2XGOA

Xcogt in complex with udp-s-glcnac
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
548
structure length
548
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCOGT
publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
total genus 203
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgoA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgoA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgoA02
4YVQC 5ARGA 2AZDA 3CUWA 5ENZA 2F3UA 1IHGA 2SKDA 3ZGQA 3EBOA 3FWVA 3RKVA 4KXKB 2WQHA 3OKPA 3T3IA 2KCLA 3MBOA 2QRPA 2VGXB 4EJ2A 3UUXA 1P4HA 5G04C 3E3NA 5TMEA 3N71A 5EX0A 4WNFA 1Z8DA 4GPKA 4JL0A 2SKEA 3BD6A 5JTUA 2XA9A 4GZ3A 3ZFWA 3OXFA 1L5QA 1FCHA 3LY7A 3IEGA 2VSNA 1XV5A 1XNFA 2C1ZA 4GYYA 1E4OA 2XEVA 5AYWD 4Z5XA 4N2SA 3AS8A 3ASFA 2GPBA 1FU4A 3O3CA 5TMDA 3L79A 4YNDA 3BEEA 2OFFA 4N3AA 3NC4A 2F3PA 5IKOA 1C8KA 3RJVA 2XCUA 3G2HA 4MI3A 2XCCA 4GZ6A 1XC7A 3MSCA 4NRHB 3MS2A 1RRVA 2QN7A 2XMPA 3S0JA 1Z6PA 4WADA 4I9EA 2UY1A 3OTGA 3BDAA 2IV3A 5EKQD 2LSUA 3OKAA 4RBNA 5TMBA 4RIEA 2E2EA 3RSZA 1K08A 4AM9A 2QNBA 3RSCA 3GZ2A 4J8FA 1NOJA 4N5CA 4UI9K 1GZ5A 3DDWA 2H1HA 2PRIA 1NOIA 3Q47B 5D00A 5LQDA 1WAO1 2P58C 4LDPA 5HI7A 4GYWA 1B4DA 2JZCA 1ZU2A 3VTYA 1WUTA 2QLNA 2G9UA 2GEJA 3IA7A 4RIIA 2KS6A 3QWPA 5I45A 2R68A 5G05C 4XIFA 1Y8MA 2WTXA 3G2KA 3S7FA 3OTHA 4UQZA 4NESA 2XGOA 4A1SA 4BT8A 3CX4A 3CEJA 3MT7A 3FP3A 3OY2A 2PQNA 1NA3A 3ZHEA 2C2LA 1WV1A 4RENA 1QQEA 2AV6A 5KJNA 3PE3A 2I6HA 4CTOA 3OTIA 3Q3IA 1P4GA 3L7CA 3E3LA 5TVGA 1GFZA 4IN3B 5BW8C 5DXFA 2PL2A 3PDNA 3NB0A 1C50A 3T5TA 4JA7A 3SYRA 2C0LA 3T3DA 1ZBPA 4I17A 2NC9A 3TAXA 1FU8A 2BGUA 1ELRA 2ECPA 3ZCTA 1TJCA 4N9WA 1B89A 3O48A 2SKCA 3OKCA 1F6DA 2C1XA 3S7JA 3D0RA 3CKCA 2QRQA 4N3BA 1L5WA 4X7MA 4CDRA 3U4TA 1P29A 3LKUA 1A8IA 4NQ0A 4EL5A 2YJNA 3ZCPA 3COPA 4YVOA 1O6CA 5CHEE 1XOIA 2R66A 2QN8A 4BWRA 3EBPA 2G9RA 1V4VA 1Z62A 1C8LA 3Q3HA 3MA5A 1NLMA 1FTYA 3NF1A 4REMA 2C9ZA 2QN9A 5KJMA 1JIVA 4NC9A 2KATA 4APOA 3IAAA 1NZFA 1UQTA 1ELWA 1UZUA 3E4BA 2C4MA 3H4IA 2HYZA 4I2WA 4AMBA 4UI9J 3MTAA 2IEIA 2QRGA 2V5FA 4G2VA 1XKXA 1AHPA 4AMGA 3KS2A 1JG6A 3Q5MA 1H5UA 1E1YA 2AW3A 3CUYA 4WUYA 4GCOA 4Y6WA 2IUYA 4AIFA 1J39A 3RHZA 3ZCUA 3VUFA 2ONDA 5CCMA 3S7DA 3OXLA 4G26A 2PQ6A 5M72A 3BEOA 3LY9A 3H4TA 3L7DA 1EXVA 4G1TA 4BQIA 3QKWA 4I9CA 5FZRA 4M7PA 5DBKA 4G23A 4N2QA 3G2JA 4RG6A 2FFRA 5FZQA 5GPBA 3ZPJA 3NP7A 2IV7A 3WADA 1JIUA 3LPZA 3HBMA 2GEKA 1KT1A 4X7PA 2VGXA 1FC0A 3JYSA 5JJTA 7GPBA 3ZCQA 4WNGA 2YQ8A 1C3JA 3LYAA 4F96A 2VSYA 2X0DA 2UY1B 2YHCA 1PNVA 2IYAA 4EKEA 4KQ2A 3E3OA 4WHMA 1Y6FA 1NOKA 1NA0A 4U0UA 2BFWA 2G9QA 4U07A 3T3GA 1W3BA 3QWWA 2QFCA 5EX3A 4UQYA 2KCKA 4GZ5A 2X0FA 2Y4UA 1WUYA 4GPBA 1L7XA 3VTXA 4MRAA 3GYZA 2GM9A 3OXGA 4JA9A 3C48A 3KAEA 4BQFA 3CVLA 4HOTA 2GJ4A 1HH8A 1FTQA 3MEKA 1P5QA 3L7BA 4YI3A 4EKYA 3CK7A 3CV3A 3HBFA 5FT9A 5KJKA 4M60A 3SF4A 1YA6A 4U04A 3PE4A 1P2BA 1WV0A 9GPBA 3MRTA 2IW1A 2F3QA 3TOVA 3OY7A 5BNWA 1IYGA 2IFUA 4CTNA 2QN2A 3MV3B 4KYOB 2ZB2A 3G2LA 3G2IA 3EDTB 1JIXA 1VGVA 1WW3A 3S27A 4PQGA 2IYFA 4J0UA 4BFCA 4YUAA 3R9AB 3QHPA 2FETA 1OUVA 4FKZA 4X7RA 1L5RA 4F9FA 2LNIA 3URZA 1WW2A 2UWJG 2G9VA 2KC7A 3BD8A 2VGYA 4EL0A 4CGWA 2FO7A 5A6CA 5KJLA 3VDNB 1UQUA 1HZ4A 4N39A 4W9RA 3VDMA 1FU7A 3U3WA 1RZVA 3S28A 1EM6A 2VCEA 1XL1A 2GPNA 1LWOA 3MT8A 1M5RA 2XGSA 5JJ6A 4RIGA 2DBAA 2BISA 4WNDA 1PYGA 2L6JA 4HWGA 3K9IA 2MHKA 1L6IA 3T3HA 3MRXA 2IF4A 2ATIA 4W6QA 4I1AA 1A17A 4JHRA 1FS4A 4J8EA 4MICA 3ESKA 4RIHA 1P2DA 4HOQA 2Y4TA 3CVNA 3FFLA 5A7DB 3LCAA 1GPYA 1Z6QA 1FA9A 4WACA 2J9QA 4U0SA 2XCIA 2BUGA 3HBNA 3MRVA 4NEQA 3MS7A 3S7BA 1SXPA 4MHSA 3CUUA 5JTTA 4GA1A 3C4VA 3NAZA 1AXRA 1PN3A 2GPAA 1WM5A 3MQFA 3QDNA 3NP9A 5HQ8A 3ZCVA 3AS5A 1PSWA 1QKJA 3CKBA 3TGOA 3QWVA 4XI9A 4O6FA 2R4TA 4AY6A 5CCLA 3AMVA 4CGVA 2OOEA 2HO1A 3QOUA 4UI9C 2QN3A 3MS4A 1Y8ZA 1XL0A 4G25A 3MKRA 1YGPA 5DU2A 2PZIA 1KLXA 2QLLA 2R5SA 2VCHA 2X6RA 3NPAA 3WC4A 4QLBA 3CEQA 3SZ7A 4B94A 3BD7A 4L22A 2IEGA 3NCHA 4F3VA 4RIFA 2ASVA 1KT0A 4BT9A 4BQEA 1FTWA 1HXIA 3RT1A 3BCUA 4GA2A 1NVKA 5D01A 1GPBA 3Q15A 3CEHA 2XA1A 1KTIA 3GPBA 5BT1A 1F0KA 4H7XA 1LWNA 2LSVA 3RIBA 2HR2A 4LEUA 3D1JA 4RELA 1PC2A 3ZCSA 5HXAA 2Q7FA 3RU0A 5LCWJ 3DD1A 3FROA 4G24A 3Q3EA 5JJ7A 3D0QA 2WPVA 2O6LA 3MTBA 2F9FA 2JLBA 3SYMA 2FBNA 3CVPA 2FEZA 5G05J 2FF5A 3MT9A 4KBQA 4KQ1A 4KQMA 3S29A 2ACWA 2XPIA 3ASGA 2Q6VA 1ABBA 6GPBA 1BX3A 3ASDA 1K06A 2AVPA 2X6QA 3HYMB 3WAGA 4WNEA 2JJMA 3GUHA 1HLFA 1E96B 3ZHEB 4UQXA 3MTDA 5DLDA 4YI5A 4GYOA 1Y6GA 2P6PA 3MV2B 2QRMA 1P2GA 2PYDA 2VG8A 4HLNA 1GPAA 5LCWC 3ASHA 2PYIA 5FJYA 2FI7A 3C4QA 1QZ2A 8GPBA 5C1DA 3DZCA 2VYIA 5D0OD 4HORA 3CVQA 4Y6CA 4AN4A 3OT5A 3G2NA 1IXYA 3KD7A 3UYLA 3AS4A 2QLMA 4MHOA 4BTAA 2GT1A 1SXQA 1QM5A 3TG4A 3UQ3A 4GCNA 4HOSA 4J8DA 3ULQA 2XCBA 1NZDA 5D0QD 3LY8A 1JG7A 4CTMA 2H1FA 4MI6A 3QKYA 2HY7A 4X6LA 3L01A 1P4JA 5ARFA 4N3CA 3Q49B 4H7YA 4I2ZA 1NZNA 3CK8A 2PRJA 1YA0A 1IIRA 4FZRA 4F97A 4HOUA 5DIZA 3ZN3A 1L5SA 4U0ZA 3CEMA 3ZCRA 4MI9A 3TG5A 5IKPA 4ME2A 5FZSA 2R4UA 3BCRA 2X0EA 4BTBA 1JEJA 1GGNA 3T7DA 2FF4A 3BCSA 4ABNA 5FTPA 3Q4AB 3UYKA 4RG9A 3CUTA 3CV0A 3DDSA 3S2UA 3L7AA 3RO3A 4M83A 2XA2A 4LEIA 1L5VA 1GG8A 3CK9A 3RO2A 2XGMA 2QRHA 2GW1A 2KCVA 4AY5A 2ACVA 2R60A 3VUEA 5G04J 2QN1A 2C0MA 3HBJA 3CUVA 3UPVA 2BGTA 4G2TA 3TSAA 4EQFA 2VQ2A 4GA0A 4XI0A 3T3EA 2PQRA 2AMVA 3WXXA 2F3SA 2QZSA 3GW4A 3GZ1A 1RZUA
chains in the Genus database with same CATH superfamily
3LBHA 4P4UA 3QPDA 2LAHA 4C05A 3I73A 3AHIA 1M2EA 1P4HA 2DPMA 2Q4RA 5EX0A 4RSGA 3VSAA 4LNGA 5JH7F 2KYRA 4R9NA 1CETA 3O8QA 2M1ZA 2XT6A 3ESQA 4HQDA 3ZEAA 3MXOA 4UULA 1E4OA 3PDJA 4MWGA 1PTKA 2H4YA 5TQ2A 4BZQA 3TWWA 1PR9A 3MNFA 3APFA 5HI7A 3TXXA 3PS6A 2KS6A 2EXXA 1H6CA 1WDKA 3NV7A 2CBZA 4W1QA 3TDMA 1FVHA 4D41A 4Q1AA 3PQEA 4FTWA 1J1UA 2YZGA 3JD1A 4YDEA 3KOYA 3OTIA 5FV4A 4FCTA 1DAFA 2DAPA 2OFPA 1ISMA 4LC0A 1JHRA 4S24A 2FH5B 2V65A 3SQMA 4YTEA 2PR2A 1JG3A 3QPVA 2YV2A 3FULA 4D82A 2GJKA 3VZSA 5JCZA 3EBPA 2NU6A 2XWPA 1UPFA 2J0EA 2WJ3A 3NTVA 3BGVA 4NK4A 3D2BA 3PQ8A 4CZ2D 1W1WA 1Z3CA 4ZPXA 5AJLA 2BRUC 2J31A 5KIAA 3ANXA 4M9SA 3PQ6A 1CY6A 1GR1A 4LBYA 4MYTA 4QYIA 2PJUA 2JB9A 3ZXPA 4NCHA 5ISMA 3ZCUA 1PT9A 2G4CA 2YMPA 3L43A 1B7GO 2C42A 5JBQA 1DKUA 4BQOA 3ADBA 1MHQA 2CFTA 2WYVA 5JD3A 4X66B 4UU1A 1NXWA 2ZRMA 1UXOA 3DZBA 1PJRA 4EOGA 5ALPA 3PNOA 5KTKA 2R86A 5DASA 4IS2A 2J4CA 3PKJA 3B89A 1Z12A 1V8ZA 5CXQA 2NZ2A 1KZ7B 4BNXA 4ILHB 3UMSA 5B55A 3LWNA 3UATA 2VDUE 4Q5IA 3DHVA 4P80A 3USCS 1U2EA 1WD5A 3HWX1 1JKJB 3FIUA 5TSDA 4E5YA 4BP8A 1X1SA 3JQBC 2GESA 4X65B 1STOA 3JVUA 3U3OA 4RIHA 1XMXA 3NIBA 1XFAA 4RETA 3G6KA 5JTTA 2FWMX 1A8QA 2DEUA 4M3OA 2XWBF 1K5HA 1HEUA 5TJHA 3GCZA 5FNZA 4FEEA 5JFOA 2E1RA 2PUJA 3BG1B 1PWHA 2RGWA 4BN4A 1UFOA 1KT0A 3FHLA 2ONJA 3LECA 2WT9A 3VZRA 2I6XA 4OBBA 2B5VA 4N0PA 4RQUA 4DDTA 2O5CA 3CRRA 1D5CA 4FD2A 4M1OA 4EW1A 3K9BA 1UBTS 5ECYA 5K0FA 3SQOA 5LCWC 4L57A 4IOLA 1JEYA 4OQFA 5TQ0B 3UKUG 1Y89A 1ZUNB 1CHDA 1YV9A 3G2NA 3VZDA 3L93A 3MSXA 2LV8A 5C4MA 3ML8A 4HOSA 2WAOA 3G82C 1JG7A 2CJXA 3WI7A 4RTPA 1H1TA 2RIRA 3GVIA 3FUJA 4RM2A 5DIZA 4FFVA 4QM6A 1EP1B 3AM1A 4E5NA 1CEQA 4LVCA 4QBHA 4IKPA 4LKRA 1GG8A 1J23A 1RQ7A 4C7MA 1FSPA 3WJ2A 4UVEA 3EVFA 3WS7A 3A9RA 4PCAA 4DZRA 4E5PA 3PI7A 4LZJA 1AO3A 4M21A 5ITVA 3G3EA 3BKWA 1E0SA 2IOQA 4R1SA 4X8LA 1FCHA 3QKSB 4FXOA 4HGNA 3ZE6A 2IYSA 1MT3A 2ZCVA 1LBQA 1JJAA 1W5TA 1C8KA 1E5XA 2AN1A 3O1JC 4Q15A 4NRHB 3B2QA 4RJLA 3OEEA 4GGMX 3IDAA 4P1ZA 3HXDA 3WIVA 4UI9K 1MA3A 5EJEA 2YS7A 2W93A 4QU8A 5YASA 2OQIA 1N1EA 1MYOA 4RKWA 4BNZA 2P27A 4H0CA 4QTZA 3DUWA 2RI0A 4C9BA 4C0SA 3IAM6 5B58T 5JIBA 5D5QA 5AO9A 4G4SP 4I2VA 3TAXA 2NVBA 1CJVC 4O4LF 4CQMD 3WV4A 3JASA 2IOFA 2H9IA 3N39C 4TWRA 4HF7A 1G2QA 2ZTLA 2GLXA 5B7NA 2DUNA 4CEHB 3WL4A 1T6NA 2E4VA 3BULA 3UV3A 4ZAGA 3E3MA 3B7WA 1PI3A 3N8GA 1JL3A 4G26A 5TARA 2BFEB 3PPWA 1SQFA 3CXUA 4LQLA 1IBLB 3DSRA 1GTRA 2R1TB 3AV0B 5CBNA 5LQMA 1MTZA 3DQZA 5DYNA 3DEIA 5JVDB 1GXSA 4U02A 3RVOA 3G68A 4L5AA 1IAQA 4EENA 5KNDA 3QVJA 3MPOA 3ZW3A 4BB6A 4O1IA 3P0IA 3W5VA 3GVCA 2JFWA 3ID6C 1MUUA 2I54A 4RD0A 5ERGB 3DE0X 4CV2A 1NJSA 2A5FA 4LSWA 2BYTA 1H3EA 2AFIE 5DE3A 3P0HA 3RFVA 2O3RA 1T3GA 1Y1QA 3GT0A 3ZLBA 3EVNA 1HL7A 3HYSA 3TBFA 2GCOA 3ZX4A 2AEMA 3U6BA 1ICIA 4LHXA 2WWYA 3CWZA 2POCA 2YOGA 3ONWA 3ILXA 2PUGA 4HLUA 2Z4TA 3WWCA 5F2NA 5CM2Z 1V1JA 4OKNA 1AKUA 4PYQA 3MGAA 5CYGA 4EBAA 3QW4B 2J67A 1ORIA 1GKIA 1KYTA 3GVHA 3UAOA 4QGBA 4W7SA 2XT9A 1ATIA 3Q9NA 2W0MA 4BMNA 4GBED 2ILRA 4TKUB 4HGQA 3QPBA 5ENOD 4ZARA 4IOMA 1VPVA 3S6JA 4Q4LA 2I2OA 1WSWA 2P40A 2W6ID 4RZ3A 3TX2A 5C8VA 2Z3VA 1PR6A 4E33A 2OCLA 1P0QA 3ZCSA 5JJCA 3CONA 4HWRA 5H0IA 1P7CA 2IPLA 3COSA 2V5UA 4Q3OA 5MGNA 5JNTA 2Y77A 3BERA 2CWDA 4A8PA 3DLHA 3I3NA 1KFKB 5H70A 1QYWA 2HZBA 4BKOA 1GPAA 3RQIA 2XQKA 3KKNA 4MRSA 2ZUDA 2A0WA 1K5GA 5IAGA 1KYZA 3JQGA 3C0KA 1PZGA 3EXAA 5DI3B 3UKJA 4G0YA 3GCWA 2CNBA 2JHPA 5D0QD 1SB8A 3VTFA 4HQNA 2EKQA 1PQWA 4TL7A 5FUWA 2AL7A 1NQTA 2VK2A 3CEMA 2C5LA 2AR9A 4J4TA 3I28A 4XIIA 5DM0A 4D8YA 3RNLA 5GP1A 3FYDA 5HKKA 1EUDB 1UODA 3QFFA 1Y7TA 5J2TB 3PFFA 5ICFA 1JG4A 2I29A 4BRSA 4G5SA 3NBAA 1VIDA 4EMBA 3C3MA 4ARZB 1Q3TA 3DXMG 4R8VA 2VNSA 1I5RA 2VYNA 1RAEA 4MVJH 3QPWA 2BMAA 3PBKA 5IASA 2F3UA 4I9FA 2FWIA 4G8BA 4H1TA 3N76A 1YRBA 2RAVA 2W90A 2ZK7A 3FHTA 2IJGX 1V96A 5DM2A 1JIIA 2I4RA 1Q7RA 2JDIA 4A3VA 1EVIA 5EN4A 5KU1A 2D2VA 2BL4A 3BE6A 4BE9A 1T4CA 2AWNA 2W2MA 1PJAA 4MV6A 1JYEA 1SK8A 3QIAA 2D1RA 5DCLA 2OZEA 4W1SA 3DFZA 3M2PA 1A7UA 3IEXA 2QROA 2F17A 4QSMA 1SURA 4Q94A 3RM3A 1NOJA 3IT2A 1ZRSA 3JCZA 3DKRA 3SZRA 1L7QA 3HJAA 2C9DA 2Y1XA 1H4QA 3LYHA 4S0ZA 1HMPA 1XZKA 1K1BA 4O1OA 2BHSA 3IQFA 1Z33A 3ETDA 3CW8X 4OUKX 3IVGA 2P6NA 1HTWA 3HGTA 3C3OA 4QE3A 3V1MA 4G41A 4QOSA 1YZGA 4C2AA 3MPUA 2GN2A 3CMMA 5EERA 1PSDA 2PGJA 2PVSA 3KEAA 4RPJA 2ZPUA 2CV0A 1AQIA 4NZZA 3ZBTA 2PGAA 3KALA 4APOA 5DLPA 2I2BA 1GYQA 3VJMA 5J90A 2XEDA 5JSUA 2DU8A 3IULA 1AHPA 3W8EA 4YQYA 1YWGO 3RUFA 2DWQA 1ZHOA 3S2SA 1JFLA 1B6GA 3WWOA 5FWAA 5BT8A 3JAKB 1LI5A 4HDNB 3T1VA 3KTDA 4N4AA 3E2PA 1EX6A 3DYVA 2QVLA 3H18A 3AR4A 1ECPA 4U00A 2YQ8A 2HMSA 3HKDB 2IYAA 1MQAA 2DWUA 2QRJA 5D3MB 1VP3A 2NUAA 2NUPA 2RAUA 3W4JA 2M1XA 1DMSA 1QB8A 3ZLJA 1Z8FA 4MR8B 1G7RA 1JDVA 4ZAZA 3KU1A 3C87A 3BE4A 2HX1A 2I78A 3KETA 3GEBA 5CEEA 1I3KA 3U19A 2B99A 2JZNA 4BN5A 2RBEA 3LTEA 3ZXIA 2J0VA 1Z5PA 5LOZA 1O57A 3L0OA 2UZ4A 3EEBA 2QJTA 5A4MS 2MRIA 5HEKA 3UF0A 2YR0A 3BTUA 3VR6D 1YULA 1RFGE 2O2DA 4WWNA 2PPLA 3KYIB 2H5JA 4NDZA 2O7VA 3DM5A 1T9BA 1MRNA 4ZCQA 4DGSA 2FA9A 5KKAA 3VVMA 4O4IF 3WK7A 2D1SA 2X2PA 1NJ6A 2FZLA 3I1FA 4HT3B 3R3ZA 3VKWA 3K0AA 4TLLB 1W93A 4CT0A 3I04M 4WE3A 3LK6A 2QI9F 3UQZA 4Q02A 2V59A 3MS4A 3SX0A 2QMYA 4H7FA 3ZEIA 4I1YA 3HPRA 4PS3A 1J8QA 3KKKA 3UWOA 2EJUA 3VR4D 1C7QA 4A8JB 1A5TA 4TLEA 1SBQA 3ZJTA 3EGDB 3UENA 5KZMB 1W4ZA 3MTBA 4O25A 3CR8A 4KT6B 2B8NA 3NHYA 3AP3A 4Y6RA 3FDFA 4F04A 4ECEA 4BB5A 3LHDA 4YDYA 4YBRA 3V34A 1QFSA 3W5JA 4IIVA 2VDPB 3BMXA 3WSTA 4NABA 1EVLA 1OKKD 3RDPA 3WLEA 4I50A 5KBYA 4DVJA 1Q6ZA 2BUBA 3DSTA 4Q03A 2QQGA 1G1AA 2UVQA 4W7IA 4EY7A 1GKLA 4HTAA 5IH7A 4BFVA 3NBFA 5FEMA 1TD1A 3SQNA 1N6IA 3FGPA 3T7DA 4KWEA 1PS0A 5LMCA 3HXPA 3ETEA 3Q3CA 3ZIUA 4M83A 3I04A 1TCCA 5EE0A 3KZMA 2CHUA 4ZI3A 4FYKA 1S96A 4KIJA 3C1UA 5EWJB 2XVMA 1N4QA 1PT8A 1WDYA 1ZK0A 2P4HX 1SXJA 1Q92A 3L6AA 1NW5A 3HDVA 3WXXA 4LN1A 1POWA 1EZ4A 2AZDA 3SLGA 4ASUA 4PYNA 3EJNA 3DPYA 3EQZA 2EDCA 2JCVA 3D8HA 3QU4A 3UFXB 5DLYA 5IT4A 1GTZA 5AW6A 3R24A 1LQTA 3WV5A 5IFLA 5E6UB 2XUOA 2Z98A 3H5NA 1LNSA 5CEDB 3DE2X 4HZIA 3ASYA 2P2NA 1P6XA 3Q75A 1KK3A 1O5IA 3BFJA 2GZAA 3TPFA 3T7EA 2F43B 4LCTA 1P5ZB 5KDOA 5DYGA 2QMUA 4UOQA 5FL7A 4DMHA 4YREA 2EX4A 4J9UE 4HAZA 3N8KA 3B13A 5MN5A 1C9KA 1PNTA 1BHO1 1NXTA 3UUFA 2VHWA 3WNZA 4ZOLF 4B81A 1UG3A 4DAEA 3RT9A 1DKRA 3M1YA 3I3OA 3GD5A 4L3WA 1RHUA 3TI9A 4AMVA 4M0PA 4DG9A 4P98A 3S2FA 3PL1A 4TZ6A 4RABA 3U4TA 2ZUWA 3SF8A 1LSOA 3FH7A 4F7AA 4PZDA 2ZISA 2JABA 4K2HA 1WY6A 4EAAA 3ZQ6A 1R4NB 4RDIA 3OJLA 2C9ZA 5CMYA 1W7AA 1VSVA 1LJUA 1WOMA 4RXMA 4ND2A 3NI2A 5CU7A 4EATA 3KXDA 2C5EA 2I34A 5BR7A 3C3QA 5AVOA 2YINA 2X8JB 2FZVA 3EZ2A 5HJ5A 2Y1DA 3L0ZA 4LOLA 1IATA 1RNLA 4M7PA 4W9MC 4BP3A 1LI4A 2W00A 4JBNA 3F3KA 1KI6B 5AVYA 1AUQA 2CLCX 1VXRA 3WLAA 1ZM4A 2R4QA 1W3BA 2QPAA 2Y6VA 4TRMA 3SQLA 5BN3B 5L3RA 4E21A 1WUYA 1DFIA 3KR1A 5JG7A 4Q7QA 4PHGA 4K5BA 1AF4A 4D9EA 5FT9A 3TTUA 2XNKA 1V5FA 4S12A 4UEJA 5HNKA 2FEKA 1ORVA 3EZ9A 2WE7A 5JSHA 2W6NA 1CVRA 2EZUA 4NBNA 4G0ZA 1JE0A 2HD4A 1B1CA 4TN5A 2FW6A 2XGGA 3HCFA 3C6ZA 4HLUC 5JS8A 4EEZA 1YHYA 2WUWE 1OASA 4RVGA 4P3PA 4YYZA 1YIDA 3U3JA 5BNIA 2PR7A 5LKRA 3MELA 4I43A 3Q9NC 2NZVG 2WM2A 5KNBH 4XQCA 3CKBA 4Z68A 3MRSA 1ZL2A 4X90A 1S9DA 3HNRA 3FN4A 3UT4A 2PA0A 3GEIA 4JXJA 1QVRA 4B09A 4DBLC 5JADA 4L9PA 3IUNA 3VLDA 4GX5A 1HXIA 2WTAA 4CCSA 1F8UA 1B73A 5JRJA 5HF6A 1MORA 1XPRA 3SQVA 1SCUB 5KOJA 2WXJA 1UK9A 3IEUA 2CUZA 5C1OA 4ENPA 1XELA 5ELLA 1CF2O 2O2XA 3EN0A 3U49A 3RTCA 4MP8A 1UXHA 2BEKA 3GX1A 4DDUA 1Y6GA 1IHYA 2XXAB 4RK7A 1U8AA 3SBDA 3TL5A 4P3XA 4Q9DA 3CF6R 1ZEMA 3UHOA 3VVLA 1G4AE 3ISTA 1T6XA 2OV1A 1N9KA 1RAFA 2BLNA 1I0ZA 1A82A 4FMDF 4PIPA 2ACKA 3H84A 2HY7A 3I0MA 4PC7A 1LS6A 1BKDR 1J42A 3PLNA 2Q5FA 3VTKA 3DUFB 4KYUA 3VX3A 1K1EA 1RJ9B 2QGNA 1CRLA 1F48A 1IHPA 5BNTA 2DVMA 2FPIB 3U66A 1E9DA 3DHEA 4JK3A 1P18A 2NSLA 4IO1A 1FDOA 3SIXA 2H0RA 2GI4A 3ZKWB 4RZHA 3EVGA 4QYWA 3AF5A 1TC2A 4OYLA 4LMRA 4KR0A 1SQ0A 1Z7GA 4OL0A 5JBNA 5CVDA 1OFTA 2KCLA 3GAFA 2HO4A 5CFLA 5EE5B 3R3XA 3FFTA 1GNSA 2QA5A 4HMQA 4Q3DA 2IYTA 1HBJA 3PE6A 3EPRA 2NUTA 1L5HB 5A7FA 4H6PA 3CT4A 1IE3A 3RJVA 3VPFA 3DOJA 2ZYHA 3A6DA 4EPVA 3FSRA 1KR2A 2Q5OA 3QVUA 1HA3A 1KOJA 1X19A 1E2EA 1N6RA 2X2EA 4JP3A 4UUMA 5A03A 3F3YA 2Q8PA 1R0CA 3QWPA 1M73E 3R7FA 1NVBA 1T35A 4W99A 3CEJA 5DN6D 2VRNA 2P9KG 3UMCA 3STYA 1JDJA 4MDHA 5KOHB 3M1LA 3MT0A 3AUSA 4LYFA 3IS3A 2HNKA 3S8YA 2Z2ZA 1BDMA 1ZGGA 3D2AA 2YVAA 2Y3IA 4KR6A 2D5LA 3EXHB 4JVLA 1P8AA 4KO2S 3SZ3A 3T6KA 4ZQBA 4WW0A 1E6KA 5B1IA 4P4TA 2ZBQA 3LUJA 4KTVE 2QS9A 2EVWX 5EMJA 2O50A 5F33A 3EH1A 4D02A 4ON9A 4KQJA 3D9IA 2X1VA 3QP9A 4Y0VA 4UE2A 4K9KA 1OJ7A 3CQCB 5FZRA 5DZSA 5FX2A 2XQGA 2QTHA 3D6MA 5BSKA 5LDGA 4UCQA 2R6DA 1MB2A 1CS0B 3AR2A 4AWXA 1NA0A 4HDMA 2IX3A 4CV3A 4U07A 4HQRA 2GAIA 1E4EB 3O6VA 3SF0A 2F8YA 1LPAB 4C0JA 4YMGA 3O38A 1OQAA 4JDPA 4LGMA 4AQYB 4AZ0A 4NSNA 2ACEA 1HV8A 2JAHA 4AG6A 3BTVA 2C94A 2XPYA 3CW2A 1WVMA 3MIZA 1T2DA 3WYAA 3VOSA 3W9YA 1YJQA 2UYYA 1TW2A 1YZLA 5EJ5A 3U64A 3IUSA 1KORA 5CJJA 3U16A 2OGSA 3L0SA 4RVDA 3IMFA 3EEFA 3QTTA 3N0XA 3FRJA 4P81A 2GZDA 2RHJA 5P8WA 5KWSA 3FEXA 4Y9TA 2PT7A 1N9GA 2VAXA 3KYDB 4L9SA 3AFGA 4JHXA 4Q4JB 1UIRA 4AZTA 3ENNA 2JATA 3N9IA 4MVJM 3UT5A 3FLMA 3BHMA 3D9NA 2X19A 2OORA 2CZQA 2EGGA 2QNRA 4RVUA 5D87A 3LXXA 4UPEA 3ZJUA 4YR9A 4KVAA 4AS1A 3LOPA 5FORA 4UTVA 5DPMA 4LNUB 1SU6A 4S1PA 1T5BA 2RGUA 3G0CA 3M6UA 2XKKA 4XR9A 3JQ7B 1EZ1A 4BWVA 1UMDB 4JLOA 3MT9A 1QIKA 1QQAA 3DXKG 1XXHB 2AJAA 4CYMA 4YJDA 3O4ZA 1OIVA 2A33A 3IP3A 2OXEA 5ALDA 4IIJB 2WJVA 1KJWA 5H83A 2OCYC 2ZYRA 3KCNA 5KTSA 4RVNA 3C4QA 2X8BA 2VXBA 4JQYA 2C00A 3D7NA 4ZVKA 4LRZA 3VH4A 1R9JA 1OXXK 2NO9A 2FN9A 3V48A 4KIWA 3SBXA 3KZCA 3R7RA 3CK8A 1LBEA 5DNWA 3LUFA 4E3WA 3D5EA 1EFUA 2QRZA 3OJXA 1M66A 1BQ3A 3W05A 4PDXA 1U2ZA 2J3HA 1I2MA 1JA1A 4MVJA 4MWCA 1SXJC 4CQNA 1TQ8A 1ZLYA 5CMLA 4EHHA 4XIYA 1KHHA 1FZTA 1T34A 3OOSA 2P58C 4YVQC 1IXSB 3I6QA 2LBPA 2WJGA 4F3YA 1OCRE 2G83A 5DYTA 3OX3A 5JI3E 3ZVMA 1COWA 4TXQA 2WAYA 3GCDA 2LO6A 2PDAA 4V2UA 2G8LA 1NC3A 1TVKB 1MR3F 4QASA 3ZKAA 4C2UA 5EP4A 2MWMA 1K88A 1R7RA 4WKCA 3GRAA 1DJPA 4I9EA 3UT8A 4BFZA 3LL4A 3N0RA 4HDOB 4H7EA 4YPFA 3BF8A 4JJ4A 5C32A 5I45A 4BO4A 4OX9B 4M6WA 5K0NA 1KOGA 5KCMA 4IUYA 2B21A 3JQFC 4OAVB 1GARA 2HV8A 4X64B 3BQNB 1VYUA 5K0CA 5FO0A 4U5XA 1CB7A 3A31A 2ZJOA 4YJ3F 1O1RA 3ZBQA 4DHWA 5LD2B 5EJ2A 1KH3A 3S44A 2QAJA 4GBMA 3K4QA 5IF3A 2JGDA 3L1IA 3HO6A 1Z5ZA 1RPTA 2ONCA 2RHHA 3HU3A 3I9MA 1BEUB 2QM3A 3H99A 2AZTA 2IQ5A 4DABA 4ZZ0A 5DBHX 3HADA 1X7GA 4Q4HA 4M88A 3JYLA 5FLYA 2PZAA 1AUXA 2YINC 2V7EA 1K7YA 3ZD7A 3IIIA 3RH0A 1IHXA 4L9AA 2DIWA 5SZKB 2IUYA 2EATA 3RRZA 1UKVY 2Y71A 2G9NA 4QSHA 2PQ6A 4G1TA 1DFGA 4H59A 4Z99A 1TA4A 1JEEA 3OLYA 1GUBA 3C6YA 2VTKA 2GN4A 1XEWX 3O83A 3LGXA 1N57A 4E5VA 4OXKA 4FI3C 3M3PA 4QD3A 4MCIA 4N0DA 3IYLW 2PAAA 3CQGB 1RXIA 4TV9F 2WDPA 4EUKA 1DTWA 1WU8A 2FZEA 2AN5A 3GFGA 2P7IA 1G2OA 4MV8A 1BU9A 2G77B 4KPUB 2HTFA 5TQJA 2R7LA 2WHEA 1Z28A 4YMIA 1LLQA 5I9MA 3R3YA 2IPNA 3CRZA 2FZGA 3ER8A 5BSHA 3ESRA 1QB7A 4V03A 1TTQB 3B82A 1GD1O 3QWAA 2P65A 3L9TA 1TM1E 3ESXA 3VKHA 3FDJA 2WV7A 3MJSA 4V0ME 1QRDA 2RE8A 3QEOA 3PR3A 2QTTA 1BWQA 1PEKE 2P0AA 1QIGA 4J0JA 1Z7EA 1OXVA 4UEOA 5TNXA 2O05A 2QL5A 1OR8A 5CCLA 3KBBA 3SDBA 1IXZA 4X1IB 3R7WB 2CNWD 3PZ2A 4HUTA 1T0IA 3EMKA 4OQQA 3TLZA 3RAJA 4M38A 2CSXA 1K8KG 4DJ5X 1DIOB 1UJCA 1Y6RA 4PPQA 1YVDA 1E6LA 2PA3A 2Y1OA 3GRRA 3V5NA 4K87A 1RQPA 5BR4A 1F0NA 3WKAA 1W5FA 3PA6A 4TMFA 3OE7A 3KVVA 1QFYA 2VGEA 5BWOA 3BIFA 4BRZA 3VAZA 4AJNA 2O8CA 1NQ5A 1YBMA 4ND3A 2WHPB 1J22A 2ZBPA 3TECE 4HGYA 1QPZA 3PZ3A 4Q19A 4CXMA 1KYYA 3CZ9A 4IIBA 1JDBB 2HB6A 1GNVA 2FJUA 3HB0A 4Z8XA 3PYXA 2I22A 3ROPA 1LF0A 4Y6SA 3DCIA 2VTVA 3KT8A 2XCQA 5AKZA 5HSGA 1HFJA 2ACVA 4PLFA 3O26A 4E30A 3OQVA 3TSAA 1N8SA 5JVDF 1WL8A 4FR2A 1RAIA 3BUSA 5BRNA 2CXQA 4HAOA 1JSXA 4HQFA 3U13A 2W4IA 4TTVA 4A3SA 3KVOA 3UJNA 3COJA 3RS9A 1UK8A 2A67A 3D3WB 1RXYA 3AVPA 1RQLA 2ZE6A 1CBUA 2YH2A 3CZ4A 1M8GA 3DTVD 3OZFA 3EQ2A 4LOJA 2P0YA 1VJCA 3JATB 1CY4A 1YFLA 1HTTA 2NX2A 2OBNA 3GRUA 3GLGA 1CB0A 4GWLA 3RAGA 1MIOB 1XZDA 4FLBA 3JQPA 4FU3A 1KP9A 3GJZA 3QVSA 1VHTA 3NHWA 4H31A 2V0GA 4FOPA 2ZS7A 2O2CA 2V7XA 2WIJA 3IKVA 3U7IA 3UWSA 4K6OA 3G9TA 2GD0A 3AKZA 3V1KA 1YIAA 3NTRA 2JCBA 5J4LA 1XCJA 2QXYA 2Y2VA 3QEMB 3BK7A 3KJHA 2ZU6A 3Q6IA 1FXUA 2FR8A 1E1MA 4N1AA 4A15A 2MYPA 3T3DA 3MA0A 5J4HA 1QP8A 2CYBA 1LQ2A 3LFTA 4RANA 3ZWMA 4MJXA 4PGGA 4RJTA 5I9TA 3O31A 1PTJA 3WGKA 2AOVA 1X39A 2QN8A 3MJTA 2W2NA 2KBEA 3WGHA 1ZD4A 4TTSA 2JHAA 4I4TB 4BAZA 3GLIB 2GM5A 4PY2A 1OOEA 4H16A 1H0SA 3FTEA 3FMOB 4RPCA 2X0IA 5A9SA 5KJCA 4NV1A 1E1YA 4IFEA 4K5CA 3TZKA 2DFLA 3QQPA 2P62A 1T1EA 4JP8A 1TEVA 2OGWA 1K6XA 3NNSA 1CY0A 3R1IA 3QENA 2JGIA 3ZD6A 4DYHA 2I1JA 4C0QC 1VL2A 5EXDA 4B40A 3MYRA 2OE2A 2QLBA 3O9VA 1O2DA 1PSZA 4DV6B 1VIYA 3K6KA 2V3VA 1ZM9A 4URWR 4II7A 2EF1A 1XPUA 5IANA 3GYZA 1EFPB 3ICPA 5LUAA 1HU3A 3LI2A 1A9TA 4LC1A 2FJ0A 5J2TF 1XTIA 1HYBA 3SCZA 4ISCA 1QBGA 3FDXA 1GTSA 3ABOB 3HWWA 3Q10A 1X8LA 4BFXA 4U5QA 1VI6A 2ZWIA 4JU8A 1VPEA 2E5LB 3DL0A 1WY7A 3ABQB 1KFBB 3BRWD 1Z83A 1UXKA 4CGWA 1U7DA 5F76A 4PO8A 1O8CA 3PUHA 4P36A 5TGDA 3EW9A 3U0BA 4YWHA 3OJWA 2BISA 4Y2GA 1YH3A 4M7CA 3E5NA 3CEAA 2NVWA 3ROKA 5KNBA 4BLRA 3UW1A 3R6GA 1KO5A 4OI4A 2KX7A 2B37A 1PGNA 4MZDA 2BUGA 1K4YA 1H9BA 5HRUA 4CM8B 3QDNA 2FQWA 2OORC 1AP7A 3W7AA 2G06A 2MSWA 3SFVA 1QF9A 5FNVF 3F0TA 1EJ2A 1G8MA 3NU1A 1XVVA 1O89A 2H08A 4P34A 3E0XA 3AW8A 4B94A 3OBIA 3OO1A 1LU9A 5IN4A 4HUQA 2ZZKA 2XWJI 3KHUA 5ALEA 1T24A 1NBME 3KX2A 2GEUA 3LLSA 2Q0HA 2R5NA 2UUCB 1JSRA 2BZ0A 1T3TA 3MINA 2GA8A 1VL8A 2FI7A 2VF7A 4R69A 3IFSA 5EWMA 3DBVO 5HFNA 1JWLA 4S1WA 4US0R 2Y99A 1H1DA 1RQRA 3AHDA 2GZSA 3DQQA 4J8DA 1O97C 2XEXA 1C3OB 2LUHA 3TRDA 4NU8X 4PICA 5CBPA 3K0SA 4DLYA 3EIXA 4YGYA 3CR7A 9LDTA 3K1TA 1WMEA 4DBVO 5CT8A 1L5SA 2FE4A 4KIFA 5ANRB 4XDYA 2ZBFA 1VCOA 4Y2HA 1XIVA 1E1CB 2HMYB 4H35A 1Y5NA 3L77A 4IOKA 1J0EA 4EPTA 1BROA 1CRZA 3T7RA 4K2AA 3I37X 2QLTA 3M82A 3RU7A 4B8ZA 4UKDA 2ZSDA 1I10A 3HP1A 3D2CA 4MLPA 2PVPA 3FWVA 2YZ7A 3MBOA 1D2NA 4ZQIA 3L82A 3IDZA 3O8DA 3JUEA 3HTXA 2BGJA 5JZOA 2GSDA 2YICA 5THKA 4BO5A 3GJTA 5KSPA 4BDTA 4Q6BA 2DUMA 1HEYA 5CLLA 4ZTUB 4IXNA 5AT1A 3P2KA 2J87A 4LY6A 4XPZA 2D7DA 4D4KA 1V3TA 4I6GA 4TYQA 4D9CA 3GUUA 3IUEA 2HJWA 4MUKA 1KDRA 4JC4A 1NMSA 2FSUA 3I8SA 5CJPA 3C7TA 4N8SA 4FGJA 2AF3C 1DX6A 4RXTA 2AW5A 1PWYE 4MK4A 3U7QA 2A5UA 3SYRA 3A3OA 4DLOA 3PPYA 2ZYDA 5CYOA 3VVCA 1V7QA 3B2EA 3VX4A 1ADBA 2FPSA 1NXVA 1Z2PX 5GONA 1LPMA 4B6RA 3HB7A 2YIJA 5EUMA 3MJHA 3BVPA 3ZVVA 4AV7A 2A94A 3ZUVB 3CVVA 3KQHA 4ZC8A 2FP3A 3BA6A 4JUFA 5HS6A 3L02A 3FF1A 1Y8AA 1V9SA 1YGYA 4MI1A 5HS0A 4WZAE 1PT7A 3BXPA 4Y9UA 2GEVA 4D5EA 2PNJA 4JBYA 3HV2A 1TU3A 4I9CA 1A98A 3GA7A 3GLKA 1K4KA 1XSEA 3FCAA 1TJFA 2J32A 421PA 4JW1A 2VP9A 4O60A 2P9QA 1V5IA 1X8XA 2GBGA 4C3VA 3IERA 3WHPA 4A0RA 1PWEA 1N32B 3BILA 3OZCA 2PZMA 3COYA 2WD7B 1YDFA 2HWYA 1TQ6A 3G5LA 2VUTA 4LV5B 2HT1A 1MC1A 2VJMB 3BQ9A 3VR1A 3RS5A 3V4OA 4HNRA 1L7BA 3QUQA 3D9QX 3QV1A 2PX8A 2YRWA 3TB4A 1VCNA 1NTRA 1VIVA 5JAMA 1UBLS 4Z7OB 5JAUA 3DMHA 3TTVA 4WT7A 4NZMA 4BVGA 4G0QA 4G11A 3TWSA 4F2DA 4PO9A 4PIVA 2Q4DA 3S28A 1KZHA 3L2OB 5INTA 2QRKA 2Y8EA 2F90A 4MA5A 4WEOA 1P81A 3KSLA 3HG0D 3QMPA 2XDQB 2AK2A 1T3SA 2OCPA 1PZEA 3GB9A 2H1LA 1I3LA 1TECE 1P7PA 1QO0A 3L6UA 3Q11A 3QVMA 1CJCA 4KFTA 1TN6A 3SZGA 4CKBA 2H63A 2BR5A 1JNXX 1ENYA 2WXHA 2X4LA 2ZIGA 4R7TA 1N5OX 4TSFD 4JB3A 3ZWYA 4Q7JB 3JAWB 4RJKA 2C78A 5IFKA 1WKVA 4P82A 1D4FA 3FWPA 2G4LA 4DCSA 1JTVA 1V0JA 3D8TA 3FNIA 2J45A 2EKDA 1W52X 2BP7B 3ANTA 6GPBA 1MABB 1OIXA 2Y76A 1M34B 4DRXE 2AC4A 1APBA 4IMJB 1K6EA 3FBGA 4B6PA 2ZBVA 3BGSA 1VKJA 3L1VA 2EZ8A 1FNSA 3L54A 2NU9B 3D8NA 3L4EA 3X2SA 2I7XA 3K16A 2ORWA 2VF2A 1HDXA 4JQCA 3TQFA 4LWOA 3QKYA 3ABSB 1NM5A 1JXOA 3KSDO 4G4SO 2ZR0A 4NH4A 1FFCA 3CNHA 4DIFA 3E33A 4MPTA 4IVNA 4FEAA 4OREX 1TXGA 2RG1A 4OH1A 1E58A 4EHJA 3U26A 2P77A 1A9YA 2I2WA 2FDRA 5KNLA 3D9LA 2L0IA 2AI1A 2NSHA 4URZR 4U0JA 1YVPA 4RF2A 3WL7A 4OHOA 4B3IA 1MJHA 3NKLA 3FNFA 3JWJA 3QHAA 1VBMA 3TSOA 2WQHA 2NM0A 2VF4X 1YZVA 1RHMA 1Z88A 1WXGA 2HJSA 1E66A 3IP9A 1J49A 3FNEA 2RHTA 1UOPA 1SUWA 3LPLA 3REQA 4FHFA 1N7JA 4YNDA 1LDYA 5IVPA 1UM8A 1V1MB 1W35A 4EHDA 1TU4A 1J5XA 4EHIA 1H2HA 5LQAA 2HMWA 1U5AA 1EFLA 3CRQA 4KWTA 3ZLUA 2ATEA 5JSFA 2IU4A 3BX1A 2JA2A 3NHMA 1GZ5A 1SRQA 2WB2A 4YP5A 5AQBA 3ROMA 3U4CA 4PS1A 2HA3A 1SHLA 3HSSA 1R8QA 1XLUA 4C4SA 3FCUB 5AHRA 2FR8C 4DA9A 1BS2A 1L4BA 4IDNA 2BEUB 1YBVA 2PL2A 3ZY5A 4L51A 1RZ3A 2GZ1A 5FPYA 4KK3A 1G19A 4EG4A 3WYFA 2PG3A 1Y3FE 1KIAA 1SIBE 5CLGA 1PTJC 4N3BA 4F6LA 5THQA 2FMXA 2CNWA 2QRNA 3COPA 1GL7A 3JVDA 2V03A 3ESAA 1U1FA 4PSDA 4HQLA 4DBLE 3PHGA 4LJ7A 4JWKA 1T9HA 1MJ5A 3PQ3A 3NIFB 2A5JA 4YMHA 4KMOA 4ZHQA 2G80A 2HZ7A 5AW3A 1W1UA 3PFGA 4D6PA 3VUFA 5CCMA 3FYSA 5KVQA 4ZN6A 2IZ7A 5DBKA 2NO5A 4RG6A 5ITZA 5IEJA 3THWB 2Q62A 1C4KA 4E6HA 2VC2B 5IM4F 4X3PA 1R0LA 4G8DA 5F1YA 3SJ7A 2X8WA 2X0DA 4PN3A 5IX8A 1NMXA 1VMAA 1GRVA 2O0MA 3R9XA 4C6SA 3BB3A 1C9MA 2W8BB 2C3UA 3PWSA 4JC0A 3UI2A 1CE8A 1CVLA 1M54A 2GK7A 1JWGA 4MDEA 3EDRA 2BGMA 1X9GA 1HRDA 2P69A 1M5TA 2XB2A 4YUXA 1NX6A 4FOTA 5EWLB 3FUDA 3BT7A 1WP9A 3MCWA 1KKLA 2A0XA 2IW1A 4TT3D 4POAA 1R64A 1GA1A 3STTA 1WW3A 3D8RA 3T4XA 5DVZA 5BY2A 1QOQB 1VG1A 1IUOA 1OH6A 2BR3A 1IM5A 2QZ9A 2G9VA 4YALA 1YJ5A 4BU0A 1Y6ZA 4W9RA 3NH6A 3SQWA 2B2XA 1Y7PA 1MAWA 2JGJA 3S2GA 2H1RA 1CERA 4IDPA 4QFBA 1MHPA 1DT5A 3OQIB 4NZOA 3TW8A 1RE1A 5HWSA 3AJIA 1XYGA 3DO5A 5IJ0A 3THSA 8MHTA 3AF4A 4KCGA 2ORYA 3WISA 3VGJA 1CUWA 2IEYA 3QEKA 1EUQA 2WC1A 1EFRD 1PRYA 2A9OA 4NOMA 4QT0A 4RD3A 3U62A 3L8EA 3O93A 4BQEA 5BSMA 4GXTA 3RHTA 4NBVA 2GNPA 4CIWA 2O1SA 4R9VA 5IABA 4B34A 2B92A 3I2YX 4EGQA 3HKCB 5K4GA 4EJMA 3SJUA 2D4HA 5GOTA 3U37A 1MB4A 4HFNA 1ARZA 3V4LA 1P2UA 3G9QA 2JHCA 3KS9A 4PC6A 1AKMA 1KZ9A 3EJWA 1YS9A 5C1DA 3TX6A 3M4XA 3R77A 1Y7LA 3EU5A 3PNKA 1BNCA 4AK9A 4XYGA 3VR6H 3AHFA 5REQA 2QF7A 3K1YA 2DBZA 1XP8A 1ZIDA 1QZTA 4CKCA 4C0WA 4KFSA 1FJ2A 1ONBA 3DL7A 3R7NA 1XDBA 4ZQHA 2O3QA 5HJ7A 2Y69E 2ZB7A 2YV5A 2VSXE 1MW9X 2ECQA 1F7VA 5G4KB 4Y2TA 4M22A 1OXMA 2QRHA 3N7TA 4WK4B 1S8AA 3VQTA 3SYTA 4WOBA 5ER6A 4KU4A 4HH4A 4ARVA 1JHXA 4TVBA 3GZ1A 1EB8A 3S8EA 2CNDA 5EP2A 3ZIAD 1HKUA 2RHBA 5A6SA 3L6OO 3VR4H 5E2AA 5FCDA 4NDAA 5AK3A 4GTPA 3NT5A 1WBBA 1YHNA 3PRYA 5KS2A 1A9QA 3OPVA 1KFJB 4MV9A 2YHIB 4YROA 4HNSA 2BGGA 3NZEA 1KBQA 4B6SA 3OO0A 4A0SA 1KERA 1FU4A 1BQEA 1QTIA 2LGJA 3LYUA 3STWA 4QLAA 4G8CA 2XRMA 1QC5B 3RARA 4CM6A 1JZTA 4G0MA 2V7VA 3DAFA 1Z13A 2FR0A 4GPZA 2CNNA 2Y1GA 3LEWA 2XGOA 2GKSA 5BUQA 2PN1A 4L2YA 3ZK7A 2CKDA 3QX8A 2X15A 4N0EA 4URYR 1ZHFA 2BBWA 2C0LA 4FFMA 4DA6A 1YDHA 4GKVA 1C1DA 1W46A 4W5HA 4P5PA 1D2GA 3OLCX 2J9FB 1IPEA 1X1EA 1C3EA 1M2VB 2HXYA 3GNTA 3AFMA 4EZKA 5A2GA 1K3TA 3E22B 1UEJA 1Q1ZA 4J76A 3KFLA 3ADKA 4R54A 2UYQA 4WAFA 5A1TA 3BMOB 1F7UA 3UJAA 4N5NA 6NULA 2OG2A 4XYLA 1J7KA 4E13A 3MHTA 2V98A 3WY9A 4ZOQI 2R6GA 2V7GA 3B8HA 3EFOB 1J70A 2JLQA 3DE7X 5K3FA 4HPJB 4I5FA 1TKCA 3IP5A 1CFZA 4BDSA 4PFQA 3PQDA 4UPDA 2R17C 2V7PA 3AX6A 3K5PA 1Y5IA 2WSMA 2ZIFA 5JDIA 4BEPA 4RGBA 4X71A 2X5KO 3HE3A 1XP5A 4MRAA 2GWRA 2NO1A 2LW7A 3QBDA 1EK5A 2PH7A 1EHIA 3MZ0A 1ID1A 3GBPA 3G2LA 2YQZA 2A92A 4MINA 4XX0B 4CZ2A 1KRXA 5EEHA 5IP5A 4TM7A 4DSAA 5JISA 1V11B 3T7IA 1EK6A 4Y7DA 1HY3A 5FPSA 4I6JA 1BX1A 1PFWA 2BSXA 4YJHA 5ADVA 1AUPA 1R3DA 1XZIA 1EFDN 4UVDA 1TUIA 2CJWB 1MAUA 1IZ9A 5K45A 5T8KA 5JD6A 1J90A 4RK4A 4D92A 4ND1A 3KKOA 4CGYA 1LBHA 4LF9B 2O48X 1EF1C 1KOLA 3E53A 2JIMA 4E5DA 4CV0A 1SAYA 5LM3A 1C8VB 4Y9SA 1I6LA 2FPXA 3MC1A 2DQ4A 4IFBA 1SHTX 2RFMA 4F3VA 1IAVA 5CFRA 4AIRA 3PUWA 2VJPA 2OENG 3TQCA 3DD1A 1U81A 3CNEA 4HDAA 5J5AA 4TS9A 2DP4E 2X1HA 4Q96A 1QG6A 3KJGA 1PQUA 2J30A 4PSVA 4QOHA 4JKYA 4YR7A 2C4TA 1M0TA 3D5TA 1RYFA 2VG8A 5EQJB 4P9NA 3TWOA 3EMVA 4JBHA 4CKWB 2W6PA 4EG7A 3R8FA 1E5VA 4ZVPA 4PS0A 1A95A 2OLJA 4TXMA 1F12A 3IIEA 3CCFA 5JQWA 4GEGA 1RVV1 1RRPA 1NM5C 5CJ2A 4R0VA 1D09A 3CQ9A 8ADHA 1QQ6A 1DO0A 2VYQA 3ITDA 5A23A 3RS0A 1L5NA 2MSLA 3GIWA 1V43A 2AOUB 4KN8A 5IKPA 4A9AA 2RKWA 1XTJA 4KV9A 1GAEO 4CTKA 4GLLA 1Z3IX 4M7RA 4XARA 4R51A 3LQ2A 1BWRA 3FYUA 3FYHA 4G01B 2JVIA 5H1YA 2YHBA 3RRNB 2G1KA 5KTRA 2B30A 1KDPA 3DB1A 1Q0TA 3NDRA 1DVPA 2C04A 1X1TA 3OQJA 1OX4B 4GL2A 4O5AA 5ENTD 2XBLA 1WXXA 2JVKA 2XGJA 4YWJA 1S1CA 3KQQA 3K8QA 4GGPA 4LRWA 4BVLA 4FN5A 1JFSA 3PEFA 2JLRA 3FMPB 1EVKA 2IYWA 4JI5B 3E8SA 2P3LA 1W0KD 4TOIA 4DVGA 2OAQ1 4LOKA 2IIPA 4C0EA 3UJ7A 4RV5A 2ETAA 2GDJA 1XDDA 2J3DA 3F8TA 4ZVLA 1ISFA 3JWPA 4WLOA 3W5UA 2QTRA 2PL3A 4DB2A 3N7AA 1W59A 2GNOA 2YIVX 2Y9MB 1U3CA 2HCBA 4RBNA 4FR0A 5CVUA 3HS3A 1H2UA 1LA2A 1X8KA 4RXUA 1Z8NA 4GOND 3KD3A 5E8RA 2O8DA 3R23A 4JVOA 4MKFA 5K4AA 1KMCA 4KV7A 1JPUA 2QDKA 1X42A 3QJ5A 1TLFA 2QMZA 5ERYA 3EHEA 1JLHA 1ZOLA 5I9NA 5CCEA 4NK5A 4CMCA 4R68A 4URUR 5TVGA 2YV1A 3PIRA 4YAUA 1GOTA 3H1EA 4PLWA 4DIKA 1A69A 4FLHA 1KYVA 1P0MA 3ELWA 2DLCX 3UAZA 4O2AF 1UFVA 4XFDA 4ZCLA 3AUAA 1P6UA 2VDWA 3F8SA 3LT5A 1GZ7A 4UOZA 1E1KA 5LOVF 5KNCD 3AHGA 1G5FA 3MTAA 3IURA 5K2MA 5K0LA 4PQRA 1Y1RA 3Q87B 4RF4A 3E7XA 1LV7A 1SVKA 1LDBA 4D5GA 1E1QD 1U8UA 4OXIA 4NBTA 3I5MA 4LHYA 2WFLA 1N25A 4BESA 1Q16A 1FUEA 4UD2A 2XZTA 4PAWA 1Y6FA 4WCFA 1SOUA 2PUEA 1IK4A 3PC3A 2I9PA 3M6IA 6REQB 1XRLA 1JXQA 1KJZA 1E2DA 5FLEX 4AYWA 4GPBA 3QBJA 1PUXA 3D3JA 2OSVA 3KM0A 4CQMA 3E9MA 3CK7A 4OM7A 5F52A 1KQPA 5I7HA 1MX5A 1DRVA 3T5VA 5JOQA 2X8AA 2EHJA 2CHXA 5DN9A 3UHAA 2J5QA 4O4JF 1CUFA 3G2IA 4OQLA 2G0TA 3CHMA 1W88B 3IHWA 4ZXPA 3I9V6 1GCIA 4BNDA 2VNHA 2ETXA 2PFGA 5TRTA 4WN3A 4YDHB 2I1VB 2D62A 1JEOA 4JJAA 1XYVA 1XEXB 3D9JA 5LPNA 3OAAD 3MRXA 4NV3A 1K9SA 2F6RA 3G2MA 1SXPA 2DMRA 1R8SA 2VPXA 2X40A 1KIMA 2GCNA 3CUUA 2RHRA 1ACJA 3PDCA 1B0UA 3HVIA 1SELA 4ZJYA 2UYHA 3GLVA 3L7IA 1RXCA 4OFXA 4EB6B 1WQ4A 4PV7A 2CCJA 1T0JB 4TMKA 2DHEA 4J9VA 3IIJA 3EPKA 2BFAA 3U7GA 1LJLA 3OT1A 5FTMA 1UAYA 1N1MA 3U39A 4JUIA 2VRBA 1VBFA 2D3WA 4U7PB 5CH5A 1VCMA 3K5IA 2Q0XA 4MBGA 1RC1A 4BGVA 2FUG1 3VKGA 2XDYA 1JEQA 1FVFA 4B8YA 1E90A 2R6JA 3H6KA 5B6PA 1WTAA 4F4FA 3JRXA 3HYLA 5JAQA 5DNYB 4F3CA 2PYDA 2JAQA 3CTMA 5EUBA 5FJYA 1NR5A 8GPBA 4J94A 4JQOA 5K3AA 3AL3A 1U3TA 4ZKDA 3LPDA 4HLLA 4AKEA 3TR0A 4CRWB 4YS6A 4MR7B 1EUCB 4HDKB 2PX4A 5M29A 1ML3A 4L16A 2BMJA 2Q8NA 4FZRA 5A4KA 2W22A 4UBIA 4BAUA 2UZ1B 2QQEA 2WU4A 4A8TA 3RUIA 4OHBA 5LA6A 1NT2A 3DKVA 1DADA 3CK9A 2W6IA 1KZPA 2GXSA 3GNQA 5K0SA 3PC8A 2WTEA 4WFQA 1NVDA 3IAEA 2ZWPA 5LB4A 4OXRA 3PNQA 2G9ZA 1M2NA 1R3UA 1EQUA 4BGUA 3IRVA 2ZRDA 4NEGA 5DBOA 4XASA 1IM8A 3NXSA 3RF7A 4BJ5A 1X3SA 3Q7AA 4G0XA 1E0KA 3WLIA 4BZXA 1ZU4A 4QVIA 4BXOA 5LIPA 2JS7A 3IPLA 2QAGA 1JKIA 1NHGA 3GT3A 4ND6A 2LSUA 4JLMA 1VYHA 1NN3A 1GPLA 1GQFA 3ONDA 3X0DA 1K7FB 1EUZA 4LDPA 2CMFA 2J8SD 3NZUA 4IHQA 1F8XA 5LVAA 1B6RA 3HCBA 5EZYF 2C2LA 3RR2A 721PA 2QPOA 3ULKA 2QJOA 1FFEA 4DV1B 1Z35A 1OWLA 3ZV6A 1J06A 2QR3A 2FWNA 3VPSA 4E32A 1FU8A 4J7UA 4MQFA 1I2AA 3IJRA 5BRAA 1Q83A 2W71A 1KY3A 1EFRA 4DMFA 5JCOA 2V4HC 4MWDA 3VO2A 2ZBUA 3THRA 4NEHB 3KUXA 1ZGJA 4J6FA 1CR4A 3ESBA 1EWKA 4NFSA 1ZM2A 1J2RA 4I2WA 3V8EA 4PTZA 3A4YA 1UMBB 4MKZA 1SO8A 1BWPA 3OIUA 3IOCA 4GUDA 5BMOA 4WGGA 1UBCA 1U1CA 3NRJA 3DONA 3U6KA 3H5LA 5CAEA 4JJIA 3Q9SA 5CCBA 3O3NB 2AC2A 4Z2YA 5FIUA 1S7CA 4NACA 1KA9H 4ACKA 3EGXA 1VHQA 1ISGA 2DT8A 4UEWA 4MROA 1G9SA 3OFND 5DEIA 3IV7A 4ZIRB 5JDIC 3PGXA 2ZGGA 2A9FA 4ZKEA 1ZK4A 2Z5GA 2WSYB 1F2VA 2YHEA 3CVUA 3ELDA 1UCFA 2OA0A 1V37A 4HDQB 1QAOA 1Q14A 2ZJAA 1Q2XA 2ZZMA 3FBTA 2NYAA 4HDRB 2X0KA 4CQLB 3LHFA 1U0BB 4Z4GA 3TSZA 4XAQA 3NUQA 2ZIZA 2WXMA 3BL5A 4B2LA 4WXPA 1O0CA 3K92A 5TT0A 2PLWA 4D4GA 3ZIAA 2GJSA 4RD2A 5MFZA 3TZQA 4XTRA 2NP7A 4M0CA 2I4NA 1INZA 5T8KC 4GSYA 4G1BA 5HS4A 1QGAA 1CIVA 1WDWB 1WCIB 5KJ6A 3U44A 1R8YA 1A9PA 4MW6A 5FLKA 3ZHCA 4H18A 2VP3A 3A4LA 4H1WA 3NP9A 4EA9A 4HDCA 5AVTA 1TUBB 3LO8A 3GRKA 1KAGA 4ECAA 5AXCA 1EK1A 4JUCA 1NW9B 3QV2A 2Z3WA 1BPOA 3ZD9A 3SZ7A 3A6JA 4YBZA 1XMQB 2X77A 1KJ9A 2C9YA 3GUYA 2QVZX 2CHWA 2HK6A 3E61A 5HUQA 1T5TA 2ZYGA 1DC5A 4QQNA 4NOJA 3VHQA 1TYQG 1RLUA 1FFWA 4UFNA 3D0QA 1X1CA 2Q07A 4NE9A 4I1PA 1ABBA 4ENWA 1B15A 3HUFA 4C1BA 2AC7A 3IEPA 1D1PA 2BPOA 4FFPA 1H2AS 3P96A 3DVAA 1E64A 3LDAA 3VR6A 2EIXA 3FPGA 2WOJA 5ALRA 4ZODA 4Q05A 3EVBA 3UK2A 1E8YA 3MTQA 2OFXA 5FKJA 1ZKDA 3N0TA 4OYHA 4OY3A 1LBTA 4O29A 2XB9A 4DNOA 2OFWA 4G1VA 4C5CA 2FWPA 1EBFA 3BHIA 3DW1X 4D3YA 3P9NA 3FYUC 1PJ8A 2D06A 3IPYA 3TG2A 4B4DA 1Q6YA 2IYRA 5ELMA 4IV0A 4RLHA 2GN1A 3FTZA 4Q3CA 4FW9A 1G64A 3VR4A 4QXPA 3Q6MA 4BX9A 3THOA 5TS3A 5ENZA 3GA5A 3HN2A 1W85A 3T3IA 1C2YA 1N3LA 2QLFA 5CECB 3T52A 2C7QA 3TQSA 4OMDA 4DX7D 1PX0A 2DTXA 2Q3BA 1NQOA 1R5NA 4MYCA 4KYTA 3GMTA 5M7EA 5DHSA 1KYQA 3LS2A 3O74A 1OKKA 4CI9A 4ZDJA 4Z4IA 1H2VC 1CUHA 2GUGA 2WXNA 3BMCB 3PUVA 1BN7A 2UYCA 3IELA 3N5CA 2I3AA 3V7FA 3RVRA 4GYWA 2JZCA 3OF3A 1II8A 3AO0B 4MWBA 1XJ0A 2WKQA 4COOA 3JQEA 4DX6D 3RNOA 2AV6A 3EG9B 2AG1A 3FPCA 4K3VA 3CE6A 4W9NA 3R6TA 1RM4A 3ZE1B 3ZS8A 3AKEA 4NFYA 1AQYA 3RRJA 4UDOA 1KO7A 1RRKA 2RC5A 4FUQA 4P92A 2D2EA 2I2FA 4CDMA 5IAEA 4KHPB 1CY2A 2OSBA 1YMVA 3OP1A 1DMRA 1X7WA 4PAMA 4D8UA 4KB5A 1FSGA 1XZFA 3L18A 3TWQA 5COQA 3IAUA 3HVHA 1NLMA 3WMFA 1V8BA 2JAPA 5DTEA 4YUVA 1U4SA 5DFAA 1NU6A 1R5JA 4MIOA 1YR2A 1E99A 5G02A 2X22A 1NBEA 4G2VA 3S1SA 3RSGA 2O8BA 2ENWA 3ZG6A 1R6AA 1JQLB 2YBDA 1RI2A 4LK3A 1WB9A 3M89A 4X7PA 2M6RA 4D56A 4WCFC 2A86A 4NBRA 2VKTA 4PUCA 3OZXA 1J8DA 2OUKA 1W8IA 3JYPA 2IEDA 1YZNA 1I4TD 2VT3A 2NTEA 5DYWA 1P8JA 4H1UA 2BR4A 2R8RA 1RWWA 3KR2A 1T5IA 4R2IA 5AIJA 3PWZA 3GP8A 2C1EA 3VR5D 2GRLA 1K8ZB 4D26A 4MGIR 2VXCA 2PMFA 1H6OA 4BB9A 2F3RA 2Q0SA 3I2IA 4MQ6A 4BMOB 5K8LA 2WZCA 4Q24A 3GT4A 3F6EX 4MEBA 5ENRD 2OY0A 1GYPA 3BK2A 4RD4A 4NG4A 2OFOA 4UPVA 1U5BB 3U61B 2F4VB 4B46A 1L5GB 1L1RA 5EOVA 1W75A 2BKLA 5AVVA 4KUGA 3WFJA 4GPTA 2QBYB 1WOYA 2PS0A 2ODPA 3CUEF 3R75A 4N7BA 3HXOA 3DV2A 3KXLA 4L5YA 1NJ1A 1EM8A 1G17A 3BZBA 3QXJA 1SC4A 1KF0A 2IUTA 1FDUA 1ACLA 2BGWA 2EIJE 2BGKA 1N95A 3EVDA 4CM7A 5FDFA 4RMHA 5BUSA 2VP4A 1PT5A 4Q1FA 4ZYVA 3HP7A 2X4GA 3A6PC 2HEIA 4WK2B 4AYXA 3QLTA 2UVPB 1LX6A 4M4SA 5EJ4A 4PRKA 3OCVA 3LSYA 3O47A 4HB3A 1ZD8A 1EFCA 3MGCA 5KI6A 1GZSA 1TJ5A 2CL0X 4TMVA 4K26A 4NQRA 5CM9C 3P4XA 2LD4A 4H77A 3RU0A 2NT4A 3Q3EA 2Y1FA 2XF2A 3N7UA 1JA0A 3PNYA 5KWVA 1X7DA 2JK1A 1X80A 1XQWA 4E4RA 4NBLA 2CSUA 1IQRA 2X58A 2ZE5A 1N94A 2A9JA 1SK9A 3MWJA 4AFNA 2ISSD 5D0OD 4QO8A 2K7ZA 3DTYA 1I4LD 3Q78A 5JMWA 3T1QA 4RHCA 1T13A 5DYYA 5ARFA 4ETIA 2I1KA 3RBZA 4LE2A 2PM7A 4WLUA 1JDPA 4EW6A 5FXMA 3QC1A 4EBFA 1Q1EA 2B4QA 3DEAA 5FPQA 5I4IA 2I99A 1VHLA 1M0SA 3FTWA 4C7KA 4WA8A 3PC8C 3MF4A 5DW3A 1GQ2A 2FWJA 2VQFB 1DPFA 5IBRA 1LNQA 4AJ9A 3PQ4A 1F2UB 4DM7A 2SHKA 2VF5X 2ZREA 4JYZA 1Q3HA 5ECGC 1T8PA 4B93B 5LN1A 1UM9B 1IZ8A 2XA9A 3MKQA 1DEHA 1JPNA 3N28A 3G0IA 3PXGA 4Q18A 2L82A 5LP1A 5C5EA 1KBOA 1VPTA 4IIEA 4BP9A 5C9ZA 3TF5A 2F3PA 2QAGC 1IIBA 3MSCA 3THXB 3IA2A 4XYBA 5TY0A 5I3CA 2GRJA 4KYVA 5AVXA 2WEKA 3VHXA 4OAUC 3ZE9A 1KP3A 1B4DA 1C9DB 4UBNA 3TLKA 4YRGA 3E9DA 4MQBA 4G8LA 1C1HA 5ABPA 1ECCA 4LF7B 1J20A 2B8WA 1ISJA 2BW0A 4B5KA 1CQIB 1XZCA 4QG3A 3R5JA 4OMFG 3PKZA 3T5DA 3O48A 1P91A 4UHHA 3H1PA 5JCOC 3JZFA 1OFUA 3F67A 3HJTA 4QT4A 3I05A 3RFUA 2VIIA 1WP4A 1VSQA 2XH8A 4GP7A 3IAHA 1US8B 2WQ6A 4LZLA 5H3LA 5AM5A 3D7RA 1I94B 3N2GB 4DCJA 5BSFA 3EG5A 4KBGA 1YQEA 4HTFB 5I5EA 1RWQA 3DTTA 1NMQA 1DHRA 1W19A 4HNAD 1EKXA 4KH1A 5DWDA 4FE4A 3MG9A 1ECJA 4G23A 1SM4A 4EG1A 4OK6A 3FPJA 4O33A 4Y98A 4RPHA 4RSYA 1VSUA 4RA9B 4MQMA 5DN6A 3I4FA 2ANBA 1G20A 2QVYX 4BLOA 1W36D 5IVIA 1KWKA 1XVLA 3PICA 1PYOA 1Q1QA 5U1PA 3LNCA 5TGZA 4ZK2A 2AYXA 2EL7A 2BFOA 4NURA 4K5QA 3H5OA 3EDMA 3UJDA 3IO5A 1WQ1R 2YWDA 1U9JA 3C48A 4F91B 2X0JA 4PNHA 1VJ0A 1W47A 3RQSA 1RYDA 5GGXA 4UBMA 1IFXA 1RLTA 3K0CA 5DNUA 3HFJA 4KGZA 1KMIY 2Q5IA 1U98A 3SS9X 3PSAA 3E2IA 4X7RA 1DKMA 1P3Y1 3IEMA 3KAJA 3PNBA 4RACA 4WNAB 5EIDA 3KZOA 3AKYA 4II2A 5F7OA 1LWOA 5BSEA 1ZW6A 1NQAO 4FUTA 1NWCA 2Z1DA 5JJ5A 3LO5A 4I4NA 4QUHA 3O8OB 4NPAA 1I7QB 4YRQA 4BMZA 1X1DA 2OP1A 1CEYA 2QL6A 4FZVA 3OCXA 3DZHA 4W5NA 3MQFA 4BVFA 2Q1WA 5HQ8A 1E6CA 2I3DA 1J21A 4DQUA 3TUZC 3EVEA 2C7GA 3ROFA 2GAAA 1TNZA 1NJ8A 1W2GA 5I7AA 4U0KA 5EJMA 3IBTA 3COZA 4F6RB 3WIBA 4C1NA 2VI5A 2P8SA 4JEUA 3KSMA 5HXAA 4QFCA 2B9VA 4XGRA 3CY6A 1N77A 3ZLTA 3WB2A 3QVOA 3EDCA 5JAPA 5HHTA 4JI6B 3UTDA 3R3UA 4CEJA 1V3UA 5F2OA 3ND9A 1NSYA 4JBGA 2DWOA 4DUZB 3U81A 5JZSA 2DWCA 4WUTA 5C1BA 4L2IA 3SHTA 2C3OA 3FH5A 2VRCD 1CY1A 1DWQA 4YDQA 4J49A 1N8NA 3I4RB 4JH0A 2ODNA 5T8IA 4U0ZA 3GJ0A 3EVAA 2QL7A 4MARA 3QTLA 4IDQA 2PCLA 2M6SA 1U0NA 3OE1A 4C5AA 4PLCA 3GK3A 3OM1A 4OP1A 5K3CA 4CKEA 3FLAA 1HOXA 3KQKA 3RYCB 1SUIA 3ZI4A 4M1EA 2XXBA 2VK1A 4TN1A 3KR0A 3MMZA 3ZXSA 3CG0A 1FYXA 2BTEA 4J16A 2QAIA 4YQEA 1SB9A 1L8OA 3DEJA 3PLAE 2VP5A 5AIAA 1ZX1A 1FP6A 4OQ4A 5BQ5A 1NKSA 4YONB 3UO8B 4JITA 1EP3B 4ERNA 2PUVA 4CBVA 4YMLA 3K9GA 3LF2A 1PK7A 1WXFA 3GR6A 2Z09A 4EKIA 4EPRA 4TMXA 1R5OA 1RPNA 2JHGA 1VLJA 1M10A 4M89A 2NZXA 2W70A 3EFHA 5JYBA 4U95D 3FOFC 2VZEA 3Q3IA 4W9NC 4HNUA 2C2XA 3CSSA 3CVXA 4AWAA 1COZA 3ANSA 3RFTA 1FRQA 1CQJB 1F6DA 4IIXA 3U4QB 1M1UA 3OFVA 2H92A 4DLRA 1FFGA 4MQEB 4OHXA 4F4HA 4F5YA 5CW1A 1YNSA 5AQEA 2X23A 2PE5A 4KO3S 3ZWVA 4DPLA 2PX6A 5EFZA 2ADFA 2FPOA 4H7HA 2Q29A 3QSGA 3UAYA 3C3KA 3NHBA 1YK0A 1J39A 1NNI1 3HJRA 2Q6IA 3I2JA 1K8XB 1U99A 2L19A 1KQFA 3BF7A 1JR6A 3OBBA 5L3QB 1Q74A 1RYYA 2OV6A 2JD1A 3SHOA 4O63O 1W87A 5AOAA 4Z4HA 3CZ5A 1ZOIA 1RJEA 3RJTA 4RVHA 5GJCA 1NUQA 4MWEA 1SFRA 4CKXA 5K09A 1KDVA 2V6FA 4PZZA 4B6JA 2ZJ5A 5JD5A 1RLMA 1EVEA 2AI3A 2CNOA 1GSOA 3IQEA 4NFHA 4EZLA 2AQ8A 5JD4A 3K8ZA 3VBEA 1U8FO 3GEPA 1L8AA 4XLLA 3WGMA 1IY1A 2YWJA 4KWIA 4I1UA 1EBUA 4JFRA 3W4IA 3SP1A 4KZ0A 1LLCA 4CLEA 1BVHA 3S2IA 4ARCA 4I1OA 2FO7A 5GJBA 3ST7A 3TGLA 4EPYA 4JYPA 2NSJA 3OH8A 4NCBA 1XF9A 3QKRA 3UWMA 1L6IA 1PBTA 1QYDA 3ML9A 4KQGA 4W6QA 4P0QB 4NJEB 3WOVA 1NP7A 2ZCJA 2P78A 4OLBA 1UWVA 5A3RA 3WRXA 4GA1A 2V8OA 4P29A 3W5IA 4TUUA 1FX1A 1HFKA 3FUXA 3LLUA 4MKTA 1L3CA 1RKVA 2RBKA 2PWPA 2BAGA 3FTDA 2PLNA 3WC4A 5CX1B 5ERXA 3LHKA 3MILA 1YJBA 1JFRA 1IY9A 3FWZA 4C07A 1G8GA 3U7EB 4QYXA 4E22A 3CVPA 5G05J 1O5MA 2GN6A 3ZE8A 4WWOA 2W6ZA 5K0TA 3PJGA 4LSMA 2NNWB 4KDEA 2X7HA 4QNMA 4YI5A 3RSLA 4GYOA 4PX3A 4FN4A 4YIKA 3HA2A 4K9SA 1E92A 1QS0B 2VYIA 2FVXA 1O0SA 4L75A 1U0JA 1OPXA 1XB2A 4CNBA 5IHPA 3LBFA 4MI6A 3WTBA 3WMEA 4W63A 3H9BA 1XDGA 3KEQA 4D3FA 4KI0A 3WLQA 4QPCA 3RC9A 5J47A 4IL5A 4IIYA 1JQBA 2C5BA 3QF4B 2BT4A 1LKZA 3WK4A 1H3NA 5CDYA 3RADC 1OWOA 1NU8A 2IBTA 1UFRA 3LC2O 4QIHA 2MR6A 4Y1GA 1EFVB 2PSFA 1JQ3A 2CC2A 2Y1CA 2QUJA 5DNAA 2GYWA 1WEHA 2EZ9A 5EQDA 3GIDA 4O4HA 1J8YF 2Q3FA 4JB8P 2SCUA 5J9FA 3RYIB 3H5WA 1H42A 2GUWA 1KS2A 2Z2YA 4Y2UA 3PC4A 4AY3A 1KEUA 2OILA 2R9VA 3VR5A 3CMCO 1P5HA 3D6AA 4D8TA 5I8PA 2XYGA 1PVDA 2AX3A 4Z5XA 4EHLA 5DX0A 5BSWA 3VU0A 5JXWA 1H85A 2W6OA 2YX1A 1T2NA 3VNUA 3L16A 5IYZB 1T9GS 2PSHA 3ZDEA 1W76A 3VNQA 5JS7A 3ZY2A 5WRFA 1H2RS 1VE5A 5JCPA 2G9UA 4DZZA 1XD9A 4MA4A 5TEWA 3D4PA 4RL6A 1TNDA 4EHFA 4ZANA 3VSCA 4R1LA 3A6EA 1JJVA 2IIQA 3OPYB 1MJFA 4Y2YA 5HTKA 5LBIA 4Y1RB 2BKXA 5G55A 2QN6A 4JROA 3WGTA 1KY2A 1AKRA 5DBGA 2RGAA 1D1SA 2WMOA 4F5ZA 3PT9A 4C4PA 3W34A 1X7XB 4FDMA 4Y8VA 2ZETA 3DC7A 5F4BA 3DTVA 5I7FA 3F3MA 3RKUA 1GAXA 3BU8A 4C7JA 4UVHA 1HC7A 1B6TA 4KBFA 4HVLA 1AHIA 3F47A 3PQ5A 3V8QA 4GAAA 3QELA 2ZJ7A 4F4JA 4J4BA 5FWXB 5J4YA 4E08A 1FX0A 4XM1A 1Y4ZA 2FEXA 1JN0A 5I7VA 1BTOA 2JAOA 4F3KA 4N6OA 1G3RA 2A4KA 1H2ZA 2VO1A 1XEWY 5JJTA 1X1RA 3CLUD 2VSYA 3C6MA 4IMIB 1W5EA 4X8OA 3QWWA 1Q0SA 1WB6A 3KZXA 3CN9A 1N0HA 1THZA 4NONA 5HRYA 4JA9A 1U8CB 4I9UA 2G0NA 4WX2B 5EZ6B 1J8VA 1OF1A 3EZ7A 4TV8A 4E07A 3K0CC 1A4XA 4U96D 4DQXA 1EFTA 1M2KA 4QDOA 4TYWA 2MT9A 2BF7A 3W06A 4EVQA 1G8PA 4YUAA 1FFYA 2IT1A 4TMZA 5J2UB 3WK9A 4Q01A 2FP4B 1LPNA 1G18A 4W7HA 4BKRA 4QU9A 3KAPA 1O4VA 2CMKA 1BD4A 1GEEA 4MIYA 4BPRA 5BW6B 4UWHA 3ZZTA 3DLPX 4QTXA 3L1UA 3BL6A 3DHNA 2HMUA 1G5RA 1E2PA 3FLEA 3I1YA 3I4CA 1J07A 3T5BA 3GAMA 2X6TA 4MULA 2LXLA 2IOFK 2SNIE 3AMVA 1EFKA 1Y8ZA 2R62A 3H6HA 1Q5PA 3G5UA 4GVLA 4WMLA 5FB3A 2YZ2A 2R5SA 4A55A 1BJRE 1NRXA 5ESDA 5IULC 5HE8A 1LDMA 2NTVA 3ADCA 4R2JA 2Q2WA 4ZJUA 1RTKA 3TE6A 3T1NA 3GUCA 4LHZA 1X1AA 1LSUA 4L85A 2BJHA 3IVAA 1CW2B 4KQFA 2ACWA 2BC9A 3IR7A 4G0PA 3BRWA 4G1UC 2GD1O 5CR9A 4AO8A 3QUTA 3EY4A 2DBRA 4KR9A 2E55A 1Q3KA 4EITA 4L4RA 1UJJA 3W9FA 1YACA 1VE6A 1B3BA 3QWIA 3K72B 3OT5A 1TE2A 2UUAB 5I48A 1ULAA 4B0PA 3LY8A 2QM7A 3F74A 1VSTA 3SXJA 3PQ7A 4BBPA 4HNAA 4A2CA 2DC1A 5HJEA 3G23A 5JNRA 1ZCJA 1KY4A 4LOAA 2W37A 5FF9A 2AG8A 3DBLA 3NLLA 1NF3A 3IXQA 3T7SA 2WKSA 4DJEC 1NUUA 2PKCA 2CXNA 1NYLA 1XWWA 2I87A 1K0UA 5ELXA 2VTDA 2W6MA 3EUWA 2RGYA 2FG7C 1Y9DA 5KNHD 5KTPA 4J16C 4B76A 2F48A 1XWFA 5GOZA 4M7OA 1V5GA 5JEDA 1PGQA 2ZIAA 4IIJF 1JHQA 1KARA 4DWVA 2RH9B 3DXZA 4OHRA 1HNNA 1YZUA 5KPJA 1H8ED 5DSXA 1OW3B 5E1DA 1KNQA 5AESA 4OQPA 3TIGA 2D2FA 4KLAA 2FHPA 3ULEG 1HDIA 3DRAA 3WK5A 1W581 3V1TC 2HWKA 3PXAA 5ER9A 3T0IA 2KZTA 2ODTX 4C3UA 2JCSA 3VDQA 1GN8A 4Q1BA 2XBUA 5HF9A 5K01A 2H1HA 4ZRNA 5CEFA 2WZBA 2QL9A 1U2PA 1J1ZA 3P9PA 2ETCA 1Z0KA 4R05A 3KE9A 3LGAA 5FPHA 4TKVA 1QHIA 4LG1A 5E4JA 1BYUA 1QF7A 3UV7A 3HV0A 1G59A 3KPYA 3L8MA 1DLIA 2QU7A 3ITEA 3V33A 3HB1A 3CHPA 1JTEA 3MX3A 5IG2A 1FUYB 3AEXA 1SXJE 4YJKA 4DTIA 3WR5A 2WTNA 2FDCA 2CD9A 4YJGA 1QHXA 3GJ8A 4ESVA 3TUJC 1AS3A 2E4ZA 3Q3HA 4LJSA 2PU5A 1DINA 2QX9A 3ECCA 2H4XA 1CDZA 1QIJA 5LNK6 2PX5A 4FONA 1KQOA 2D5CA 5AR1A 4QVKA 4CLOA 2DULA 3EIOA 1Z2OX 4JJGA 1OCOE 3E34A 5AUQA 4BO6A 1UXGA 1Q1BA 4RNDB 3VXKA 3GG2A 2GCPA 5CRIA 2XWSA 2YYAA 3GN2A 2VGXA 1ZFNA 3CIOA 2QWXA 3T8KA 4V2IA 4OJQA 1ZMOA 4IF4A 2XD9A 1SG9A 3K9CA 5DJ5A 4PNPA 1TR4A 3M1IA 4YIHA 2QT0A 3Q85A 3GAAA 4FJ1A 1H2EA 1UF9A 2Y0PA 3A4MA 4HH0A 2H3EA 2HSEA 3CVLA 3TQIA 4YRAA 3SJAA 3L7KA 4UHDA 4AY4A 4DC1A 3TGPA 5TLSA 3DMGA 1PZFA 2P6OA 4ROTA 1HUQA 3MJCA 3KLOA 3LA8A 4CF7A 1ZD5A 2FF7A 4CW7A 4PYKA 1MC5A 1PFYA 2IZ0A 5KHOC 3C3CA 4UU7A 5B1AE 1JYSA 3BHJA 2DBQA 3MYYA 4BKQA 5CVCA 1VJTA 2ZIWB 5KNCH 4L5JA 3NFYA 2O20A 2C2OA 3G2VA 4Q48A 3O7MA 4CR8A 4IIDA 5A4FS 1XHFA 1I9CA 2RGGA 1RZRD 4OQZA 3OLVA 3L6EA 4P0PB 2ILVA 3WRXC 3U09A 2XMBA 1UJBA 2XYHA 5H5JA 2P9HA 4RZUA 2ZEJA 3L8HA 2QT1A 1PDWA 1GT6A 2VHVA 3HSKA 3E8XA 5AI8A 1Y3IA 1HG5A 3L1KA 2GEFA 1VC2A 4N18A 4WZAB 4DKXA 1Y80A 4DXAA 5FUYA 3C72A 3N86A 2HXSA 1M6HA 3QY0A 3HJCA 1KQNA 4C0LA 4QWWA 1KVTA 2Z58A 3FJOA 2Y93A 4RPGA 4GP9A 4M8KA 4XYMA 4Q4AA 3WA7A 3B7RL 1MH9A 2BY4A 4G5OA 1GY8A 5FD8A 2ZTVA 1LK5A 5BNFA 5FTJA 4ZMRA 5C7OO 1DLJA 3CJTA 3WQSB 4HGRA 2RK6A 2FPUA 4NS4A 3NBNB 3WQBA 1IXYA 2H18A 2WJ4A 1KSJA 4X95A 4MR9A 3PL5A 4ND5A 3SEZA 2R7MA 1UPAA 2GASA 2JIQA 1PCXA 3WX0A 4FGUA 4DMLA 2JGEA 5C5DA 3TG5A 4EQ6B 1T8TA 3ISVA 5FZSA 3BCRA 2QMQA 5FUBA 3H1TA 4ABNA 1BEEA 1S0PA 4TSFA 2O8NA 2VAPA 4TZ0A 1HWYA 4P31A 2ZANA 2WQZA 4HNVA 1SCJA 3SY2A 2H17A 4F84A 2A58A 3TO5A 2V6JA 1U80A 1SZCA 2P2GA 3G0DA 3OZRA 1XK6A 1I1HA 1IXKA 4P93A 1WXWA 3IQIX 3EEYA 2ZQZA 4EKDA 3TM5A 3UTMA 2C07A 3O3MB 4LYAA 2FTKE 2B25A 1TB4A 4PSKA 3UH0A 3VKVA 2FVYA 3KTFA 4JP1A 3ETGA 1THTA 4JGBA 4JNKA 4XEHA 2FSPA 4HLDA 3BEEA 3IP6A 4AUEA 4C7OA 4GZ6A 1S7GA 1YB2A 1DBPA 2FLKA 2XEEA 3TZLA 1W30A 4CIVA 1BS9A 2AJTA 4G1EB 4NV0A 3SVLA 4UWLA 4JLUA 1E63A 4HRVA 3ONLA 1YU9A 3DZGA 4DSUA 3W7VA 1X7ZA 4OKSA 2ZR9A 4CM4A 4KPYA 4XM2A 1U2TA 2A6PA 1U9CA 3V7WA 4IXTA 2NSYA 3LXMA 5KJNA 5B1HA 3GMDA 1E3SA 4DRXB 2GN8A 2DOKA 4HBDA 1NVMB 2BM1A 3MWEA 5D1NA 1INLA 2EFJA 5DNDA 1DQNA 3AQ4A 2PD6A 4HAIA 2P2DA 2Y0EA 3CFYA 4NVRA 4B6OA 3CKCA 1Q1AA 1S89A 5F4ZA 1UDCA 4KIUA 1FYWA 1CUXA 1LDNA 4XB6B 1HDZA 4X84A 3RODA 3D5QA 3Q7FA 3F1KA 4L8GA 4O5OA 4GQIA 1R4MB 3SY8A 2XZDA 4RW0A 5DM1A 1TAHA 4UMDA 4OKIA 1QQ5A 3WGYA 4W5RA 4GO1A 2NO7A 5FYQA 2IU0A