BFAA 4PXAA 1I6WA 1JKIA 2GVZC 1TUEA 4I81A 1SPBS 3K1ZA 4F46A 4EW3A 3HJFA 2WQHA 1Y3CE 2WINI 3HCEA 3QSGA 1JLSA 4HDKB 2ZYIA 1X39A 1IWPB 4Q01A 3V8VA 3OF2A 4W63A 2XCOA 3OZWA 1V7ZA 1UQRA 5K0NA 5FBQB 1L6RA 1TZMA 2IV3A 2A7QA 4NPAA 3JUEA 5AQ9A 1P2GA 1ISGA 1H65A 4KAAA 3CX6A 1V8BA 2R6CA 3RUAA 4EVIA 1TGYA 1TFRA 1KOGA 3TQOA 3EAGA 1KERA 1RAEA 1RHRA 1WU7A 4NVRA 3WIOA 4JZYA 1DWOA 3CK8A 4A3VA 2IPOA 2BUBA 2W6CX 3AOEA 3FOCA 4AIFA 3MTBA 3DEAA 2O9JA 2AJ8A 2RMKA 1NA0A 1X1AA 2PR2A 2ZYDA 3OCZA 4V0NA 3NVMB 5T67A 3M49A 4CMEC 1MB2A 3UJDA 3A6PC 1JUDA 3BB4A 2H1OA 3WYBA 4C3UA 5H4GA 2CLCX 2Q8QA 2DQSA 2BBOA 4NATA 1RNLA 2Y4NA 4PZAA 4NPCA 1R6UA 2ILRA 2PGOA 3KB8A 2CNLA 3T1OA 3EXIB 4E7OA 3LT2A 1EP2B 2B69A 4NXNB 3V1NA 1DLIA 2ZXWE 2EHDA 5EXTA 1L5HA 1U2QA 3R75A 3SQLA 2AFRA 2C7VA 1KETA 4UBIA 1QS0B 4ZQFA 3AKEA 4UCFA 3T7KA 1T1GA 4JGIA 5DT9A 1KZOA 1BG6A 1NG1A 2PL1A 2PSSA 4FBGA 4M9QA 2UXDB 5G53C 3JY6A 4BGIA 1ACMA 4DEVA 3LYLA 4BRUA 1M1UA 2F1RA 3UJHA 3QVVA 5HW0A 4DEYA 3VX3A 2HDOA 4BVJA 3D1VA 1D0IA 3PC7A 4RCZA 3SR4A 5I45A 2GCPA 3GJ7A 1SUAA 2RAPA 1NXQA 2O57A 4R2LA 2XR1A 4IKOA 3THOA 1N0WA 4XI9A 4D10C 3HL4A 1E0AA 1U1IA 2PMFA 3WLOA 1D7AA 1A8HA 5IBRA 2J45A 2IYNA 4MGIR 1DAKA 4IZHA 4XAQA 4N9QA 4BJ1A 2PS3A 5F35A 2O8EA 5I7SA 5FAXA 2GB4A 4BQFA 2PNJA 3GN1A 2PM8A 3RWMB 1EZ4A 4H7YA 3IIKA 3E4CA 4PG6A 1CU1A 4ER7A 2YCLA 3LUHA 3B5EA 1AURA 3OPYB 4TL9A 4JBWA 4EPZA 3ASYA 3F5SA 4ZPJA 3W7BA 5BWNA 1MG0A 1OQAA 3AY7A 1NUAA 4HYQA 4BMVA 5EYLA 1N75A 1XXLA 1I33A 1QVZA 3LPLA 4FLEA 1VTKA 4G63A 1USKA 1NUHA 4XDGA 4Y1FA 1BJRE 5F76A 1RZRD 1X7ZB 4ZVTA 1PJLA 1HORA 4X45A 4FVTA 2VUTA 3TIFA 4ZGGA 3VR6H 3DWLG 5DLEA 4EJ6A 5LP6B 3JQRA 2WC1A 4HVAA 1ZEJA 3T9CA 4RTNA 2DUJA 2ZRIA 4KH1A 1J21A 4P29A 1GSIA 1NL3A 2PYIA 3N2LA 2BFBA 1FDVA 1NI1A 2XMPA 3DMFA 5ELLA 3GJZA 3OJ0A 2B4YA 2QM3A 3V7NA 3I3SR 1VPTA 1Q0SA 3NOVA 4LAFA 1UK6A 5A5DA 1JQ5A 1WP9A 2VTEA 4Q19A 5A7HA 1NDQA 3CK9A 2IYFA 4J8FA 1HKHA 2O6HA 3CRNA 3JQAB 3MZ0A 1V4VA 2BLNA 3LFUA 2OYSA 1A8QA 2A5FA 2XYRA 2GRMA 2OV6A 1T2FA 4RH0A 2HMVA 3UAXA 2DVWA 3VTXA 4FWBA 3Q41A 3TWQA 5FEUA 1G3NB 1DEKA 3AUAA 3E27A 4L9AA 4Y0AA 2PWBA 1GZ4A 3D2CA 3W1VA 1KEKA 4TYNA 3LOUA 4I55B 2FFRA 4C4OA 1SVSA 3KELA 1KAEA 1T4CA 4CQMA 3H11A 4UWGA 1UKVY 1C2TA 1JEEA 1M2FA 1R9GA 1QKIA 1YQDA 1E1DA 3DOOA 3LF1A 4Q9LA 4ASUD 2PT6A 1SBZA 2QUIA 3TRFA 2K2WA 1H3EA 4KLCA 4RETA 2BF0X 4KYUA 1J8MF 1E6CA 2M9MA 3UQYS 1BFDA 2JHGA 1KAGA 4OAQA 2PWAA 4UNIA 2GQ0A 2BL4A 3WTBA 4I08A 1HLFA 4I2NA 3J7TA 1WV1A 4PO8A 3EHMA 2Q1YA 3ZWXA 3E0XA 3JQ7A 1KQNA 1FP4A 1BE1A 2GPYA 1YDMA 2RC5A 2WIKA 2MINB 3FDIA 3H7IA 3JTEA 1UJKA 1QGUB 1CSEE 4RJTA 1XZCA 2KQUA 3PS6A 3QWVA 4LJSA 5JXHA 1F7VA 1JT2A 2A1TR 1KWKA 1W0CA 3BRWA 4X8MA 4B2IA 3BL6A 2QL7A 4YJFA 4WLEA 3N7TA 2BEJA 4XIIA 1DPGA 2A5LA 3G88A 4M8SA 3WKDA 3ZWDA 4B45A 1T2AA 3DSTA 1L8LA 2JEZA 3PFCA 1U7OA 2PVPA 3CKKA 3IHYA 1W93A 2H8GA 2OC4A 2ZIXA 1UFRA 1CUYA 1GPNA 3EC7A 4PFQA 1B4DA 4F6RD 4DDWA 1ZJ4A 1NNI1 2CSUA 4DBLE 2XMQA 1YR1A 2AJCA 2BUCA 1OASA 2XE7A 4L8GA 5EKUA 5KYXA 2IBMA 3KDSE 4MIYA 2QN7A 3OCWA 1JP7A 1FE8A 1EPUA 1JAZA 1SZCA 1Y3BE 5CJPA 3TW0A 1C8VB 4B0OA 5I6DA 5COAA 3I5YA 4LJ4A 4GUDA 4DNFA 2DKNA 4JP1A 3FRHA 2Q9CA 1LH0A 3TQFA 1XUOA 1J8VA 1PJ4A 2HL6A 1CWUA 3AY6A 4US2R 1E3WA 1Z7WA 5FRDA 3KQTA 3O4ZA 1CQPA 3RREA 5ADHA 4CGZA 4PIPA 3VPGA 5HR5A 4E33A 1B1CA 2ENWA 4RFSB 3I37X 3KTDA 1U0EA 4FIZA 4XCVA 1HNZB 3ZDFA 4FFBB 2C7GA 1K9SA 3AEQB 5ALYA 4Z8XA 2DPXA 3VO2A 3HIZA 2BE7A 3MWEB 4X20A 4EJSC 1GCUA 1Z2PX 5FA6A 5CLJA 1JQKA 2ZCUA 2VK8A 1FB5A 3G85A 3WZMA 4B4KA 3WR5A 3BZBA 4C0JA 4CEMA 1R3UA 2DY1A 4OLBA 2D8MA 5FFNA 1J0AA 5HS4A 1C3XA 1A9SA 1AIPA 2CMGA 2R6HA 2C61A 2DULA 4EWLA 5E2BA 2ZAYA 4ARZB 1NXPA 5DM60 4U07A 2RBKA 1NXVA 1NQUA 1LPPA 4QDTA 1E1KA 1MV8A 4G1FA 2R6R1 4NY1A 3ROZA 1GKLA 3QPUA 3VX4A 5ES3A 4YQZA 4D97A 4IF4A 1ZEMA 1CRQA 2Q4DA 1NKSA 3SE0A 1OX4A 5FUWA 4NLLA 2HLHA 3D81A 1N6KA 1YK1A 5H80A 4QNNA 4HF7A 5JCXA 2UYQA 2GOYA 5AKIA 5BW8C 1RLTA 1NW9B 3B9RA 4PBTA 3GU3A 2ZJ1A 3HB4X 2HTEA 3QE0A 4ILKA 3BUAA 2NT4A 4DLSA 4RDXA 4TUMA 2P69A 5K0SA 4NEHB 3V42A 1QQBA 4OK3A 2VC2B 3IT2A 2LRHA 2VR1A 5A3SA 5KHAA 1EM8A 3WRYA 2CVPA 4EG6A 4RJLA 5IJZA 1JKXA 1Y3FE 1BX1A 2W5UA 1Q91A 4UVIA 4BOYA 4UREA 1XXHE 2FW1A 3DXXA 1U0LA 1W85A 4L28A 3KYJB 2HIAA 3C3DA 4KXFB 3LJKA 4PBSA 4KOAA 1CRWG 4KJXA 1YIDA 3JQPA 4PPNA 4GCNA 13PKA 1TOAA 2APJA 2LD4A 3BHJA 2H16A 3HI4A 4YAFA 3ZWAA 4EI7A 4YRAA 5AXDA 3SJUA 2JD2A 4GMDA 4V0MA 3S7JA 4B6PA 2IYTA 1CE8B 2PGNA 2BI7A 1EVYA 2XF2A 2HIHA 2NTJA 4IGEA 3FSGA 4UUQA 3A6ZA 4I6GA 1ZGCA 5ENRD 1SZ9A 1JEQB 3P0EA 3BSYA 2ZWIA 5DP2A 1PBNA 4DV2B 3C5RA 2LDBA 4UW9A 4ARAA 1OILA 3REOA 1UCFA 3AR7A 1JA0A 1SPXA 3AU9A 2O2XA 3FCCA 4QEZA 4W5RA 1YZVA 2R17C 2I29A 4FS3A 4W6QA 3WQHA 1W19A 2C83A 1NWHA 3U3MA 3O8LA 1XFDA 1K8RA 3FZGA 1QM5A 4PCLA 4D6YA 4DNQA 1U0BB 3KPYA 1H6AA 1ISHA 2ZS8A 3T95A 4K9NA 5K5EA 4HTFB 4LKOA 1A9RA 1HYEA 1WXEA 4Q1DA 4GO1A 3KHTA 1RBYA 1U0NA 3KL4A 3OWHA 3C6ZA 2ZE6A 3GLTA 4KX3A 4PZLA 1O96A 4NOLA 1I7QB 3ZFWA 2XZDA 3G0GA 4LYJA 1XZLA 3ZEFA 3NUZA 2O1XA 2FK7A 2V7EA 4GI1A 3P96A 3WNCA 4BLPA 1J0BA 4DA6A 4YYZA 1ECFA 2OQIA 5F7JA 4MQ5A 2X6QA 4CRWB 2CLIB 2QVCA 3X1DA 3JZDA 4I7EA 1ZESA 1BO6A 1J2JA 2VYVD 4MO9A 4MUBA 1K2VN 2OCAA 5TEVA 5TX7A 3DUFA 3I5MA 2BMJA 1JQLB 1ZCAA 1Z6PA 3AR8A 5A3JA 4JI3B 2UDPA 2YY7A 3I32A 2AKYA 3K9FC 3B13A 1JJFA 1UP7A 1M54A 1OA1A 2C2LA 1RJEA 1Y6JA 1TYEB 2LNIA 2ZSKA 3D5QA 2R9VA 1HSZA 3NRCA 3QPDA 4Q93A 1USWA 3JVVA 3RVBA 3ZS9A 4B9EA 4XVCA 2IRWA 4ZOEA 3MT8A 3UAVA 1QQEA 3TZHA 3WGQA 3IQIX 1H9CA 4KMRA 1R6DA 1DEAA 2OT3B 3IBCA 3CVQA 4MAAA 5HCNA 1OLXA 1SQ0A 4GZ5A 3A37A 5JPCA 2XKKA 1DL5A 4PS7A 1FNCA 2WTBA 1Z8DA 3ECSA 3JQAA 4BNDB 3HSSA 2B1JA 2Q99A 2XMRA 1S3SA 2B30A 4FFDA 2NYAA 3PI6A 4FZJA 4U1RA 3WQRA 5BSGA 4JWTA 3L4KA 4GMFA 3NBUA 3O6VA 4X1OA 3LDGA 2EP7A 1KJ8A 2J32A 4ED9A 4HGZA 4U7JA 4BO6A 1DWQA 4JB3A 1COZA 2PT9A 2AW6A 3DTTA 4YMVA 4Y9DA 1X7ZA 4KO3S 4UHEA 5A1TA 5AHWA 1SXJE 1R16A 5KOJB 2CJPA 2H5JA 4M1EA 4CEJA 4HJXA 2XUDA 1S89A 3FI9A 2AFHB 2VF8A 1AQUA 3TIVA 1WPXA 4WOCA 2ID9A 4NZMA 3ST7A 1G5PA 2OOKA 2ZSEA 4EBAA 5FINA 2O3TA 2GFQA 2XRYA 5C5EA 2C57A 2UYCA 2XECA 5CB4A 1E79D 1QG0A 2GZRA 3HXPA 5TGTA 3U3RA 1C3JA 1SG0A 5EXPA 1KAMA 1X38A 3BF8A 5GONF 3SSMA 1Z62A 2EATA 4II7A 1TUGA 3ELUA 2OOSA 5T4FA 1V5GA 1XRNA 3NAQA 1P5QA 2ET6A 4AJ9A 4LMBA 5KYGA 1ZNWA 4OMDA 4DNOA 3KZVA 2GEUA 3EIFA 6ADHA 1ILWA 4K6FA 2FUG1 3HJHA 4AZ0B 2X4DA 4F7WA 4M87A 4BE7B 5JNLA 3NMUF 2Z8YA 1YCSB 1FJ2A 4B33A 4IM7A 4TSRA 1VJ0A 3R8CA 3ORYA 1M6HA 1HRKA 4GPIB 2F8YA 4H31A 4KBFA 4WXRA 1T3TA 3WBFA 3P5SA 2YY5A 5KTSA 1XPOA 1A27A 4BAUA 4F2HA 5B4VA 3I9V6 2OAQ1 4U8YD 3MRXA 2FQYA 3A6GA 4ARBA 3RJTA 3TZKA 4GA1A 3S7DA 1GQOA 2ETAA 3D3MA 3DEYX 4RK5A 4AUEA 5JI3E 3PZDA 1MAVA 2R5WA 2XF8A 3RYTC 4C0XA 4EHDA 1DVPA 2FPUA 1UW4B 3C7KA 4DSZA 4ZT6A 1X1BA 1NUUA 4MOWA 1DQZA 4JA9A 3DXFA 4K9DA 1HEIA 5LB4A 4I5DA 1E9RA 3W8NA 1ORDA 4URVR 4RTOA 4OP1A 1Z6YA 1P5ZB 3H97A 1YFJA 3Q3CA 5EEHA 3PYMA 1E0JA 2XBUA 1VBFA 4MWZA 4R3UC 4WBSA 3GLIB 4Y2VA 3GK3A 3UWSA 4FEAA 2H0RA 3H2GA 2RGBA 1JI3A 2XCQA 4C06A 2I71A 2WWHA 4WESA 4WZAB 3MT7A 4BFCA 3SQWA 3ZDZB 5CB8A 5KTPA 1DC4A 3QYAA 3GXBA 4MP6A 3DUFB 3GYGA 4XGKA 2XUAA 3AIKA 3TK1A 1KDTA 2GT1A 1ML4A 1J9ZA 1PD0A 1V8PA 1GCIA 5FR1A 4DQLA 7MDHA 1UR5A 3NAGA 4Z2YA 3D8BA 3PXGA 3AUKA 3ITEA 2K87A 5ER6A 3R9KA 2CV1A 4MRRA 4LXQA 1EESA 2J3IA 1JB9A 3OWXA 3DULA 2Y71A 3ORSA 3RIHA 1HLGA 2VJ8A 2VYIA 1JUQA 4GC9A 4GKAA 3U1TA 4BP3A 4DNXA 4EEXA 2CXOA 5B1SA 2H31A 2BW0A 2Z83A 2CXXA 4S0ZA 1YULA 5ITWA 3B5IA 5IZCC 5K05A 3QNUA 3RHSA 3RT7A 3ZTWA 3EU5A 5KX5F 3WLHA 1OCZE 1ST3A 1ENZA 2F64A 2Z43A 1SC6A 4Q6WA 2X0FA 2W0MA 2A1UB 4XOUA 5IDVA 3CPEA 4HOYA 3ROMA 3WO0A 2ZT8A 4ZMRA 5EINA 3PUWA 3KOXA 1BCRA 4UPEA 2R6AA 4JKYA 1OWMA 1XMIA 2WJAA 4C0SA 4E11A 1DNPA 2G25A 3LW8A 3AVXA 2JGRA 2Z09A 5SICE 3AUSA 3RV3A 3KZKA 2ATVA 3GQVA 2EDCA 4Y2SA 5F7XA 3L18A 2VHVA 3ESZA 4I66A 3ZU4A 3NX4A 1DJPA 3O2JA 2O8FB 4Q7JB 4FOOA 4KYVA 1D8AA 4GYWA 1H05A 2CNOA 1O87A 4KGDA 2QR5A 4YGXB 2JRCA 2CLKB 3FFXA 4D4JA 1R0ZA 4Y6GB 1E0DA 3CB2A 4X93A 1TZ2A 4B6FA 2L6BA 3CH4B 5CR9A 2NZ2A 5B58C 2I7DA 2QENA 1RQ7A 4HT3B 3K31A 2OP0A 4LPSA 3C45A 3HGQA 2W4IA 3R9MA 4UBJA 3TZEA 4B4WA 1X86B 4NNOA 4E2WA 3D54D 4DM3A 4EJSA 4XWYA 2JAXA 4XFDA 4JIMA 2BTOA 3V8QA 1QJ4A 2I3GA 4BFXA 1EUZA 3LF2A 5L3SB 1Z4KA 1JEAA 1A8UA 2G0AA 4NYJQ 4TVBA 1LX6A 3Q98A 4NBVA 4ZV7A 2FPSA 1VMIA 3TTVA 2Y4OA 3D6NB 3BFVA 4GOND 1FYFA 5EHNA 4OHKA 5ALDA 2F3PA 2Y8EA 4H27A 1N9KA 3MMNA 1DIRA 1VE1A 3TLGB 4ZHQA 1YVDA 4KR9A 1Z83A 2RHTA 4S1NA 2J4CA 3L8DA 3QBJA 4GNRA 4JLPA 4OLFA 4IMRA 1BEEA 2Z8XA 2PUBA 3VNUA 1QQTA 3R1IA 1YWGO 2ZUWA 4GA2A 2QN3A 1UKBA 2B8EA 3JTMA 2IUYA 4KFUA 3T4PA 5CURA 4CU5A 5GIPE 1YTLA 1OX4B 1VC2A 3ZX5A 3RLIA 1GUFA 3ONFA 4XA8A 2J48A 3IQGX 4EY7A 3U3OA 5CCMA 1W9HA 4CE6A 4E4RA 4CM9D 1QHIA 1XAIA 3NT5A 1GN8A 2DBAA 3NP9A 1A2BA 1PR0A 2I4NA 2D0DA 4LVNA 2JARA 2VWGA 2H5LA 1E3TA 5BURA 1Q22A 3GD7A 4JB8P 2WHQA 2F62A 1L4EA 3AEXA 3DLAA 3PCTA 3FRJA 1U0JA 1WY6A 1XOIA 3HWX1 4DJFC 1VHTA 5EQFA 1ND6A 5BNWA 3C3XA 5BO5A 2O8VA 5G05C 5DHPA 5F1PA 3W2EA 1RI5A 2I55A 1QQ6A 1CS0A 5JFGA 3K0CC 3UBTA 3OQJA 5FWAA 3CRMA 3HA3A 2GRPB 5JAOA 1T8UA 3P97A 1XD8A 2VL7A 5F52A 1R0KA 3R5FA 4KGVA 5DK4A 3TZ6A 1A1VA 1XA3A 1E7RA 3IIEA 2EX0A 3LUDA 5SZIA 3UK2A 2R7NA 3JRWA 1E3WB 2W43A 3FUDA 1LF0A 4MVJA 2C7RA 4NS4A 4U6NA 10MHA 3U9TA 4IS3A 3QU5A 4F2PA 2NP7A 2NSLA 4CCAA 1SXJC 1PO7A 4ND3A 4O1IA 3AU4A 3EZXA 2DWUA 2G71A 2AJTA 2WJ4A 4M21A 4PR3A 1Y1KE 2IPNA 1ZA2A 4KQCA 1FQJA 2HHLA 3FCUB 5AJDA 2YRWA 2W2MA 1JWLA 2DFPA 4OHBA 2EYUA 3GRKA 3QX3A 3W2GA 4N0MA 2H1VA 4C6TB 1W36D 1WQ1R 4W5JA 4HNVA 1VHQA 3U5TA 3LLVA 1OFUA 5ALJA 2GN2A 2V5FA 4JBHA 3HK2A 2PCJA 4JHKA 1C4XA 4DK5A 5CDHA 3A3NA 1QBKC 4CZ2D 4X54A 2D3TA 2HHCA 5B7NA 1KO4A 4JP2A 4MIEA 4QRHA 4PGMA 2PE5A 1P8JA 1IUNA 3DE4X 1OFIA 2QTBA 1SHZA 3FYUA 1G5IA 4YJFB 2VXCA 3WIBA 2WJWA 1E3MA 4G1EB 2O3UA 2FMFA 3TWVA 1QYMA 5DYIA 1ZU5A 1Y3IA 1JE0A 1FMJA 4IVPA 4TWAA 1BWPA 2Y68A 2BGUA 2JIMA 5F7ZA 2EARA 3OHMA 1U3GA 4LXXA 1G3UA 4NAUA 2QRGA 1FDSA 4JBLA 2A4ZA 1XLWA 1NSTA 5ITZB 5JHAA 4GPBA 1APBA 3VGPA 2ZJ8A 3BXOA 1VKHA 2QTFA 1T3GA 2WR8A 2IIPA 3FWHA 3IDZA 2WVGA 2PUJA 3ME5A 3VTZA 1VKNA 2QD2A 3IIMA 5EN5D 2XOEA 3C2QA 3P9IA 4UEWA 3R6TA 4L16A 4DQVA 2QW0X 5B64A 3EEOA 1MC5A 2EVWX 2RHOA 1OUVA 2Y0PA 4TL6A 4II3A 5E76A 3IFSA 4FFRA 4N8EA 4IH9A 1SUSA 5E2IA 3ZBQA 1TIPA 2QAIA 3OKFA 3M3HA 2AVNA 1PL6A 1XNJA 1C41A 2JJMA 3IAUA 1YCFA 4TKLA 4ZCPA 4B3GA 4LCBA 1JW9B 1RYEA 1TNZA 2ATIA 4MWEA 4S3MA 1E6EA 5JMPA 3VPBA 2A9RA 3G0CA 1AXRA 2AR7A 3BCSA 4R0NA 5FBRB 1HS6A 1TO1E 1BI8B 4CM4A 2IHNA 3R7BA 1H6OA 2WMYA 3IP7A 3DQZA 1E5VA 4XASA 1IIBA 3P0IA 2I78A 2YX1A 4KPUA 5DHQA 1P4SA 2A94A 3GHYA 4UDOA 5F2KA 2IYYA 2YINA 5ICFA 2VHUA 4F45A 1KRXA 4Q4HA 2Y2VA 4N49A 3HL0A 4ZYXA 4QM6A 1XT6A 4J07A 3H2HA 3I42A 5AVYA 1UDAA 2XAAA 1P33A 4YBRA 3EGDB 3W2FA 3V2GA 1P6QA 2EFEB 5FL7D 2KMLA 1E6WA 2HU8A 2POCA 3ECCA 3EZ9A 3LKDA 3MRTA 4LQDA 4D41A 3WC4A 5DBGA 3ONVA 4OKSA 5F2OA 3S70A 5CB4B 4C2AA 5A9SB 3C98A 1MGOA 1WR8A 3ABIA 3ZR4B 1X3LA 4LWZA 4BNVA 1L5FA 1IOWA 1IVYA 5KAMA 5FUMA 4ER5A 4E1AA 2RKOA 1RZUA 1WZUA 2AEJA 3ANMA 3CV3A 1ISJA 3LTEA 4W7SA 3IP1A 4EB6A 4MQ4A 1IBLB 3KVYA 2CVFA 4G5RA 4U0SA 1JILA 3YASA 4IVQA 9ATCA 4JI0B 3KPJA 1LBEA 1LSUA 3OLXA 3L01A 1K4YA 3PQ3A 2JAWA 2WSBA 1Z39A 3R7DA 2AW5A 5CRVA 2A9FA 1X1RA 3A6HA 3TPCA 4C7OB 2XD9A 2JG3A 1VSTA 5DGIA 4ZAXA 2DCPA 2FJPA 5JYCA 1AHHA 1JHXA 1U9YA 1WOMA 3BFKA 2G1JA 3HU5A 4RPGA 4AZ3B 3PA8A 2FWMX 1KLXA 3PF8A 1GFIA 5FNVF 5JQGB 4KPUB 4AM8A 1N6NA 3ZI4A 5KHOC 1P75A 3HUFA 3VHXB 3NOOA 4HOQA 3LUJA 3WRYC 4ZI2A 4ABYA 5CM2Z 2YJGA 2V4LA 2YXDA 3IUNA 4TN5A 5FFMA 4K5CA 2QC9A 1QTIA 1R6BX 3ZWWA 4EMSA 3L4BC 2BFDA 1NRIA 5B53A 1D4AA 3LC2O 2F67A 3DOFA 4D42A 5A06A 5I7VA 1OI3A 1EINA 1XE3A 5DV9A 2X40A 2I87A 2OCCE 3W6NA 3OTOB 1YH3A 4J6FA 3BMCB 2C04A 3LA8A 3OT1A 4Y1EA 3C24A 3TTSA 4F6RB 3ZGXA 4AXHA 1E18A 1P7PA 1Z5SC 1W88B 2VJKA 3BS4A 4LWOA 3VNSA 2YQ4A 2NXWA 3OQBA 4YIKA 5F3WB 2OO7A 4X3OA 1SHJA 5TIIA 1AY0A 2YJ6A 1RWXA 4WZZA 4A73A 1KJYA 1X74A 5DYYA 5KWJA 2C82A 4JI7B 2ESRA 4N5IX 4GNKA 3C14C 3PQDA 1AKMA 1ZISA 5J40A 1D8TA 4DS3A 1LXCA 4HFMA 4G0MA 3B3AA 3W3AH 2ZDQA 2WB2A 2AZDA 3LXXA 3TBFA 2N3ZA 3JVEA 4HYEA 4BX8A 1YZNA 3A1EA 4YIHA 1AKUA 2BFPA 3SZMA 2X38A 3DWFA 1QMPA 1RXYA 2N1MA 3I9MA 3AG2E 4Q02A 4ZAZA 3WIUA 1UPFA 2BH2A 3Q7PA 5GV8A 4Q4LA 3L9XA 2I7TA 3ETJA 2VNAA 4HATA 2ZS7A 1PG5A 4PPQA 3T9DA 2AKAB 3CONA 3O9MA 1GIAA 2BKAA 4LXGA 5E7MA 2VWPA 1SB9A 3DL0A 2J30A 3IMCA 4N5DA 2VF2A 3LM8A 2CDNA 5BSKA 5DN6A 3WA7A 2CZCA 4UC0A 4TXLA 5LJLA 2H2FA 3G23A 2UZ3A 2VP5A 2I2DA 1TJYA 2Z5FA 5K45A 1ZNZA 5KC9A 1V8DA 4LJAA 1DUVG 1YJXA 2YW2A 3D7LA 4MW1A 3LAWA 3NQ41 5IYZF 2O4UX 4EG1A 5ICGA 1QK5A 2FRVA 1JSLA 3E7FA 4HSGA 4LJRA 3PSAA 1MJ5A 3VSEA 2NUTB 2A5UA 3NLLA 1GSHA 4IUCS 1Y8RA 3UJ9A 3NGLA 4Q7MB 2ZAGA 3IUEA 3ISVA 4RTLA 5CNJA 5K03A 5IBCA 1CTQA 2ZCVA 3VUEA 3JD3A 3UV7A 4R2IA 1HDZA 3JQFA 4AN1A 4LXTA 5JHBA 3EZFA 4ND7A 3DXYA 4YEDA 4PV7A 5CTAA 2M6SA 4HEA1 4P7JA 2IGTA 4WKBA 5KNBD 2SHKA 1KQ3A 5IPFA 3DG9A 5DJ5A 4Z53A 1B1AA 3FSRA 1QV7A 3UAZA 4UASA 2GA9A 5K8UA 2IS1A 4MI1A 1CUJA 5JMOA 4EMTA 2P2CP 4F53A 1F0YA 2CMFA 3L4BA 4DZRA 4LVOA 3I04M 4ZYTA 1K8QA 4FYYA 3GLFE 3MJEA 3KOWA 1OT5A 1JXQA 1XVAA 3AZQA 3R76A 3VJRA 3HCFA 4GWGA 1R10A 4LX8A 2P9IG 2J9RA 3H2SA 3S1AB 4Z1MD 4ZJUA 2DRIA 3D7SA 3KYIB 4KIGA 3THYB 2FFAA 3VRHA 5BXQC 3U44B 1CFZA 1ZONA 2HSEA 3GAMA 3QTBA 3G6KA 4EJ0A 2LCIA 2ZB4A 5IU6A 4PINA 4RQAA 4HJRA 5DTIA 2V6FA 4FN5A 1X9IA 2V5QC 2CNNA 5EIOA 3ZBPA 4DZTA 1T9HA 5B3SE 4QDKA 1RIIA 2X5JO 2XWBF 3TBKA 1PX0A 3PQFA 3VU9B 2CNBA 4EKEA 5CNMA 2ZBEA 1ATIA 2C0MA 5EE1A 1YS4A 2HA0A 3AKCA 2BSXA 3G7UA 5FKJA 2XQKA 4JSTA 2CHWA 2KLBA 4BO9A 4YRBA 4RFSA 3E32A 4BZWA 4AMZA 4L57A 4DIDA 3DMHA 3BXXA 1EDEA 1MD9A 2GF2A 2BMAA 1ZG3A 3KLOA 3RFUA 1GU7A 2I2AA 3BXEA 3OKAA 4LRSB 3ZWYA 2HF8A 3W5AA 4JI8B 2QLLA 5FH9A 3OVMA 1TN7A 1AQYA 1X7XB 1OBCA 1XU9A 2BY4A 2FG7C 4TN1A 3ZIUA 3FGPA 4ZT5A 3MB5A 1WZNA 1D5CA 1RC1A 2PHZA 1US8A 3K9GA 1H6PA 4TLEA 1Z0IA 4K2AA 5EFZA 5TRTA 4JWKA 3R7NA 4RD3A 3RK4A 2HNBA 5B1HA 1RWNA 3C4QA 5EXXA 2ZJFA 5JDCC 2KYRA 4HVBA 3E7PA 3EAFA 3G5AA 5CK5A 3DBOB 1JA9A 1T0PA 2VDNB 4DC0A 1CY8A 2G9QA 4OMCA 3MWGA 1NBWB 2AOTA 1ZW1A 4G07A 4K88A 1PG2A 2FPGA 3Q8WA 3LS2A 4OHUA 3TWTA 4MRMB 4EW2A 4KYIB 3PPIA 5GJWC 4RE6A 4MX8A 5HKKA 3DE2X 1E20A 1I3OA 1Q11A 4FADA 2ZBDA 1X8KA 4J0HA 3HFSA 2PANA 4KIJA 4JVMA 4J8YA 1O9BA 4KL8S 3ZE1B 1DUSA 1TJ5A 1M72A 8AT1A 1N7GA 2XCSB 4E09A 2CLMB 3TG2A 4AKIA 4JT4A 3WFIA 5ECWA 1OT8A 2QI9F 2YINC 3UJ8A 1YQWA 1R0RE 1XA0A 3LYUA 2X77A 1PK7A 1PW7A 3K5WA 3O1LA 2QW1A 2WFLA 4HX2A 5A6SB 2XT9A 3QEAZ 3AJDA 5H59A 621PA 1PFKA 1UH5A 1YA4A 1KMIY 1VJTA 2V59A 4RIEA 4EFLA 3ZE6A 3H4IA 4ILEA 5JADA 5C8XA 1PZGA 4HI8A 1UKYA 2BPOA 2JGLA 2V5AA 1S02A 3PQ4A 3BG5A 4REQB 3VYWA 2QJFA 5ANRA 3CNLA 4Z7QB 5CJJA 2WXLA 4H4DA 4RC9A 2AK3A 5BOSA 1Y4UA 2OKCA 2PZAA 4AOFA 2G5TA 4OI1A 2NZYA 4LWPA 4BZQA 2JH3A 3G2QA 4JD5A 1D0VA 5DX1A 4DYDA 3Q2OA 3JCKC 4B93B 1V47A 3AR2A 4MUKA 4XB6B 5JCPA 3HCAA 2OP1A 4RDIA 1MVLA 3BSSA 4CM3A 2MWMA 2QQ0A 1VGVA 1VRWA 3H17A 4NZ9A 2HQSA 3PTLA 5ISMA 4ER6A 1ZJYA 2LPMA 3KCNA 3L79A 4KYTA 2W2TA 4KQKA 4GS5A 4X9XA 4EF6A 5CCLA 1SCQA 2A78A 3L7DA 3F0TA 4M2LA 5KYNA 4P86A 1CLEA 5IC5A 1K1EA 5A71A 2HMAA 5TS3A 1EX1A 2DY0A 2W2KA 4Y67A 3QPVA 1Y8CA 3CPHA 4S04A 1KKMA 5LA6B 5E0OA 2J87A 2W48A 221PA 1H6BA 3AP2A 2C9YA 3B1ZA 5FP0A 3SHWA 2VPTA 1UXGA 2WT9A 2L0TB 1UT8A 3WBBA 1JG6A 3F2VA 2KCLA 3FUVA 3EEFA 2CDRA 1J00A 2G40A 4J4BA 4L95C 4IFBA 1ZZGA 1JDBC 2I6SA 3WK6A 4D8VA 4D3YA 5BMVA 2GFHA 3TL6A 5BQFA 3MJVA 4LNUB 4LF7B 5FA5A 1E3EA 1RYMA 3L7NA 3LIPA 1YZ3A 3OKPA 1ISPA 1ZIXA 3LKZA 1VLZA 2PWPA 3H5AA 2R7MA 2DZDA 4GKKB 4GOLD 4AL4A 1XG5A 4EUFA 2HU2A 2FW9A 3BJRA 4IMIB 1YF3A 1Y3AA 1M6VB 5GPBA 4IXWA 2C2BA 3ZDRA 4CODB 3BJIC 5KQSA 2EFJA 5CHEE 1PGOA 2UUCB 4F56A 1E9CA 4A8JB 4WJZA 5FAKA 2GRAA 1NAHA 3QXJA 3SYKA 4BNTA 1I3NA 1Q1QA 1KVSA 2HMYB 3GT4A 1LK0A 3DLIA 1IXYA 1SXIA 4I6JA 1D2HA 1MJHA 1T6ZA 1OLUB 2Y92A 1PTJC 3GX1A 4K1XA 4MVCA 1V71A 2UY1B 3NVAA 3SX4A 3S8YA 3THXA 1M5RA 2P3SA 2KZTA 1Z33A 3B7GA 3VDRA 4MS6A 5ENPD 1LNZA 1UEIA 1DC8A 3RSFA 1BQ4A 2PSHA 5CFZA 3HUTA 3P9PA 1DZIA 2AFHA 2OAP1 4IJ5A 2HR1A 1WETA 1ZJ6A 1JLMA 2QSZA 4MUFA 1Z4JA 2AFIB 2VNIA 4U7PB 2NAPA 4TLLB 1T2VA 2VJAA 4EJFA 4X6XA 2ZRBA 3HRKA 3FTEA 3B85A 4K6KA 2NZJA 5J2TB 2K7ZA 5LIPA 4I5IA 2VPXA 3BE8A 3M89A 1SR8A 1Z8NA 3NH9A 1HQKA 1XL0A 2AMVA 1EDZA 1R5OA 3TW8A 2I2XB 3UYLA 4X8LA 2DCMA 1MG5A 4ZQCB 3RS0A 3ZWMA 2W90A 4N3AA 3KFVA 4RDCA 4JI1B 3PEVB 1KYXA 1JSCA 3EVZA 4IR7A 3GRFA 2BCEA 5B2EA 1YC5A 3NS7A 1G5TA 2LZ0A 4OB6A 4RSMA 3M4NA 3VU3A 1I2AA 2GCIA 2IS6A 3FKSA 3ZY3A 1EWTA 3CUKA 2AC4A 4C7OA 1AQJA 3TVDA 3E9RA 3F73A 2FSIA 4MUEA 4ZI7A 3L04A 2BR5A 2L0XA 3EH2A 1SRQA 3AUTA 3KB2A 1YS1X 2I33A 3TL2A 2HA2A 3U49A 4UUPA 1OROA 3NJRA 4TV9A 3T99A 4IGIA 1A9YA 1QIJA 4F06A 4I14A 1B89A 4WNAB 3QE9Y 4PZ0A 1VI2A 2OHFA 3I04A 2WPVA 2QT1A 2V4UA 2ACKA 3BXGA 5GQSA 3G89A 5FOUA 2VZ0A 4RELA 3QBDA 4MBGA 2PUVA 5A9SA 1CY4A 1OLUA 5LWHA 1IONA 1YFKA 4XSVA 5E6UA 3W5DA 5LXTF 4M0LA 4REOA 4PAQA 1IATA 2CFOA 2G77B 3H9QA 3W34A 1J1IA 2ZI3A 4CRWA 1OTYA 1JWBB 1JQBA 1OCEA 3HB7A 1MHPA 1NR5A 3LFHA 3UWKA 1O8CA 1IH8A 1RHKA 3QV1A 4GLBA 4HBDA 2JGKA 1A8SA 2AQKA 4Q4HB 3RS2A 4A8JA 2A0KA 2F3TA 4UXIA 2KW5A 3WMFA 1BS2A 2ODNA 2RFLA 4GP7A 3GFGA 2BEUB 5BN5B 4EA7A 1XXHA 2HZBA 3R7SA 1KYWA 4N6OA 1EK1A 3FH0A 4OQMA 4UM8B 4PF1A 2VCYA 2B1GA 4F2WA 5CDUA 3NOCD 4L23A 2Y1GA 4NX2A 5AIBA 3ZGQA 1ZVQA 3H0EA 1ZNYA 2P7IA 3HKCB 4JLUA 4AULA 5DTEA 2WIBA 1ZOPA 1VJ5A 4M83A 3T8YA 1PQWA 1Q1AA 5DN6D 2JVJA 5UKDA 2EP8A 3R7FA 3UAGA 2GERA 2I4MA 4RZ2A 2IOFK 3V8RA 2JB9A 1ZR2A 3EPHA 3QX7A 3AHIA 2ZM6B 1J1UA 3PE3A 3UBMA 3K0BA 1V54E 2GCEA 4X00A 4BV9A 2VOJA 3ACDA 3BD7A 5FHRA 4F3YA 1CUEA 3GQBA 4QATA 4HFNA 3RT1A 2FFQA 2O6LA 4YCJA 4KITB 1IULA 1W47A 2ZRMA 3E9EA 4B2LA 1K3UB 4ZRNA 2AH5A 1FP6A 3VMMA 3PXXA 1XNRB 1PFUA 3LQRA 5CIYA 3T9BA 4IIJB 1GVHA 3ETHA 3PEUB 2FXIA 1NMZA 1Q6YA 4HPJB 4R5HA 1XEWX 1ZUHA 5G1PA 4DXDA 4EB8A 2A0UA 3IULA 2Q2VA 4MVJD 1TM5E 4XCQA 2FPLA 5JZVA 5EJ4A 3OE7A 4Y9UA 1UPBA 2CJWA 3GT7A 5LL6P 2ZI7A 1JG7A 1Z0JA 2OXTA 1KQFA 1W5FA 3D3EA 2H4JA 4WFIA 4PYNA 3PCXA 2YJZA 4MYTA 3TI9A 5ITVA 4M88A 5TC4A 5M34A 3ZE8A 4JYCA 4GKJB 2C4WA 3QM1A 4UUOA 5H9VA 1V1MA 4RFLA 2A9JA 4ECAA 2BZGA 2W2LD 1SIUA 3F46A 5EDSA 4HUQB 4KQ2A 1XRRA 3N53A 3QBVA 3ZYQA 1WZEA 4MWDA 4W1RA 3HYNA 3K35A 3VPDA 4P7GA 4B8CB 3ZLUA 4C2TA 5KSOA 5FBVB 4XRRA 1VL2A 3LC1O 1G18A 3N05A 5KDLA 2BEDA 3D5EA 3RRNB 1C1XB 3AG5A 4HWPA 4ZVQA 1W30A 2XPIA 1OC4A 1F9AA 3EBOA 3IRUA 2Q3HA 5IN4A 4OB7A 2IIBA 2JH8A 3K1YA 3PDCA 3URZA 4A55A 4NBKA 4BFSA 1R0BA 4B8AA 3QHAA 4JC0A 4MV7A 4Q9JA 1EF1C 1PU2A 2GEKA 1VSUA 2DKFA 2P5UA 3SN6A 4YRZA 5L4SA 4GGMX 2RIRA 2HBRA 4YWJA 2CHXA 1C7QA 1OIXA 1U6IA 3NHFA 4C43A 1HG2A 2FN4A 5JH7F 2HRQA 2BHTA 4AECA 1RABA 4C4AA 2EQAA 4HLDA 3UKDA 3AVUA 3PNPA 4JSYA 1PT8A 2G4VA 3VAZA 1PW5A 2G67A 2EYQA 4BWYA 2H6IA 4F6CA 4ZAYA 1YUMA 4MUGA 5BV2P 1V4NA 5D00A 3WGJA 4HGQA 1CUDA 2FPIB 4PX9A 4WQMA 3X1WA 4DSTA 3R0VA 3E23A 3SWWA 1WMEA 4URYR 1OIVA 4M0DA 3KQNA 4J3FA 1Z7GA 1QBQA 2Z5GA 4G4SO 4ZODA 1NVVQ 1LSSA 3UEOA 2PQNA 3IJRA 4JC4A 1BHJA 2JIQA 3C3WA 4IXDA 4RZHA 4E4TA 1NVEA 2FEPA 3HVJA 1WW2A 4JVOA 5BORA 3CLVA 5U4XA 1P72A 4XR4A 3WKCA 3OZBA 3PT9A 1Q0PA 1A7UA 2I8AA 3CRRA 1QH0A 4HFGA 2A33A 3EPPA 4GU5A 2JRLA 3CT6A 3HR7A 1EFCA 1FPQA 4NG5A 2WOOA 2YKGA 2IP4A 1CR6A 4KOEC 2GAJA 2X8BA 3ELDA 4WLUA 3WSTA 3I2KA 2B5WA 5HK9A 3L6UA 4HQKA 1XTSA 3Q9UA 2LR0A 4YLYA 1V5WA 2X5OA 2GBCA 4AF6A 4KR2A 4GWKA 3OZIA 3L1IA 4IIVA 1ZUNB 4I3FA 4RA9B 4XIGS 2D2IA 1IHUA 4INOA 4KHZA 3ESQA 3N76A 4Q5IA 1Z5ZA 1GLNA 1WSWA 2YYAA 3CBGA 3KQWA 2Z98A 5EQJB 4IO0A 4KPGA 3VJLA 3LPDA 2OCPA 1IQRA 4OH1A 4ESVA 3U3ZA 2ZLBA 4BATA 4GBED 1UDRA 1IQPA 3G59A 4ZPXA 4GQAA 4URXR 3NG1A 4DFDA 1Q0HA 2VJMB 2PFGA 3IE0A 3F90A 3OFNA 4D9NA 5DM1A 3CUSA 2IZ6A 1FXUA 2X3FA 4R7ZA 4C6SA 2PM7A 2RONA 3WBJA 1R3DA 3CX4A 3EFOA 3QNKA 1SC1A 1Y5MA 1WM1A 2PY6A 3PC8C 4UJ5A 5T4HA 3ZUPA 1FYXA 5J90A 4ERNA 2BHLA 4NS1A 4NMLA 1ZOIA 4X44A 3PU6A 2PV0A 2SKEA 4YJ3B 3NWBA 3BD6A 4JA0A 1KO7A 5T6BA 2VSXA 1U02A 1U9ZA 4W8OA 5GM1A 2RAFA 4HN4B 5B3JC 4EECA 3AMVA 3DF7A 1ODLA 5AJVB 4C7VA 5JCJA 1XPRA 2GRRB 4FFLA 1IOVA 1MRSA 3PJFA 4HUJA 4N7BA 1BCRB 1ZCFA 2C5GA 5INTA 3IPXA 1W35A 2OGUA 4P33A 2OCYC 1LDGA 2WG0A 4WUTA 5C53B 4K3UA 5JSZB 4I1OB 2MYPA 1GAJA 3F3SA 3K1JA 5IJ0B 1SCNE 1UJCA 1UN8A 4GLOA 4HPXB 3AUUA 2BMDA 2Q49A 3KLMX 1QG4A 4YJKA 1FQOA 3DKIA 2ZU0C 4R3WA 3UAWA 1M75A 1U31A 2GESA 3NM5A 3ORHA 3UW3A 3FHLA 3FOWA 4GRIA 1GTMA 3H1TA 1MC1A 1ZMBA 4RXTA 1MQSA 1OBOA 2NO4A 4BGEA 2JBAB 3DE7X 1D2GA 4IIBA 3SKYA 2YN2A 5G2OA 4GM1A 3H1BA 4X1KA 2QN9A 2YR0A 4HWOA 4PICA 1ML3A 1USVA 4F4UA 3VHQA 2UV8A 2UKDA 1RRFA 3G79A 1QR6A 2NU9B 1JCRA 4FMPA 3NDIA 3CE9A 3DGEC 3L0ZA 2XRFA 1JLRA 3L0BA 4OUDB 1SVLA 1RBMA 4ZVSA 3SM3A 5J2UF 1AJEA 1WG0A 4UCQA 3HS3A 1AGYA 1SOVA 2FA9A 4TV9B 3SXUA 3TQSA 2VDJA 1EGVB 3AERB 1VDYA