2XGOA

Xcogt in complex with udp-s-glcnac
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
548
structure length
548
Chain Sequence
b'QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
total genus 203
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgoA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgoA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgoA02
3LKUA 3CV0A 1L5QA 4I2ZA 1HLFA 5DIZA 4BT8A 4GPBA 3Q47B 3BD8A 3T3GA 1ELRA 1UQTA 2JJMA 1NA0A 4N3BA 5EX3A 4MI6A 3KAEA 4IN3B 2QN3A 3OKCA 2WPVA 1IHGA 5EX0A 4BTAA 3FP3A 3TGOA 3ASFA 4J0UA 4MI3A 1C3JA 1Y8MA 2I6HA 3ZCQA 2PL2A 5CCLA 2O6LA 1RZVA 5ARFA 3GYZA 3VDMA 1UZUA 3S2UA 2LSVA 3CVQA 2R66A 3BEEA 3N71A 4UI9C 4JL0A 1OUVA 3G2IA 3CUUA 2G9RA 4GCNA 2JLBA 4FKZA 3EBPA 4KQ2A 3MS4A 2YHCA 2QN7A 2XGOA 1JIVA 3Q4AB 3MS2A 3FFLA 5LCWC 3IAAA 3L7BA 2ATIA 2P6PA 3PDNA 1O6CA 3MA5A 3L79A 3S27A 4Y6WA 1H5UA 1P4GA 2QRQA 3CUTA 1NA3A 1WV0A 4RELA 5ARGA 3LPZA 2FETA 3QKYA 4G1TA 3G2LA 2QN8A 5JJ6A 3DDWA 5BW8C 2IW1A 1JG6A 6GPBA 4RG6A 2PRJA 1EXVA 4RG9A 2NC9A 5TMBA 2BUGA 3MV3B 1C50A 4JA9A 3MS7A 2AVPA 4JA7A 3ZN3A 2XGMA 2FFRA 4F9FA 2IV3A 1KT1A 2ACVA 4MRAA 4XIFA 1FU7A 4GZ6A 1P29A 3ZCSA 1Z6QA 3JYSA 3ULQA 3CUYA 4EL5A 5EKQD 3HBFA 3IA7A 4N3AA 3DDSA 2C2LA 4B94A 3G2JA 3HYMB 5G04C 1JIUA 4GYWA 4N3CA 1KTIA 3AS5A 2C1ZA 5D0OD 2OFFA 3OT5A 3OTIA 1KLXA 4CTMA 4F97A 2IV7A 3T7DA 1K08A 4RENA 3OKPA 4H7XA 3CK7A 3MSCA 3QDNA 5G05J 2C0MA 4CGVA 1KT0A 4WUYA 1NOKA 4M83A 1VGVA 1WAO1 2XA2A 5D0QD 2X6QA 4REMA 2FBNA 2SKEA 1C8KA 2AMVA 2R4TA 4WNGA 2Q6VA 2XCIA 3GPBA 3NP7A 3T3HA 4AMGA 5TMEA 4WNDA 4CTNA 3ZCPA 4AM9A 4BTBA 1NZFA 5JTTA 1XNFA 5BNWA 3RKVA 3MT8A 4WNEA 4BFCA 4EJ2A 4I2WA 4NRHB 4UQXA 2UY1A 2YQ8A 1FCHA 3T5TA 1FTQA 3ZHEA 2YJNA 4N2SA 3D0RA 2F3PA 3AS4A 3Q3IA 5FJYA 5DBKA 5AYWD 4HOSA 4KBQA 3MRVA 2KATA 1PNVA 3ZPJA 4BQEA 4WNFA 5G05C 3LCAA 3GW4A 2VSYA 1GZ5A 4KQ1A 1Y6FA 3MRTA 1W3BA 4PQGA 4U0ZA 4RIEA 5IKPA 2VGYA 4F96A 3BCRA 5LCWJ 2XCBA 4O6FA 2KCLA 3S7JA 2SKDA 3COPA 2PYDA 2C4MA 2FO7A 3MBOA 3CX4A 3ZCUA 7GPBA 1GFZA 1RZUA 3MQFA 1P4HA 4HOQA 4N2QA 3E3LA 1NZDA 3CUVA 1FA9A 3OKAA 3NP9A 3MEKA 2Q7FA 2AW3A 1JEJA 4RBNA 4RIIA 4U04A 3D1JA 2G9QA 1L5WA 4RIGA 1A8IA 1EM6A 4GA0A 5FTPA 2R60A 3ZHEB 1P2GA 2H1FA 3S0JA 4J8DA 3OXLA 4MICA 2IEGA 2ASVA 3BCUA 1E4OA 3SYMA 1WW3A 3Q3EA 1GPBA 2GW1A 3CVPA 2L6JA 1FU4A 2X0FA 1FU8A 1J39A 3CVLA 3MT7A 3OY2A 8GPBA 5G04J 1GPAA 2FF5A 4G26A 1WUYA 4WADA 2P58C 2VSNA 3OXGA 4LEUA 2IYFA 3G2NA 4NC9A 4EKEA 1Y6GA 4JHRA 2X0DA 4EQFA 4M7PA 3ZCRA 1IXYA 4N9WA 4AMBA 2VCHA 5HXAA 2E2EA 3UQ3A 5I45A 3Q5MA 1A17A 4LEIA 3VTXA 1Z62A 3H4IA 1PC2A 3CEJA 4KXKB 3GZ1A 2IUYA 2XCUA 4YVQC 5FZQA 3Q15A 2R68A 2QRMA 2XMPA 3O48A 1XV5A 3C48A 3OY7A 3Q3HA 1SXPA 5JJTA 1NOIA 3TSAA 4G2VA 3TG5A 1SXQA 2LNIA 3G2KA 3FROA 5DU2A 1HZ4A 2VGXA 3GUHA 1QM5A 1IYGA 3AMVA 5D01A 3S29A 3BD6A 1RRVA 4GZ5A 1YGPA 1F6DA 1PN3A 1ZU2A 3Q49B 3ESKA 4I1AA 2LSUA 3PE3A 4UI9K 2X0EA 4GYOA 5CCMA 2HYZA 3L7AA 2QNBA 5KJMA 4YUAA 1XKXA 3RHZA 4AY6A 3MTDA 4GPKA 3BCSA 3TAXA 2MHKA 3VDNB 1JG7A 2VYIA 4N5CA 4N39A 2KC7A 3CV3A 1E96B 3E4BA 5FZSA 4X7PA 2PYIA 2HO1A 5A6CA 2VQ2A 2ACWA 3WADA 1L5SA 5DLDA 3E3NA 1Y8ZA 4G24A 4GCOA 2C0LA 2QLLA 4CDRA 1AXRA 4WHMA 2KCKA 3LY8A 2C9ZA 1WUTA 2BGTA 2VGXB 3DZCA 4Y6CA 3BD7A 4RIFA 1L6IA 3RSCA 1Z8DA 2GM9A 3UPVA 3H4TA 2WTXA 4MHOA 1P5QA 3HBMA 4U07A 4F3VA 4U0SA 5D00A 1IIRA 1XOIA 4G23A 2KS6A 3NB0A 3E3OA 4YNDA 4NQ0A 3R9AB 3RO3A 3CEMA 3WAGA 1P4JA 2PQ6A 3T3DA 3FWVA 4W6QA 3TOVA 1NZNA 3SZ7A 4AN4A 2PQNA 4HORA 2GEKA 1LWNA 4HLNA 4XI9A 2VCEA 1NLMA 2XCCA 3SYRA 1ABBA 3GZ2A 2V5FA 1XC7A 3CK9A 2ECPA 3IEGA 2C1XA 3ASGA 1FS4A 4AY5A 4BQFA 4X7MA 1BX3A 4Z5XA 4X6LA 4CGWA 5DXFA 2ONDA 3S7BA 4BT9A 4NESA 3ZCVA 1L5RA 3LYAA 4XI0A 1FC0A 1GPYA 1P2BA 4WACA 4EKYA 4BWRA 3DD1A 2Y4UA 2XEVA 3CVNA 4M60A 3K9IA 3RIBA 3NCHA 2UY1B 4HOUA 3CKCA 5HI7A 1QQEA 3U4TA 1ZBPA 2JZCA 5JTUA 1JIXA 3D0QA 3UYLA 3MTBA 3VTYA 1GG8A 3ASHA 3PE4A 5JJ7A 1F0KA 3NAZA 3UUXA 2BFWA 1NOJA 2ZB2A 4J8FA 4ME2A 2BGUA 5TVGA 4RIHA 4J8EA 4UQYA 4ABNA 5ENZA 2QLMA 2GT1A 1FTYA 4KYOB 1M5RA 1YA6A 3MRXA 4YVOA 1PYGA 2GJ4A 3HBJA 2R5SA 4GYYA 3WC4A 3BEOA 2GPAA 5C1DA 4G2TA 2XA1A 3MT9A 3O3CA 1C8LA 1QZ2A 2GEJA 1HXIA 2QRGA 4HWGA 1L5VA 3NF1A 3NC4A 5FZRA 4NEQA 3ZFWA 3OTHA 4AIFA 5M72A 1XL0A 1PSWA 5KJKA 2H1HA 3LY7A 1V4VA 4W9RA 3TG4A 1WM5A 2J9QA 2OOEA 2SKCA 4I17A 4KQMA 3C4QA 3AS8A 5TMDA 2QN9A 2G9UA 2F3UA 3RJVA 3L01A 1YA0A 3CK8A 1HH8A 4FZRA 2HR2A 2QFCA 1NVKA 2IF4A 3BDAA 3EBOA 3VUFA 2F9FA 2QN1A 3NPAA 2KCVA 3ZCTA 3QWVA 4BQIA 4QLBA 2QZSA 3EDTB 4X7RA 2F3QA 3RO2A 2QN2A 5LQDA 1QKJA 3QHPA 4EL0A 3T3IA 4LDPA 2UWJG 3S7FA 1UQUA 3L7CA 2FI7A 3CEHA 3QOUA 1E1YA 3S7DA 2HY7A 3RSZA 5KJLA 3S28A 2F3SA 3U3WA 3SF4A 3HBNA 5CHEE 3ZGQA 2PRIA 2R4UA 1XL1A 2WQHA 4GZ3A 5IKOA 3CUWA 4CTOA 9GPBA 3RT1A 4MHSA 1P2DA 4GA1A 3VUEA 4UQZA 3WXXA 4U0UA 3G2HA 3MKRA 1LWOA 4I9EA 2VG8A 3MV2B 2Y4TA 4H7YA 2IYAA 2PZIA 1B89A 1WV1A 1ELWA 2AV6A 1TJCA 2FF4A 2AZDA 2IEIA 3KD7A 3KS2A 2DBAA 1L7XA 3C4VA 5A7DB 2PQRA 3QWWA 4HOTA 1FTWA 4L22A 2FEZA 3T3EA 3OXFA 3RU0A 5KJNA 2BISA 1GGNA 2IFUA 1AHPA 3MTAA 3CKBA 3OTGA 3URZA 2G9VA 2XGSA 2QRHA 4APOA 1Z6PA 2XA9A 2QLNA 4GA2A 3L7DA 2QRPA 4A1SA 3QWPA 4UI9J 2GPNA 1B4DA 2XPIA 4YI5A 3QKWA 1WW2A 3UYKA 3ASDA 3CEQA 4YI3A 4MI9A 5HQ8A 3LY9A 2GPBA 4I9CA 5GPBA 4G25A 5BT1A 2X6RA 5FT9A 1K06A
chains in the Genus database with same CATH superfamily
2DPYA 3T3GA 4BNFA 1ZK0A 1BKSB 3FNBA 4KO8A 3RFXA 1U8EA 4U9HS 1GPDG 3JQAA 5AJVB 5HVNA 4L08A 1L7VC 4ZI7F 2QM8A 3FUJA 4HEQA 4I08A 2JAOA 3CNOA 4S1TA 2PSEA 2UZ1A 1U90A 2WMNB 3Q4AB 1TF7A 4MS4A 3MOSA 1G5PA 3EHMA 2Q4BA 1YQXA 5EZSA 2YZMA 2PQ2A 1RT9A 4CEHB 4IRUA 2R8BA 4WVLA 5HOEA 2PH3A 1KPIA 1I80A 5TPWA 1KJNA 1K4YA 5DM70 3MGCA 3ILXA 4ODIA 3BMQA 3HPRA 4HPJB 4KBGA 4OJTA 1ZD2P 2AMFA 4Q48A 5AHOA 4U1RA 4JQSA 1XO1A 3FNHA 3ELBA 3TE6A 2YY6A 1H2RS 3GX1A 3HP1A 3NT5A 3BXEA 2VP9A 3T95A 1RVDA 4BLPA 3QU9A 1VG9B 4KK4A 4LHEA 1RWKA 2AIRA 4U7EB 3VOSA 5JC1A 4HOSA 2JBWA 1GZ5A 2ZIXB 4B6QA 2VH5R 1KAGA 3ZK8A 2RGNA 2JLVA 2CJWA 2PBLA 3SE0A 5CVEA 4JN6B 4CKCB 3RUIA 4M9RA 3WGOA 4GKVA 1YJBA 4LFBB 1AA6A 4FXOA 5DGTA 5EJAA 4QUIA 3LU1A 3UKDA 5IFKA 2G1KA 3G5MA 3SYMA 1R88A 1PGJA 1NY5A 3M81A 3W5VA 2V9CA 5TX7A 3G2NA 3W1VA 3PNMA 2PY6A 1CUBA 2PSHA 5HR5A 2NXWA 4W1QA 3TOXA 5F33A 3ESAA 4AOFA 5IF9A 1ZK3A 3R4VA 2GNOA 3C6XA 2GS9A 5LU9A 4C22A 3TN7A 1AURA 5C5DA 2Q21A 3CX3A 4PG8A 8ATCA 5JSZA 5K8IA 2GI4A 3H5VA 4K9LA 1JDPA 1H6OA 2QYUA 4R9RA 3ZYKA 4HAUA 2HK7A 1WY5A 2QLTA 3H2GA 3C45A 2YFYA 4HZGA 1OH8A 1PHPA 5B1EA 3O4FA 1NATA 3A4IA 3L9WA 5C2JB 4MPPA 2ZRHA 2PPLA 5HG0A 4EPRA 3AETA 2XH8A 4XPZA 4XGNA 1XXHE 2P9NG 4WNCA 6ADHA 1R66A 1H6PA 4RPGA 4URUR 4A2PA 1ZAYA 1FSGA 3ML8A 5AJYA 2OTCA 2FW6A 3AGPA 2QYHA 2VDVE 3ZIMA 4IO1A 3E81A 3GD7A 3O0TA 4BAUA 2G63A 4G67A 3MWLA 2WRZA 4LF5B 2FQYA 1LCIA 2AXVA 2H52A 3F2VA 1AY0A 3P2MA 2JAHA 2OXRA 4A2CA 1KBZA 4XWYA 3FU6A 2NAFA 3MUEA 4RKQA 3MXOA 4E3WA 5I8PA 4NONA 2G9UA 4V3IA 5KCZA 4LV6A 3PQ8A 3LYHA 3VTKA 4OGGA 4N5LA 3NHRA 4WK4B 3NV7A 2QPLA 2R79A 3CUSA 2W93A 2BEWB 4B87A 3SR3A 3TSOA 3HKCA 2C54A 1HYBA 1U6KA 5E6RA 3FOCA 1G42A 2YVQA 4DBLE 3BSFA 3ANXA 1PX2A 4HV4A 2VL7A 2JJ1D 1T25A 3RBZA 5B4TA 2C5AA 2P9KG 4FI3F 5ADHA 4E85A 3RUAA 1ZQ9A 2OGUA 4N0EA 4DT1B 1HF8A 1F1BA 5JROA 5G0SA 3TI7A 3O1JC 3DHNA 4JVLA 1PG0A 1JGTA 4WOPA 5TVKA 4XFKA 3MJSA 2AA3A 1YQUA 3CW9A 5CGQB 5EWLB 4AIIA 3K0CA 3CGHA 2FWJA 1NYLA 4H1VA 5BRJA 4JP5A 3O26A 3GLKA 4OQPA 5AW9A 3KAEA 3VNVA 3FAKA 2UXDB 4ESOA 3SD5A 3Q3GE 1U2RA 3TGOA 4HQRA 3SSMA 3NBUA 4D3FA 2R4QA 1B6RA 3CLSD 1P2SA 1QH8B 4K2HA 3HH8A 3L13A 1XCGB 1VLHA 4ED9A 3ZV6A 3Q2OA 1DT5A 1G2OA 3FH8A 2HSZA 2XX3A 2X5OA 2VWGA 1N2CB 5IASA 5I7RA 4AJ9A 3DL7A 4IJQA 2PXXA 4ESVA 4DLZA 2FG5A 1IN4A 2W2TA 4RO0A 4PDXA 3SMQA 4IVNA 3OOWA 1PYDA 4L4SA 2IPOA 1TM4E 3IPRA 5KTSA 3NYQA 4F7WA 4IJWA 2W2NA 4NARA 2ZUBA 4GRIA 2RAVA 4Y6GB 4BOYA 1TVEA 2ZU6A 3ISVA 1N3YA 1MC8A 2Q5JA 1Y5NA 2YXNA 3QA3E 4AMGA 3HQ4O 1V6CA 4DPRA 1V47A 4FGSA 3WIOA 3BJIC 1A95A 2AC4A 1JFVA 4F2HA 1UT6A 3I42A 4BEJA 2GAJA 2BUCA 4DC1A 1PNVA 1JI0A 5B37A 4JLBA 5FTWA 4BBAA 3AEKA 3HEAA 5K20A 3GLVA 5KI6A 3E3LA 4JDPA 1GKLA 4ZYTA 1KWKA 4GM4A 1WD5A 2G72A 3GGSA 2Q5CA 4QQ8A 3C3XA 3ZHEB 1BXKA 1Q0ZA 3UK0A 7AT1A 3RT7A 3UOAB 1ISRA 4WY8A 4OIMA 4EQZA 4KR6A 4DDHA 1Q22A 3V6LA 4WZZA 1J6UA 2F8MA 2XXAA 4B4KA 3PDIA 4IV8A 2ZIVB 1QIKA 4IL5A 4AMBA 2PZMA 4TTTS 5I45A 4PC1A 3A06A 5E0OA 4PYOA 5KYWB 5L7WA 5SY4A 3LSYA 3AXTA 1EBFA 4EA7A 3NZUA 3DWLG 4OQZA 4OXKA 3FNIA 3UA3A 4IXTA 2BKVA 2NZVG 1CJSA 2D00A 5LLSA 4PQYA 2XOEA 4V38A 4HS9A 5J47A 1RI4A 4R1LA 3C70A 4N01A 3RT9A 3VDNB 4HBDA 4F92B 5FJIA 1HE8A 3CV3A 2F90A 2BFMA 5BV8A 2Z43A 3PYMA 3HUUA 2R2GA 3ORQA 4CEJB 1KVUA 3EY9A 1VKJA 3QG5A 2B8EA 1OFUX 3Q7QA 1S01A 3CSUA 1E7SA 4A3SA 2MOKA 1LZLA 1L4GA 4DARA 1GYRA 2ZZNA 3FHTA 1KQPA 1Z5PA 3LX4A 4EG7A 3KPWA 3CNQS 3B48A 3SG0A 1R2QA 4DPLA 2X5JO 2WIDA 1TMYA 4Q1EA 1ACJA 4IOMA 4YUZA 4KE6A 4M1TA 3E7FA 1SOVA 4UEQA 3UT5B 4Q4AB 4YAGA 3P9QA 4GTVA 2I78A 2NW6A 4K9RA 3GFQA 4H35A 2QVYX 4DZRA 2Z5VA 4E94A 3E84A 3D6VA 5K99A 1P5FA 4TSFD 2NVUB 1G5FA 1X1AA 3I0NA 1SJ9A 3V8NA 5HZMA 3X1XA 2CDBA 1M34B 5C8DA 3HYCA 1HH8A 3X1WA 1Y5IA 1PAUA 3QIVA 2QP3A 2W0MA 3I4GA 2A9VA 4G0QA 1EESA 4ZYYA 4J8SA 4FU3A 1O94C 4O2LA 3QFSA 2YJZA 4CIXA 4F6RB 3VYUB 2WAYA 1JN0A 3C97A 4HO1X 4RLFA 3ZLTA 2D3TA 5AJWA 2Y99A 1DKOA 3CGWA 3OIYA 4S35A 2AEFA 4BRSA 1XEXA 1JHXA 4U6SA 2ZTVA 4OL0A 4DX1A 4MWEA 1FZQA 1AT1A 1YTUA 1STOA 1WBJB 2QGFA 1HLPA 1ECPA 1LTQA 2GRMA 2JI9A 2GCIA 2IPAB 4Y9DA 5L6MB 4FJ2A 1B6SA 3GNLA 5FT9A 5GONA 4NF2A 1HMPA 4Z4FA 3OLCX 5BSGA 5FOUA 3OKCA 3TWWA 2HUNA 3STVA 3WGGA 2PX5A 1IMJA 5AQ1A 2D0OB 4UI9C 3RRBA 3G2IA 3OBBA 4QFCA 2JGNA 1MC1A 3K1JA 2HN9A 2O07A 3NBAA 3QIAA 3QVUA 4GTQA 1NF8A 5EZYF 2IKQA 2QXTA 3R0IA 3MB8A 1WF6A 4IM7A 4IDPA 3HYMB 3DOOA 4B3MB 1P1CA 2H2FA 3FUKA 2IXEA 3QXJA 3FKJA 4RZHA 4P82A 3ZNOA 1WAO1 3BGDA 5ANRA 4QARA 4AM9A 1T6XA 4L78A 3NBNB 3GLFB 2R47A 2C5SA 4DSUA 3AUXA 3FTPA 5HS6A 2E6UX 2WG1A 3DAFA 3MHPA 2K2WA 1UN8A 4GSLA 4B48A 2FJPA 2YHAA 4ACAA 2CG3A 4ITRC 1OXJA 4S1OA 3KYCA 3QP9A 2IH2A 3DNMA 4DLPA 3BQMB 3ZW3A 2ONJA 1RQ2A 3EXHB 3TLMA 1WY6A 4YRRA 1NZDA 4QRIA 1T35A 5JJCA 4NCIA 3PB3A 4NG4A 2QD3A 4IH9A 2I71A 3U7GA 5F7ZA 1JFSA 1UPAA 5FF9A 2Z6AA 3O9ZA 5DVZA 2QJRA 1E7WA 1TNUA 3CF4A 1M7GA 2Z58A 4GUAA 1TO6A 5K0GA 3B7BA 2NTEA 4AJ1A 4BFRA 3LLCA 4DPKA 2RG1A 3Q8KA 2YJGA 3VXKA 1XD9A 2BMVA 4YDOA 3OSZA 1MX2A 4X60A 4YYZA 4RDIA 3KEFA 4MW0A 1FUYB 4U7FA 3FPGA 1ML3A 1CP2A 5SYAA 1N8TA 4TMZA 3MAJA 4DCPA 3N8KA 3M1IA 2I3GA 3CKMA 3SI7A 3CS3A 3DKIA 2NUBA 2WF6A 3EMBA 3L1JA 3TDNA 1IEWA 4KE7A 2VAVA 3H5NA 5F5LA 5CFNA 1MJ0A 2Z8XA 4DLAA 4BLOA 4X7PA 2DTXA 3MCXA 4L2IA 4Z53A 1XKTA 4AJLA 1TK3A 4FLHA 3B89A 2N1MA 3OZVA 3LJNA 1ML4A 4Y6RA 2I4MA 1QP8A 4A73A 3G8CA 3CH5A 3DMPA 5F4BA 3QHQA 3VX4A 2X5NA 1RHKA 4C2UA 4K6KA 4BUJA 3SYRA 1W49A 1HMYA 5K1ZA 4URWR 1AHIA 5G3ZA 4YRPA 1WZ2A 1BD4A 3SC2A 2XQFA 3I2YX 1W4CA 4ZO6A 3TZQA 4W5OA 1N0RA 3IAFA 3FUHA 3NCHA 2ALJA 4NWIA 4QBFA 2IFTA 1SBQA 3QBDA 3PE4A 3PFFA 4JS0A 3E2IA 3OZRA 1TDJA 4F60A 4OKNA 4DDKA 2DY0A 5ADWA 1P1KA 5C8VA 4Y9UA 3UGTA 4V0RA 4Q5IA 3B6JA 4INAA 4BMDA 3KQMA 4JLNA 3QX3A 5HZKA 3DSWA 4HWGA 3KTAA 3GLHB 1WCWA 2QV7A 3ICWA 2JGLA 2TMGA 3W4IA 4Q7JB 1NQAO 4NZOA 1E1CB 3AF6A 4MIEA 4MRNA 4MVJE 2W6MA 3OZWA 1UMDA 2E3JA 1PWXA 1MO5A 1SZPA 2ZWVA 4DLNA 1KU0A 4EL0A 4GQBA 5KSOA 2NXCA 2NG1A 1ONNA 3GZTB 3S7DA 3CPSA 3W04A 3MWJA 3CVYA 2WQHA 3O5AA 3HE3A 4R81A 1P0FA 3I4FA 2QK4A 5EZYB 5FOXA 5JMPA 2PZIA 4HUJA 3IPXA 2AZDA 4QDUA 4DR5B 2B7LA 1O0BA 2P65A 3DP7A 5L51A 1MO3A 1PGQA 2A0UA 4GVLA 3O8CA 1IVNA 4BLTA 2OY0A 3N59A 2OEPA 1OGJA 2PSJA 2BF0X 4HVCA 4B3IA 1S2DA 3H8JA 1HDGO 1WX1A 3L22A 4FHFA 5EX3A 2ZXFA 3SDSA 4YMIA 1PJ4A 1CY0A 3KWFA 1Q0QA 3Q15C 2REQA 3U13A 2Z2JA 3D6FA 2EZ8A 3ISMC 1Z0ZA 4M0DA 1AZSC 4WWNA 4LHZA 1JIVA 2VHJA 4OQYA 1R5OA 2VZ0A 3TMAA 4IZ6A 4R3WA 5KPJA 1SQSA 3T15A 3CWQA 1ULHA 4ZYZA 4D9CA 2VH2A 5TMBA 2CLSA 4KB5A 3CO0S 3SS7X 3OVMA 1LRKA 2R8XA 4WOBA 2E0IA 1R8QA 4JI6B 4LDQA 4BJ5A 4MX8A 4X84A 3PQ4A 1CF4A 1XZNA 4E03A 1BD8A 1GGEA 3ZWPA 3LEWA 3B12A 3MMNA 1G18A 3ZKJA 1XRJA 2RD2A 1GCAA 2WA2A 13PKA 5T7BA 4J94A 5C34B 3DDZX 4BFCA 3T7CA 4V39A 4IGFA 2PGDA 2V54A 1Y4UA 2D4HA 3MQ4A 5FJYA 4KSYA 1WG8A 1TEZA 1E3JA 3KSDO 1AZWA 4JYCA 2GN9A 5AOBA 4N7RA 4ID9A 2OSVA 3I8OA 3FHLA 3DEHA 2QU7A 3E18A 1FNDA 3WO1A 4TRMA 5ITWA 2BGJA 2J31A 3ELWA 2QE7D 3ZQJA 3K6JA 1U0RA 5K03A 2X0FA 1NVTA 3H9QA 4BBPA 2WHEA 3BIJA 4AUEA 1XZGA 4E5YA 4PLFA 2F2TA 1WAMA 6CHYA 3CGGA 1G5HA 4HXEB 4DY6A 1D04A 4YT4A 1EWRA 1G8FA 4JD5A 1MAWA 2MSKA 3B9PA 5LP1A 1CNEA 3SZRA 3DBIA 3D7MA 2O8CA 5HF5A 1ZN9A 2WMOB 3TZCA 4ETMA 1NBEA 1JYFA 3HKEA 1LKZA 1OR8A 2RHLA 1ND5A 5K4HA 5JH7B 1SG6A 2VWQA 4K9MA 4C4TA 4LYDA 4JJEA 4J49A 5KNDD 3P97A 2GEKA 5CTJA 4E2YA 2WXKA 1DHTA 1HE4A 1H1DA 1QVWA 4L16A 3MCTA 3B7PA 2I1VB 4ENSA 3VNUA 4QGBA 4GVPA 4W4TA 4DBZA 1F9EA 2CHQA 2DZDA 3SJBA 3QARA 1ZICA 1JNXX 2H1VA 3KIPA 2FZWA 1TCVA 3HZRA 2IP1A 3G0BA 4KFTA 3EHEA 4RQIA 2WU0A 1TYAE 3EA0A 1VMDA 2IEZA 3ADBA 4OXQA 2NADA 3OM1A 3IP6A 3DBRB 4RTQA 5DASA 2AKAB 1PYGA 1I3CA 1N6PA 4YRSA 3IKJA 5IT4A 1EM8B 3MFQA 5ABPA 2LIVA 5IMBA 4PZAA 5DI9A 3ESYA 3IAUA 4D6YA 3HDHA 4DRZA 2H1HA 1LFDB 2COKA 2Q7DA 4DNXA 1X38A 2J5QA 1UWLA 1R8JA 1RRGA 2Q3LA 1L3IA 3RFUA 4QJ5A 1YCSB 2YS7A 1VKNA 3HCEA 2BGMA 1E6EA 2XCOA 2XUZA 4MMYB 4NFHA 1CQPA 4XX5A 1CTQA 3BBPA 4UTVA 2DPLA 4G0MA 2UYHA 4O2AB 4I8DA 5IDWA 4J7XA 2P9CA 5TPZA 5DYYA 3Q7PA 5ADUS 2GH1A 3FUXA 2F3SA 1JSXA 1CY2A 4UVGA 3DMNA 1A77A 2YIDA 1IHDA 3ZVKA 1V5WA 4TGLA 2W70A 2I1JA 1GZ6A 4LJRA 3UFXB 3EA5A 2NM0A 4F3TA 3KL2A 1RM0A 3TIIA 2CW5A 5DCYA 1GVHA 3E7PA 1JWAB 4P4GA 5JCJD 3TWUA 1S8NA 2FMIA 2IYPA 1I2MA 4W5HA 2JLUA 2GYYA 4PBTA 1VKHA 1L5QA 4RL6A 2ZXEA 2NU7A 3L7YA 4NNPA 2WU8A 2C7GA 4WE3A 1WCV1 3TLGB 4GM1A 3ZXXA 5IYZA 3S55A 3B51X 1SVXA 4Q39A 3KTOA 1NP3A 5HTOA 1RQRA 1GG2A 1O9HA 1HDYA 3TWSA 2YJ5A 3FPJA 1BE0A 2UZAA 5C1OA 4ANWA 2LXLA 4RH1A 3VR4H 1Z2PX 4LMAA 5DNAA 4NCNA 5A6SB 3V7WA 4KI7A 3UOGA 4OH7A 1GQSA 2NOAA 2AQ8A 4RPCA 3LBNA 1LBHA 1IL0A 4IX1A 1P7VA 3M4JA 4TM8A 4EENA 5GOZA 1J5XA 1JR2A 4CNBA 3EEBA 1QLHA 1YAHA 2QYOA 3O91A 5G05J 3NBXX 5IP5A 1LDEA 2RHGB 3LD9A 3IQHX 1EDOA 1I3MA 4M87A 4UM7A 1F8XA 3H3XA 2XVYA 4DRYA 1ONSA 1A7JA 2DE0X 1XPOA 2Z8YM 3TZLA 3L6BA 4L57A 4YLEA 3L1HA 1KNQA 1G8KA 2JGEA 4TS4A 4AZ0B 3R40A 3F7OA 3ECAA 4Z99A 3P9ZA 3DXXA 1GTL1 1QF9A 1KPHA 3WIDA 5A0FA 5GZ3A 1DL5A 4H4CA 1YL5A 3ZCUA 3KJHA 4HGQA 4RA9A 1H69A 4RBNA 4WCFC 2XVAA 3ORFA 1RRCA 1L7QA 1OXMA 3BG0B 2HTEA 2UZ4A 2I4LA 5JRZA 4LMPA 3JCZA 4J4TA 3SEQA 1JWGA 1UC9A 1KE1A 5H4HA 1NMYA 3Q7RA 3RS0A 1GW6A 5IAOA 1U0BB 3SN6A 2YXEA 1AQLA 2A3NA 1HZ4A 1RLOA 1P5ZB 2IZZA 4GZ5A 3EGXB 4YP9A 5GGXA 5TF0A 3EZFA 2WXJA 3V4SA 4LQLA 2ZWAA 4Q1AA 2NU6B 1C80A 3DW3X 4JLJA 3AR7A 1POWA 5EOVA 2OQRA 2JLSA 3BSWA 2GEDA 3ZQUA 2BW0A 1BS9A 1NT4A 2P6MA 3NHBA 3OPXA 3N2ZB 2ZRBA 3SXJA 4CIYA 5DYGA 1IHPA 2AL7A 3I5PA 5H68A 2REBA 1UJNA 3FCSB 5CM8B 4QOGA 2CFUA 1UDRA 10MHA 1AQ6A 2AQHA 4W8GA 4BY9E 2F8XK 5IJ0B 1FRZA 2FEKA 4YP1A 1LF0A 1G17A 3EUWA 5JXGA 1YJQA 1ECGA 3G7SA 4YIKA 1EGMB 4IFIA 4CT4A 2WZCA 3MYVA 3AUJB 2VDQB 2X42A 4DRXE 4GYKA 2V3WA 1QO0A 1JG1A 1K98A 1VE5A 2H16A 1R0SA 3R5SA 4E15A 5FUMA 1V4VA 2SKCA 1YJAA 2QN9A 5C7LO 4DQ0A 1NQXA 1R6AA 3TTWA 3U3DA 3MWDB 3SVZA 3D3EA 1T8SA 3C3BA 3DMGA 2IYWA 2BR3A 3PNBA 5I51A 2J85A 3C6MA 3ZCXA 2OYCA 2AHOA 4XPIA 5HILA 1U8TA 3S7FA 4MSUA 4U6QA 3OFKA 4JLOA 3ETCA 3PQ7A 2VJLA 3O8BA 3OCXA 1X92A 4YONB 1C3OA 3KKOA 3PNTB 5TSDA 2RGXA 1J9ZA 3DYBA 4M22A 7YASA 5DF1A 2VCYA 4BY6A 4K5CA 3VR5H 2FTKE 4LNBA 3EF0A 2O2HA 4C5CA 2TRSB 1XDBA 1N25A 4ZQCB 1KAQA 4HEA6 3KVNA 3KEGA 5F78A 1KJZA 2ZUWA 4HOYA 3QKWA 4CG1A 2DBVO 1TEHA 4MI9A 2Z0MA 1WPRA 1P29A 2XYPA 3JAKA 5A3QA 1H9AA 2WE8A 621PA 5H5JA 1QGOA 3ETNA 3NJRA 4S05A 3WS7A 4DLWA 1F3OA 2WWGA 2Q6OA 4JI3B 1QOQB 2WDPA 3AF1A 1RHJA 1W7AA 1RXSA 1N78A 4ZANA 3VJMA 4EPZA 4RG6A 1QC5B 4U8HA 1TZKA 1OLXA 3F7MA 4KREA 3N07A 3TPCA 3ERCA 5CEJA 3AR6A 4YUWA 5E9WA 1I4LD 3EGCA 4RENA 3DXYA 3IERA 3K0FB 3H9JA 2W2KA 4L7VA 5EKTA 2MSLA 3SVLA 1VLLA 1XMSA 2W7TA 3QLJA 5TGZA 1N92A 2V3VA 5ES3A 5J9FA 1FP7A 1HETA 4F86A 5SICE 4ZMBA 1COWA 2P5YA 2WSMA 4P5DA 2QE6A 3R2JA 2RGAA 3ZU4A 2IU0A 4IINA 3K5PA 1KK3A 4MTLA 5AJTA 3GBVA 2AB0A 3FHOA 4HWKA 5JCPA 5HCNA 3A6EA 4EKNB 4F8JA 2HLDA 1N2OA 1QYIA 2F3RA 4AN1A 3VU3A 5EL0A 2PKWA 3D1JA 3TO5A 4B74A 2NP7A 4G85A 4QA9A 3DZFA 1K1EA 4DV5B 4JPSA 5E1OA 2HO4A 3EISA 4ZWNA 2JBAB 4JLWA 4B3SB 4G4GA 3SKVA 1REQA 3OPYB 4J0GA 4RS4A 2ASEA 4UE3S 1NMZA 3SQXA 4WADA 2P58C 2XZPA 3DWFA 4QPZA 2Y6VA 3V4RA 3L82A 2JG3A 3QFHA 2CNWA 2QRMA 5IH3A 2DSNA 4E6EA 2DZOA 4E22A 1XYYA 2IUSA 3FROA 5F12A 4PLHA 4UQPA 3PJEA 1GPWB 2WXIA 5E6UB 2JFBA 3A14A 4AY6A 2XRZA 2PX8A 2HBZA 2BGLA 1U0JA 4QFBA 4QUKA 2PYIA 2B3TA 3IKMB 4EFMA 2J3LA 3COYA 4JEMA 1F06A 3CZ5A 3OQJA 2WKSA 5HK9A 4K5QA 4KRGA 4NCAA 3OQIB 2ZI4A 1CIJA 4XQGA 1WHSB 1E7VA 3ACBA 4UBIA 5G2OA 2B5VA 3RJZA 4HFMA 3PE6A 3RSFA 4F6LA 4P80A 2XUFA 3QZUA 4RY0A 5D7NA 1AK2A 3ZEFA 3I2FA 2PU5A 4GKBA 4EA9A 2OGTA 3RAEC 1E18A 4K87A 1DGQA 3FJYA 4LA4A 1N8SA 4PNEA 1VIYA 1RS0A 2VN8A 5TEVA 5G53C 1ACLA 3CW2A 1DUSA 1RP1A 4V0OA 4BETA 5JSFA 1H22A 4O4LA 1O8BA 1M5RA 4R1TA 3OZ7A 4Q9DA 4ZV7A 4G0WA 1C3EA 5CX4A 5T67A 1YVEI 3PGVA 4OJMX 3DFZA 5BUZA 4LJ4A 5EPUA 4HI8A 4R2MA 3IIIA 2EWWA 3MB5A 1YC2A 1IULA 4G1VA 2X2FA 3ILVA 2QVBA 3L9XA 2C92A 3AOEC 2WFZA 3ELDA 2FULA 1JBQA 1Y1QA 1KVQA 2E4WA 3IP7A 3GZNB 3WGVA 2CFIA 2VYCA 4CR6A 1GKKA 2R1VA 4WECA 5B1IA 3ZDRA 1BS1A 2XHEA 5ENPD 3IUSA 5IVPA 1TU0A 1MPTA 2ZUEA 3BAZA 2PQRA 4YX9A 1NUTA 4YRFA 3ZIAA 3UAXA 4ZYVA 3GHHA 1PR1A 1F2VA 5TNXA 3SI5A 1Y48E 4A8JA 2PGIA 3DOCA 3RBAA 4CMEA 3LPCA 4MQEA 2MWMA 2JZNA 5JSUA 1ETUA 2GPJA 1G5IA 3FPFA 5D84A 4YV1A 1T0IA 3CV0A 2OSBA 1TNBA 2XDQA 3AVUA 2BR4A 1RJGA 4TQ9A 5I6DA 4AURA 2G0TA 4J8PA 1G6HA 4B0OA 2DHRA 1ZD1A 4NXNB 5JQGA 3LZDA 3BU8A 4HWSA 1Q6ZA 4EW2A 4Z4GA 4A2WA 3A9UA 4DXAA 2HA0A 4FKBA 3UFBA 4UDNA 1SFRA 2QVGA 5EXTA 3RSOA 1T4GA 2WT4A 1M1YE 4OYLA 2JGJA 3IJEB 4AX8A 2P2YA 4MAMA 5EE3A 2DVMA 5KYYB 1TMOA 5KJ1A 1C1DA 1P6QA 1E64A 2ZGVA 4BO4A 5KVAA 2EFHB 1ESMA 4HVTA 2AJTA 3I6ZA 4FOPA 4DV2B 4PICA 4DNFA 1A4UA 3WQBA 4PTZA 4MB0A 1EIZA 1NF3A 3CLSC 4O63O 1TFRA 1D4ZA 2ZIUB 1RZUA 1QCDA 1MABB 2P9ZA 1KDOA 1EP9A 2XVMA 1GZ7A 1Y6RA 1Z6XA 2PANA 5KNCH 4J7CA 2AE1A 5ES4B 4KOAA 2HQ1A 4PEVA 1Q0TA 3RYIA 5B64A 3DO6A 1RPTA 5IBQA 2EKLA 4KGZA 1QUFA 2VTEA 3H4IA 2GZ2A 4ND8B 2ZRKA 3OG9A 1BVRA 1KVRA 3LUPA 5LQRA 1VTKA 2JFNA 1HNNA 5JRDS 4U39A 2B9VA 2CBGA 2IYLD 821PA 1XZ8A 3R6TA 4YR9A 2BP7B 1WXIA 2BONA 1ETHA 2JIMA 3PR2B 3BXPA 3LOQA 1EH5A 1ECJA 3W2FA 3OZGA 1EFLA 4MMXB 1R5NA 4OY3A 3V8VA 3H2KA 1D1TA 4JL8A 1H4QA 2WYWA 2GM9A 2B94A 1CY8A 3JRNA 2BF7A 4WWOA 1SG9A 1U1GA 3BFJA 3G8AA 4JI0B 4PG6A 4PC2A 2QQEA 4GSKA 1HDXA 1CJKC 3KZKA 4CKEA 4EARA 4R4JA 4K28A 1PL0A 1JZSA 1CEXA 4AJ2A 4HAIA 1QPZA 4X91A 1E89A 1NN3A 4LISA 4UHHA 4OHCA 2QZAA 3KZ1E 1PU2A 4MV7A 3K9WA 3VDQA 3VJLA 1ADYA 5C5EA 2AG0A 4OHPA 3FFBA 3H3FA 3ZD7A 3HSSA 3S2SA 5BSMA 1FTGA 4G89A 2WJYA 3T7AA 4UTRA 4OBBA 5BP7A 1CQIA 5CH8A 1PR2A 1F12A 1S7GA 4QJBA 3JYNA 4QLOA 4DMGA 3BE6A 1A2QA 1Y8RB 5L4LA 1NW9B 3H87A 1KO4A 2FQQA 1E2IA 3EN0A 5JXHA 4A2QA 3DBSA 2H18A 3HRIA 5C3MA 2P2GA 1DSSG 4X1IA 2Y4TA 3DP9A 3VHLB 2PT9A 5D3QA 3TSZA 1PJQA 5K0SA 1JQDA 1YZGA 5JFOA 2RB4A 1SA0A 1IBLB 1HX8A 3T4UA 2QRPA 3DR5A 3UHAA 2CUKA 3QF4A 4DQVA 1MP0A 5C80A 3V1UA 2WUWE 2C4HA 5HSGA 4RXTA 4OA5A 3HFJA 4UHDA 3F5SA 1NA0A 1UXGA 3JQEA 1AKTA 5BT8A 3PHBE 4HBGA 1TXGA 4DCOA 3MTJA 4TTQA 3FP3A 3WLAA 4WXHA 4HNTA 4QPDA 2H11A 3ILSA 2JHAA 4L5CA 1EP2B 4OKIA 3AY0A 3HXQA 4UASA 3BD9A 3ODPA 1OI7A 2PX3A 3PSAA 3WB1A 3NJ4A 4V2IA 4QXAA 1FRQA 4CVNA 3DDWA 1M1UA 2IW1A 3GGDA 5EILA 1UOHA 1PZFA 4YR7A 2GZ3A 4KXVA 3WLSA 1W6UA 7REQA 1Z83A 4MR8B 4R7ZA 4FHGA 4MV5A 4TUMA 4KYVA 2Z3WA 5ULLA 2CDCA 3OU6A 1NBWB 3ZWNA 5KYNA 1PGNA 4I7EA 4YNBA 1TW3A 4YP6A 4QQRA 3QMWA 3EGVA 2HBRA 2QW8A 5HNKA 3L5KA 3NWOA 3AR5A 3TWQA 3KRTA 2J33A 4GTPA 4UWKA 2VHVA 4OHFA 4KPEC 1PFGA 4E5DA 4NYIR 2I65A 1IRXA 4Q00A 3CF4G 3OO1A 3IDOA 3KPYA 5BQPA 1M2NA 3SFXA 3ETJA 3L7OA 3AFOA 3S8EA 5TQJA 4ANXA 2EFEB 1VIAA 3ZI4A 1AD2A 1UBJS 1SB9A 3K16A 3K73O 2CDRA 5J1SB 3BCUA 2QXUA 4PC6A 2Z6VA 2ZCVA 2PO5A 2WKRA 4NIKA 5FOSA 1A8QA 1SVSA 4YXWA 4ENVA 4UWLA 4CG0A 3N0VA 1ICEA 3AL2A 1NN1A 4M1OA 2JD1A 4MUGA 2W2PA 2EW1A 4M88A 5E6SA 3FX2A 3PXCX 2IIPA 5KKNB 2ZRAA 2AT1A 5LQKA 5DBFA 2ES4A 3TSAA 1H0HA 5M7EA 2C7PA 1EB9A 2PWPA 4NYJQ 4NOMA 1IOVA 3I2GA 3A37A 4TUYA 1XEAA 1PJ2A 1U8AA 2V59A 1XNHA 2B82A 1DBQA 4KT6B 1AXRA 1LUAA 3BD7A 1EE2A 4YAJA 4M38A 1U8FO 1EFRD 4QYSA 4G9GA 4LV8B 3HB9A 2ZB7A 1OPXA 2EKQA 3R7NA 3TB6A 4AKSA 5BNFA 3WGTA 1M1NA 1BEUB 2ESRA 4YRJA 4CZ2D 1Z7EA 1Y8QA 2BR5A 4F5ZA 4EKYA 3EXG1 5CIYA 2JJ8A 4RA6A 4ZU1X 1JDJA 1PZXA 1DARA 2P30A 2ZSKA 5ENZA 3KVYA 1GCOA 1XZMA 2JLRA 4C1NA 3HDXA 1M2WA 1PG2A 2VKQA 3AHCA 3WIBA 4ND4A 3FI0A 4A82A 3ESXA 4C6RA 3EH1A 3AJIA 2GHTA 3GP5A 3O82A 4KLNA 4JBGA 4CCAA 5IT5A 3FDXA 4BU0A 5ALSA 1ZZGA 5BW5A 1OTXA 4JEHA 2ORVA 3PZ2A 4QGSA 3I62A 1UXJA 1QG6A 3DOIA 7MDHA 1ZGGA 3RJMA 5JSYA 4OUDA 2J46A 4JSYA 1W44A 3IMEA 5K0BA 5ECWA 4V1CA 4NY1A 4A6DA 3RKSA 3P5BA 5BWCA 4L73A 2L17A 3O6VA 1NRIA 1VLQA 5JWOA 1DTEA 4PSAA 2QRJA 4X41A 4L4XA 2CXUA 4I9EA 2FEXA 3TIXB 3ZIAD 4YDRA 3R7RA 4Z1MA 2IS1A 2IPNA 4HB0A 1GR0A 5ED0A 2CT8A 3HDJA 2FEOA 3L04A 2EAUA 4FZVA 1VIVA 3L0IB 1PNOA 4X63A 1PFKA 4HNRA 3UMGA 3PRZA 3GFVA 5AI5A 3RADC 5I5EA 1W76A 3G9UA 1N9AA 4WZBB 4BP9A 6Q21A 3TMKA 5CCLA 3B13B 5IDYA 1KQFA 3HTXA 2HDWA 1YXMA 1NKVA 3N71A 4OGLA 1JUQA 4BVGA 4QATA 2CVOA 1FT2A 4C0LA 5LCWC 3RRYA 2P6PA 3WMEA 1N1EA 4H08A 1G20A 4O08A 1ZA1A 1DE0A 1UDWA 1DIGA 5T41A 5AUPB 4P3NA 3D3KA 1KEZA 1CQJA 3RARA 3MIZA 5EHZA 4MQ4A 2DIWA 1PR6A 1SEPA 3IQFA 3W8RA 2OXIA 3VJKA 3U3RA 1KETA 1AUVA 5FOTA 2NSZA 2PM8A 3AUFA 3QYFA 4IDDA 3H5IA 5IMSA 5BNWA 3WA6A 3ZJYA 3VPAA 3AVPA 3T5TA 1SQFA 2C9YA 4S1NA 3WDSA 5CEFA 3VI3B 4F2GA 4GDFA 2WP8J 3JR7A 1U5AA 1TNOA 2HMYB 3OIDA 5B2ZA 4M9SA 3QUAA 1XRMA 5BORA 2WINI 3AVQA 4ZPJA 3M70A 5E2AA 2OYRA 3ZDCA 1HYEA 1X7WA 2I9KA 2CFTA 3ONLA 4NULA 3L1KA 2AW3A 2BFFA 3K2BA 1OLSA 3DE3X 3OOSA 1IU9A 1V1RB 2XZTA 4ZD6A 4RETA 3KAKA 4F72A 2RFAA 3L6AA 2GROB 1NSFA 2ETCA 2Q3MA 4WKCA 4FYKA 1YUBA 1ZOPA 1K2VN 1GARA 3ZE7A 3N5KA 1RAGA 3EDMA 1Y81A 4DNPA 4ESHA 3LVBA 3WLNA 3LM8A 5KTMA 4K7JA 4OQQA 3K9LA 2AUMA 1MOQA 5L3QB 2H4HA 1QH1B 4JYZA 3JQFC 4ZQBA 1XKXA 1U9CA 3EUAA 2ILTA 2Y0EA 4B5KA 4E2WA 3JQ8B 4HNSA 2PFKA 3L1IA 3JR3A 1DAGA 4HDCA 1XCJA 4LOHA 4BO5A 4C6TA 3QW2A 2WF7A 5TXGA 2WTXA 5JE8A 1XLWA 1Z28A 2YRXA 4CL0A 4EUEA 3UQYS 1SG0A 6YASA 5K3FA 4XXHA 4D6XA 1LWNA 2FN8A 2PMFA 3BTVA 3SC3A 1CS0B 4TLMB 1PIWA 4CETA 3DPYA 4OQFA 1MF7A 3ASZA 2AEJA 2BI4A 3GDWA 5BWLA 1FBTA 1GPNA 1TL7C 4JIGA 3KYDB 3UMJA 1N4SA 2E7ZA 4YN3A 4JU8A 2NPIA 1YFJA 5JSHA 1JG2A 2FQWA 3JQAD 4LZOA 4GPEA 5CPBA 4ME2A 3E82A 5HRUA 2CLMB 5K8TA 3GCGA 4LCBA 2JPDA 2KBEA 2X2EA 3JD4A 2O06A 4FSDA 2OK8A 3AF3A 3EVGA 2RJ3A 1Y3DE 1V3VA 3CVWA 2ODAA 3VNSA 3D2LA 3W9BA 4D0NA 1YMQA 3N0TA 4BYGA 1DCFA 1ISPA 1HQDA 1KIMA 3QLUA 2G36A 4NP6A 2PNJA 3TUJC 3JTEA 3GFGA 4KPUA 3TLKA 1VFPA 4AKTA 1HEYA 3R3VA 3FYCA 1KRHA 3SCZA 2ORED 1Y5MA 3CU5A 3EEOA 1IJEA 3ABQB 3TVTA 3FTZA 2Z56A 2YHBA 1N2IA 3AH8A 2O4UX 3AEUB 2W6IA 3LOPA 1H3NA 3GAAA 2Q9AA 3R6DA 1VPVA 4MS1A 3ABSB 2JCYA 1ZJWA 2VQEB 2XOKA 5IDXA 5I9NA 2HRQA 3UYKA 1SQGA 1Z8FA 3JARA 5J4KA 5EXDA 1QFSA 3KU1A 2I4IA 2P40A 5JNUA 4TMFA 5BT1A 2A0YA 3B8HA 1XVLA 2Z83A 1WMAA 3C5VA 3CCFA 5ALQA 3NPMA 5KINB 1H5NA 4KNYA 2LZ0A 4FPXA 3Q3JB 1FDRA 5HKLA 4MINA 1TI7A 4U0KA 3CIFA 5E7JA 4L3OA 5TT0A 1K6MA 2OBLA 4YC7A 2XVZA 5L40A 3ES9A 1KORA 3L0PA 4KU4A 1OI4A 1TAGA 1M2KA 3MSXA 3L4JA 4OYRA 4RE6A 3RWMB 1Z5NA 1K92A 5JR3A 4YO8A 1B3RA 1B0ZA 2R02A 5FBQB 1IM5A 5E3JA 1X13A 2GRUA 2FPGA 1Z6QA 2RGRA 1P8JA 5JU6A 1JIUA 3CE9A 2WICA 1KLXA 3HCPA 5JIBA 3NYWA 4C0JA 3HXOA 1M2VA 3K6SA 2QBYB 4BPRA 4WNGA 1HDOA 2PMDA 3SD7A 3AERB 4BLWA 5J08A 3EB9A 5A9TA 2WILA 1I0IA 3RVRA 1RM5A 1RKBA 1NQ5A 2QJOA 4ZT4A 4PZZA 2VJOA 3LCRA 4WJZA 3UMSA 3L0SA 3C6YA 1QRSA 3GL9A 4YJDA 2QLJA 2ZATA 4PTYA 4Q02A 3FVQA 3S7JA 1HTBA 3R7BA 3CUEF 5F23A 1R5JA 2UUPA 3D7NA 1HFKA 5EAIA 1X7ZB 5CA1A 2EILE 4TTPA 1UODA 3H75A 2ASVA 1E63A 3KG2A 3CG4A 2HHLA 4B3TB 4KQ6A 3JD2A 3EW9A 4NFSA 2D2FA 3ZUVB 1G98A 2QPTA 5L6LB 1DCEA 3UO8B 1KYVA 4LG6A 3AVXA 3C74A 3GBSA 4DLKA 2RH4A 1KR5A 2ZBRA 4H6VA 4ZJZA 5JH7F 4PNHA 3OESA 1LBTA 5C1BA 4HFNA 4UM8B 3IHKA 4RQBA 2B61A 1G5RA 4OI1A 2HRBA 4NBRA 4B8ZA 2EDAA 4YCMA 2GCGA 3ZLBA 5EJ8A 3OTQA 1XPJA 4IUDS 4NE7A 2RSLA 1NUUA 1NXWA 3P8ZA 3IX7A 3PX3A 3TNJA 1CUEA 4PX5A 3VPFA 4C3UA 3A9TA 3ABIA 1VJ1A 4PYNA 4ZCMA 1B3BA 5F5XA 1JA9A 3HV2A 2PRZA 5BNZA 3NIGB 5EJ5A 2PZEA 1BYIA 3TRHA 3CHPA 2CL6X 1U0EA 1SC9A 4L8FA 4X6LA 2QX9A 1GNPA 5E76A 1L5RA 4MWGA 1ZJ5A 3FDFA 2XMZA 4LWOA 5JAQA 5EJ7A 3GZSA 5J4VA 3W7VA 5M2QA 1H23A 2IE8A 1NXTA 1DX9A 1A3CA 2A1UA 2ST1A 1E9CA 3OWOA 1AB6A 1QP0A 1INLA 4IH1A 5E1MA 3V80A 2PXAA 3X43A 1XD2A 3F6RA 3RG2A 2F1JA 4E11A 5LP0A 2FSIA 2Y27A 2JD2A 3COSA 5EPEA 3UPUA 4O2AF 4N8DA 3FZEA 2RC5A 3IHVA 1J8QA 4JOSA 4WPGA 5A5EA 1ZBDA 2R7MA 1H2HA 4XARA 3WR5A 4KAXA 2IH4A 2XMQA 2CMGA 1DWOA 4BVAA 2Q3BA 2D06A 4OL9A 3KLNA 4LG1A 3M8KA 4QIHA 4DDTA 1IIBA 1L5FA 1P33A 1L0BA 2ZT5A 4BMSA 4C88A 3OCZA 1TQHA 4OJKA 5D6OA 3QBJA 2EKDA 1QPGA 3KSZO 4BIMA 4Z1MD 3WYFA 3A7EA 2YJTD 4N6NA 4FBGA 2XUKA 1Z8NA 2EU8A 4X8LA 4I55B 3BORA 5J5CA 4GC9A 3CKBA 2O9JA 4O0LA 4XQ9A 4E7PA 5BXQC 2VPIA 2WVJA 1G3IA 2E55A 3EGDB 2ROQA 1ZIYA 2R96A 3IQWA 1XMVA 4YI5A 3GVCA 1B0UA 2P7HA 1XTVA 4CPDA 2NYVA 3ZC3A 5GOTA 3ZXSA 4J0UA 3OO0A 3IBGA 1R0KA 2XECA 5MF6A 1OCRE 3RH0A 2POCA 3E0XA 4MS3A 1YVDA 1J0EA 4GH5A 3IAAA 1A9PA 4ZT2A 4F9GA 3SBTB 1A97A 4J3JA 1WS6A 4KRFA 2H0RA 5ALVA 5G2NA 1BU5A 1DJOA 3KR1A 3OLYA 4U2BA 1A9QA 1P77A 4XX0B 1FLNA 1POXA 1P6UA 4N3CA 3CX6A 3C15C 3NDIA 4Q03A 3L6UA 3ZDBA 5BQXA 2VSOE 4Y18A 3RFTA 3I9JA 3AM5A 5MHTA 1DBPA 2WZQA 5SZJA 1QIJA 3V6MA 3G6KA 3UWOA 3BTSA 2Y0CA 4TKUA 4AYTA 1SRRA 4EIWA 3PDCA 4YMGA 3NB2A 5HIAA 2YWDA 4MO9A 4C3VA 3IQIX 1A5BB 1RC1A 3HPQA 2XB8A 2IY9A 4HB5A 1W3BA 1J21A 2WVIA 4NPHA 4U0ZA 4RW0A 1XI2A 2O1SA 3H11A 1DAPA 3P9RA 3MBOA 4DMMA 4RXUA 1W5AA 3QYAA 4HXGA 1CUGA 5CK5A 2UYGA 2IS2A 4G5QA 2I80A 1UKVY 3KLPX 1R0XA 3S2IA 5H81A 3F98A 5B6IA 3GRKA 1IXKA 2DUUA 1NJ8A 2PLNA 1U7DA 5K3AA 5CD9A 2I2DA 2I4NA 2ZZKA 3CQGB 1XAHA 3W34A 2CXNA 3BA1A 2BBOA 1GA6A 4ME6A 3ILHA 5LJIA 2PWBA 3A6JA 3JRWA 1E9AA 1JDVA 1MX6A 3MMSA 4GW3A 1GTZA 2ZETA 1JVNA 1AMOA 1HQYE 1TZBA 2ZYRA 3VA7A 2GNPA 3VAZA 1XTZA 3LUFA 4IUBS 2VRWA 1U4SA 3GGOA 1C29B 1VL8A 2J9ZB 4I8IA 4LWPA 2QP4A 4QDTA 1G5TA 1I0ZA 3FDHA 1AQNA 4Q96A 2KB0A 3PL5A 1AUXA 5AR1A 2OB2A 1LQTA 5A7FA 1D03A 1YI8A 4PZUA 2EL9A 3H2IA 1XZPA 5EVJA 2CJXA 5EUMA 5B3JA 3AY3A 3F5DA 1YHYA 2WIJA 3UMVA 4UQLA 4L7TA 2C5BA 1B26A 2XY4A 3AKCA 1B0AA 1D8AA 1U0GA 4A27A 3EW7A 1N5DA 2GDZA 1CIVA 1T8WA 1VIMA 1XDUA 3KTFA 3ENVA 3EAFA 4K88A 2FPIB 3KK0A 4LK3A 1Q21A 4DR1B 2PZGA 1G21E 1Z15A 5B58C 1I4DD 1JMVA 4GPIB 5LNK6 3ABKE 2KPOA 3ASHA 5TS3A 1Z0IA 2GCEA 3K31A 3VU9B 2OQ2A 1UP6A 1NV9A 1C9MA 1LDYA 4GAAA 4LSZA 1LVHA 5A1TA 1IG0A 2ZUVA 1TJ4A 3P19A 3C7TA 3CYFA 4FDLA 4IFTA 3PFBA 5I9MA 5I9LA 4GXQA 1OX4B 4LDAA 4CKBB 1PE0A 4L1BA 1NQOA 3AYZB 4K03A 2SHKA 4CGZA 4EEXA 3CT6A 2PR2A 1ODKA 3EU5A 1X7HA 4EFLA 4JLDA 3SSAA 4L9PA 5IX8A 1JBEA 3N05A 1YB1A 3ONWA 1EUYA 1QX3A 1YZHA 1RW4A 2VDPB 5KB3A 1LDNA 1U7PA 1PVOA 2XZDA 2BISA 4MEAA 4FOSA 1D4FA 5A4KA 1EJ0A 1XELA 4U3JB 1C0KA 3EXAA 5KSWB 1ZSNA 2Z6UA 4IDAA 5GJCA 4XJTA 4GMDA 3VR0A 5L8VA 2WMNA 2BBSA 2JFYA 4BB6A 4R5MA 4UFNA 4L0QA 2NO1A 4WVFA 2QVXX 3FLEA 2XAUA 5HM6A 1M54A 3KP1A 3MWFA 4Y2TA 4LJSA 3QWAA 1XPRA 2V7EA 3VNQA 4L23A 1PJBA 3HABA 1PEYA 3O4JA 2MR5A 3ETGA 4BCDA 1B8VA 3D7SA 4E5PA 1VSQA 3MLAA 1E96A 1HT3A 4Y9SA 1NA3A 3RS9A 2QWXA 3D2CA 3F71A 4UUAA 1BCRA 3U16A 4YAFA 4D81A 1O6ZA 3KSUA 3OX2A 2HJHA 1DFGA 2NVWA 1DWQA 2PX0A 4W9MC 2C5HA 3OZCA 2BPOA 1MDFA 4KQCA 3BILA 3ICOA 4A55A 4RMIA 4UARA 2DLDA 3DUFA 2OBNA 2XW6A 1X8XA 2ZJBA 5BW4A 4RJLA 4CKCA 4A3VA 4QPCA 2Y3AA 4OSEA 2I4RA 1JE0A 4LVNA 3IIJA 2NSDA 1MMFB 1DKUA 2QVZX 3I34X 4DANA 4WZAB 1TA0A 1RRKA 3LKBA 1B8UA 2ADOA 2BZGA 4H60A 5CYOA 3ROQA 1FUUA 3U19A 1MHTA 1NXPA 2PX2A 2WHYA 3OP1A 4NU6A 1QKIA 3FH5A 1HURA 3UH1A 1TVKA 3ND5A 4F3NA 1RHQA 2OWEA 1EWTA 1WXXA 1MOZA 4OAPA 1UFQA 3DULA 4P54A 3EUFA 4EY8A 1L5OA 1XVIA 4TLDA 4EVSA 2CNNA 4WGFA 3AFMA 1U28A 2QJWA 3INNA 1R0LA 1XT6A 3CFYA 1IPEA 5F98A 4MR9B 2VTKA 1A69A 2VYIA 2WTMA 4MQMA 5IAGA 2AK3A 1I5EA 4DR7B 3E9MA 4LTNA 1W52X 4ZQHA 3LY8A 2WPNA 3EXEA 3GEBA 3W9YA 1CY1A 1VE6A 4RFSB 3CLTC 2W6CX 1DTWB 4RVFA 4QBGB 3L0YA 1ISHA 2YUIA 1PKEA 3K0BA 1QONA 2IIBA 3UMRA 4BQFA 4ZVVA 4U0JA 2BC9A 4UUMA 5KJ6A 3GLIE 1NRJB 5AQ7A 4Z7OB 1ZC3A 1U8UA 1I8TA 3KFLA 1W59A 2C4NA 1J5PA 4NNJA 2ZSDA 1UCFA 4G5SA 4Y1RA 3SO8A 2C2YA 3K94A 4DIOA 2H5JA 3AESB 4JJIA 2JA2A 2L82A 3UAGA 4ZI7A 3P9PA 4BC1A 1EXMA 3GN1A 1KOGA 5E9JA 4EJFA 3I1YA 1NURA 4EYEA 3LGXA 1E8XA 4ZVMA 1D1PA 3OTHA 4EI9A 1BG6A 4LGVA 1MZVA 2NUPB 2VNSA 4M6WB 3IBYA 2IF4A 2WK1A 3G5AA 3FPAA 3PHIA 3KJFA 3P27A 3BGSA 1T9HA 4L4ZA 3I5AA 1YT5A 2R97A 3LYUA 5HE8A 2QUJA 2ZRQA 3E5NA 1UBRS 3F78A 3UC5A 1HYHA 1QRAA 5EWLA 1SUPA 2C98A 1K0UA 3QPCA 3PEEA 4S1WA 1EK2A 3HJAA 2BFPA 3BC1A 3FCEA 4LBWA 3VH1A 1MOPA 3HXEA 4EJSB 3BN3A 2VJKA 4J4BA 1N54A 4EFKA 2ZG6A 1EZ4A 3HYLA 3APFA 2J3IA 3QWPA 1J7JA 1ZD9A 4DDVA 4ACBA 1SCUB 1B1AA 1COZA 1LNQA 4LYAA 1YIOA 2VZ8A 4CEIB 1N2CA 2VK8A 3WWZA 2GJSA 2WWYA 3UWMA 3A6DA 3DVLA 1MEJA 3CF0A 4JA2A 4I9HA 2WTUA 3GEDA 4KWEA 3O4VA 3VDMA 3DC7A 1SB8A 5CLHA 4YGXB 2X1MA 4M7WA 1IWBB 5C8XA 4IIUA 4UNRA 3CZPA 3MLEA 2R05A 2QGZA 2UKDA 4BWGA 4G1UC 2FW0A 4QJIA 2CHXA 1CB0A 4I46A 1YL7A 4XW2A 3LHDA 2O8EA 4FNOA 4HH4A 3RWBA 3OWXA 1W19A 3DDSA 3LL4A 4CIWA 3MGKA 3QI7A 3GJ5A 5FWXA 4G8JA 2CXTA 4LUNU 1UXIA 4TWRA 3M3PA 1J99A 4MRSA 4RORA 2OO5A 2OCXA 1TIPA 4WQMA 1V55E 1LEHA 2AMLA 5I48A 3MJ4A 1Q6YA 1QYVA 1J8MF 3ZHEA 1E9RA 1R6BX 1KZ4A 3AS4A 4D5GA 1FUKA 1TR4A 1U6IA 4MW2A 3SP1A 3FMVA 2WHPB 1UKAA 2KCLA 1M0WA 4N2QA 4O6VA 1XZJA 2QXYA 1IXRC 4QL3A 4RIIA 1JI3A 3Q9NA 1DKPA 1EWVA 2R60A 4CBVA 3TUZC 1UR5A 2YMQA 1O9GA 3EHNA 2AUTA 1WO8A 3D8UA 2VPQA 4G09A 3PNVA 1QFXA 3H0KA 1LTHR 4C0BA 1OZFA 4FE3A 1X1BA 4DVGA 5ILGA 1MQAA 3Q3HA 1KI9A 3U7RA 1QHEA 5IY5E 1XRLA 3ODGA 4KG7A 3NOOA 5DI3B 2ZYWX 3LXRA 1U9IA 2C29D 2OCBA 1X9IA 3IILA 4A3TA 2VJMB 3IRVA 1ODIA 1E69A 2O8FB 1VJTA 5IM5A 3TD2A 5TPZD 2VATA 3E70C 4URYR 3TOSA 3DZCA 4Y6CA 2Q7XA 3UT4A 1E6CA 3UPVA 3HBMA 1C30A 2DOKA 3UT5A 4O29A 4Q94A 5TF4A 3C3OA 2PQNA 2VCEA 4QYWA 1ABBA 1GZHB 5ALUA 3HNPA 5FWDA 4L5JA 3NZEA 5F7JA 4MCAA 3SBEA 1SN7A 1E4EA 4IIDA 3ZY6A 5FLKA 2I3AA 3ICVA 4AY2A 3HCBA 5JBQA 1M67A 1XWWA 4AZTA 2UY1B 3WLLA 3KHKA 2B1JA 4I50B 2WNIA 1OV4A 1GG8A 4C76A 4Y2UA 4LXTA 5H02A 4NMXB 1V8BA 4LE0A 4GAEA 2C2XA 2PIAA 3N76A 1W29A 1X80B 3ZVRA 3VSBA 3UJAA 4PLTA 1CUDA 1YR3A 4RK5A 2WVGA 4AO7A 5CVTA 3QVJA 1Y6IA 4NS1A 4MW6A 1RTKA 3DZJA 4WXRA 4F6RA 4BLQA 3L01A 3D8NA 3M49A 2HR2A 2ZVQX 2IGBA 4BGVA 3M6VA 3PC2A 3QMPA 1N3IA 4K9PA 2QZJA 4L9SA 1KEPA 3VSAA 1V7PC 1N0VC 2D1SA 3D4LA 1M83A 5CEAA 2DFNA 3WLRA 3D9JA 4HX2A 2GVDC 1OBCA 2GZDA 4L9AA 1VE1A 1R8XA 1HT2E 4X5OA 5AVKA 4EPVA 4F21A 4DTCA 1YR8A 4Y1FA 2BKEA 3D0OA 1VFNA 5GGYA 4C20A 2B4YA 5H80A 4PW0A 2FPXA 5TDHA 2HRDA 3OC6A 2LRHA 1D2MA 1WOMA 1KRWA 4LPSA 4AVYA 3LWZA 2IP2A 3DE0X 1U11A 3NOVA 1TX4B 4MWZA 1XZEA 4B2LA 3SNXA 1YIAA 3IOBA 2AC7A 3KQPA 2A9RA 2KBFA 2CE7A 2OT3B 2IXBA 4CN8A 3AGQA 3DMTA 5G1PA 4MWOA 4MQBA 2WJ4A 3CUUA 4Q7QA 3GEPA 3AUKA 2L9BA 2ATIA 1OTHA 1VPLA 4C4ZA 1IHYA 4FWTA 2QN8A 4DSOA 2XS1A 2AVPA 2TMDA 3IV9A 1OYOA 2UVQA 2ACVA 3GLFA 4DDWA 3IEMA 2ZSEA 3HLTA 3ZTYA 3EZXA 4JVOA 1TPZA 1XMJA 1GNSA 3HFSA 3O83A 1EIWA 2OFFA 1WSBA 1LFAA 1B6TA 4P2GA 4K9NA 4G1MB 3ANYB 5I9TA 2XDYA 4KGVA 1QTIA 1LXCA 2Y0DA 1WKBA 4YUAA 3KSAC 2ZUCA 4MJLA 2FMKA 3EXHA 4DA6A 1V2HE 4CM1A 2AW6A 4ZEMA 2JFPA 5KEIA 1AKMA 1Y98A 2CXXA 4MJ3A 5CDFA 2P5SA 4TKVA 4ZJUA 4RTJA 1CUZA 1V16B 5KNGA 1BX1A 2XDWA 2OD9A 4BQEA 3GW4A 3TWVA 4CUKA 2XUGA 4K46A 3R5FA 4J1TC 2MYNA 1LNSA 1XNJA 1MQ9A 5DWDA 5T3YA 2PL5A 2EJVA 1MPXA 2PBFA 4GOKA 3E1SA 1USGA 3TQRA 4EKDA 4KNWA 4M0PA 4HEHA 3TL2A 3BMOB 4M0LA 1P4SA 1EVYA 1B74A 2YRWA 2KM1A 5G04J 4C6SA 4EW1A 1UJBA 1QO0D 4DX6D 1E2FA 3LCMA 3AKZA 2JLXA 4AUKA 1A17A 1PQUA 2CG2A 3JPWA 3KB6A 1E2BA 3DZHA 4AJJA 3N2GB 4S0ZA 4N40A 2F8YA 2BMDA 3DDNA 1NHWA 3K8QA 3OZAA 2G5PA 4TTRA 4J91A 3ETHA 1R50A 5LYYA 4GBED 3ULEG 3PEUB 2ATXA 1P80A 3RGGA 5DRTA 3T6KA 1UP4A 1RWNA 2OQVA 2FPLA 2CSUA 3Q72A 5K4AA 4N76A 5CBPB 2ZI5A 1GGKA 1XOIA 4EB8A 1LS1A 3DT6A 4B84A 4Z8YA 5I8ZA 2RKOA 5JAIA 3RO3A 3R9AB 2VUSA 3DG9A 4J8YA 4LZAA 2DX7A 3QXXA 2I1QA 1V11A 5SZHB 1NDHA 3KWJA 1MHQA 3FYUA 3WOHA 4F1KA 5DYIA 3O1HB 4WRRA 2CSXA 2HU5A 3LDAA 2CVPA 1JJBA 3AHGA 3IT0A 3UMBA 1NI3A 4LGCA 1E1CA 2EHJA 5JARA 3ZYLA 3AF0A 2R5SA 5D85A 2QY6A 3E5MA 3SJZA 4FK8A 4U6NA 2QRGA 5J43A 3T4EA 1SVNA 3W8EA 4TMYA 2J8ZA 1BHO1 1KMMA 2F37A 2YQZA 4R7LA 3I4RB 4UAGA 5U1PA 2F3UA 3D6JA 5EZYA 3T1OA 2ATCA 5BNIA 1FQJA 3ZBQA 2KCVA 3PZRA 4HKTA 1NUHA 3L3BA 2OM2A 5CFPA 1J42A 3U6KA 5IT0A 2PX4A 2GN4A 1GL6A 1YSCA 1JMYA 3S28A 4FN4A 5JAHA 4HD8A 5LBIA 2JAXA 1I2AA 3QPBA 2X5KO 3PDUA 4OPMA 4X1KA 1TJCA 5CDTA 2ZAMA 4RZQA 1COWD 1U2DA 4P3XA 4V3CA 2X4GA 3QWWA 3I1FA 1I1NA 1K6EA 3VR4A 2HNAA 2JCGA 2A78A 1YZKA 4ZAGA 5JS1A 1XXLA 3GNQA 3JQDA 4YPVA 4MUYA 1UMBA 3CEQA 2HWUA 4CKYA 9ABPA 3J7AC 2GPBA 2HLDD 4DG9A 1K06A 5F2NA 4BESA 4WXEA 5DIZA 3JXJA 3JVUA 3CX7A 3B85A 1QKKA 4UMEA 4BN4A 3FYSA 3OUUA 3OMLA 4J90A 2WWRA 4QICA 4N5DA 1JWFA 3KQKA 1MEOA 4NBUA 4OHWA 5T4YA 4AZ3B 3HCDA 1FK8A 2ZYSA 4FWIB 3QK0A 4JL0A 4EMBA 1N7JA 4OFZA 3E2PA 3ON5A 4PH4B 2XKJE 1XP5A 4HQDA 4FKZA 4DB2A 4UBOA 1AM4D 2CUTA 2CNWD 1DKQA 4GPAA 4BQOA 2O2JA 4M9QA 2B4RO 4LRZA 3UUGA 4RELA 5A4AA 2IHKA 1AKUA 4B4OA 1LU9A 1SHUX 1DC6A 2VQ6A 2WI8A 2ZRFA 1NP6A 4BATA 1BMTA 2QS9A 3FRJA 1PS8A 1VCNA 3OTIA 1NGSA 4LVUA 1RLMA 1ZOSA 1ZRHA 3KKNA 1I5RA 5CT8A 1IVSA 1DEOA 3CJRA 3E3MA 3OLQA 1Y3AA 1NNUA 1ZP6A 2RGNC 3KQWA 2FE1A 5C18A 3OTWA 4IIVA 4I2WA 2DWCA 3Q7IA 1E8YA 3VLDA 1B00A 3UK2A 1AVTA 3CM0A 4IMIB 4EA8A 2R6HA 5CHEA 4YWHA 4OQ4A 3RU7A 5AHKA 2OV2A 2KATA 1E61A 4TV3A 4DSTA 1Z16A 1M1XB 1KFBB 1PS0A 3COPA 4DEVA 2XB9A 5JMWA 1UPCA 2UZIR 1FDOA 2CYBA 2WJ3A 1RIIA 4OM8A 1QRTA 3EXIB 4HN9A 2PWYA 5KNHD 3EVAA 1JR6A 2BGRA 4OMCA 1NYQA 2IYFA 3A0UA 3RIEA 2WMOA 5AW4A 2ID7A 2MYTA 2B8JA 3A31A 4W1SA 4R40A 1GG9A 4XASA 1XV5A 5KYUB 4KYTA 1A82A 3K70D 3DEJA 5JH7A 2XTJA 3LTEA 1THZA 1X15A 3EIFA 4A36A 3OA2A 5E4JA 1W36D 1E0JA 2E89A 1T9CA 3UXMA 5M3BA 2QG4A 5L3SB 1P5QA 3T9FA 3BT7A 1NLZA 1RBYA 1SNYA 1AG9A 4NPCA 2NTNA 5EP1A 4HS2A 3DZKA 2BH2A 3D3WB 1JX6A 3AWIA 1PFQA 4ZAYA 3R41A 4JB8P 4AJPA 4G0ZA 3CHQA 1AKRA 3NAGA 2VDRB 4MW5A 2IHJA 5HJ2A 2Q46A 1G5QA 4F8EA 2ZOSA 4M9ZA 3HN7A 4M60A 3QTLA 1EK0A 3B7TA 2AEMA 3E9RA 4BRZA 3CNLA 2P4UA 3UHFA 1HF3A 2XBLA 1D07A 3OHSX 4BFXA 4FYMA 3W8DA 4J8EA 4GWGA 2PKYX 5CA0B 1IY0A 3PYLA 1P31A 3BGWA 1WHTB 1I14A 1ELKA 3Q4GA 3AINA 3P4XA 1NVMB 5JEDA 4O2AA 3VR5A 4C06A 1URPA 1AA9A 3MJWA 2V74B 2J9FA 3FTDA 4O1MA 4DV4B 3INRA 2UAGA 3FWHA 3EYAA 4IIJB 4C04A 3LUJA 2CHUA 2PCJA 2NO4A 1Z35A 4YJ2B 2FUEA 3QOUA 4OK6A 1FXUA 4MLCA 1I32A 2EP5A 4G8DA 3ZE9A 3IDQA 2GD0A 4EHDA 3K0CC 4H7HA 3ANSA 4HAXA 4DIFA 1CQZA 1RBQA 2GBLA 1DX4A 1C3VA 2IRWA 5KOJB 5A9SA 5BWNA 5AW8A 4NECA 4MUAA 1ZS9A 5HS0A 5IJ9A 5DX8A 2X8JB 3H0CA 5JMOA 4DR4B 3K35A 3S8YA 1RC8A 3F6YA 2WWWA 4YECA 3ZDXB 4R1PA 4QT4A 1T2CA 1JIIA 3WRYC 4BX2A 5A6SA 3UB3A 1SCQA 4O8ZA 2QRKA 3EG5A 1QFYA 2XR1A 5DCWA 3H19A 2JLBA 1NAHA 2GN2A 4D56A 1DZIA 1U4OA 2BEVA 4UHJA 2WM9B 4KX5A 3EIQA 5HRAA 3G2MA 1GDTA 2FETA 3V4FA 2IWHA 4KQ9A 3I61A 4RSRA 3GJXC 1ZU4A 3AP2A 1DVPA 2A0XA 1H2WA 4FMBB 5CFRA 4IHAA 4N65A 4BV9A 1RVV1 4ZEVA 1NX9A 2BEUB 3N6VA 4AZ0A 2O2ZA 4Y6PA 1CHDA 3NGMA 3P2IA 4G1EB 2A5JA 2XXJA 3A11A 1UT5A 4OSPA 2WV9A 1QHXA 4Y0AA 4CCYB 3WNVA 1YS4A 1T3SA 1S2OA 2AMYA 4JUFA 2DBZA 2OKGA 2P9IG 3NHWA 3PFIA 4EJ2A 1CFZA 1YQEA 1M66A 4E88A 4J6EA 1JTVA 2JFZA 3BIOA 3SYKA 3FEXA 3LUKA 3PENA 3HR4A 3VDRA 2EP8A 4R2WA 4MJ7A 3I12A 2CB9A 4Q1FA 3H5OA 2C5LA 2FOIA 5KTRA 3B9RA 4PU0A 3AKYA 2O2XA 3FNGA 2HWWA 3L08A 4MYSA 4KQKA 3NU1A 3ZU3A 4A8PA 1CE8A 3KZVA 4F4FA 1ULTA 1VQ1A 3PNYA 3ROKA 3EGXA 3G8DA 4GPTA 2M2IA 1XROA 1T15A 4HT3B 1D9XA 4E08A 2NU6A 4Z7NB 4QTYA 3DQQA 3KV3O 1CVRA 1GPUA 2AE2A 4FONA 3M6WA 3PFKA 4B7CA 3S81A 1V6SA 1NJSA 2JFUA 1PZHA 4O1PA 1ZRSA 3ASVA 4IDGA 1F5SA 5EHXA 3RAPR 4DQKA 3HJCA 2HYZA 4BVJA 3PFHA 2DWOA 1B8PA 1KE2A 4KI0A 3KELA 4MVJI 5EJIA 3LHSA 1R4NB 5GZ6A 3UUWA 4II7A 5ALMA 1X7XA 4EUKA 5HJ5A 3DZ8A 2KCKA 2ETVA 3N86A 3G9QA 2VGXB 5JI3E 3Q0TA 5LMCA 5BN4A 4RJJA 4EJ6A 4BKRA 3HU2A 2XKKA 1P4JA 1XZIA 2Z2ZA 3L93A 1ZSYA 5AXDA 2IU1A 2BVNA 3WG9A 2VK1A 2AZTA 4JB8A 3NM4A 4HNVA 5CCEA 1JQLB 3CF2A 3ZQKA 2BFBB 1U80A 4L51A 1LQUA 4B4WA 4V0LA 3F1KA 3UH0A 5JNTA 3FBGA 4BP8A 3OURA 4KDEA 2IU6A 4URFA 5JATA 4LOKA 2OXEA 2EOAA 2H51A 2ZYUX 2HCTA 1BVYF 4OTZA 3GV0A 2VKTA 5A4FS 2V5QC 2AFIA 3D7LA 3ZWBA 2D54A 1Z08A 4Z49A 1YULA 2G4LA 3OM0A 3SF0A 4Z9BA 3P9SA 1PV1A 1L4KA 2QFCA 2CNKA 1GUFA 1YFKA 1I9CA 5LDHA 2Q5IA 4HFRA 4R98A 5FOVA 3FBTA 2JAQA 1KSGA 3EDTB 4L6IA 4I55F 4YAUA 3FGZA 1I13A 3WKEA 2P41A 3ONDA 2R1TB 2F1HA 3G2PA 3I5MA 1K7CA 4PGHA 3D9QX 3ZX5A 1CJMA 5A06A 2XZDG 3L4EA 4BC0A 5JECA 5DNDA 3RROA 2ZJ0A 4TMTA 5KKAA 4LY0A 2L0XA 3H17A 1KI3A 1J00A 5KAMA 1NZJA 5DBOA 3ZIDA 4W1RA 2FEZA 4H27A 5KJNA 2HA5A 2O0LA 2ZTSA 5EN5D 1X1CA 3UZUA 3LPNA 1P1RA 1BVUA 1ZNWA 5FBWB 4W7IA 2NU8B 2JS7A 2C2GA 3LY9A 3RM3A 1SZJG 3G02A 4RY9A 4Q3BA 2TMKA 4L95C 3L17A 5ENSD 3ZHZA 5E9AA 1NNEA 4YDSA 4XEIG 3GY0A 1Z82A 3RVJA 3ASFA 1EZZA 4YXWD 2X9GA 5EG5A 1GSIA 3HWSA 5CIWA 2HLNA 2TSYB 2G71A 1RZ4A 2HFJA 3TH5A 1W96A 2VHWA 2QUZA 3PL1A 3ZTTA 2PE5A 1S0UA 2FAXA 4OUKX 4B6RA 3PPWA 3U7FB 3OT1A 1RJ9B 3LP5A 3UWDA 1S9HA 2GDJA 1WMFA 5J3JA 4RTNA 1VBKA 1T5LA 1OZHA 5IARA 1SC1A 3AXSA 4AYWA 5KNCA 1XQVA 1U0FA 5A3JA 5JYDA 3ZZ1A 4EHIA 1O1SA 2FCAA 2FBNA 1IDOA 2OUIA 2SKEA 4ZAWA 4RM3A 3WGQA 3B1KA 3CRRA 1HZJA 2A4KA 4HQLA 1SKMA 3HRKA 5EKDA 2CVHA 3PRHA 3K4PA 4F2PA 1IBCA 2I54A 2VUHB 1V2GA 3NNDA 1KWGA 5EE5B 3IPCA 3ESZA 3OPYA 3R5KA 3S8MA 3WXMA 3QK7A 4FGWA 3SU8A 2RIPA 4PLCA 4CI9A 4KVOA 3UKUG 5HHTA 4B3FX 2XADA 4IMJB 2G08A 4TQGA 4IFEA 3WL4A 1GNVA 4F3KA 5ALLA 2GZ1A 1EM6A 3V31A 3F4BA 3OX4A 1J70A 2YBEA 2BGIA 1A71A 2P9EA 1IXVA 3LBFA 3E58A 3OQ1A 1YQGA 3OU2A 1FLVA 3I30X 2ZLBA 2C94A 3R09A 3H9BA 5B1YA 2H3HA 3V2IA 3DLBA 1CY4A 3E8XA 3ZHOA 4D9BA 1J49A 4UUPA 1ZO8A 4Q3EA 2I2AA 4KQFA 2XT9A 1TZCA 4UI9K 1U7UA 1H1TA 3JD1A 2AR0A 3C87A 3SX4A 4HDKB 1RXYA 1PBTA 3RS2A 4MB2A 1L7BA 3P45A 3N2KB 1QV6A 1EEXB 1JG4A 2P9BA 5ALJA 4FEGA 2H4YA 3P7MA 1ILEA 4YK7A 1OXXK 5CMLA 3AO0B 5EWJA 3FTYA 4LAFA 2AFRA 1DQPA 3V8RA 2FMTA 5AKXA 1A9XA 4EZIA 5FUXA 4D5EA 1UJMA 3OJFA 2X76A 1FS4A 4C9BB 3QE2A 1WMBA 1VJCA 4FEEA 1VL6A 3COWA 2D5CA 1W6RA 4N5IX 5IVDA 1OFIA 4J1NA 5FTKA 1IHUA 2WYOA 3KUXA 2PGJA 3QMMA 3IB6A 4GDMA 2GK4A 2JH8A 3H16A 3ANLA 1N52A 1DDGA 3S2ZA 2YKGA 1UFVA 4BO8A 1YE5A 3ESCA 1FTYA 1FZTA 2DFVA 2O0KA 3LI2A 3E53A 3TG8A 4U7WA 2PUHA 4KDFA 1CJTC 2FK8A 2YHSA 1RAFA 4OAOA 1FJGB 4TXPA 4DR6B 2A0KA 2FP4B 2OG1A 4HH0A 3TG4A 1FP4A 1PJAA 1RKQA 4M76B 4GGOA 2FZLA 3QLEA 3UJ6A 3K1ZA 3PUZA 3DSRA 1M5TA 1C7JA 1U0SY 4JJKA 1GR1A 3D8BA 3NQ41 3PIRA 4HXFB 2ZRNA 3URKA 1NLUA 2ZUFA 3NWBA 2HJVA 2QPAA 4DPMA 2B25A 3BF8A 1UZMA 4EZKA 4J0KA 3VLEA 1NC3A 1AQJA 1T24A 3WB2A 3NXKA 5G0TA 2VT3A 3DSVA 1RYYA 2D0DA 1WV1A 1E0SA 1IZ0A 4PS0A 5KNBH 2NXNA 1IKND 3E1KA 3KE9A 1YCGA 5E95A 1Y6JA 2PH7A 1NBHA 2QTVB 2GRNB 4CUZA 4KQJA 2XA9A 2W4QA 4OCZA 4K3UA 2JFGA 4M3OA 4TQUS 2WOOA 2PLWA 3SFVA 3RIHA 5F4ZA 1XZQA 3Q8XB 1LI5A 3LQQA 2H07A 1LY1A 3QWHA 1AHHA 1SD1A 1IN7A 1UPTA 2B0JA 3BD8A 3RS4A 2RCYA 3HBLA 4FFOA 5KS2A 1BCSB 4PS7A 3SIWA 4R83A 5EI5A 3KR2A 3EWSA 3OETA 4UE2A 4N5HX 3ZQ4A 1Q1QA 1XSEA 2BEDA 2R6CA 4HUQB 3PNOA 4HDSB 1E32A 2O50A 1FYXA 4OJQA 3UGQA 1OH6A 4J0CA 3DMFA 1TNDA 2XWSA 4Q3LA 5FNVB 3GEMA 3CUTA 2FPWA 3V4LA 3QVGB 3L43A 1X3LA 4KUHA 3RRMB 3MV3B 2B37A 1JHDA 2XGMA 3SF8A 3PPXA 4L4UA 2Q8PA 4LI3X 3HL4A 3CUYA 2OZEA 5GAJA 2QL6A 2BUBA 3K71B 4UVEA 4CLDA 2XYVA 1QYWA 4I4NA 3O2SB 1FS5A 1QX4A 1XP8A 5TJ9A 3AR4A 2O0HA 1TFUA 1VLVA 4OB6A 1N33B 1VHJA 3QVKA 4N49A 1C7FA 2JD0A 4ZZ3A 1D2CA 2Z2YA 2ZANA 5AXAA 2G70A 2LPMA 4U02A 4QOJA 2C4UA 3IVAA 3DBLB 4TLCA 1KERA 4ILKA 2QQFA 3K9FC 2BSXA 4FMDB 2IE0A 3HKBB 1PJ8A 5L53A 2AS0A 4ARUA 4FS8A 2XBUA 2K7FA 4FEAA 1H2UA 3PUWA 3NTUA 4NJEA 4UBMA 3C3DA 1X1QA 1GZVA 1P2TA 1G4AE 1NW6A 1FA9A 1HSZA 2JFXA 2JVIA 4HDRB 1Y82A 3A4NA 4YV7A 4HB4A 4FHCA 3EDYA 3O74A 3V97A 1ULUA 5A03A 2L6JA 3LNCA 2Z9BA 5CMYA 1G4HA 2BP7A 2XT6A 3KR9A 3FJ1A 2A94A 4MVWA 1F3LA 4I6GA 3W8NA 2RGBA 2K2QB 1LK5A 4L3WA 4EB6B 3AVTA 3R8XA 3MF4A 1NG1A 2J0UA 1EYZA 1C9JA 5GMOA 4CM4B 1P7CA 5KDDA 3AU5A 3FKQA 5JDIA 4GYOA 3MWYW 1O96B 2OR3A 4RESA 3EJWA 5GJBA 2AXPA 3BCSA 2Q3CA 5FULA 1FMFA 3KDAA 2GBGA 4G37A 1P9RA 1JAXA 4E6PA 2C0LA 1YZLA 3KKZA 2OXCA 1KY4A 3MGBA 5TQ0B 4MV1A 2QRZA 3QWIA 3S40A 4H59A 1Z6GA 3VAYA 1SVMA 1U04A 3KSLA 2WG0A 1OB5A 1MAUA 4W5JA 2W6ID 4AN4A 3UB4A 3TOCA 4HORA 2PQMA 5LZ7A 3RRFA 1NI1A 5KYVA 3T0IA 1YK1A 3LX6A 1HFWA 4JFAA 2XOKD 4KIJA</