2XGOA

Xcogt in complex with udp-s-glcnac
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
548
structure length
548
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 203
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgoA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgoA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgoA02
1WUYA 3GW4A 5IKPA 2PQRA 3CK7A 2QN2A 4U0UA 3L7CA 4KQ2A 3MV3B 3CK9A 3CVNA 1Y8ZA 3TOVA 4IN3B 1IIRA 1FU4A 5BW8C 1XOIA 4CGWA 4X6LA 5ENZA 4WUYA 1JIXA 3ASDA 4YNDA 4HWGA 1B4DA 2XCUA 1C3JA 2QRQA 4KQMA 4I1AA 5G05J 2KCKA 1KT1A 2PL2A 4WADA 3C4VA 5DXFA 3MA5A 2GPNA 1J39A 4X7PA 3LY7A 3OXGA 4W6QA 3OY7A 2IEIA 2Y4TA 3CV3A 1NOJA 5AYWD 2G9RA 1FU8A 3BCSA 3MRTA 4JA7A 1ZU2A 5KJNA 4UI9K 4KXKB 3PDNA 7GPBA 1XC7A 3T3DA 1FTWA 2F3SA 3CKCA 3MRVA 3L01A 2ATIA 1QKJA 3E3OA 3OKCA 3RSZA 3NF1A 5KJKA 3D0QA 2HYZA 4YUAA 3Q5MA 2QFCA 3UPVA 5DLDA 5TMBA 4UI9J 2GJ4A 1Z62A 1Z6QA 4X7RA 1FTQA 2C2LA 1A17A 4RG9A 3G2LA 1EXVA 2SKCA 2P58C 3UUXA 1P4HA 3EDTB 1GPAA 3PE4A 1P4JA 4WHMA 2FF5A 4I2ZA 1SXPA 1HXIA 2UWJG 2G9VA 4CTNA 3MTDA 1L7XA 1NZNA 3TG5A 3NP7A 2ASVA 1GPYA 3KAEA 3K9IA 1EM6A 3BD8A 1KT0A 3PE3A 1L5WA 1IXYA 1L5VA 4RIFA 1L5QA 3NB0A 1A8IA 3LYAA 4KQ1A 3HBFA 4GZ5A 4NESA 4N5CA 5BT1A 5D01A 4WNEA 2VSNA 3NP9A 2AV6A 1FTYA 4WNDA 5BNWA 3E4BA 3WADA 1P29A 3ASHA 3O3CA 3VTXA 2IV7A 3CKBA 3WXXA 2QRGA 3BD6A 5D00A 4BTBA 2YHCA 3WC4A 3UQ3A 3BEEA 3E3LA 4RG6A 5CCMA 4CTOA 2X0EA 1FC0A 5LQDA 2XGMA 3G2IA 2JJMA 2XCIA 1RRVA 3CK8A 3QOUA 3Q4AB 4RENA 3D1JA 2VCEA 5TVGA 4XIFA 4Z5XA 3BCRA 4M60A 2C0MA 2MHKA 4O6FA 4HOSA 9GPBA 3C4QA 5ARGA 1YA0A 5FZRA 3VDNB 3H4TA 3T5TA 2QRPA 5CHEE 1HLFA 2WTXA 3ZCRA 5EX3A 3OXLA 2QRHA 4G2VA 1NZFA 1P2BA 5LCWJ 3ZFWA 4KBQA 1QQEA 1E4OA 5GPBA 3D0RA 2QN7A 3CEJA 3S7BA 5D0QD 1JEJA 2FBNA 4GZ3A 3UYLA 3HBJA 4BQEA 1NOKA 3UYKA 3CVLA 4BFCA 3NPAA 1IYGA 4GYYA 4U0SA 2AZDA 2Y4UA 5DU2A 5IKOA 2E2EA 2QLLA 3QWWA 3ESKA 3C48A 2JZCA 4YVQC 2GPBA 3OKAA 5EX0A 5A7DB 3G2KA 3LY8A 2F3QA 5JTTA 3Q49B 1KLXA 2SKEA 1M5RA 3RIBA 2LSVA 4H7YA 3ASFA 3CVQA 3BCUA 3MT7A 4HOQA 4N3BA 3OT5A 1C8KA 1L5SA 2FETA 2PQ6A 2BGUA 2FF4A 5DBKA 2QN1A 2F3UA 1NLMA 1C8LA 3T3EA 4MI6A 2GM9A 4EKEA 4CDRA 5CCLA 2PRIA 2G9UA 3CUWA 2F9FA 1PN3A 1IHGA 4XI0A 4EL0A 1XKXA 1XNFA 3FFLA 4UI9C 2R4TA 3S27A 4AN4A 3BEOA 3FROA 2IYAA 4MRAA 4WNGA 3ZHEB 3L7BA 5FT9A 2VGYA 3GZ2A 3URZA 3AS4A 1WW2A 3BD7A 4J0UA 5HI7A 1XL0A 2ECPA 1JIUA 4ABNA 1FA9A 1RZUA 3QDNA 3MS2A 4MI3A 1HZ4A 4GYWA 1ELWA 4LEUA 4M83A 3L7DA 4JHRA 4N3CA 2XEVA 1NVKA 4BQIA 4J8EA 2QN8A 2HO1A 2KCLA 3OXFA 3S29A 5JJ7A 3EBPA 2HR2A 4Y6WA 2R5SA 4EQFA 4I9CA 3HYMB 1JG7A 1FU7A 4LEIA 2FO7A 3S7JA 2P6PA 3VDMA 3N71A 2IYFA 4U07A 4BTAA 3CEQA 2VGXA 4NRHB 2C4MA 3L7AA 3OTIA 1HH8A 2VCHA 4BQFA 3ZCTA 3MS4A 3FWVA 4CTMA 1SXQA 3GUHA 2UY1B 2J9QA 3CUYA 4RIIA 1Y6GA 4G24A 4GCNA 2NC9A 3IEGA 3COPA 4MI9A 3T3GA 4YI5A 1Y8MA 4GZ6A 1GG8A 1PSWA 2R60A 1UQTA 2QLMA 2KCVA 4LDPA 1AXRA 2XA2A 2WQHA 5LCWC 4U04A 2H1HA 2LSUA 3Q47B 4GCOA 3DDSA 3WAGA 1P4GA 4XI9A 4REMA 2F3PA 2XPIA 2GW1A 1P5QA 4AM9A 1Y6FA 4JL0A 3LKUA 5FTPA 2PYDA 2QLNA 2XMPA 4PQGA 1UZUA 4U0ZA 4F97A 4HLNA 2XA9A 4MICA 3CV0A 2L6JA 2ACWA 3BDAA 3RO2A 3OTGA 1OUVA 1ZBPA 5HXAA 2XCCA 2KC7A 5JTUA 3ZCUA 5G05C 1VGVA 3ZGQA 8GPBA 3U3WA 3CUUA 2BISA 2IV3A 2YQ8A 3AS8A 1ELRA 4AY6A 4UQZA 3S2UA 2IFUA 3MT9A 3ZN3A 2AMVA 5FJYA 5FZSA 2H1FA 5D0OD 3TAXA 2FFRA 3CEMA 3OY2A 4WACA 4HORA 3R9AB 4J8FA 3LY9A 4AIFA 2LNIA 2QNBA 4X7MA 3ZPJA 1WM5A 3LPZA 4FZRA 4HOUA 4I2WA 3MV2B 5JJTA 6GPBA 3JYSA 4UQYA 5JJ6A 2IUYA 2ONDA 1WAO1 3ASGA 4GA2A 4N3AA 3T7DA 3MRXA 1PYGA 4G25A 2HY7A 5FZQA 1NA3A 3Q3HA 3RKVA 3L79A 4RIEA 4A1SA 4B94A 4BT8A 3EBOA 2OFFA 3LCAA 2G9QA 2PYIA 1QZ2A 4ME2A 4W9RA 1NA0A 2X0FA 4GA1A 3GZ1A 5KJLA 4RELA 1GZ5A 2C9ZA 2IF4A 4GPBA 3SZ7A 3T3HA 4EJ2A 2IW1A 2ACVA 4EKYA 2XGOA 1PC2A 3H4IA 2XGSA 1RZVA 4GYOA 3RT1A 1W3BA 3QWPA 2X0DA 1K06A 3VTYA 3FP3A 4I17A 3RU0A 4G23A 2BGTA 1B89A 2BUGA 2FEZA 3ZHEA 3NC4A 3CX4A 2PQNA 3G2JA 4GA0A 4AMBA 1LWNA 4KYOB 5KJMA 1ABBA 2BFWA 1L5RA 3QHPA 3S7DA 2C0LA 2AVPA 3CUTA 1Z6PA 2KS6A 1GFZA 5TMDA 3T3IA 4RIHA 3GYZA 3E3NA 4EL5A 2OOEA 3Q15A 5G04J 5C1DA 3TGOA 3NCHA 2V5FA 1JG6A 3MTAA 4AMGA 4UQXA 3ZCVA 1F0KA 3MEKA 4NEQA 1FCHA 1XL1A 1YGPA 1FS4A 4M7PA 3KD7A 5A6CA 1O6CA 4QLBA 1WW3A 3MTBA 1LWOA 4YI3A 4AY5A 1P2DA 3ZCQA 2QZSA 1E1YA 3MBOA 2QN3A 2VGXB 3NAZA 4G2TA 3MT8A 4G26A 2C1ZA 3DD1A 2UY1A 2VG8A 3MQFA 1YA6A 4APOA 1TJCA 5TMEA 2PRJA 4RBNA 1P2GA 3CVPA 3DZCA 2Q7FA 4YVOA 3QKYA 3QWVA 4NQ0A 1K08A 1PNVA 4MHSA 3VUEA 1AHPA 5G04C 2R66A 2XCBA 2GPAA 1UQUA 2ZB2A 1XV5A 3MKRA 2KATA 3GPBA 3S0JA 1L6IA 3ZCSA 2O6LA 1V4VA 3CUVA 1Z8DA 1KTIA 4BT9A 2R68A 3ZCPA 4F3VA 1E96B 4N9WA 3S7FA 3MS7A 3HBNA 3SYMA 1NOIA 2R4UA 4G1TA 3SF4A 2IEGA 4I9EA 5DIZA 3IA7A 3OTHA 2C1XA 2QN9A 2XA1A 3AS5A 3VUFA 3RO3A 3ULQA 2GEKA 4RIGA 1GGNA 4H7XA 3OKPA 4GPKA 4JA9A 4J8DA 3RHZA 4N2SA 4Y6CA 5HQ8A 2AW3A 4NC9A 2JLBA 1QM5A 2VQ2A 2WPVA 1BX3A 2VYIA 3G2HA 2PZIA 2SKDA 3RJVA 1JIVA 3AMVA 2I6HA 4WNFA 4L22A 4N2QA 1H5UA 3O48A 5ARFA 4FKZA 2GT1A 2DBAA 2YJNA 4CGVA 1C50A 5M72A 3SYRA 3Q3EA 1WV1A 4N39A 1WV0A 2X6QA 5I45A 1GPBA 3CEHA 4F9FA 3MSCA 2X6RA 2VSYA 2GEJA 3RSCA 3Q3IA 1WUTA 3U4TA 4MHOA 3DDWA 1NZDA 2QRMA 2Q6VA 3G2NA 3S28A 1F6DA 3HBMA 3QKWA 4F96A 3TSAA 3IAAA 3KS2A 4BWRA 4HOTA 3TG4A 5EKQD 2FI7A
chains in the Genus database with same CATH superfamily
4OI4A 4OHXA 3GW4A 1RHUA 2XE7A 1U8EA 3HPRA 1JEYA 4BFTA 4HQ6A 4OK3A 2P79A 1WG0A 4PG6A 3AIOA 2NWQA 4QYXA 4XTRA 4H35A 4LYYA 1ENOA 2VYVA 1GADO 3K9CA 4D9JA 2OORA 4Y6OA 3NHLA 5I5GA 3TLZA 3NBZC 4D10C 2QRQA 4ER3A 1CLEA 4LECA 3SG0A 1JEQB 2RCNA 3I2GA 3ASYA 1ZK1A 2IZ0A 3P2OA 4MS6A 1F8UA 2VIIA 5EZYF 5YASA 4CEIB 3THXB 1CRLA 3SYLA 5E1MA 4ZYZA 3ILXA 3GLGE 3LGAA 2R6FA 4RMGA 2QENA 1QHFA 3TKAA 3OT1B 4AMYA 1DVRA 2C88A 2NGRA 2B0CA 3DQZA 5EIFA 3IMEA 3C3AA 4PHHA 1U7DA 3TFOA 2AD1A 4DSOA 2GYUA 5ITZA 4Y6QA 1JIQA 2JEYA 3H2HA 1N4AA 3ECAA 4WFJA 2CJYA 1KYTA 1NJFA 1QZTA 2CY0A 4GP7A 4HGNA 3QE0A 5EIEA 3A3NA 3PB3A 4IS2A 1F2TB 1U0JA 5ICCA 1MXFA 1QUEA 1AQNA 2PD4A 2XRZA 1ZUWA 2XWBF 3JVIA 3OJCA 4LHZA 1OZHA 3RSZA 4CUJA 1MPXA 2FPPB 4C20A 2ZYRA 5HKBA 2H7VA 2NV0A 5JQGF 3SY2A 5L40A 3FH7A 5DLDA 2PWBA 3K16A 1TCAA 5A6SB 2VAXA 3NMUF 1JHPA 2IONA 2AWOA 1FTQA 1JZQA 2C2LA 4HRVA 3OZRA 4WNAA 2DHRA 3MNFA 3UXMA 1TMGE 1T35A 2R1VA 3KZNA 1XFAA 4I2ZA 2WJ6A 5JE8A 3ZWOA 3WLEA 2J3HA 1XMQB 3SR0A 1RXVA 1OGJA 4NAUA 3MHPA 1A1VA 3G3EA 1JB9A 1WZEA 1O97C 5FWYA 4JI4B 2RIRA 3M81A 1E2BA 3P9KA 3SJ7A 1YONA 5EE0A 1IEWA 3NGXA 4HXEB 3NBAA 5B7GA 3GF4A 2YV4A 4GOND 1XZPA 3V8PA 5B4VA 1W36D 1I8TA 4KN8A 1MOPA 1OC2A 4W8HA 2XTJA 4RK6A 4RO0A 1UAYA 4TZKA 3VNVA 2FXIA 1K5DA 2N3ZA 2XNSA 3WA6A 3ZV7A 2JH9A 1YA4A 1S01A 3L1IA 1ZC3A 5E38A 2F9LA 2HH9A 4HGQA 5CW2A 1L5QA 5EY5B 1XPUA 3HY3A 3K70D 4MCIA 1PJ2A 1E89A 2CLEB 2FW9A 3F47A 2Z4TA 3HWRA 2O50A 5AWFC 4KQ1A 4IJWA 2RHRA 4DANA 5K0JA 3UMJA 6Q21A 3GLIB 3ZLJA 1FP4B 4GC9A 3IERA 1PW5A 3UPTA 3BHMA 3W6OA 4CM9D 1DO8A 2NPOA 2EKPA 4EHHA 1EXDA 4GMHA 2G67A 5HJ5A 4MRVA 4U8HA 3T8YA 5CNKA 4NATA 3VBEA 2WTAA 5IXYA 3HFJA 4HDCA 1C9NA 2GCIA 2EZTA 5DGHA 3RVQA 5ALFA 1GN9A 5LWQA 3FKSD 1JLKA 1OIVA 2C61A 2N1BA 3OCXA 3NTVA 4KQFA 3TINA 5CCMA 1A2QA 1LXCA 5F5LA 4NH0A 3RS7A 1YI8A 2BFEB 1O5TA 3UMMA 2DMRA 1FC0A 1TGVA 3CPEA 2IDKA 2XGMA 2CXUA 2FFAA 1XX6A 3DOCA 3HVJA 3I3SR 2WA2A 4M0KA 4U2BA 5AK6A 5JFGA 1T8PA 3FUDA 3GZNA 4KRYA 3K4HA 4Z5XA 3RFCA 4ENWA 1W2GA 4DV5B 4HOSA 4C7KA 3LWBA 4F1JA 1L5OA 4G0QA 1N94A 4KGZA 3ZIUA 2WF5A 2FW0A 4F5WA 3OQNA 3ROTA 1CUUA 3RAUA 1DRUA 5F1OA 4Q66C 3SKYA 1XIVA 3T4PA 5GM2A 4U6NA 3NNSA 2R00A 3SJBA 4ETWA 3AUUA 5AW0A 2A92A 3NOOA 3ZFWA 3K9GA 1WTCA 2OYCA 3KT8A 3O4ZA 3V7UA 4ROTA 4BN4A 5L3QB 2AG5A 1VFPA 1XLTA 1FFDA 1ONSA 5DBGA 5IF9A 1E6EA 3M6XA 4CKCB 2WLTA 2XHZA 3PEUA 4PLVA 2FR0A 3PRHA 2XB4A 3FPKA 4MGHA 4ZYLA 4IWXA 1YZGA 3CRVA 1HLGA 1ZCZA 3CW8X 3KYDB 2Y9MB 5AUQA 2WAMA 4ZVOA 1ZIDA 3CVLA 4TXPA 3G0CA 3KPJA 3UYKA 4UE6A 2J3JA 3W8NA 5J2UF 2PG3A 2NUTB 2V7QA 2YUTA 3HYRA 3MC1A 4JUCA 4CQLA 1I24A 2X6HA 2HDOA 1E9AA 3F6CA 4TKUB 1TVMA 2C4TA 3EVEA 3HEAA 3SFTA 3AI2A 3PXEA 4W5HA 1LI4A 2HJSA 4BMYA 1DSSG 5ALLA 3OKAA 1EE9A 1K6XA 1KI3A 2R8XA 2TSYB 3VC2A 1GGVA 4YS6A 3W1VA 3KT0A 2HCBA 3YASA 1XDSA 2YYAA 4G8KA 1A0OA 1RPTA 4OQNA 3PHCA 4A7PA 2BY4A 1LK7A 3QZUA 5LZ8A 3ZKJA 3R5SA 4M9UA 4QXMA 4CJXA 2FPSA 3C85A 3OZAA 3DPDA 4U7GA 5AMXA 3AVTA 3CVQA 2VZLA 3BCUA 4RLSA 2C3MA 3Q8KA 3N6XA 4CU5A 1N2IA 3GJ5A 4U5QA 5TQ0B 4PO3X 3TTVA 1C2YA 2AMLA 3IHVA 4U2EA 1UKZA 5CVJA 1QLHA 3WG7E 2JHGA 4ON9A 2QSJA 2VWGA 1YR2A 1WB6A 2D06A 3QYPA 2G0AA 3V1LA 1O6BA 2EFYA 1EWTA 1MO6A 3MKQB 1RVDA 2GD1O 2PSDA 4W9NA 5AHRA 1Q19A 2RGWA 3OQ6A 3JXEA 4M1YA 3REQB 4NE7A 2OECA 1DIBA 3H5TA 4C9BA 2VJBA 2WD9A 1XMXA 1XKXA 2RSLA 3DC2A 5EJGA 4FM9A 3HKCB 1OXTA 4LY6A 4AKEA 2FEPA 1N1DA 2DU8A 3AU9A 5ITZB 3V1KA 1HU3A 3RC9A 1QQAA 4UWKA 1R27A 2AQHA 2PLAA 4UWLA 1KAQA 1RE0A 2Z56A 4MUAA 2QOEA 2X4LA 3GZ2A 4PHGA 1L7NA 3L77A 1HFWA 5E7MA 1ICEA 3ZW7A 4AIIA 4ZVNA 4M46A 4UDOA 1NSFA 1T8RA 3KSMA 2GO1A 2IYZA 2RHOA 5BMOA 1SWWA 4NONA 1E2JA 5KOYA 1XRJA 3E3AA 3PC4A 5LCXA 4WZBA 1SQFA 4E3ZA 8LDHA 3NIDB 3LCRA 4B81A 1NYLA 1LLCA 3JALB 4BQIA 1DS6A 2DQKA 2DWOA 4P34A 4I9UA 4PG7A 4JI2B 2CB0A 3IVAA 2V45A 1OAOC 2Y99A 3CZ5A 3NASA 2O0HA 1ODLA 3JAKA 5FP0A 4D4HA 2OA0A 3R5JA 4FD2A 3Q9NC 1XN1A 2GETA 3IOMA 4G1BA 4IDHA 1XBTA 1X9IA 3HB1A 3UUEA 3WY9A 5CT4A 3EQ6A 3LT1A 4ZU6X 3H7AA 3EEQA 3IEKA 2WICA 4E1BA 2PGOA 5BSHA 3HO6A 4NZMA 2JD1A 3MRSA 2HM8A 5JSQA 2HCTA 3JR7A 4BNUA 1N2SA 1FW8A 4MWOA 5DV9A 2V3VA 5AKJA 4IRUA 4EW2A 1RC8A 2J9QA 4D25A 4BNIA 4RIIA 1UPUA 1J21A 1ZIYA 2XNKA 5KUTA 1JGTA 2DIWA 4EW1A 3T3GA 5ER9A 1SUEA 2BC9A 3RRFA 1RMYA 4YAKA 2O2CA 3I3OA 1RZ4A 2Q5LA 1A7KA 1N9GB 3PUZA 3FPAA 3V8QA 2QMHA 3HCFA 3QM1A 4ZGBA 2W93A 1BE1A 5HEKA 4UHHA 5GM1A 4KPEC 1EGQA 3KQTA 1UM9A 3WISA 5GJVC 3ELBA 4LCBA 4BEPA 2JCXA 5DBIA 4C3UA 4YRAA 3HXQA 2MT9A 5FRDA 1YQTA 3T38A 2ZAMA 3PDUA 2XNDD 5KQSA 1YJCA 3CJRA 2IS2A 2FPMA 4EHAA 1A98A 1M5TA 3K0AB 4LPKA 3ZNGA 2IOFK 2Q7DA 1YS9A 4CIXA 4F97A 1D7OA 1ILEA 4OB6A 1HT1E 4MW2A 1YFLA 2D59A 1IN5A 3MJ4A 4MWDA 4DQDA 4GPD1 3AHGA 4GW3A 3SEZA 2ADFA 3T15A 4X45A 5HXAA 4BN5A 5J08A 3IJRA 3E5MA 3N05A 8GPBA 5AENA 1TMOA 3DLCA 3VR6A 2JFYA 2GWHA 4MKZA 4F3KA 5B12A 5MHTA 1O58A 1MORA 3FETA 5SZKB 4QAQA 3GJZA 4BMOB 2R17C 4PNHA 1FYFA 1GNSA 3GFBA 3S2UA 4EI8A 3HB0A 3O9ZA 2NZJA 3G7UA 4MXDA 4O59O 4JZYA 1ECCA 2BM8A 4YRLA 3I5XA 3D6HA 2I7CA 4IV5A 4CG3A 3UKOA 4CCAA 3B7UX 3SIWA 4CCYA 1OLSB 3KXLA 4F1WA 2QNBA 4NFHA 3RABA 4ZFNA 1DJPA 2NSLA 4QLOA 1BROA 5DYTA 4MLZA 1SCJA 3WYNA 1L2TA 1PCXA 3I8OA 4IDAA 3MV2B 5I4CA 2A5FA 3DQPA 2W2QA 5G3ZA 1YVRA 4RY8A 3JYSA 1CY6A 5JMPA 3F7TA 3KVYA 4XJTA 1M6NA 2PWZA 2KPOA 4UUQA 3ONVA 3ESLA 4PLGA 2FLVA 2ES4A 2FUCA 3B8EA 3PVZA 4DRZA 4BBPA 3OPQA 4FLEA 3P20A 4JP1A 2F1KA 2G88A 2OFFA 4EO9A 1DCFA 1U2DC 1PAQA 3C4JA 3NHSA 1CJVC 3PQ5A 2C5EA 2P9FA 3ANMA 3JRNA 3M4ZA 4C21A 3W6UA 3UHPA 3C1AA 4QPZA 4ENQA 1GFSA 1K5GA 1V45E 1NKTA 5IJ0B 1R8SA 1T4BA 2FHPA 4JP3A 1IQUA 2Y1DA 2GBPA 4BLVA 3EQZA 3P8ZA 2W22A 4AUNA 5KNCH 1MC8A 4KH0A 3OZVA 1KEUA 2ZW9A 2RG8A 4P08A 1J2RA 2HA5A 3EDQA 4PZYA 3TOXA 3U3OA 5JJBA 2GFHA 3ETEA 2O20A 2OFXA 4IV0A 5BWBA 4PYLA 1Z2PX 4YALA 5FLXA 4Q4CA 3WQQA 1MQ9A 1IEVA 1GT91 1Z16A 2FW6A 3HMKA 3NALA 4AM8A 1RIFA 2XD9A 3LDHA 4HYYA 3UGJA 1EM8A 3PUJA 2DLCX 2AW5A 3GEBA 4LZNA 3WRVA 2LCFA 3DVLA 1XXHA 2XYQA 4YFVA 1UBMS 3SIPA 1WUJS 2COKA 2RKWA 3C6KA 3HI4A 2FNAA 2YWDA 3ZKWB 1AGPA 1JJBA 1ZVQA 5FA6A 4J49A 1DQPA 1ZVJA 3NBNB 4CT4A 1DBQA 3LC1O 1TYCA 2VHYA 3Q7AA 2WSYB 1PJSA 3M6WA 3A06A 4BP1A 4GTSA 2Q6IA 3RAGA 3V8EA 2BI8A 2VSOA 4M1KA 3D8NA 1CPYA 2PT5A 4DV3B 3VMMA 5BYKA 5AW3A 3EJNA 2WW8A 4L1BA 2C0PA 3D81A 2ZGGA 4KB5A 2FZVA 2RG1A 2RG7A 5EZ6B 5KCZA 3GJQA 3PFNA 1P1FA 1UQRA 1XL1A 2H4YA 3JAKB 4B40A 4DDTA 1YCGA 2DETA 1FS4A 2YFHA 4OI1A 3KUDA 1A04A 3TTXA 2WFAA 4CQMB 3VR4H 3DR5A 3L8HA 4XARA 3GLSA 2J48A 5A0FA 4TXJA 4L4YA 3ZCQA 3I2JA 4F56A 1NF3A 2PKCA 1HYGA 2VDPB 1E7YA 2ZKLA 2ZRQA 3OFKA 1IHXA 4RDIA 1QMPA 3CVJA 2PNNA 1HETA 4ZCLA 1IXSB 4MUFA 4EGSA 3ZHVA 2OHVA 2YMLA 1T6XA 3A1EA 3OWXA 4MVXA 1KARA 4MZXA 3D2LA 2V7XA 5CA0B 4O4JB 3DV0B 2PX3A 4P7FA 1J8DA 2ODEA 3ZZUA 4PLHA 1TR4A 3KS9A 2XT0A 3RVLA 4TL7A 4YQEA 4A0HA 4QM7A 3CVPA 1UXJA 3DZCA 1I2BA 3W9GA 4EVRA 3DHYA 1RXCA 3ZZ0A 5FOTA 4XW2A 3IV0A 4L2YA 1KK0A 1V71A 2W8ZA 3HCDA 4K3UA 4WLOA 4ZCPA 3VH1A 4BO4A 1PQYA 1V39A 2GPAA 3RRNB 2ZB3A 4OU4A 4RXUA 13PKA 1SUBA 2QRVB 4KU4A 4BPRA 4F3YA 4WVFA 1E9SA 4DIBA 1THZA 1U5CA 2UAGA 2Q3HA 1SCNE 4EHNA 2KX7A 1OD6A 4NENA 4KIGA 4WSOA 3U7GA 3PXXA 3PGLA 1T9GS 5HGXA 1LBQA 5JJCA 3RYCB 4DMRA 2NXPA 1PZNA 1UBOS 2I7TA 3CSUA 1REQA 3RUDA 1XKQA 2CMKA 4HMPA 4I19A 5JNUA 1V6AA 5LMCA 5IY5E 3U4MA 2HZBA 5IAOA 2VLIA 1X7ZB 2PT7A 2IEZA 4S04A 2R4UA 3OPMA 4YJ2F 3OUUA 1VI6A 2CLMB 2HHLA 3D6JA 1Q1ZA 3O2SB 4OJTA 5TY0A 5FEUA 2C1XA 4KNYA 3ZYKA 1WULS 1ZWKA 2I1WA 2J3LA 3IOEA 2H8KA 3EYAA 1GZHB 3NYRA 5TNXA 3SN6A 3VUFA 1GW6A 3CPJB 3DEPA 3BU8A 3DMNA 4QOSA 5JZBA 3NVDA 4J9UE 3ZKAA 3TI9A 1ZD3A 5FDFA 4DM3A 3N2KA 4IS3A 2HF8A 4YK7A 1WDTA 4XPIB 3RHZA 2LAHA 4KMSA 4NC9A 2QRKA 4GMLA 1H23A 1YIAA 5EXSA 3WLAA 5FWNA 1NDHA 1WUIS 3DOEA 1Y8AA 4WNFA 2X1LA 3WJ2A 2ZU6A 4Y1EA 1X2BA 5FLYA 2LNDA 4PG4A 2INGX 3W5IA 5ICSA 2B5VA 5SZHB 5GJBA 2QGZA 1KDYA 1N54A 1EP1B 3Q8MA 1QRUA 3TGPA 2XKBA 1ML3A 2JGMA 4DLXA 1QYVA 2PUTA 3L9TA 3UVEA 2FI1A 3OM1A 4HMQA 4NYJR 3ZDBA 2IDZA 4O4HA 2VSYA 3LNCA 3ZE9A 4BVGA 5BSGA 3MGKA 2JJ1A 1LNZA 1YCHA 4S1OA 5EHGA 3AGQA 2V9ZA 3UUGA 3O3NB 3IODA 3RF6A 3ENQA 1B2LA 1RLOA 1YU6A 2IRWA 1QGYA 2HV9A 1BWSA 2FOLA 2JI9A 3ZTTA 4TKUA 3KEOA 4B8ZA 3QVGB 1YFZA 5F3WB 5IJ0A 1XA0A 4U0UA 4EIWA 1HYHA 1YB5A 1DXOA 2HSDA 1KJQA 3ZY4A 3HLYA 3D6MA 2AOWA 1QPGA 4GR5A 3IAM6 1TUBA 1DCEA 1RAHA 3ESZA 4R9RA 1VKNA 4RK7A 3S68A 2FQQA 4ZVQA 3SHQA 2PFKA 2PR2A 3GUUA 2QN6A 1P7WA 3QEMA 5G05J 1JYEA 5K4AA 1PHRA 5BURA 1NURA 3FVVA 4OYYA 1L7EA 2PK3A 1CQIB 3QWAA 2VHZA 5LKRA 3U61B 3CF2A 1E8WA 2IPOA 3DMRA 1IE3A 4MUGA 3ENNA 4Q1DA 3AU4A 1AV7A 1IOLA 3O8CA 2R0QC 2FH5B 4BB9A 3AVYA 1XXHB 4JOSA 3R9KA 1LPNA 3TGLA 3R8FA 1Z39A 4QUBA 1W49A 4RTSA 2EV9A 4W9MC 3OAAD 3NATA 5BMVA 2W6IA 5G55A 3SD7A 2VF8A 1BXGB 4GF5A 4G4SP 3ZQ4A 7GPBA 1UPTA 4H4CA 3VTKA 4ABTA 1S4QA 1JDTA 3C70A 4UBLA 4CKEA 3ZVKA 2ZJ8A 1L1EA 4JSRA 1EE1A 3O1JC 1WQ1R 2Q29A 2EHDA 1TLTA 2WMOB 3O31A 4GTQA 2R8EA 2WWXA 1XUOA 1NR7A 5FPKA 1NVWQ 2OP1A 1NBMA 3P71T 5DGTA 2ZISA 2QPAA 5JPIA 4NHEA 3L0DA 4YXFA 5LOZA 1VSBA 3KRTA 3PC3A 2I4OA 3D9QX 1RWBA 1RWMA 4RX1A 3MIZA 4QOHA 5ADWA 2HMYB 2G9VA 3WMFA 4PC2A 3RRBA 4G5HA 4RVGA 1Z17A 4Z4FA 3OIUA 4PC7A 3VZQA 3Q41A 3WLTA 1I0IA 3CMCO 4EX6A 5ITVA 4K0KB 4MAFA 1GSAA 1C8VB 1IXZA 1W2HA 4TTIA 4X92A 4OHZA 3BFKA 1E3TA 2WXRA 4DX2A 1H8EA 2BMAA 3DTTA 3GAZA 4E6HA 3LUDA 1O95A 4I8DA 4MP3A 3BULA 5MN5A 3QNWA 1Q12A 2IUFA 3U3JA 1E7RA 1PQUA 4X93A 3HYSA 5KMGB 2ONKA 2CNNA 1IHBA 1A9QA 3NTLA 4GP6A 5CIWA 4CODB 4O4LF 3DGFC 1PJCA 1TJPB 4HSGA 5EYPB 5J1SB 4R9NA 2FYTA 4GZ5A 1WZCA 5B2ZA 4FXPA 5CCXA 2D3TA 3H2GA 3V2HA 4CGZA 4CEMA 3QEOA 1MLDA 2IU0A 5FUYA 2BGRA 2AWNA 2AV6A 2IU6A 3E35A 3PG5A 4RTKA 3ZU7B 3WLSA 4ZZ0A 1N4DA 3O3CA 2IX3A 3ZU6A 1D5WA 1NU8A 3LCCA 4NCKA 3RYCA 3DE3X 4U4AA 5JXWA 4H7FA 4M1EA 2I1KA 3R0ZA 2ALJA 3M34A 4RADA 2DR3A 3SPXA 2I3ZA 4L4ZA 5DNVA 4GL4A 5TSDA 1JDBB 1H2WA 1WCWA 1TYEB 5AKXA 5F3DA 2FDRA 4DI3A 4QD3A 4PXSA 3OCUA 3I1FA 3KG2A 2X0EA 3WGTA 4AZ0A 1M6HA 2IA5A 4JEMA 4C06A 3PT9A 4U63A 4B73A 2GN8A 2WPNA 2X3YA 3WI7A 2HMTA 3PKJA 1BTOA 4FGLA 4TWZA 1U0GA 3KO8A 5D3MB 1ZIXA 2I8LA 3D1JA 3DBLB 3EZXA 3MWJA 1K2WA 4QHSA 4RHEA 5E8RA 3RWBA 3Q6IA 3RLFA 1G63A 1Z3CA 3U7JA 3TX2A 4B5KA 2NXCA 3C4QA 4FGUA 1FSPA 1YL5A 4JWTA 3C8MA 1UOPA 1Z2OX 3P2EA 2YJGA 4TT3A 2QRPA 1R0RE 3PUWA 5FBHA 3ZE2B 5A4DA 1HDOA 4CF4A 2FKNA 1NBMD 2VQDA 3C45A 3RIEA 4UNRA 4KBQA 4ESHA 4WY2A 2ERXA 2Q8QA 1HI9A 3FSJX 4K9LA 3ZDQA 3RS0A 2XB9A 3CWQA 4L74A 1H3FA 2D6FA 2AVNA 3A37A 4RSRA 3TQIA 5BRNA 4M6WB 4CV1A 3GWGA 3OIFA 4BKRA 2P77A 3L7LA 4I1IA 4U0JA 1E0JA 1WKBA 5CGZA 3W2GA 1X8XA 5FQ7A 1VI5A 2ID7A 3EZYA 3SNKA 2JK1A 3H1PA 3MBKA 4P3KA 3U4GA 5K0SA 2CDRA 3BWDD 1XD2B 2R6HA 3NEPX 3FW1A 2KE5A 2W6QA 4MCAA 3SHTA 2D1YA 2P6UA 4KFUA 3IIJA 1VIYA 3EDMA 5GAJA 1C1HA 2WJHA 4PPNA 1GQSA 2E5WA 3J7TA 3EHDA 5AP9A 2GSWA 3JX9A 1W19A 2VL7A 4Y6PA 5H82A 2FRXA 4X1YA 3HL4A 3QX3A 1H9AA 1M5RA 4KHPB 3MT0A 3Q0TA 4LQCA 1QYMA 3BMXA 1N9GA 1A9TA 1DEHA 3IAFA 3H19A 5JV5A 1E4YA 1NR1A 1ZMXA 1XYGA 1BS9A 2VSQA 3OE5A 2OWDA 1UM9B 1W75A 1PV4A 1Y4DE 3Q8XB 3QSGA 5JNRA 1GZ6A 4RQTA 1HNZB 1PUXA 3DZFA 3SFVA 1R00A 1OLOA 1IRXA 2BEJA 3ORYA 3D8RA 2CG2A 2QD3A 4TLEA 3V4LA 4DGSA 2V7WA 4GC5A 2RD0A 3FA2A 4DBLC 5GTDA 1N3YA 3EC7A 1HG2A 2HXSA 3EASA 1R9JA 4BKUA 3K8QA 4EL0A 5L53A 3BFJA 1I2CA 3CURA 3H42B 1Q11A 1G2QA 4AAYA 1N33B 3DZ8A 1W87A 3VTAA 4CV3A 1E2DA 4OQ4A 3T61A 4WOPA 3CLKA 1PNQA 3GPIA 2JVJA 3OU7A 2CL7X 3COYA 3D6AA 4CL2A 5HK9A 4Z53A 4F1PA 1C0KA 1T9HA 2OFPA 3AS4A 3AZPA 4A2PA 3S2GA 4LBWA 4C0SA 2XCQA 1U80A 2XTNA 1Y98A 5IN4A 2WIBA 4YX9A 3BH0A 1JTFA 3JZDA 5EE9A 5CFOA 1RZUA 2ZAYA 4A1GA 1FPMA 4GYWA 2I3GA 2VDUE 4LVOA 1ELWA 4WERA 1NUQA 1AHHA 2GPWA 1BXKA 3ND5A 3NOXA 2PJRA 3CU5A 1NVBA 3W9BA 1SBIA 1E5XA 2B3TA 4BN0A 1AG9A 3DKKA 3QPCA 1CV2A 1FZQA 1OI3A 4HZUB 2CD9A 2J5BA 4JHKA 1WABA 2R7AA 3ESBA 3D6VA 4EARA 4ZAGA 4D0NA 2D13A 1PR0A 1LLFA 1MF7A 3GT4A 3U1TA 4MV7A 1XD9A 1C14A 2FO7A 2OHXA 1PS0A 4ZAFA 4EEXA 1KYIA 2FZWA 3N71A 1VIVA 5LOVB 3CEQA 4FOPA 3JYLA 4O33A 5DSXA 5ILOA 3UX4A 1IUPA 4IVRA 1FPQA 1NBOA 2JFPA 2Q99A 2Y0EA 2Y0BA 5HYVA 2WEKA 1JEYB 2NNWB 1BWRA 2J0UA 1WRBA 3HI6A 1NUUA 1RP7A 2O1XA 3MS4A 1ZYUA 1WQ4A 4B3JA 2AI2A 5KMGA 1O6GA 3LVBA 2I3DA 3CUYA 1LSSA 3UJNA 3I32A 5EQTA 2Q3MA 3MERA 1BN7A 3UC5A 2PWYA 2RKBA 5CG2A 4HQ0A 4DCUA 1UKYA 2IQCA 2EJVA 2IVZA 3K3PA 1WU8A 3LF2A 1KP2A 3ZC3A 4JI0B 4BJ5A 1AKEA 3HQ4O 3RKRA 4K7JA 3PTZA 1Q21A 3M82A 2R25B 1TEVA 4CDNA 2HMVA 2I1QA 3HNRA 3L0CA 4PS8A 3UFXA 4K9NA 4A9AA 5HOQA 3AI7A 4C5BA 3ZU2A 3DDSA 4RZXA 1L4GA 1N2JA 2QE6A 2V7UA 1DKLA 4IYRA 4R1PA 1NXQA 1WHTA 3EFOB 1WO8A 3GV0A 3GLKA 1RQ2A 2NO7A 3IEUA 4HDAA 3IEVA 2ROQA 2HK8A 3PJGA 1PYOA 1VCHA 4I4CA 3NHPA 4BE4A 1YB7A 2JA2A 4JFRA 4J1QA 5FTPA 1P2SA 4UBNA 4I55F 4MIOA 3U19A 2VDQB 2W6MA 1I7SB 1HF8A 221PA 1MRNA 2PTHA 4URWR 1CYEA 4X8LA 3ER6A 1H22A 1RACA 4Q0MA 2ZYTX 5EP2A 3CV0A 3IE0A 1E1RA 4L0DA 1QWSA 1ADJA 3QRWA 2PN1A 3LHIA 5CEJA 4Z7OB 4JBXA 3R7SA 3F78A 1T2FA 2REOA 3LLVA 4BJ3A 3KP1A 3LM8A 1G6Q1 2I5PO 2QUHA 3CSDA 1TU0A 3EF1A 4YT4A 1C7IA 1HNXB 1PS9A 4RKFA 1BA3A 1NE2A 3U4HA 3FOEC 1KMIY 4LY9A 2UUCB 2TECE 4WD3A 4ZK6A 4N0PA 4M1MA 2HLDD 4NYMQ 3MMPA 5FZSA 2BFFA 3CEMA 4LRSB 4CQMA 4Y2TA 2DWQA 5FWYB 3IEMA 1UDRA 4DXDA 2A1IA 4X71A 2OG2A 5EYPF 2QQ0A 3K1JA 5K0NA 1ONNA 3I4LA 2WOOA 2ENWA 3VKGA 3SEQA 2G5GX 2QXYA 2YVLA 3GFGA 3RRJA 2PJUA 1PT9A 2IW3A 4WKBA 1XD2A 2A9FA 1IRIA 2Q9BA 4M37A 4B1FA 1QRSA 4F5DA 5BSEA 3UWPA 5CA0A 2GX6A 4DJDC 1JFTA 1IZ0A 2WDPA 3NTUA 3AEQB 5IF3A 3X2QE 2VNKA 1ZN8A 3IVMA 2K2WA 3DVRX 1NKSA 1NNI1 4J2TA 1EFVA 4LRWA 2JH3A 3VR6H 3WL5A 5J4VA 4QUKA 1MC5A 3KDAA 3MW8A 1A71A 3VM6A 1VYHA 4CU2A 4U7WA 4Y18A 2WBLC 3HDYA 3PQFA 2FMHA 4CF6A 2H08A 4QFDA 1MYOA 4V3IA 4WOKA 2NSJA 1H4SA 1GZ5A 1AQIA 1EDBA 1N7IA 1P91A 4HVBA 3IDZA 4I9FA 4MR7B 5DHAA 3LRXA 1IXRC 2JRLA 4KI0A 1OI2A 2H48A 3CGGA 3A1TA 3K5HA 3K4PA 3KAPA 5IJAA 2Q4BA 2NUPA 1AWCB 2QRJA 5D1NA 2NPIA 4V0NA 1P7VA 3DOFA 2HU7A 5SZIA 1GY8A 2GZRA 3A14A 5AVUA 2WAYA 1R0WA 1FQKA 2BFNA 2GJ9A 3OKFA 4IHJA 4BIIA 3M49A 1AGNA 4U39A 1TM7E 4ZT4A 4UTXA 4RQIA 3HN6A 4AY4A 1SC9A 3TZEA 3L06A 4DWJA 5HKKD 5IVKA 2VYVD 1KZ1A 1UKAA 2CVPA 3ZI7A 2BUGA 1A27A 1HPLA 2DUUA 4HI8A 4LK3A 1C8BA 3LDGA 4RKYA 1CZNA 4Q4AA 2W2KA 3K0HA 3WGIA 4MRNA 2NV2B 2BMFA 3WO0A 4RTNA 4QPPA 3N53A 2VZEA 2C7VA 2XEHA 3B1JA 3LOQA 1UBLS 1EXWA 4AYTA 4FI3F 4K9OA 1AHNA 3K7EA 4H3VA 5ES3A 3VR2D 3DC7A 4BOYA 4JQCA 1H0SA 2WA1A 3IXEA 1H2RS 1WS6A 3Q87B 3U31A 3VPGA 1OCZE 1QAOA 3GNTA 1LV8A 3UM1A 2X13A 3M5WA 4B3SB 1P19A 1FMCA 4QEZA 1YB6A 3Q0EA 2ZBFA 1BFUA 4GI7A 4U7EB 1FNBA 4L5BA 4QARA 3GJ6A 4RMJA 2F2TA 2V5UA 3AUYA 3N8GA 4IOKA 1RP1A 2CFIA 2ZTHA 3ML1A 3V1YA 1FCHA 3U4QA 1OWOA 2AC4A 2AFHB 3C6BA 4HQFA 4Y3UA 3KD7A 1O6CA 2EFJA 4Q15A 1QTQA 3P7MA 2QZSA 5KYWA 3RUFA 1AHIA 4JC5A 1E1DA 1P6UA 3TEJA 4EAQA 3R0VA 1XDUA 1TW3A 3UIOC 2QTCA 1AGXA 2PRKA 3IUJA 1YHZA 4I4TF 5BVGB 1BDIA 1V25A 3MTEA 4KCGA 1FLVA 1BEEA 1KA9H 1AT1A 1KBZA 1YR6A 1M1XB 1Y9DA 2OM6A 2WP8J 4EG0A 5FLKA 4ZEXA 3WLKX 1JFFB 1IU9A 5AYVA 1TEXA 2X2PA 3OQVA 2WR8A 3S1AA 4M7CA 3JQEA 4R98A 2PUAA 2HRDA 4MHSA 1Y4SA 2ZSJA 2EERA 4N76A 3TXYA 1ZOLA 4PCAA 2OM2A 2P3QA 1ZICA 1DV1A 1R0BA 1ZFNA 5HKPA 3LQKA 1XGWA 2J30A 4P86A 1X8KA 2ZETA 2E4VA 1E62A 2AHRA 4HK4A 5DLQC 1NP7A 4E22A 4ONEA 3I9OA 1RJFA 4D45A 4E7OA 4NFYA 4MVJA 5C1IA 2DJ5A 4CM7A 1M8JA 3KJQA 1E8YA 1ESCA 1GLVA 1RLMA 4NBKA 4AS1A 1GV1A 2FWMX 3IL2A 4Y0VA 2CK3D 3K70B 3E30A 2EOAA 5BWCA 3HR8A 3TQFA 4EI2A 3AF5A 4B7UA 2R11A 3B12A 3C7KA 3O83A 3JZAA 3PZDA 3BK2A 3FPLA 3VTZA 4A82A 3ZE0B 2UUAB 3OLQA 5EC8A 2JS7A 3R40A 3HKDB 5EKDA 4JA9A 1B6SA 1FUIA 1YB4A 3CCFA 4ZXFA 4US2R 5KZMB 5FFFA 4FHGA 2ZUFA 3NBFA 2IOQA 2ZRIA 3OJLA 2OV4A 4C0AC 4W5OA 2LDBA 4WKNA 1YJQA 2YFQA 2DE0X 3M6UA 4PU0A 3QQPA 5CLHA 3QXCA 3UK1A 2BFPA 1UAGA 2EINE 5A0TA 4DEXA 4CETA 2BFDB 1ORTA 1FUYB 1JQEA 3DLBA 4FFBA 1FFAA 3K32A 5IT5A 4RVUA 1AX9A 2ZSIA 2Q49A 2P41A 5CP8A 5KX5A 1FJXA 4JYAB 5DNEA 1G5RA 2ZJAA 3TLMA 3MSCA 4B75A 3PVCA 3RSCA 5D86A 4RZIA 1WUTA 5HF6A 4YRRA 3Q98A 2QRMA 2QUAA 1Y5IA 5L3RA 3RSGA 5JMWA 1NF2A 1PDVA 1XMVA 3C5EA 1DCMA 1SEVA 2DLNA 1J70A 1Y6RA 3GCXA 3OCCA 2YJ4A 4NAHA 3ZLBA 4HOTA 4NMXB 4NQZA 5JAPA 2O14A 4K3VA 2DF8A 3O3MB 3QG1A 4TMFA 4PLYA 1MX2A 2UZIR 1QFXA 1TJ5A 2HRBA 1GYPA 2P27A 3E1SA 3B7RL 1TFUA 1NVVQ 1X80A 4MYTA 1C3OA 4WMLA 2GXQA 1QF6A 1AXEA 3H5OA 3PI6A 4JT4A 3PQ4A 4FJYA 4IJ5A 3RODA 2XKKA 3H87A 4OLJA 1N0UA 5EP4A 3ZDFA 1B4DA 2OT3B 1V16B 1RFGE 3GJ7A 1D9XA 2YZ2A 2XUHA 3CRNA 3OSZA 2FPLA 1HORA 4LXQA 4RACA 1QWOA 2BM9A 3HJNA 3KEGA 4OXXA 3DTNA 3MTGA 4U8YD 1YS4A 1Q1QA 2B8TA 2PUBA 2QIPA 3KDPA 2A14A 1QBQA 3LHSA 1J39A 1NI1A 3NVAA 2K5UA 1MU0A 2XOKA 3A4IA 3L0OA 2YN4A 4LTNA 5DNWA 3SX0A 5HQJA 1OA1A 5E9WA 1YDEA 2Y1WA 3AB3A 5ILGA 2D4AA 5G2NA 3ZDDA 1NI4A 1L4YA 1TCBA 3KKNA 5INTA 1K6JA 3X2EA 3CHMA 2CVFA 5DOVA 4FYHA 4RU1A 3ABQB 4QU8A 4CM4A 2BPOA 3GGDA 3F8TA 1IKND 4EGQA 3ZQJA 3JS5A 5K8TA 4OM7A 2CMDA 1LC3A 4CL0A 1L0BA 1JIIA 1WLYA 4PH4B 5FUQA 1LY1A 4QRHA 3HKBA 1PR4A 2QL6A 3QBEA 3GJ4A 2D1RA 2NO5A 2VAWA 5T41A 2Q9AA 4WNYA 3APCA 2ZQZA 3PUVA 4C03A 4BQSA 4E07A 1R15A 1W88B 2YV3A 3L40A 3SQVA 3OD1A 1KYVA 2XUPA 4LGMA 4TMXA 4WHMA 3ZK9A 4BO6A 4F4FA 1ZM2A 5AW2A 1Z73A 5HWSA 5F5NA 3Q73A 4CTNA 1BGVA 1JIJA 2AVDA 5DSTA 5K6RA 3GELA 1HQCA 1ZO8A 4EO7A 4YMGA 1J4AA 1M2FA 5D51S 2AKAB 3CNBA 2AN9A 3FYDA 3TG5A 2PZGA 1YJ8A 3HM9A 1H0KA 3APFA 3M9XA 1VGQA 2XWSA 2ZRNA 4UBJA 4LV6A 1VHJA 5JSYA 3RREA 3WWPA 1A9RA 4DHEA 1KI9A 3FTFA 2JAPA 2Z5FA 1L5WA 1PD1A 3O75A 1DG3A 1KQNA 2QR2A 1T8TA 2PD3A 3UW1A 3S70A 3WLIA 4H0FA 3E9DA 3LYHA 1T34A 5DZSA 2EWMA 5EWJB 1BW9B 1SFRA 2BHRA 1FF9A 2G72A 3RAPR 3WP1B 4B31A 4BECA 5F9FA 1IJBA 3N2NA 2ZWMA 1JXOA 2GGFA 4CV0A 3EPJA 4ZDKA 3F49S 4FYWA 1GTRA 4UTZA 4GI3A 2OV1A 5IULC 2VDLB 2P9JA 2F90A 3T7SA 1DIAA 3RKUA 4YJ3B 4HWKA 1K68A 4M0LA 4OM8A 2Q3CA 5C5EA 2DYRE 1TIPA 3KKEA 2NZ2A 2CFTA 3D7NA 3BD6A 2QVGA 1S2LA 4EPRA 4GE0A 8MHTA 4AV7A 5GV8A 1UFQA 3JVEA 2B37A 4ZREA 5I9LA 1YZ3A 4JPSA 3UT0A 5IT9A 4RG6A 2Z6QA 3RS8A 4GM1A 5HS4A 4QRDA 1K8RA 2XEXA 1P6XA 1SBYA 1JAZA 5A1TA 2I3BA 1HQKA 2BM0A 5FL7A 4BWYA 3ITNA 3NHUA 3ZI4A 1KIFA 2OENG 2EBHX 4X97A 2ERYA 2C0QA 2P0AA 2O2JA 1H4VB 3PTLA 2C0MA 3G82C 3UMSA 3F4BA 1S8OA 1TK2A 2AOTB 2OGWA 4XDZA 1OWLA 3C1OA 2H6EA 5BVHA 5FWXB 2YRWA 4CXMA 5FOUA 1GARA 3H4TA 3T5TA 3OTNA 1GUAA 3LJKA 1OYYA 2X9NA 3M70A 4YRNA 1QQBA 3LP8A 4Q1BA 4MPDA 3EZ2A 1YDHA 4R84A 3S5JA 1U65A 1LBTA 2ZGDA 2CXRA 4QUEA 3LTNC 1NFQA 1JWLA 5LJIA 1XZDA 1T6NA 3CEJA 4NOMA 5JFOA 4YAWA 1PFWA 4PX9A 4N7BA 4YRBA 1PYDA 1T2VA 2QG6A 4OGWA 1EFAA 4OYSA 2HXGA 2O54A 2COEA 2ZJ1A 1IXKA 1EUCB 1FJHA 1QHNA 2OXRA 1L5JA 4UJ5A 5CX1B 2WRZA 4Q3NA 3VKFA 3ZXYA 2O52A 4BMSA 2LXMA 5LOVA 3NQPA 4GYYA 3QXJA 2C83A 5C8YF 1KH1A 4XX5A 4QOGA 5TDHA 3WIOA 5BY2A 2XQFA 4OIFA 1S70B 1QS0A 5CAEA 1HDZA 3VYRB 1H0RA 3ASZA 3IUBA 4GNKA 4YH1A 5L9AA 1SHJA 2WKRA 4RL4A 1EB8A 4DYDA 2C2XA 2F3QA 2WTEA 3R0IA 3Q49B 4QU5A 2IUUA 4L8WB 4A0QA 3P0RA 3DSRA 4S1PA 4DQVA 1NYTA 1TGYA 5P8WA 3FMFA 4OYRA 3D9LA 4EZJA 3WMEA 4L75A 4NENB 2PRSA 4KIWA 1URPA 2QNIA 2D2EA 2NSHA 4YP7A 3EOBI 4DNFA 1T0UA 1XRSB 1QQ6A 2XMZA 1G2IA 1AA9A 1REQB 2PQ6A 3BGOS 3BWVA 3MILA 4J0EA 3I04A 4L3VA 1JHOA 1OX4A 1UP6A 4FP9A 4MVJP 5FHRA 2BFOA 1UJMA 1R0XA 2A4MA 4UVIA 4ZOLB 2C03A 4CG0A 5CDSA 3OOYA 4QVKA 1J5PA 5FUXA 4RTLA 2CHWA 3B7TA 4XI0A 1GFIA 1PN3A 1V48A 2REXB 4MQFB 4N1AA 4OHOA 2CFUA 4UI9C 2R8OA 4GICA 3VNAA 5CA1F 3BGVA 5AVYA 4QE3A 3TG2A 4MW5A 5A4AA 4XWTA 4FMCB 1H93A 4HRNA 4DZTA 2I1VB 1ATZA 4WQMA 3AH8A 3JPWA 2JAWA 1JU9A 4M99A 5JH7F 3E15A 1J1IA 4WGFA 1MOZA 3H18A 4ABNA 2JLSA 3EAGA 3CPSA 1PNOA 4AG5A 5IEBA 3TM4A 3V2OA 3FI0A 3U3DA 1UJCA 5JAUA 4AZ3B 4ENPA 3ZS8A 4M8LA 4LKOA 1SCUA 3BQOA 2QN8A 3V3TA 1P31A 3LQYA 5ESWA 1I1HA 5JWHA 1Z56C 4U2DA 4I3HA 5DYGA 4KFTA 1U7UA 4FT4A 2XBUA 3WDLA 4R1NA 4H9GA 4EUKA 2JI8A 2YYYA 3CHSA 4JXJA 5CNMA 5ECWA 5H02A 3X0DA 4HV4A 1SCBA 2CN1A 1ZLYA 4OYLA 5A0VA 2YN0A 2IYFA 1Z07A 3CH7A 1PSDA 4UBMA 3WKDA 2C4MA 3JAWB 4F04A 2VCHA 4Q9HA 2QGFA 5C0OE 4D6PA 3H6HA 1X81A 2NTJA 3GUYA 3FWVA 5EWMA 5HRYA 4CR7A 2J5QA 3EYWA 3D6FA 5FOQA 2OO7A 3VSAA 4YUVA 3EZ9A 2V6FA 4JQYA 5MF6A 1QGDA 1SQSA 4GX1A 4ITVA 1K75A 5E3JA 5B1IA 5K3SA 3SX4A 4XXHA 5LMZA 4IUYA 4UZFA 2OBFA 4LWQA 1TE2A 3DS8A 3NBQA 4LMPA 5C4GB 1QIDA 4GGPA 1OWNA 4C7OB 4Q6BA 2IKSA 5BN3B 5IBQA 1JQDA 3KYBA 3F90A 5AOAA 2G0TA 2GN2A 2FW1A 1NRIA 1XTRA 2XA2A 3CKKA 3E9YA 3NKVA 2PH5A 4GXRA 4NCHA 2C4NA 4R16A 3RK1A 4DARA 1JG2A 5FL7D 3NORA 4IQGA 2H2IA 1KEEA 4RKEA 1VCOA 3E61A 1NX6A 3ROEA 2NP7A 3WE7A 5T67A 1XPOA 3GXBA 5T3YA 1W5BA 2PYDA 1WKCA 1SZ9A 2ASEA 3OMXA 3ESCA 1SXGA 1IHYA 4G6ZA 4LXGA 3RBVA 4JKIA 2GVNA 3HY4A 3DAHA 3Q6MA 1C1XB 1ACLA 3WIBA 2G4VA 2B69A 2L6BA 4R2KA 3N2GA 3EF0A 4XH9B 1ZN2A 3Q2OA 3FDZA 4BPBA 1BPOA 1XAGA 5A05A 5J2TB 4V38A 3ZR4B 1DXYA 2J6HA 2IY7A 1OUVA 1NVGA 2BZ0A 3L7YA 3DONA 1S3GA 3BVPA 3EXEA 3PQ8A 4B3GA 3ZCUA 4ZHBA 3KAQA 1JLMA 1M2WA 2FA9A 4GVXA 4JBIA 4JHXA 5JSFA 2GERA 2YQ8A 4PYJA 1GPLA 4OVUA 1DJQA 2A0WA 3BMCB 4PS7A 5IM4F 4H6PA 3MT9A 1UMCB 5HDQA 3FUTA 2GLTA 3PQ3A 2HTFA 2IY9A 3JASB 4ZYXA 5CT9A 5DHUA 2WNSA 1IOZA 1QB7A 4QUDA 4ZZ3A 1JA1A 3UTCA 5KYWB 2JCVA 3MGGA 4IJVA 3OF2A 3WGLA 1M0SA 4WZAB 3FFAA 5I6DA 2AUMA 3TQCA 4DV0B 3QKIA 2WFLB 4IGEA 4NTZA 2Z98A 1CQZA 2WSLA 3FUVA 3QJYA 2VH5R 3HS3A 1V41E 2BD0A 4MEBA 2IUYA 4Q4JA 3B5IA 3UJ3X 4UNNA 3ASGA 5KDOA 3EQ9A 1EJBA 5FBKA 1M6YA 4AVXA 4PSKA 1NA3A 4WN3A 3ZCXA 1CRWG 2PM8A 4YECA 2JFGA 1DX9A 3IV6A 3HYCA 4B94A 3QWIA 5BNTA 3TEMA 2KBEA 4RA6B 2QZPA 1EF1C 1JR4A 2I9KA 1VCMA 3HNPA 4GBGA 1GUBA 2VCYA 2VBGA 2Z2IA 2PMFA 3EMKA 2A5EA 1N4SA 3KPUA 4XM1A 2OXFA 1LW7A 4A26A 4E08A 1Z26A 2ZG6A 2RGXA 2HU8A 5B1HA 4AURA 4KVAA 3ABZA 3M1IA 4CW7A 1ZW1A 5IK2D 5CYGA 3IP8A 1GRVA 3D9HA 5AKLA 2QI9C 3SZ7A 1PHPA 1M0TA 3DD5A 5T7BA 5EMJA 1ABFA 1W93A 1AMUA 1RE1A 1L4MA 2H18A 3ESAA 3U7QB 3BIXA 4YCMA 1U6KA 1TM1E 4HLQB 2HADA 4R8LA 5EWLB 1JB1A 1J49A 1PQ4A 4FEEA 4PW0A 2X0DA 4H16A 4WA7A 3ZWXA 3JWJA 4XASA 3N58A 4B2YA 2A5YB 2FUNB 3B9RA 3C7CB 3DE0X 3TLBA 2XUZA 3WB0A 2P2SA 2B5WA 5A23A 1ZESA 1G20E 2FG7C 1YBMA 5A6SA 1ISMA 4XTCS 2RGAA 5E6UA 4BX3A 5L3SB 1CUDA 4LYFA 1VPWA 3UT7A 3H13A 4WI1A 1V9LA 3EIQC 2G70A 3CF4G 3D7SA 4GFDA 4MWSA 4PYRA 3EXFB 5AIAA 5G41A 1X9HA 4QAJA 2O8CA 2KS6A 3SOZA 1FSFA 2DFDA 3V1UA 1U6IA 5T6MA 1OH5A 2FGJA 5CYFA 3Q15A 1XU4A 5G04J 2DPHA 2EZ4A 2FWIA 2QYHA 2YZKA 1DIGA 2SBTA 4Z7NB 3ZIAA 2G40A 1OF1A 1PGOA 1W7AA 3N2YA 3RVKA 4OFWA 5IDWA 2NVUA 1JDBC 3DULA 4DJ5X 1BHQ1 4GO1A 2ODAA 1MIHA 4KSYA 4XSVA 3NHWA 3CW9A 3QU9A 4U5XA 3PL1A 3ZV4A 3WGVA 1TCCA 3NUZA 1WZNA 1XZJA 2YL2A 4O08A 3NAZA 2FRDC 2OOKA 3EUEA 2PNJA 2OPHA 1R37A 1XCJA 3D4LA 3I9MA 3JAWA 3P27A 2FN4A 1VL6A 3QENA 1S63A 3WHIA 4KXWA 4M0CA 3WLPA 3K96A 4ZXPA 2BHSA 3BE8A 4BO2A 2UY1A 4JJGA 4MR9B 2IP4A 3SLRA 2IZ7A 1YCDA 1PZEA 4N82A 5AESA 4RTRA 4D43A 5FV4A 4Y2HA 3PNYA 1NVFA 1M7GA 2CSUA 2O8BB 3LJ3A 3GR6A 3C3BA 4R5HA 4LVUA 1HY3A 1ETUA 3VNRA 2CKMA 2JFWA 3FSGD 5BR7A 3EZFA 2C7PA 3K35A 3COVA 4INZA 2FZKA 4XGKA 5B58C 2XGJA 3KJHA 4TYQA 3T7CA 4L8YA 4PONA 2FX3A 1CIPA 1TQ4A 2ZYIA 2XIJA 1HDXA 4EGFA 1USGA 4ZHSA 4BFRA 5M5BA 4ZO7A 4NYIQ 1NLUA 3LDAA 3HJGA 521PA 4BT9A 4JGIA 4AY3A 4XVUA 4QRIA 4PS3A 1PGJA 4TKLA 5EGNA 4L85A 5JBQA 3VC1A 3T9AA 3S7FA 1O8BA 2A86A 4W8OA 2J0SA 1LLQA 5EVCA 4CMKA 5EN5D 1MO2A 4HXYA 1MEJA 1PUJA 5EUBA 3LKBA 5K5EA 2QN9A 2P9KG 2OV3A 4PZAA 4KXUA 3E8MA 1JHRA 4FJ1A 4W7IA 5BSKA 3ONLA 5JQWA 3IFSA 3ASUA 1C80A 3PFFA 4H7XA 2HA4A 2NTNA 1CUWA 1E6MA 1W0JD 3OJEA 3TQHA 2H5EA 1PW7A 5A3VA 1KORA 2AW3A 4CMCA 1OT5A 2V0CA 3HJAA 4JSYA 2QD2A 1CHDA 1FP2A 2HEIA 3WHKA 5BOSB 4UHFA 2VQ2A 4Y2YA 1KAMA 2FO1E 5DTQA 5ANRB 2VYIA 1LSUA 4XUDA 1TAGA 3JR3A 1XTKA 4AZWA 4XIGS 2F64A 5ARFA 4U8GA 1DRWA 3DTVA 1DTWA 4G0NA 2E6KA 2D5IA 4WZAA 1BYUA 2W6OA 3HRIA 3N59A 1AK1A 3ER8A 3DNPA 3RQSA 4BNTA 1SBHA 4JLBA 1A76A 1WV0A 1DFIA 4A91A 2WYVA 3O8NA 3TPFA 4EJFA 1NN5A 2V7EA 3FPHA 4D8UA 1MVOA 3R7LA 5GONB 2IYRA 2GEJA 5BO5A 1R6VA 4V0OA 3WLOA 1ZCAA 5BT9A 3U16A 1U28C 5AW4A 4L23A 3RS2A 4IDFA 1EDUA 3ZTWA 5CB6A 4U7FA 1CUBA 2Q6VA 5KIAA 4V24A 3ZXUB 4F4HA 1DCQA 1C9DB 3UXEA 2C7GA 5EIXA 1XMIA 1WXHA 4ZZ1A 1XCBA 2GFIA 1XMPA 5IUKC 4ZMRA 5GVSA 1OT8A 2F17A 3L1KA 4Q3KA 4IWNA 1BCSA 1U2DA 4EUNA 3UJHA 3REQA 5MGBA 3KQHA 3RFXA 1RRFA 3OOEA 3GCDA 5BN5B 3OCYA 3RVPA 4C05A 3ROPA 1XTQA 1Y3DE 1RYMA 2X8WA 1I10A 1XWWA 2GCOA 4GLBA 4LS3A 4QTUB 1I7LA 3DHVA 5KKNB 3GOQA 4TQ9A 3VR4A 3ZN2A 4FIZA 2Z5GA 1V5FA 3TIFA 1YRYE 1XCGB 2GN4A 1XTZA 1T5SA 3PGJA 4WPGA 4Y7CA 4EM6A 1VHTA 3EVTA 4HB2A 4XKJA 3LP5A 4ZQCB 1C4OA 1HGXA 4FSDA 3OJWA 2RGDA 3NG1A 4R51A 5K3EA 1B6RA 4DUZB 3R3VA 3T9BA 4YASA 4BE9A 1PQPA 3VC7A 3GHYA 3LFHA 4K81B 3UNXA 1CUZA 3KUXA 4GAEA 1XA3A 2FSHA 4M4SA 1E6LA 3JALA 4LI0A 5EOVA 3JUEA 2BWJA 5CRUA 2XQGA 2ETXA 1US8B 2BJVA 3OZEA 4R8VA 4KE8A 4TX1A 5FOVA 3E2MA 3TD2A 5KWSA 1X7XA 3KCNA 5JTUA 3BQNB 1AH2A 1L5ZA 1Q0HA 1TC1A 1C30A 2WIAA 1MHPA 3FU5A 1FXUA 1I6WA 1E60A 2CFSA 2WUGA 1N3BA 1R1DA 2BEVA 3GW8A 4X8OA 1V5EA 3IUYA 3IUQA 1XWFA 3RTAA 1NXTA 3FTEA 4RW0A 1EXVA 1Z5NA 4QU0A 1JLLA 4IIYA 4L28A 1HK7A 2X5OA 3PE4A 3GH1A 3JD4A 3TI7A 4PIVA 5HKAA 1DBWA 2CF6A 3OAAA 1UOQA 5MDHA 1YE5A 4F6RA 2C96A 4BNMA 4IRUB 3D54D 2ZYGA 1CXZA 4TS9A 1UWVA 3II6X 3GLRA 2MIIA 4ZODA 3SEAA 5JANA 3MCVA 1DOZA 3FNFA 4TUYA 1TADA 3OZ7A 3W5HA 2QP3A 1OBCA 1U2ZA 2XE8A 3P0JA 4M53A 2FV8A 5AVRA 5JAIA 2JF0A 4FR0A 4B76A 2GCGA 4M2LA 3B1VA 3BE5A 3GN1A 3OP1A 3QUCA 3KSQA 4TVBA 4LZPA 3LXRA 3W2TA 4CM8B 4OSOA 3JW8A 2PKXA 2V5VA 3CHRA 1JR3E 1BWQA 2NZVG 4RZHA 1XB2A 3FMPB 3ZHQA 5EA2A 2FR8A 4NESA 1U2PA 3D5TA 2XYPA 1YSCA 1H9BA 2QTVA 1XQ9A 4QXQA 2WK1A 3I04M 2VPXA 1Q6ZA 1IOWA 4LMRA 4RHUA 1IN7A 3THYB 3KVRA 3AP1A 3NP9A 2HA3A 2J4CA 1JNYA 4IHJB 2YRFA 3VX3A 3E4BA 2YFYA 3JQQA 4MS1A 1P29A 3FU0A 3O8DA 3UGQA 4YMVA 1FFXA 1VE3A 3B20A 3AYXB 4NULA 4R8RA 5AHWA 2XKJE 3L93A 3ZPXA 3LKDA 3WYCA 4Z4EA 5TQ2A 4URYR 4G37A 3AKZA 4ER5A 1SKYB 4UU0A 1S0PA 1PV2A 2UVPA 3WDSA 4CG2A 3TVDA 1GFWA 2R8BA 2Q0XA 2CXOA 1QO9A 2QQEA 1W25A 2QVYX 1N2CE 4E09A 3V9AA 3ZIAD 3R7QA 3OFND 5GGYA 4DM4A 3MTJA 4FBGA 1GGHA 1QH9A 3QF7A 2XYRA 4RGYA 4BQQA 5ESXA 4KQWA 3SFYA 3AR5A 5ARBA 3HUFA 1MBZA 3E23A 2V7QD 3PUYA 2ZT5A 3H6KA 4QQKA 3T12A 3UIPC 4ZYYA 3OLZA 4OQZA 5LQNA 3NZEA 2XW6A 1SG0A 5AVTA 3PQEA 2JCBA 5LZ4A 3GJXC 1EZZA 3L2OB 4Q16A 1ISHA 3PFBA 1D5CA 1JXMA 1CR2A 4FHEA 2J3IA 5AVSA 1JQ3A 1O96A 2NU7B 2YZGA 4IY1A 2AS0A 4PZDA 4REQA 2BEKA 4PO1A 2LXNA 3D0RA 3FPCA 2CXPA 4U7PB 2CF5A 3S7BA 3T9FA 2FPGA 3V1TC 1NIPA 2Z3WA 3DBHB 2WMDA 5CFPA 1SA5A 1Z4OA 3GEDA 3H6GA 4FBLA 4N6GA 4UE3S 3UV3A 5ALDA 2IO2C 1MW8X 1XTIA 1J97A 1RJGA 1W5EA 2ONZA 2VHXA 3DKIA 4K8RB 3B6EA 4MDEA 1IYGA 4QFCA 2C7OA 3EWAA 4R8KA 2JGLA 4FNGA 1CEQA 1I30A 1PEYA 4IR7A 1FDIA 5C1PA 4YAEA 2V7GA 2V5AA 5EWMB 2ZCUA 4ND6A 4TWAA 1QV9A 5EPUA 1E9BA 1K3TA 3K2BA 3Q72A 1U0NA 1PLLA 1N57A 4MWTA 5A7DB 1JLHA 3NT5A 5DBHX 1PVOA 1L4NA 1NLZA 3U5TA 4MRMB 2YWFA 3C3JA 1V9SA 3ORHA 1IJEA 3IHTA 2YC4C 2NZYA 4RZ3A 3TLXA 2FPIB 2LSVA 1U3GA 1V1RB 3BTOA 4Y9UA 3CG4A 3Q40A 4OAUC 3GIWA 5A6VA 4O0MA 2AQ8A 5DXJA 3FTUA 4Z8XA 1F7VA 4Z4IA 2IPXA 4RCZA 1MJFA 4DNQA 2Z6VA 5KOHB 2IQIA 1Q92A 2WT9A 4HDKB 4TT8A 1D8DA 2ILTA 2BR4A 2KZTB 1YV9A 1ZIOA 1H65A 3F6QA 5I48A 1IPFA 1U5AA 3ZKWA 1R8QA 2QW1A 1OXJA 1E3WB 4QG3A 1D1QA 4W5QA 2RFMA 5KO2A 1C7QA 2P9QA 3A1FA 5CW1A 4AP5A 2ETVA 3WTCA 3KDSE 1MX1A 1XLTC 1V96A 3P9ZA 2QY6A 3M9WA 2RI1A 4KN5A 1DAKA 3R2JA 1PTJA 1I6MA 5EMLA 4OK5A 1Z74A 2R00C 3AL0C 1K8KG 2QVZX 1B0UA 3IGFA 2Y6VA 1LEHA 5JR3A 1FX1A 1NMEA 4UHKA 1GA1A 4WNIA 3VAYA 2QAGB 3MOIA 1ZWLA 3D4NA 1C7FA 1VL1A 1Z9BA 1L7BA 4QTYA 3P5BA 2ODBA 5CDTA 2P6RA 4Q18A 1F3LA 3D9KA 3LUGA 4B8YA 4ML3A 3QVSA 3U7FB 4MYSA 1L8QA 4IMPA 4FCCA 4QU9A 3ULEG 3QNKA 1KRHA 5BUZA 3TCNA 1IN1A 3U7IA 2QZZA 2GRPB 4R3NA 2CLKB 3SSAA 2FW8A 2PMKA 1P9LA 3L22A 3A1DA 4OEHA 4C2BA 1NXWA 2JLZA 2GZ2A 2ZJYA 4NFSA 5J5CA 5T4EA 5A62A 5KVVA 2ZRKA 1XZEA 3X1XA 2Q3JA 3T9KA 2PDAA 1YQEA 5B3SE 1I1OA 4OHKA 1SUAA 1EMDA 4B46A 1U98A 4LXYA 1WP4A 4CQJA 3OO0A 1THTA 4YB8A 5CFZA 1E4EB 1HO3A 1N5IA 2O1EA 3ORQA 1YMVA 4OXRA 2BFBB 3RRNA 1BJTA 2BTQB 4XJVA 4Z2YA 3OEED 4TKZA 3RS4A 2AFIB 3E9QA 2J09A 3T0IA 3TG8A 2WYOA 4YT8A 3FYTA 5HBRA 4NDZA 1G20B 4WVLA 1SHLA 4URVR 4LOAA 1LDMA 4TLMB 6REQB 1ZH4A 2Y92A 1EAMA 4H15A 2BMVA 3A4VA 4JP8A 3I4CA 1MQSA 1RPJA 3GGSA 4II2A 4UPEA 3T5AA 5EJFA 3VKVA 2E85A 4MS1B 3OU2A 3UW3A 5LZ2A 4GVPA 1QP8A 1N4PA 2EQAA 3AY3A 4I7EA 1NP6A 3ZDXB 4EATA 5HS6A 3PRKE 3HTXA 3MGBA 3RC3A 2P4UA 4GX2A 4X90A 1OIWA 4OP3A 4A23A 4J1NA 4WLEA 5ALEA 4ZYWA 1SIOA 3FNRA 5FO1A 4I99A 2XMPA 4UCFA 4Q3LA 4KEAA 4MW9A 1M66A 3WL4A 2ZITA 4XCQA 5IJ9A 3T7TA 4KSBA 4YDWA 2W2TA 1ECBA 1MOQA 3ZXSA 1PR3A 2OMEA 4DM7A 2R2LA 1VE7A 2RHHA 3K9HA 2D0PB 1PT8A 4KK3A 5F78A 4GR4A 4XFKA 4BFUA 5K8IA 4WXPA 1RMTA 3DZJA 4NIKA 1QH8B 2ZEJA 2PZ8A 2XCCA 5G1OA 1Q2ZA 3JSAA 4MPJA 2H6FA 1U2SA 4UREA 1GSOA 1IAVA 2I55A 2L82A 5HG0A 2YYZA 2ZBUA 3G0DA 4AVYA 3E37A 3VHQA 4EJSB 1OAAA 5B37A 3DDOA 1EDDA 3QHAA 4GP9A 1L7MA 3AS8A 4J90A 4RVFA 3OU6A 2XMCA 1Z4QA 4RF5A 4Y67A 3ZQUA 1GVHA 1VJ0A 2K7FA 6CHYA 1XTVA 4TSRA 1OMOA 3ONWA 4WACA 1F06A 1RYZA 1T15A 4AP6A 3ZWVA 4RWEA 2X6JA 2CCJA 3BXOA 4LYGA 4O2RA 3V8BA 2QVXX 5HIMA 2VTVA 1SOWA 2D7DA 1YVEI 3PZBA 4XGNA 2B1JA 2HB6A 1VLLA 2ZR0A 4Y30A 2D8MA 2QTTA 5T3RA 1MVNA 1RWWA 1JFVA 1OA0A 2ZWVA 3G5AA 3I9V1 3R77A 5D7BA 3WMGA 3CVYA 4GSYA 3ZZNA 1G9SA 5THXA 5JD4A 3W5AA 2XNDA 1DDGA 3FFTA 5KYNA 2ORED 1PO7A 3ICVA 4MR9A 1KOLA 2G6TA 1UC4B 2IDJA 4RH1A 3ZDEA 2OORC 4RIEA 2XAUA 3NHKA 3Q4GA 2OQRA 3C1UA 1N6PA 2BLLA 2OAP1 2RC6A 1Z13A 2GZ3A 4M3NA 3DWFA 4HDMB 5TV2A 4ME2A 1Z4IA 4RAOA 1WSDA 4ITRC 4U9UA 1WDMA 3G2VA 1D0IA 3HHPA 4QO8A 4FB5A 3OCVA 1DI0A 5JJLA 3AILA 3ZYCA 2O7VA 4KQJA 3EXG1 4U2GA 2C9ZA 5E7JA 3C6ZA 3U9SA 4PSUA 5IAGA 4UZSA 1BWPA 4M22A 1Y82A 1Z08A 3LX5A 4PN3A 1IG0A 3GZTB 3QU4A 4ZHQF 1IWPB 3KSRA 3VPBA 1LBEA 3FSEA 4ZO6A 3ZD9A 4D8WA 5BMVB 4PV7A 3QVKA 2R1TA 1X2EA 1BXGA 1S2IA 2XUJA 3OLXA 4MIEA 2D5LA 4UKDA 1C9KA 4DX1A 3OZGA 5FA8A 1YZHA 2NG1A 1JS1X 1MH9A 2HLNA 1IM2A 4JEHA 3QPDA 4B43A 1DKOA 1RW2A 4GPZA 3ENZA 1V5WA 2UXDB 2IU4A 4H17A 1RXEA 3MN1A 4BGEA 2GBLC 1UP4A 3L7MA 2VNHA 4HAWA 4J6FA 5ICGA 1CUVA 1RTKA 5AARA 3Q8LA 2XPZA 1VYTA 3HBAA 1KP3A 1VCIA 2Y66A 1CNEA 3RU7A 2PXXA 1TNBA 3GVCA 4M86A 1E7QA 5A4KA 4MX8A 4FD3A 1QG0A 2ACKA 3GYZA 2JW5A 4HZGA 2PGNA 3CA8A 2OOEA 4IH1A 2QM7A 4OOFA 5EEHA 5C1DA 2NUAB 4AYWA 3GMIA 1P18A 1PZMA 4MKXA 5D5QA 1IBMB 1JR6A 2QM0A 5SV2A 1CUCA 4CPDA 9ABPA 2A9KA 1HS6A 4H18A 1DC5A 3A6HA 4BFVA 2OV8A 3AEUB 4LE2A 4YLGA 4DJTA 1U1GA 4IX9A 3LLCA 2L69A 1A7AA 4FDLA 4RM2A 2HU2A 3DDUA 3MYYA 4AY5A 4UTOA 2PV0A 5CAEB 2OCYC 3VVBA 1E1YA 2I6TA 2DERA 1KSFX 3IRUA 1VECA 2OWEA 5EPEA 5FPYA 2D62A 3C7DB 3LK7A 5ECYA 5FV7A 1Y7HA 3H99A 1GQYA 3A6EA 3L0ZA 4X3PA 4KFRA 3IEPA 1Q15A 4X61A 3G2SA 4KOEC 4AB1A 2PE5A 4BNYA 3KL2A 4IDEA 5CU7A 5E9AA 5B6IA 1PNRA 3BXFA 1CE8A 1DKNA 2I2CA 4BLOA 4BERA 3CJQA 4WXRA 3RO7A 1NW3A 3BREA 4F2PA 3GPLA 3VKUA 3D6NB 2WM9B 3LRTA 1QHIA 1XVVA 3QBVA 2FJPA 4GEKA 3TFQA 1XNRB 1P44A 3QW2A 3TJZA 5JCZA 4C4AA 4F72A 2IZOA 3PTAA 1LQUA 2DLDA 2F8YA 3HVIA 3GPBA 4J0DA 5DN9A 3RC1A 4M38A 4AZ0B 4D74A 4DEVA 3EXHB 4LHEA 4EG3A 3DXZA 1NJ2A 5CXXA 3AM4A 1W4LA 3JWHA 4GPIB 1A5TA 1OXMA 3WSVA 1X7HA 1OYVA 4QX6A 4KE7A 1UXHA 121PA 4MUYA 4UBKA 3IPCA 2W83A 5B7PA 4X8QA 1DDIA 4FYKA 3ZCPA 1VIAA 2XB6A 3IBCA 4N9WA 3RG8A 4ENRA 3GEPA 5FH9A 5I47A 1NOIA 1NQVA 3SF4A 3O8BA 1O0BA 4GX5A 1JG4A 3FUKA 5KTTA 2IPAB 3A9WA 1HE8A 4LA4A 1DARA 1NI3A 4PO8A 4B7CA 2B7CA 3DBRB 1N3IA 2SNIE 2FE4A 2J9YB 1C30B 3KZ1E 3DA8A 4PINA 3GRVA 3AF1A 3ULKA 3BZUA 3JQ8A 4CN8A 1KGDA 2UV8A 4Y6CA 3EG9A 1P0FA 1ZH6A 1UMDB 1KEWA 3DEAA 3J5QB 1GRRA 1O1TA 3KE8A 3KOYA 3KWLA 4RPHA 4YMTA 4C7XA 3FGPA 1MABB 5AQ9A 2Y1EA 4YEDA 4GDFA 3LW7A 3WFIA 4C4OA 2Z8XA 1EUDA 4URZR 2GT1A 3CLSC 1B42A 4D8TA 3RU3A 3VQTA 1TTHA 5JI2E 2VDRB 2ZUSA 1ZJZA 2EL7A 3IT0A 5M72A 1Y89A 3W8DA 1DTSA 2I67A 3K09C 3T7IA 5AJYA 2RE8A 2NZXA 2JLVA 1UXGA 1N78A 3N9IA 4X1YB 5FFNA 2W42A 2ZUCA 3MA0A 4LRUA 5CJPA 3SQWA 3MJSA 2BMJA 3MMSA 3AJRA 3VLEA 3A32A 2R05A 2IODA 3NW9A 4HN4B 5CVEA 3QOYA 4OQMA 3KPYA 4LOJA 2GEDA 1F6DA 3I12A 1INZA 1N1MA 1PJQA 4PRZA 3QKWA 4LFBB 2CCKA 3WKEA 2F8XK 3DAOA 4JLMA 1GPUA 4GECA 3WHLA 1HTWA 1R6TA 5FBLB 3SDZA 4JELA 4DDUA 4PQEA 3H84A 1D6SA 1EFUA 2PQRA 2VPWA 2Z0MA 4FKBA 4CEHB 3F5DA 5AKZA 3THYA 1ILWA 1R0ZA 2F0YA 2H9AA 4OBBA 5AHXA 4BUZA 5T8KA 1NUPA 1P8AA 2AR7A 3FNHA 1TUGA 5DO9A 3STYA 2CUKA 2QW0X 1WCV1 2GDJA 2ZJ4A 1YJ5A 1VOTA 4C7MA 4Y6LA 5DXFA 5TQ2B 2AE1A 1IBLB 3PV0A 1G4HA 4GXQA 2LPMA 4B89A 3FRJA 2BKLA 3AVUA 3OTOB 1JQ5A 3LY7A 4TS4A 4TTSA 3ZI0A 3FTPA 1JQBA 4YV2A 1TJYA 5JECA 3V30A 1R0KA 1Y6ZA 4A36A 3UENA 2Z4SA 3CV3A 4GE3A 3KEAA 4HQNA 4ZKDA 3JQCA 3WBKA 4LGYA 1CY0A 5LUBA 5AYWD 1P80A 1SZCA 4UAVA 3U4CA 3MRTA 1H0HA 3EEYA 2PA3A 2EQBA 4NOLA 5LA6F 2UU9B 1SO8A 1U9IC 3V2XA 3L4BC 5JCOC 3OEHD 3F6PA 1A9OA 3WAJA 2DFTA 1M2KA 1MKYA 2NVWA 2V1XA 4Z3DA 2WKPA 4E5MA 2QYSA 1QKJA 2YJTD 3A6DA 1GSHA 3AXSA 3KEFA 2NSZA 1GQRA 4R5MA 3QOFA 5HIKA 2CVHA 4C04A 2PXCA 3IE2A 2QFCA 3A6ZA 4OQLA 3OZFA 1L3BA 3AK4A 4UI9J 3U3KA 2EF0A 3IURA 5I7VA 5JJIA 3FEXA 5C7YA 4YUYA 4ATGA 4Q9DA 2EFDB 1VDZA 1V1MB 2JIOA 4Q9KA 1HBJA 2IXTA 3HFGA 1CCWA 1QDEA 1P4JA 2HIGA 4L50A 2XQIA 3J5PA 4J76A 4MOWA 3QK0A 2I62A 1PUIA 3UQZA 3OO1A 4Q47A 1H6OA 3FU3A 3HVKA 5JATA 3RANA 1LK0A 1VLVA 1VJ5A 3AVWA 1JEOA 3A05A 3FH8A 5H83A 4GMRA 1EDEA 1H66A 1NMQA 1OIXA 1VSTA 3MJCA 4P33A 4RSHA 3KJGA 4EMSA 3OFJA 5KWJA 4ZHQB 1KRXA 2FOXA 1F17A 2ATVA 3N2EA 4MA0A 1TKCA 5DCUA 2QZJA 2XPCA 4KWHA 1KT0A 1J20A 2I7VA 1QYDA 2JGFA 2VUHB 4MRMA 1XCLA 1Q7EA 1Y3CE 1XVUA 3TLEA 4EHJA 3H04A 1L5NA 5JBIA 4QGBA 4B3FX 4PFQA 1P5HA 3QC1A 1XZNA 2IK8A 4P5EA 2VRCA 5CFRA 3I23A 1AKVA 2CVZA 5BT1A 1JQKA 4IULA 2DUWA 1AKNA 3DCNA 4RJLA 3RM3A 2IF0A 2OHFA 4MV4A 3VR6D 2I6GA 5CLIA 5EIDA 4OLFA 4G1MB 2CUZA 4LHSA 2G4CA 5FTKA 1XT6A 3ASHA 1KHTA 1P7YA 1QFSA 2VEOA 4WEQA 5EWLA 2Q9UA 1JSRA 2E0IA 4H08A 4H0CA 4RKWA 1PJ3A 3EG5A 3K72B 4X6YA 3ZUGA 4MW4A 4FXOA 3S8YA 3H1FA 1R8XA 3DXFA 3NIGB 4BTBA 3TUIC 5L51A 3UQ3A 5LQSA 5EESA 3SZLA 2JFVA 1NA5A 2EJCA 1OZFA 4CKXA 3C3OA 2BFCA 2ZYVX 3I34X 3DW1X 4D98A 4KITB 4DR2B 2G17A 4IFBA 2PMBA 4FDAA 3C2QA 1ZMOA 2NU8A 5T57A 3AERA 2OVBA 3RSQA 3B95A 3CK8A 4AD8A 2RBGA 3AJDA 3QPAA 3RYFB 5MFPA 1VHQA 2QTGA 1PE0A 3C3XA 5TB5A 1WMSA 4O4HF 3BG0B 1EI9A 1Q20A 2GYWA 3T06B 2IJGX 2ZXUA 1MMFB 3FZGA 1E5QA 2M1ZA 3LZ6A 1UMDA 1TRHA 2CHVA 4EBAA 2ZRHA 3UWOA 2VTDA 4RE5A 1ZCJA 2EKBA 2IC5A 2QRHA 3SHFA 1AIPA 1PLJA 4FIDA 3R5TA 4TRMA 5J59A 4DIKA 1T3LA 1VMKA 3SJUA 3HU1A 5ENNA 2RGGA 2D1SA 3BA6A 5IZ4A 3W7BA 4DR5B 2VRWA 3TO5A 1R6BX 1Z0SA 2C98A 4RH0A 5ENOD 3K94A 2Q1SA 4ZVMA 2FFQA 4LRQA 3JXJA 3GBSA 4OREX 5KTPA 4JYZA 3X43A 3CZAA 1EFVB 1I6KA 5IXSA 4F7WA 5FUWA 3BKXA 1L6RA 2VP5A 3TR0A 4KXQA 1U04A 4X60A 1S2MA 1HMPA 1POXA 1XDGA 2VC2B 3JQ9C 1R6XA 1WBBA 1DQSA 5C5CA 3L7KA 1TQDA 4C0LA 4TMTA 4RVHA 3TWWA 2Q3EA 1GKYA 1UM8A 3EXHC 2DB3A 2CHXA 1T9GR 5K99A 1DBPA 3OOWA 2HK9A 5HM6A 1QCZA 3WWCA 5LR6A 1P1HA 3U13A 1Q7TA 3F3KA 4Q6WA 2ZRPA 1ZM3A 2NYRA 3ANTA 4IG4A 4C76A 3DT8A 4AP2A 5BMVF 5G1PA 4H7YA 1J7KA 1OXSC 1JKXA 4P53A 5TT0A 5KB3A 1QVZA 2QMQA 1WBJB 2YXDA 3U17A 4BBZA 4Y0NA 5ECDA 2DHCA 3HVHA 2Z04A 3H17A 4YO7A 1I3NA 5C31A 1O54A 1UODA 4EKIA 2FETA 3K2EA 2GAAA 1BE8A 3I6YA 1N2OA 2B4QA 2PVPA 3B36A 3V7YA 1NLMA 1OV6A 2X3MA 2D7CA 4X3CA 1AV6A 1X42A 3HCRA 1IPEA 4CDRA 1RXUA 4W99A 4EKEA 2X0RA 2XVZA 5JVDF 1U63A 3CXRA 3AR4A 5EJEA 4JQOA 4WH0A 1UJJA 4BZQA 4XKCA 1ZUD1 5EQJB 2IYAA 4RLFA 4IQ8A 3SCZA 1ZBDA 3UBTA 1SXJA 1G5FA 3RVRA 1VMDA 1DJNA 2DOKA 2RAPA 4J3JA 3S2SA 2EWVA 1ULHA 5AOCA 1JUDA 1RBZA 1XP8A 1XL0A 2HOQA 1FFYA 3GJ8A 5TQJA 1EGVB 1FB5A 4XZ3A 4A4DA 4EJSA 2Y2UA 3QDNA 1OC4A 2XS1A 1M8KA 1JDPA 4FFVA 3L0BA 2CD7A 1BKSB 1SA4A 1G2PA 4M83A 4R71A 2CV1A 2PFSA