2XGTA

Asparaginyl-trna synthetase from brugia malayi complexed with the sulphamoyl analogue of asparaginyl-adenylate
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
427
Chain Sequence
VKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPNGHELIADFWKIIGNAPPGGIDNVLNASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAQDNTLTESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hybrid Structural Model of the Complete Brugia Malayi Cytoplasmic Asparaginyl-tRNA Synthetase.
pubmed doi rcsb
source organism Brugia malayi
molecule tags Ligase
molecule keywords ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC
total genus 128
structure length 427
sequence length 435
chains with identical sequence B
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2xgtA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2xgtA02
3HOZG 3BFMA 1EIYB 1Q7YC 1VQJA 1SLJA 3F2DA 1N32Q 1A0IA 2K14A 2Q2UA 3J81c 1NMFA 3IKMB 4Y7NH 2XGTA 5C0XG 1CUKA 4JCVE 4X66Q 4B3MQ 5M3MH 4GKKL 5M5XH 4A3FG 4JBKA 4DR2Q 2Q5IA 4RMFA 2ES2A 2OTJA 2RHQA 2EAYA 4JI5Q 3P8TA 1KMNA 2K5HA 3IRBA 2LXJA 3CQZH 4A3EH 4DR4L 2WP8J 5C0XJ 4LNSA 4LF8Q 1WNLA 4ZTUB 2NN6G 5JJIA 1O7IA 4YY3L 2AKWB 4YYEA 4A3JG 1KAWA 1B7YA 1K3RA 1SESA 2ZTGA 4KLKA 4BXXG 1X6OA 3KF8B 1IZ6A 1N34L 4WJ3M 4CS4A 1PA6A 5C52B 3LGJA 2ZTDA 5ELNA 3T1HL 4IPGA 2ARSA 1I50H 3A74A 3RKYA 1NJ8A 4DV7Q 4GLXA 4DV2L 3M85A 1C9OA 4OX9Q 2IY5B 1UE5A 4TVAB 4YROA 3G71A 2DXUA 2K5VA 5JJKA 1ASYA 1NY4A 3QNEA 3S2HH 4B3SL 4IPCA 2ZT5A 3ERSX 4XU3A 2VL6A 2PNHA 2BA0A 4OX9L 2I4OA 2B29A 4OWTB 2HT1A 2ZXFA 3K81C 4DNIA 4HWSA 3M4QA 1X3EA 3CCQA 1BBUA 4DV3L 5IYBG 1SERA 1VQZA 3T1YQ 4K86A 3PUWA 2AWNA 2IT1A 3GDEA 5FLMG 4YDQA 3NELA 5HGQA 4DV1L 4DV0Q 4C3JH 5IP9G 1WLEA 2K4KA 3CXCA 4JI8L 1ATIA 4NXNQ 1EYGA 4LFBL 4KHPQ 3QTCA 2ZZEA 4POGA 4OLFA 1NBWA 2KCMA 1MJCA 4YCVA 4XIGS 1YNXA 2Q7EA 2NVYH 1YB3A 5FJ8G 3ULPA 4PG3A 1YJWA 4JI8Q 2YTYA 1A62A 5E7NA 1EQRA 3EBEA 3U50C 1RIPA 2E2JH 2AWOA 4LF5L 1PH1A 3UDXA 2RHSA 3E9IA 3HXYA 3RF1A 3E9HA 4RG1A 4YRIA 3VBBA 4ZIBA 2XTIA 4A93G 4CS2A 1Q82C 1VQ6A 1QVGA 4AYBG 2OCEA 4A3IG 4LF9L 4NCXA 1N32L 1K8GA 3I4NH 3ERRA 2ZT7A 2ODRC 4TVAA 5HY6A 1WJJA 2E64A 4QGUA 4YWLA 1I94L 3HXXA 1PVOA 4DAMA 1NJ6A 5H1SE 4DK3C 2BA1A 2DU5A 3AEVA 3J7ZC 4DUZL 1FYFA 1L2FA 1RL2A 4TWAA 1XPOA 1G5IA 1P8LA 5JEAG 2OWOA 4X62Q 4LF8L 4P74A 2DZCA 3V8JA 3AFQA 3VQYA 1VQFA 3UE0A 1V43A 2CIMA 5EAYA 1VQGA 2E2IH 4H2TA 4JI1Q 3I4MG 1JB7A 3A7RA 2IHFA 3U4ZA 3RLNA 4DQ2A 3F2CA 3A32A 1KD1C 2AHOB 4B3ML 1WFQA 3PF5A 2Q7HA 1H4SA 3PZCA 4YRTA 1CSPA 4CH5A 3S1QH 2MFIA 2JA8H 1NTGA 3HKZG 4GKJL 4IJLA 2J3MA 4HJ9A 3GTQH 5IP7G 1EQQA 1OTCA 1K83H 3FHWA 1KC8C 3UE1A 12ASA 4XEOA 3L0OA 2ZINA 1SROA 1X9NA 2DTOA 4YRSA 2QHSA 5DLQE 1JJGA 2F4VL 2UUBQ 2Q5HA 4A4IA 1H4QA 5C51B 3M4PA 3HRIA 1HR0Q 5IY0A 2DU7A 1YI2A 2K52A 4KR3A 2DKGA 4DV4L 2P0LA 3PUVA 1J5EL 1HTTA 4XTWA 2PMEA 1SRUA 2ARTA 4TQDA 1K9MC 4A93H 2N8NA 2ZJRA 2I5HA 2Q2TA 3U58A 4P3NA 2ZZFA 1VQDA 4TTVA 1P16A 4GOPC 4A3BG 4HJ7A 1G5HA 1LUZA 1Y1VG 4AYBE 3A5ZB 1XJVA 4IOAA 5E3IA 4Y52H 5C44H 4NB3A 1Z47A 4JI0L 1Q86C 2HHHQ 2ZIOA 3CCUA 3V8KA 4NXML 3HOYH 4APVA 4AQYQ 3S15H 4A3DG 3B6YA 3K0XA 1FL0A 2K75A 3K80C 3VQWA 2ZM6L 1PH5A 4LF5Q 4K88A 5IYBH 1QUQB 1GD7A 4A3CH 3HY1A 4LFBQ 3RIRA 2UXBQ 1X3FA 1G51A 1YFTA 4YRNA 4HJ5A 4Q6GA 4XU2A 2ZIMA 3I4OA 3RKXA 1YHAA 2N78A 2G4CA 4KQEA 1HZAA 3MF2A 3NBHB 4GOPA 2D62A 1Y1WH 1L1OB 5IP7H 1QZGA 3FJPA 3PIPA 3PGZA 2C8MA 4BBRH 3S16H 3RUXA 4B3TL 3CMAA 1K0RA 4TVWA 4OO1I 1X56A 2WFWA 1OXXK 3U4VA 4JI4Q 4DV6L 4JBMA 2L15A 3HKZE 5M5YH 4DR6Q 2YU9H 1PYSB 1YFSA 3KYHC 4YP0A 4DV6Q 2RHSB 4ZTZB 3UGTA 1PH8A 4LW1A 3GTLH 1HJPA 3FKIG 3D31A 1B8AA 4CH6A 1CKOA 4MNOA 1UEBA 2MNAA 2CJBA 2ZR2A 2FXQA 4Q15A 3G1ZA 4A3LH 1GVPA 3NENA 3M3YH 4GNXA 4YCWA 2ALYA 1I6HH 2NVQH 3H0GH 1N34Q 3CCSA 1IBLQ 4H2XB 3GTOH 1E7ZA 3GD7A 5C4XH 2DDZA 3CC2A 1A8VA 5FLXc 4JBJA 3RNUA 2ARUA 4DR4Q 2PMFA 4GOPB 4JC0A 3RLFA 1EVLA 1W2BA 1TWCH 4YREA 3UDFA 2UXCQ 4AIMA 3G4SA 1M90C 2CJ9A 4BY1G 4XTUA 1YZ6A 4DV5Q 1X3GA 4GKKQ 2EIFA 4DR5Q 2CFMA 2ASBA 4CH4A 2DJZA 3A5UA 3BU2A 1Y1VH 3OYYA 1SR3A 2KHJA 1PH9A 3HFVA 4WJ4A 5GROA 1QUQA 3FP9A 4OONA 1CKNB 1XNRQ 3RGLA 1VS0A 1HNWQ 4QY7A 5IYCH 2ODRD 1HZ9A 2K5NA 4O0AA 1EIYA 4IFDI 2VUMH 3PUZA 4LF6L 1KL9A 3UDGA 3BJUA 4YHHQ 4A3GG 4X65L 1V9PA 3T1HQ 4L5RC 4H2SA 1L1OA 2DVEA 1M1KC 4YWMA 3RR5A 4JOIA 4O2DA 2BH8A 4JI6L 2VQFL 3MEYA 5FJ8H 2I4MA 4BA1I 1CKNA 3I2ZA 2OQKA 4EX5A 3BZCA 4TQUS 4YY3Q 3DLLA 3STBD 4ALPA 5GADC 2UUCQ 3CP0A 1HNZL 3S2DH 2EJGA 2JA7H 2NN6I 1B70B 3HTZA 2EJFA 3QO8A 4HWPA 2BH2A 4JI5L 4R4OA 1HR0W 4PHCA 4B3RQ 1VQEA 2ZTEA 4OXPA 2EL9A 1QVFA 2R93H 1FJGL 1OXVA 3CCEA 2QGQA 4QJFA 5F5WA 4KHZA 3NETA 1EIFA 2EJ9A 3WQZA 1VQIA 3CCVA 4P75C 3G6EA 1IL2A 4A3LG 4H2YA 4HA8A 3EFSA 5C0XI 2F3IA 4K0KL 4OP0A 4EQ5A 4LF6Q 5JJLA 2E1HA 1HNXL 4HIKA 3HOWH 3ULJA 2QHVA 2VQFQ 3HOWG 2VZAA 3M7NA 1IBKL 1N8RC 3MXNB 3A5ZA 4OWXB 3A0JA 2E10A 5C53B 1NMGA 4DAYB 1VQAA 3ZJYC 4XTXA 4MTNA 1ASZA 4LF4Q 3UDIA 1NYRA 2I5MX 3G48A 5LMUQ 4GN4B 2IX0A 3JC66 4LWCA 2K50A 5GQOA 2EQSA 4DR6L 4LF4L 4BY7G 4H2UA 5IWAQ 4P71C 2R93G 2QHTA 2DXTA 2GVAA 2GN5A 3H15A 4R4TA 2B63G 1YHBA 1FVIA 4UP9A 2HQLA 5J3BA 1Q8KA 1KRTA 2PI2E 1JT8A 3OTOL 1U5KA 2ZNIA 3CMQA 4DV5L 2R92G 3L7ZC 1PFSA 3F1ZA 5AJ3Q 1SFOH 3QO7A 5LMNW 3I4NG 1UE1A 1R9TH 2OQ0A 1NJIC 1XNQQ 2UXDL 2JJQA 1S40A 3KOJA 2JE6I 1K73C 3CW2C 1YHQA 1N36Q 1Q1BA 3HKSA 1EFWA 3KLWA 2MO1A 2CQOA 4HVCA 1L1OC 3JAMi 4TVYA 1UE7A 4R1JA 2R92H 4LNQA 2YV5A 4E51A 2R7FA 4DV0L 4GNXB 2DQ0A 3EN2A 2WB1E 3S1RH 2UU9Q 2D0PA 5IP9H 2IY5A 1PH6A 4DR7L 4A75A 3K7UC 5AJ3L 2P5IA 3HOUH 4JBWA 3I56A 3A31A 4JI6Q 3P8VA 4JI3L 3TS2A 1E1OA 2A1AA 1AE3A 2R7ZG 3D0FA 1BKBA 3V7SA 1TWAH 1KOGA 3HOXH 3M4OH 1KIXA 3ICAA 1H4VB 1TWFH 2MQHA 5GAHC 1YIJA 1Z7NA 2I0QA 5LMNQ 4LFAQ 4R4IA 3H3VI 4RQEA 2PQAB 1PV4A 3ER0A 1OXUA 1NYQA 3PUYA 3Q8DA 2WAQG 4GLAC 2JA8G 2D0OA 2OTLA 5LMUL 4YCUA 2ZCEA 1VQNA 1Q46A 3F8TA 2IHEA 1MKHA 1SETA 4YRQA 1J5WA 5JEAJ 2VS1A 2VQEQ 1QE0A 4H2WA 3W3SA 4P71A 2ZR3A 3TREA 4GN3B 2DTHA 1X2GA 3HXZA 4XTYA 2DEQA 4KI0A 1W3SA 2UXCL 1YGBA 3AYHB 3PF4A 4PMWA 2UXBL 1IBML 4HIDA 1KRSA 1AE2A 4GNXC 3LC0A 4X6AH 3BZKA 2HHHL 1C0AA 2PI2A 4JI0Q 1S72A 1WPYA 2CWAA 1VQMA 1VQBA 5IT9c 2ZGWA 4DKAC 1GO3E 5BR8Q 3MF1A 3L2ZA 4YRFA 3CC4A 2N3SA 1HNZQ 4P75A 3CCRA 1VQ9A 2JA6G 1PHJA 4X65Q 4YHHL 4LUVA 4JYAL 2CWPA 3E0EA 2RHQB 4HWTA 2ATWA 4JI2Q 2KENA 4BBRG 4IPHA 4L87A 4YRJA 3J7A5 4HJAA 4J15A 3HY0A 1G291 2VQEL 1E22A 4H2XA 4BW9A 1V1QA 1VQ5A 1I5FA 2NVXH 1RIQA 1I94Q 2RCNA 4H02A 2WB1G 4LF7L 4YPFA 4FDBA 3KDFA 4K87A 1VQCA 4DUYL 2VUMG 3GTKH 1PYBA 3RN2A 4LUOA 4JI2L 1XMQL 2JEAI 1N33Q 2RF4A 5K1XA 4YWKA 1VQHA 2UUBL 1XMOL 1B7YB 5M3FG 4LFCQ 1Q1EA 1SE8A 1Y14B 2ZNJA 3IG2A 1SN8A 4XTZA 1YJNA 1WCMH 4LUZA 4XEMA 2E41A 2J3LA 3CCMA 2Y0SG 4DR5L 1SMXA 2QA4A 2AKWA 4YRPA 2Z6KC 4TQFA 2ALYB 1H4TA 4BY7H 2JA6H 3UFGA 3OW2A 2UUAL 4IPDA 3HOVG 4L5SA 4JV5L 1LYLA 3H0GG 4AQYL 4BY1H 1EWIA 2F52A 1YJ9A 2E65A 3F2BA 1ADYA 4YRKA 3L1AA 1XNQL 4BA2I 2UXDQ 3DSQA 2E5LQ 2R6GA 2WAQE 3SGIA 4DV1Q 4AH6A 1EVKA 1IBLL 2LSSA 4C2MH 4P3OA 4RQFA 4QL5A 4DUZQ 2FYKA 2CGHA 4UPAA 2DTIA 4P74C 5LMNL 4C3IH 1K8AC 1D7QA 2AMCA 5ELOA 2EWNA 2DGYA 3CAMA 4A3KG 2N49A 2KHIA 4EO4A 1CKMA 4JI4L 1JJCB 1X54A 2JK8A 2EXDA 5IWAL 4LF9Q 1KQSA 1NNHA 4DV2Q 3PO3H 3M9BA 1J5EQ 1NJ2A 3A5YA 1Z9FA 3VQXA 4A76A 3A7UA 4A3KH 2JA7G 1X65A 2GVBA 1XTDA 1USYC 1JJ2A 3K8AA 4B3TQ 1BIBA 4BXXH 1IXRA 2F4VQ 4WF2A 4JI7L 1J6QA 1JE5A 2E5LL 2Z6KA 1JJCA 1BBWA 1ADJA 4A3MH 1S3OA 3RZOH 4A3GH 4A3IH 1Y1WG 4YRRA 4A3DH 4UP8A 1Q81C 4HWRA 1A63A 3HOZH 3A7AA 4PZ6A 2A19A 3UGQA 4HIOA 3HOVH 4DR2L 2Z0SA 2I4NA 2I5LX 1L0WA 2UUAQ 2R7ZH 3T1YL 5C44G 2JA5G 1NJ1A 3I7FA 3P8YA 2Q2HA 4GLVB 3S1NH 4HWOA 1FGUA 1YEZA 3I55A 2JEBI 3HOUG 5IYCG 1SRYA 3RACA 4JI7Q 2ZT6A 3HRKA 3WWVA 2KBNA 1KXLA 2DUDA 3GO5A 2B3GA 1NE3A 4BBSH 1OXTA 3GTPH 3PSIA 2YTVA 2DQ3A 2HNIA 4B3SQ 3VDYA 1MJEA 1XMQQ 4G85A 3RZDH 1WQWA 4DUYQ 4YRCA 4A3MG 4A3BH 1USYA 1H95A 4L5QA 1VQ4A 1VCIA 2E2HH 2NZOA 4JYAQ 3TEHB 3V8LA 5C3EH 2NVTH 3W1GA 3H3VH 1YVCA 1VQOA 1HR0L 4BWAA 3ICEA 4XU0A 4HJ8A 2ZJPA 3PUXA 5FLMH 4R4QA 4X5OA 1T9HA 4POFA 3REUA 3GTGH 3FKIH 1I3QH 4DR3Q 1FJGQ 4GKJQ 3HXVA 1GKHA 3CCLA 3OD1A 1PH7A 3HXWA 3HFZA 3EFRA 2VW9A 3KJPA 4C3HH 2QHUA 3TUPA 3DM3A 5GAEC 4PZ8A 3CC7A 3L4GA 1QZHA 3CD6A 1Z7MA 2QEXA 1UWVA 3L2PA 3GTJH 4HIMA 3TS0A 4H2VA 3L4GB 3EIVA 3ULLA 1NJ5A 4JI1L 5IE8A 1PYSA 1HC7A 1DGSA 5IYDG 1XMOQ 3V7CA 2HIVA 1G6PA 4DR1L 3JAMc 4LFAL 4X62L 3V7RA 1E1TA 5M3MG 3J80c 4G84A 5C4JH 3W1BA 1IYJB 4IFDJ 3KF6A 3PO2G 3TEGA 1UE6A 2V1CC 1XPUA 1Q12A 3CPFA 3CPWA 1WU7A 4JI3Q 3TEHA 1TWHH 2PMZE 2Q2IA 2AMCB 5C3EG 4A3FH 5M5WH 4R4CA 4QQBX 4YRLA 4WI1A 1PH3A 3AQQA 2PQAA 4DPGA 5M3FH 3W5OA 2VY3A 2IX1A 3TQYA 1YFRA 1HXDA 4UY8C 5KNNA 4A3CG 1VQ8A 2UU9L 1JMCA 2CJAA 3VQVA 1E24A 2YYZA 1KMMA 3J81i 1QVCA 1YITA 4P3PA 3REXA 4DR7Q 2ZJQA 3J80i 3S17H 3S1MH 2CCZA 2JQOA 2C7IA 3CCJA 4CS3A 4DK6C 4IJHA 4JG2A 3KJOA 3OTOQ 2ZM6Q 1VQ7A 1YBYA 4IOCA 1QF6A 3PV0A 1HH2P 3CMEA 2E8GA 3QO5A 1BVSA 4OWWB 4P72A 3S14H 2E5AA 3LSQA 3RLOA 2JA5H 4KR2A 4KHPL 4NXNL 5GAGC 5K36G 4IO9A 2A8VA 3RKWA 1D8LA 4XTVA 1CSQA 3S24A 2Q7GA 5IYDH 4DV3Q 3AFPA 3R07A 2C35B 4UP7A 2B63H 2NZHA 4LFCL 1WYDA 2E3CA 4PZ7A 3PO2H 4YRMA 4P73C 1W66A 5C4XG 1WI5A 2ZT8A 1HZCA 1B70A 3TRZA 4DV7L 1E3PA 1VQKA 2I4LA 1HNXQ 2ZZGA 4P73A 1VQLA 4K0KQ 1IBKQ 1EOVA 4A3JH 4XU1A 1VQPA 1C7YA 3KDFB 3K7AH 4GN5A 1PH2A 4YRGA 2Y0SE 3PO3G 3PCOB 1AH9A 2JA9A 4NPSA 3KF6B 2CKZB 3IKLA 4QIWE 3KFUA 4GS3A 3HXUA 1WQ7A 5K1PA 4JV5Q 1N36L 3I4MH 3CF5A 4X66L 4NXMQ 1B76A 5BR8L 4B3RL 1IBMQ 1TXYA 1X2HA 4CH3A 4A3EG 3RN5A 1PH4A 4RDXA 4DR3L 1KHIA 2MO0A 3RL6A 1U0LA 2H5XA 3IALA 3LSSA 1LM0A 1N9WA 2YTXA 4L5TA 1TWGH 3STBC 1X55A 3UH0A 3HOXG 2UUCL 3HFZB 1GGMA 4MZ9A 2HIXA 2ZTCA 1N33L 3NEMA 2VNUD 2KCTA 1HNWL 4X64Q 2ID0A 4LF7Q 4OO1G 3PIOA 11ASA 3MEFA 4ME3A 4DV4Q 2DZ9A 3PCOA 2R7DA 4DR1Q 1HZBA 1OXSC 1WCMG 4JOIC 1MIUA 1EUJA 3HOYG 4P72C 1WOCA 1X01A 4X64L 4IFDG 3J81j 1LTLA 1XNRL 4BBSG 2LXKA 1BIAA 1XPRA 3GTMH 4XTCS 1GM5A
chains in the Genus database with same CATH superfamily
4FXDA 3HOZG 3BFMA 2MJ8A 4J8QA 4H44C 1PXUA 5ELFA 1EIYB 1Q7YC 1VQJA 3CKIB 1SLJA 1HTPA 3F2DA 1K0SA 1N32Q 1A0IA 1D1IA 1SYBA 2K14A 2Q2UA 1DJRD 5JAVA 3J81c 2QF7A 3S14B 5KEEA 2XNAC 2Q8IB 1NMFA 4IURA 3IKMB 3H94A 4Y7NH 2XGTA 5EPKA 5C0XG 5E4WC 1BCPD 3BYTB 1CUKA 4JCVE 3TP5A 1MGSA 4X66Q 4J6HA 2H4OA 4B3MQ 5M3MH 4GKKL 3N52A 2XVSA 5M5XH 5KNCA 1WTVA 2B2TA 4A3FG 1TWAB 1WD0A 4JBKA 5FKAC 2XWBB 4DR2Q 4I65A 2Q5IA 3H6MA 1J8IA 4C3JG 4RMFA 3D4DA 2ES2A 2OTJA 2RHQA 1AZQA 2I46A 2EAYA 3I4LA 4JI5Q 3P8TA 1KMNA 2K5HA 2X6LA 3IRBA 2LS01 4RGMA 2PZUA 2LXJA 1T5XD 2HQEA 3CQZH 4A3EH 1SYGA 1ZYRC 1QILA 2K7VA 5KNDA 4DR4L 4CDCC 4ZUJA 2A73B 2WP8J 3H09A 5C0XJ 4LNSA 4LF8Q 1WNLA 4ZTUB 1SAPA 2NN6G 5JJIA 1O7IA 3P20A 3PIP3 4YY3L 5A2QE 3S1RB 2AKWB 2CW0D 3QIAA 3QWNA 1ONLA 4YYEA 4A3JG 1H9SB 1KAWA 1A6XA 4QB4A 1B7YA 1K3RA 2F0NA 2Z4HA 1SESA 2ZTGA 4KLKA 3VR4A 3SK4A 4BXXG 1X6OA 3KF8B 4FVMA 1IZ6A 2Q8TA 1N34L 4C3IG 4WJ3M 3MZ5A 4CS4A 1PA6A 1V8QA 3Q23A 5C52B 5KYLA 3LGJA 1ILPA 2ZTDA 5ELNA 3T1HL 4IPGA 4YIJA 4X3KA 4G7ZC 3IFTA 2ARSA 4GZYC 1I50H 3A74A 3RKYA 1SJHD 1NJ8A 4A3DB 3D4WA 4DV7Q 4GLXA 4DV2L 1EFID 3M85A 5ISRA 1C9OA 4OX9Q 2IY5B 1NCVA 1UE5A 2KQ3A 2VB2X 5JVG3 4TVAB 4YROA 1I4GA 2F0VA 2Z1CA 3G71A 2DXUA 2K5VA 5JJKA 1ASYA 1NY4A 3QNEA 3S2HH 3SDZA 4B3SL 4IPCA 4R8NA 2ZT5A 3QB3A 4KY6A 3ERSX 4XU3A 1CHPD 2VL6A 2PNHA 2BA0A 4OX9L 1ENAA 2I4OA 2B29A 3HOUB 4OWTB 2HT1A 1EY4A 4P2CB 3K81C 2ZXFA 4DNIA 4XYQA 4HWSA 3M4QA 1X3EA 3CCQA 5FLXE 3A7AB 1BBUA 4DGZA 4DV3L 5IYBG 2F0MA 5CORA 5EBDA 4A3GB 1G91A 1VQZA 3T1YQ 1SERA 4K86A 3G7LA 3PUWA 2AWNA 2IT1A 3DMUA 4FF1A 3GV3A 4Q0FA 2RA4A 2Z6BA 3DUZA 3GDEA 5FLMG 4YDQA 2F0UA 3NELA 5T1IA 5HGQA 4DV1L 4DV0Q 4C3JH 5IP9G 1WLEA 2K4KA 3CXCA 4JI8L 5CR3A 3SEBA 1ATIA 2DN8A 4NXNQ 1EYGA 4LFBL 4KHPQ 3QTCA 2M2LA 4QUCA 4POGA 2ZZEA 4OLFA 1NBWA 4DNRB 1TWHB 2KCMA 1MJCA 4YCVA 4XIGS 1YNXA 2Q7EA 4HAEA 1KTKA 2NVYH 1YB3A 4BY1B 5FJ8G 2EJGC 3DM1A 3OPOA 4QF4A 4IZ8A 3J7AV 3ULPA 4PG3A 1YJWA 4JI8Q 1PFBA 4WJWA 3NBHA 1O7YA 1YNNC 2YTYA 1A62A 5E7NA 1EQRA 1WTHA 3PIO3 1KLUD 3EBEA 1SSOA 5C4XB 3U50C 1RIPA 1S5BD 2E2JH 2AWOA 3MTSA 4TRDA 4LF5L 5CV6A 1PH1A 3UDXA 2RHSA 3E9IA 4EQNA 3HXYA 5IGFA 4CDDC 5DEHA 3RF1A 3E9HA 2IWHA 2FMCA 3QR8A 2R7ZB 3NSWA 4RG1A 1SXTA 3VBBA 4YRIA 1IKLA 1GUWA 1K3BC 4N8X1 1A3UA 2TMPA 4ZIBA 2XTIA 1LTAD 4A93G 1MHWC 4CS2A 2E2IB 1GHKA 1LTID 1WTPA 1Q82C 1SNDA 4UHVA 1VQ6A 3HG9A 1QVGA 1SMYD 4AYBG 3RD4A 2OCEA 4A3IG 4LF9L 1NR4A 1ESRA 2EYPA 4NCXA 1N32L 2AQ1B 1K8GA 1F2YA 1KLGD 2E2JB 3I4NH 3ERRA 4LVKA 3HEJA 2ZT7A 2ODRC 3NK9A 4TVAA 5HY6A 4FO2A 1WJJA 2E64A 4QGUA 3U9OA 5G3LD 4ULLA 4YWLA 1HFGA 3AMUA 2B2YA 2RCFA 1IYVA 1I94L 2A74C 1BQQT 1PTOH 3VYTA 2SNMA 3E5SA 3HXXA 2ZXPA 1PVOA 2B8GA 4DAMA 1NJ6A 5H1SE 4L8JA 4K14A 4DK3C 2PCFB 3HRZC 4IUQA 1JCKB 2BA1A 4IUUA 2DU5A 2GA4B 3AEVA 3J7ZC 3HZXA 4DUZL 1FYFA 1K28A 1L2FA 3FKIB 1RL2A 4TWAA 1XPOA 2M9VA 5G3LF 3K7AB 2EYMA 1G5IA 1P8LA 5JEAG 1TVXA 2OWOA 1TIID 4X62Q 4LF8L 4P74A 3OW7A 1Q3LA 2IJ0A 5C3XA 2DZCA 3V8JA 2SOBA 3F2UA 3AFQA 3VQYA 1VQFA 3UE0A 1V43A 4MTKA 2CIMA 4K8IA 5EAYA 1VQGA 1O7LA 2N55A 4EQPA 2E2IH 1D5MC 4H2TA 4JI1Q 1JWMD 3I4MG 4OIKA 1JB7A 3A7RA 1AEXA 1O80A 4KK7A 4K5VA 3BZDB 3I8ZA 2IHFA 3U4ZA 3RLNA 4DQ2A 1I6VC 3F2CA 3V96A 1PZJD 3A32A 1KD1C 2AHOB 4B3ML 1WFQA 2Z4IA 3I72A 4K2LA 3PF5A 1HA5A 2Q7HA 1H4SA 3DWAA 3PZCA 1D5XC 2DJFC 4YRTA 1CSPA 3VR6A 1M4VA 3JAML 4CH5A 1BCPF 3BYYB 3S1QH 2MFIA 2JA8H 1NTGA 4JVZA 4IUTA 3HKZG 4GKJL 4IJLA 2MHVA 2J3MA 4HJ9A 3GTQH 5IP7G 3R93A 1EQQA 2PPBC 1OTCA 3ONAB 2K5DA 4DF7A 5FOBB 1K83H 3FHWA 1KC8C 3UE1A 1CHQD 1HCZA 1LABA 1LACA 3L0OA 3J7AF 12ASA 4XEOA 2ZINA 1STGA 1SROA 1X9NA 1BCPC 2DTOA 1U4RA 4YRSA 4G7OC 2QHSA 4S3SA 5DLQE 2JA5B 1XWEA 1JJGA 4CHTB 2F4VL 4HN7A 3K59A 2F0WA 2XN9C 2UUBQ 2Q5HA 4A4IA 1H4QA 4BBRB 3S16B 3M4PA 5C51B 3HRIA 1HR0Q 5IY0A 3DXJC 5D14A 1D5ZC 2DU7A 1YI2A 2K52A 4KR3A 2DKGA 3VR3A 1EY9A 3T56B 4DV4L 5A2QL 2AUKA 4KHVA 2P0LA 3PUVA 1J5EL 5LHY1 1HTTA 2RDGA 5C3EB 4XTWA 1PFNA 2PMEA 1SRUA 2ARTA 3K5OA 4TQDA 1TWCB 5CGKA 1K9MC 4A93H 2N8NA 2ZJRA 2I5HA 4ZAIA 2Q2TA 3U58A 4P3NA 2ZZFA 1VQDA 2CH4A 4IFDH 3T53B 1FYCA 4TTVA 2L5TA 2C9OA 5K36H 1P16A 4GOPC 4A3BG 3E0JA 3Q6SA 4CBVA 4NMZA 4HJ7A 1G5HA 1LUZA 1Y1VG 3QJYA 2AQ2B 4AYBE 3EJIA 3W3AA 1ENCA 2NWGA 3A5ZB 1XJVA 2O5JC 4IOAA 1JICA 4I7ZC 5E3IA 1G2SA 4Y52H 5C44H 2A68D 1I6HB 4NB3A 1E0BA 3P75A 1Z47A 2KA7A 3VYUA 5EQ0A 4A3EB 4C3HB 2ICEC 1BR9A 4HCEA 3NXWA 4JI0L 1Q86C 2XIWA 2ENBA 2HHHQ 1KAAA 3NWTA 4FXKC 1S5CD 3CCUA 1TS4A 2F0OA 2ZIOA 3V8KA 1XYIA 3R8BA 1JOOA 1NUCA 4NXML 4APVA 3HOYH 1HUMA 2K6AA 4KKSA 4XYOA 4AQYQ 3S15H 4A3DG 3LWUA 4CDFC 3B6YA 3Q0AA 3K0XA 1I4PA 1FL0A 1ZEQX 3M4OB 1GUOA 2K75A 1CK1A 3K80C 1ET9A 3VQWA 2ZM6L 1PH5A 4LF5Q 2CH4W 1G8ZD 4K88A 2JP1A 5IYBH 1QUQB 1GD7A 4A3CH 3L3OC 3HY1A 5FO7B 4LFBQ 5I9PA 3RIRA 1QOHA 3NBIA 2UXBQ 3Q24A 1X3FA 1G51A 1YFTA 3NTKA 1SYEA 2PZTA 2OEOA 4EQOA 4YRNA 4HJ5A 2F3WA 4Q6GA 2IW3A 4XU2A 2ZIMA 1IW7C 3K57A 2KECA 3I4OA 3RKXA 1YHAA 1C48A 2N78A 2K33A 2G4CA 2V4DA 4KQEA 1HZAA 3MF2A 3NBHB 4GOPA 2D62A 1Y1WH 1L1OB 4ZK9B 5IP7H 1QZGA 3BVZA 4CJ2C 3PGZA 1HQMC 3PIPA 2C8MA 3FJPA 4BBRH 3S16H 3K0YA 3RUXA 1PTOD 1QWYA 4B3TL 3CMAA 1K0RA 4TVWA 4OO1I 1AZPA 3P1HA 1X56A 2WFWA 2X6GA 1OXXK 3U4VA 4JI4Q 4WORA 5DM73 1QG7A 2B2VA 4FP5D 1UUPA 4CKCA 4DV6L 4JBMA 4CJ0B 2L15A 3HKZE 4JK1C 5M5YH 4DR6Q 1TS3A 2YU9H 3C46A 1PYSB 1YFSA 5BN5A 1EYDA 3KYHC 1S5DD 4O1NA 4YP0A 4R9WA 4DV6Q 2RHSB 2X69A 4ZTZB 2SNSA 3UGTA 1NR2A 1PH8A 4LW1A 3NPPA 1BCPB 4NW2A 1E2WA 2NN6H 2QKIC 2K32A 5J39A 3GTLH 4HSVA 5IIFA 5FO8B 1HJPA 1K8MA 3FKIG 1EIHA 3D31A 1B8AA 1S4ZA 4B08A 3TDQA 4CH6A 1F9SA 2B2TC 1CKOA 2C5CA 3PQIA 2J0TD 2KHSA 1PLFA 4MNOA 1UEBA 2EZVA 2MNAA 5IGDA 2CJBA 2ZR2A 2FXQA 4Q15A 4BBSB 3G1ZA 4A3LH 1GVPA 3NENA 2PW5A 3MAQA 1R9TB 3PMFA 3M3YH 4C3HG 1EEFD 4O42A 4YCWA 4GNXA 2ALYA 2F0SA 1I6HH 2NVQH 1I4HA 2NTSA 5I6WA 1IL8A 3KK7A 4TKOB 3H0GH 1N34Q 4KN4C 1SBBB 1LLRD 4LK1C 1SE4A 3CCSA 3CRLC 1IBLQ 3K58A 4H2XB 1CZGA 3GTOH 4I7AA 1E7ZA 2F0FA 3DEPA 2RDHA 2B39A 3GD7A 5C4XH 2DDZA 2TSSA 3CC2A 5I2XA 1A8VA 5FLXc 4JBJA 3RNUA 1WTWA 1GUNA 2ARUA 2EPBA 2RSOA 4DR4Q 2PMFA 4GOPB 1LTRD 2LKVA 4JC0A 2XSCA 3RLFA 1B50A 1EVLA 1W2BA 1TWCH 3UDFA 4YREA 2UXCQ 4AIMA 5DNFA 3G4SA 1Q8IA 1M90C 2B8FA 3AU7A 4DFAA 2G9DA 1WTOA 2CJ9A 2WKDA 5I4DA 4BY1G 4A3KB 4XTUA 3DHQA 1YZ6A 1PRTD 4DK0A 4EVOA 5D3IB 1KDCA 2B63B 2I07B 4LMQD 4DV5Q 3ND9A 5KGUA 1X3GA 4GKKQ 2EIFA 3OWEB 1CTMA 3I4MB 4DR5Q 2CFMA 2CVRA 2ASBA 1A2TA 3SVMA 1PRTB 1BBXC 1RHPA 3MXGA 3LWEA 4CH4A 2DJZA 1MD2D 3TSSA 4FF4A 4RWSC 4IN3A 3A5UA 3BU2A 1Y1VH 3OYYA 1Y8OB 4H7BA 1SR3A 1H9MA 2KHJA 1PH9A 3HFVA 4WJ4A 1PRTF 1SMYC 4RGTA 5GROA 4IUVA 3T4AC 1X3PA 1QUQA 3FP9A 4DN4M 4OONA 3CHBD 3HKZB 3T51B 3C2PA 1U4MA 1CKNB 1XNRQ 1Y8NB 3RGLA 5M5XB 3TBIB 5CV7A 1VS0A 1HNWQ 4QY7A 5IYCH 2ODRD 1HZ9A 2EYLA 2K5NA 3FDTA 4O0AA 1EIYA 4IFDI 4N8FA 2NZ1D 1LT3D 1F77A 2VUMH 3PUZA 4LF6L 1KL9A 3UDGA 3BJUA 4YHHQ 4A3GG 4X65L 1V9PA 3T1HQ 4L5RC 2F0EA 4H2SA 1L1OA 2DVEA 4LVIA 1M1KC 4QCLA 4YWMA 3RR5A 4JOIA 4QUFA 4O2DA 2BH8A 4JI6L 1I4XA 2F03A 2VQFL 1Z6HA 3MEYA 5FJ8H 2I4MA 4BA1I 1QB5D 2F0GA 4PQXA 3BDOA 1CKNA 3I2ZA 2OQKA 4KKTA 1STEA 3HS0C 1D6EC 4EX5A 3BZCA 4TQUS 4YY3Q 2WAQB 3DLLA 1B2TA 3STBD 4ALPA 5GADC 4RFBA 1B9NA 3CP0A 2UUCQ 1UAPA 1RD9D 1IW7D 1HNZL 3S2DH 1GXDC 3D6CA 2EJGA 2JA7H 3KLRA 2NN6I 1B70B 5M3FB 5A35A 1EYCA 2EJFA 3HTZA 2A6HC 2PYKA 3QO8A 5I2YA 4HWPA 2BH2A 3CQZB 5C4HA 4JI5L 4R4OA 1HR0W 4PHCA 1MI2A 4B3RQ 4LJZC 1VQEA 1STNA 2ZTEA 4OXPA 5CYUA 5CC4A 4OHJA 3K5NA 2BE5D 1QVFA 2R93H 2EL9A 3ND8A 1KNAA 1YNJC 1FJGL 2NBFA 3CRKC 3A55A 2O4XA 1OXVA 4MIUA 3WOEA 4ABNA 3CCEA 2QGQA 3JAME 1WTXA 3D3RA 4QJFA 5F5WA 4KHZA 3NETA 2F0TA 1EIFA 2EJ9A 4A3JB 3WQZA 1PMRA 1VQIA 3I4NB 1CT1D 5C6AA 1LTBD 4MN3A 3CCVA 4P75C 5F2DA 3G6EA 1IL2A 4A3LG 4H2YA 2MUYA 4HA8A 3EFSA 5C0XI 3FVQA 2F3IA 5M5WB 4K0KL 4OP0A 4EQ5A 4LF6Q 4AYBB 5JJLA 3S1MB 4LVJA 2E1HA 1HNXL 4HIKA 3HOWH 3ULJA 2QHVA 4J1MA 2VQFQ 3HOWG 5EKIA 2VZAA 2NB0A 2KJXA 3M7NA 1IBKL 1N8RC 3MXNB 3A5ZA 1F9QA 4OWXB 3A0JA 2E10A 5C53B 1BF4A 1HQRD 1NMGA 4DAYB 1VQAA 3ZJYC 1V1OA 4ID6A 2A6ED 4MTNA 4XTXA 1ASZA 3V2TA 4CJ1B 3IAYA 4C2MB 4LF4Q 4U673 2DNCA 5IGBA 3UDIA 2DY8A 4BS9A 1NYRA 2KEEA 1ZXTA 1LTSD 2I5MX 3G48A 5LMUQ 4GN4B 2IX0A 3TN2A 3JC66 4HSPA 4UAIA 4LWCA 2K50A 2OT2A 5GQOA 2EQSA 4DR6L 1SNPA 1SNQA 3E3XA 5E1FA 4LF4L 5IT9E 4BY7G 4H2UA 5IWAQ 4P71C 2R93G 2QHTA 1ESFA 1AP0A 1RTNA 2DXTA 1DYQA 2GVAA 1MSGA 4RGNA 4DXFA 4FYDA 2GN5A 1TWFB 4R4TA 3H15A 2B63G 1YHBA 1FVIA 4UP9A 2HQLA 1WTRA 1I4RA 5J3BA 5CBAE 3C1FA 1Q8KA 1KRTA 2PI2E 4RHSA 1EOTA 3GQBA 1JT8A 3NTHA 4RKLA 3OTOL 1U5KA 3C1EA 2ZNIA 3CMQA 2KVMA 4DV5L 2R92G 2NVTB 4KY5A 3L7ZC 3R2TA 1PFSA 5DM63 1R4QB 3F1ZA 5AJ3Q 1SFOH 1TKWB 3QO7A 1TQOA 5LMNW 3I4NG 1UE1A 1JB3A 1EZ8A 1SNMA 1ZYRD 3MFYA 4KD3A 3QOLA 5CV8A 2OQ0A 4QMGA 3VA5A 1R9TH 1NJIC 1XNQQ 2UXDL 2JJQA 4Q5VA 4CKBA 1S40A 4RGOS 3KOJA 2JE6I 1K73C 3VA7A 3CW2C 1YHQA 3GTLB 4JW0A 3BS1A 1N36Q 1Q1BA 3HKSA 4RCNA 5TSSA 1CM9A 1EFWA 3KLWA 2MO1A 3LX0A 2CQOA 4HVCA 1L1OC 3JAMi 2KOLA 1UE7A 4TVYA 1PRTC 4R1JA 5I9OA 2R92H 4LNQA 1QE6A 2YV5A 4E51A 2R7FA 3EQLC 4C3JB 5EKLA 4EGVA 4DV0L 4GNXB 2DQ0A 2A68C 3EN2A 2WB1E 1HRJA 3S1RH 2UU9Q 2D0PA 4A3FB 5IP9H 4WRDA 1AN8A 5KYIA 4G7HC 2IY5A 1PH6A 4DR7L 4A75A 3K7UC 5AJ3L 2P5IA 3HOUH 4JBWA 3I56A 3A31A 2EY5A 4JI6Q 3P8VA 5LL6X 4JI3L 4V190 1NSNS 3TS2A 2MPMA 1E1OA 2A1AA 5EJWA 2K05A 1AE3A 2R7ZG 5ELDA 3D0FA 3GV6A 1BKBA 2K01A 1PZID 3V7SA 1TWAH 1KOGA 3KF8A 3HOXH 3H3VC 3M4OH 3I73A 4XXEA 1KIXA 3LNNA 1H9SA 3ICAA 1F2LA 4FXGC 1H4VB 1TWFH 2MQHA 2A5HA 5GAHC 1W6KA 1YIJA 1Z7NA 2I0QA 3ZYYX 5LMNQ 1L0XB 2QCPX 1L0YB 1R4PB 4LFAQ 4R4IA 1TY2A 3H3VI 4C1NK 4RQEA 2KUMA 2PQAB 3TMEA 1PV4A 3ER0A 1OXUA 1NYQA 3PUYA 3Q8DA 2WAQG 4GLAC 2JA8G 1JWSD 3C3LA 2D0OA 2OTLA 1XXGA 5LMUL 4YCUA 1O7ZA 2ZCEA 1VQNA 1Q46A 3A7LA 1S5FD 3F8TA 4C56C 2IHEA 1MKHA 1B3AA 1PTOC 1SETA 1XX8A 4YRQA 3TZUA 2EXZA 1J5WA 5JEAJ 2VS1A 1SEBD 2VQEQ 3BVGA 3GTMB 1QE0A 3I70A 4H2WA 3W3SA 4P71A 1FD7D 4IUNA 2ZR3A 3TREA 5FK9C 3GP7A 2BCOA 4GN3B 2F0IA 1BO0A 3HOYB 1HPCA 2DTHA 3OSOA 1X2GA 2EYOA 1EL0A 4B9WA 3HXZA 4XTYA 2DEQA 5T1GA 1EZ6A 5BN3A 4KI0A 1W3SA 2UXCL 1YGBA 3AYHB 3J7YW 1EU4A 3PF4A 4PMWA 2UXBL 1IBML 1KDBA 2P5ZX 4HIDA 1KRSA 1AE2A 4GNXC 3LC0A 4X6AH 3BZKA 3J80L 2XRQD 2ZXRA 5M3MB 5CV5A 2HHHL 1C0AA 2PI2A 1IKMA 4JI0Q 1IHZA 4DU9A 2CW0C 1S72A 4Y7NB 1WPYA 2CWAA 2M00A 3A8IE 1VQMA 3A8KE 1VQBA 5IT9c 2ZGWA 1UEAB 4DKAC 1GO3E 2AQ3B 4FNFA 5BR8Q 3VYSA 2E75C 3MF1A 4R8IA 3L2ZA 4YRFA 3CC4A 3W2DA 1A2UA 2N3SA 2HD3A 1HNZQ 4P75A 3CCRA 1VQ9A 2DY7A 2JA6G 1U9RA 1PHJA 2EVBA 2BDNA 1SYDA 4KMUC 1HXYD 4XQNA 4X65Q 1VMCA 4YHHL 4LUVA 1B4OA 2CWPA 3E0EA 4JYAL 3GTJB 2RHQB 4HWTA 2N88A 5EGTA 2ATWA 4JI2Q 2KENA 4BBRG 4KTAA 4IPHA 4L87A 4LAAA 2B2VC 4YRJA 1HA6A 3J7A5 4A3MB 4HJAA 2CQAA 4ZKBB 4J15A 3HY0A 4U68A 1G291 3NWSA 4DNTB 2LFNA 2VQEL 1E22A 2IL8A 4H2XA 4BW9A 2B2UC 1V1QA 2L55A 5M9OA 5BN4A 1VQ5A 1I5FA 2NVXH 1RIQA 1I94Q 1TS5A 1QNKA 2RCNA 4H02A 5C0XH 2F4IA 2WB1G 2F0HA 2HDLA 4LF7L 4YPFA 4XDXA 2A69D 3MA2B 4FDBA 3KDFA 3HOWB 1AFPA 1VQCA 4K87A 1JC7A 1TR5A 3P7JA 4DUYL 3PO3B 3WOFA 3EROA 2VUMG 3GTKH 1PYBA 2F0KA 3RN2A 4LUOA 3T16A 2HCCA 3D6WA 1XMQL 4JI2L 2JEAI 1N33Q 2RF4A 3S1QB 5K1XA 1BOSA 2IX3A 3ERQA 4YWKA 1VQHA 2UUBL 1RJTA 1XMOL 2MGSA 1B7YB 5M3FG 4LFCQ 1Q1EA 3OMCA 1SE8A 1Y14B 2ZNJA 1CQVA 2EY6A 3IG2A 4BWGB 5ELCA 5JPNC 1SN8A 2HCIA 1XTCD 4XTZA 4RA8A 1YJNA 1WCMH 1MSHA 3DWPA 4LUZA 4XEMA 2E41A 2J3LA 3CCMA 2K03A 3TZDA 2Y0SG 5KIXA 4DR5L 4G57A 1SMXA 2QA4A 2AKWA 3SXHA 3D8GA 1PZKD 3J81L 4YRPA 1SE2A 2Z6KC 4TQFA 4JPBW 4UDUC 2ALYB 1PYWD 1H4TA 1RF2D 5NUCA 4RH6A 1F2MA 3EA6A 3TP8A 4BY7H 2JA6H 1PTOF 4DK1A 3UFGA 1U4PA 3OW2A 3GTKB 1OO9B 2F0QA 2UUAL 4IPDA 1JOQA 3HOVG 4L5SA 4JV5L 1LYLA 2KEDA 4E6IA 4FF3A 3H0GG 4AQYL 4BY1H 1EWIA 4HMIA 3FPUB 2F52A 5E4XA 1YJ9A 3NP8A 2E65A 3V05A 3F2BA 1ADYA 1LT6D 4YRKA 3SHLA 3L1AA 1XNQL 1FGBD 4BA2I 2UXDQ 3DSQA 2QW7A 2E5LQ 2R6GA 2WAQE 3SGIA 1EWHA 4DV1Q 4AH6A 4ZYSA 3J80E 1EVKA 1B44D 1IBLL 2BDOA 4F87A 2L11A 2QILA 1EY8A 1DOLA 1A3VA 2LSSA 4C2MH 1B9MA 2A6HD 3J81E 3BDLA 3FRPB 4Z9CB 4P3OA 1EWCA 4NKLA 4RQFA 4QL5A 5D3DA 3FPPA 4DUZQ 4KJNA 1EY5A 2FYKA 3I91A 2K28A 3TP6A 2CGHA 4F7XA 4UPAA 2H1EA 1UNSA 4DAYA 1KABA 5LMNL 4C3IH 2DTIA 1K8AC 1D7QA 4P74C 2R61A 1VF5C 3BVMA 1Y1VB 2AMCA 3N6RA 5ELOA 1GOZA 1PDQA 3CU7A 2OXPA 3FMCA 2EWNA 2DGYA 2D5DA 3CAMA 4A3KG 2N49A 5D65A 2KHIA 4EO4A 1CKMA 4JI4L 2JA7B 1JJCB 1X54A 2JK8A 5CBEE 2EXDA 4K6LA 5IWAL 2F0LA 3MQZA 5ELBA 5CMDA 3KLSX 1KQSA 4LF9Q 1NNHA 4A3IB 4DAPA 4DV2Q 5JEAH 1FNVA 3PO3H 3M9BA 4XT1B 1HUNA 1J5EQ 2IPKD 1NJ2A 1FR3A 3A5YA 5IGEA 2Z9HA 1CA5A 1Z9FA 2RVLA 3VQXA 4A76A 3A7UA 3SK8A 1JE4A 4A3KH 4F88A 2JA7G 1X65A 2GVBA 1S5ED 1XTDA 3S17B 1USYC 1JJ2A 3K8AA 4B3TQ 1BIBA 5C5MA 4BXXH 2VB3X 4IQZA 1IXRA 2F4VQ 4WF2A 4JI7L 2EOTA 2DNEA 1J6QA 1JE5A 2ZT9C 3EFXD 2E5LL 2EJMA 2NVYB 2Z6KA 4L63B 1JJCA 2A6EC 1BBWA 2PW7A 3NTIA 5CV4A 5C44B 2F0PA 4ZLTF 1K83B 1ADJA 4ZRZA 4M1UB 2K5QA 1QCBD 5JJZA 4A3MH 1NAPA 1S3OA 3RZOH 1EU3A 2PQEA 4NDXA 2NTTA 1JORA 5FO9B 2G9HD 3R2IA 1WD1A 5JVH3 1STYA 4OEMB 4A3GH 2J7ZA 4HTHA 5EKKA 4A3IH 3U9SA 1Y1WG 4YRRA 1NNXA 3MXUA 2EYFA 4A3DH 4UP8A 5C5LA 1Q81C 4HWRA 1A63A 3HOZH 1G2TA 3A7AA 2RDFA 4X3UA 1RODA 4PZ6A 2A19A 3UGQA 4HIOA 3OIPA 3HOVH 2FJ2A 5AFWA 4DR2L 1K8OA 2Z0SA 3L9AX 2I4NA 2I5LX 1L0WA 4QIWB 4K2KA 2EYJA 2PZWA 1E2ZA 2UUAQ 1GJXA 2R7ZH 3HOXB 3T1YL 1B1ZA 1JQYD 3RZDB 5C44G 3NQTA 2JA5G 1NJ1A 3I7FA 3P8YA 2Q2HA 1BDOA 4GLVB 3D4RA 3TP7A 3S1NH 4HWOA 1FGUA 3SE0A 1DCZA 1YEZA 3I55A 2B2YC 1YNND 2JEBI 2K1BA 3OOCA 3HOUG 5JPMC 1EY6A 1BUVT 2A69C 1LTGD 1DD2A 1LO5D 5IYCG 1SRYA 3RACA 4JI7Q 2E74C 2ZT6A 3HRKA 3WWVA 1SYCA 2J4XA 2KBNA 1KXLA 2DUDA 1U4LA 2B3GA 3GO5A 4PNYA 1NE3A 4BBSH 4FF2A 1OXTA 3GTPH 2F0JA 3PSIA 2NVXB 5M5YB 3BG3A 2D9UA 2CHBD 1Y8PB 4KV6A 3OHXC 2YTVA 3A54A 2DQ3A 2E76C 2HNIA 4B3SQ 3S1NB 1RTOA 3NUCA 3VDYA 1MJEA 4OIJA 5CV9A 2L4NA 1XMQQ 3GTGB 4G85A 1EQVA 2JSOA 3RZDH 2EYHA 1WQWA 3H0GB 4DUYQ 4YRCA 1TWGB 1TT2A 2SEBD 4LVLA 4A3MG 4A3BH 4ILWA 1USYA 1H95A 4L5QA 1VQ4A 1VCIA 1WTQA 1KNEA 4XQJA 2E2HH 2NZOA 4JYAQ 3TEHB 3V8LA 4KN7C 5C3EH 1H9RA 5I6YA 2NVTH 1KDAA 3W1GA 4NP5A 3H3VH 1O78A 3OWFA 1YVCA 1VQOA 1HR0L 4BWAA 1M8AA 3ICEA 4XU0A 4HJ8A 3OMGA 4CKEA 2ZJPA 3PUXA 2NUCA 2LMCB 5FLMH 2R3ZA 4V0BA 3DWQA 4R4QA 5L37A 4X5OA 1SDFA 1T9HA 2B2UA 4POFA 3REUA 3GTGH 3FKIH 1I3QH 4DR3Q 1F9PA 4KJOA 1CFMA 2NVQB 2BE5C 1T5EA 1FJGQ 3NQIA 2LY7A 4GKJQ 1VMPA 3GTPB 2ICIA 3HXVA 3X3MA 1GKHA 3CCLA 3OD1A 1PH7A 3HXWA 3HFZA 3EFRA 1X3QA 1HTLD 5COYA 1STAA 4CDEC 1A15A 4A3BB 1V1PA 1C8CA 5EPLA 2VW9A 1DOMA 2WACA 3RMHA 3KJPA 4C3HH 2QHUA 3TUPA 3DM3A 5GAEC 4PZ8A 3CC7A 3L4GA 1QZHA 3CD6A 2O2LD 1A3TA 1FNUA 4M8AA 2DJGC 1I3QB 1Y69U 2QDBA 1SNOA 3FEWX 1HFNA 1Z7MA 2QEXA 1GUTA 1UWVA 1SJED 3L2PA 3GTJH 5J1ZA 4HIMA 3TS0A 4H2VA 3KLSA 5C4ZA 3L4GB 5HURA 3EIVA 1BXTA 1LV9A 3ULLA 1NJ5A 4JI1L 3A56A 5IE8A 1SFOB 1PYSA 1HC7A 5IGCA 1V1PB 2QDLA 1TS2A 1DGSA 2SDFA 3KBGA 5IYDG 1XMOQ 2R93B 3V7CA 2HIVA 1B3QA 3M4YA 1G6PA 2JN4A 2O5IC 3OIQA 4DR1L 3JAMc 4LFAL 4A93B 4X62L 3V7RA 1TU2B 1E1TA 1MBYA 4XQQA 5M3MG 2F0DA 4TSSA 3J80c 4G84A 4X3SA 5IOCA 2PMZB 5C4JH 2E2DC 1Y1WB 3W1BA 1IYJB 5ELEA 3QO2A 4IFDJ 1STBA 3KF6A 3PO2G 1II3A 2FFKB 2FMMA 1UE6A 2V1CC 3TEGA 5DAUA 3VR5A 2L0CA 1XPUA 2F3VA 1Q12A 3CPFA 3HOVB 4DAVA 3CPWA 3K5MA 1WU7A 3IKJA 3E6ZX 4JI3Q 4K5XA 5E3FA 3TEHA 1TWHH 2OF1A 2PMZE 2Q2IA 2AMCB 5C3EG 2JYOA 1D2BA 3GTQB 4G4KA 4A3FH 5M5WH 4R4CA 4QQBX 4YRLA 4WI1A 1STHA 1PH3A 3AQQA 4OGQC 2L12A 2PQAA 3K6OA 4DPGA 5M3FH 1I4QA 3W5OA 1AW7A 2VY3A 4WFN3 2IX1A 1SNCA 3TQYA 1YFRA 3IFDA 4DXGA 2WKCA 1HXDA 4UY8C 1ZKOA 3AB9A 2AUJD 5KNNA 4ODGA 4A3CG 1VQ8A 2EDGA 2UU9L 3X3NA 1JMCA 2CJAA 2Z8LA 5IT9L 3VQVA 4K5WA 1E24A 2YYZA 3G6JB 1SE3A 2EY2A 1KMMA 3J81i 3QOJA 4X3TA 1VDZA 1RKNA 2K5WA 4DA2A 1QVCA 2FHTA 1YITA 4P3PA 3REXA 4DR7Q 2ZJQA 3J80i 3PO2B 4HCSA 3S17H 3S9WA 3S1MH 2EE1A 2CCZA 1CA6A 2JQOA 4MHEA 1FNWA 2VXWA 2C7IA 2VUMB 4N9TA 3S2HB 4K8JA 3CCJA 2JA8B 1JWUD 4CS3A 2EY1A 2PO4A 4CGYB 4DK6C 4IJHA 2Q8RE 4PMCA 1JOKA 3Q22A 3T13A 4JG2A 1LT4D 3KJOA 3SR1A 3OTOQ 2ZM6Q 1VQ7A 1YBYA 4IOCA 1DZ1A 1ML0D 1QF6A 3PV0A 1HH2P 4OO1H 4KD4A 3CMEA 2E8GA 1RDPD 3QO5A 1BVSA 4OWWB 4P72A 3S14H 2E5AA 3LSQA 3IL8A 5IODA 1PFMA 3RLOA 2JA5H 4KR2A 4KHPL 3HOZB 1Z7TA 3VYRA 4NXNL 5KNBA 4C1NI 5GAGC 5K36G 2G5DA 4IO9A 1ICWA 3SK6A 2A8VA 3RKWA 1H9JA 2MP1A 5KRUA 2FINB 2Y0SB 4RAUC 1D8LA 4H0LC 4IALA 4XTVA 1CSQA 3NE5B 3EVQA 3S24A 2Q7GA 1F2ZA 2PNRC 5IYDH 4OELB 2NS6A 4DV3Q 1SYFA 3RZOB 1HHVA 3AFPA 5C4JB 3R07A 2C35B 4HEDA 2JA6B 3KUPA 5JOBA 4UP7A 2B63H 2B2WA 2NZHA 2WV6D 4LFCL 2D2CC 4HR7B 2A8EA 2NYZD 1WYDA 2KCCA 2E3CA 1D1KA 1H9KA 4PZ7A 3PO2H 4YRMA 3HGBA 3O13A 4P73C 1W66A 3M3YB 5C4XG 4ME5A 2RQXA 1WI5A 4ZUIA 1Q90A 2ZT8A 1HZCA 1WCMB 1B70A 4PMBA 3TRZA 4DV7L 1RCVD 1E3PA 1EQTA 1VQKA 2I4LA 3MXPA 1HNXQ 2ZZGA 4IUPA 4P73A 1ENFA 3ITPA 2JXMB 1VQLA 1LTTD 4K0KQ 1IBKQ 4HMJA 4B9XA 1EOVA 3R3OA 5IGGA 3MC0B 4A3JH 3GTOB 4XU1A 3NHHA 1X32A 1VQPA 3KDFB 1C7YA 4LVMA 4OL7A 4RCOA 1G6ZA 3K7AH 4GN5A 1PH2A 4YRGA 2Y0SE 3VR2A 4ZKCB 3PO3G 3PCOB 1AH9A 2JA9A 1GUSA 4NPSA 3KF6B 4H13C 3HP3A 4C3IB 2CKZB 3UI2A 2WB1B 4RHRA 3IKLA 4QIWE 1YNJD 3KFUA 3MVVA 1VF7A 4GS3A 3HXUA 3M7GA 3MEHA 5FLXL 1WQ7A 5K1PA 4JV5Q 3URYA 1DM0B 2F1MA 1N36L 3I4MH 2RSNA 3CF5A 3S2DB 1ET6A 4X66L 4NXMQ 1B76A 3WDNA 3I90A 1EY0A 3RUZA 5BR8L 4BY7B 1E2VA 4B3RL 1W6JA 3MWYW 3SK5A 5J22A 1IBMQ 1TXYA 1X2HA 3MHBA 4L6TB 4CH3A 2HUGA 4A3EG 1CQFA 5EBCA 3RN5A 4ZCKA 5EPJA 1TY0A 4F8MA 2RBMA 1PH4A 4RDXA 4DR3L 1EY7A 1KHIA 1PTOB 2MO0A 3DEOA 4K6DA 3RL6A 1U0LA 2H5XA 3IALA 2ZXOA 1EYAA 5C3WA 2L1BA 3K5LA 1QNUA 1GHJA 4RKBA 3LSSA 1LM0A 1N9WA 2YTXA 4L5TA 1ICFB 1TWGH 2WINB 3STBC 3I3CA 1X55A 3UH0A 3MFGA 3H91A 4KY7A 2KCNA 1DOKA 4XT3B 1CZWA 1LT5D 3HOXG 2UUCL 1B53A 2L9HA 2XRSD 2EJFC 3HFZB 3A8JE 1WVLA 2B2WC 1GGMA 4MZ9A 1EIGA 1DXMA 2HIXA 2ZTCA 3BDCA 4ZQ3A 1QJOA 1N33L 3S15B 1DONA 3MXNA 1F9RA 3NEMA 2BOSA 4N9PA 4KKUA 5K5PA 2VNUD 2KCTA 2YU9B 1HNWL 3KBXA 5HGTA 4X64Q 4PV1C 2ID0A 4LF7Q 1I50B 2WIIB 4OO1G 3PIOA 1CI3M 3MEFA 11ASA 2E2HB 4ME3A 2K04A 4DV4Q 2RKSA 1EEID 3QG1A 2DZ9A 3PCOA 2R7DA 4DR1Q 1HZBA 1GUGA 1OXSC 1BNZA 1WCMG 4JOIC 1JR0D 1MIUA 1EUJA 3HOYG 2R92B 4P72C 2HDMA 4HT4A 1WOCA 1IYUA 2QEJC 2XWJB 1C4QA 4X64L 1X01A 4IFDG 5LL6S 3J81j 1ILQA 1LTLA 1XNRL 4BBSG 2LXKA 1BIAA 1XPRA 3GTMH 4XTCS 1GM5A 1J9OA
chains in the Genus database with same CATH topology
3HOZG 3BFMA 1EIYB 1Q7YC 1VQJA 1SLJA 3F2DA 1N32Q 1A0IA 2K14A 2Q2UA 3J81c 1NMFA 3IKMB 4Y7NH 2XGTA 5C0XG 1CUKA 4JCVE 4X66Q 4B3MQ 5M3MH 4GKKL 5M5XH 4A3FG 4JBKA 4DR2Q 2Q5IA 4RMFA 2ES2A 2OTJA 2RHQA 2EAYA 4JI5Q 3P8TA 1KMNA 2K5HA 3IRBA 2LXJA 3CQZH 4A3EH 4DR4L 2WP8J 5C0XJ 4LNSA 4LF8Q 1WNLA 4ZTUB 2NN6G 5JJIA 1O7IA 4YY3L 2AKWB 4YYEA 4A3JG 1KAWA 1B7YA 1K3RA 1SESA 2ZTGA 4KLKA 4BXXG 1X6OA 3KF8B 1IZ6A 1N34L 4WJ3M 4CS4A 1PA6A 5C52B 3LGJA 2ZTDA 5ELNA 3T1HL 4IPGA 2ARSA 1I50H 3A74A 3RKYA 1NJ8A 4DV7Q 4GLXA 4DV2L 3M85A 1C9OA 4OX9Q 2IY5B 1UE5A 4TVAB 4YROA 3G71A 2DXUA 2K5VA 5JJKA 1ASYA 1NY4A 3QNEA 3S2HH 4B3SL 4IPCA 2ZT5A 3ERSX 4XU3A 2VL6A 2PNHA 2BA0A 4OX9L 2I4OA 2B29A 4OWTB 2HT1A 2ZXFA 3K81C 4DNIA 4HWSA 3M4QA 1X3EA 3CCQA 1BBUA 4DV3L 5IYBG 1SERA 1VQZA 3T1YQ 4K86A 3PUWA 2AWNA 2IT1A 3GDEA 5FLMG 4YDQA 3NELA 5HGQA 4DV1L 4DV0Q 4C3JH 5IP9G 1WLEA 2K4KA 3CXCA 4JI8L 1ATIA 4NXNQ 1EYGA 4LFBL 4KHPQ 3QTCA 2ZZEA 4POGA 4OLFA 1NBWA 2KCMA 1MJCA 4YCVA 4XIGS 1YNXA 2Q7EA 2NVYH 1YB3A 5FJ8G 3ULPA 4PG3A 1YJWA 4JI8Q 2YTYA 1A62A 5E7NA 1EQRA 3EBEA 3U50C 1RIPA 2E2JH 2AWOA 4LF5L 1PH1A 3UDXA 2RHSA 3E9IA 3HXYA 3RF1A 3E9HA 4RG1A 4YRIA 3VBBA 4ZIBA 2XTIA 4A93G 4CS2A 1Q82C 1VQ6A 1QVGA 4AYBG 2OCEA 4A3IG 4LF9L 4NCXA 1N32L 1K8GA 3I4NH 3ERRA 4LVKA 2ZT7A 2ODRC 4TVAA 5HY6A 1WJJA 2E64A 4QGUA 4YWLA 1I94L 3HXXA 1PVOA 4DAMA 1NJ6A 5H1SE 4DK3C 2BA1A 2DU5A 3AEVA 3J7ZC 4DUZL 1FYFA 1L2FA 1RL2A 4TWAA 1XPOA 1G5IA 1P8LA 5JEAG 2OWOA 4X62Q 4LF8L 4P74A 2DZCA 3V8JA 3AFQA 3VQYA 1VQFA 3UE0A 1V43A 2CIMA 5EAYA 1VQGA 2E2IH 4H2TA 4JI1Q 3I4MG 1JB7A 3A7RA 2IHFA 3U4ZA 3RLNA 4DQ2A 3F2CA 3A32A 1KD1C 2AHOB 4B3ML 1WFQA 3PF5A 2Q7HA 1H4SA 3PZCA 4YRTA 1CSPA 4CH5A 3S1QH 2MFIA 2JA8H 1NTGA 3HKZG 4GKJL 4IJLA 2J3MA 4HJ9A 3GTQH 5IP7G 1EQQA 1OTCA 1K83H 3FHWA 1KC8C 3UE1A 12ASA 4XEOA 3L0OA 2ZINA 1SROA 1X9NA 2DTOA 4YRSA 2QHSA 5DLQE 1JJGA 2F4VL 2UUBQ 2Q5HA 4A4IA 1H4QA 5C51B 3M4PA 3HRIA 1HR0Q 5IY0A 2DU7A 1YI2A 2K52A 4KR3A 2DKGA 4DV4L 2P0LA 3PUVA 1J5EL 1HTTA 4XTWA 2PMEA 1SRUA 2ARTA 4TQDA 1K9MC 4A93H 2N8NA 2ZJRA 2I5HA 2Q2TA 3U58A 4P3NA 2ZZFA 1VQDA 4TTVA 1P16A 4GOPC 4A3BG 4HJ7A 1G5HA 1LUZA 1Y1VG 4AYBE 3A5ZB 1XJVA 4IOAA 5E3IA 4Y52H 5C44H 4NB3A 1Z47A 4JI0L 1Q86C 2HHHQ 2ZIOA 3CCUA 3V8KA 4NXML 3HOYH 4APVA 4AQYQ 3S15H 4A3DG 3B6YA 3K0XA 1FL0A 2K75A 3K80C 3VQWA 2ZM6L 1PH5A 4LF5Q 4K88A 5IYBH 1QUQB 1GD7A 4A3CH 3HY1A 4LFBQ 3RIRA 2UXBQ 1X3FA 1G51A 1YFTA 4YRNA 4HJ5A 4Q6GA 4XU2A 2ZIMA 3I4OA 3RKXA 1YHAA 2N78A 2G4CA 4KQEA 1HZAA 3MF2A 3NBHB 4GOPA 2D62A 1Y1WH 1L1OB 5IP7H 1QZGA 3FJPA 3PIPA 3PGZA 2C8MA 4BBRH 3S16H 3RUXA 4B3TL 3CMAA 1K0RA 4TVWA 4OO1I 1X56A 2WFWA 1OXXK 3U4VA 4JI4Q 4DV6L 4JBMA 2L15A 3HKZE 5M5YH 4DR6Q 2YU9H 1PYSB 1YFSA 3KYHC 4YP0A 4DV6Q 2RHSB 4ZTZB 3UGTA 1PH8A 4LW1A 3GTLH 1HJPA 3FKIG 3D31A 1B8AA 4CH6A 1CKOA 4MNOA 1UEBA 2MNAA 2CJBA 2ZR2A 2FXQA 4Q15A 3G1ZA 4A3LH 1GVPA 3NENA 3M3YH 4GNXA 4YCWA 2ALYA 1I6HH 2NVQH 3H0GH 1N34Q 3CCSA 1IBLQ 4H2XB 3GTOH 1E7ZA 3GD7A 5C4XH 2DDZA 3CC2A 1A8VA 5FLXc 4JBJA 3RNUA 2ARUA 4DR4Q 2PMFA 4GOPB 4JC0A 3RLFA 1EVLA 1W2BA 1TWCH 4YREA 3UDFA 2UXCQ 4AIMA 3G4SA 1M90C 2CJ9A 4BY1G 4XTUA 1YZ6A 4DV5Q 1X3GA 4GKKQ 2EIFA 4DR5Q 2CFMA 2ASBA 4CH4A 2DJZA 3A5UA 3BU2A 1Y1VH 3OYYA 1SR3A 2KHJA 1PH9A 3HFVA 4WJ4A 5GROA 1QUQA 3FP9A 4OONA 1CKNB 1XNRQ 3RGLA 1VS0A 1HNWQ 4QY7A 5IYCH 2ODRD 1HZ9A 2K5NA 4O0AA 1EIYA 4IFDI 2VUMH 3PUZA 4LF6L 1KL9A 3UDGA 3BJUA 4YHHQ 4A3GG 4X65L 1V9PA 3T1HQ 4L5RC 4H2SA 1L1OA 2DVEA 4LVIA 1M1KC 4YWMA 3RR5A 4JOIA 4O2DA 2BH8A 4JI6L 2VQFL 3MEYA 5FJ8H 2I4MA 4BA1I 1CKNA 3I2ZA 2OQKA 4EX5A 3BZCA 4TQUS 4YY3Q 3DLLA 3STBD 4ALPA 5GADC 2UUCQ 3CP0A 1HNZL 3S2DH 2EJGA 2JA7H 2NN6I 1B70B 3HTZA 2EJFA 3QO8A 4HWPA 2BH2A 4JI5L 4R4OA 1HR0W 4PHCA 4B3RQ 1VQEA 2ZTEA 4OXPA 2EL9A 1QVFA 2R93H 1FJGL 1OXVA 3CCEA 2QGQA 4QJFA 5F5WA 4KHZA 3NETA 1EIFA 2EJ9A 3WQZA 1VQIA 3CCVA 4P75C 3G6EA 1IL2A 4A3LG 4H2YA 4HA8A 3EFSA 5C0XI 2F3IA 4K0KL 4OP0A 4EQ5A 4LF6Q 5JJLA 4LVJA 2E1HA 1HNXL 4HIKA 3HOWH 3ULJA 2QHVA 2VQFQ 3HOWG 2VZAA 3M7NA 1IBKL 1N8RC 3MXNB 3A5ZA 4OWXB 3A0JA 2E10A 5C53B 1NMGA 4DAYB 1VQAA 3ZJYC 4XTXA 4MTNA 1ASZA 4LF4Q 3UDIA 1NYRA 2I5MX 3G48A 5LMUQ 4GN4B 2IX0A 3JC66 4LWCA 2K50A 5GQOA 2EQSA 4DR6L 4LF4L 4BY7G 4H2UA 5IWAQ 4P71C 2R93G 2QHTA 2DXTA 2GVAA 2GN5A 3H15A 4R4TA 2B63G 1YHBA 1FVIA 4UP9A 2HQLA 5J3BA 1Q8KA 1KRTA 2PI2E 1JT8A 3OTOL 1U5KA 2ZNIA 3CMQA 4DV5L 2R92G 3L7ZC 1PFSA 3F1ZA 5AJ3Q 1SFOH 3QO7A 5LMNW 3I4NG 1UE1A 1R9TH 2OQ0A 1NJIC 1XNQQ 2UXDL 2JJQA 1S40A 3KOJA 2JE6I 1K73C 3CW2C 1YHQA 1N36Q 1Q1BA 3HKSA 1EFWA 3KLWA 2MO1A 2CQOA 4HVCA 1L1OC 3JAMi 4TVYA 1UE7A 4R1JA 2R92H 4LNQA 2YV5A 4E51A 2R7FA 4DV0L 4GNXB 2DQ0A 3EN2A 2WB1E 3S1RH 2UU9Q 2D0PA 5IP9H 2IY5A 1PH6A 4DR7L 4A75A 3K7UC 5AJ3L 2P5IA 3HOUH 4JBWA 3I56A 3A31A 4JI6Q 3P8VA 4JI3L 3TS2A 1E1OA 2A1AA 1AE3A 2R7ZG 3D0FA 1BKBA 3V7SA 1TWAH 1KOGA 3HOXH 3M4OH 1KIXA 3ICAA 1H4VB 1TWFH 2MQHA 5GAHC 1YIJA 1Z7NA 2I0QA 5LMNQ 4LFAQ 4R4IA 3H3VI 4RQEA 2PQAB 1PV4A 3ER0A 1OXUA 1NYQA 3PUYA 3Q8DA 2WAQG 4GLAC 2JA8G 2D0OA 2OTLA 5LMUL 4YCUA 2ZCEA 1VQNA 1Q46A 3F8TA 2IHEA 1MKHA 1SETA 4YRQA 1J5WA 5JEAJ 2VS1A 2VQEQ 1QE0A 4H2WA 3W3SA 4P71A 2ZR3A 3TREA 4GN3B 2DTHA 1X2GA 3HXZA 4XTYA 2DEQA 4KI0A 1W3SA 2UXCL 1YGBA 3AYHB 3PF4A 4PMWA 2UXBL 1IBML 4HIDA 1KRSA 1AE2A 4GNXC 3LC0A 4X6AH 3BZKA 2HHHL 1C0AA 2PI2A 4JI0Q 1S72A 1WPYA 2CWAA 1VQMA 1VQBA 5IT9c 2ZGWA 4DKAC 1GO3E 5BR8Q 3MF1A 3L2ZA 4YRFA 3CC4A 2N3SA 1HNZQ 4P75A 3CCRA 1VQ9A 2JA6G 1PHJA 4X65Q 4YHHL 4LUVA 4JYAL 2CWPA 3E0EA 2RHQB 4HWTA 2ATWA 4JI2Q 2KENA 4BBRG 4IPHA 4L87A 4YRJA 3J7A5 4HJAA 4J15A 3HY0A 1G291 2VQEL 1E22A 4H2XA 4BW9A 1V1QA 1VQ5A 1I5FA 2NVXH 1RIQA 1I94Q 2RCNA 4H02A 2WB1G 4LF7L 4YPFA 4FDBA 3KDFA 4K87A 1VQCA 4DUYL 2VUMG 3GTKH 1PYBA 3RN2A 4LUOA 4JI2L 1XMQL 2JEAI 1N33Q 2RF4A 5K1XA 4YWKA 1VQHA 2UUBL 1XMOL 1B7YB 5M3FG 4LFCQ 1Q1EA 1SE8A 1Y14B 2ZNJA 3IG2A 1SN8A 4XTZA 1YJNA 1WCMH 4LUZA 4XEMA 2E41A 2J3LA 3CCMA 2Y0SG 4DR5L 1SMXA 2QA4A 2AKWA 4YRPA 2Z6KC 4TQFA 2ALYB 1H4TA 4BY7H 2JA6H 3UFGA 3OW2A 2UUAL 4IPDA 3HOVG 4L5SA 4JV5L 1LYLA 3H0GG 4AQYL 4BY1H 1EWIA 2F52A 1YJ9A 2E65A 3F2BA 1ADYA 4YRKA 3L1AA 1XNQL 4BA2I 2UXDQ 3DSQA 2E5LQ 2R6GA 2WAQE 3SGIA 4DV1Q 4AH6A 1EVKA 1IBLL 2LSSA 4C2MH 4P3OA 4RQFA 4QL5A 4DUZQ 2FYKA 2CGHA 4UPAA 2DTIA 4P74C 5LMNL 4C3IH 1K8AC 1D7QA 2AMCA 5ELOA 2EWNA 2DGYA 3CAMA 4A3KG 2N49A 2KHIA 4EO4A 1CKMA 4JI4L 1JJCB 1X54A 2JK8A 2EXDA 5IWAL 3MQZA 4LF9Q 1KQSA 1NNHA 4DV2Q 3PO3H 3M9BA 1J5EQ 1NJ2A 3A5YA 1Z9FA 3VQXA 4A76A 3A7UA 4A3KH 2JA7G 1X65A 2GVBA 1XTDA 1USYC 1JJ2A 3K8AA 4B3TQ 1BIBA 4BXXH 1IXRA 2F4VQ 4WF2A 4JI7L 1J6QA 1JE5A 2E5LL 2Z6KA 1JJCA 1BBWA 1ADJA 4A3MH 1S3OA 3RZOH 4A3GH 4A3IH 1Y1WG 4YRRA 4A3DH 4UP8A 1Q81C 4HWRA 1A63A 3HOZH 3A7AA 4PZ6A 2A19A 3UGQA 4HIOA 3HOVH 4DR2L 2Z0SA 2I4NA 2I5LX 1L0WA 2UUAQ 2R7ZH 3T1YL 5C44G 2JA5G 1NJ1A 3I7FA 3P8YA 2Q2HA 4GLVB 3S1NH 4HWOA 1FGUA 1YEZA 3I55A 2JEBI 3HOUG 5IYCG 1SRYA 3RACA 4JI7Q 2ZT6A 3HRKA 3WWVA 2KBNA 1KXLA 2DUDA 3GO5A 2B3GA 1NE3A 4BBSH 1OXTA 3GTPH 3PSIA 2YTVA 2DQ3A 2HNIA 4B3SQ 3VDYA 1MJEA 1XMQQ 4G85A 3RZDH 1WQWA 4DUYQ 4YRCA 4LVLA 4A3MG 4A3BH 1USYA 1H95A 4L5QA 1VQ4A 1VCIA 2E2HH 2NZOA 4JYAQ 3TEHB 3V8LA 5C3EH 2NVTH 3W1GA 3H3VH 1YVCA 1VQOA 1HR0L 4BWAA 3ICEA 4XU0A 4HJ8A 2ZJPA 3PUXA 5FLMH 4R4QA 4X5OA 1T9HA 4POFA 3REUA 3GTGH 3FKIH 1I3QH 4DR3Q 1FJGQ 4GKJQ 3HXVA 1GKHA 3CCLA 3OD1A 1PH7A 3HXWA 3HFZA 3EFRA 2VW9A 3KJPA 4C3HH 2QHUA 3TUPA 3DM3A 5GAEC 4PZ8A 3CC7A 3L4GA 1QZHA 3CD6A 1Z7MA 2QEXA 1UWVA 3L2PA 3GTJH 4HIMA 3TS0A 4H2VA 3L4GB 3EIVA 3ULLA 1NJ5A 4JI1L 5IE8A 1PYSA 1HC7A 1DGSA 5IYDG 1XMOQ 3V7CA 2HIVA 1G6PA 4DR1L 3JAMc 4LFAL 4X62L 3V7RA 1E1TA 5M3MG 3J80c 4G84A 5C4JH 3W1BA 1IYJB 4IFDJ 3KF6A 3PO2G 3TEGA 1UE6A 2V1CC 1XPUA 1Q12A 3CPFA 3CPWA 1WU7A 4JI3Q 3TEHA 1TWHH 2PMZE 2Q2IA 2AMCB 5C3EG 4A3FH 5M5WH 4R4CA 4QQBX 4YRLA 4WI1A 1PH3A 3AQQA 2PQAA 4DPGA 5M3FH 3W5OA 2VY3A 2IX1A 3TQYA 1YFRA 1HXDA 4UY8C 5KNNA 4A3CG 1VQ8A 2UU9L 1JMCA 2CJAA 3VQVA 1E24A 2YYZA 1KMMA 3J81i 1QVCA 1YITA 4P3PA 3REXA 4DR7Q 2ZJQA 3J80i 3S17H 3S1MH 2CCZA 2JQOA 2C7IA 3CCJA 4CS3A 4DK6C 4IJHA 4JG2A 3KJOA 3OTOQ 2ZM6Q 1VQ7A 1YBYA 4IOCA 1QF6A 3PV0A 1HH2P 3CMEA 2E8GA 3QO5A 1BVSA 4OWWB 4P72A 3S14H 2E5AA 3LSQA 3RLOA 2JA5H 4KR2A 4KHPL 4NXNL 5GAGC 5K36G 4IO9A 2A8VA 3RKWA 1D8LA 4XTVA 1CSQA 3S24A 2Q7GA 5IYDH 2NS6A 4DV3Q 3AFPA 3R07A 2C35B 4UP7A 2B63H 2NZHA 4LFCL 2A8EA 1WYDA 2E3CA 4PZ7A 3PO2H 4YRMA 4P73C 1W66A 5C4XG 1WI5A 2ZT8A 1HZCA 1B70A 3TRZA 4DV7L 1E3PA 1VQKA 2I4LA 1HNXQ 2ZZGA 4P73A 1VQLA 4K0KQ 1IBKQ 1EOVA 4A3JH 4XU1A 1VQPA 1C7YA 3KDFB 4LVMA 3K7AH 4GN5A 1PH2A 4YRGA 2Y0SE 3PO3G 3PCOB 1AH9A 2JA9A 4NPSA 3KF6B 2CKZB 3IKLA 4QIWE 3KFUA 4GS3A 3HXUA 1WQ7A 5K1PA 4JV5Q 1N36L 3I4MH 3CF5A 4X66L 4NXMQ 1B76A 5BR8L 4B3RL 1IBMQ 1TXYA 1X2HA 4CH3A 4A3EG 3RN5A 1PH4A 4RDXA 4DR3L 1KHIA 2MO0A 3RL6A 1U0LA 2H5XA 3IALA 3LSSA 1LM0A 1N9WA 2YTXA 4L5TA 1TWGH 3STBC 1X55A 3UH0A 3HOXG 2UUCL 3HFZB 1GGMA 4MZ9A 2HIXA 2ZTCA 1N33L 3NEMA 2VNUD 2KCTA 1HNWL 4X64Q 2ID0A 4LF7Q 4OO1G 3PIOA 11ASA 3MEFA 4ME3A 4DV4Q 2DZ9A 3PCOA 2R7DA 4DR1Q 1HZBA 1OXSC 1WCMG 4JOIC 1MIUA 1EUJA 3HOYG 4P72C 4HT4A 1WOCA 1X01A 4X64L 4IFDG 3J81j 1LTLA 1XNRL 4BBSG 2LXKA 1BIAA 1XPRA 3GTMH 4XTCS 1GM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ G;  3BFM A;  1EIY B;  1Q7Y C;  1VQJ A;  1SLJ A;  3F2D A;  1N32 Q;  1A0I A;  2K14 A;  2Q2U A;  3J81 c;  1NMF A;  3IKM B;  4Y7N H;  2XGT A;  5C0X G;  1CUK A;  4JCV E;  4X66 Q;  4B3M Q;  5M3M H;  4GKK L;  5M5X H;  4A3F G;  4JBK A;  4DR2 Q;  2Q5I A;  4RMF A;  2ES2 A;  2OTJ A;  2RHQ A;  2EAY A;  4JI5 Q;  3P8T A;  1KMN A;  2K5H A;  3IRB A;  2LXJ A;  3CQZ H;  4A3E H;  4DR4 L;  2WP8 J;  5C0X J;  4LNS A;  4LF8 Q;  1WNL A;  4ZTU B;  2NN6 G;  5JJI A;  1O7I A;  4YY3 L;  2AKW B;  4YYE A;  4A3J G;  1KAW A;  1B7Y A;  1K3R A;  1SES A;  2ZTG A;  4KLK A;  4BXX G;  1X6O A;  3KF8 B;  1IZ6 A;  1N34 L;  4WJ3 M;  4CS4 A;  1PA6 A;  5C52 B;  3LGJ A;  2ZTD A;  5ELN A;  3T1H L;  4IPG A;  2ARS A;  1I50 H;  3A74 A;  3RKY A;  1NJ8 A;  4DV7 Q;  4GLX A;  4DV2 L;  3M85 A;  1C9O A;  4OX9 Q;  2IY5 B;  1UE5 A;  4TVA B;  4YRO A;  3G71 A;  2DXU A;  2K5V A;  5JJK A;  1ASY A;  1NY4 A;  3QNE A;  3S2H H;  4B3S L;  4IPC A;  2ZT5 A;  3ERS X;  4XU3 A;  2VL6 A;  2PNH A;  2BA0 A;  4OX9 L;  2I4O A;  2B29 A;  4OWT B;  2HT1 A;  2ZXF A;  3K81 C;  4DNI A;  4HWS A;  3M4Q A;  1X3E A;  3CCQ A;  1BBU A;  4DV3 L;  5IYB G;  1SER A;  1VQZ A;  3T1Y Q;  4K86 A;  3PUW A;  2AWN A;  2IT1 A;  3GDE A;  5FLM G;  4YDQ A;  3NEL A;  5HGQ A;  4DV1 L;  4DV0 Q;  4C3J H;  5IP9 G;  1WLE A;  2K4K A;  3CXC A;  4JI8 L;  1ATI A;  4NXN Q;  1EYG A;  4LFB L;  4KHP Q;  3QTC A;  2ZZE A;  4POG A;  4OLF A;  1NBW A;  2KCM A;  1MJC A;  4YCV A;  4XIG S;  1YNX A;  2Q7E A;  2NVY H;  1YB3 A;  5FJ8 G;  3ULP A;  4PG3 A;  1YJW A;  4JI8 Q;  2YTY A;  1A62 A;  5E7N A;  1EQR A;  3EBE A;  3U50 C;  1RIP A;  2E2J H;  2AWO A;  4LF5 L;  1PH1 A;  3UDX A;  2RHS A;  3E9I A;  3HXY A;  3RF1 A;  3E9H A;  4RG1 A;  4YRI A;  3VBB A;  4ZIB A;  2XTI A;  4A93 G;  4CS2 A;  1Q82 C;  1VQ6 A;  1QVG A;  4AYB G;  2OCE A;  4A3I G;  4LF9 L;  4NCX A;  1N32 L;  1K8G A;  3I4N H;  3ERR A;  2ZT7 A;  2ODR C;  4TVA A;  5HY6 A;  1WJJ A;  2E64 A;  4QGU A;  4YWL A;  1I94 L;  3HXX A;  1PVO A;  4DAM A;  1NJ6 A;  5H1S E;  4DK3 C;  2BA1 A;  2DU5 A;  3AEV A;  3J7Z C;  4DUZ L;  1FYF A;  1L2F A;  1RL2 A;  4TWA A;  1XPO A;  1G5I A;  1P8L A;  5JEA G;  2OWO A;  4X62 Q;  4LF8 L;  4P74 A;  2DZC A;  3V8J A;  3AFQ A;  3VQY A;  1VQF A;  3UE0 A;  1V43 A;  2CIM A;  5EAY A;  1VQG A;  2E2I H;  4H2T A;  4JI1 Q;  3I4M G;  1JB7 A;  3A7R A;  2IHF A;  3U4Z A;  3RLN A;  4DQ2 A;  3F2C A;  3A32 A;  1KD1 C;  2AHO B;  4B3M L;  1WFQ A;  3PF5 A;  2Q7H A;  1H4S A;  3PZC A;  4YRT A;  1CSP A;  4CH5 A;  3S1Q H;  2MFI A;  2JA8 H;  1NTG A;  3HKZ G;  4GKJ L;  4IJL A;  2J3M A;  4HJ9 A;  3GTQ H;  5IP7 G;  1EQQ A;  1OTC A;  1K83 H;  3FHW A;  1KC8 C;  3UE1 A;  12AS A;  4XEO A;  3L0O A;  2ZIN A;  1SRO A;  1X9N A;  2DTO A;  4YRS A;  2QHS A;  5DLQ E;  1JJG A;  2F4V L;  2UUB Q;  2Q5H A;  4A4I A;  1H4Q A;  5C51 B;  3M4P A;  3HRI A;  1HR0 Q;  5IY0 A;  2DU7 A;  1YI2 A;  2K52 A;  4KR3 A;  2DKG A;  4DV4 L;  2P0L A;  3PUV A;  1J5E L;  1HTT A;  4XTW A;  2PME A;  1SRU A;  2ART A;  4TQD A;  1K9M C;  4A93 H;  2N8N A;  2ZJR A;  2I5H A;  2Q2T A;  3U58 A;  4P3N A;  2ZZF A;  1VQD A;  4TTV A;  1P16 A;  4GOP C;  4A3B G;  4HJ7 A;  1G5H A;  1LUZ A;  1Y1V G;  4AYB E;  3A5Z B;  1XJV A;  4IOA A;  5E3I A;  4Y52 H;  5C44 H;  4NB3 A;  1Z47 A;  4JI0 L;  1Q86 C;  2HHH Q;  2ZIO A;  3CCU A;  3V8K A;  4NXM L;  3HOY H;  4APV A;  4AQY Q;  3S15 H;  4A3D G;  3B6Y A;  3K0X A;  1FL0 A;  2K75 A;  3K80 C;  3VQW A;  2ZM6 L;  1PH5 A;  4LF5 Q;  4K88 A;  5IYB H;  1QUQ B;  1GD7 A;  4A3C H;  3HY1 A;  4LFB Q;  3RIR A;  2UXB Q;  1X3F A;  1G51 A;  1YFT A;  4YRN A;  4HJ5 A;  4Q6G A;  4XU2 A;  2ZIM A;  3I4O A;  3RKX A;  1YHA A;  2N78 A;  2G4C A;  4KQE A;  1HZA A;  3MF2 A;  3NBH B;  4GOP A;  2D62 A;  1Y1W H;  1L1O B;  5IP7 H;  1QZG A;  3FJP A;  3PIP A;  3PGZ A;  2C8M A;  4BBR H;  3S16 H;  3RUX A;  4B3T L;  3CMA A;  1K0R A;  4TVW A;  4OO1 I;  1X56 A;  2WFW A;  1OXX K;  3U4V A;  4JI4 Q;  4DV6 L;  4JBM A;  2L15 A;  3HKZ E;  5M5Y H;  4DR6 Q;  2YU9 H;  1PYS B;  1YFS A;  3KYH C;  4YP0 A;  4DV6 Q;  2RHS B;  4ZTZ B;  3UGT A;  1PH8 A;  4LW1 A;  3GTL H;  1HJP A;  3FKI G;  3D31 A;  1B8A A;  4CH6 A;  1CKO A;  4MNO A;  1UEB A;  2MNA A;  2CJB A;  2ZR2 A;  2FXQ A;  4Q15 A;  3G1Z A;  4A3L H;  1GVP A;  3NEN A;  3M3Y H;  4GNX A;  4YCW A;  2ALY A;  1I6H H;  2NVQ H;  3H0G H;  1N34 Q;  3CCS A;  1IBL Q;  4H2X B;  3GTO H;  1E7Z A;  3GD7 A;  5C4X H;  2DDZ A;  3CC2 A;  1A8V A;  5FLX c;  4JBJ A;  3RNU A;  2ARU A;  4DR4 Q;  2PMF A;  4GOP B;  4JC0 A;  3RLF A;  1EVL A;  1W2B A;  1TWC H;  4YRE A;  3UDF A;  2UXC Q;  4AIM A;  3G4S A;  1M90 C;  2CJ9 A;  4BY1 G;  4XTU A;  1YZ6 A;  4DV5 Q;  1X3G A;  4GKK Q;  2EIF A;  4DR5 Q;  2CFM A;  2ASB A;  4CH4 A;  2DJZ A;  3A5U A;  3BU2 A;  1Y1V H;  3OYY A;  1SR3 A;  2KHJ A;  1PH9 A;  3HFV A;  4WJ4 A;  5GRO A;  1QUQ A;  3FP9 A;  4OON A;  1CKN B;  1XNR Q;  3RGL A;  1VS0 A;  1HNW Q;  4QY7 A;  5IYC H;  2ODR D;  1HZ9 A;  2K5N A;  4O0A A;  1EIY A;  4IFD I;  2VUM H;  3PUZ A;  4LF6 L;  1KL9 A;  3UDG A;  3BJU A;  4YHH Q;  4A3G G;  4X65 L;  1V9P A;  3T1H Q;  4L5R C;  4H2S A;  1L1O A;  2DVE A;  1M1K C;  4YWM A;  3RR5 A;  4JOI A;  4O2D A;  2BH8 A;  4JI6 L;  2VQF L;  3MEY A;  5FJ8 H;  2I4M A;  4BA1 I;  1CKN A;  3I2Z A;  2OQK A;  4EX5 A;  3BZC A;  4TQU S;  4YY3 Q;  3DLL A;  3STB D;  4ALP A;  5GAD C;  2UUC Q;  3CP0 A;  1HNZ L;  3S2D H;  2EJG A;  2JA7 H;  2NN6 I;  1B70 B;  3HTZ A;  2EJF A;  3QO8 A;  4HWP A;  2BH2 A;  4JI5 L;  4R4O A;  1HR0 W;  4PHC A;  4B3R Q;  1VQE A;  2ZTE A;  4OXP A;  2EL9 A;  1QVF A;  2R93 H;  1FJG L;  1OXV A;  3CCE A;  2QGQ A;  4QJF A;  5F5W A;  4KHZ A;  3NET A;  1EIF A;  2EJ9 A;  3WQZ A;  1VQI A;  3CCV A;  4P75 C;  3G6E A;  1IL2 A;  4A3L G;  4H2Y A;  4HA8 A;  3EFS A;  5C0X I;  2F3I A;  4K0K L;  4OP0 A;  4EQ5 A;  4LF6 Q;  5JJL A;  2E1H A;  1HNX L;  4HIK A;  3HOW H;  3ULJ A;  2QHV A;  2VQF Q;  3HOW G;  2VZA A;  3M7N A;  1IBK L;  1N8R C;  3MXN B;  3A5Z A;  4OWX B;  3A0J A;  2E10 A;  5C53 B;  1NMG A;  4DAY B;  1VQA A;  3ZJY C;  4XTX A;  4MTN A;  1ASZ A;  4LF4 Q;  3UDI A;  1NYR A;  2I5M X;  3G48 A;  5LMU Q;  4GN4 B;  2IX0 A;  3JC6 6;  4LWC A;  2K50 A;  5GQO A;  2EQS A;  4DR6 L;  4LF4 L;  4BY7 G;  4H2U A;  5IWA Q;  4P71 C;  2R93 G;  2QHT A;  2DXT A;  2GVA A;  2GN5 A;  3H15 A;  4R4T A;  2B63 G;  1YHB A;  1FVI A;  4UP9 A;  2HQL A;  5J3B A;  1Q8K A;  1KRT A;  2PI2 E;  1JT8 A;  3OTO L;  1U5K A;  2ZNI A;  3CMQ A;  4DV5 L;  2R92 G;  3L7Z C;  1PFS A;  3F1Z A;  5AJ3 Q;  1SFO H;  3QO7 A;  5LMN W;  3I4N G;  1UE1 A;  1R9T H;  2OQ0 A;  1NJI C;  1XNQ Q;  2UXD L;  2JJQ A;  1S40 A;  3KOJ A;  2JE6 I;  1K73 C;  3CW2 C;  1YHQ A;  1N36 Q;  1Q1B A;  3HKS A;  1EFW A;  3KLW A;  2MO1 A;  2CQO A;  4HVC A;  1L1O C;  3JAM i;  4TVY A;  1UE7 A;  4R1J A;  2R92 H;  4LNQ A;  2YV5 A;  4E51 A;  2R7F A;  4DV0 L;  4GNX B;  2DQ0 A;  3EN2 A;  2WB1 E;  3S1R H;  2UU9 Q;  2D0P A;  5IP9 H;  2IY5 A;  1PH6 A;  4DR7 L;  4A75 A;  3K7U C;  5AJ3 L;  2P5I A;  3HOU H;  4JBW A;  3I56 A;  3A31 A;  4JI6 Q;  3P8V A;  4JI3 L;  3TS2 A;  1E1O A;  2A1A A;  1AE3 A;  2R7Z G;  3D0F A;  1BKB A;  3V7S A;  1TWA H;  1KOG A;  3HOX H;  3M4O H;  1KIX A;  3ICA A;  1H4V B;  1TWF H;  2MQH A;  5GAH C;  1YIJ A;  1Z7N A;  2I0Q A;  5LMN Q;  4LFA Q;  4R4I A;  3H3V I;  4RQE A;  2PQA B;  1PV4 A;  3ER0 A;  1OXU A;  1NYQ A;  3PUY A;  3Q8D A;  2WAQ G;  4GLA C;  2JA8 G;  2D0O A;  2OTL A;  5LMU L;  4YCU A;  2ZCE A;  1VQN A;  1Q46 A;  3F8T A;  2IHE A;  1MKH A;  1SET A;  4YRQ A;  1J5W A;  5JEA J;  2VS1 A;  2VQE Q;  1QE0 A;  4H2W A;  3W3S A;  4P71 A;  2ZR3 A;  3TRE A;  4GN3 B;  2DTH A;  1X2G A;  3HXZ A;  4XTY A;  2DEQ A;  4KI0 A;  1W3S A;  2UXC L;  1YGB A;  3AYH B;  3PF4 A;  4PMW A;  2UXB L;  1IBM L;  4HID A;  1KRS A;  1AE2 A;  4GNX C;  3LC0 A;  4X6A H;  3BZK A;  2HHH L;  1C0A A;  2PI2 A;  4JI0 Q;  1S72 A;  1WPY A;  2CWA A;  1VQM A;  1VQB A;  5IT9 c;  2ZGW A;  4DKA C;  1GO3 E;  5BR8 Q;  3MF1 A;  3L2Z A;  4YRF A;  3CC4 A;  2N3S A;  1HNZ Q;  4P75 A;  3CCR A;  1VQ9 A;  2JA6 G;  1PHJ A;  4X65 Q;  4YHH L;  4LUV A;  4JYA L;  2CWP A;  3E0E A;  2RHQ B;  4HWT A;  2ATW A;  4JI2 Q;  2KEN A;  4BBR G;  4IPH A;  4L87 A;  4YRJ A;  3J7A 5;  4HJA A;  4J15 A;  3HY0 A;  1G29 1;  2VQE L;  1E22 A;  4H2X A;  4BW9 A;  1V1Q A;  1VQ5 A;  1I5F A;  2NVX H;  1RIQ A;  1I94 Q;  2RCN A;  4H02 A;  2WB1 G;  4LF7 L;  4YPF A;  4FDB A;  3KDF A;  4K87 A;  1VQC A;  4DUY L;  2VUM G;  3GTK H;  1PYB A;  3RN2 A;  4LUO A;  4JI2 L;  1XMQ L;  2JEA I;  1N33 Q;  2RF4 A;  5K1X A;  4YWK A;  1VQH A;  2UUB L;  1XMO L;  1B7Y B;  5M3F G;  4LFC Q;  1Q1E A;  1SE8 A;  1Y14 B;  2ZNJ A;  3IG2 A;  1SN8 A;  4XTZ A;  1YJN A;  1WCM H;  4LUZ A;  4XEM A;  2E41 A;  2J3L A;  3CCM A;  2Y0S G;  4DR5 L;  1SMX A;  2QA4 A;  2AKW A;  4YRP A;  2Z6K C;  4TQF A;  2ALY B;  1H4T A;  4BY7 H;  2JA6 H;  3UFG A;  3OW2 A;  2UUA L;  4IPD A;  3HOV G;  4L5S A;  4JV5 L;  1LYL A;  3H0G G;  4AQY L;  4BY1 H;  1EWI A;  2F52 A;  1YJ9 A;  2E65 A;  3F2B A;  1ADY A;  4YRK A;  3L1A A;  1XNQ L;  4BA2 I;  2UXD Q;  3DSQ A;  2E5L Q;  2R6G A;  2WAQ E;  3SGI A;  4DV1 Q;  4AH6 A;  1EVK A;  1IBL L;  2LSS A;  4C2M H;  4P3O A;  4RQF A;  4QL5 A;  4DUZ Q;  2FYK A;  2CGH A;  4UPA A;  2DTI A;  4P74 C;  5LMN L;  4C3I H;  1K8A C;  1D7Q A;  2AMC A;  5ELO A;  2EWN A;  2DGY A;  3CAM A;  4A3K G;  2N49 A;  2KHI A;  4EO4 A;  1CKM A;  4JI4 L;  1JJC B;  1X54 A;  2JK8 A;  2EXD A;  5IWA L;  4LF9 Q;  1KQS A;  1NNH A;  4DV2 Q;  3PO3 H;  3M9B A;  1J5E Q;  1NJ2 A;  3A5Y A;  1Z9F A;  3VQX A;  4A76 A;  3A7U A;  4A3K H;  2JA7 G;  1X65 A;  2GVB A;  1XTD A;  1USY C;  1JJ2 A;  3K8A A;  4B3T Q;  1BIB A;  4BXX H;  1IXR A;  2F4V Q;  4WF2 A;  4JI7 L;  1J6Q A;  1JE5 A;  2E5L L;  2Z6K A;  1JJC A;  1BBW A;  1ADJ A;  4A3M H;  1S3O A;  3RZO H;  4A3G H;  4A3I H;  1Y1W G;  4YRR A;  4A3D H;  4UP8 A;  1Q81 C;  4HWR A;  1A63 A;  3HOZ H;  3A7A A;  4PZ6 A;  2A19 A;  3UGQ A;  4HIO A;  3HOV H;  4DR2 L;  2Z0S A;  2I4N A;  2I5L X;  1L0W A;  2UUA Q;  2R7Z H;  3T1Y L;  5C44 G;  2JA5 G;  1NJ1 A;  3I7F A;  3P8Y A;  2Q2H A;  4GLV B;  3S1N H;  4HWO A;  1FGU A;  1YEZ A;  3I55 A;  2JEB I;  3HOU G;  5IYC G;  1SRY A;  3RAC A;  4JI7 Q;  2ZT6 A;  3HRK A;  3WWV A;  2KBN A;  1KXL A;  2DUD A;  3GO5 A;  2B3G A;  1NE3 A;  4BBS H;  1OXT A;  3GTP H;  3PSI A;  2YTV A;  2DQ3 A;  2HNI A;  4B3S Q;  3VDY A;  1MJE A;  1XMQ Q;  4G85 A;  3RZD H;  1WQW A;  4DUY Q;  4YRC A;  4A3M G;  4A3B H;  1USY A;  1H95 A;  4L5Q A;  1VQ4 A;  1VCI A;  2E2H H;  2NZO A;  4JYA Q;  3TEH B;  3V8L A;  5C3E H;  2NVT H;  3W1G A;  3H3V H;  1YVC A;  1VQO A;  1HR0 L;  4BWA A;  3ICE A;  4XU0 A;  4HJ8 A;  2ZJP A;  3PUX A;  5FLM H;  4R4Q A;  4X5O A;  1T9H A;  4POF A;  3REU A;  3GTG H;  3FKI H;  1I3Q H;  4DR3 Q;  1FJG Q;  4GKJ Q;  3HXV A;  1GKH A;  3CCL A;  3OD1 A;  1PH7 A;  3HXW A;  3HFZ A;  3EFR A;  2VW9 A;  3KJP A;  4C3H H;  2QHU A;  3TUP A;  3DM3 A;  5GAE C;  4PZ8 A;  3CC7 A;  3L4G A;  1QZH A;  3CD6 A;  1Z7M A;  2QEX A;  1UWV A;  3L2P A;  3GTJ H;  4HIM A;  3TS0 A;  4H2V A;  3L4G B;  3EIV A;  3ULL A;  1NJ5 A;  4JI1 L;  5IE8 A;  1PYS A;  1HC7 A;  1DGS A;  5IYD G;  1XMO Q;  3V7C A;  2HIV A;  1G6P A;  4DR1 L;  3JAM c;  4LFA L;  4X62 L;  3V7R A;  1E1T A;  5M3M G;  3J80 c;  4G84 A;  5C4J H;  3W1B A;  1IYJ B;  4IFD J;  3KF6 A;  3PO2 G;  3TEG A;  1UE6 A;  2V1C C;  1XPU A;  1Q12 A;  3CPF A;  3CPW A;  1WU7 A;  4JI3 Q;  3TEH A;  1TWH H;  2PMZ E;  2Q2I A;  2AMC B;  5C3E G;  4A3F H;  5M5W H;  4R4C A;  4QQB X;  4YRL A;  4WI1 A;  1PH3 A;  3AQQ A;  2PQA A;  4DPG A;  5M3F H;  3W5O A;  2VY3 A;  2IX1 A;  3TQY A;  1YFR A;  1HXD A;  4UY8 C;  5KNN A;  4A3C G;  1VQ8 A;  2UU9 L;  1JMC A;  2CJA A;  3VQV A;  1E24 A;  2YYZ A;  1KMM A;  3J81 i;  1QVC A;  1YIT A;  4P3P A;  3REX A;  4DR7 Q;  2ZJQ A;  3J80 i;  3S17 H;  3S1M H;  2CCZ A;  2JQO A;  2C7I A;  3CCJ A;  4CS3 A;  4DK6 C;  4IJH A;  4JG2 A;  3KJO A;  3OTO Q;  2ZM6 Q;  1VQ7 A;  1YBY A;  4IOC A;  1QF6 A;  3PV0 A;  1HH2 P;  3CME A;  2E8G A;  3QO5 A;  1BVS A;  4OWW B;  4P72 A;  3S14 H;  2E5A A;  3LSQ A;  3RLO A;  2JA5 H;  4KR2 A;  4KHP L;  4NXN L;  5GAG C;  5K36 G;  4IO9 A;  2A8V A;  3RKW A;  1D8L A;  4XTV A;  1CSQ A;  3S24 A;  2Q7G A;  5IYD H;  4DV3 Q;  3AFP A;  3R07 A;  2C35 B;  4UP7 A;  2B63 H;  2NZH A;  4LFC L;  1WYD A;  2E3C A;  4PZ7 A;  3PO2 H;  4YRM A;  4P73 C;  1W66 A;  5C4X G;  1WI5 A;  2ZT8 A;  1HZC A;  1B70 A;  3TRZ A;  4DV7 L;  1E3P A;  1VQK A;  2I4L A;  1HNX Q;  2ZZG A;  4P73 A;  1VQL A;  4K0K Q;  1IBK Q;  1EOV A;  4A3J H;  4XU1 A;  1VQP A;  1C7Y A;  3KDF B;  3K7A H;  4GN5 A;  1PH2 A;  4YRG A;  2Y0S E;  3PO3 G;  3PCO B;  1AH9 A;  2JA9 A;  4NPS A;  3KF6 B;  2CKZ B;  3IKL A;  4QIW E;  3KFU A;  4GS3 A;  3HXU A;  1WQ7 A;  5K1P A;  4JV5 Q;  1N36 L;  3I4M H;  3CF5 A;  4X66 L;  4NXM Q;  1B76 A;  5BR8 L;  4B3R L;  1IBM Q;  1TXY A;  1X2H A;  4CH3 A;  4A3E G;  3RN5 A;  1PH4 A;  4RDX A;  4DR3 L;  1KHI A;  2MO0 A;  3RL6 A;  1U0L A;  2H5X A;  3IAL A;  3LSS A;  1LM0 A;  1N9W A;  2YTX A;  4L5T A;  1TWG H;  3STB C;  1X55 A;  3UH0 A;  3HOX G;  2UUC L;  3HFZ B;  1GGM A;  4MZ9 A;  2HIX A;  2ZTC A;  1N33 L;  3NEM A;  2VNU D;  2KCT A;  1HNW L;  4X64 Q;  2ID0 A;  4LF7 Q;  4OO1 G;  3PIO A;  11AS A;  3MEF A;  4ME3 A;  4DV4 Q;  2DZ9 A;  3PCO A;  2R7D A;  4DR1 Q;  1HZB A;  1OXS C;  1WCM G;  4JOI C;  1MIU A;  1EUJ A;  3HOY G;  4P72 C;  1WOC A;  1X01 A;  4X64 L;  4IFD G;  3J81 j;  1LTL A;  1XNR L;  4BBS G;  2LXK A;  1BIA A;  1XPR A;  3GTM H;  4XTC S;  1GM5 A; 
#chains in the Genus database with same CATH topology
 4FXD A;  3HOZ G;  3BFM A;  2MJ8 A;  4J8Q A;  4H44 C;  1PXU A;  5ELF A;  1EIY B;  1Q7Y C;  1VQJ A;  3CKI B;  1SLJ A;  1HTP A;  3F2D A;  1K0S A;  1N32 Q;  1A0I A;  1D1I A;  1SYB A;  2K14 A;  2Q2U A;  1DJR D;  5JAV A;  3J81 c;  2QF7 A;  3S14 B;  5KEE A;  2XNA C;  2Q8I B;  1NMF A;  4IUR A;  3IKM B;  3H94 A;  4Y7N H;  2XGT A;  5EPK A;  5C0X G;  5E4W C;  1BCP D;  3BYT B;  1CUK A;  4JCV E;  3TP5 A;  1MGS A;  4X66 Q;  4J6H A;  2H4O A;  4B3M Q;  5M3M H;  4GKK L;  3N52 A;  2XVS A;  5M5X H;  5KNC A;  1WTV A;  2B2T A;  4A3F G;  1TWA B;  1WD0 A;  4JBK A;  5FKA C;  2XWB B;  4DR2 Q;  4I65 A;  2Q5I A;  3H6M A;  1J8I A;  4C3J G;  4RMF A;  3D4D A;  2ES2 A;  2OTJ A;  2RHQ A;  1AZQ A;  2I46 A;  2EAY A;  3I4L A;  4JI5 Q;  3P8T A;  1KMN A;  2K5H A;  2X6L A;  3IRB A;  2LS0 1;  4RGM A;  2PZU A;  2LXJ A;  1T5X D;  2HQE A;  3CQZ H;  4A3E H;  1SYG A;  1ZYR C;  1QIL A;  2K7V A;  5KND A;  4DR4 L;  4CDC C;  4ZUJ A;  2A73 B;  2WP8 J;  3H09 A;  5C0X J;  4LNS A;  4LF8 Q;  1WNL A;  4ZTU B;  1SAP A;  2NN6 G;  5JJI A;  1O7I A;  3P20 A;  3PIP 3;  4YY3 L;  5A2Q E;  3S1R B;  2AKW B;  2CW0 D;  3QIA A;  3QWN A;  1ONL A;  4YYE A;  4A3J G;  1H9S B;  1KAW A;  1A6X A;  4QB4 A;  1B7Y A;  1K3R A;  2F0N A;  2Z4H A;  1SES A;  2ZTG A;  4KLK A;  3VR4 A;  3SK4 A;  4BXX G;  1X6O A;  3KF8 B;  4FVM A;  1IZ6 A;  2Q8T A;  1N34 L;  4C3I G;  4WJ3 M;  3MZ5 A;  4CS4 A;  1PA6 A;  1V8Q A;  3Q23 A;  5C52 B;  5KYL A;  3LGJ A;  1ILP A;  2ZTD A;  5ELN A;  3T1H L;  4IPG A;  4YIJ A;  4X3K A;  4G7Z C;  3IFT A;  2ARS A;  4GZY C;  1I50 H;  3A74 A;  3RKY A;  1SJH D;  1NJ8 A;  4A3D B;  3D4W A;  4DV7 Q;  4GLX A;  4DV2 L;  1EFI D;  3M85 A;  5ISR A;  1C9O A;  4OX9 Q;  2IY5 B;  1NCV A;  1UE5 A;  2KQ3 A;  2VB2 X;  5JVG 3;  4TVA B;  4YRO A;  1I4G A;  2F0V A;  2Z1C A;  3G71 A;  2DXU A;  2K5V A;  5JJK A;  1ASY A;  1NY4 A;  3QNE A;  3S2H H;  3SDZ A;  4B3S L;  4IPC A;  4R8N A;  2ZT5 A;  3QB3 A;  4KY6 A;  3ERS X;  4XU3 A;  1CHP D;  2VL6 A;  2PNH A;  2BA0 A;  4OX9 L;  1ENA A;  2I4O A;  2B29 A;  3HOU B;  4OWT B;  2HT1 A;  1EY4 A;  4P2C B;  3K81 C;  2ZXF A;  4DNI A;  4XYQ A;  4HWS A;  3M4Q A;  1X3E A;  3CCQ A;  5FLX E;  3A7A B;  1BBU A;  4DGZ A;  4DV3 L;  5IYB G;  2F0M A;  5COR A;  5EBD A;  4A3G B;  1G91 A;  1VQZ A;  3T1Y Q;  1SER A;  4K86 A;  3G7L A;  3PUW A;  2AWN A;  2IT1 A;  3DMU A;  4FF1 A;  3GV3 A;  4Q0F A;  2RA4 A;  2Z6B A;  3DUZ A;  3GDE A;  5FLM G;  4YDQ A;  2F0U A;  3NEL A;  5T1I A;  5HGQ A;  4DV1 L;  4DV0 Q;  4C3J H;  5IP9 G;  1WLE A;  2K4K A;  3CXC A;  4JI8 L;  5CR3 A;  3SEB A;  1ATI A;  2DN8 A;  4NXN Q;  1EYG A;  4LFB L;  4KHP Q;  3QTC A;  2M2L A;  4QUC A;  4POG A;  2ZZE A;  4OLF A;  1NBW A;  4DNR B;  1TWH B;  2KCM A;  1MJC A;  4YCV A;  4XIG S;  1YNX A;  2Q7E A;  4HAE A;  1KTK A;  2NVY H;  1YB3 A;  4BY1 B;  5FJ8 G;  2EJG C;  3DM1 A;  3OPO A;  4QF4 A;  4IZ8 A;  3J7A V;  3ULP A;  4PG3 A;  1YJW A;  4JI8 Q;  1PFB A;  4WJW A;  3NBH A;  1O7Y A;  1YNN C;  2YTY A;  1A62 A;  5E7N A;  1EQR A;  1WTH A;  3PIO 3;  1KLU D;  3EBE A;  1SSO A;  5C4X B;  3U50 C;  1RIP A;  1S5B D;  2E2J H;  2AWO A;  3MTS A;  4TRD A;  4LF5 L;  5CV6 A;  1PH1 A;  3UDX A;  2RHS A;  3E9I A;  4EQN A;  3HXY A;  5IGF A;  4CDD C;  5DEH A;  3RF1 A;  3E9H A;  2IWH A;  2FMC A;  3QR8 A;  2R7Z B;  3NSW A;  4RG1 A;  1SXT A;  3VBB A;  4YRI A;  1IKL A;  1GUW A;  1K3B C;  4N8X 1;  1A3U A;  2TMP A;  4ZIB A;  2XTI A;  1LTA D;  4A93 G;  1MHW C;  4CS2 A;  2E2I B;  1GHK A;  1LTI D;  1WTP A;  1Q82 C;  1SND A;  4UHV A;  1VQ6 A;  3HG9 A;  1QVG A;  1SMY D;  4AYB G;  3RD4 A;  2OCE A;  4A3I G;  4LF9 L;  1NR4 A;  1ESR A;  2EYP A;  4NCX A;  1N32 L;  2AQ1 B;  1K8G A;  1F2Y A;  1KLG D;  2E2J B;  3I4N H;  3ERR A;  4LVK A;  3HEJ A;  2ZT7 A;  2ODR C;  3NK9 A;  4TVA A;  5HY6 A;  4FO2 A;  1WJJ A;  2E64 A;  4QGU A;  3U9O A;  5G3L D;  4ULL A;  4YWL A;  1HFG A;  3AMU A;  2B2Y A;  2RCF A;  1IYV A;  1I94 L;  2A74 C;  1BQQ T;  1PTO H;  3VYT A;  2SNM A;  3E5S A;  3HXX A;  2ZXP A;  1PVO A;  2B8G A;  4DAM A;  1NJ6 A;  5H1S E;  4L8J A;  4K14 A;  4DK3 C;  2PCF B;  3HRZ C;  4IUQ A;  1JCK B;  2BA1 A;  4IUU A;  2DU5 A;  2GA4 B;  3AEV A;  3J7Z C;  3HZX A;  4DUZ L;  1FYF A;  1K28 A;  1L2F A;  3FKI B;  1RL2 A;  4TWA A;  1XPO A;  2M9V A;  5G3L F;  3K7A B;  2EYM A;  1G5I A;  1P8L A;  5JEA G;  1TVX A;  2OWO A;  1TII D;  4X62 Q;  4LF8 L;  4P74 A;  3OW7 A;  1Q3L A;  2IJ0 A;  5C3X A;  2DZC A;  3V8J A;  2SOB A;  3F2U A;  3AFQ A;  3VQY A;  1VQF A;  3UE0 A;  1V43 A;  4MTK A;  2CIM A;  4K8I A;  5EAY A;  1VQG A;  1O7L A;  2N55 A;  4EQP A;  2E2I H;  1D5M C;  4H2T A;  4JI1 Q;  1JWM D;  3I4M G;  4OIK A;  1JB7 A;  3A7R A;  1AEX A;  1O80 A;  4KK7 A;  4K5V A;  3BZD B;  3I8Z A;  2IHF A;  3U4Z A;  3RLN A;  4DQ2 A;  1I6V C;  3F2C A;  3V96 A;  1PZJ D;  3A32 A;  1KD1 C;  2AHO B;  4B3M L;  1WFQ A;  2Z4I A;  3I72 A;  4K2L A;  3PF5 A;  1HA5 A;  2Q7H A;  1H4S A;  3DWA A;  3PZC A;  1D5X C;  2DJF C;  4YRT A;  1CSP A;  3VR6 A;  1M4V A;  3JAM L;  4CH5 A;  1BCP F;  3BYY B;  3S1Q H;  2MFI A;  2JA8 H;  1NTG A;  4JVZ A;  4IUT A;  3HKZ G;  4GKJ L;  4IJL A;  2MHV A;  2J3M A;  4HJ9 A;  3GTQ H;  5IP7 G;  3R93 A;  1EQQ A;  2PPB C;  1OTC A;  3ONA B;  2K5D A;  4DF7 A;  5FOB B;  1K83 H;  3FHW A;  1KC8 C;  3UE1 A;  1CHQ D;  1HCZ A;  1LAB A;  1LAC A;  3L0O A;  3J7A F;  12AS A;  4XEO A;  2ZIN A;  1STG A;  1SRO A;  1X9N A;  1BCP C;  2DTO A;  1U4R A;  4YRS A;  4G7O C;  2QHS A;  4S3S A;  5DLQ E;  2JA5 B;  1XWE A;  1JJG A;  4CHT B;  2F4V L;  4HN7 A;  3K59 A;  2F0W A;  2XN9 C;  2UUB Q;  2Q5H A;  4A4I A;  1H4Q A;  4BBR B;  3S16 B;  3M4P A;  5C51 B;  3HRI A;  1HR0 Q;  5IY0 A;  3DXJ C;  5D14 A;  1D5Z C;  2DU7 A;  1YI2 A;  2K52 A;  4KR3 A;  2DKG A;  3VR3 A;  1EY9 A;  3T56 B;  4DV4 L;  5A2Q L;  2AUK A;  4KHV A;  2P0L A;  3PUV A;  1J5E L;  5LHY 1;  1HTT A;  2RDG A;  5C3E B;  4XTW A;  1PFN A;  2PME A;  1SRU A;  2ART A;  3K5O A;  4TQD A;  1TWC B;  5CGK A;  1K9M C;  4A93 H;  2N8N A;  2ZJR A;  2I5H A;  4ZAI A;  2Q2T A;  3U58 A;  4P3N A;  2ZZF A;  1VQD A;  2CH4 A;  4IFD H;  3T53 B;  1FYC A;  4TTV A;  2L5T A;  2C9O A;  5K36 H;  1P16 A;  4GOP C;  4A3B G;  3E0J A;  3Q6S A;  4CBV A;  4NMZ A;  4HJ7 A;  1G5H A;  1LUZ A;  1Y1V G;  3QJY A;  2AQ2 B;  4AYB E;  3EJI A;  3W3A A;  1ENC A;  2NWG A;  3A5Z B;  1XJV A;  2O5J C;  4IOA A;  1JIC A;  4I7Z C;  5E3I A;  1G2S A;  4Y52 H;  5C44 H;  2A68 D;  1I6H B;  4NB3 A;  1E0B A;  3P75 A;  1Z47 A;  2KA7 A;  3VYU A;  5EQ0 A;  4A3E B;  4C3H B;  2ICE C;  1BR9 A;  4HCE A;  3NXW A;  4JI0 L;  1Q86 C;  2XIW A;  2ENB A;  2HHH Q;  1KAA A;  3NWT A;  4FXK C;  1S5C D;  3CCU A;  1TS4 A;  2F0O A;  2ZIO A;  3V8K A;  1XYI A;  3R8B A;  1JOO A;  1NUC A;  4NXM L;  4APV A;  3HOY H;  1HUM A;  2K6A A;  4KKS A;  4XYO A;  4AQY Q;  3S15 H;  4A3D G;  3LWU A;  4CDF C;  3B6Y A;  3Q0A A;  3K0X A;  1I4P A;  1FL0 A;  1ZEQ X;  3M4O B;  1GUO A;  2K75 A;  1CK1 A;  3K80 C;  1ET9 A;  3VQW A;  2ZM6 L;  1PH5 A;  4LF5 Q;  2CH4 W;  1G8Z D;  4K88 A;  2JP1 A;  5IYB H;  1QUQ B;  1GD7 A;  4A3C H;  3L3O C;  3HY1 A;  5FO7 B;  4LFB Q;  5I9P A;  3RIR A;  1QOH A;  3NBI A;  2UXB Q;  3Q24 A;  1X3F A;  1G51 A;  1YFT A;  3NTK A;  1SYE A;  2PZT A;  2OEO A;  4EQO A;  4YRN A;  4HJ5 A;  2F3W A;  4Q6G A;  2IW3 A;  4XU2 A;  2ZIM A;  1IW7 C;  3K57 A;  2KEC A;  3I4O A;  3RKX A;  1YHA A;  1C48 A;  2N78 A;  2K33 A;  2G4C A;  2V4D A;  4KQE A;  1HZA A;  3MF2 A;  3NBH B;  4GOP A;  2D62 A;  1Y1W H;  1L1O B;  4ZK9 B;  5IP7 H;  1QZG A;  3BVZ A;  4CJ2 C;  3PGZ A;  1HQM C;  3PIP A;  2C8M A;  3FJP A;  4BBR H;  3S16 H;  3K0Y A;  3RUX A;  1PTO D;  1QWY A;  4B3T L;  3CMA A;  1K0R A;  4TVW A;  4OO1 I;  1AZP A;  3P1H A;  1X56 A;  2WFW A;  2X6G A;  1OXX K;  3U4V A;  4JI4 Q;  4WOR A;  5DM7 3;  1QG7 A;  2B2V A;  4FP5 D;  1UUP A;  4CKC A;  4DV6 L;  4JBM A;  4CJ0 B;  2L15 A;  3HKZ E;  4JK1 C;  5M5Y H;  4DR6 Q;  1TS3 A;  2YU9 H;  3C46 A;  1PYS B;  1YFS A;  5BN5 A;  1EYD A;  3KYH C;  1S5D D;  4O1N A;  4YP0 A;  4R9W A;  4DV6 Q;  2RHS B;  2X69 A;  4ZTZ B;  2SNS A;  3UGT A;  1NR2 A;  1PH8 A;  4LW1 A;  3NPP A;  1BCP B;  4NW2 A;  1E2W A;  2NN6 H;  2QKI C;  2K32 A;  5J39 A;  3GTL H;  4HSV A;  5IIF A;  5FO8 B;  1HJP A;  1K8M A;  3FKI G;  1EIH A;  3D31 A;  1B8A A;  1S4Z A;  4B08 A;  3TDQ A;  4CH6 A;  1F9S A;  2B2T C;  1CKO A;  2C5C A;  3PQI A;  2J0T D;  2KHS A;  1PLF A;  4MNO A;  1UEB A;  2EZV A;  2MNA A;  5IGD A;  2CJB A;  2ZR2 A;  2FXQ A;  4Q15 A;  4BBS B;  3G1Z A;  4A3L H;  1GVP A;  3NEN A;  2PW5 A;  3MAQ A;  1R9T B;  3PMF A;  3M3Y H;  4C3H G;  1EEF D;  4O42 A;  4YCW A;  4GNX A;  2ALY A;  2F0S A;  1I6H H;  2NVQ H;  1I4H A;  2NTS A;  5I6W A;  1IL8 A;  3KK7 A;  4TKO B;  3H0G H;  1N34 Q;  4KN4 C;  1SBB B;  1LLR D;  4LK1 C;  1SE4 A;  3CCS A;  3CRL C;  1IBL Q;  3K58 A;  4H2X B;  1CZG A;  3GTO H;  4I7A A;  1E7Z A;  2F0F A;  3DEP A;  2RDH A;  2B39 A;  3GD7 A;  5C4X H;  2DDZ A;  2TSS A;  3CC2 A;  5I2X A;  1A8V A;  5FLX c;  4JBJ A;  3RNU A;  1WTW A;  1GUN A;  2ARU A;  2EPB A;  2RSO A;  4DR4 Q;  2PMF A;  4GOP B;  1LTR D;  2LKV A;  4JC0 A;  2XSC A;  3RLF A;  1B50 A;  1EVL A;  1W2B A;  1TWC H;  3UDF A;  4YRE A;  2UXC Q;  4AIM A;  5DNF A;  3G4S A;  1Q8I A;  1M90 C;  2B8F A;  3AU7 A;  4DFA A;  2G9D A;  1WTO A;  2CJ9 A;  2WKD A;  5I4D A;  4BY1 G;  4A3K B;  4XTU A;  3DHQ A;  1YZ6 A;  1PRT D;  4DK0 A;  4EVO A;  5D3I B;  1KDC A;  2B63 B;  2I07 B;  4LMQ D;  4DV5 Q;  3ND9 A;  5KGU A;  1X3G A;  4GKK Q;  2EIF A;  3OWE B;  1CTM A;  3I4M B;  4DR5 Q;  2CFM A;  2CVR A;  2ASB A;  1A2T A;  3SVM A;  1PRT B;  1BBX C;  1RHP A;  3MXG A;  3LWE A;  4CH4 A;  2DJZ A;  1MD2 D;  3TSS A;  4FF4 A;  4RWS C;  4IN3 A;  3A5U A;  3BU2 A;  1Y1V H;  3OYY A;  1Y8O B;  4H7B A;  1SR3 A;  1H9M A;  2KHJ A;  1PH9 A;  3HFV A;  4WJ4 A;  1PRT F;  1SMY C;  4RGT A;  5GRO A;  4IUV A;  3T4A C;  1X3P A;  1QUQ A;  3FP9 A;  4DN4 M;  4OON A;  3CHB D;  3HKZ B;  3T51 B;  3C2P A;  1U4M A;  1CKN B;  1XNR Q;  1Y8N B;  3RGL A;  5M5X B;  3TBI B;  5CV7 A;  1VS0 A;  1HNW Q;  4QY7 A;  5IYC H;  2ODR D;  1HZ9 A;  2EYL A;  2K5N A;  3FDT A;  4O0A A;  1EIY A;  4IFD I;  4N8F A;  2NZ1 D;  1LT3 D;  1F77 A;  2VUM H;  3PUZ A;  4LF6 L;  1KL9 A;  3UDG A;  3BJU A;  4YHH Q;  4A3G G;  4X65 L;  1V9P A;  3T1H Q;  4L5R C;  2F0E A;  4H2S A;  1L1O A;  2DVE A;  4LVI A;  1M1K C;  4QCL A;  4YWM A;  3RR5 A;  4JOI A;  4QUF A;  4O2D A;  2BH8 A;  4JI6 L;  1I4X A;  2F03 A;  2VQF L;  1Z6H A;  3MEY A;  5FJ8 H;  2I4M A;  4BA1 I;  1QB5 D;  2F0G A;  4PQX A;  3BDO A;  1CKN A;  3I2Z A;  2OQK A;  4KKT A;  1STE A;  3HS0 C;  1D6E C;  4EX5 A;  3BZC A;  4TQU S;  4YY3 Q;  2WAQ B;  3DLL A;  1B2T A;  3STB D;  4ALP A;  5GAD C;  4RFB A;  1B9N A;  3CP0 A;  2UUC Q;  1UAP A;  1RD9 D;  1IW7 D;  1HNZ L;  3S2D H;  1GXD C;  3D6C A;  2EJG A;  2JA7 H;  3KLR A;  2NN6 I;  1B70 B;  5M3F B;  5A35 A;  1EYC A;  2EJF A;  3HTZ A;  2A6H C;  2PYK A;  3QO8 A;  5I2Y A;  4HWP A;  2BH2 A;  3CQZ B;  5C4H A;  4JI5 L;  4R4O A;  1HR0 W;  4PHC A;  1MI2 A;  4B3R Q;  4LJZ C;  1VQE A;  1STN A;  2ZTE A;  4OXP A;  5CYU A;  5CC4 A;  4OHJ A;  3K5N A;  2BE5 D;  1QVF A;  2R93 H;  2EL9 A;  3ND8 A;  1KNA A;  1YNJ C;  1FJG L;  2NBF A;  3CRK C;  3A55 A;  2O4X A;  1OXV A;  4MIU A;  3WOE A;  4ABN A;  3CCE A;  2QGQ A;  3JAM E;  1WTX A;  3D3R A;  4QJF A;  5F5W A;  4KHZ A;  3NET A;  2F0T A;  1EIF A;  2EJ9 A;  4A3J B;  3WQZ A;  1PMR A;  1VQI A;  3I4N B;  1CT1 D;  5C6A A;  1LTB D;  4MN3 A;  3CCV A;  4P75 C;  5F2D A;  3G6E A;  1IL2 A;  4A3L G;  4H2Y A;  2MUY A;  4HA8 A;  3EFS A;  5C0X I;  3FVQ A;  2F3I A;  5M5W B;  4K0K L;  4OP0 A;  4EQ5 A;  4LF6 Q;  4AYB B;  5JJL A;  3S1M B;  4LVJ A;  2E1H A;  1HNX L;  4HIK A;  3HOW H;  3ULJ A;  2QHV A;  4J1M A;  2VQF Q;  3HOW G;  5EKI A;  2VZA A;  2NB0 A;  2KJX A;  3M7N A;  1IBK L;  1N8R C;  3MXN B;  3A5Z A;  1F9Q A;  4OWX B;  3A0J A;  2E10 A;  5C53 B;  1BF4 A;  1HQR D;  1NMG A;  4DAY B;  1VQA A;  3ZJY C;  1V1O A;  4ID6 A;  2A6E D;  4MTN A;  4XTX A;  1ASZ A;  3V2T A;  4CJ1 B;  3IAY A;  4C2M B;  4LF4 Q;  4U67 3;  2DNC A;  5IGB A;  3UDI A;  2DY8 A;  4BS9 A;  1NYR A;  2KEE A;  1ZXT A;  1LTS D;  2I5M X;  3G48 A;  5LMU Q;  4GN4 B;  2IX0 A;  3TN2 A;  3JC6 6;  4HSP A;  4UAI A;  4LWC A;  2K50 A;  2OT2 A;  5GQO A;  2EQS A;  4DR6 L;  1SNP A;  1SNQ A;  3E3X A;  5E1F A;  4LF4 L;  5IT9 E;  4BY7 G;  4H2U A;  5IWA Q;  4P71 C;  2R93 G;  2QHT A;  1ESF A;  1AP0 A;  1RTN A;  2DXT A;  1DYQ A;  2GVA A;  1MSG A;  4RGN A;  4DXF A;  4FYD A;  2GN5 A;  1TWF B;  4R4T A;  3H15 A;  2B63 G;  1YHB A;  1FVI A;  4UP9 A;  2HQL A;  1WTR A;  1I4R A;  5J3B A;  5CBA E;  3C1F A;  1Q8K A;  1KRT A;  2PI2 E;  4RHS A;  1EOT A;  3GQB A;  1JT8 A;  3NTH A;  4RKL A;  3OTO L;  1U5K A;  3C1E A;  2ZNI A;  3CMQ A;  2KVM A;  4DV5 L;  2R92 G;  2NVT B;  4KY5 A;  3L7Z C;  3R2T A;  1PFS A;  5DM6 3;  1R4Q B;  3F1Z A;  5AJ3 Q;  1SFO H;  1TKW B;  3QO7 A;  1TQO A;  5LMN W;  3I4N G;  1UE1 A;  1JB3 A;  1EZ8 A;  1SNM A;  1ZYR D;  3MFY A;  4KD3 A;  3QOL A;  5CV8 A;  2OQ0 A;  4QMG A;  3VA5 A;  1R9T H;  1NJI C;  1XNQ Q;  2UXD L;  2JJQ A;  4Q5V A;  4CKB A;  1S40 A;  4RGO S;  3KOJ A;  2JE6 I;  1K73 C;  3VA7 A;  3CW2 C;  1YHQ A;  3GTL B;  4JW0 A;  3BS1 A;  1N36 Q;  1Q1B A;  3HKS A;  4RCN A;  5TSS A;  1CM9 A;  1EFW A;  3KLW A;  2MO1 A;  3LX0 A;  2CQO A;  4HVC A;  1L1O C;  3JAM i;  2KOL A;  1UE7 A;  4TVY A;  1PRT C;  4R1J A;  5I9O A;  2R92 H;  4LNQ A;  1QE6 A;  2YV5 A;  4E51 A;  2R7F A;  3EQL C;  4C3J B;  5EKL A;  4EGV A;  4DV0 L;  4GNX B;  2DQ0 A;  2A68 C;  3EN2 A;  2WB1 E;  1HRJ A;  3S1R H;  2UU9 Q;  2D0P A;  4A3F B;  5IP9 H;  4WRD A;  1AN8 A;  5KYI A;  4G7H C;  2IY5 A;  1PH6 A;  4DR7 L;  4A75 A;  3K7U C;  5AJ3 L;  2P5I A;  3HOU H;  4JBW A;  3I56 A;  3A31 A;  2EY5 A;  4JI6 Q;  3P8V A;  5LL6 X;  4JI3 L;  4V19 0;  1NSN S;  3TS2 A;  2MPM A;  1E1O A;  2A1A A;  5EJW A;  2K05 A;  1AE3 A;  2R7Z G;  5ELD A;  3D0F A;  3GV6 A;  1BKB A;  2K01 A;  1PZI D;  3V7S A;  1TWA H;  1KOG A;  3KF8 A;  3HOX H;  3H3V C;  3M4O H;  3I73 A;  4XXE A;  1KIX A;  3LNN A;  1H9S A;  3ICA A;  1F2L A;  4FXG C;  1H4V B;  1TWF H;  2MQH A;  2A5H A;  5GAH C;  1W6K A;  1YIJ A;  1Z7N A;  2I0Q A;  3ZYY X;  5LMN Q;  1L0X B;  2QCP X;  1L0Y B;  1R4P B;  4LFA Q;  4R4I A;  1TY2 A;  3H3V I;  4C1N K;  4RQE A;  2KUM A;  2PQA B;  3TME A;  1PV4 A;  3ER0 A;  1OXU A;  1NYQ A;  3PUY A;  3Q8D A;  2WAQ G;  4GLA C;  2JA8 G;  1JWS D;  3C3L A;  2D0O A;  2OTL A;  1XXG A;  5LMU L;  4YCU A;  1O7Z A;  2ZCE A;  1VQN A;  1Q46 A;  3A7L A;  1S5F D;  3F8T A;  4C56 C;  2IHE A;  1MKH A;  1B3A A;  1PTO C;  1SET A;  1XX8 A;  4YRQ A;  3TZU A;  2EXZ A;  1J5W A;  5JEA J;  2VS1 A;  1SEB D;  2VQE Q;  3BVG A;  3GTM B;  1QE0 A;  3I70 A;  4H2W A;  3W3S A;  4P71 A;  1FD7 D;  4IUN A;  2ZR3 A;  3TRE A;  5FK9 C;  3GP7 A;  2BCO A;  4GN3 B;  2F0I A;  1BO0 A;  3HOY B;  1HPC A;  2DTH A;  3OSO A;  1X2G A;  2EYO A;  1EL0 A;  4B9W A;  3HXZ A;  4XTY A;  2DEQ A;  5T1G A;  1EZ6 A;  5BN3 A;  4KI0 A;  1W3S A;  2UXC L;  1YGB A;  3AYH B;  3J7Y W;  1EU4 A;  3PF4 A;  4PMW A;  2UXB L;  1IBM L;  1KDB A;  2P5Z X;  4HID A;  1KRS A;  1AE2 A;  4GNX C;  3LC0 A;  4X6A H;  3BZK A;  3J80 L;  2XRQ D;  2ZXR A;  5M3M B;  5CV5 A;  2HHH L;  1C0A A;  2PI2 A;  1IKM A;  4JI0 Q;  1IHZ A;  4DU9 A;  2CW0 C;  1S72 A;  4Y7N B;  1WPY A;  2CWA A;  2M00 A;  3A8I E;  1VQM A;  3A8K E;  1VQB A;  5IT9 c;  2ZGW A;  1UEA B;  4DKA C;  1GO3 E;  2AQ3 B;  4FNF A;  5BR8 Q;  3VYS A;  2E75 C;  3MF1 A;  4R8I A;  3L2Z A;  4YRF A;  3CC4 A;  3W2D A;  1A2U A;  2N3S A;  2HD3 A;  1HNZ Q;  4P75 A;  3CCR A;  1VQ9 A;  2DY7 A;  2JA6 G;  1U9R A;  1PHJ A;  2EVB A;  2BDN A;  1SYD A;  4KMU C;  1HXY D;  4XQN A;  4X65 Q;  1VMC A;  4YHH L;  4LUV A;  1B4O A;  2CWP A;  3E0E A;  4JYA L;  3GTJ B;  2RHQ B;  4HWT A;  2N88 A;  5EGT A;  2ATW A;  4JI2 Q;  2KEN A;  4BBR G;  4KTA A;  4IPH A;  4L87 A;  4LAA A;  2B2V C;  4YRJ A;  1HA6 A;  3J7A 5;  4A3M B;  4HJA A;  2CQA A;  4ZKB B;  4J15 A;  3HY0 A;  4U68 A;  1G29 1;  3NWS A;  4DNT B;  2LFN A;  2VQE L;  1E22 A;  2IL8 A;  4H2X A;  4BW9 A;  2B2U C;  1V1Q A;  2L55 A;  5M9O A;  5BN4 A;  1VQ5 A;  1I5F A;  2NVX H;  1RIQ A;  1I94 Q;  1TS5 A;  1QNK A;  2RCN A;  4H02 A;  5C0X H;  2F4I A;  2WB1 G;  2F0H A;  2HDL A;  4LF7 L;  4YPF A;  4XDX A;  2A69 D;  3MA2 B;  4FDB A;  3KDF A;  3HOW B;  1AFP A;  1VQC A;  4K87 A;  1JC7 A;  1TR5 A;  3P7J A;  4DUY L;  3PO3 B;  3WOF A;  3ERO A;  2VUM G;  3GTK H;  1PYB A;  2F0K A;  3RN2 A;  4LUO A;  3T16 A;  2HCC A;  3D6W A;  1XMQ L;  4JI2 L;  2JEA I;  1N33 Q;  2RF4 A;  3S1Q B;  5K1X A;  1BOS A;  2IX3 A;  3ERQ A;  4YWK A;  1VQH A;  2UUB L;  1RJT A;  1XMO L;  2MGS A;  1B7Y B;  5M3F G;  4LFC Q;  1Q1E A;  3OMC A;  1SE8 A;  1Y14 B;  2ZNJ A;  1CQV A;  2EY6 A;  3IG2 A;  4BWG B;  5ELC A;  5JPN C;  1SN8 A;  2HCI A;  1XTC D;  4XTZ A;  4RA8 A;  1YJN A;  1WCM H;  1MSH A;  3DWP A;  4LUZ A;  4XEM A;  2E41 A;  2J3L A;  3CCM A;  2K03 A;  3TZD A;  2Y0S G;  5KIX A;  4DR5 L;  4G57 A;  1SMX A;  2QA4 A;  2AKW A;  3SXH A;  3D8G A;  1PZK D;  3J81 L;  4YRP A;  1SE2 A;  2Z6K C;  4TQF A;  4JPB W;  4UDU C;  2ALY B;  1PYW D;  1H4T A;  1RF2 D;  5NUC A;  4RH6 A;  1F2M A;  3EA6 A;  3TP8 A;  4BY7 H;  2JA6 H;  1PTO F;  4DK1 A;  3UFG A;  1U4P A;  3OW2 A;  3GTK B;  1OO9 B;  2F0Q A;  2UUA L;  4IPD A;  1JOQ A;  3HOV G;  4L5S A;  4JV5 L;  1LYL A;  2KED A;  4E6I A;  4FF3 A;  3H0G G;  4AQY L;  4BY1 H;  1EWI A;  4HMI A;  3FPU B;  2F52 A;  5E4X A;  1YJ9 A;  3NP8 A;  2E65 A;  3V05 A;  3F2B A;  1ADY A;  1LT6 D;  4YRK A;  3SHL A;  3L1A A;  1XNQ L;  1FGB D;  4BA2 I;  2UXD Q;  3DSQ A;  2QW7 A;  2E5L Q;  2R6G A;  2WAQ E;  3SGI A;  1EWH A;  4DV1 Q;  4AH6 A;  4ZYS A;  3J80 E;  1EVK A;  1B44 D;  1IBL L;  2BDO A;  4F87 A;  2L11 A;  2QIL A;  1EY8 A;  1DOL A;  1A3V A;  2LSS A;  4C2M H;  1B9M A;  2A6H D;  3J81 E;  3BDL A;  3FRP B;  4Z9C B;  4P3O A;  1EWC A;  4NKL A;  4RQF A;  4QL5 A;  5D3D A;  3FPP A;  4DUZ Q;  4KJN A;  1EY5 A;  2FYK A;  3I91 A;  2K28 A;  3TP6 A;  2CGH A;  4F7X A;  4UPA A;  2H1E A;  1UNS A;  4DAY A;  1KAB A;  5LMN L;  4C3I H;  2DTI A;  1K8A C;  1D7Q A;  4P74 C;  2R61 A;  1VF5 C;  3BVM A;  1Y1V B;  2AMC A;  3N6R A;  5ELO A;  1GOZ A;  1PDQ A;  3CU7 A;  2OXP A;  3FMC A;  2EWN A;  2DGY A;  2D5D A;  3CAM A;  4A3K G;  2N49 A;  5D65 A;  2KHI A;  4EO4 A;  1CKM A;  4JI4 L;  2JA7 B;  1JJC B;  1X54 A;  2JK8 A;  5CBE E;  2EXD A;  4K6L A;  5IWA L;  2F0L A;  3MQZ A;  5ELB A;  5CMD A;  3KLS X;  1KQS A;  4LF9 Q;  1NNH A;  4A3I B;  4DAP A;  4DV2 Q;  5JEA H;  1FNV A;  3PO3 H;  3M9B A;  4XT1 B;  1HUN A;  1J5E Q;  2IPK D;  1NJ2 A;  1FR3 A;  3A5Y A;  5IGE A;  2Z9H A;  1CA5 A;  1Z9F A;  2RVL A;  3VQX A;  4A76 A;  3A7U A;  3SK8 A;  1JE4 A;  4A3K H;  4F88 A;  2JA7 G;  1X65 A;  2GVB A;  1S5E D;  1XTD A;  3S17 B;  1USY C;  1JJ2 A;  3K8A A;  4B3T Q;  1BIB A;  5C5M A;  4BXX H;  2VB3 X;  4IQZ A;  1IXR A;  2F4V Q;  4WF2 A;  4JI7 L;  2EOT A;  2DNE A;  1J6Q A;  1JE5 A;  2ZT9 C;  3EFX D;  2E5L L;  2EJM A;  2NVY B;  2Z6K A;  4L63 B;  1JJC A;  2A6E C;  1BBW A;  2PW7 A;  3NTI A;  5CV4 A;  5C44 B;  2F0P A;  4ZLT F;  1K83 B;  1ADJ A;  4ZRZ A;  4M1U B;  2K5Q A;  1QCB D;  5JJZ A;  4A3M H;  1NAP A;  1S3O A;  3RZO H;  1EU3 A;  2PQE A;  4NDX A;  2NTT A;  1JOR A;  5FO9 B;  2G9H D;  3R2I A;  1WD1 A;  5JVH 3;  1STY A;  4OEM B;  4A3G H;  2J7Z A;  4HTH A;  5EKK A;  4A3I H;  3U9S A;  1Y1W G;  4YRR A;  1NNX A;  3MXU A;  2EYF A;  4A3D H;  4UP8 A;  5C5L A;  1Q81 C;  4HWR A;  1A63 A;  3HOZ H;  1G2T A;  3A7A A;  2RDF A;  4X3U A;  1ROD A;  4PZ6 A;  2A19 A;  3UGQ A;  4HIO A;  3OIP A;  3HOV H;  2FJ2 A;  5AFW A;  4DR2 L;  1K8O A;  2Z0S A;  3L9A X;  2I4N A;  2I5L X;  1L0W A;  4QIW B;  4K2K A;  2EYJ A;  2PZW A;  1E2Z A;  2UUA Q;  1GJX A;  2R7Z H;  3HOX B;  3T1Y L;  1B1Z A;  1JQY D;  3RZD B;  5C44 G;  3NQT A;  2JA5 G;  1NJ1 A;  3I7F A;  3P8Y A;  2Q2H A;  1BDO A;  4GLV B;  3D4R A;  3TP7 A;  3S1N H;  4HWO A;  1FGU A;  3SE0 A;  1DCZ A;  1YEZ A;  3I55 A;  2B2Y C;  1YNN D;  2JEB I;  2K1B A;  3OOC A;  3HOU G;  5JPM C;  1EY6 A;  1BUV T;  2A69 C;  1LTG D;  1DD2 A;  1LO5 D;  5IYC G;  1SRY A;  3RAC A;  4JI7 Q;  2E74 C;  2ZT6 A;  3HRK A;  3WWV A;  1SYC A;  2J4X A;  2KBN A;  1KXL A;  2DUD A;  1U4L A;  2B3G A;  3GO5 A;  4PNY A;  1NE3 A;  4BBS H;  4FF2 A;  1OXT A;  3GTP H;  2F0J A;  3PSI A;  2NVX B;  5M5Y B;  3BG3 A;  2D9U A;  2CHB D;  1Y8P B;  4KV6 A;  3OHX C;  2YTV A;  3A54 A;  2DQ3 A;  2E76 C;  2HNI A;  4B3S Q;  3S1N B;  1RTO A;  3NUC A;  3VDY A;  1MJE A;  4OIJ A;  5CV9 A;  2L4N A;  1XMQ Q;  3GTG B;  4G85 A;  1EQV A;  2JSO A;  3RZD H;  2EYH A;  1WQW A;  3H0G B;  4DUY Q;  4YRC A;  1TWG B;  1TT2 A;  2SEB D;  4LVL A;  4A3M G;  4A3B H;  4ILW A;  1USY A;  1H95 A;  4L5Q A;  1VQ4 A;  1VCI A;  1WTQ A;  1KNE A;  4XQJ A;  2E2H H;  2NZO A;  4JYA Q;  3TEH B;  3V8L A;  4KN7 C;  5C3E H;  1H9R A;  5I6Y A;  2NVT H;  1KDA A;  3W1G A;  4NP5 A;  3H3V H;  1O78 A;  3OWF A;  1YVC A;  1VQO A;  1HR0 L;  4BWA A;  1M8A A;  3ICE A;  4XU0 A;  4HJ8 A;  3OMG A;  4CKE A;  2ZJP A;  3PUX A;  2NUC A;  2LMC B;  5FLM H;  2R3Z A;  4V0B A;  3DWQ A;  4R4Q A;  5L37 A;  4X5O A;  1SDF A;  1T9H A;  2B2U A;  4POF A;  3REU A;  3GTG H;  3FKI H;  1I3Q H;  4DR3 Q;  1F9P A;  4KJO A;  1CFM A;  2NVQ B;  2BE5 C;  1T5E A;  1FJG Q;  3NQI A;  2LY7 A;  4GKJ Q;  1VMP A;  3GTP B;  2ICI A;  3HXV A;  3X3M A;  1GKH A;  3CCL A;  3OD1 A;  1PH7 A;  3HXW A;  3HFZ A;  3EFR A;  1X3Q A;  1HTL D;  5COY A;  1STA A;  4CDE C;  1A15 A;  4A3B B;  1V1P A;  1C8C A;  5EPL A;  2VW9 A;  1DOM A;  2WAC A;  3RMH A;  3KJP A;  4C3H H;  2QHU A;  3TUP A;  3DM3 A;  5GAE C;  4PZ8 A;  3CC7 A;  3L4G A;  1QZH A;  3CD6 A;  2O2L D;  1A3T A;  1FNU A;  4M8A A;  2DJG C;  1I3Q B;  1Y69 U;  2QDB A;  1SNO A;  3FEW X;  1HFN A;  1Z7M A;  2QEX A;  1GUT A;  1UWV A;  1SJE D;  3L2P A;  3GTJ H;  5J1Z A;  4HIM A;  3TS0 A;  4H2V A;  3KLS A;  5C4Z A;  3L4G B;  5HUR A;  3EIV A;  1BXT A;  1LV9 A;  3ULL A;  1NJ5 A;  4JI1 L;  3A56 A;  5IE8 A;  1SFO B;  1PYS A;  1HC7 A;  5IGC A;  1V1P B;  2QDL A;  1TS2 A;  1DGS A;  2SDF A;  3KBG A;  5IYD G;  1XMO Q;  2R93 B;  3V7C A;  2HIV A;  1B3Q A;  3M4Y A;  1G6P A;  2JN4 A;  2O5I C;  3OIQ A;  4DR1 L;  3JAM c;  4LFA L;  4A93 B;  4X62 L;  3V7R A;  1TU2 B;  1E1T A;  1MBY A;  4XQQ A;  5M3M G;  2F0D A;  4TSS A;  3J80 c;  4G84 A;  4X3S A;  5IOC A;  2PMZ B;  5C4J H;  2E2D C;  1Y1W B;  3W1B A;  1IYJ B;  5ELE A;  3QO2 A;  4IFD J;  1STB A;  3KF6 A;  3PO2 G;  1II3 A;  2FFK B;  2FMM A;  1UE6 A;  2V1C C;  3TEG A;  5DAU A;  3VR5 A;  2L0C A;  1XPU A;  2F3V A;  1Q12 A;  3CPF A;  3HOV B;  4DAV A;  3CPW A;  3K5M A;  1WU7 A;  3IKJ A;  3E6Z X;  4JI3 Q;  4K5X A;  5E3F A;  3TEH A;  1TWH H;  2OF1 A;  2PMZ E;  2Q2I A;  2AMC B;  5C3E G;  2JYO A;  1D2B A;  3GTQ B;  4G4K A;  4A3F H;  5M5W H;  4R4C A;  4QQB X;  4YRL A;  4WI1 A;  1STH A;  1PH3 A;  3AQQ A;  4OGQ C;  2L12 A;  2PQA A;  3K6O A;  4DPG A;  5M3F H;  1I4Q A;  3W5O A;  1AW7 A;  2VY3 A;  4WFN 3;  2IX1 A;  1SNC A;  3TQY A;  1YFR A;  3IFD A;  4DXG A;  2WKC A;  1HXD A;  4UY8 C;  1ZKO A;  3AB9 A;  2AUJ D;  5KNN A;  4ODG A;  4A3C G;  1VQ8 A;  2EDG A;  2UU9 L;  3X3N A;  1JMC A;  2CJA A;  2Z8L A;  5IT9 L;  3VQV A;  4K5W A;  1E24 A;  2YYZ A;  3G6J B;  1SE3 A;  2EY2 A;  1KMM A;  3J81 i;  3QOJ A;  4X3T A;  1VDZ A;  1RKN A;  2K5W A;  4DA2 A;  1QVC A;  2FHT A;  1YIT A;  4P3P A;  3REX A;  4DR7 Q;  2ZJQ A;  3J80 i;  3PO2 B;  4HCS A;  3S17 H;  3S9W A;  3S1M H;  2EE1 A;  2CCZ A;  1CA6 A;  2JQO A;  4MHE A;  1FNW A;  2VXW A;  2C7I A;  2VUM B;  4N9T A;  3S2H B;  4K8J A;  3CCJ A;  2JA8 B;  1JWU D;  4CS3 A;  2EY1 A;  2PO4 A;  4CGY B;  4DK6 C;  4IJH A;  2Q8R E;  4PMC A;  1JOK A;  3Q22 A;  3T13 A;  4JG2 A;  1LT4 D;  3KJO A;  3SR1 A;  3OTO Q;  2ZM6 Q;  1VQ7 A;  1YBY A;  4IOC A;  1DZ1 A;  1ML0 D;  1QF6 A;  3PV0 A;  1HH2 P;  4OO1 H;  4KD4 A;  3CME A;  2E8G A;  1RDP D;  3QO5 A;  1BVS A;  4OWW B;  4P72 A;  3S14 H;  2E5A A;  3LSQ A;  3IL8 A;  5IOD A;  1PFM A;  3RLO A;  2JA5 H;  4KR2 A;  4KHP L;  3HOZ B;  1Z7T A;  3VYR A;  4NXN L;  5KNB A;  4C1N I;  5GAG C;  5K36 G;  2G5D A;  4IO9 A;  1ICW A;  3SK6 A;  2A8V A;  3RKW A;  1H9J A;  2MP1 A;  5KRU A;  2FIN B;  2Y0S B;  4RAU C;  1D8L A;  4H0L C;  4IAL A;  4XTV A;  1CSQ A;  3NE5 B;  3EVQ A;  3S24 A;  2Q7G A;  1F2Z A;  2PNR C;  5IYD H;  4OEL B;  2NS6 A;  4DV3 Q;  1SYF A;  3RZO B;  1HHV A;  3AFP A;  5C4J B;  3R07 A;  2C35 B;  4HED A;  2JA6 B;  3KUP A;  5JOB A;  4UP7 A;  2B63 H;  2B2W A;  2NZH A;  2WV6 D;  4LFC L;  2D2C C;  4HR7 B;  2A8E A;  2NYZ D;  1WYD A;  2KCC A;  2E3C A;  1D1K A;  1H9K A;  4PZ7 A;  3PO2 H;  4YRM A;  3HGB A;  3O13 A;  4P73 C;  1W66 A;  3M3Y B;  5C4X G;  4ME5 A;  2RQX A;  1WI5 A;  4ZUI A;  1Q90 A;  2ZT8 A;  1HZC A;  1WCM B;  1B70 A;  4PMB A;  3TRZ A;  4DV7 L;  1RCV D;  1E3P A;  1EQT A;  1VQK A;  2I4L A;  3MXP A;  1HNX Q;  2ZZG A;  4IUP A;  4P73 A;  1ENF A;  3ITP A;  2JXM B;  1VQL A;  1LTT D;  4K0K Q;  1IBK Q;  4HMJ A;  4B9X A;  1EOV A;  3R3O A;  5IGG A;  3MC0 B;  4A3J H;  3GTO B;  4XU1 A;  3NHH A;  1X32 A;  1VQP A;  3KDF B;  1C7Y A;  4LVM A;  4OL7 A;  4RCO A;  1G6Z A;  3K7A H;  4GN5 A;  1PH2 A;  4YRG A;  2Y0S E;  3VR2 A;  4ZKC B;  3PO3 G;  3PCO B;  1AH9 A;  2JA9 A;  1GUS A;  4NPS A;  3KF6 B;  4H13 C;  3HP3 A;  4C3I B;  2CKZ B;  3UI2 A;  2WB1 B;  4RHR A;  3IKL A;  4QIW E;  1YNJ D;  3KFU A;  3MVV A;  1VF7 A;  4GS3 A;  3HXU A;  3M7G A;  3MEH A;  5FLX L;  1WQ7 A;  5K1P A;  4JV5 Q;  3URY A;  1DM0 B;  2F1M A;  1N36 L;  3I4M H;  2RSN A;  3CF5 A;  3S2D B;  1ET6 A;  4X66 L;  4NXM Q;  1B76 A;  3WDN A;  3I90 A;  1EY0 A;  3RUZ A;  5BR8 L;  4BY7 B;  1E2V A;  4B3R L;  1W6J A;  3MWY W;  3SK5 A;  5J22 A;  1IBM Q;  1TXY A;  1X2H A;  3MHB A;  4L6T B;  4CH3 A;  2HUG A;  4A3E G;  1CQF A;  5EBC A;  3RN5 A;  4ZCK A;  5EPJ A;  1TY0 A;  4F8M A;  2RBM A;  1PH4 A;  4RDX A;  4DR3 L;  1EY7 A;  1KHI A;  1PTO B;  2MO0 A;  3DEO A;  4K6D A;  3RL6 A;  1U0L A;  2H5X A;  3IAL A;  2ZXO A;  1EYA A;  5C3W A;  2L1B A;  3K5L A;  1QNU A;  1GHJ A;  4RKB A;  3LSS A;  1LM0 A;  1N9W A;  2YTX A;  4L5T A;  1ICF B;  1TWG H;  2WIN B;  3STB C;  3I3C A;  1X55 A;  3UH0 A;  3MFG A;  3H91 A;  4KY7 A;  2KCN A;  1DOK A;  4XT3 B;  1CZW A;  1LT5 D;  3HOX G;  2UUC L;  1B53 A;  2L9H A;  2XRS D;  2EJF C;  3HFZ B;  3A8J E;  1WVL A;  2B2W C;  1GGM A;  4MZ9 A;  1EIG A;  1DXM A;  2HIX A;  2ZTC A;  3BDC A;  4ZQ3 A;  1QJO A;  1N33 L;  3S15 B;  1DON A;  3MXN A;  1F9R A;  3NEM A;  2BOS A;  4N9P A;  4KKU A;  5K5P A;  2VNU D;  2KCT A;  2YU9 B;  1HNW L;  3KBX A;  5HGT A;  4X64 Q;  4PV1 C;  2ID0 A;  4LF7 Q;  1I50 B;  2WII B;  4OO1 G;  3PIO A;  1CI3 M;  3MEF A;  11AS A;  2E2H B;  4ME3 A;  2K04 A;  4DV4 Q;  2RKS A;  1EEI D;  3QG1 A;  2DZ9 A;  3PCO A;  2R7D A;  4DR1 Q;  1HZB A;  1GUG A;  1OXS C;  1BNZ A;  1WCM G;  4JOI C;  1JR0 D;  1MIU A;  1EUJ A;  3HOY G;  2R92 B;  4P72 C;  2HDM A;  4HT4 A;  1WOC A;  1IYU A;  2QEJ C;  2XWJ B;  1C4Q A;  4X64 L;  1X01 A;  4IFD G;  5LL6 S;  3J81 j;  1ILQ A;  1LTL A;  1XNR L;  4BBS G;  2LXK A;  1BIA A;  1XPR A;  3GTM H;  4XTC S;  1GM5 A;  1J9O A; 
#chains in the Genus database with same CATH homology
 3HOZ G;  3BFM A;  1EIY B;  1Q7Y C;  1VQJ A;  1SLJ A;  3F2D A;  1N32 Q;  1A0I A;  2K14 A;  2Q2U A;  3J81 c;  1NMF A;  3IKM B;  4Y7N H;  2XGT A;  5C0X G;  1CUK A;  4JCV E;  4X66 Q;  4B3M Q;  5M3M H;  4GKK L;  5M5X H;  4A3F G;  4JBK A;  4DR2 Q;  2Q5I A;  4RMF A;  2ES2 A;  2OTJ A;  2RHQ A;  2EAY A;  4JI5 Q;  3P8T A;  1KMN A;  2K5H A;  3IRB A;  2LXJ A;  3CQZ H;  4A3E H;  4DR4 L;  2WP8 J;  5C0X J;  4LNS A;  4LF8 Q;  1WNL A;  4ZTU B;  2NN6 G;  5JJI A;  1O7I A;  4YY3 L;  2AKW B;  4YYE A;  4A3J G;  1KAW A;  1B7Y A;  1K3R A;  1SES A;  2ZTG A;  4KLK A;  4BXX G;  1X6O A;  3KF8 B;  1IZ6 A;  1N34 L;  4WJ3 M;  4CS4 A;  1PA6 A;  5C52 B;  3LGJ A;  2ZTD A;  5ELN A;  3T1H L;  4IPG A;  2ARS A;  1I50 H;  3A74 A;  3RKY A;  1NJ8 A;  4DV7 Q;  4GLX A;  4DV2 L;  3M85 A;  1C9O A;  4OX9 Q;  2IY5 B;  1UE5 A;  4TVA B;  4YRO A;  3G71 A;  2DXU A;  2K5V A;  5JJK A;  1ASY A;  1NY4 A;  3QNE A;  3S2H H;  4B3S L;  4IPC A;  2ZT5 A;  3ERS X;  4XU3 A;  2VL6 A;  2PNH A;  2BA0 A;  4OX9 L;  2I4O A;  2B29 A;  4OWT B;  2HT1 A;  2ZXF A;  3K81 C;  4DNI A;  4HWS A;  3M4Q A;  1X3E A;  3CCQ A;  1BBU A;  4DV3 L;  5IYB G;  1SER A;  1VQZ A;  3T1Y Q;  4K86 A;  3PUW A;  2AWN A;  2IT1 A;  3GDE A;  5FLM G;  4YDQ A;  3NEL A;  5HGQ A;  4DV1 L;  4DV0 Q;  4C3J H;  5IP9 G;  1WLE A;  2K4K A;  3CXC A;  4JI8 L;  1ATI A;  4NXN Q;  1EYG A;  4LFB L;  4KHP Q;  3QTC A;  2ZZE A;  4POG A;  4OLF A;  1NBW A;  2KCM A;  1MJC A;  4YCV A;  4XIG S;  1YNX A;  2Q7E A;  2NVY H;  1YB3 A;  5FJ8 G;  3ULP A;  4PG3 A;  1YJW A;  4JI8 Q;  2YTY A;  1A62 A;  5E7N A;  1EQR A;  3EBE A;  3U50 C;  1RIP A;  2E2J H;  2AWO A;  4LF5 L;  1PH1 A;  3UDX A;  2RHS A;  3E9I A;  3HXY A;  3RF1 A;  3E9H A;  4RG1 A;  4YRI A;  3VBB A;  4ZIB A;  2XTI A;  4A93 G;  4CS2 A;  1Q82 C;  1VQ6 A;  1QVG A;  4AYB G;  2OCE A;  4A3I G;  4LF9 L;  4NCX A;  1N32 L;  1K8G A;  3I4N H;  3ERR A;  4LVK A;  2ZT7 A;  2ODR C;  4TVA A;  5HY6 A;  1WJJ A;  2E64 A;  4QGU A;  4YWL A;  1I94 L;  3HXX A;  1PVO A;  4DAM A;  1NJ6 A;  5H1S E;  4DK3 C;  2BA1 A;  2DU5 A;  3AEV A;  3J7Z C;  4DUZ L;  1FYF A;  1L2F A;  1RL2 A;  4TWA A;  1XPO A;  1G5I A;  1P8L A;  5JEA G;  2OWO A;  4X62 Q;  4LF8 L;  4P74 A;  2DZC A;  3V8J A;  3AFQ A;  3VQY A;  1VQF A;  3UE0 A;  1V43 A;  2CIM A;  5EAY A;  1VQG A;  2E2I H;  4H2T A;  4JI1 Q;  3I4M G;  1JB7 A;  3A7R A;  2IHF A;  3U4Z A;  3RLN A;  4DQ2 A;  3F2C A;  3A32 A;  1KD1 C;  2AHO B;  4B3M L;  1WFQ A;  3PF5 A;  2Q7H A;  1H4S A;  3PZC A;  4YRT A;  1CSP A;  4CH5 A;  3S1Q H;  2MFI A;  2JA8 H;  1NTG A;  3HKZ G;  4GKJ L;  4IJL A;  2J3M A;  4HJ9 A;  3GTQ H;  5IP7 G;  1EQQ A;  1OTC A;  1K83 H;  3FHW A;  1KC8 C;  3UE1 A;  12AS A;  4XEO A;  3L0O A;  2ZIN A;  1SRO A;  1X9N A;  2DTO A;  4YRS A;  2QHS A;  5DLQ E;  1JJG A;  2F4V L;  2UUB Q;  2Q5H A;  4A4I A;  1H4Q A;  5C51 B;  3M4P A;  3HRI A;  1HR0 Q;  5IY0 A;  2DU7 A;  1YI2 A;  2K52 A;  4KR3 A;  2DKG A;  4DV4 L;  2P0L A;  3PUV A;  1J5E L;  1HTT A;  4XTW A;  2PME A;  1SRU A;  2ART A;  4TQD A;  1K9M C;  4A93 H;  2N8N A;  2ZJR A;  2I5H A;  2Q2T A;  3U58 A;  4P3N A;  2ZZF A;  1VQD A;  4TTV A;  1P16 A;  4GOP C;  4A3B G;  4HJ7 A;  1G5H A;  1LUZ A;  1Y1V G;  4AYB E;  3A5Z B;  1XJV A;  4IOA A;  5E3I A;  4Y52 H;  5C44 H;  4NB3 A;  1Z47 A;  4JI0 L;  1Q86 C;  2HHH Q;  2ZIO A;  3CCU A;  3V8K A;  4NXM L;  3HOY H;  4APV A;  4AQY Q;  3S15 H;  4A3D G;  3B6Y A;  3K0X A;  1FL0 A;  2K75 A;  3K80 C;  3VQW A;  2ZM6 L;  1PH5 A;  4LF5 Q;  4K88 A;  5IYB H;  1QUQ B;  1GD7 A;  4A3C H;  3HY1 A;  4LFB Q;  3RIR A;  2UXB Q;  1X3F A;  1G51 A;  1YFT A;  4YRN A;  4HJ5 A;  4Q6G A;  4XU2 A;  2ZIM A;  3I4O A;  3RKX A;  1YHA A;  2N78 A;  2G4C A;  4KQE A;  1HZA A;  3MF2 A;  3NBH B;  4GOP A;  2D62 A;  1Y1W H;  1L1O B;  5IP7 H;  1QZG A;  3FJP A;  3PIP A;  3PGZ A;  2C8M A;  4BBR H;  3S16 H;  3RUX A;  4B3T L;  3CMA A;  1K0R A;  4TVW A;  4OO1 I;  1X56 A;  2WFW A;  1OXX K;  3U4V A;  4JI4 Q;  4DV6 L;  4JBM A;  2L15 A;  3HKZ E;  5M5Y H;  4DR6 Q;  2YU9 H;  1PYS B;  1YFS A;  3KYH C;  4YP0 A;  4DV6 Q;  2RHS B;  4ZTZ B;  3UGT A;  1PH8 A;  4LW1 A;  3GTL H;  1HJP A;  3FKI G;  3D31 A;  1B8A A;  4CH6 A;  1CKO A;  4MNO A;  1UEB A;  2MNA A;  2CJB A;  2ZR2 A;  2FXQ A;  4Q15 A;  3G1Z A;  4A3L H;  1GVP A;  3NEN A;  3M3Y H;  4GNX A;  4YCW A;  2ALY A;  1I6H H;  2NVQ H;  3H0G H;  1N34 Q;  3CCS A;  1IBL Q;  4H2X B;  3GTO H;  1E7Z A;  3GD7 A;  5C4X H;  2DDZ A;  3CC2 A;  1A8V A;  5FLX c;  4JBJ A;  3RNU A;  2ARU A;  4DR4 Q;  2PMF A;  4GOP B;  4JC0 A;  3RLF A;  1EVL A;  1W2B A;  1TWC H;  4YRE A;  3UDF A;  2UXC Q;  4AIM A;  3G4S A;  1M90 C;  2CJ9 A;  4BY1 G;  4XTU A;  1YZ6 A;  4DV5 Q;  1X3G A;  4GKK Q;  2EIF A;  4DR5 Q;  2CFM A;  2ASB A;  4CH4 A;  2DJZ A;  3A5U A;  3BU2 A;  1Y1V H;  3OYY A;  1SR3 A;  2KHJ A;  1PH9 A;  3HFV A;  4WJ4 A;  5GRO A;  1QUQ A;  3FP9 A;  4OON A;  1CKN B;  1XNR Q;  3RGL A;  1VS0 A;  1HNW Q;  4QY7 A;  5IYC H;  2ODR D;  1HZ9 A;  2K5N A;  4O0A A;  1EIY A;  4IFD I;  2VUM H;  3PUZ A;  4LF6 L;  1KL9 A;  3UDG A;  3BJU A;  4YHH Q;  4A3G G;  4X65 L;  1V9P A;  3T1H Q;  4L5R C;  4H2S A;  1L1O A;  2DVE A;  4LVI A;  1M1K C;  4YWM A;  3RR5 A;  4JOI A;  4O2D A;  2BH8 A;  4JI6 L;  2VQF L;  3MEY A;  5FJ8 H;  2I4M A;  4BA1 I;  1CKN A;  3I2Z A;  2OQK A;  4EX5 A;  3BZC A;  4TQU S;  4YY3 Q;  3DLL A;  3STB D;  4ALP A;  5GAD C;  2UUC Q;  3CP0 A;  1HNZ L;  3S2D H;  2EJG A;  2JA7 H;  2NN6 I;  1B70 B;  3HTZ A;  2EJF A;  3QO8 A;  4HWP A;  2BH2 A;  4JI5 L;  4R4O A;  1HR0 W;  4PHC A;  4B3R Q;  1VQE A;  2ZTE A;  4OXP A;  2EL9 A;  1QVF A;  2R93 H;  1FJG L;  1OXV A;  3CCE A;  2QGQ A;  4QJF A;  5F5W A;  4KHZ A;  3NET A;  1EIF A;  2EJ9 A;  3WQZ A;  1VQI A;  3CCV A;  4P75 C;  3G6E A;  1IL2 A;  4A3L G;  4H2Y A;  4HA8 A;  3EFS A;  5C0X I;  2F3I A;  4K0K L;  4OP0 A;  4EQ5 A;  4LF6 Q;  5JJL A;  4LVJ A;  2E1H A;  1HNX L;  4HIK A;  3HOW H;  3ULJ A;  2QHV A;  2VQF Q;  3HOW G;  2VZA A;  3M7N A;  1IBK L;  1N8R C;  3MXN B;  3A5Z A;  4OWX B;  3A0J A;  2E10 A;  5C53 B;  1NMG A;  4DAY B;  1VQA A;  3ZJY C;  4XTX A;  4MTN A;  1ASZ A;  4LF4 Q;  3UDI A;  1NYR A;  2I5M X;  3G48 A;  5LMU Q;  4GN4 B;  2IX0 A;  3JC6 6;  4LWC A;  2K50 A;  5GQO A;  2EQS A;  4DR6 L;  4LF4 L;  4BY7 G;  4H2U A;  5IWA Q;  4P71 C;  2R93 G;  2QHT A;  2DXT A;  2GVA A;  2GN5 A;  3H15 A;  4R4T A;  2B63 G;  1YHB A;  1FVI A;  4UP9 A;  2HQL A;  5J3B A;  1Q8K A;  1KRT A;  2PI2 E;  1JT8 A;  3OTO L;  1U5K A;  2ZNI A;  3CMQ A;  4DV5 L;  2R92 G;  3L7Z C;  1PFS A;  3F1Z A;  5AJ3 Q;  1SFO H;  3QO7 A;  5LMN W;  3I4N G;  1UE1 A;  1R9T H;  2OQ0 A;  1NJI C;  1XNQ Q;  2UXD L;  2JJQ A;  1S40 A;  3KOJ A;  2JE6 I;  1K73 C;  3CW2 C;  1YHQ A;  1N36 Q;  1Q1B A;  3HKS A;  1EFW A;  3KLW A;  2MO1 A;  2CQO A;  4HVC A;  1L1O C;  3JAM i;  4TVY A;  1UE7 A;  4R1J A;  2R92 H;  4LNQ A;  2YV5 A;  4E51 A;  2R7F A;  4DV0 L;  4GNX B;  2DQ0 A;  3EN2 A;  2WB1 E;  3S1R H;  2UU9 Q;  2D0P A;  5IP9 H;  2IY5 A;  1PH6 A;  4DR7 L;  4A75 A;  3K7U C;  5AJ3 L;  2P5I A;  3HOU H;  4JBW A;  3I56 A;  3A31 A;  4JI6 Q;  3P8V A;  4JI3 L;  3TS2 A;  1E1O A;  2A1A A;  1AE3 A;  2R7Z G;  3D0F A;  1BKB A;  3V7S A;  1TWA H;  1KOG A;  3HOX H;  3M4O H;  1KIX A;  3ICA A;  1H4V B;  1TWF H;  2MQH A;  5GAH C;  1YIJ A;  1Z7N A;  2I0Q A;  5LMN Q;  4LFA Q;  4R4I A;  3H3V I;  4RQE A;  2PQA B;  1PV4 A;  3ER0 A;  1OXU A;  1NYQ A;  3PUY A;  3Q8D A;  2WAQ G;  4GLA C;  2JA8 G;  2D0O A;  2OTL A;  5LMU L;  4YCU A;  2ZCE A;  1VQN A;  1Q46 A;  3F8T A;  2IHE A;  1MKH A;  1SET A;  4YRQ A;  1J5W A;  5JEA J;  2VS1 A;  2VQE Q;  1QE0 A;  4H2W A;  3W3S A;  4P71 A;  2ZR3 A;  3TRE A;  4GN3 B;  2DTH A;  1X2G A;  3HXZ A;  4XTY A;  2DEQ A;  4KI0 A;  1W3S A;  2UXC L;  1YGB A;  3AYH B;  3PF4 A;  4PMW A;  2UXB L;  1IBM L;  4HID A;  1KRS A;  1AE2 A;  4GNX C;  3LC0 A;  4X6A H;  3BZK A;  2HHH L;  1C0A A;  2PI2 A;  4JI0 Q;  1S72 A;  1WPY A;  2CWA A;  1VQM A;  1VQB A;  5IT9 c;  2ZGW A;  4DKA C;  1GO3 E;  5BR8 Q;  3MF1 A;  3L2Z A;  4YRF A;  3CC4 A;  2N3S A;  1HNZ Q;  4P75 A;  3CCR A;  1VQ9 A;  2JA6 G;  1PHJ A;  4X65 Q;  4YHH L;  4LUV A;  4JYA L;  2CWP A;  3E0E A;  2RHQ B;  4HWT A;  2ATW A;  4JI2 Q;  2KEN A;  4BBR G;  4IPH A;  4L87 A;  4YRJ A;  3J7A 5;  4HJA A;  4J15 A;  3HY0 A;  1G29 1;  2VQE L;  1E22 A;  4H2X A;  4BW9 A;  1V1Q A;  1VQ5 A;  1I5F A;  2NVX H;  1RIQ A;  1I94 Q;  2RCN A;  4H02 A;  2WB1 G;  4LF7 L;  4YPF A;  4FDB A;  3KDF A;  4K87 A;  1VQC A;  4DUY L;  2VUM G;  3GTK H;  1PYB A;  3RN2 A;  4LUO A;  4JI2 L;  1XMQ L;  2JEA I;  1N33 Q;  2RF4 A;  5K1X A;  4YWK A;  1VQH A;  2UUB L;  1XMO L;  1B7Y B;  5M3F G;  4LFC Q;  1Q1E A;  1SE8 A;  1Y14 B;  2ZNJ A;  3IG2 A;  1SN8 A;  4XTZ A;  1YJN A;  1WCM H;  4LUZ A;  4XEM A;  2E41 A;  2J3L A;  3CCM A;  2Y0S G;  4DR5 L;  1SMX A;  2QA4 A;  2AKW A;  4YRP A;  2Z6K C;  4TQF A;  2ALY B;  1H4T A;  4BY7 H;  2JA6 H;  3UFG A;  3OW2 A;  2UUA L;  4IPD A;  3HOV G;  4L5S A;  4JV5 L;  1LYL A;  3H0G G;  4AQY L;  4BY1 H;  1EWI A;  2F52 A;  1YJ9 A;  2E65 A;  3F2B A;  1ADY A;  4YRK A;  3L1A A;  1XNQ L;  4BA2 I;  2UXD Q;  3DSQ A;  2E5L Q;  2R6G A;  2WAQ E;  3SGI A;  4DV1 Q;  4AH6 A;  1EVK A;  1IBL L;  2LSS A;  4C2M H;  4P3O A;  4RQF A;  4QL5 A;  4DUZ Q;  2FYK A;  2CGH A;  4UPA A;  2DTI A;  4P74 C;  5LMN L;  4C3I H;  1K8A C;  1D7Q A;  2AMC A;  5ELO A;  2EWN A;  2DGY A;  3CAM A;  4A3K G;  2N49 A;  2KHI A;  4EO4 A;  1CKM A;  4JI4 L;  1JJC B;  1X54 A;  2JK8 A;  2EXD A;  5IWA L;  3MQZ A;  4LF9 Q;  1KQS A;  1NNH A;  4DV2 Q;  3PO3 H;  3M9B A;  1J5E Q;  1NJ2 A;  3A5Y A;  1Z9F A;  3VQX A;  4A76 A;  3A7U A;  4A3K H;  2JA7 G;  1X65 A;  2GVB A;  1XTD A;  1USY C;  1JJ2 A;  3K8A A;  4B3T Q;  1BIB A;  4BXX H;  1IXR A;  2F4V Q;  4WF2 A;  4JI7 L;  1J6Q A;  1JE5 A;  2E5L L;  2Z6K A;  1JJC A;  1BBW A;  1ADJ A;  4A3M H;  1S3O A;  3RZO H;  4A3G H;  4A3I H;  1Y1W G;  4YRR A;  4A3D H;  4UP8 A;  1Q81 C;  4HWR A;  1A63 A;  3HOZ H;  3A7A A;  4PZ6 A;  2A19 A;  3UGQ A;  4HIO A;  3HOV H;  4DR2 L;  2Z0S A;  2I4N A;  2I5L X;  1L0W A;  2UUA Q;  2R7Z H;  3T1Y L;  5C44 G;  2JA5 G;  1NJ1 A;  3I7F A;  3P8Y A;  2Q2H A;  4GLV B;  3S1N H;  4HWO A;  1FGU A;  1YEZ A;  3I55 A;  2JEB I;  3HOU G;  5IYC G;  1SRY A;  3RAC A;  4JI7 Q;  2ZT6 A;  3HRK A;  3WWV A;  2KBN A;  1KXL A;  2DUD A;  3GO5 A;  2B3G A;  1NE3 A;  4BBS H;  1OXT A;  3GTP H;  3PSI A;  2YTV A;  2DQ3 A;  2HNI A;  4B3S Q;  3VDY A;  1MJE A;  1XMQ Q;  4G85 A;  3RZD H;  1WQW A;  4DUY Q;  4YRC A;  4LVL A;  4A3M G;  4A3B H;  1USY A;  1H95 A;  4L5Q A;  1VQ4 A;  1VCI A;  2E2H H;  2NZO A;  4JYA Q;  3TEH B;  3V8L A;  5C3E H;  2NVT H;  3W1G A;  3H3V H;  1YVC A;  1VQO A;  1HR0 L;  4BWA A;  3ICE A;  4XU0 A;  4HJ8 A;  2ZJP A;  3PUX A;  5FLM H;  4R4Q A;  4X5O A;  1T9H A;  4POF A;  3REU A;  3GTG H;  3FKI H;  1I3Q H;  4DR3 Q;  1FJG Q;  4GKJ Q;  3HXV A;  1GKH A;  3CCL A;  3OD1 A;  1PH7 A;  3HXW A;  3HFZ A;  3EFR A;  2VW9 A;  3KJP A;  4C3H H;  2QHU A;  3TUP A;  3DM3 A;  5GAE C;  4PZ8 A;  3CC7 A;  3L4G A;  1QZH A;  3CD6 A;  1Z7M A;  2QEX A;  1UWV A;  3L2P A;  3GTJ H;  4HIM A;  3TS0 A;  4H2V A;  3L4G B;  3EIV A;  3ULL A;  1NJ5 A;  4JI1 L;  5IE8 A;  1PYS A;  1HC7 A;  1DGS A;  5IYD G;  1XMO Q;  3V7C A;  2HIV A;  1G6P A;  4DR1 L;  3JAM c;  4LFA L;  4X62 L;  3V7R A;  1E1T A;  5M3M G;  3J80 c;  4G84 A;  5C4J H;  3W1B A;  1IYJ B;  4IFD J;  3KF6 A;  3PO2 G;  3TEG A;  1UE6 A;  2V1C C;  1XPU A;  1Q12 A;  3CPF A;  3CPW A;  1WU7 A;  4JI3 Q;  3TEH A;  1TWH H;  2PMZ E;  2Q2I A;  2AMC B;  5C3E G;  4A3F H;  5M5W H;  4R4C A;  4QQB X;  4YRL A;  4WI1 A;  1PH3 A;  3AQQ A;  2PQA A;  4DPG A;  5M3F H;  3W5O A;  2VY3 A;  2IX1 A;  3TQY A;  1YFR A;  1HXD A;  4UY8 C;  5KNN A;  4A3C G;  1VQ8 A;  2UU9 L;  1JMC A;  2CJA A;  3VQV A;  1E24 A;  2YYZ A;  1KMM A;  3J81 i;  1QVC A;  1YIT A;  4P3P A;  3REX A;  4DR7 Q;  2ZJQ A;  3J80 i;  3S17 H;  3S1M H;  2CCZ A;  2JQO A;  2C7I A;  3CCJ A;  4CS3 A;  4DK6 C;  4IJH A;  4JG2 A;  3KJO A;  3OTO Q;  2ZM6 Q;  1VQ7 A;  1YBY A;  4IOC A;  1QF6 A;  3PV0 A;  1HH2 P;  3CME A;  2E8G A;  3QO5 A;  1BVS A;  4OWW B;  4P72 A;  3S14 H;  2E5A A;  3LSQ A;  3RLO A;  2JA5 H;  4KR2 A;  4KHP L;  4NXN L;  5GAG C;  5K36 G;  4IO9 A;  2A8V A;  3RKW A;  1D8L A;  4XTV A;  1CSQ A;  3S24 A;  2Q7G A;  5IYD H;  2NS6 A;  4DV3 Q;  3AFP A;  3R07 A;  2C35 B;  4UP7 A;  2B63 H;  2NZH A;  4LFC L;  2A8E A;  1WYD A;  2E3C A;  4PZ7 A;  3PO2 H;  4YRM A;  4P73 C;  1W66 A;  5C4X G;  1WI5 A;  2ZT8 A;  1HZC A;  1B70 A;  3TRZ A;  4DV7 L;  1E3P A;  1VQK A;  2I4L A;  1HNX Q;  2ZZG A;  4P73 A;  1VQL A;  4K0K Q;  1IBK Q;  1EOV A;  4A3J H;  4XU1 A;  1VQP A;  1C7Y A;  3KDF B;  4LVM A;  3K7A H;  4GN5 A;  1PH2 A;  4YRG A;  2Y0S E;  3PO3 G;  3PCO B;  1AH9 A;  2JA9 A;  4NPS A;  3KF6 B;  2CKZ B;  3IKL A;  4QIW E;  3KFU A;  4GS3 A;  3HXU A;  1WQ7 A;  5K1P A;  4JV5 Q;  1N36 L;  3I4M H;  3CF5 A;  4X66 L;  4NXM Q;  1B76 A;  5BR8 L;  4B3R L;  1IBM Q;  1TXY A;  1X2H A;  4CH3 A;  4A3E G;  3RN5 A;  1PH4 A;  4RDX A;  4DR3 L;  1KHI A;  2MO0 A;  3RL6 A;  1U0L A;  2H5X A;  3IAL A;  3LSS A;  1LM0 A;  1N9W A;  2YTX A;  4L5T A;  1TWG H;  3STB C;  1X55 A;  3UH0 A;  3HOX G;  2UUC L;  3HFZ B;  1GGM A;  4MZ9 A;  2HIX A;  2ZTC A;  1N33 L;  3NEM A;  2VNU D;  2KCT A;  1HNW L;  4X64 Q;  2ID0 A;  4LF7 Q;  4OO1 G;  3PIO A;  11AS A;  3MEF A;  4ME3 A;  4DV4 Q;  2DZ9 A;  3PCO A;  2R7D A;  4DR1 Q;  1HZB A;  1OXS C;  1WCM G;  4JOI C;  1MIU A;  1EUJ A;  3HOY G;  4P72 C;  4HT4 A;  1WOC A;  1X01 A;  4X64 L;  4IFD G;  3J81 j;  1LTL A;  1XNR L;  4BBS G;  2LXK A;  1BIA A;  1XPR A;  3GTM H;  4XTC S;  1GM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...