2XGOA

Xcogt in complex with udp-s-glcnac
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
548
structure length
548
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 203
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgoA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgoA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgoA02
4LDPA 3SYRA 3VDMA 1HXIA 2UY1A 1JEJA 4X7MA 3T3IA 5AYWD 2AW3A 3MRVA 1WV1A 3E3NA 3LY9A 2XGOA 4UI9K 3TG5A 3OKPA 2O6LA 3LYAA 1IHGA 3RSZA 4X7PA 3Q47B 2R4TA 5TMBA 5G04C 4A1SA 3S27A 1LWNA 3ZCQA 2HY7A 3E4BA 4G25A 3S7FA 1P4GA 3L01A 3FFLA 3U4TA 2P6PA 1K06A 4BQIA 1FU8A 2AVPA 3COPA 5KJMA 2C1ZA 8GPBA 5M72A 3VUEA 5D0QD 2KCLA 3MRXA 1AHPA 1FU7A 4W9RA 4AY5A 2QN1A 4CGWA 3G2LA 3OT5A 5DU2A 2FI7A 4YUAA 3LY8A 3EBPA 2XPIA 2ACVA 3CEQA 2L6JA 1NOJA 1RRVA 4WUYA 2UY1B 2QZSA 3EDTB 5FZSA 2X6QA 2G9RA 4EL0A 3MTAA 3QHPA 5BT1A 3NF1A 1FU4A 1ZBPA 1L5VA 1WUYA 3IAAA 3L7BA 4UI9J 1OUVA 2VGXA 5HI7A 2GEJA 3BD8A 3G2NA 2DBAA 2BFWA 4G23A 3VDNB 2R66A 1JG7A 4WACA 3R9AB 2IV7A 3PE3A 3MSCA 4APOA 4I17A 3ASHA 4RIHA 3RO2A 1WUTA 1P2BA 1IYGA 3GUHA 2XEVA 3ZGQA 3CK7A 3GYZA 2FFRA 2QN9A 2SKEA 1XNFA 2GJ4A 1ELRA 1C50A 1P5QA 2VYIA 4RIGA 3RKVA 5HQ8A 2V5FA 3Q5MA 4NEQA 2OOEA 2QLMA 4BQEA 1L7XA 4EL5A 1F6DA 2C4MA 1RZVA 1JIXA 2QN8A 3S28A 1NOIA 2IYFA 3HBJA 4GPBA 4ME2A 4MI3A 1P4HA 2ONDA 3BCUA 5DBKA 3ZCVA 1NA3A 1Z62A 2KCKA 3MKRA 3VTYA 1PNVA 3O3CA 2GT1A 4M60A 3TOVA 5HXAA 3WAGA 2Q6VA 4O6FA 3ZHEB 4HORA 4WADA 1A17A 4JA7A 3ULQA 2PYIA 1TJCA 5JJ6A 5ARGA 5FJYA 3N71A 4RENA 1E1YA 1XOIA 1AXRA 2QLNA 3BEOA 3CEJA 2GM9A 4JHRA 1O6CA 3IEGA 5GPBA 5KJNA 5ARFA 5D00A 1XC7A 3S7BA 2QN3A 4RG6A 3L7DA 3KAEA 1C8KA 3ZN3A 3UPVA 4YVQC 4G2VA 1B89A 2R4UA 4HLNA 4JA9A 5KJKA 3IA7A 5ENZA 4NRHB 3T7DA 1RZUA 2F3QA 1HH8A 5A6CA 1GG8A 4N39A 2YHCA 3ZCRA 4H7XA 2IUYA 3NAZA 3VTXA 4EQFA 3MS7A 2UWJG 3JYSA 1C8LA 5FTPA 2F9FA 4U04A 2AZDA 4U07A 4XIFA 1WW3A 3K9IA 5A7DB 1Z6QA 3HYMB 2X6RA 4BT9A 2X0FA 4G24A 3TAXA 4KQ2A 3ZFWA 1FTQA 4MI9A 1J39A 4WNEA 4JL0A 3E3OA 1YA6A 4GZ3A 3L7AA 3MEKA 4RIFA 4BFCA 2FO7A 4MICA 3CVPA 3NC4A 4NESA 2E2EA 4HOTA 4WNDA 1E4OA 2QRPA 1NOKA 3QKYA 3WADA 3BCRA 2XMPA 3OKCA 3WC4A 1IXYA 3ZPJA 1Y6FA 3CUWA 3FP3A 2QN7A 3Q49B 4GA1A 4AIFA 1P29A 3CUVA 3NB0A 4GPKA 2LNIA 4YI3A 3HBNA 1UQTA 1P4JA 4Y6WA 2ATIA 1JIVA 1HLFA 3ZHEA 4F3VA 2R68A 4GCOA 3CKCA 3CVLA 4HOUA 3CV0A 3D0QA 3GW4A 3WXXA 2VQ2A 1FA9A 2IV3A 2OFFA 4N2QA 4BTBA 4FKZA 4W6QA 4KBQA 3UYLA 1PN3A 2PL2A 3H4IA 3CV3A 2ASVA 4J8FA 2C1XA 3BD7A 3ZCUA 2YQ8A 3MTBA 3C4VA 1XL1A 3OXFA 3VUFA 1QZ2A 1FCHA 4G1TA 3L7CA 3OY7A 4HOSA 2QNBA 3RIBA 4REMA 3OTHA 3G2HA 1KT0A 3QWVA 2Q7FA 4GYWA 3TG4A 4UQXA 4XI0A 3UUXA 2ECPA 2NC9A 3T3EA 1GFZA 3HBFA 4YNDA 2HO1A 4N3AA 3AS5A 1NZFA 5DXFA 2H1HA 3OXLA 4BT8A 2QN2A 2MHKA 4WNFA 1M5RA 3MV2B 3MT8A 5DLDA 4EKYA 4Z5XA 3AS4A 1VGVA 1A8IA 4NC9A 3MA5A 3SZ7A 4MI6A 1QKJA 2XCUA 3MRTA 1GPYA 2J9QA 2FF4A 1NZDA 3CUYA 3DDSA 5CCMA 4YVOA 3KS2A 3PDNA 1FC0A 2VSNA 3MTDA 3RHZA 4I9CA 3UQ3A 1WM5A 1QQEA 3NP7A 1SXQA 4XI9A 2WTXA 2R5SA 4X6LA 5CHEE 5LCWC 5FZQA 1EM6A 1P2GA 1QM5A 3L79A 1WW2A 4CTMA 4HOQA 3OY2A 4AMBA 3G2IA 4IN3B 1EXVA 4AY6A 2C9ZA 4HWGA 1Y8MA 2X0EA 2QRQA 3BEEA 5D0OD 2F3UA 4B94A 3CK9A 4RBNA 3ASGA 1XKXA 5JJTA 4J8EA 4U0UA 1L5SA 4I2WA 1L5RA 2XCBA 3Q3HA 3ZCSA 3CEMA 1Y8ZA 3MS2A 3CVNA 5D01A 2QRHA 5JTTA 3BCSA 1ZU2A 2PRIA 2VGYA 2FBNA 3LY7A 3FROA 4FZRA 2IW1A 1KLXA 3BDAA 2XA9A 4M83A 2HYZA 4U0SA 4H7YA 1NLMA 3ASDA 2QRGA 2GPBA 3O48A 4UQYA 4UQZA 4N2SA 4Y6CA 2KS6A 2FF5A 1UZUA 4GCNA 4F97A 3MS4A 4UI9C 3CUTA 4KQ1A 3LKUA 4AMGA 2VGXB 3AS8A 3C48A 3AMVA 4M7PA 3MBOA 3GPBA 5FT9A 2KC7A 2X0DA 1HZ4A 4BQFA 2XA2A 4RIIA 3T5TA 2GW1A 3OTGA 1Z8DA 1P2DA 1LWOA 4BWRA 4NQ0A 1SXPA 2HR2A 4RG9A 5DIZA 4CDRA 5BNWA 4GA0A 1YGPA 3PE4A 4LEUA 3H4TA 3T3HA 3Q15A 2PYDA 2BISA 2XA1A 4RELA 5TVGA 2VSYA 3TGOA 5TMDA 4I9EA 3MQFA 2ZB2A 2XGMA 3NCHA 3S0JA 5IKPA 1W3BA 2QFCA 3SYMA 1H5UA 2G9VA 3D0RA 4N3CA 2GPAA 2SKCA 2AMVA 2AV6A 2WPVA 3DD1A 3GZ2A 3Q3EA 4MHSA 3MV3B 2P58C 4G26A 3ESKA 1JG6A 2PRJA 2G9QA 3BD6A 4U0ZA 3ZCPA 1JIUA 4PQGA 1K08A 1V4VA 5G05J 3OKAA 5EKQD 1C3JA 1WAO1 4RIEA 2QRMA 2WQHA 2KATA 3OTIA 5LQDA 2XCIA 1ELWA 3Q4AB 3FWVA 4GZ5A 5G05C 3S7DA 3HBMA 2Y4UA 5BW8C 2I6HA 3GZ1A 3DZCA 4YI5A 5JTUA 2BUGA 5JJ7A 2BGUA 2SKDA 1NZNA 5EX3A 2IYAA 2YJNA 2LSVA 3QWWA 3CKBA 1L5QA 5C1DA 3G2JA 5IKOA 1BX3A 1Z6PA 7GPBA 5I45A 2C0MA 4AM9A 3RT1A 2PQNA 3Q3IA 3CX4A 2XCCA 1XL0A 4MRAA 1FS4A 4EJ2A 1NA0A 2ACWA 2JLBA 4GA2A 4N9WA 2BGTA 1XV5A 3CK8A 1GPBA 2VCHA 1PYGA 1ABBA 3RSCA 3UYKA 2FEZA 1KT1A 4I1AA 1F0KA 2IEGA 3TSAA 4J8DA 4F9FA 4WHMA 2F3PA 2F3SA 3U3WA 3S2UA 3S29A 4KYOB 2XGSA 3MT9A 3QOUA 3LPZA 4CTOA 2GEKA 2JZCA 1Y6GA 1B4DA 3T3GA 1FTWA 9GPBA 1KTIA 2GPNA 1GPAA 4CTNA 2VG8A 3T3DA 3SF4A 4N5CA 4F96A 2IF4A 2VCEA 1PC2A 2IEIA 5G04J 3C4QA 4GYYA 4LEIA 3CVQA 1L6IA 4MHOA 3URZA 3S7JA 1IIRA 1E96B 3ZCTA 2C0LA 3DDWA 5TMEA 2G9UA 1GZ5A 4GYOA 4GZ6A 4EKEA 1UQUA 3OXGA 3EBOA 4ABNA 3G2KA 2PZIA 2IFUA 3RJVA 5KJLA 1YA0A 1GGNA 3RU0A 2QLLA 2R60A 4KXKB 4N3BA 2KCVA 3RO3A 2PQ6A 4BTAA 2H1FA 3QKWA 2PQRA 5CCLA 3NP9A 4X7RA 4AN4A 3KD7A 3CEHA 2C2LA 3LCAA 4J0UA 4KQMA 2JJMA 3QDNA 1NVKA 1FTYA 2FETA 6GPBA 4I2ZA 3D1JA 2LSUA 3CUUA 2Y4TA 1L5WA 5EX0A 4WNGA 4G2TA 5FZRA 4L22A 1PSWA 3ASFA 3MT7A 3E3LA 1WV0A 3NPAA 4CGVA 3QWPA 5LCWJ 4QLBA
chains in the Genus database with same CATH superfamily
2XF2A 1EVJA 3AXSA 3JRWA 4QGBA 3SKYA 1CP2A 4F4DA 1J1ZA 1Z7GA 3VTFA 5CBPA 3DRAA 3MRVA 2XB4A 3MWEA 1LLQA 5IJ0A 3O74A 1G21E 4IDGA 2ZWIA 1GQSA 1QGOA 3EA0A 4GP9A 3ZZTA 3JYPA 4MA4A 2OBLA 1BYUA 3E7PA 5AJUA 3U3MA 1K1BA 2IF0A 1W85A 3C5VA 1JSXA 2R97A 1SIWA 3D8NA 1PR3A 1Z33A 4FYMA 3WMXA 1YDGA 4M3OA 5KTKA 2DWUA 2H1CA 1Q57A 1H9BA 2O7SA 3I9MA 4YBZA 5JSHA 4JIGA 3FJ1A 4GYJA 2VNKA 2JEKA 3HH8A 4H0CA 5ABPA 2C2HA 2JGLA 3GZSA 5G3ZA 1WB5A 3OLYA 2IS2A 4TUUA 4IKOA 2HE0A 2KLHA 1M9NA 2A8YA 3OSUA 1E9SA 3QX7A 5LOVB 2C1ZA 1RP7A 3WRYC 3C1AA 5AAOA 1JU3A 5THXA 1FNNA 4IUBS 5JW6A 3O9ZA 3EVEA 4C08A 3ISMC 3EVCA 4KXMA 3GCZA 3H7IA 4KUGA 1OTYA 5KNBD 3QWBA 1ZHOA 3HWSA 1T34A 3FPAA 1TIPA 4YUAA 2B0JA 5L3QB 4J3NA 5HQ3B 3NVKI 1J07A 2KSQA 4M89A 4U8YD 1Q44A 2VH1A 3DTNA 3PCXA 4MW6A 4URFA 5ALDA 3ELBA 4H0FA 4OHZA 6NULA 1U0GA 3C87A 5EJ9A 1NLYA 3CR3A 1MAHA 2NU7B 4ZVQA 2DZNA 1Q1EA 1ZO8A 5CP8A 5KWSA 3TTYA 5B5SA 2XVXA 3DSTA 4HADA 1U90A 2ZSKA 5DM70 1GILA 5JJKA 1P73A 5EE5B 3UBMA 1FUIA 3VPGA 2EFEB 3GLIE 2ZOSA 1DRJA 2AN9A 3G2NA 3N05A 5LCXA 4MCHA 4DSOA 2VP3A 2R3SA 1B3BA 1JHDA 1JG7A 2R66A 4HQLA 3OWXA 4LJ6A 4S3MA 5DHRA 2L9BA 1S9DA 5FI5A 1SAYA 1EX9A 3G0BA 5TVKA 2BE9A 2P5YA 3CLTD 1J99A 2JGFA 3AHFA 1MMFB 2VPPA 3OP4A 4JXXA 3DPUA 3DKIA 4RHXA 3EH1A 2QL5A 1RAIA 4L5CA 5C53B 3F4KA 1ZKMA 2DHEA 2HWKA 5AVYA 1I80A 3NVAA 1JFSA 4DUYB 2NMVA 3MMZA 5HQ8A 2V5FA 1MXFA 1A9YA 2W4QA 4MRMB 4RK5A 5CLIA 3F4LA 3PUZA 4US2R 5K0CA 2FEPA 3MW8A 5CFMA 5HGXA 4Q18A 2XDQA 4WERA 2C7BA 3RK0A 4TWIA 1YVEI 2H1RA 4CKEB 1NOIA 3L05A 2W2MA 1XG5A 1A7UA 2B8NA 3FHOA 5I7FA 3DVAA 2BYTA 3ZE9A 5KYVA 3R7SA 1A9TA 1SC3A 3UAOA 5HXAA 2H7XA 1U8TA 3VTYA 4WK2B 3CSTA 1YUNA 3TQCA 5BW4A 1N6OA 3ZJVA 5JLJA 3FUCA 2V5VA 4F46A 2PPVA 3F3YA 2ZXUA 4CL3A 2UVPB 1S64A 5T8IA 2C7VA 3IKLA 5I51A 4CL2A 4DKJA 1NN1A 2X5JO 2HBYA 1NPDA 1G17A 3UJ7A 4L85A 1E1CA 5ADUS 5FTJA 4I4IA 5IANA 3LDGA 3A28A 2CL6X 1PNQA 5G4LA 2V0NA 2X5XA 3CEJA 3ZY2A 3KEZA 3E7FA 1G0OA 3O2SB 4UHFA 5D51S 1VL8A 3WLOA 3MHPA 5AW7A 1H6PA 1TNZA 4XKBA 1NVGA 4XDHA 4GM1A 1GAJA 3ZXUB 1SEPA 2O0JA 2EIHA 3KV3O 4RGBA 3NWJA 5CTAA 1G2QA 4P53A 1AJEA 2IO3C 3EPKA 3BUAA 3OE7A 4CLOA 4HEHA 2JANA 1YAHA 3ITKA 1JL3A 1GTVA 1O7JA 1RPNA 2V5AA 1URPA 2BMJA 1PR9A 4ONEA 1L7MA 2A0KA 3LW7A 4HLNA 4MRUA 1DZIA 4NE2A 1V0JA 4WK6A 2O1XA 3F97A 3TTUA 1TMYA 3BL8A 3M83A 1PS9A 4KP7A 1HNZB 2WP8J 1RZUA 3PDHA 5F3DA 1MJ0A 2C9BA 2O2JA 3QQPA 1WZNA 1YWGO 2AN1A 2XE7A 3ZCRA 4HF7A 4F7WA 4OG2A 3QVVA 8ADHA 1JFVA 4LY3A 2OB1A 1KC3A 3HDGA 4KV9A 2OP0A 2QY9A 5KYXA 1P7YA 4X92A 2QX9A 3R6LA 3VC2A 5IBCA 1E2BA 4U07A 2AG5A 4IDEA 3UWKA 4R0MA 3QEMB 5GWXA 1BDIA 2AYZA 4LZOA 2O8BB 3N5CA 3GEMA 2G7MC 1QX3A 1WSDA 2HTEA 3LXXA 2AD5A 2I9KA 1IHXA 2VPXA 3CW8X 5ITZF 1GLVA 1E7UA 3ESBA 3RO7A 4B4OA 4PY2A 4IVQA 2AXQA 2NQ2C 2Q5FA 3FWZA 3L7YA 3DXYA 4KX5A 2QYJA 1DAHA 1UP4A 1CF9A 2WRZA 3NHJA 1TC1A 4OQQA 1FMCA 4KE7A 4KO8A 3RYIB 1U94A 1W52X 3OZBA 3Q0IA 4O4LF 5BW5A 1EP1B 1PFUA 1RM0A 3DWEX 4MICA 1LI4A 3R6TA 4LRTB 4N8EA 4MKGA 3V2UA 1JHVA 4YAUA 4NESA 1QB7A 3ZWYA 1BD4A 4MAMA 3VGPA 1A9ZA 3AUJB 1E4OA 3JY6A 1WCIB 4JC0A 2E21A 4Y2UA 5E7IA 4BOYA 4E94A 3GFOA 3ZNOA 4KR6A 1UEJA 2IU4A 3UAYA 4HRMB 3E1SA 1HTWA 2DPGA 1RQNA 2PMWB 4Z99A 3U66A 4WLNA 4EKNB 2QD1A 5ISMA 4OXKA 4Y2YA 5GONB 3EWAA 3UWOA 5AMXA 1VGRA 2RHHA 2CUTA 2JFWA 3HVUA 1KOLA 3M1IA 1EK2A 3BXFA 4M8LA 3UJAA 2RI1A 2QL6A 4QNNA 4QX6A 4BNHA 4BO0A 5A5EA 5H59A 5B2FA 3A4MA 4PIPA 1YO6A 4GZDA 4JWTA 3ZKWA 5GINE 2EFDB 3FU3A 2J3DA 3I4GA 4KMRA 4AIRA 4FQ8A 4M8IA 4J0FA 3L22A 3MOSA 2P9IG 3I9KA 3N0WA 2JRLA 3KPJA 1F8YA 1KO4A 1HLFA 2Z6AA 4IPTA 3IYLW 2ZBVA 4F3VA 5P8WA 4UMDA 4K26A 3P9PA 1MH1A 2IP2A 5HKAA 6PFKA 3CZPA 4ENPA 2Q3MA 2C59A 4DLTA 4XJTA 1HNXB 1G291 3KDAA 3WV4A 4MDYA 4WXPA 4LYHA 2KXPC 1Y3FE 2EKPA 3BE6A 2C58A 1OTHA 4NJOA 4G0YA 3UX4A 4HGYA 5FWXA 4R69A 3GJ0A 5I7RA 1FT1A 5IT5A 5ICFA 3KOZA 4AF8A 3T1HB 4D9IA 1NWHA 4Y6OA 4LNBA 1MKYA 2WG2A 5CVVA 5EIBE 1G66A 2NGRA 4HZIA 1BKDR 5FD8A 4BMYA 3QPBA 5HX7A 3KWMA 3ZDCA 5LFAA 1JPNA 1TUIA 3HYLA 3T3PB 3RS5A 4B48A 2XE6A 6ABPA 2QZJA 5AHWA 3WZLA 4GR4A 4JYAB 2RHRA 2VSXA 1EDDA 2CD9A 3HBFA 4N3AA 3B7RL 3M7IA 3MUOA 4WD3A 3HI6A 3L7JA 2NU8B 4TXMA 3PGJA 5KNCA 1GKYA 1YOBA 1IHYA 5C4GB 1K2WA 1WUKS 3HY4A 4E4RA 2GM5A 1VPTA 4ALJA 4IFEA 5JAOA 2AWOA 3F6YA 1TM2A 3FUIA 2FMHA 1X7XA 1TAQA 4OLAA 1FXUA 5CM2Z 1CDEA 1Y48E 1ZJ4A 4GIBA 2POQX 3HB0A 3I0NA 1EAYA 1SXHA 2ZJAA 4P6VF 4C6SA 4DLYA 5LXTB 2HRCA 2ZISA 5AHXA 3NT2A 2WF5A 3GH1A 5C5IA 1U63A 1KP3A 4XWOA 1YBMA 4R8KA 1KMHB 4BP3A 4DQXA 5F9MA 1LFDB 1K97A 4X6LA 3U7GA 4IVNA 1ZDMA 4GR9A 1WW2A 3QK0A 5LP0A 1T4BA 2QX4A 2ZTHA 5H82A 4CTMA 1YACA 3G2IA 3PNMA 4GSKA 5ALHA 5JAQA 4ZEWA 5I9NA 4M37A 5A5GA 4K9DA 3WIDA 3DCIA 1WL8A 1BH2A 1YB6A 2WIBA 2XKJE 2BFDA 2ZB4A 2TMYA 3LBYA 4FOOA 5TXGA 1FFWA 1W4ZA 2GTPA 3RYHB 4ACBA 2CJWB 5AJTA 5C8VA 1KMMA 4CL8A 3UTCA 4IUDS 1EBFA 4U0UA 4CEJA 1AKEA 5BN4A 1YR8A 2P62A 3G2TA 1WPXA 3KV1A 3THOA 2JFQA 1SUEA 4Z9YA 1H22A 1GGMA 4N4AA 1PT6A 2QTVB 4N49A 2PKRA 1ZVQA 4PAGA 4AECA 5C9ZA 3P9QA 4OQ4A 2X8WA 5IJ0B 1L5HB 2PCLA 4JLDA 2Q21A 2IEZA 1P72A 4M1SA 2LXMA 3BRQA 3OHSX 3KR0A 3HUFA 4RHFA 4LRQA 1FSPA 2FPRA 2WWTA 3ZQKA 3LWDA 4H7YA 4Z9FA 3ZYLA 4P4GA 1NJ1A 1VJ1A 1JT2A 2GJSA 2WD7A 1Q2XA 2WNHA 4HMPA 4DLKA 2FK7A 4F93B 1FSSA 2GPBA 4MVJF 2PVSA 4JS0A 3C3YA 1T2AA 2W8ZA 3DEIA 3P2YA 2GN2A 4I5DA 4NMXB 4NTZA 3CHYA 4ZKDA 3G2OA 1VQ1A 2BTQB 2OLJA 3ZH2A 4GVPA 4EARA 3YASA 1AK2A 4DR4B 4JY7A 4D3SA 1Y98A 3NBYC 2OL4A 1QK4A 1B41A 2VQSA 5BSRA 2BFFA 2OV8A 3F5QA 3U3OA 1VKZA 2CLKB 5FFNA 4C0WA 2YHIB 1KZYC 3CWQA 3CH6A 3DE3X 4M7PA 3M6WA 1QV9A 4E07A 4DMUB 3IO5A 1RWNA 1MA0A 3EB9A 3BWVA 4PANA 1NKTA 4PPNA 4HR7A 3FPLA 4C20A 2B94A 1HZ4A 1A7KA 1AM4D 4H18A 4IYRA 4CI9A 1OA1A 4EHAA 3FDIA 1XJQA 4MVJM 1SBCA 2C3OA 3FCSB 4QJ5A 5AXCA 2F8XK 2HR2A 5CRIA 4UE6A 1QO0D 4K81B 3SLKA 5B1YA 4OXNA 1HDGO 4HSEA 4ZOEA 5DB4A 3PE4A 2BJVA 1KVUA 2IPXA 1FP4A 3ELDA 4MJ7A 1UF9A 4UUQA 3UA4A 2H57A 2CUNA 2HYDA 4ZO9A 3WK7A 1SUPA 2VPZA 3SZMA 3AR2A 1S70B 3NCHA 4PWYA 3OFVA 1B23P 2HZBA 3R0JA 2KZTA 2XHEA 1DJLA 1E5XA 2G9VA 3D0RA 4HJXA 1PKEA 3V1LA 5KI6A 3DD1A 4S05A 5JFOA 3S40A 3D3KA 4KLAA 4P31A 4URKA 4ZFHA 2G9QA 4JQCA 2RKWA 4D02A 1C3OB 5AUPB 1NG9A 1Z6GA 2EQAA 2I4MA 4X8OA 1CCWA 2DFLA 1SHTX 3QYPA 1NR5A 5KDLA 5IEBA 1Z28A 4RIEA 3PFKA 2JNWA 1XWFA 1F2DA 3B1XA 4PDXA 4DZZA 2B4KA 4O4HB 1SA5A 4QIHA 3VSEA 2J9ZB 1E98A 5G05C 1QIJA 2QORA 3IKTA 4BGEA 4GKKB 1SCQA 1DBIA 1V1JA 1ZSNA 1KJ9A 4YI5A 4URXR 2EP7A 4DFDA 2JK0A 5LX8A 3HB9A 1CR4A 3WVNA 1X7DA 5CLHA 2R6HA 3D3WB 1JEAA 1OE0A 2NP7A 3AVYA 2GRUA 1ULHA 3IKJA 2FXIA 4Y2SA 3I42A 4E3ZA 4YRSA 3U4QB 1QHXA 2IPOA 2ODQA 3ZJUA 1CVIA 5UKDA 4B7AA 4EUHA 4UQPA 2ZRCA 5SZKB 1CLEA 1U7ZA 2WYHA 4JHLA 2CFSA 2ZGVA 1I2DA 1Q22A 2I3DA 5E0KB 2W6QA 3APCA 3QW2A 2NPIA 4E31A 2E1RA 4EHHA 2AX4A 3M6MD 7MDHA 4MS3A 1TPYA 1UQRA 1AUVA 2V74B 3G8YA 3IAM6 5KX5B 3I1FA 3UXYA 1WY7A 4BNJA 1PG0A 3M1AA 3UVEA 3T5MA 2IEGA 3VI3B 4C30A 2HSWA 1GITA 2MDTA 1U0LA 1UXJA 1USKA 3FI9A 2J5BA 4A03A 2ZIRA 2OMEA 2P90A 1TVKA 3T1YB 4CTOA 3LVQE 2RI6A 3CUKA 3TRFA 2XYPA 3KEGA 2WV7A 2R84A 2ODBA 1QVWA 5FBHA 1XHFA 3NONA 1GDTA 3ZGZA 3CLRD 2QW8A 1UOPA 4CV0A 3OZTA 4EDFA 2C4UA 1LS6A 1UT6A 3T3DA 4U3JB 3I6QA 4YA6A 5JECA 1SCDA 1KOJA 1SA0A 1FRQA 1TCBA 1TF5A 1WCWA 4NX2A 3PIRA 3VZDA 1ZK4A 2CC2A 2HNKA 4YVFA 1SUFA 3G02A 3TPCA 4JI4B 3DPSA 1OC4A 2R1ZA 3NNNA 5A7GA 2NTEA 3JQFC 4TL6A 3S7JA 1ZA1A 2VHYA 5TMEA 5F52A 3FUHA 5BRNA 3QA9A 1A71A 1D7AA 3NT5A 3BPSA 2ZYTX 3HACA 3RKRA 1O08A 4UU7A 1JRLA 3WIBA 3SQOA 2FMKA 2C77A 2ZYDA 1MB2A 3AKEA 3EFHA 2QWXA 4IXMA 2VXYA 4XE5A 3B1VA 3L43A 4HNGA 5J2TF 4PG8A 2B78A 4DCGA 1G3NB 4MVJP 4QUGA 3ZY6A 5EC8A 3KD7A 2NXWA 2REXB 3ZVNA 3BJZA 3LCAA 3LK7A 5SZJA 2IOFA 4KQMA 2DLCX 2R87A 2PX6A 5EOVA 5G3YA 4BKOA 5KYYB 1Q1AA 1SOAA 1WZUA 2YJGA 2GH1A 4UVDA 1I7NA 5HTKA 5HS4A 4IHJF 1Z7EA 2JIOA 4OY3A 4ZK2A 1V2GA 9LDTA 5K2MA 5KYWB 5LP6A 3EZNA 3O75A 3EQZA 5EZYF 3HGTA 1WXFA 3RDPA 1RHMA 2BEUB 1K0UA 3L0OA 4EVSA 1GHTA 1Q0ZA 3NPAA 3ICPA 3KXDA 4LDPA 2XCLA 4QATA 1QQTA 3DUFA 1DEOA 2EL7A 2B92A 2HRZA 2NADA 3A9VA 4HK4A 3NYWA 5I6DA 1NBMA 2CUZA 3PEYA 2NW6A 2BMVA 2FPLA 3T06B 3OJFA 3W3ZB 3W3AA 1QDUA 4A8HA 2X1LA 1FFAA 3ZBPA 4OVUA 4Z3OA 1FDWA 5AVTA 4TXJA 5LWQA 4OH1A 3ZEAA 2DT8A 3TF5A 2BEJA 5FOXA 3D9OA 1ST2A 4UNNA 1AXGA 1V9SA 2JGAA 3K4PA 2AR9A 2XNSA 2CLFB 3ULKA 2IOLA 3RFXA 2AXNA 5HOQA 3KTOA 2O2HA 3O82A 1ZBQA 5LQCA 4DLQA 1AQUA 1EE9A 3A3PA 3ROMA 4NYJQ 1ECBA 4BAGA 1QAMA 3I3OA 3OHMA 5G0WA 1TKRA 1SHUX 2BELA 4IH1A 4ZI7A 1QK5A 2GXSA 4ARCA 4CDMA 3CLKA 2Q1YA 3UMMA 1QGUB 2IP1A 4A1GA 4R7ZA 3SG0A 1E7WA 2VAXA 3TWWA 3ZPXA 4A5OA 3RC2A 4RTOA 4CGWA 1PZNA 2OXCA 1JCSA 1SR8A 2AC2A 1YFKA 4K5BA 2V6JA 2YW9A 3Q3VA 4K6GA 4OGKA 4RA6B 4Q9LA 1O97D 4A8JB 2CNNA 3OG9A 4IQGA 1WD5A 2II6A 4B4DA 3EC7A 4JX8A 2QM0A 4F8JA 5SYAA 2D5AA 2VAMA 4BECA 4EFDA 2G9RA 2L0TB 3QKRB 2YMQA 2NX2A 3NZUA 3Q2IA 1Z68A 4MQMA 3ZE7A 2HPHA 4BPBA 4E51A 2VNSA 5JQGA 1D5WA 2YWRA 1F8FA 1FU4A 1SA0B 1L4FA 3IV6A 2HK7A 3D7SA 2O7NA 4QUEA 1F60A 5GONF 3ZXIA 4HS9A 1E1QD 3DHYA 3IQGX 1ORHA 4V3BA 2BFWA 5JHGB 3MC1A 4MV7A 521PA 1M6WA 4J6IA 2OD9A 2G72A 1KQOA 1F20A 2BZSA 4ZT3A 5B1HA 3ZHBA 4DWVA 1HFWA 2EJBA 1VRVA 3GUUA 3MSCA 2AJBA 1OXSC 2A6PA 3BAFA 4FNGA 3EFOB 4JWKA 2Z2XA 4RIHA 3UHPA 4P5PA 3KUKA 1LD3A 3C6BA 4MXDA 4RE5A 4MQ6A 1KDYA 3GYZA 1JG1A 4TMYA 1U7PA 4LDZA 1XQXA 2ZDGA 1E79A 4HNTA 2DIWA 5BSUA 1XR3A 1O8BA 3QG1A 1XO1A 1YKSA 3H5OA 2VIIA 5TGZA 5BW8A 5A0FA 1GPH1 4ZICA 5D5QA 3N39C 3WK6A 3K9FC 2EW2A 3CGGA 2AJDA 4F6RD 1F8UA 1M1YE 1XZDA 4FKMA 4WK4B 2IYEA 4AG3A 1PUJA 5L4SA 4A55A 3AONB 3HDHA 3WY9A 3QLUA 2BGGA 5KWJA 2FPGB 1E18A 2QMEA 2G1PA 4D5EA 3BCUA 3EDYA 3VC3A 5EI5A 5HMLA 2RGBA 4OHBA 1J0CA 1R8SA 3QW4B 4B85A 1FVFA 5CYOA 2D7JA 4F92B 3HM2A 4F6RA 1E7QA 2G08A 4YH1A 3EXG2 2FP4B 4H4CA 3JQCA 5F33A 4BFWA 4JI2B 4YV7A 5AVXA 2PYIA 1QBQA 4JBGA 2N75A 3OO1A 4JITA 2UUAB 1WF6A 1D4FA 1JDJA 3DDZX 1D2CA 4DR6B 1RQGA 3HSKA 3VX4A 4GMLA 2HUPA 4HL6A 3TQHA 3VZBA 5AQ1A 4NFLA 4QBKA 1TTPB 3FULA 2AR7A 2FWPA 4DDTA 3GYBA 1P3DA 2FUNB 2GM9A 2D3WA 1R6UA 1GNTA 3IKVA 3WLAA 3O83A 3EIHA 2AVNA 3NZEA 1Z12A 4D81A 4TMXA 4BNDA 1XC7A 1M8PA 1RWMA 2EGGA 5AOBA 4DAOA 3K70C 1AGNA 4IXTA 2J0VA 1C8KA 3E5HA 2F3RA 3NKFA 3R40A 2BKEA 1UFVA 1JI0A 1DRVA 4FEYA 4FVTA 1KE2A 3H11B 4WT7A 1I7PA 1Y80A 1S8OA 4IZ6A 4JA9A 2ZJ5A 3BX1A 3PXXA 5EJIA 5KYUA 3OESA 1D4OA 2QZPA 3D7LA 2OQ2A 3W2GA 1JE1A 3LS8A 3GF4A 1JQEA 4JOCA 4A6EA 4PBRA 2PH3A 4HB3A 3UV6A 1V37A 1LRJA 2Y9MB 4HDKB 2B6CA 1OLXB 5E2BA 3GD5A 5KNDA 2CYCA 1BW9A 3OAAD 4NMLA 2VT3A 3AESA 2F48A 4ZQIA 4FFNA 3RR2A 2HH9A 5AM2A 2ZTSA 1ZGCA 2ZBQA 3EEFA 1RC0A 2ZRHA 3F7OA 1JXMA 4LF8B 1NFRA 1J56A 4TXRA 4QQNA 3K9LA 4DTCA 3KJXA 4FDTA 4Q19A 2WINI 3CJRA 3R24A 4K2HA 1LNQA 3IPLA 3S2GA 4UM9B 4IRMA 2CHVA 3GK3A 5IKXA 4HRXA 2QR5A 3BVPA 4QU8A 3RM3A 4YT2A 4F2DA 4R0VA 5DISB 3M3DA 5K3DA 4WNEA 3GD7A 3OZFA 1I4LD 3B1YA 1F9AA 1TU0A 4KPFC 3ZV7A 4EPWA 3RC7A 5A02A 3H0KA 1XLTA 4D8WA 2H06A 4ESVA 4ER6A 3HNRA 3ZDQA 4TQGA 5KOJA 1RXEA 2V7EA 4K9KA 1SVUA 1MR3F 2COKA 3QY9A 5K0FA 2VQFB 3DMTA 3UPTA 3X2EA 3P9NA 3ZVMA 1TIBA 4I5FA 4TSRA 1G41A 5DRTA 4NU0A 2KB0A 1NXSA 1WIWA 1MX5A 4HOTA 1MH9A 1S01A 1RCUA 3CLTC 3L0ZA 3BIOA 4D8UA 5E9QA 3T15A 3ESCA 5LZ9A 1I7SB 2NPFA 1Y3HA 3OLWA 3KAJA 2PL3A 2GHQA 4EW6A 1BX0A 1W25A 4HRVA 4I0WB 1XEWY 1ELOA 2ST1A 5L3RA 5ADHA 3H1TA 2EJVA 1IZ8A 2FI1A 1GJRA 3ILYA 4TKVB 5MN4A 1IFXA 1FQKA 3K8OE 4MVJG 1G8PA 4F8EA 4BY9E 2FULA 1V5GA 5B7GA 2C4VA 3STUA 4HNAA 1WY5A 3B3JA 4F1SA 4AP6A 4YMVA 3L0YA 3NBKA 1SVNA 4KO4S 2J49A 4MV8A 4DQDA 5AVVA 1G38A 4UTZA 3EGOA 2AQKA 3WLJA 4LK3A 1Q0LA 3KVOA 5BUQA 1FMLA 5BSWA 1OI2A 4JEHA 1V6CA 2EARA 2QE7D 3VNSA 3D3MA 1MJFA 2JEYA 3T6KA 1YI8A 1UJ5A 4BETA 3WHIA 3SE0A 2D2IA 3AHCA 2VQ2A 1YZFA 3DVRX 3HJGA 5BSKA 1Q14A 2E4AA 1O0BA 2JAOA 4J2TA 5DT9A 4FHKA 2RONA 5MFPA 1COZA 3IQFA 1D4AA 4MIOA 2HIMA 3ONDA 2BM8A 3TWTA 2Q2OA 1SQMA 1QFMA 3IKOB 5DCWA 1N5LA 4L28A 1FDUA 3NGMA 4DIDA 4FE3A 2Q5CA 3W5CA 1UKYA 3N76A 4MOWA 1NTOA 2GLXA 5HS0A 4LOJA 2Z5VA 4ZU1X 3QVXA 3NTQA 3WBJA 4GYWA 4UQXA 1R66A 4XI0A 3OQJA 4DILA 5HF5A 4C4YA 3OX2A 5ERYA 3OA0A 3I9NA 5M5BA 4LOAA 4TS9A 2JH3A 1FNDA 2QUZA 4BN0A 1GUZA 3O8OA 4Q3BA 3VR1A 1SHLA 3A4YA 7YASA 4TYNA 1RAFA 4BERA 5FTWA 1M5RA 2ID7A 5KVCA 1YL7A 5BR8B 2JBAA 1UPTA 2WSMA 5JANA 3WLMA 1RLUA 4WGFA 3L1JA 2QP9X 4B3FX 3SZ7A 2A84A 2V3WA 5T5QA 1V5WA 1BEUB 3JS5A 1NZDA 2JHFA 2FQQA 4NBTA 2X2PA 5L9AA 2FE4A 3UQ3A 2AUNA 5KC9A 1E8YA 1E90A 3CMMA 3P5SA 4XI9A 2XWQA 2PKQP 4EGQA 3UEOA 4I1YA 3LXMA 3FH5A 2V0PA 4TLCA 3RFTA 1I6LA 4IV5A 1I51A 1E96A 3WISA 4BNKA 2X6KA 4HNRA 4F86A 1FW6A 5EWMB 4QPZA 3LCRA 5C8YA 4Y1FA 2I6SA 1BCRB 2AIRA 2ZIWB 2J85A 4KFUA 3RLFA 4CIVA 5LQUA 2NU9A 3M6VA 1FXWF 5KOHB 3AV3A 4FDMA 1IU9A 1IVYA 3HXKA 1E20A 1V8OA 4K40A 4CMKA 1XA4A 2ECKA 1WQ4A 2ATCA 3CK9A 3FYCA 1D1QA 1ONSA 1AHIA 4DIFA 5C51B 4LBVA 1U8EA 3TO5A 4I2WA 3W04A 3W5UA 2WE8A 3FYTA 4F1JA 4PH4B 3T7AA 4HT3B 3EJ6A 4JVSA 3JVEA 3L2OB 1H5NA 3ZCSA 5A9RA 1YJ8A 1R4MB 3OZWA 2L42A 5FA6A 3HJUA 1EGAA 3VPFA 5E9JA 3EMDA 3G5TA 4NBLA 3FTUA 2ZB8A 4JI6B 3T0IA 5D3MB 1QYCA 3AK4A 3SZ3A 2FAXA 1REQA 2FG6C 2BM9A 4OGLA 1NR1A 3NHPA 1SVMA 2BEKA 3C0KA 2BC9A 3R0QA 4J6EA 1SBIA 4G9EA 4RCZA 2VBGA 4M36A 2IW1A 4B8AA 4LOHA 5L40A 4KI7A 1K88A 1PGPA 1TCAA 5HMMA 5L4LA 3W5DA 2NQ8A 1DCTA 2WDZA 5IH7A 2LVBA 4QQFA 4XIJA 3MKQB 5ENTD 3OURA 2KYRA 1B73A 2I6QA 4X20B 3BDIA 4JX9A 2IY0C 1O6FA 1F0PA 1QLHA 2AMLA 3IIMA 2ZUVA 2AA3A 2ZAGA 3FNGA 1O6ZA 4E6EA 2DPHA 2JARA 4RKFA 4EI9A 1W93A 5GZ3A 1SBQA 4OB7A 1DCKA 2JI8A 1ZD1A 1RP1A 3MS4A 1IPHA 1IQPA 1EGMB 2Q99A 3CONA 3I6BA 4HYTA 4UCWA 4UMEA 2IELA 4M9SA 4QZVA 2D2VA 2I1VB 4HXFB 3VGJA 4WQMA 1SOMA 3C48A 1IOLA 2GJAA 2RFMA 4BX8A 3HUDA 4HZGA 4JYMA 1CUWA 4NCHA 3GVXA 4U2DA 3RSSA 1BXRA 4FFOA 1Q1ZA 2NZYA 5CFQA 2Y0DA 1DXHA 4LNUA 1G7RA 4LSGA 3ACDA 4F3YA 4K7JA 3GWZA 5IZCC 1I8TA 3GP5A 4K05A 2P11A 3AWDA 3K72B 1P33A 2J31A 1GKKA 3ZVKA 1TU4A 1XTIA 5E2IA 1OH8A 1C8VB 3LPAA 5ECWA 2Z3ZA 3EEBA 4XJXA 3T7JA 2KBFA 4P4NA 1VJ0A 3T3HA 5HUQA 5C8YF 5JO0A 4XVCA 3CPJB 5DW3A 2I4LA 3GNTA 3GPDG 4D98A 1KEEA 1TEHA 4QGAA 3IUMA 4KIUA 3CURA 4NBRA 1XROA 1D1TA 1LRKA 3DC2A 1JSRA 4G11A 5EIEA 4NXNB 2O59A 3T1QA 4LKOA 2IHYA 3UCXA 4FQ7A 4CJXA 3MXTA 1Q16A 3R9WA 3HA5A 2HA7A 3HYRA 2FRXA 4HPXB 1YMPA 4TZTA 4P38A 2HX1A 3ZCPA 4RJIA 3VYTB 1Y82A 2W6JD 2D1TA 3GI1A 3SBEA 4PQGA 3SBSA 2JL1A 3T0GA 4CUJA 3G3EA 2SICE 4CIXA 4DDKA 1H0HA 5JFTA 4HAUA 3UXHA 3K0KA 5EINA 4EA9A 5J2UA 4Y2XA 2GEDA 1KVQA 4HNUA 1QIDA 5JCJA 1WO8A 1IB0A 1IDOA 2JI7A 3U26A 3WWCA 3WYDA 3CZAA 3KG2A 4CLHA 4KGXA 2HO4A 1KBQA 4QVIA 4EB8A 5FI0B 1L5OA 1QQ5A 3OCCA 3W5VA 1O57A 1DMSA 4DCJA 3E82A 2I03A 1LLUA 4ZYWA 1V4NA 1CNFA 1RAHA 1T8SA 3GPIA 4HQNA 4BX9A 2YJNA 4KFTA 1E59A 4W8OA 5IKOA 3WRYA 4BNNA 3MT0A 5FV4A 3LCCA 5LZ4A 2XHZA 1JXOA 2OCLA 4TQUS 2I1JA 4O4IB 5BV0A 4MRAA 1GKUB 2IP4A 4D9JA 4EJ2A 3HFJA 2B21A 2IL1A 2QRVB 4PZ0A 2X8JA 1Z74A 4JBLA 2Z4RA 4JW1A 4JA2A 4BGVA 1BVRA 4PTYA 4NJEA 2KE5A 3FR8A 3G7NA 4JB0A 4PSAA 4D4KA 2WJWA 4WMLA 3E53A 2MYPA 3SYLA 2ERYA 4ILIA 5B7PA 1Z0AA 3U9LA 1H8EA 4OLJA 5KREA 3JALB 1XPUA 2GETA 1JYEA 1JKIA 4J8DA 3BFJA 2FX2A 2KPOA 3E9QA 3WMRA 4BDTA 1AIPA 3ZWBA 1NE7A 4K6CA 2P6NA 1RJ9A 3LF1A 1P1IA 2WSIA 2YUTA 2XTMA 4QJ4A 5HF9A 1GNQA 3HKEA 2WSBA 1L4LA 4GLLA 1IMOA 4INAA 5FEMA 3I39X 3BIFA 4KYVA 3AP3A 4Z2AA 3BK2A 1O5OA 4YDSA 4ZJPA 4BZXA 4GOMD 4F96A 2ZI5A 2BH2A 4D82A 1O8CA 2A3RA 2EJCA 2YUIA 1PC2A 2IEIA 3D2BA 3EXAA 3LO5A 4LDAA 4FFVA 4NLLA 4B43A 5LM3A 4JEMA 4IJUA 2OO3A 4B76A 3IJPA 2YXEA 1VBMA 2BFPA 3KR2A 2DKOA 3TQRA 2DQ4A 1N57A 4C0XA 3DDWA 5IJZA 1M66A 1HPLA 2RB4A 2WXFA 3TZEA 3W05A 4BLUA 2R79A 5GAJA 4TTSA 1XJ0A 4BLPA 5I9IA 4BJ3A 1Y8CA 4Q00A 3TNJA 1BFUA 1LTHR 4L3WA 5IJXA 1T1IA 4DX1A 1MGOA 3KKOA 4R31A 2GRMA 5D86A 2AJAA 3MGCA 5CB0A 3G17A 3HU5A 3A2KA 3RC8A 1NSYA 2J9XB 3E33A 3U4AA 1N5JA 4ICIA 4NEGA 3VLEA 4RW0A 4DC0A 4GL4A 3W6UA 2G0TA 4G0VA 1BD3A 3OE4A 2BJHA 1Q17A 2Q4DA 2ZRLA 2XD4A 1W96A 1P39A 1WXGA 3CEHA 5JRZA 3ENNA 4R40A 4QXRA 3BRWD 1GW6A 3TI7A 1S6YA 4R2IA 4XYLA 1JKMA 3ELWA 4ALNA 2CHWA 1KTVA 2IH2A 3SR3A 1K6MA 3FFXA 1EP3B 2ISCA 4M0KA 3PC2A 4W5JA 5GADl 5FEUA 2FUEA 1PSWA 4K87A 4NV0A 1QFSA 2Z08A 1D4ZA 2B5VA 4O63O 4HN9A 5HPYB 1NMEA 4C06A 3ANNA 3NJRA 3TFWA 3D6TB 2PUEA 1U2RA 1ABEA 3L8EA 3SYRA 4D3XA 3NV7A 4WASA 3PQ8A 2B6HA 1T0IA 2A9VA 2XGOA 3TG5A 1C7JA 3I0ZA 1SBHA 5FFFA 2CCGA 3DP7A 5DNCA 1O1TA 2NV0A 1PQPA 4MHTA 4GKBA 5LZ7A 1XK6A 4A1SA 3OTNA 2H00A 2YFYA 3ZCQA 2RDMA 2I67A 4TTTS 4KQCA 3P2MA 3V8PA 4AKEA 3L01A 2WMDA 3OBIA 3E58A 5IN5A 4EZEA 1QGDA 1QYRA 2ZCJA 2NACA 2X42A 3BJEA 3G68A 2EQ5A 2X1VA 3C1OA 5JVDF 4GBMA 4QYIA 1R00A 1NYLA 3AR6A 4EJSC 4PNPA 4BP8A 2PIAA 2ZUBA 3OT1B 3Q3GE 4XM1A 1E2EA 2H1VA 3WLTA 1QRAA 2RHMA 2H4FA 5D0QD 1A77A 3K9HA 4RQBA 2ZUEA 5MF6A 2P2CA 5J23A 5F7OA 5EESA 2XQFA 3PJDA 5EUQB 3EMBA 3RARA 1OOEA 3MRXA 2XQ0A 4KYUA 3K0FA 2HRQA 3T34A 3G2LA 5KYGA 2UYHA 1U1EA 5KO2A 1PR6A 2PU5A 3EBPA 2GJ8A 2BZ0A 2O3QA 3KOWA 3LLSA 3EY4A 4DK5A 3IMKA 4NYJR 3KBOA 3QF7A 5FZSA 2FFAA 3VTZA 3WYAA 5JROA 5L7TA 3HJCA 3CF4G 3U16A 1UP7A 4TM7A 2V1XA 3TSZA 2FZ5A 3EEIA 1L9XA 1Z15A 4BEWA 1KOGA 3DOOA 1ZBPA 1SCKA 3I92A 5BMVF 3ADKA 4Q1AA 1C9DB 3CZMA 3HVHA 5TPWB 2VGXA 1EHCA 1DEKA 3D7KA 4EHLA 2F67A 4CMIB 2VKTA 5EY5B 1DQSA 1H2HA 1Z0FA 2W6JA 4EQZA 421PA 1NIPA 4MLCA 4NG5A 2ZJ7A 1UBFA 4L57A 1OXJA 2QUIA 4YY3B 3HFRA 4UUBA 1ENOA 3AHJA 3ELYA 3LWNA 1IYGA 2NZWA 4PC7A 4BVKA 1DC6A 1QAQA 4MWEA 2QN9A 3WMFA 4F3TA 3N86A 4QGFA 3HU1A 1VKNA 5AM0A 1FSFA 4KVMA 2NZUG 2YVQA 3E9RA 1V7ZA 2E85A 3DEZA 4MVJD 3QVJA 4CPDA 2DQKA 1FIUA 3Q5MA 5GM1A 1VJ5A 4YCBA 4E5KA 5BUCA 1M2KA 1Q0QA 3RUHA 3ACCA 2XENA 2N42A 5JWOA 2N1MA 1G3UA 5JZMA 4XDYA 3ZHSA 1BXGA 5AN8A 1XCLA 5AYVA 4Z68A 4S04A 1FDRA 1C0KA 4TN1A 2GAFA 1L1RA 4R2KA 5IRCD 3IQZA 1BSVA 3K0EA 1DJPA 4ME2A 3ZD9A 4BKMA 4NIMA 5T3UA 1G20A 5AVZA 3G8DA 2DBRA 4QJIA 1Z62A 5IDXA 1PNVA 4MV4A 4B6JA 4BEJA 2BFCA 5CDSA 3VR5H 2F9LA 3ZHEB 1IN4A 3IILA 4GMHA 4HX2A 4IRUB 2R65A 3RRZA 5IG2A 1NBME 3PQ4A 4RD6A 3NLLA 4NULA 2P2YA 5IYZF 2H17A 3DR5A 1SG9A 4DA7A 4J0KA 2YXNA 4FB4A 5KX5A 4MRPA 4FGJA 1ISIA 4Q4DA 4CDNA 3L4JA 3GRFA 4NOMA 4Q9AA 4TKUB 5F23A 2HT1A 1M2OA 1YULA 1HF3A 4MYTA 5ULLA 3ZLJA 1GLGA 1MOPA 1KERA 3GGGA 4IAOA 3B3GA 3VVBA 2D0OB 3IEGA 2RH8A 4UBJA 5GPBA 1ISFA 1J21A 3V1TC 4LWZA 3Q7PA 1H5QA 1Z5ZA 1J8YF 1ZXLA 2DTXA 1K89A 3OZ7A 4WNAA 5IMBA 5TQ0A 4BVHA 4C5CA 3BT7A 3WWPA 3HE3A 1ZW6A 2QRUA 3UGQA 3NDIA 3OZSA 1AHNA 2ZLBA 1FDTA 3CCBA 1FNBA 1I1OA 2A0FA 5FNVA 4DUPA 4YGYA 4QKQA 4R1NA 5KQPA 2PUJA 2QVCA 3JYNA 5DCLA 1H2XA 5FHQA 5LZ5A 2PX8A 2E0IA 1YRYE 3H7AA 4TWRA 3UFBA 1QU3A 5ENZA 2WZQA 1FF9A 1NN5A 1C9YA 1J6UA 2F3QA 3HZZA 3K5PA 3L1UA 3MGAA 4I3FA 4L9PA 1V4BA 5JYCA 1OKKA 4C7KA 3C6KA 1Z2EA 1FTGA 4U9UA 1NQXA 5AVUA 2UWJG 1J70A 2A9QA 4Q9NA 4QVKA 5BN4B 2RHLA 3EHEA 4DM4A 1SUBA 1RE0A 3HYMB 3I5UA 1IOZA 2WFLB 2P8SA 1R4NA 5GQSA 1H2EA 3STHA 1F6BA 3A05A 1QS0B 4QELA 2G76A 1XTPA 1FTQA 1H1LA 2HWXA 4RVHA 1P81A 3WXMA 4P32A 1OWOA 5I8PA 1RFLA 3ZYMA 2QX8A 5J4HA 1KL7A 4QTYA 3M6IA 1EXWA 2H8KA 1IJBA 4F4UA 4YR7A 2YZKA 3NM4A 1ID1A 4J8YA 4DEYA 2WXRA 3ER6A 1N6HA 4KRYA 5ELLA 5LP6B 1TCCA 2VZLA 4UM9D 1SCNE 6REQB 1JEYA 1IEVA 3JQRA 4IVPA 4ECAA 1U2QA 2VTEA 2PD4A 3IEKA 3IQEA 3EXHC 4LISA 2JEOA 2FW8A 4PX9A 3ZC3A 3NASA 3BFXA 1T6NA 5FIOA 1EXNA 1NOKA 2BCJQ 2VFAA 2Y1KA 2ZWVA 2FPPA 3BCRA 1XTUA 3CT6A 3D02A 4QUJA 4W8GA 2XYVA 1HLPA 3RVPA 1FSGA 2C29D 2PMEA 4C4XA 1AQLA 2G40A 4X3OA 3CXUA 1POWA 3KJZA 2NO4A 3OEWA 3W77A 3GFPA 3K2EA 1T36A 4HDSA 3KR1A 5IAOA 1IY2A 3U3RA 2HQ1A 4QXOA 4H1TA 3VJKA 1QTQA 5FBQB 5C37A 1UIRA 2JH8A 3KQWA 2EOAA 1Z08A 3K5WA 1XQWA 3EZYA 3TH5A 3OZRA 3VVMA 4O3FA 2AOWA 3NTVA 3OU6A 4D9NA 1ZX1A 3W78A 1CRWG 5J08A 3ICVA 1PFGA 1VLVA 2GPSA 2VPIA 5FLYA 5H4HA 2DPLA 2XGJA 1NP6A 1QLWA 3FSGA 3M4NA 4KBGA 2ODNA 4W1SA 2C4TA 3PYMA 2BF0X 1A8HA 3HVEB 2VPQA 2WXNA 2QGFA 3GJZA 1LPNA 5AI9A 4EYQA 1QLJA 5T7BA 5FOSA 4D9BA 2YVKA 4OK5A 3RYIA 3JXIA 1T43A 2JGDB 2Z95A 3NHAA 3EG5A 3AU8A 3DZ8A 1N36B 3H4IA 4LRUA 1K6XA 3BIWA 2IHJA 2JFYA 3GRAA 3JYLA 3ORRA 1QYXA 1B16A 4EPVA 4UQOA 3ND5A 1LBTA 3LTEA 1KWGA 1UPBA 1OREA 1QZ2A 1ARZA 1F1BA 2LCQA 5AFSA 1EESA 2K87A 4WFJA 2L18A 3VOAA 1ZITA 2E49A 4RCVA 1WBBA 1WPGA 2ZBRA 3KR9A 2BV3A 3CR7A 3LECA 3JRNA 3ONNA 2QJRA 5TMPA 5EILA 1ULTA 1SRQA 1TU3A 2AB0A 2O3JA 2PMFA 1Z29A 1CERA 1IK4A 1GGEA 1MRZA 2WHYA 1H6BA 3M70A 3ID6C 2L82A 4QNMA 4S0XA 2VDPB 3O4GA 4YGXB 4YAEA 5FBLB 4H35A 2FXVA 3TCNA 2GHTA 2YMPA 1N2XA 3B1JA 3Q8LA 1QQAA 3NRJA 4OATA 1M75A 2GNAA 1LUAA 2PUTA 3R3VA 3NNDA 1U2PA 4ISBA 4J1SA 3R8XA 5KWIA 6CHYA 3CN7A 2Z2IA 3BH7A 1VP9A 4TVOA 5EJ5A 4TS4A 3UGTA 1XKLA 4ZIRA 1UBCA 4KQWA 4CZ2D 5LZ2A 4NNJA 1ZM2A 5AK6A 2QQ0A 4ZAGA 5LOZA 2RAFA 2VHEA 5EMJA 4NNPA 5GVRA 3FCCA 1V55E 3MTDA 2FSSA 1XMIA 3MWDA 1B8OA 2GCOB 2V0CA 3MJEA 4J2OA 1WM5A 3TECE 4RS3A 3VKWA 4R68A 3TLBA 5B55A 2WB4A 5JXGA 3ZHRA 3I9FA 3TX2A 1SXQA 2HC9A 4DX5D 1V1MB 2NNLD 1MEJA 2YBDA 3PPVA 4CIWA 4DV3B 1WETA 4O2BF 1OXMA 4L4UA 3DCYA 3IJ5A 4DW8A 1BE6A 1UDWA 1TD1A 4B8CB 3VPCA 1M5UA 4LRSB 2GZMA 4CF4A 4X6XA 2A67A 1M34B 2ZPTX 2VHUA 3PUKA 1Z06A 3AM5A 1YZUA 2Q5LA 3U64A 3EF0A 3M8KA 4JNCA 1PEAA 1YCSB 5CA0B 5F51A 3BKWA 4FNOA 2QYHA 3WZMA 3CKYA 3BSWA 3DWFA 2GBLC 4PX5A 2V58A 3IMFA 1NMQA 1X7ZA 2FX5A 3P7MA 4JLUA 3SPXA 3WL3A 3M1LA 4CWAA 2JHAA 2GBIA 3PZBA 3Q98A 1RPJA 1LK0A 3OAAA 4M55A 1QB8A 3IELA 5I7HA 2NIPA 2QVZX 3DWIA 4Q9JA 3UNXA 1GA6A 1A0OA 1Y5MA 1G20E 1HYEA 1U9JA 3KJIA 3LFTA 4JJZA 4UAUA 4YXFA 3A31A 2VQ6A 1JLHA 3DCNA 1Z0JA 4MQUA 1M2HA 2P27A 3U4IA 4WOJA 3EG9B 4P8RA 5CDUA 4Q47A 5FLEX 4FZRA 2YWJA 4GBJA 1WX1A 1M1ZA 2XNDA 4URWR 3BDAA 1NWCA 1V39A 2ANCA 2BR4A 1S3GA 3SHOA 5DWVA 4H1WA 1OHHA 2BONA 3PQ2A 3DBHB 3U56A 2R5FA 4EMTA 1V47A 2J8ZA 2FSHA 1L3CA 3EA5A 4M7CA 1RAEA 1CHDA 1DBPA 1SZAA 1G2IA 1GZUA 2V5UA 3HMKA 1UC9A 3PHGA 4KUEA 1M54A 2PMDA 1ULSA 2BHNA 2DBVO 3OPNA 4G07A 4O33A 1VKOA 4LXIA 4Q39A 5DLEA 2OV3A 4U7TB 3J7TA 4X65B 4Q7LA 3ZQ4A 4B5LA 3N2EA 2WKPA 4UI9C 1HK7A 2YXBA 1M1YA 1UR5A 3RSEG 1F8GA 3QP9A 5E75A 3FUFA 2HQRA 2QSYA 4QG7A 2VLBA 1VYHA 4K5CA 2OCBA 1F5SA 1JHAA 1PU2A 1XNHA 2H07A 2PQMA 1X0XA 3CTMA 3NKVA 3S7ZA 3WYNA 4TVSA 1OCCE 1R0SA 5IM5A 3WWZA 5C4MA 3BQ9A 1FFDA 4TZKA 1DT5A 5I4IA 1A5ZA 1LDBA 1LK5A 2C9DA 4PCUA 5JSZA 4HGPA 1E9RA 2RGEA 1PJRA 1DKUA 2I54A 4BWRA 3KUCA 4PQYA 3WL5A 4DR2B 4L4XA 2LUHA 4RQUA 3T9EA 5AWFC 1C81A 3O7MA 1PEYA 4YACA 2WWFA 3NBZC 4YS6A 4D0RA 4ZI3A 2OENG 3UW3A 1PWZA 2C8LA 2HBRA 4Q1FA 2LTAA 1NN0A 3VQTA 3PT5A 2WJGA 3KHKA 3DT8A 3U7FB 1MJ5A 1H93A 1VE3A 2XGMA 4ASUD 5IKPA 5LL6P 1AZWA 1NXVA 2H4ZA 10MHA 2ETXA 3QAQA 5AXAA 3FETA 1CQIA 2DUJA 2XUPA 2R6R1 2C9CA 1ZGZA 2FK8A 4OIFA 4QECA 3JYHA 4XJSA 5HE9A 2GZHA 3IP1A 2CV0A 1RYZA 4ZOCA 4Q4JB 4EKIA 2JFFA 3BD6A 4KOEC 3ZHCA 1KIAA 2XS1A 4CM8A 1DEAA 3FUEA 2I87A 1M8JA 4CEIB 3QKIA 1ONOA 3A4LA 1PFYA 3BSSA 4Q7KA 3AY3A 3I5XA 3GMIA 3KAKA 3BA1A 4K3VA 3VFDA 1C9KA 2H7VA 4M0LA 3VOBA 1CUZA 1KI2A 2Z3WA 2CF5A 4RFLA 4AZVA 3HJNA 2Z98A 1L7PA 2CDNA 4FMPA 1PWEA 1JW9B 1B43A 3VSAA 5BT8A 3OIVA 3AU9A 3RBXA 1V1RA 4M22A 4YLYA 2QW1A 3F3KA 3RAJA 5BW8C 1N4AA 3VVLA 4KODA 1UPUA 4KSBA 5CJPA 4LJ5A 5SV2A 5DHQA 4AUKA 2GN1A 1E9AA 3TL6A 2PCJA 3ZGYA 5BR7A 1UFKA 1U3WA 3REQB 3U37A 4IM7A 2QX7A 1X8LA 3L7NA 2A1UA 4C0EA 2FB9A 1P6QA 1VLZA 3WNDA 1ZSVA 2QZ9A 3OX1A 1KMCA 2ES4A 2H52A 2ZJ3A 2B37A 2OYSA 1PX0A 3EG9A 1P44A 2ZYHA 3OEHD 3UPUA 1OBCA 1ZJ5A 4G81A 3CK8A 1WSBA 1K7EB 3V8VA 4GP6A 1UJBA 1XIVA 1TEZA 2C2WA 4LYFA 1Q0HA 2VTBA 2YN4A 5K3EA 1C4KA 4RA9A 1XVTA 4CKCA 4DV0B 3PRJA 4OI0A 2XZPA 4JDPA 2FR8C 4FQ5A 1R9MA 4N5LA 3M9WA 4YCJA 4Z0PA 2YRFA 3URKA 3OQHA 4Q9DA 1KP2A 1V25A 2ISQA 3LUAA 1ZJWA 3SM3A 1OD6A 3I6MA 3ZK7A 1N1GA 1TTQB 4DR5B 1N0RA 1B6SA 3WNZA 1W6UA 4TV3A 1HLGA 1A2BA 4TVKA 1Y6IA 1MW8X 1U9ZA 1LI7A 5FQ8A 5DP2A 5TQJA 1V45E 3H18A 3H2BA 4Y7CA 3KBBA 1U7UA 5JHHB 3MCWA 1AOXA 3BMOA 4BZZA 2VP9A 3E22B 1UC5B 1UXGA 4N54A 1WE2A 2QVLA 1QHIA 4PFKA 3TLJA 4ECEA 1KI4A 4KDRA 4D44A 5CB4A 1Y6RA 3UJPA 3BOSA 1E96B 2WKRA 2BDEA 2DH6A 3TTXA 4YFYA 1P5RA 5JO9A 3RHTA 2V4MA 5AD1A 5AW1A 2Z2ZA 2VDQB 4KDEA 2DCMA 1WDKA 4IGEA 1RMQA 3DLBA 4AIIA 2AFHA 5AW8A 4ZOLB 2GXQA 1PK9A 2C31A 5C8XA 3WYFA 3DFUA 3B7PA 3L77A 4G63A 4G1FA 3TCKA 1R6AA 1CYDA 4X95A 5ARCA 2ZJ4A 5FPQA 3V55A 1YU6A 3DZHA 1L8LA 1FDVA 3QDNA 2KHZA 3J81k 3RS2A 4DJJA 2NU7A 3DE5X 6GPBA 3UB3A 2HCTA 1WULS 3PQEA 1NHWA 4EJ6A 2VJ8A 4WNGA 3SO8A 4KQIA 1JWBB 2IFTA 1BOFA 2JIRA 3PPWA 4NECA 3SVLA 5J2TA 4KU4A 5K3SA 1NXPA 3FEXA 1I3NA 3GZJA 5ALTA 2PL1A 4QT4A 4BXOB 1U02A 4Q96A 4ZV7A 3RRMA 2ODWA 1ZD5A 1L5ZA 2PVCA 3D4LA 3DTTA 3PXDA 4NR0A 5DYWA 5EKTA 3IXMA 3RASA 2FY8A 1WXIA 1JEJA 4PS8A 1IPEA 1UBRS 3AZQA 3Q8WA 4BWYA 4RETA 2GQ0A 1YOVA 1SJ9A 2D1QA 4PVCA 3T1TA 3ZU7B 1JDVA 4XVHA 1EU1A 5AI8A 5B1EA 3QF4B 3K0FB 2OCIA 2XDWA 4NV1A 3D7RA 1SVIA 4Q9HA 4N6GA 2IXBA 1SQ5A 5F2OA 1PG5A 5DK6A 4F1WA 4H15A 2JLXA 2VGEA 3QLVC 4UUOA 3E8MA 3MCAA 1WKBA 4YMSA 3E4BA 3WG9A 3ZKWB 4ALKA 1Z63A 1JIQA 4WI1A 4B34A 5EQDA 1NF8A 1AWCB 1X6VA 3VDXA 1ABFA 1GPJA 2XB9A 1TGVA 3G8CA 3HA7A 2G8LA 4ZT5A 1E9FA 2GR9A 1VZ3A 3RGGA 1C4OA 4UTRA 3AETB 2ZAOA 4E03A 5KJMA 2ONYA 4UE3S 5JDCA 2AF4C 1FBNA 1SUAA 3O1JC 3MFQA 1GM5A 3E2MA 1E9EA 2I4IA 4FEEA 4HDAA 4B4KA 3ZU4A 4D8YA 5IZCA 5T8KA 3K8QA 1G5QA 4LIPD 4U02A 1DAKA 5CDFE 3OCZA 5F1KA 3OT5A 4L07A 3KJQA 2HJVA 5C4IA 3ZU2A 3RREA 3N53A 4BNMA 3SQNA 2ACVA 3KJHA 1FLAA 4EHKA 1RRVA 1S1CA 2C7GA 4R7TA 5HZGA 3QVGB 5H9WA 5JI2E 2PSHA 3Q9NC 4AY4A 3HN6A 4FA6A 1WVMA 2ZZMA 4KLRA 5E4FA 3TDNA 2PX4A 2HSDA 2C0CA 4XXHA 3VU1A 1QH0A 4BLOA 4UI9J 3L1KA 1Q15A 2HOQA 3ABIA 4HAYA 1ESMA 2QT0A 1C5KA 2HWUA 2ZR8A 2BKXA 5BUSA 3TWUA 2LXNA 4OTZA 1HS6A 4WACA 3DEJA 1Q12A 3S2AA 3M6FA 3N2GB 4Q5IA 1Y8AA 2ORWA 5JBNA 4LS3A 3AXTA 3VZRA 2NXEA 3LM8A 1IHOA 1V8BA 1EWTA 3FPGA 1LV7A 1OCZE 3C3PA 4ZVTA 4DNQA 2GN4A 2BHTA 3MMXA 1Z5UA 1FNMA 3B82A 3MAGA 1RTTA 3TXAA 2P9FA 1P5QA 2XWJI 3KS9A 3CM0A 5LMUB 3F2VA 2HMWA 5J47A 5BV1A 1CETA 4NI5A 1EUDB 1G18A 2NO1A 2Z56A 2ZRGA 5HCUA 3AEXA 2PSSA 3QNMA 4MS1A 1A2KC 2IKQA 2V97A 1QO0A 1G55A 2LE0A 3PP8A 2AYYA 4FT4A 4GUDA 1EDZA 3D4OA 4C6RA 1Q1QA 3K9WA 2DH5A 2J3JA 1Y34E 3VV2A 4MB6A 3HBJA 4MI3A 2A9KA 3HVRA 3OMWA 2ZVQX 5EJ7A 2A0YA 3FOCA 3VSCA 1S7GA 3EWIA 4JR0A 3DW3X 4Q7MB 1YKGA 2VYVA 3PYLA 2BZGA 4MV6A 1YMQA 3X1ZA 3BDVA 2XZTA 3IDFA 4ZMRA 1DKQA 1FUKA 1WJGA 1SQGA 1ZJ6A 2JBAB 5P21A 4OB6A 1YJQA 3TFQA 3LDHA 1TJNA 5AQ9A 3FCEA 2X6JA 5CECB 3EZ7A 4TYMA 5CVEA 1CLUA 3GZ4A 2ZSFA 5K3CA 2Q07A 3RSHA 3CMCO 3C6XA 5B12A 5E2AA 3EU5A 1BMFD 3R5JA 1QHFA 1XRPA 3ZRHA 3P20A 5KJ1A 1SKMA 4ER5A 4MUIA 2O05A 2GAAA 4HATA 2IUEA 4YLEA 4D5GA 3I62A 3WTBA 3ZGXA 1ACMA 1CKEA 3GC6A 4ES6A 3ROTA 2J4FA 2OC9A 3WMEA 4KNYA 5LA6B 5CVJA 2DHQA 4KXNA 4XTCS 2KMLA 4JI8B 5A06A 1JFRA 4WKCA 1C29B 2AC4A 3ZIMA 4XIIA 5J4KA 3M3HA 2BTDA 1KI9A 1K8XB 1PLLA 5CPBA 2PAFA 2YYAA 3IA7A 3K35A 3VPSA 3T7DA 2Q6LA 1MHPA 3U4GA 1U7XA 4BS9A 4J4BA 4DLSA 5E3JA 3D8HA 1WY6A 4FGLA 3PDJA 4L8YA 1HF8A 4FYXA 3FBTA 1E8XA 2YYYA 4LQLA 1VL5A 2EF0A 5TPZA 1HRKA 3K6SB 1ESCA 4ZHQF 4L8LA 1P1RA 1K3FA 2O2CA 4DYHA 2ZVDA 4RSRA 1ANKA 2VQEB 2OGUA 1WW3A 4DV6B 3JQ1A 1XAIA 4YJFB 1UMBB 2ZBPA 4LVCA 5CVDA 3VJMA 3J81A 1XMOB 3PPXA 4CETA 1GCOA 4MUEA 3VAZA 1QRSA 5CH5A 3VH3A 1ZU4A 4MINA 2JFGA 3AHEA 5JCPA 1KZOA 1ES9A 2CWDA 1K8QA 2JGRA 3KLBA 4AKTA 4E1BA 3NHZA 3MTJA 1D2HA 4QXAA 2P68A 4GZ3A 3FJOA 3DAFA 3LX5A 4KK4A 5CK4A 5E95A 5D84A 5EA2A 2W9XA 4BFCA 4DUGD 3N2LA 3ETHA 3QPDA 1Y7TA 3KDSE 2I7XA 4LV6A 4DIEA 3FUDA 1RKVA 1JWAB 2HHAA 3WWEA 3ZV6A 1FP4B 3ND7A 5IUNC 2G07A 1M1NB 2ORED 3H5TA 4REOA 3W4KA 3S2YA 1Y4SA 3GLHE 2I2WA 4C21A 1D8EA 3MHTA 4MZXA 4ZCRA 4RQAA 3RSLA 3UM2A 3OKCA 1JA1A 5LB2A 3REQA 4TMVA 1AY0A 3GDHA 2AT1A 3CUWA 1DTWA 4ZI5A 3IAEA 1FX0B 2BUAA 2FEAA 3LQ2A 1CRLA 5DHSA 1Y5NA 1XDZA 2J7PA 2HMTA 4WNAB 2ZUTA 3WNQA 1P2UA 2ZBEA 4AIFA 1XDSA 2X8LA 4RY8A 3WQHA 2WMYA 1KMIY 4HBDA 3MRSA 3NB0A 4RJKA 1Z73A 2VYFA 3A1EA 2CVOA 3LYUA 2VRWA 2Y92A 2JFBA 4GE0A 1PV4A 2VUIB 4EABA 1S1MA 4IMRA 5JWRA 3U19A 5HS6A 3LHDA 1Z2OX 3QJGA 1H2TC 3VDQA 2YHSA 4MULA 1US8B 1E9CA 2YYSA 3IEVA 4EQ6A 1ZZEA 1DWPA 3CV0A 2NXJA 2HLDD 5EP2A 2P77A 4JI3B 2X77A 1KC1A 2HF8A 1DVPA 2O23A 2VNAA 1B8VA 2QAGB 3C3JA 1XDDA 3QIAA 5B4UA 3NMUF 1V16A 1CJCA 3R7RA 1TADA 1C9MA 3K15A 1DC2A 2AX3A 3H8WA 5B58T 4BBAA 1Y0BA 3U4QA 1RYEA 2ALJA 1PN3A 3IEPA 4OHXA 1NVWQ 3CV3A 4TTAA 1H3FA 1YZHA 4ZYTA 2YQ8A 4QJBA 2J5QA 4EZKA 3FGZA 3THXB 4MKIA 4BB6A 3HJHA 1GPWB 1FX1A 4OF4A 4XEUA 1YZTA 3N70A 3WKAA 2IZOA 2J9GA 3FDZB 4RUKA 1A95A 1UJNA 3CZ9A 3FOAA 3GWGA 1E4YA 2X6IA 2BI7A 1T6BY 2PLWA 2Q7FA 3UUXA 4GWKA 5IK2D 2X4LA 1TNOA 4GXQA 5I7WA 3RSFA 1NJ6A 1QOQB 5THQA 5E3HA 4MNTA 4QBTA 3UUFA 2WSLA 5ITZA 1A8SA 1DAIA 4F6RB 3DTYA 2P7HA 3MV2B 3IB3A 1TVKB 1MO4A 1ZOSA 4HNQA 2FPPB 2JPDA 2RBEA 3GJSA 3KVNA 4L0MA 2AKEA 3I8XA 1AKMA 4LGCA 4H6VA 4UWKA 4LHSA 4Z0TA 1QKJA 3IP6A 3CW2A 1U8UA 4EG1A 5J2UF 4AZ0B 3HG7A 5TF0A 3HXMA 4YJDA 5EHXA 2W2TA 2MSEB 3V00A 3G6WA 4U7PB 1WHSB 3OIWA 4RM3A 2ZYGA 2CNLA 3F6EX 3O8BA 3CGWA 2FMTA 2YWCA 4P7KA 3NYIA 3BBPA 2RHDA 1VJRA 2PBFA 5IT9A 1ZRNA 2QXUA 4ZT2A 2XT9A 3GARA 1TM1E 3HXOA 2O50A 2O2ZA 2RCYA 1C1HA 4NCBA 3P5BA 3CRMA 1ENPA 1B8PA 2OV1A 2VDMB 3H11A 4JC8A 3FLMA 5DBIA 5F76A 4YQEA 1YQTA 1I4TD 1LI5A 4JB8A 5AK3A 1GGFA 1S4QA 2IITA 1P60A 4NJMA 4DWWA 1R15A 2BBTA 4KTVE 2ZE8A 4GM4A 1NC1A 2G36A 2WIAA 3HDXA 3SWWA 2F3UA 4QRDA 2P5TB 3IH5A 3PWKA 4IWXA 2D5BA 5T64A 4EEXA 4DCSA 3V1UA 2D6FA 2YS7A 4GTRA 1NXWA 4RPGA 5SZHB 2GF2A 4GQAA 3KEAA 3C8DA 2CYAA 5DV9A 1ZM3A 2HHCA 5KCZA 3KLPX 5D01A 2ESRA 4K86A 5EE3A 3UENA 1SMKA 3UQZA 4FZVA 1P0QA 4ARZA 1XRMA 2PO7A 2CD7A 2NTYC 1ZU2A 3HYTA 1QNLA 1JMKC 1XQYA 2AKAB 3GAZA 3HDYA 4NCNA 5DDIP 5FBVB 1IN1A 2C4NA 3LQKA 4FZ5A 4FYYA 1AT1A 4NCXA 1W4BA 2C4HA 2Q0QA 1YB2A 3MX3A 5K0NA 4C3OB 2AYXA 1ZEMA 2JJ8A 2I62A 4UXJA 3UZUA 3DKPA 3H1GA 2TRSB 1OLOA 5C1OA 5BWBA 1Z5PA 2J4BA 4B7XA 1CB7A 3CVXA 3INNA 2GLTA 2QENA 3ANXA 4TTPA 1RC1A 1T2EA 1ZBDA 1XRQA 1W19A 4CCAA 2I7TA 2Q3EA 3ACBA 4J75A 4BVLA 1TJFA 4WBNF 1JJBA 5IAAA 4TYYA 3HXPA 1NSTA 2VHQA 2V4LA 1CRQA 2GCPA 1QCDA 4Y6CA 2J3MA 2WM8A 4FKBA 3EZXA 4NDNE 1MA3A 3PUYA 1MTOA 4C4AA 3A4VA 1NVMB 4HNVA 1U81A 2YWDA 4NOLA 3R8CA 4YQFA 3IOCA 5AVWA 4YRZA 4L5BA 5HJ5A 1WRBA 3H5IA 4HDRB 5B1SA 2V9ZA 3BAZA 3B3QA 1EGQA 2XXAB 3MBOA 4PO8A 3OZGA 3I04M 3JQ7A 4G0UA 4AY2A 4UAJA 2RD0A 2YV3A 1TXGA 2QUJA 3ZUVB 3PTLA 3LZDA 4KMSA 3NH9A 4ZU3A 3R7AA 3UOAB 4RSYA 1P74A 1ZC3A 1NGSA 2R6FA 4UBOA 2UXBB 1CJMA 4QTTB 3F2IA 1YMUA 1WBJB 1IUPA 2PU7A 2X5OA 3BB3A 3JWGA 3JVDA 1OSNA 1Z17A 2CK3A 4QPNA 3IBSA 4RQTA 4B9AA 5D85A 2XA1A 4HSGA 5FQOA 3CF2A 4BO5A 4EB0A 1ZSYA 3NETA 3GQBB 5AW9A 1BPOA 1A7JA 2GUWA 2VT2A 3JUEA 1DX9A 4XWWA 1K68A 4O2BA 1P5ZB 2OA0A 2AV6A 3G5LA 5YASA 3LUPA 1J8QA 1N5OX 1XZGA 1DXOA 2I22A 4IFTA 4LF5B 4I8IA 4R6XA 4BFUA 5FUQA 4U6SA 2VF2A 1BS1A 2VC2B 5D3ZA 3U5TA 5IXSA 1A4UA 4LPSA 1QTRA 1LPOA 2ZWOA 1AX9A 3DLAA 4UCXA 3L5KA 4L9WA 2QTMA 2QQFA 3QZUA 4JASB 3SEQA 3JQGA 1JHPA 3QQ5A 1XDGA 4TUYA 4D4IA 4IY1A 4GOLD 4QOEA 3STXA 3VH2A 4PN3A 3OTIA 3PA8A 2VF5X 3GEEA 3OZDA 4A63B 1G6KA 1MB9A 4J43A 4TMFA 1XKQA 221PA 1VP3A 4YRCA 3TXMA 3T5CA 4FWTA 1HDXA 1VG0B 4V0SA 3TE6A 3LHSA 3W90A 1RMTA 5EE0A 3T3MB 1ETHA 2SKDA 3I30X 4N8DA 4R2MA 4BC1A 3H8JA 5FDFA 4KQEA 5G4KB 2ZT7A 4M99A 4OBEA 3EIEA 3UW1A 1WBDA 1L1EA 3KOOA 4XGRA 2WZBA 3C3WA 3OFSA 2FPGA 4MQBA 1DBSA 3FNEA 4U7GA 5ETJA 5CEJA 1JLRA 1GTG1 2WTMA 3L7LA 4EWLA 4MVJI 1AK1A 4BO4A 4DMGA 1KI1A 2OBYA 5G40A 4ANUA 1CF4A 2BGTA 1SCUA 3LE8A 4KWTA 5KNDH 4F60A 1ISRA 1JLKA 2ODAA 1G2PA 1ZH6A 1XD2B 5GIOE 4KR9A 4DI4A 4I1AA 1IXKA 1YR7A 4PSUA 2WWWA 4RK6A 2EJTA 2XRMA 4MUBA 3UT7A 4EW2A 3KJGA 1ZGGA 4I9UA 4BMOB 2P67A 1KJJA 4GEKA 5K09A 4EYEA 3LWZA 5KHAA 3IRUA 4LJ8A 1G8KA 4M1WA 1ZMXA 2B7CA 5CLFA 3IODA 2BCEA 4UD6A 5L3QA 3L04A 4HI9A 3TB4A 3MQ4A 1Q92A 1SVLA 5DMHA 1PX2A 5HRYA 5CA0F 5ALYA 2ZYUX 3OFJA 3E2IA 1KDTA 1YBAA 4B3HA 4CR6A 3V8QA 5KWDA 1FRNA 4IQ0A 4IHJB 4I4TB 4GYYA 2YNMC 2Q29A 3O4VA 3OCVA 1KJIA 4U6NA 3RS8A 4CTJA 4LHXA 2IIPA 4NCIA 3EUAA 2C0LA 1V7QA 3S6JA 2G9UA 4FYKA 3RS0A 3S8MA 3F0TA 1GSHA 2JHCA 4FS3A 4QUAA 3TBFA 1TW3A 3KB1A 4XVQA 5CYPA 3CLSD 3TKLA 4FC6A 3TLCA 2VDJA 3O4FA 4FGKA 3PZDA 3QNKA 2QTNA 4GMFA 4TKUA 3EZGA 1AB6A 1DFHA 2XDYA 1KEVA 3BQMB 5I5EA 2W6CX 1ZWKA 2B82A 2B3TA 3ZJ4A 4YHBA 1X7XB 3DQQA 3C45A 3ZY5A 4AEZC 4EHBA 3BB1A 3MYYA 2XUDA 3NP9A 2C5BA 3R4CA 4W5HA 4W1RA 1MOQA 4JIMA 1G8AA 4MIYA 3ZDXB 2LGJA 2JJMA 4EY3A 2K7FA 1UK9A 2CXSA 1L8XA 1W1UA 1GEGA 1JEEA 4B2IA 4COKA 4OJQA 2E4UA 5EUMA 5TV2A 3Q72A 8ABPA 3C7AA 3KEFA 4HI0E 2XOKA 4EPRA 4RK7A 2QUHA 5K8UA 1RZ4A 1SC4A 2BM1A 2WNSA 3E7WA 2PX0A 2R8RA 4KIFA 2YJ6A 4S35A 1RC8A 1SPXA 1IJFA 2ID9A 4IGIA 1L3IA 1NT4A 5L95A 4P84A 2GROB 3PREA 5BN5B 1X1DA 1WV1A 3I09A 4F4HA 5CFNA 2WY2D 5G02A 1WPQA 1E1KA 3TM4A 1KSGA 3RSZA 4RDXA 4CG1A 4YDWA 2IHVA 1ODCA 2R4TA 3U4CA 3UJ9A 1CUHA 1YCGA 2J6CA 2Z83A 1CY1A 3BMQB 3HLTA 4RPIA 4ARAA 2I80A 2A5YB 1U2GC 2CXQA 1Z2CA 3NHRA 5HIAA 5IT4A 2W6PA 4ENWA 3N75A 1KAGA 3T5PA 1HEIA 3H84A 3MJHA 4QSHA 3VR6D 1TQ4A 4FILA 1U7TA 3B6MA 1K06A 4FMDF 4O4IF 4PU0A 1T5HX 5BQOA 3ZDYB 5DXAA 1Y1KE 3AF0A 4BUZA 5C7YA 2QU7A 5BN3A 1RE1A 3PT9A 3PKZA 2VSFA 4JVMA 1RW4A 4WCVA 4ER3A 3UMVA 1E6EA 3LWBA 4G5HA 4LMAA 1JDUA 2YOFA 1GAQA 2ZQYA 5DPMA 1TMOA 4ZHBA 1CDDA 1KY2A 5DP1A 4DABA 3DFIA 4UTNA 2HYIC 1OPRA 4G5SA 5LYJF 1XE3A 2SBTA 3DXMG 4XX0B 1J33A 1JQLB 1U0NA 3PNQA 2Z8XA 1RLTA 3PJRA 3G1WA 1GWNA 2Q7XA 3QKSB 3ROPA 1BCSA 5GMOA 3COZA 3HV0A 2CY0A 4K1LA 5KSPA 4AK9A 4AYTA 4IH4A 1SUSA 4EY5A 4B89A 3CO0S 2Q0SA 3FAKA 3L82B 4YWJA 5LKRA 1EPUA 1W9MA 3EPJA 2RGWA 1ATZA 1L7EA 2JFXA 4KXXA 2WQ7A 1EFVB 1LF0A 2NXNA 2PZAA 2QI9F 2V4HC 1BA3A 3EVDA 1IAQA 1MAAA 4L2YA 1R0KA 2RHOA 1LZKA 2PK3A 3ESRA 5KB3A 5EXSA 4AU1A 1VDZA 3RU2A 3IJRA 4EDHA 5ECGC 1P8JA 3PE3A 3DUFB 3WB2A 1M7GA 1ZIXA 2Q5QA 5ALMA 1AQIA 2CVFA 2BL4A 1X1AA 1P9OA 2WVGA 2RH9B 4GTMA 3KQPA 3PC6A 3GDFA 4ATZD 2NOAA 3R20A 4M1TA 1OLXA 2G3YA 3IAFA 2OXTA 3EWNA 3I32A 1XNRB 2RSLA 5JAHA 3H8VA 3NTXA 3R77A 5LLDA 2XR1A 1SHKA 2C8JA 2GYUA 2VYIA 3MTEA 1DEXA 3FHEA 4ZYLA 4KVAA 5B58C 3UMJA 4TV8B 3RS4A 2WF7A 3U81A 3BZBA 2JIQA 4ZRNA 3SD5A 4BQEA 2NUAA 1QVRA 3ENKA 5E6RB 1F7UA 4PZCA 4PQEA 2QN8A 3ZH9B 2Q46A 5CH8A 1R0ZA 3H0CA 5AKIA 5FI3A 3ZXPA 4L8WB 4WN3A 4DCPA 1MQ9A 2XOEA 4Y0NA 5FJIA 2XNHA 3W8EA 4Z7QB 4B3SB 3HP1A 4A2QA 2A0WA 2HMYB 3O1IC 1C1YA 4WAFA 2HDWA 3QPUA 5LA6A 5BURA 2MYOA 2PL5A 5D8DA 3NANA 1L5MA 3P32A 8MHTA 4WGGA 3ABRB 2ZWMA 3ULQA 1IZ9A 1ULUA 1JKFA 3AG5A 1JDTA 5DO9A 1JF8A 1FS6A 1UJ4A 3WLKX 2Z09A 1JIKA 5BN5A 1SULA 2XSZD 1MVOA 1Q83A 5FPKA 1B2LA 1CNEA 2PGNA 3KD3A 4MDFA 4C9BB 4ND8B 3DL2A 2F0YA 5E1BA 5D2CA 4O1PA 1ZMOA 5K51A 4KPYA 3VR4A 3M4JA 4PSKA 4Q02A 3V4ZA 4C2AA 1UMBA 1S4MA 2PZJA 4OXIA 4Q7EA 3UBTA 3SJCA 1SY7A 3QY0A 2I4NA 2W2LA 2R85A 3DFFA 2K5UA 4XQ0A 3VKVA 4YT8A 4CF6A 2UYCA 4YVQC 2I4OA 1EQ2A 1WNFA 2J45A 1N0WA 1IOWA 2IQ5A 3DEYX 4HQRA 1E61A 3BWEA 4JBYA 5BNIA 2B7LA 3CZQA 2C82A 3GL9A 5CTJA 3KVYA 3RAFC 2I6FA 3HABA 5EWLA 1DKLA 3O4JA 3K4HA 4J7CA 5FB3A 2NP6A 1QV7A 3FU6A 1UT8A 3DS8A 4TV8F 1Q1NA 2NXPA 1QQBA 4BAZA 4CTKA 4Z6KA 3MJ4A 3E30A 2NYAA 1E58A 1C1DB 3DV2A 3PGVA 3GZNB 5H5JA 2GZ1A 4ZGBA 2C94A 2NO7A 1XTQA 1Z4PX 1ZMRA 1NNUA 1Q7RA 1XA0A 3UV7A 4ACKA 1TW2A 4ITVA 4LZWA 1FX0A 4PR0A 4KQ2A 5CIQA 3SMQA 1ISPA 4OQYA 4XE0A 5CEAA 3IDZA 2CCJA 4DXDA 1MHTA 3DBLA 4BO6A 1AUQA 4DB4A 2E7ZA 4J4TA 1KAQA 3PI7A 4XTRA 3V8EA 4GLBA 1CU1A 3ZI0A 3P52A 4UPDA 1QSGA 3JQBC 1RWWA 3QEOA 1R5NA 1D1PA 3D43A 4YAGA 3WGUA 5BSVA 3FYSA 2QTAA 3LXRA 1M2FA 3FHCB 4YCNA 5KNBH 1I4OA 1IQUA 2PXAA 2GK6A 4I50A 4MKXA 3AG2E 2IZ7A 2PT6A 4MWZA 4F1KA 2Z04A 3PJEA 1RQ7A 4PC1A 3HDQA 5TX7A 4F5EA 2DM6A 3LEWA 2Q9CA 3PEVA 2C42A 3ANSA 1NZJA 3ONEA 3PI6A 1C7IA 1KZ6A 3LUFA 1J00A 4MV0A 2V65A 4P2GA 3RVLA 2H51A 5AVOA 4BVEA 1IVSA 3LTNC 1QZZA 4JLWA 4PNHA 5ENSD 1KPHA 2QTVA 4QOJA 2EHJA 5FF9A 3U80A 1RBYA 5FL7D 4CQMB 3NAWA