2XGOA

Xcogt in complex with udp-s-glcnac
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
548
structure length
548
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate and Product Analogues as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Xanthomonas campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 203
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xgoA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2xgoA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xgoA02
2ASVA 1NOKA 5DXFA 1LWNA 1ELRA 1SXPA 3Q47B 1Y6FA 3LY9A 2IEIA 4CDRA 4CGVA 2LSVA 1FU4A 1AHPA 3RT1A 3OKCA 5JTUA 2FEZA 1B89A 4GA0A 2QN3A 3FROA 3RO3A 4F97A 2XA2A 4NRHB 4YVOA 3ZCSA 3C48A 4XI0A 2GM9A 3PE4A 1WW2A 1PN3A 3CUTA 3CX4A 1QKJA 4XI9A 4WUYA 2GPNA 4H7XA 1ABBA 2R4UA 4LEIA 4BFCA 2DBAA 4RG9A 5A6CA 4EQFA 1RZVA 4W6QA 2G9QA 2C0MA 3MRXA 7GPBA 4I9CA 1E96B 1PYGA 2ECPA 1HXIA 3OY7A 3D1JA 1KLXA 3L7AA 2MHKA 5LCWC 3HBFA 4BWRA 4GPBA 4ABNA 3MRVA 2QLLA 4GYYA 1FCHA 3WC4A 4MI3A 4RENA 1NOJA 1M5RA 4WADA 2SKCA 4CTOA 2XCIA 3WAGA 2P6PA 3CEHA 1GPAA 2PQRA 1C3JA 5ARFA 2FI7A 2XCCA 2BGTA 4NESA 5I45A 3S28A 1NA0A 4YNDA 2BFWA 4YUAA 1QZ2A 4HWGA 2KC7A 4M83A 3KAEA 3ASGA 1AXRA 3PDNA 3VUEA 1W3BA 3COPA 4KYOB 2C4MA 2KATA 5IKOA 3GUHA 1PNVA 1PSWA 1GG8A 3QKYA 5DBKA 4REMA 3NAZA 4O6FA 3RU0A 2XCBA 2GPBA 4WNFA 2VQ2A 2R66A 3OT5A 1IXYA 4B94A 3L7CA 5JJ6A 1Y6GA 1SXQA 4MHSA 4H7YA 2VG8A 4IN3B 3NP9A 2R4TA 3ZCPA 2JZCA 2OOEA 3CKCA 2C0LA 3EDTB 2H1FA 3CV3A 1JG6A 3RJVA 1NA3A 1L7XA 2F3PA 3QWVA 1HLFA 3L7DA 3E3OA 4BTBA 5M72A 4MI9A 3QWWA 4N2SA 3MQFA 2WTXA 3O3CA 3QHPA 4RIHA 4A1SA 1FTWA 1GPBA 2AZDA 4AY5A 3T7DA 4RG6A 2XA1A 3WADA 9GPBA 5A7DB 1EM6A 3MTBA 2OFFA 1O6CA 2XGMA 3FP3A 3S27A 5HQ8A 1J39A 3UUXA 2LNIA 1NZDA 3UYLA 3MEKA 2FF4A 2XA9A 2FO7A 3C4QA 5G04J 5AYWD 1K08A 3T3HA 3GZ1A 4LDPA 2IYFA 3BDAA 2XEVA 1C50A 5G05C 5D0QD 2ZB2A 3CVPA 4Y6CA 1XKXA 2QRQA 4X7PA 3TAXA 2PL2A 4WNEA 2IUYA 3RSCA 2IYAA 3E3NA 3QWPA 4I2ZA 1FU7A 1L6IA 8GPBA 3NC4A 3ASFA 1QQEA 3MV2B 3NCHA 1L5VA 3RSZA 4HOSA 3OKAA 3CEQA 3D0QA 3UQ3A 4XIFA 3KD7A 2JJMA 3TG4A 3OXGA 1RZUA 2PYIA 2QLNA 3U4TA 4I17A 1A8IA 3MT8A 3RO2A 3DD1A 1F0KA 3GYZA 1P29A 1Z62A 2GJ4A 1Y8MA 3QOUA 4GZ3A 3CK8A 2PYDA 3C4VA 3AS8A 3QKWA 2F9FA 3ZGQA 3EBOA 2VCEA 3AS4A 3QDNA 1C8LA 1L5RA 6GPBA 3CK7A 1WV1A 4LEUA 2VSNA 2G9RA 1JIUA 2QRMA 4CTNA 4APOA 4ME2A 4JA7A 3IA7A 2YJNA 3T3GA 3G2IA 1KT0A 2GW1A 4UI9K 3MKRA 4HORA 1FTYA 4HOQA 3S7BA 3O48A 3ZCRA 2HO1A 3S7JA 1XV5A 4EL0A 4GCOA 3MBOA 1GGNA 3LKUA 3MTDA 3ZN3A 2XMPA 1P4GA 3Q3HA 1FTQA 3ZFWA 4YI5A 2PZIA 4HLNA 5CCMA 4GPKA 4G24A 1TJCA 5DIZA 3OKPA 4BTAA 3UYKA 2PRIA 4N3CA 5D0OD 2AMVA 2C1XA 4EKYA 4UI9C 2GEJA 3G2NA 3ZHEB 3T3EA 3L01A 2XGOA 3S0JA 3TSAA 2UY1B 4CGWA 2IEGA 4RIGA 1UQUA 2PQ6A 5BW8C 2BISA 2XPIA 5KJMA 1EXVA 1XL0A 3BCRA 1JIXA 5ARGA 3U3WA 3MS4A 4WHMA 2QNBA 3BCSA 2KCVA 1YA0A 5GPBA 1ZBPA 1WV0A 2X0EA 2FF5A 4F3VA 2QN2A 2X6RA 3DDWA 3SZ7A 3Q3EA 1L5WA 4X7RA 3R9AB 3T5TA 2V5FA 4GYOA 3TGOA 3HBNA 5EX0A 5LQDA 2O6LA 3G2KA 3NP7A 2SKEA 3G2JA 3ESKA 3S7DA 2VGXA 3UPVA 4N9WA 3TOVA 2HY7A 4WNDA 3Q4AB 5FZQA 2QZSA 1NZFA 3Q49B 2UWJG 2R60A 1IYGA 3VTYA 3IEGA 4GZ6A 4U0SA 3Q3IA 5FTPA 3TG5A 5JJTA 5FT9A 5EX3A 1K06A 3BD6A 2JLBA 5TMEA 5JTTA 5D00A 1WAO1 4JL0A 2ATIA 4UQXA 2F3QA 3VDMA 3S7FA 3ZHEA 1GFZA 4NC9A 4NEQA 3HBMA 1KTIA 2X0FA 2NC9A 2LSUA 5FJYA 2AV6A 3RHZA 3FFLA 5CHEE 1Y8ZA 3MRTA 1Z8DA 5LCWJ 1E4OA 3ASHA 4J8FA 2H1HA 2J9QA 4G23A 3NF1A 3CKBA 1YA6A 2F3UA 1JIVA 2BUGA 2VYIA 1NOIA 5FZRA 1XL1A 3RKVA 3ZCUA 4J8EA 5KJKA 1P2DA 3CVQA 3T3DA 3AS5A 4U0UA 4MI6A 5BNWA 2SKDA 3AMVA 4AM9A 3GPBA 3DDSA 5DU2A 4MICA 4N2QA 4F9FA 1WUYA 2Q6VA 3VDNB 3MT9A 4GCNA 1BX3A 3OXLA 3NB0A 5ENZA 3GW4A 2ACWA 2QLMA 4RIEA 3CK9A 2WPVA 3PE3A 2L6JA 1VGVA 4Y6WA 2HR2A 1PC2A 2X6QA 4X7MA 2QRPA 3K9IA 2IF4A 3OTGA 3MS7A 2ONDA 1UQTA 4G2TA 2IW1A 2BGUA 2XCUA 5CCLA 2FBNA 2GEKA 3VTXA 4BQIA 1IIRA 3BD8A 4I1AA 2AVPA 1ZU2A 4FKZA 4KQMA 3ZPJA 5DLDA 2E2EA 4U07A 2QN1A 2IFUA 3GZ2A 3D0RA 1XNFA 3DZCA 2QN9A 3H4IA 4GYWA 1HH8A 4G26A 4I2WA 2FFRA 3MTAA 5D01A 2ACVA 4UQYA 4N3AA 1P4JA 2QN8A 3ZCVA 4MRAA 2KCKA 3OTIA 2R68A 3CUUA 4WNGA 4BT9A 5G04C 1H5UA 2PRJA 3E4BA 4WACA 4AMGA 2YQ8A 1WM5A 3SF4A 5G05J 1F6DA 4RIIA 2Y4UA 3CVNA 4HOTA 3EBPA 3NPAA 4Z5XA 3CEMA 4U04A 4G2VA 3ASDA 4U0ZA 2QN7A 2I6HA 1JEJA 1C8KA 1LWOA 3BEOA 2WQHA 4UI9J 1FA9A 2GPAA 1JG7A 5JJ7A 4M7PA 5HXAA 4YI3A 3MV3B 1GPYA 4J0UA 4KQ2A 2G9UA 3L79A 4AMBA 5C1DA 1P4HA 4AN4A 2C9ZA 2XGSA 3G2LA 2R5SA 3G2HA 3CUVA 1P5QA 4FZRA 1HZ4A 1KT1A 3H4TA 3IAAA 1WW3A 1FS4A 3OXFA 1A17A 4G1TA 2IV7A 4N3BA 4EL5A 3FWVA 2YHCA 4AY6A 4JA9A 4YVQC 3JYSA 3BD7A 2P58C 4NQ0A 5BT1A 5KJLA 3MSCA 3T3IA 3OTHA 3MS2A 2QRHA 2VGYA 4KXKB 3CEJA 3LYAA 1XC7A 2AW3A 5TVGA 1NVKA 4GA1A 4UQZA 4BQFA 4JHRA 3LCAA 3LY8A 5TMBA 1IHGA 3Q5MA 1WUTA 4N5CA 4G25A 1Z6QA 1OUVA 2GT1A 2IV3A 3S29A 2F3SA 2X0DA 1UZUA 1NLMA 3ULQA 2C1ZA 1XOIA 1B4DA 3RIBA 3LY7A 3WXXA 4KBQA 2VGXB 2C2LA 3URZA 4W9RA 5KJNA 2PQNA 3CVLA 1FC0A 1Z6PA 3BEEA 4RIFA 1P2GA 4EJ2A 1QM5A 2KS6A 3SYRA 3L7BA 2G9VA 1GZ5A 3HBJA 3KS2A 4QLBA 4RBNA 2VCHA 4GA2A 4L22A 1P2BA 3CUYA 4BQEA 1L5SA 4CTMA 4I9EA 4KQ1A 3ZCTA 4F96A 2VSYA 5FZSA 1YGPA 3E3LA 3N71A 3SYMA 2KCLA 4AIFA 5IKPA 1NZNA 4PQGA 3Q15A 3BCUA 4X6LA 4M60A 3MA5A 1L5QA 2QRGA 3LPZA 1E1YA 1V4VA 3CUWA 1ELWA 3S2UA 4HOUA 2QFCA 3VUFA 2FETA 1RRVA 4GZ5A 3CV0A 5EKQD 1FU8A 3OY2A 2HYZA 2Q7FA 3HYMB 3MT7A 4EKEA 5TMDA 4BT8A 2Y4TA 2UY1A 4J8DA 4MHOA 4RELA 5HI7A 3ZCQA 4N39A
chains in the Genus database with same CATH superfamily
1E2UA 1DKMA 3KPWA 1VI2A 2PM7A 1NOKA 4V2UA 2HLPA 2H16A 5JSHA 2GBCA 4KNVA 3TWWA 1NNSA 1F6BA 1XVVA 3KZKA 3PI7A 4CDRA 1PCXA 1TIKA 2YNMC 3AUXA 1P3JA 3HY4A 3L0PA 4MUHA 4PVCA 3U3RA 4GOOD 3QU7A 5CVVA 9ABPA 2FR8C 4TL9A 3K8ZA 4UU8A 3UT6A 2BFFA 2RFAA 3FRIA 4RL6A 3EXHA 2NZYA 4NYIR 4JMLA 1M6VA 2EX4A 3AY7A 4GTMA 2XA2A 1E9DA 3KC2A 3RIMA 2C7OA 2XB6A 3FTWA 3BTSA 5DNUA 4LE1A 2BKAA 2XY4A 1QKIA 4LG1A 4ZDWA 2D2XA 1V7CA 4NF2A 3T9DA 2QQ5A 3SQOA 4OJKA 1P1IA 4PR3A 2H85A 3MGKA 3UNXA 4RG9A 2XJ9A 3USES 2J6BA 1I2CA 3FSGA 5ICMA 1B0AA 3NV9A 3W5BA 3BMNA 1CYEA 2RHMA 3VSAA 2AA3A 1YS7A 2VK1A 3MERA 2WU1A 2JCYA 1N2ZA 3P20A 3M81A 3D1JA 4L9SA 2FZEA 4U2GA 1YB4A 4XQ0A 3WGYA 1E6LA 4Q96A 2A5JA 3LZCA 5LCWC 1F9EA 2WWTA 4M21A 1PAQA 3TCXB 2IS6A 1P8AA 1TRHA 3FTXA 3PZ3A 1HDYA 2WFLA 3AF2A 4BMVA 3H84A 4G5FA 1ZH8A 4C20A 4RVOA 5L3QA 4MKIA 2NZ8A 4FW9A 1Z8NA 2XWBF 2QENA 1R0WA 1XJ0A 4AZWA 5AQAA 2FFJA 3EDQA 3GK3A 3IP1A 1BN6A 3QW4B 4Y0NA 3STXA 3QEJA 3KEQA 2VSOA 4EHKA 6AT1A 1CF2O 1QH1B 1TEXA 4DOMA 3FTYA 3S28A 3QNKA 1HT2E 3A1TA 5MF6A 2Y1WA 4YMHA 1DTWA 2AFHA 4NOLA 4MUBA 3ASGA 4ZOEA 1Y8AA 1VCMA 4INPA 5CJ2A 2Q50A 1ZK0A 4DBVO 1DQZA 4LX8A 3O2JA 3ML8A 3U4QA 2C5EA 1RAGA 2RGAA 2GASA 2DR3A 4QFDA 1G3MA 1SD5A 2QZZA 4I4TF 4PS3A 4JZKA 3J7TA 1QBQA 4K9SA 1E9EA 1QHNA 2QI9F 4OK3A 4E31A 1T9AA 1K8QA 3AWDA 3NAZA 4XWWA 4XYMA 5CEFA 4ARIA 4LYGA 1ZB1A 5AIJA 4UU1A 4F9GA 2VYNA 3JXIA 3JZIA 3DO6A 3HYLA 5KQPA 5JJ6A 4ZJUA 2DTEA 1IQ0A 4MHSA 3NTLA 2IONA 1G98A 5CMYA 4KMSA 2CD9A 4F4UA 2I91A 1P61B 4C08A 3E84A 3R76A 1QUEA 3EDTB 4M36A 1JYEA 3VYUB 3HJAA 4HLUC 4I9FA 4ZYXA 2Y0PA 4EVIA 3QWVA 1HLFA 3P2YA 3X1KA 1QH8B 2HHLA 1XRPA 2A9QA 2R00A 1R4MB 2OV1A 4LQCA 5FUBA 3AVXA 3SSAA 3PXAA 3KUDA 4XYLA 2GF0A 2Q4RA 4A1SA 1FMTA 3B7TA 1P9RA 1JDZA 1S1CA 1RRFA 1VIYA 2ISSD 2NSYA 3DWEX 3NEYA 4X20B 1RI5A 1ZO8A 4JLSA 3MWEB 2XWQA 3N3AC 4FC7A 3WYCA 2XGMA 5CNJA 2EDCA 3SZLA 1I1QB 5HQ8A 1CC1S 1XK6A 5C4MA 5E7QA 4HAIA 4DMKA 4R5HA 4XIIA 1RRMA 1OB5A 2WMYA 1KYIA 1LY1A 4W63A 1XZ8A 1TO6A 4LZZA 1C7ZA 4MS1B 1L3IA 4RPCA 4TMKA 4N5HX 4U8GA 1GYQA 2GVDC 2JGDA 3HKDA 2AXUA 3KZVA 4MVWA 5HG0A 5B53A 3JWGA 2JFXA 2ICAA 5F21A 3UMCA 2WVGA 1ZGJA 2V3CC 1VIVA 1USVA 3E3NA 5HJ7A 3IV0A 4M1KA 1GLVA 8GPBA 1K5GA 2GZ1A 2HJRA 1S2LA 1S96A 1WO8A 3N8HA 3NCHA 4CLOA 3R5JA 4X8OA 1KGDA 1BU5A 4LRYA 4O2AF 1TMOA 2MSLA 4N5IX 3G2TA 2E6UX 3BS4A 3IJ5A 5LQNA 5CD1A 3KD7A 4WN9A 4H3KB 3C3YA 2RHRA 4R1NA 3ZN2A 5J1TB 4O2AB 3QXSA 1QRSA 2RCNA 3QA9A 3I62A 3RAGA 4QU9A 4LHYA 1U7UA 5FULA 1O87A 2GN8A 1SD2A 4XCXA 4DYHA 2CYBA 4RK6A 1ISMA 4MGEA 4YAIA 1KF0A 3JZMA 3IQHX 3AS8A 1KQPA 1NBHA 2XGJA 3ZGQA 1JSCA 4AYWA 1N32B 4R68A 1TJ4A 4D4HA 5BUZA 1T3HA 2RAUA 1S8FA 1ENPA 4E15A 4NCNA 3CCCA 3PC6A 4OVVA 1SQ6A 2QSZA 4RSYA 1P6UA 3BHIA 2J09A 1O9GA 1NXPA 3EA5A 2VUIB 5CXXA 5AVTA 5JRJA 1I1OA 5JROA 4CMGA 2ISQA 1KC3A 4JA7A 1ECCA 3H42B 4WUTA 4RKRA 3E37A 2Q2QA 2DFVA 2AUTA 1H85A 1I0IA 2J30A 4FGUA 4YRBA 4HOQA 5KVAA 5E95A 5HW0A 1L4MA 5ALWA 1U28A 4WJKB 4BMZA 1XWWA 4LCTA 3SHVA 5IAJA 2X9LA 3EWAA 4AP6A 1XZIA 2G40A 3IKMB 1WQ1R 2ANCA 3VR2D 4MPTA 1LS6A 5GADl 3MTDA 1N8NA 3I53A 4OKNA 4QBFA 5IP5A 4ZO4A 4FN4A 2IW3A 5TGTA 4HQ0A 3LHSA 1P31A 4X9XA 1JKJB 5B2EA 2FYTA 1PFUA 3FUJA 2EBHX 4I9NA 3GFVA 1NBME 4MRUA 2BY4A 4RPLA 4DDHA 3ETHA 3PDCA 5GZ6A 2Q62A 4QQIA 2AJAA 3OZBA 3ZV6A 3PIIA 1UJCA 1EDZA 4IXDA 3F1LA 4WCFC 2P2NA 1Z63A 2J3QA 3LUKA 3OWOA 4V0QA 2JJ8A 2XGOA 1WXWA 1KZ1A 1UR5A 2BWJA 4IRMA 5C1BA 2XXJA 3TSAA 2HHAA 1KE1A 3K2EA 1ZNXA 3H8VA 5ESRA 1YE8A 2Y4NA 5F7ZA 2V7QA 2G3YA 4JJ6A 4AN0A 1ORVA 3CLJA 1P4RA 1WD7A 4MW2A 1U8CB 5LJIA 2NMVA 3ZU6A 4BKRA 1Z7YA 1O94A 2RHGB 3SIRA 4ES6A 3ZYLA 1NQVA 5AK6A 1MJHA 1C1DA 3FHJA 3GOQA 4DK5A 3NHRA 2VRWA 3V00A 5K0TA 3RK0A 1EQ2A 4RKQA 4EYGA 2Z1MA 1E3TA 1TVKB 4JC4A 3TR5A 4JI7B 1EYHA 4CHGA 1H65A 4ZVNA 2PAAA 3KL2A 4BVBA 4ILHB 4EJ0A 3QUBA 5J1SB 1P3Y1 2YHUA 1UKCA 5JHBA 1Z2CA 5FJJA 5AESA 1CT9A 4A0SA 4YUXA 4H7HA 2J9YB 3UPVA 1M74A 1EFAA 1LPNA 1JXQA 1DT3A 2ZE8A 4FTWA 3GIWA 5EE0A 4XFKA 2R79A 2W9XA 1AU9A 3K6SB 3IQXA 3NHWA 4GBED 3Q4AB 1MXHA 3ZK8A 3ZEFA 4YJFB 1XZNA 2R60A 1GNLA 1RM0A 3E4DA 4S35A 5EQDA 4PLZA 2I7CA 3PR1A 1VSBA 3DPIA 5DSTA 2YXBA 4CKCA 5HK9A 4RC9A 1IVYA 3FDZA 3RROA 3DO5A 2ZIVB 4D98A 2CE2X 5TMEA 2ZCUA 4KV9A 2XZLA 1KZ9A 4J6FA 3SN6A 4ZZ3A 3D2CA 5KYVA 3CLRC 4AVXA 4A8HA 1GFZA 2QPTA 4GICA 1XLWA 4RZIA 4NEQA 4W4TA 1SGWA 1QIJA 2KYRA 4GPD1 5EUBA 2AX3A 3EMDA 3D1VA 4A15A 5CHEE 2H7XA 3ENVA 1R00A 1H6DA 4W6ZA 4YRRA 3VR0A 2N3ZA 4CV3A 2VBFA 4Q9JA 1HE3A 2PGXA 3D9QX 3MC1A 5ALLA 3H0KA 1GTZA 2ZAIA 1JAHA 1MVLA 3OOHA 2XZDG 4HGZA 1U2TA 3CNBA 3PHJA 1XAHA 4JX8A 1P73A 5FORA 1ONBA 4NONA 4ZVUA 3VZDA 3CISA 1CLEA 4LZPA 3TTXA 2BDEA 4A1OA 3EZNA 1QG4A 2VHUA 5DRTA 3D02A 1EB8A 1P9WA 4CJXA 1ZUHA 1H2ZA 1E20A 1PU2A 5ADUS 1YDMA 1Z73A 2QYOA 4JGBA 2CV2A 3ZI4A 1EBUA 3DOOA 4G5OA 3FH0A 3A1EA 1VIAA 3K32A 1NTRA 3DULA 4OH7A 4BNDA 1AZLA 1DAMA 3OE1A 3LJ3A 2O6HA 4PZ9A 1BE1A 1KI9A 3ZK9A 4B81A 5LLDA 1TNDA 1W88A 1YQEA 3TTSA 4H3VA 2V0GA 2VYFA 2O8VA 3H2GA 4W7SA 3RYIB 2P3QA 2P5SA 4BKUA 4EUSA 1ORHA 4DBLC 5J08A 1K97A 2WPVA 1JHDA 4MJ3A 4DIEA 2R1TB 3ZUGA 4ZYTA 5CXUA 5HQ3B 4ZV7A 3H18A 1UJJA 3IAXA 1ACMA 3K1ZA 3LBFA 5LFAA 4FE4A 3ZRHA 5EJ7A 4KDFA 1VDZA 4YCBA 5KTNA 1N33B 4PV7A 1W76A 1XPUA 3IE1A 3ORYA 3I73A 3WMWA 2Y1CA 5MFPA 4HFRA 1TA4A 2V98A 4P7FA 3CNEA 3ZLTA 2H4HA 3A6EA 3M6VA 3VLFA 1AK1A 3BD8A 1PO7A 1K6IA 2PH5A 2IXFA 4PH4B 3ZPJA 3Q88A 4ZYWA 3F5FA 4S05A 4UNSA 3SQLA 4JHJA 4U07A 1HKHA 4L3OA 4DSNA 4QREA 5EZYA 3PXEA 1OPXA 1S02A 3D0RA 1VG9B 4UWGA 5KJCA 1HH8A 3EE6A 1RPTA 4CGYA 4J0EA 3L4EA 3Q0TA 1U3WA 1FDUA 1KSHA 2BRUC 3FI0A 3IDZA 4UQYA 4R2WA 4ZARA 2QMEA 1P4JA 1P7PA 3GEGA 1RRCA 2ILTA 4MRAA 1NATA 1N0VC 5CURA 4DMCA 1QH8A 2EDAA 3QWAA 3E23A 5JCOC 4EKNB 1Y1RA 3A1FA 3EY9A 3PEEA 1E1QD 4QPZA 3NANA 4RLQA 3U62A 3ZY4A 1C2TA 3DO8A 2ZXFA 2PBRA 1IVNA 3ZJYA 1W0CA 2YVQA 4EA6A 4M6WA 1CUUA 2QMQA 4KIWA 2Y4UA 1A8HA 4HB4A 5AM4A 1GPH1 5EA2A 5EI5A 5EP3A 3S7TA 1D4OA 4QKQA 2IHYA 3ITKA 4O4JF 4HYYA 4XDYA 4A63B 1QVZA 1DJPA 2ZS9A 5FD8A 3ASDA 1STOA 1GPLA 4L72A 3DWFA 3HY6A 3FTPA 2M9MA 3U39A 4MS3A 3ZNQA 2DQ4A 1PYOA 3AHHA 1A4RA 1JLLB 4RA6A 2GPAA 3FPKA 3QJYA 1PRYA 1JG7A 3HSSA 5AVQA 2HNAA 3OEED 3QXCA 2O8BA 3RF7A 1LJUA 4XVUA 3U44A 4KQWA 2O2IA 1XK7A 4MKTA 2P8JA 2R2GA 3BJIC 4ID9A 4Y2JA 1TM3E 5F3RA 4EZIA 8AT1A 4LI3X 2ZWPA 3A7DA 1Q44A 4P58A 4ILKA 3H4TA 2IOFK 2VLIA 3VR4D 3ZGOA 2QR5A 4TTIA 2FFAA 1RXIA 3ZTWA 2WD9A 1OXXK 2HIHA 3H2JA 4LFAB 1JCRA 4DV1B 5GVSA 4J8YA 5BT1A 1XTTA 2DSNA 1H2VC 2QXTA 3WLHA 5A9SA 2HPVA 7ADHA 1GNSA 4KXKB 4M99A 2WKPA 5ALHA 4KBFA 1NVKA 2HRRA 3AIKA 3CW9A 4YCAA 4O1PA 2IYZA 2I66A 1ZKMA 3PJEA 3S1AA 3UXMA 3Q10A 4XAQA 4CKWA 3R3SA 2PCJA 1YFLA 3DXZA 3FN4A 2R8RA 5DNAA 5AVRA 2JJ1A 3BN3A 1TLTA 2JBAA 3DP9A 5T64A 3T5DA 3R4CA 4N5LA 2B7BA 3SR0A 4TYNA 2R6JA 4X7BA 5I7AA 3WOVA 2OK8A 4O2RA 1L2TA 3ZHXA 4KPUA 2Q1WA 1KRXA 1X86B 3O8BA 1QRRA 5HZGA 2EL9A 2SCUB 1NYLA 2YV4A 5J63A 5M34A 2J4DA 1O8BA 2VNIA 4PE5B 4YRZA 3BJEA 3V8MA 1VJDA 3VVLA 3R3ZA 3H2HA 3WGMA 1OH7A 5LA6F 3NYRA 5EWLA 5FOSA 5LBUA 2VGXB 1DV1A 1RTKA 2QJWA 2VPQA 4IH1A 4IZIA 3ABOB 2NW6A 2H29A 2BF0X 2A3NA 2BZGA 3O1IC 3CVLA 4IDGA 4JFRA 3ZDYB 3EMKA 4BP8A 1F2VA 1JEOA 2BD0A 2HF8A 2H51A 1CY1A 2LD4A 2DT8A 2PZGA 1QNLA 3KXIA 2LXLA 4IKEA 1CUYA 4ZAXA 1N0UA 4HVTA 5KTYA 2XEEA 2P4QA 2OESA 3C8ZA 3O0DA 3CRMA 1Y5LA 3PNVA 1BCSA 2BI7A 3HBJA 1EEHA 2PWBA 1KA9H 1MX9A 2L17A 3JYNA 5D3MB 4Y9DA 1B6RA 5E2BA 4YO8A 3GJRA 4K9NA 4OFBA 4WOBA 1AKNA 2I4NA 3O90A 4LK2A 1P2BA 2VF7A 5TB5A 1J0CA 2FRDC 5FRDA 1HGXA 2WKWA 3WYAA 2O0MA 4W99A 1WJGA 2NT4A 2ZKIA 3B7WA 3V34A 2H5JA 5ADHA 1V35A 4OOEA 1JI0A 3DVLA 1EVZA 4LJ5A 1E7VA 1DXHA 1KJ8A 2R7MA 4V0LA 2IZ1A 1XNHA 2WSSD 1XFAA 4DLLA 4EX6A 3OF2A 3N5CA 2ZZNA 1E1YA 3QKIA 5FL7A 3U0VA 5A0VA 1LGYA 1OXVA 2QG4A 4H7IA 3GZNA 3VI3B 1W36B 4JLKA 3AXSA 4NJMA 2QFCA 3CLUC 4CQNA 3FBGA 5EXPA 3ZDEA 3CRQA 3OFSA 5BMVF 1SVSA 5JOQA 1YI0A 4C48B 1AGNA 1SXHA 2NXEA 3OY2A 4RDHA 1E6MA 4EMUA 3MZLB 4EGQA 3QFTA 3LCRA 2WFLB 3TRDA 3MLAA 4K9MA 4II3A 3G6WA 3UM3A 4ESEA 4BT8A 4UZEA 1A8SA 2B7CA 2JGEA 2ZDQA 4Y98A 3RD5A 3SNHA 2ZSHA 3AR4A 5BWBA 2QGNA 4Q03A 2Q5IA 2CNBA 2Q0QA 2ASVA 2JGNA 3CZMA 3HU3A 4F12A 3UF0A 1IOVA 1WDKA 1I4WA 4QU5A 1FMJA 1SCNE 3TUIC 2VJMB 3TZEA 2YOFA 3JVEA 1ZUWA 3FNGA 2FG7C 3MMZA 1RCUA 1W59A 1KK2A 4REOA 4DVJA 2IE0A 2ZIXA 3OG9A 1ABFA 1U7WA 3U19A 1WHTA 3B7BA 5JMPA 1X7WB 5B6IA 2VHTA 1AHPA 5F2NA 2JI8A 2LCFA 2ZYSA 3ANYB 3L43A 4UVIA 1WOMA 1RE0A 3ZCSA 2VPWA 1AP7A 3L49A 2O23A 2ZYAA 1UBTS 1WW2A 2QT9A 3SZOA 2EQ5A 1NFIE 3DCYA 3HABA 3EWIA 4YDSA 5TARA 2GN0A 2OAEA 1PR1A 5B64A 3K6RA 2FEKA 2I3GA 1WTAA 3CF4A 3PYMA 1SCUB 4BFCA 1PFYA 2CLCX 3KVNA 4FC6A 4G5XA 4S0ZA 1QSGA 1VBMA 4DC9A 4UW9A 3PD0A 3EUAA 1XYVA 3TVDA 1H66A 2CMDA 1CIJA 1K1BA 3BWVA 1UJNA 2YY7A 4CIWA 2HD4A 3IURA 3A36A 1TPZA 3KJIA 4K3UA 4X93A 3HXOA 1FYVA 4KQKA 2QVCA 4NE9A 2WOOA 1ML4A 3UWSA 5JZOA 2RH9B 2RJOA 5ES3A 4DY4A 3JAMA 2YYYA 4JKYA 1TRKA 3E22B 3O8QA 2UZ1A 3HA3A 2K5UA 4Z4IA 3BREA 5BOVA 3RUDA 2CZQA 3WRYA 1EGMB 3O03A 5FHRA 2SKCA 3UK6A 3FUHA 3I1FA 4ARUA 1BSVA 3JD2A 4HTAA 4XM1A 4Q3CA 2C9DA 4L07A 2HF9A 1KMHA 2IUTA 1EX1A 1TYAE 3HVIA 4X1YB 4HDAA 5SYNA 1G8SA 4JC0A 4DC0A 5LC1A 1QZ2A 5A02A 1FP2A 1R0SA 4M83A 3KHUA 1H2XA 4MQLA 1LZLA 2WMDA 3NH9A 3TLXA 1AXRA 2QL9A 4HC4A 4CM3A 1I4TD 5U1PA 3I61A 4MV5A 2XHZA 2EHDA 1QC5A 5JNTA 3W8FA 1N25A 4WD3A 1VI5A 3D6VA 1OHHD 3MYVA 3ENKA 2DM6A 3QU9A 5BRAA 1K8KG 3X1YA 5CFLA 1EFCA 3K9GA 2MCFA 4FKMA 3RVSA 1Y4UA 3VU0A 2BLLA 4EQZA 1ORDA 3G7SA 3HR7A 4CU2A 2ATXA 2XRFA 5DSZA 1F8FA 1X42A 4JUAA 1L1FA 1KQGA 4LHZA 3OURA 2LV8A 1YS4A 2QROA 1MX2A 4B3DA 5HRUA 2C03A 3PPIA 3B7PA 4B3RB 2D2IA 5IMSA 2R4TA 4MOWA 4PNPA 4HPXB 3PS9A 4KYUA 2ACEA 1ORIA 4JVSB 1F17A 2I87A 3PU6A 4K88A 3OTWA 4FQ8A 1T0IA 4P6VF 3DEIA 3N0XA 1Z26A 5C34B 1O97C 4DKXA 3GDFA 5ESDA 3HU1A 3A10A 4E46A 2WINI 1WMEA 4IIBA 3K7EA 4KR3A 4PONA 2QTMA 2EP5A 3RI3A 3THRA 1M9NA 3KYDB 3ERCA 4D41A 4QUHA 1TTPB 1PJ3A 4NBVA 4RAOA 3O1JC 3KAKA 3VYWA 1INLA 3IBGA 4K6GA 5E9JA 2BM1A 4WZAA 3MTBA 4HBGA 2ARKA 3ESAA 3R44A 4G65A 2HGSA 4RDIA 4Z0TA 1E5XA 5JAQA 3VPGA 1AA9A 1J39A 1YB2A 1EZ1A 1KK3A 4TMYA 1Z83A 4PSCA 2J49A 1MG5A 4FNAA 4NBUA 5DBOA 3SC4A 3USCS 3ZBTA 4IFIA 4JAVC 4B87A 1T36A 2ZYRA 4DT1A 1CY2A 1ORWA 2FK8A 3V1YA 4M22A 2CY0A 3CWQA 1GUFA 3UMFA 4WXEA 1A9TA 3D59A 5D0QD 1QHYA 4QOJA 5BQXA 1O5OA 6ABPA 4U39A 4XWAA 3TAXA 3BWDD 4UTRA 5LMNB 3GD7A 4EUFA 3S81A 1FFAA 4ARZA 3ZHSA 3FU3A 2A9RA 1QV7A 3HZZA 2Q3MA 3ASFA 1OWPA 3QNUA 3JXJA 1JQ3A 1EKXA 4G41A 2J0UA 3C6QA 3FYSA 1FQKA 4UCWA 1U0EA 4XIFA 2PYIA 2WFAA 2IHZA 1WZUA 3L7MA 1UBOS 4AI6A 3KKKA 1RPZA 4IPTA 4Q02A 3EZFA 2G6TA 5HIIA 4V24A 4XFJA 4ENRA 4B4OA 3JVIA 2A14A 3AG4E 1WHSA 4HFNA 2W93A 4YEDA 1UXGA 2O7QA 1QBKC 3G82C 1Q20A 1Q50A 3KEZA 3TN7A 3LEWA 2H8KA 3MSXA 1PV4A 2J3LA 4D42A 3QM1A 1UOEA 2DBYA 4L50A 3QDNA 1C8LA 1JMKC 4UNPA 4EHBA 4TUYB 4XXHA 2PR7A 3AR8A 5AD1A 3CJRA 4DGQA 4BHTA 4JOBA 3EPPA 2JFUA 3WG7E 1N5KA 3PXCX 4MGKR 4APOA 5D3QA 1J8MF 1GP2A 3LS2A 1JDJA 4NIMA 2IP1A 3CPHA 3EZ7A 3HU5A 4RY2A 5HQTA 2BFCB 5I48A 1XVIA 2VZLA 3HCOA 1FTYA 3ZQ4A 3PEVB 5JD5A 3LPMA 3SC3A 4HN9A 4Z9FA 2HO1A 2UUOA 1KSJA 1CHDA 2YVAA 3A8TA 3M6MD 4FONA 4P29A 3MBIA 4G1VA 1YQWA 4G5HA 1TIBA 3KR9A 4W7HA 3TLMA 2BEJA 1E9BA 3EVGA 3TJPA 1VLHA 1WMDA 4OEHA 4CT4B 3GP5A 4P22A 3DEAA 2AS0A 1XVTA 2G0TA 5GV7A 4HLNA 3C3DA 2GPYA 4G24A 4LF7B 1MJNA 1JTFA 4BCCA 1CR4A 2IZOA 2YNMA 3R3JA 4DV6B 3ORQA 2OCKA 1PG5A 1P17A 1MA3A 4R2HA 1CVRA 2OWDA 3ONWA 3TSWA 5C2JB 1L1QA 5G3ZA 2MDTA 2AHOA 5THQA 1X39A 1MABB 4FLHA 3MX3A 1QO7A 4Q7QA 1GCUA 3U61B 5TEWA 3QLVA 3S70A 1ZYUA 1DO2A 2WIJA 1U2DA 1V3QE 2AOXA 4MKHA 2WC1A 3IPRA 4RH0A 2ZP1A 4L4SA 4YXWA 5JVDA 1JW9B 3JAWA 3KG2A 3I37X 2H31A 2CKDA 4Q7EA 5HF9A 5FWQA 3HB0A 4YRSA 3ASZA 3GN1A 2E7ZA 2FPSA 2GPWA 2H6FA 4RD0A 2WB2A 4B1FA 4AJIA 5KDOA 4X91A 4YQFA 5A06A 4DHWA 2O2SA 2WT9A 4GTQA 1UL1X 3IUQA 3D6NB 1ZN7A 4MYDA 2R0QC 1JJIA 1DRJA 3D7MA 5GPBA 3LM8A 1GRCA 2ZYWX 4QTUB 2UZ1B 2DCMA 1BXRB 2C8JA 2QUKA 4KRXA 3JALB 2GD1O 3CSSA 1JI3A 5LWHA 4YGXB 4L9PA 1E92A 4KFUA 1YRAA 2Y1LA 3PFHA 3VTKA 2FZKA 1C7EA 4O4HF 4TTJA 3PEFA 1RXCA 2R8OA 5TQ0A 4F4HA 3Q41A 1KE2A 4Y0AA 4JELA 2BHLA 4TLDA 3U4AA 4CV1A 2VJ8A 2A4KA 2WHPB 3IE2A 1RR6A 4YLYA 4LF8B 2ZJ5A 2B21A 2FU5C 2QSUA 4OI1A 4NMHA 2B0OE 3ZUVB 3T6KA 2PJZA 3AUSA 3CEAA 3HI4A 1ZK4A 4L4XA 4NH4A 1L5KA 5FX2A 3VTYA 1JFRA 1XMIA 3I9MA 4LRUA 1HR0B 1HEIA 3TG5A 4WCFA 3PDWA 3KU4A 5DT9A 1ZM9A 2I2CA 1BKDR 1EJ2A 4EKGA 2QYUA 3PHHA 4WJZA 4I5DA 4KN6A 4WLFA 4QQNA 2Y9MB 3K05A 1Q74A 4U0KA 3HXDA 2DFTA 2KBEA 3EG9B 5EWLB 3ADCA 4GRAA 3TLGB 3UHFA 1JPLA 2P6UA 2GH1A 3DEOA 1E89A 1T3LA 1OYYA 3GEMA 2CXSA 2JPDA 2OZVA 4KMMA 2X0FA 5AVYA 1U6JA 4B73A 1PZNA 4EVSA 3RHZA 4HT3B 4R71A 2IO2C 3NRJA 4LZWA 3TBKA 1KH1A 3DHEA 3PYXA 4IDHA 3P9QA 2AQIA 2HMTA 5DISB 4F45A 1IKND 1CUFA 4CUZA 3EG9A 1A5TA 3UK1A 1EIZA 2GUGA 3BULA 4C2BA 4BNKA 4BO7A 4X1OA 2VYIA 4UAGA 1DIBA 1TI7A 2DZOA 2L19A 5FZRA 1DKQA 2OA0A 3VNQA 4QDKA 3DTVB 4OHMA 4WUVA 4YV1A 3L8HA 1UMDB 3FJYA 2JFNA 1KJ9A 3NM4A 3PVSA 1CF4A 4IHJA 4DPRA 4JIMA 1WHSB 4RFLA 5TR9A 2WJ3A 1DOHA 2Z8XA 2SKDA 5JXJA 3TXYA 1PUXA 3MG9A 2P1RA 3KKZA 3RADC 2B8JA 1AUOA 1JEAA 1DJLA 1WX1A 1I33A 2HJSA 3GZNB 1NN0A 1UM9A 3VC2A 4IHQA 2BEVA 3U4HA 4F4DA 3PXBA 3AKZA 1A1VA 3VO2A 2R1ZA 1Y4AE 2YHIA 4XQGA 3D3JA 4HRNA 4CI0B 5BV7A 2O20A 4LF6B 1GGJA 3QIAA 4LWPA 3B6EA 4ILEA 4C0EA 5CAEB 1BJTA 1VLMA 1MX3A 1E6KA 2E2WA 2ZRQA 2P9FA 1IQUA 5AOCA 1MD9A 1R6AA 5F5NA 5CIYA 4EFDA 5ALKA 2CLMB 1R27A 2A1UA 3DZGA 2ZAGA 2JGKA 3GEDA 4L6CA 4PRLA 4X5OA 4G2TA 2PZEA 4D80A 2XUJA 4EY7A 2XZPA 4KR7A 2BHNA 1YB5A 3FOCA 1PBNA 5BPFA 5EZ5A 3ZU3A 1P72A 4ZT5A 4JUCA 3GD5A 3RRZA 1V8DA 1ATZA 4AEZC 1C0IA 3PQ6A 3ZZ0A 1HETA 1LC0A 1D2GA 1PL6A 1IL0A 3NTQA 1TA0A 1YZYA 4KGZA 3V8PA 1NQ5A 2FZWA 2ZYVX 2QJRA 4M6WB 2RG1A 1QWOA 2QN9A 4I2WA 4WNCA 2NX2A 2VP9A 3ELUA 3P2EA 2M6LA 5J2UB 2CFCA 2J3MA 2ACVA 2OB2A 3H4VA 4RMHA 3IQFA 4MW6A 3FOZA 3OZFA 3LLSA 2OQVA 2QVLA 2ZOSA 5E6UB 3LX6A 1IG3A 3HPRA 3QX3A 3Q11A 4BT9A 4J90A 1KKUA 3ZDAA 5JNVA 4HNTA 3LUJA 3VOAA 3D0OA 3GG9A 4POAA 3L4SO 4WEQA 3VZQA 3CHOA 1FVHA 1WP9A 4YO7A 2B36A 5AK0A 3JCKC 4AP2A 4NBWA 1KI8A 4X3PA 5LM3A 1MU0A 4NE7A 4HLLA 4N8DA 4Y1RB 3DXMG 3C41J 1U0JA 1HI9A 2X6HA 1BU9A 3HCBA 5TMPA 3M2TA 3KYJB 4OD0A 3IERA 1LTQA 2FJPA 2RB4A 3H5VA 1JEJA 4JBYA 1GVNB 2KZTB 5D3KA 2KBXA 2ZBRA 3ZU2A 4F93B 1LSOA 4UI9J 3L0CA 4GMJA 3GN2A 2BZSA 4KVGA 2G06A 5FUWA 1R15A 1DC5A 1QFSA 3MIIA 4D6PA 1Y7LA 2DJ5A 3GPLA 1OLUB 3NGLA 3B7RL 4IVQA 4NG4A 5EZSA 3D6FA 2WJAA 1G21A 2EATA 2H59A 2LZ0A 1G8MA 1UOQA 1D2HA 2H9AA 3H5AA 2W4QA 1KBZA 2HI0A 3G2LA 3LD9A 1TMKA 4G4IA 4P3PA 4X1YA 5FOXA 5GQSA 4W1SA 3EN0A 1XIVA 4MVJM 3RK4A 3TTUA 4BAZA 3RRYA 3VNAA 4EATA 1QU2A 1ZP6A 3A2NA 2BGJA 1J23A 1WW3A 3LOPA 3WHPA 2DFNA 4HK4A 4BS9A 1EP3B 4DDKA 2EC5A 1Q6ZA 1ZEJA 2GAOA 4R31A 4PNEA 1H9BA 4NCBA 1PX0A 1WUJS 3QVMA 5KJLA 1JVBA 5LB2A 2WJPA 3O8RA 4DRYA 3K9HA 4M9ZA 4OIMA 2IUEA 2O05A 1AMOA 3CEJA 4J16C 4ETNA 1SKBA 3OQMA 4ZDJA 1VB5A 2WDPA 1QLWA 2O07A 4QNNA 4CMBA 4BQFA 4C0MA 1NE2A 3NFYA 4CLRA 4TZ0A 5H5JA 4NARA 4TRJA 4UE3S 5AM2A 5KYXB 1ZUD1 4NI5A 3B12A 3DCJA 4WCFB 3UUEA 5GIOE 3ZE6A 1S63A 1RLMA 3EPRA 2X6JA 3W9FA 4RV9A 4U6NA 5LVAA 5DWVA 3TE6A 2JLWA 3AF6A 4JBIA 5B1DA 4TV8F 2X9NA 2C1ZA 4MLPA 1US8A 1ZNYA 1SUAA 1QB7A 3ND5A 4CMJA 5MDHA 3S2ZA 1T8RA 1GZSA 2NUAA 4W5OA 1VG0B 3OTOB 1ZW1A 5TF0A 2NVUB 3LWBA 4ZICA 5DNYB 1Q92A 2W2VA 1I6MA 2XENA 3I6BA 4AKGA 2A6PA 2Q29A 4G81A 4PS8A 2TRSB 2BMDA 1LVUA 1VHJA 2J5BA 1JHAA 4L74A 4AUNA 3SYRA 1VMAA 4MV3A 3WLIA 2P9EA 1IY0A 4LOHA 5JARA 1XELA 5F73A 4B3IA 1KZOA 3EWNA 1Q11A 2CE7A 2GM4A 1MRNA 3I45A 2OENG 3DBRB 1F5NA 3QEOA 5JECA 1Z3YA 2ZBVA 3MK31 4C4TA 4UKDA 1XU9A 2FW6A 4URYR 3Q4GA 3REFA 1JQLB 4C7MA 4B34A 3II6X 3FPGA 4LC1A 3RB8A 1MQ9A 1OW3B 4F60A 3CJQA 1DDIA 4X3CA 1KDOA 1PE0A 2FPKA 4HS9A 4L4ZA 1TZKA 5AK3A 1RYYA 4FJ2A 1M1YB 1JIIA 1L7RA 2FWRA 4MWDA 4PO1A 1Z37A 5LOZA 4WDRA 5C1OA 3NTVA 2ODAA 2OY0A 2YWEA 4BAGA 2ZI6A 4B6QA 5CH5A 1FSZA 1SB9A 5JJ5A 3MTQA 3DVRX 1G9TA 2O8NA 4G0NA 4C4XA 1RAEA 3B52X 4GYJA 3D3EA 3OIUA 4KJZA 3H5LA 4M87A 3KLBA 4TRRA 1M2HA 2A9OA 3FR7A 5JBQA 1QFZA 1TJYA 3HYMB 1Y48E 2BFPA 5AJHA 1ISHA 3UBTA 5CDUA 2GZAA 3E35A 3SVZA 2A1TR 2GXAA 5KU7A 1Y8RA 4KDCA 2QW1A 1VFNA 1H2AS 4KYVA 1EXDA 2WZBA 1MLDA 3NHJA 2LPMA 4G37A 1P9OA 2VYVD 2I4OA 2X4IA 4EB6B 5AKKA 2WXGA 3RUAA 1H0HA 4M7OA 1AUVA 3NGXA 4HH1A 4Y6RA 5AW1A 4JV5B 4FEEA 3Q47B 3WYGA 3ZDRA 3HA7A 4CEHA 1ZMOA 1GUYA 3LY9A 5I8ZA 4ZI7B 1ZAKA 5CERB 1O5IA 2CXUA 1KYQA 2E1PA 3QE0A 3LQ1A 1DBQA 1HDRA 4UNQA 5P8WA 3JARA 4IH9A 2GKSA 4IXWA 3HXBA 2VSQA 3NHYA 4FJ0A 4ND6A 4Y9TA 3IEVA 3UFBA 4XPIA 2ESRA 2FEZA 1LC3A 3AY0A 3I0ZA 4O4IA 1RABA 5FI1B 1XMOB 2QJTA 4CM7A 1PAUA 3SEQA 1CDDA 1Q7EA 2JL1A 3C3WA 2WP8J 3DBVO 3B6JA 2W42A 3U49A 3L6AA 1WTCA 1BE8A 2DMRA 2RARA 4QXPA 1AJEA 1X38A 2W43A 2AXZA 2JW5A 4ED9A 1LS1A 4NZOA 1SG6A 3GU3A 3K9CA 5IDVA 3EGOA 3WKCA 1KI7A 1L4LA 2JI7A 5CVEA 4GE3A 2HPHA 1SIOA 1SELA 1ZIXA 4B6PA 5DHSA 4DVGA 2D5CA 3WNBA 2QV0A 3N8GA 1R8XA 1JVSA 2EFCB 4RF4A 2X0JA 3WNDA 4LNAA 5JY1A 4TRNA 3QOFA 1DE0A 1QGUB 4AECA 1WHTB 3T7RA 1A27A 4YRPA 3OCUA 2M1XA 3BAZA 3P9RA 4K6FA 4YFYA 4EBFA 1EB9A 1OLSB 2VATA 3QOYA 1M5RA 3R74A 1BMFA 4NICA 4IKPA 3VO1A 3CRW1 2OEVA 1ZQ9A 2XD4A 4FZVA 5A1TA 4IZHA 2N0SA 1KYWA 4U2EA 5ARFA 2R1VA 3D4BA 1ZJJA 4I99A 1TQDA 1OXSC 3MAAC 2OYRA 3HLYA 3QFCA 2Q1XA 4OBBA 3I9V1 3C8DA 3LDGA 1RLTA 1KFJB 4LSZA 1P3DA 2OC9A 3NHFA 4QPDA 5DGIA 4D8VA 2IPXA 4ZYLA 2VQSA 4KYTA 4UXIA 3P94A 4DJFC 4XASA 2GXUA 2OGWA 1LSJA 5L3SB 2V9CA 1IN4A 4G09A 4DCSA 3BK2A 4Z0HO 3TQSA 4E5NA 3EGWA 4QO8A 5IKXA 4BFRA 2Q9CA 1SBNE 4L8LA 5C7LO 5EJ2A 4J0HA 1TADA 2P0EA 1RPNA 4PS7A 5CBPA 1EX6A 2GPBA 3E7XA 3PNLA 4DDWA 3L8YA 1GZHB 2YRXA 4AICA 1T4CB 1ZPDA 2C42A 1EGVB 2JJ1D 1HURA 2PXAA 3DV0B 4TKMA 4X54A 4JYZA 1WMFA 2Y1KA 1I80A 2ZUDA 2MYOA 4ETIA 1BI8B 1XDBA 1XZPA 1ZLXA 2HQSA 3FZEA 3KEOA 3ORFA 5AXAA 3RYHA 4IW3B 2YWGA 2NUAB 4BNJA 4DS3A 4AYTA 1IN6A 1BRMA 3L7DA 4LZJA 5KNBA 1YR1A 5CHYA 3IGFA 2NP6A 4JP1A 4WNAB 3CZRA 5JH7A 3KWFA 4N9QA 4FCCA 4EY5A 4AMUA 5KOYA 1NW5A 1VLZA 2BE9A 1KAEA 1IBSA 1QGOA 1M0SA 3IQWA 4ZHQA 4AY5A 2XA1A 2GDZA 4D79A 1AKRA 3KVRA 1U1IA 4MKXA 3DVAA 3ROFA 4HNAD 1UWLA 3N07A 4CEIA 4C5CA 1B14A 3UC5A 1J06A 4XM0A 5IDWA 1XDSA 3T1HB 4ZANA 3KLNA 5D1HA 3CHQA 2FO7A 1ZH0A 1N9KA 1O57A 2H2WA 2IU4A 2VJCA 3AUUA 3IQEA 1K08A 4G4SO 4NRDA 4G1EB 4U6QA 4YRTA 1JH9A 3SHTA 2BKLA 3TWTA 2IHNA 1QTRA 4Y6CA 1R3UA 3HK2A 4BCBA 1LLDA 3N58A 4GLBA 2PUCA 1M1NA 1MO6A 2CV0A 2OZLB 1ULBA 4BU1A 3NC4A 1YE3A 4RVGA 1M0EA 4NK4A 1HE5A 3IP7A 1GZ4A 2LIVA 3FWYA 1GPKA 3HJFA 1LUAA 4F5EA 2JFQA 1GA4A 4AKTA 1EI9A 3OT4A 1R6DA 1TD9A 3QBDA 3KKQA 4RTJA 5ISMA 5HS4A 3UQ3A 3I5UA 3WB9A 2ZZMA 1AN0A 4ZKDA 3TKLA 3PZDA 3D9LA 4X1IA 1KRHA 3PNOA 2WWHA 3IT2A 3JTMA 3MGCA 1UDBA 3C3CA 4PCVA 3SBOA 2VC2B 1RQNA 4PLFA 1E1QA 4LNUB 1O9HA 3M2PA 1R0BA 4PYKA 2OVBA 1N9GA 3E5RA 3GFSA 1ZZEA 1TECE 1SQ0A 4LDZA 4P7BA 3SHWA 2BH2A 3VO8A 2XDWA 3DMTC 4WWHA 4EO9A 2WXRA 4UEJA 4CKBA 2XAUA 2UZAA 3OFKA 4FJYA 3SLRA 4EZEA 3DSXA 1FLAA 1EQAA 1L4YA 3H17A 4XB1A 5ENPD 5F2KA 3K16A 4FDUA 3FIUA 1XG5A 3RYTC 2FKNA 3HV0A 5GTDA 2Z0MA 1PZXA 2ZBPA 3WHIA 5BN1A 1T3ZA 4V1CA 5BNTA 5CM8B 4NHEA 2AF3C 3OJ0A 4ZXPA 4ZZIA 5DHFA 1WPQA 5T5QA 1HEYA 4CL8A 1KT0A 4M8KA 3GJQA 4QGGA 5IM4A 3EFOB 3QSGA 4R9NA 1F0PA 3VH2A 2QM8A 5IT0A 1CEXA 4V0ME 1ZD1A 4RJLA 2ZB7A 3D31A 2G5PA 3VPBA 2OO3A 4JQYA 5DCUA 2FR8A 3BFXA 4CQMA 3RVMA 2Q6LA 4IIDA 2PS0A 5FBRB 2PGIA 3M6LA 3AUFA 1M73E 3DYIA 3QKSB 5TX7A 1KU0A 1SUIA 3T4EA 3TEJA 4AFNA 3VKHA 1V6AA 3DMDA 2UUCB 2AYZA 2DKOA 3ONNA 4FYYA 3NZSA 3QG1A 3W3AA 3HYTA 3CW8X 2ZJ8A 1AS0A 3FDXA 4BTAA 3HZRA 1MX4A 3TQQA 1K4YA 1KP9A 1SCDA 3G8BA 3ZDFA 2AR0A 1E7UA 1ZIOA 3X0DA 4EKYA 2N47A 3N75A 1GD1O 4KXUA 4EPWA 1CJTC 1XTZA 1ABEA 3UV7A 3V5NA 1BRTA 1KFKB 4B5KA 3S0JA 4XSGA 1LPMA 3F6BX 3RAJA 3EXIB 4Q19A 1F48A 5DOZA 1T0JB 2P9PG 1ZMRA 1K88A 1NLZA 2W6MA 1OT3A 1TK3A 1DVRA 4B09A 2L0XA 1JIXA 4RTSA 1NT4A 2X2PA 3JYPA 4DV5B 1J8DA 1CEEA 3VISA 2E6KA 3CLSC 1THZA 3B1WA 3FYUA 3IDSA 4IWNA 1ZVVA 1KXJA 5DBEX 2VYND 4J76A 3A6HA 1GWNA 4FYJA 3FNFA 5BR7A 3NT2A 2WIKA 3AETB 4BVFA 3BXGA 5F1PA 3ASYA 1MT0A 3WQHA 4CODB 5FNVB 4Q3NA 4RF5A 2OXEA 4TV9A 4A1GA 3G0OA 2VPZA 2QN2A 3IR5A 3QPVA 3PTLA 4ZZ1A 5A5GA 1XLTC 1N2JA 2XEHA 1PJTA 4GYOA 1W85A 4GPMA 4LTDA 5DLEA 1I7QB 4R6XA 5LQDA 4H7PA 2VAPA 4C43A 3FGPA 2REQA 4NULA 5DI3A 5AQ7A 4TVKA 2SKEA 4BBJA 4CRWB 1HDGO 4HFJA 1E96A 1OIWA 3N74A 4WN3A 2ECQA 4ZAVA 5FWDA 4DR3B 2JIZD 3D8NA 1EFTA 4H7DA 4S12A 5AICA 5C8YF 1Q2UA 2J67A 4BNMA 3IAUA 4N9WA 5ED0A 1CP3A 2BT4A 4MP6A 4YRDA 4H6VA 5G41A 4I55B 5EXEA 3HXQA 1M2OB 4OJNA 4WFQA 4UFNA 3N7AA 4F53A 1KYVA 5I7RA 2CB0A 3QKRB 4HI0E 3UMSA 4BGVA 3V1NA 1F3OA 3VXKA 3T3OA 4HMQA 1G20E 1WF3A 4UXJA 2TYSB 5FT9A 2YJGA 3KT3A 4AUMA 4KQFA 4V1CB 1UN8A 2IU0A 4DR4B 1WDMA 1QWSA 3DCIA 3GFPA 4KX5A 4C7OA 3FRJA 1WQ3A 3W6PA 3DE5X 2GD6A 4UQXA 3L9WA 3SQDA 1VJGA 3QQPA 4Z4HA 2D4HA 3RTAA 1WF6A 2ZJZA 3NI2A 3ZI7A 5IJ9B 1KTIA 2O2YA 1GO2A 6CHYA 2ZI9A 2NC9A 1CUCA 2NU6B 2JLYA 1Z35A 4PLHA 3I2YX 3SM3A 5TEVA 3A9CA 4J1TC 2Y1GA 3Q2OA 2FG6C 4G5QA 4LJYA 4EG7A 4CMEA 1U0GA 1JV2B 2QQ0A 4AJHA 3CKBA 3WGOA 1RLOA 5FWYA 3JWEA 2V6BA 2ZUCA 4DIFA 2P77A 1JIVA 4EUHA 3HPQA 3CLRD 3GGCA 4BBAA 4YMLA 4EG1A 4KVFA 1B2LA 3AEXA 3LT5A 2H6IA 1PY1A 1ULAA 2MR6A 4MEBA 4XWOA 1MW8X 1SOMA 5KJKA 1P2DA 3OU2A 1ZUNB 4DUIA 4U0UA 3PC4A 4MI6A 3BAFA 4UBLA 4UQPA 3K0FB 3ZK7A 2UYGA 1C81A 3GNQA 3ENQA 2X9VA 1YRYE 3DDSA 2JD2A 2O57A 1MC1A 2BAGA 3Q7SA 1CJCA 1EWKA 4FIZA 2WWYA 2ZTUA 1BX3A 5K2MA 1EAYA 1M3SA 1DAHA 4BNYA 4M7WA 1QCZA 2CMGA 3C8MA 3ZIMA 2HLDA 4PCLA 1SUDA 4RHCA 4GTTA 5EUMA 4OJMX 1GUAA 4X63A 1F6WA 1JEYA 1Q3KA 1QLHA 2IV2X 4BERA 2XOKD 4IUCS 1T5OA 4BZQA 4E1VA 2WD7B 3A0RB 4O8CA 5KSPA 4EMBA 2MYPA 6PFKA 3KQUA 4TYWA 1HDXA 3T1TA 1KDTA 2MINA 3AHDA 1VMKA 3GMDA 3QU4A 5B5SA 1D2RA 1BKSB 4RK4A 5CFNA 5IJ9A 1E2IA 4MJXA 1X1RA 2FPUA 3UJ7A 1H9CA 2WUFA 3ICEA 1E8WA 4GQIA 1AQ6A 1U2SA 2JVJA 4Z7JA 2GETA 3PC8A 2AKAB 5A4IS 3EODA 3VTZA 3ESCA 3F7TA 1MH9A 3PUIA 1R9JA 3QMMA 4FCTA 4ZVVA 4BESA 3SAJA 3K70D 1Q84A 2QQGA 1JBEA 2IFUA 1IHUA 3E7DA 5TPWA 1CUZA 4IJ6A 1GGKA 1GKLA 4HEA6 4K9DA 3DZCA 4E2WA 4AB1A 1CJVC 1SCQA 1M8PA 3EIOA 2RHDA 1BNCA 3ET5A 3U13A 1CJMA 3BSWA 2GEUA 2PGJA 3X2SA 2VL7A 2DHRA 4K9OA 1PEAA 1ZCAA 4EF4A 4F6CA 2F8LA 1HZZC 1S9HA 2DWUA 2HSGA 2HUNA 3K5PA 3OTIA 1Q7BA 4G2NA 5HF8A 3CGHA 5REQA 2HSZA 1AV7A 1EIWA 2PRJA 2PJRA 2KMLA 2PMCA 1Y81A 3I92A 3H2BA 3NATA 3AI2A 1LBIA 1W5EA 3OOJA 3H5TA 4HMPA 1J2JA 3LPDA 3D8BA 1C9KA 3I04A 4B6SA 1KR5A 1FP7A 1RFGE 1JR3A 4ITVA 4M9SA 4ACLA 4Q4LA 1EDBA 2JHAA 5HRYA 4RD6A 2O8DB 2O3QA 9LDBA 4M4SA 1I6LA 4L15A 5CM9C 5D7BA 4JLDA 3VKWA 4BN4A 4BV3A 1E60A 1LB1B 5IXJA 2XB2A 1UN9A 2XT6A 1R5BA 1NIPA 3ML9A 4UHCA 4AM8A 4BEVA 2R65A 1G1MA 1N5LA 4PBRA 1P74A 2HWWA 4LYDA 2I2AA 3LKVA 1O96B 2PPLA 3W2EA 1G3QA 3JVDA 3NGMA 2DLNA 4LGVA 4RACA 4DUGA 1JQAA 2O1SA 3FUCA 3ZIUA 2C9ZA 3T0FA 2PUFA 1VRWA 2FSHA 1NJSA 3A9VA 3JYQA 4PC3A 2FWAA 3PNMA 4J07A 3RH0A 3MWDA 3SBXA 4JUDX 2IEZA 3ABZA 4WIAA 1DUIA 5AWFC 3E7WA 5TVKA 4BX0A 4ZJPA 3U16A 1QG2A 2XNDD 5AVVA 4N3BA 2FSIA 5DVZA 3W5UA 1NL4A 2B2CA 2FDRA 2ZBDA 4YVQC 3JZAA 5ALMA 4A9AA 4YUZA 1VBNA 3BF7A 3GG2A 4KRYA 1F20A 2SICE 4DLUA 4RFSB 1YMQA 1ZNQO 3VU3A 1KFCB 2HCBA 1A77A 1NN1A 2GMWA 2ORIA 2IF0A 3FMVA 3JYOA 3L6EA 3P9PA 4HAUA 5TQJA 3EMBA 3RBAA 1U11A 4ZQCB 4BO9A 4DIOA 3NHBA 2PRSA 4TWZA 4UQZA 4HY3A 5JD6A 3TWVA 5ICSA 2DJIA 4KVAA 2D3WA 1XPJA 4LWQA 1XZAA 1AB6A 1MX5A 2YTZA 5E4YA 1TM5E 4N5CA 1Z6QA 4JSTA 4F91B 4HFGA 4J7AA 4S1PA 3NWJA 4BNWA 1NVXQ 3A05A 1Q7TA 1Y3HA 4FHZA 1IJBA 1QGZA 2ZUVA 4OVKA 5IZCC 1IZYA 4I6JA 1FMLA 1E3SA 1YI1A 3M83A 4ZREA 1P80A 4IUDS 3GCGA 4LDJA 2YWJA 2PZMA 3I23A 5E2IA 3KQMA 3EXHB 5D51S 1Q83A 1XMPA 2G0NA 2JATA 3IDOA 5A4KA 5FUQA 3RUFA 3TBHA 1Y1SA 3PITA 4QPPA 5EERA 1GVHA 3K5HA 3RVOA 4CG2A 4EFNA 5IVKA 1U7TA 4XJSA 4CEJB 3AHJA 2E4VA 1OV4A 4H08A 2ZAYA 4BQQA 1O3YA 1H8HD 1PFQA 5HM6A 4GI1A 2BFBA 3DR5A 4QC2A 2EYUA 3RTEA 1OCOE 2F1JA 4ER5A 5IAEA 3RIXA 3R0IA 1RYEA 4CG1A 1JYFA 4C21A 2F1RA 3SYMA 4RGBA 2ZRNA 1BWSA 1CS4C 2E49A 3RNLA 3W3AH 2GR9A 1Y7TA 3MA5A 4YALA 3I4FA 4JHLA 3L0BA 4QYXA 4Q4HB 1E0SA 3SF8A 1JMVA 3N28A 1TJPB 1FPMA 1V11A 3B1JA 3LJKA 4IDDA 4GG1A 5AHXA 5K4GA 3SIXA 1ZCFA 3RWMB 1NPTO 1T9BA 2A0XA 2DQYA 3QVSA 3FETA 4IDCA 4IYRA 5JPIA 2EGUA 2I6GA 4QQ8A 5B1AE 2VHEA 2HYZA 1NI3A 1VG8A 3O4VA 2Q7FA 1RI3A 3O3MB 4FDAA 5L4SA 1MORA 2IKQA 3AILA 3AG2E 3GQBA 3JS5A 2ORWA 3UO8B 1EESA 3SICE 4ANXA 1VE5A 3C24A 4BFZA 4DDVA 4E32A 5CH3A 2Y4TA 1W52X 4F1KA 5CDFE 5IDQA 2Q4BA 4KNYA 1K8RA 4MHOA 5LBTA 3J80A 1ZGHA 4FQ7A 3DWGA 2B30A 4JJGA 1QQ5A 4OYHA 3M6IA 3TS1A 1IHYA 2QSYA 3QVOA 3Q9LA 4NS1A 4XH9B 3GPIA 2PQMA 4EG0A 3N2YA 4TSFA 1T8PA 1CLUA 1H19A 3A6KA 1XA0A 1JFFA 1V1JA 4JLBA 4MRMA 4Z4FA 2ZWAA 4N49A 2V7BA 1XP8A 1ID8A 3I9FA 1Z0UA 1ZD8A 1YV9A 4HNQA 5C3UA 4E5PA 3O21A 3FROA 4YAUA 3VLDA 2EBWA 3ROZA 1ZISA 2OTCA 2YZGA 3ZKAA 3IBTA 3UFXB 1IUOA 3GCWA 1U63A 1FCJA 2OKCA 1R6BX 5JJKA 1J33A 1Z4PX 2VRBA 4RJKA 1NUSA 2AHRA 1JIKA 1J56A 1QKJA 3M6UA 3RC8A 1YB6A 4EI7A 1M2VA 3VSBA 4HSEA 2DBAA 3ETGA 4BNVA 2SBTA 3HGTA 4C07A 3V1TC 2LR0A 4LGMA 2BSAA 4KJXA 5KHOC 5EIEA 3I2FA 1X1BA 3DUFA 6LDHA 5LD2B 1E96B 2JNWA 2NQ2C 3LI2A 4CTJA 1PFWA 4EG5A 1UP6A 4J0FA 4HATA 1UJBA 1EFDN 1KLXA 4R2JA 3WX0A 5LQRA 2YJ5A 2ZI5A 2MHKA 3H8SA 1CUJA 2CG2A 1XVLA 1NVVR 4RTPA 1Y63A 2YH2A 3OX4A 1W85B 2GJKA 2WKSA 3GDGA 1DEXA 4N3GA 4R5MA 5IUNC 3AXTA 1OFIA 1U1GA 1UDRA 2NO4A 2GCIA 2XEXA 2JJYA 1UMCA 1Z36A 4MQMA 1II0A 4WADA 2CVQA 3WB2A 2ZGDA 1FYDA 3JQ8A 4GOMD 4WX2B 2XMDA 1PR4A 3ZE2B 2FNAA 2WHXA 4KT6B 2X8JA 4GP9A 2NO1A 1A9PA 2EEPA 4PC7A 1AG9A 4PM4A 4UHJA 4WBSA 4ALKA 5A2QA 3OIFA 4JI4B 1MVNA 4D44A 2JKYA 3V8RA 3QV2A 2BGTA 4UWKA 1P1JA 3DBIA 1NA0A 1V39A 2BR3A 1BROA 1DUSA 1E7RA 4OUDB 4M0DA 3UCXA 4Q66C 4FYMA 4RXUA 5K0GA 4XEHA 3RVLA 3MGAA 3I64A 3AI7A 3A28A 4RX1A 1X81A 1MUUA 3SSNA 5IJWA 1Z6XA 3A4LA 3Q9UC 2ZBEA 3OEWA 4FVTA 6Q21A 1E32A 3RO7A 5BV1A 4UWHA 4MQBA 2HBZA 5KVQA 5IKOA 1JDBB 2JAQA 1F8UA 3QBTA 2OYCA 2IVZA 1WBDA 5KNCD 2I1QA 4JOSA 3URKA 4YJ2A 3NBYC 2Q9BA 5H68A 2VYQA 1PK8A 1GKUB 1G6KA 3IAM6 4UWFA 1W9MA 2IDJA 4QUJA 4TKUB 3VMFA 3W8DA 2UZ4A 3E0QA 1LXCA 3L7CA 1GDDA 1SA0A 2ZAMA 4A6DA 5L6MB 2HHHB 3Q9UA 2WYWA 4OU4A 4HGPA 2PBFA 2JZCA 3CKCA 4GZCA 1X15A 2NTEA 3A1CA 2WWIA 3FKSA 2Y4OA 4D1YA 1T24A 4IMPA 4CHTA 1Z5NA 3EH1A 5A3SA 3IELA 4JP2A 1XEFA 3N9IA 1GARA 1GU1A 3ZE8A 1NXSA 4FSHA 4DIKA 3D9PA 3VFDA 4M1OA 2WTXA 2BRUA 4E12A 1HG0A 5A2GA 4IIYA 2ZIUB 1E1DA 2XIJA 3ZDXB 3U09A 1YD7A 1ZONA 4LMAA 3BMXA 2P6OA 2FSGA 5DHPA 4WOPA 3PQEA 3THWB 3K1TA 1LLFA 4A5SA 4JI2B 5SZJA 4YAGA 4RZSA 3B9RA 3GGSA 4YDYA 3C7TA 3KZMA 3TNJA 4I3HA 2H3EA 2LNIA 1FRFS 2OB1A 3QEMA 4Y2XA 4QUEA 5AJXA 5FJIA 5DM0A 3WDLA 1MV5A 2VH5R 2IYFA 3W5IA 1KAHA 4PLPA 5FAKA 2X0KA 2XODA 2QRQA 4X7PA 4ASUA 4HZGA 2PKCA 3ZZ1A 3KEGA 4RPHA 3QWPA 4RTLA 3OZGA 3PPXA 5A9RA 3MMNA 2QU8A 2CWDA 4C4ZA 1ZOOA 3EHEA 4NZNA 4BNLA 4OJQA 3OKAA 1JCSA 3DYVA 1NXQA 4MDYA 1GADO 3D7NA 4CTKA 1TL7C 1ZEMA 1KSFX 4NY1A 1ZJ4A 5K1ZA 2HGZA 4JBGA 5TGZA 2LXMA 3FPSA 3U4TA 4RZXA 2OBYA 1DRUA 2P9CA 2VNSA 3AHIA 5CCDA 3UJAA 3B95A 4C7BA 2JIQA 3KYBA 3MT8A 3DGFC 1LF5A 4ZOBA 2GF9A 3ZWXA 2OYSA 2PUEA 3CK8A 2YJTD 4KOAA 1PT5A 3GJ8A 3QWIA 3AEQB 2Q8QA 4C2AA 4OFXA 3WLSA 5EHGA 2EIJE 1RE1A 2J85A 4JBWA 4U3JA 2D4AA 3FH7A 5G40A 3LUBA 4DM3A 4O29A 3HXCA 1D7AA 1T2EA 5E8JA 1JIUA 1NW6A 2ZGVA 4NOMA 4PZYA 1GQQA 3GYBA 1MB3A 3GCZA 4YJGA 3VC1A 3U9WA 3G2IA 4HNAA 5GONA 4GMXA 2PGLA 5IABA 4P98A 2Z4RA 1DJMA 3E2MA 1C0KA 3AJ8A 4RMGA 2VQ6A 3FLMA 3SD7A 3E8SA 3JATB 3O7WA 3P97A 4X1KA 4BB5A 2Y1FA 3MINB 1NJ8A 3N8KA 1XV5A 5KUTA 4XX5A 5G2NA 4EJSA 2IGBA 4EDHA 3OLYA 2PM8A 3HJNA 4MDEA 5B1EA 2DE0X 1JHYA 5KAPA 5JQGF 2QU7A 5C8YA 2KM4A 4KQHA 4AQYB 1DAFA 1NQAO 3ZXPA 4QHYA 2XLBA 3VPHA 2G36A 4JBXA 2QBYA 2C7GA 3GBPA 4EHDA 1V16A 2JLSA 3VHLB 3VU1A 2FX2A 3EIEA 2B1GA 3VHRA 5H82A 5KYYB 3ZVNA 4EHHA 1G5RA 5GOZA 2CFZA 3WLFA 2GEJA 2NZVG 2WQ7A 1X92A 1GL6A 4HQFA 4JQZA 1QDLB 1JR2A 7ABPA 3OWXA 2Z5LA 4E5UA 3H3XA 1ZVJA 2DX7A 3PCXA 5J5CA 5ILQA 1L5OA 1ZY2A 1P8JA 1A8UA 2A57A 3ELYA 3JW8A 3I30X 1TZJA 1S2DA 3U56A 3DBSA 3FA2A 4OGKA 4G0UA 1O54A 2FFQA 2RSLA 3H83A 3P27A 2WDZA 5I7SA 2REOA 3FB4A 3WRYC 4L51A 3OSZA 1AIPA 3Q0EA 1UF9A 1U2GA 4RTNA 2CLDX 1M66A 3EZYA 1NIJA 2J1LA 3L4BA 2YMLA 2JI4A 4N0PA 4ZAYA 2GK6A 2IBTA 4CU5A 1P0IA 2X38A 5PGMA 4RTMA 4IUBS 1WULS 2EGHA 4R16A 4X61A 4DLQA 2YJ3A 2VNKA 4B4WA 5F35A 5CG2A 1J5XA 3SZ7A 3V4ZA 1CQPA 1J6UA 3A11A 1DRKA 3FFXA 3OWHA 4L8GA 1FFHA 3T54A 1JDTA 1JU9A 5BYJA 4B82A 1K8ZB 4MW4A 1YBAA 2C3PA 3MGGA 4PNHA 2FXVA 3IALA 3P9YA 4I50B 1JU3A 5JS7A 5KNDD 3LQFA 4NBSA 1YVEI 4DR5B 3LV8A 1T5HX 3X43A 3B48A 4MS3B 3GAAA 1W0KA 1IOZA 1R0LA 1U5BA 4JWTA 4Q6BA 4U8VD 3B5IA 4MAFA 4BNNA 4KKXB 4LYYA 2PVSA 4WPGA 2DBQA 4I1OB 5FTPA 3KU1A 2XS1A 3ODPA 3ZW9A 2PKQO 5U4QA 2UYQA 2OHJA 1NR1A 4NLLA 2JLBA 4RMIA 2C3OA 3NBMA 4TGLA 1M33A 5K6AC 3IFSA 3CVWA 3KOZA 4F86A 3KDAA 1P5FA 4YV0A 3GLHB 1I4EB 3CG4A 4KLAA 3SEAA 2F3QA 1J0BA 3C15C 3IOMA 1L7QA 3RUIA 3E03A 3U1VA 4UAUA 4LZAA 4B85A 2VTDA 4E5VA 3E7FA 1N4RA 2HSEA 4MWBA 1KPHA 4BJ3A 5K9ZA 5CCEA 2GNPA 2VDOB 3F49S 3MJCA 4GI2A 1XGWA 5DHTA 5TS2A 3UG6A 3ZQUA 5CEEA 3FHCB 1VG1A 4LYHA 2AZXA 4WLUA 4UHEA 4OHZA 2HZ7A 5I7OA 5IEJA 3ZDDA 1B16A 5FL7D 3BL5A 2WICA 5L3VA 5FQ8A 2HPZA 3AJDA 3BTOA 1E9FA 3S1AB 4XX0B 2C2BA 3NBKA 3TQIA 1SEPA 5BVGB 5LBIA 1QG0A 3UX4A 4UDXX 4BLRA 1AGYA 4G0QA 3RLIA 3TKYA 2XOEA 1RMTA 3V4PB 4QWMA 4BUZA 4KFCA 1Z29A 4HI8A 4HDMB 4CQLB 1Z17A 1BO6A 2NU9B 1Y89A 3GP3A 2CHUA 3TZQA 1M2EA 1TNZA 1DU4A 5BNWA 2XOKA 3QVJA 5JMOA 2IEJA 3R7RA 3OAAD 3NWOA 3WP0A 3L82B 4XD7D 3GJTA 7REQB 3S7ZA 1CY8A 3PDJA 4OXQA 5L3QB 3EVAA 3P8ZA 4BAUA 3PS6A 1TCUA 4GCNA 2XUIA 3BXZA 2PGOA 3JSXA 1II8A 2JGJA 1FX0B 3GW4A 2IS1A 5EILA 2FX3A 2CLHB 4KO4S 2IDZA 2W90A 3TQTA 3RQIA 3KOWA 1OAOA 1E6WA 2D1YA 2D06A 1T2FA 4ZVMA 2A33A 4OATA 3RODA 4A2QA 2ONDA 4YQYA 2GA9A 2IY8A 2RHCA 2JF0A 3D7LA 1TYZA 3A7EA 5DX0A 4B3TB 2WUEA 1KI1A 2QG9A 2IOYA 3NLLA 2B94A 5KOJB 5CA1B 2HYIC 5D85A 5J59A 3TAHA 3ED5A 4I1AA 1ECBA 3EQ2A 4R1SA 4AN1A 4CG3A 4DIDA 3EW7A 3BB1A 2IXGA 2VJOA 4UEKA 3BPSA 3OZIA 3L6RA 1N5MA 3ISTA 4LHXA 4COKA 4E14A 4DLBA 3D9MA 3GQVA 3ZW8A 1GZ3A 4L95C 1QCYA 4GKVA 4URZR 4Z7QB 3L8GA 2MR5A 2QX8A 2NNWB 4PQYA 4LNBA 4N3AA 4JSRA 4S1OA 4JIGA 5AUOB 6REQA 4FYIA 3SZGA 3IOBA 2FEWB 5LMCA 3GHHA 1S8NA 4Q15A 3FYHA 2HXGA 4RO0A 4B4DA 5J4KA 3DZKA 2HT6A 4Z68A 2BDTA 2VI5A 4MYUA 1TVEA 4P5DA 5EJ6A 2BF7A 3MILA 2YQ8A 4JZYA 1B6TA 4RHUA 3V7FA 4BYGA 1PGPA 4CLRB 2VQEB 3HVUA 2V3VA 3R9WA 3NPAA 3NIWA 3AP2A 4U04A 1LD7A 3D6HA 4U02A 4QEKA 4FFBA 1EFVA 3FU0A 4G2VA 3O4FA 5B2FA 1FJGB 4EEXA 2WR8A 3F3SA 2C8VA 4TYYA 1XZMA 3VX3A 4U7FA 2DY1A 3FSJX 3ANNA 1U0HC 3EOZA 2MSDB 1E4EA 4PG5A 1U7HA 5ANRB 5JJ7A 2AX4A 2AXNA 5SYMA 1EX7A 3V42A 5K45A 2NZJA 2V8OA 4HB5A 2OM2A 2QMZA 1C29B 3ELBA 2CVHA 3GGPA 3RYIA 1OI7A 1YR8A 2XGSA 5EJGA 1J0XO 5H3HA 3UM1A 3WKBA 1OFUA 5FOWA 1PGOA 1E94E 4RDXA 1KT1A 2CF6A 1YOBA 2ZDHA 1B0PA 3OXFA 4J2OA 4KK3A 4L5CA 4U7HA 3CY6A 1WEKA 3A9TA 3K1AA 3UGKA 4AY6A 3H11B 3UCFA 1G5FA 1UDWA 3WL3A 2G9ZA 1KKMA 1BDBA 1U2VG 3ETLA 4FOOA 1V5IA 5KNDA 2Y92A 1P39A 3EFHA 2VGYA 3PDIA 2IHJA 3DXYA 3PR3A 2NZWA 3E82A 4KGXA 1D6JA 3SEFA 3EHQA 2MOKA 1XU7A 1L8OA 3KR1A 5LZ9A 2AFVA 2RFLA 4NZPA 3G0GA 4OCZA 3BKWA 1FRNA 3TOSA 1YZUA 4BMXA 2GZ2A 2PEYA 4EA7A 1GNPA 1O1YA 3CINA 3D4NA 1M6NA 5DV9A 3O8NA 1Q22A 2JFFA 5E6RB 1K3FA 1P1FA 2CHZA 1ZA1A 2X8BA 3K31A 3K1JA 2XYVA 3P2IA 4IDBA 4ZAZA 4D81A 3LKZA 1G4UR 1AKUA 4KZCA 1XQ1A 4I50F 2X0DA 4EH1A 5FUMA 3W4KA 4DKJA 4NXMB 4Z7OB 3H86A 3O8LA 2CC2A 1KO8A 2ONCA 5CTAA 4UULA 4YP9A 2E48A 3K8YA 1Z7EA 2C7QA 3ABME 2JB9A 2PL5A 1ZD3A 1IK6A 3F8SA 2WA2A 1TGYA 1FW8A 1PWYE 3IMEA 1U9IC 3LDFA 3HRIA 3N6XA 1G2OA 4LHVA 1XQWA 1KAQA 4XM2A 4Q48A 2DKNA 4RIFA 1N75A 3ZHYA 3WGHA 2GCOA 2PZJA 3RJTA 3ZVVA 3JAKB 2FZGA 3L7BA 1YBMA 1R7RA 2WV9A 1NSTA 2CXRA 1TEVA 4ZQFA 3UT5B 1BHJA 5TS3A 3OPQA 3DONA 1LTXA 4PUCA 2P5UA 1MOSA 3OQ6A 5JHGB 1Z07A 2D1SA 2Q5CA 1T25A 4ZOLF 3ZYZA 1L5SA 2WHRA 1J21A 4NV3A 1Q0PA 4O4IF 4D8UA 4PAQA 4F96A 4OKIA 3KYIB 5BNIA 3P9CA 2XCSB 3OJCA 4URKA 1NZNA 1AOXA 2C07A 3I4RB 2W4IA 3D2BA 3R3HA 4ILGA 2IBSA 2QUIA 3CQGB 1VSTA 3U40A 4M60A 1C7IA 3BG5A 3SIPA 3CUWA 2H2FA 3KPYA 3SQXA 5M5BA 2XF2A 3EAGA 1QMPA 2FSSA 3CBGA 2J0VA 4J1QA 5IJXA 1P44A 3FXAA 1RRVA 3H1FA 1TU3A 3FVVA 4ISBA 4L6AA 3RS4A 2M2IA 4B7UA 1JR6A 3G7UA 1X2BA 2Z2ZA 2C0CA 4GMRA 1LNZA 4G3XA 4Z99A 4GXNA 1K8XB 2VQDA 1ATIA 1W44A 2ZRCA 4K28A 5REQB 1L5LA 2Z5VA 3SJ7A 3UV3A 4TTPA 3G0HA 2IU3A 4Q69A 4NH0A 4D8WA 1C5KA 5ENQD 5IS2A 4F46A 4EF5A 2QTLA 1WAMA 1N52A 2C00A 1Z2PX 2KB0A 4GMKA 3OM0A 2AJBA 1SCIA 2H1VA 3EU5A 1LCIA 4NYMR 4AK9A 1JHZA 3AHGA 4JKOA 3EGDB 5JJBA 3B13A 2W0SA 3U6BA 3SF8B 1A0OA 1K7EB 2IEIA 5I3ZA 2QL6A 4U9IS 3NMUF 1FSFA 4HUTA 2YXNA 1SVNA 2FEOA 4CV0A 3DE0X 1NJ1A 1M76A 1W1UA 5JNUA 5JTUA 2A5YB 2XTJA 4ZEOA 2XUQA 3NU1A 5L53A 1KERA 1X87A 4YVOA 2Q7XA 4M3NA 1Y6JA 3PFIA 4OQYA 1R0YA 3DF9A 2XUPA 3HKCA 3HV2A 4MGYR 4KQXA 5AKZA 3U26A 3QUAA 4CIAA 1C3VA 3FNHA 2UYYA 1JHQA 2HAEA 2QQEA 4HXEB 5KREA 1FL9A 1N2BA 1N9GB 3KM0A 2C0MA 1GPMA 2JJ2D 4HOYA 5LN1A 1M8GA 5G0SA 5HM8A 4R81A 3QF7A 4TXMA 2Z2IA 1U98A 3TFOA 4DR6B 2ECPA 4US0R 3EG5A 3FNEA 1PZMA 3QLUC 5AI4A 5EE1A 5EJ4A 1G16A 3DL2A 4D3YA 1FIUA 5MHTA 3BQ9A 3I01M 3UT4A 2O2EA 2NIPA 2PMEA 4BWRA 1T1EA 3L9TA 1C3EA 4FR5A 3GLGB 3R6DA 3QKRA 1GDTA 4CMHA 3MRVA 1B41A 3C8HA 1EGAA 4PZCA 1L9XA 4KLZA 1IEWA 2BFCA 1VE1A 2LGJA 4NFYA 2YHEA 3UWMA 4RM2A 5FI5A 3WAGA 4I81A 1GN9A 3HFJA 3PC2A 4B3XA 2C1EA 5IVPA 1DEOA 1C3JA 1V25A 2BR5A 3LH5A 2I4MA 3PIDA 4J3FA 4IIEA 4OHFA 2WILA 4O1MA 4IXTA 4ROTA 2L0IA 3JZDA 2JLZA 2EJCA 3DSUA 4M8SA 1F4VA 4HXIA 5H80A 3RARA 4LF4B 3PA6A 2AFHB 1PI3A 2MHCA 2RGRA 2JAOA 2F3RA 4JA2A 1OASA 1JDUA 3U4GA 5JISA 1OZHA 2YS7A 2YXDA 3HHEA 3OCJA 4BB6A 1N2GA 1ANKA 4FDTA 4YYZA 2ZJ1A 3H0EA 3HUTA 4MIOA 4NBNA 3ZCXA 3I5XA 3HNRA 4CW7A 3T5VA 5IKEA 1Z34A 4LXXA 1YI8A 4MGZR 4YRQA 1NV8A 4XFDA 1EXMA 3Q5EA 1OTHA 2FEPA 5EUQB 1EK0A 2DKFA 2JIDA 3I34X 3CSFA 3WJ7A 5C5DA 2WPDD 3H5NA 2XBMA 2YZ2A 4M98A 1IXYA 4W7IA 3AYXB 3HIZA 4A2WA 3TVYA 1PR6A 1RHUA 3K8QA 1GLGA 1MW9X 1ZK2A 2JRCA 2H63A 3A6ZA 3WXMA 3CKLA 5JQGA 1IULA 3WYEA 4HX5A 1IN1A 4C0QC 1V5WA 1XA4A 5F3WB 4U2FA 1V37A 4O2LA 1CKEA 3CV3A 4URVR 3IJEB 4U2CA 3SK0A 1L7VC 5EYPF 2IYPA 4EAQA 2V7WA 4YRCA 2WIBA 3KSMA 2J3EA 4MI9A 4GPEA 2W22A 2BM9A 3MUNA 2OZPA 4NZZA 1H0RA 2BJVA 3JYHA 4D8TA 5EYLA 1RKUA 1GPBA 1DLIA 1QRDA 2R17C 2QXYA 3CSUA 4M76B 5BR8B 3H5IA 2LW7A 2X3MA 9GPBA 4GBGA 2IP2A 2O0HA 4QO7A 4LCEA 5B58C 3VAYA 5C8ZA 3B5EA 3L8MA 2FSPA 4QVGA 2RDMA 3VSCA 1YQUA 1S4MA 4DI3A 3OOEA 4KDRA 4GEGA 2B6NA 4R1PA 1J9EA 2PSEA 4JU8A 1AX9A 4EY6A 2OMKA 3NCTA 4BPRA 3THYA 1DI0A 3C0KA 1XTKA 2FEAA 3CX6A 3L2OB 4H0NA 4PW0A 3L4JA 3WIVA 3PGKA 1RQ7A 3E30A 1S7GA 2AWIA 3F71A 1I24A 4I3GA 1M34A 1QGAA 2IPLA 3ZV3A 4DMLA 3LXXA 3OQIA 2G8LA 1OFHA 2R7KA 4FADA 3PGA1 4MRPA 2HKIA 3MV2B 1AUQA 1P0PA 3SXUA 3K4QA 5EHQA 5FLKA 3UBMA 3CF6R 1EK5A 3DOCA 5HX7A 2NVWA 4KBGA 4Y2GA 1T2DA 1J90A 2IEDA 4RCYA 2DPHA 4M88A 3QC1A 1I3CA 2PMFA 3B3FA 2BGMA 3PSAA 3RAUA 2CMHA 1NF9A 2QI9C 1CYDA 1UJMA 3F6PA 3AHCA 3OXGA 1Y33E 3GLVA 3V32A 4G36A 5JASA 1ISJA 1CHNA 1ESCA 1HMPA 3PIRA 4MQ4A 1UKEA 5E1OA 4ARZB 5ULLA 3GI1A 1QVAA 4CBVA 3ZD6A 1EH5A 1C0EA 3PGJA 3DD1A 2WZQA 1QS0B 1TCVA 2CNWD 3T34A 1PUIA 2JH3A 5F5XA 5CCXA 1JBKA 4GZ3A 1E3MA 1TKBA 2F9FA 3LBHA 3Q98A 3E22A 3O8QB 1NQWA 3AFHA 4JLNA 5G4KB 1XALA 4CM8B 5AO9A 2YIDA 3KUUA 3RVRA 5KYUA 1H2EA 1ZG3A 1SZPA 2JFBA 4NQZA 2WWVD 5JNSA 2J59A 1YJCA 3G13A 1YS1X 2FKAA 3D9NA 2UVDA 2H4FA 4X85A 3FDZB 2EIME 1EE9A 4CCWA 2BFDB 3WLNA 2ZIGA 2PUDA 4ZDKA 4JJFA 2YJNA 1THTA 2HL6A 5J4LA 1FPPA 2XYHA 4RJ2A 5K7SA 4TV9F 4BWVA 1YXMA 3JD4A 4QGHA