2XGTA

Asparaginyl-trna synthetase from brugia malayi complexed with the sulphamoyl analogue of asparaginyl-adenylate
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
427
Chain Sequence
VKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPNGHELIADFWKIIGNAPPGGIDNVLNASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAQDNTLTESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hybrid Structural Model of the Complete Brugia Malayi Cytoplasmic Asparaginyl-tRNA Synthetase.
pubmed doi rcsb
source organism Brugia malayi
molecule tags Ligase
molecule keywords ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC
total genus 128
structure length 427
sequence length 435
chains with identical sequence B
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2xgtA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2xgtA02
1V9PA 4IO9A 4B3TQ 2A8VA 1WLEA 1BBUA 5J3BA 4LF8Q 3PV0A 4FDBA 1VQZA 4LW1A 2AKWA 3GD7A 3K81C 4H02A 1E1OA 4UPAA 3PZCA 3EBEA 3CQZH 1VQNA 2YTVA 1EIYB 2C8MA 3S14H 1UE7A 4BXXH 1XNRL 3L4GB 3PCOB 2I5HA 4G85A 3PUXA 1YB3A 2KCMA 3DM3A 1Q1BA 1S40A 2DVEA 2UXCL 4H2XB 3J81j 4CS4A 1WCMG 3VQYA 4DV1L 4OO1G 2ZNIA 3LSQA 2D0PA 3FKIG 5GAHC 4A3GG 1WQ7A 2IY5A 3TQYA 1HNXQ 3UH0A 3HFVA 4K87A 4YRRA 1SRUA 3S1QH 3CMAA 1Y1VG 4XTXA 3GO5A 4YRLA 2H5XA 1YITA 1YJWA 2C35B 4A3DG 1IXRA 3VQXA 3RLFA 2ZCEA 2Q5IA 3EFSA 2DXUA 4JOIA 3RUXA 1YHBA 4YRQA 2AMCB 4YY3L 4XIGS 2QGQA 1U5KA 2Q7HA 2AWNA 3RKWA 1LM0A 4OONA 1Q82C 2R6GA 1SLJA 1N33L 2EXDA 1QZHA 4ALPA 1HNZL 1A62A 2UUCL 3DSQA 1E1TA 4NCXA 5M3FH 4R4QA 4DNIA 1TWCH 2UXDQ 1PYSA 4POFA 2K50A 3UFGA 2DTIA 1Z47A 4BY1G 1SETA 4GKJQ 3T1YQ 4YRPA 2IX1A 2CQOA 4BWAA 4POGA 2ZTCA 4K88A 4KR3A 4CH4A 1PH3A 3H0GG 1G5HA 3U4ZA 3HOWG 1HR0Q 3S2DH 4LF7Q 1VQ9A 3KDFB 2CJBA 3AEVA 2UUBQ 3CF5A 4KQEA 3I4NH 2R7ZG 3ZJYC 2ZT6A 2CIMA 4HJAA 2R7DA 3A7RA 1FJGL 1XTDA 5IP9G 2CJ9A 2ID0A 4DV7Q 4BBSH 1G6PA 4DUZQ 1I94Q 4A3JH 1HR0L 4HJ9A 4JI1L 3JAMc 4B3MQ 3FJPA 4JYAQ 1VQ7A 4YCVA 2L15A 3A5UA 4IFDI 1SROA 4GKJL 2V1CC 4DV7L 4HIDA 2OQKA 4IFDJ 1IBMQ 4RMFA 1ADJA 3PF4A 3CCEA 1I6HH 2EQSA 3HXWA 2N8NA 1KAWA 2E41A 2MNAA 1P8LA 4DV6L 3S16H 3A5ZA 4C2MH 1M90C 1HH2P 4OX9L 4A3FH 2DU5A 4DUYQ 3ER0A 3J81c 3K80C 1OXSC 1UWVA 2JA7H 4KHPL 4JI7Q 3LGJA 4DV5Q 2PMZE 3Q8DA 3GDEA 1D7QA 3M3YH 3PO2G 2RCNA 4UP7A 4DR2Q 1GKHA 4DV0L 1ASYA 3STBC 3HXUA 4WJ4A 2JJQA 3KF8B 2F3IA 1PH7A 4A4IA 1JJGA 1L1OA 3A0JA 2K5HA 2OQ0A 4DAMA 1A0IA 3VQVA 2JK8A 1K3RA 3R07A 1JJCB 5FLXc 5JJLA 2ZGWA 2RHSB 4AQYQ 2E8GA 1L2FA 1Y1WH 2N49A 1Z7NA 5JJIA 3HOZH 3HOXH 4GKKQ 5AJ3L 1UE1A 3H15A 4G84A 4BBRH 3HOUG 1Y14B 2DQ0A 3KJOA 2ZT7A 1VQBA 4DV2Q 2ZZFA 2Z6KA 1KMMA 1TXYA 2Q7EA 2RHSA 2XGTA 4HJ7A 1E7ZA 4DR4L 1K83H 2JA9A 2Q2UA 4QJFA 3HXXA 4TVWA 3CCUA 2N3SA 1RIQA 1YFRA 4OWWB 4R1JA 2PQAB 2ES2A 2ASBA 3U4VA 5IP9H 2ZIOA 2KENA 1Q81C 1OXXK 1UE6A 5C0XG 3P8TA 4IFDG 1B70A 4LF8L 4HWRA 4GLAC 2Q7GA 3U50C 2K5VA 4JYAL 3CW2C 4LF4Q 4YREA 1L1OC 1PH1A 2R93H 1OXVA 1YZ6A 1C0AA 4DUZL 1XMQQ 3HOYH 1OTCA 1HTTA 3WQZA 1GM5A 4XTCS 1IZ6A 1WNLA 2ZT8A 2D0OA 1BVSA 2E2HH 3PUVA 1RIPA 4PMWA 4ZTUB 4NXML 5C44H 4Y7NH 4DV3Q 4K0KQ 2JEBI 4JI6L 3F8TA 2DTHA 1YEZA 2ZJQA 2UXBQ 3HFZB 3IALA 3CCSA 4LUVA 1AE2A 4LF7L 1YGBA 4GS3A 3HY1A 4HJ5A 1KOGA 3HOYG 5LMNL 3D31A 2ZM6Q 2E64A 4IPCA 3A32A 2QHTA 4IPGA 3HFZA 4TQUS 3M4OH 4IOAA 3V7SA 4A3CH 1I3QH 4X64L 3QNEA 3BU2A 2VUMG 1PFSA 1NE3A 2I5MX 2UU9Q 1FJGQ 4YRCA 1VQ4A 4JI6Q 4A3GH 1H95A 2IT1A 5IYDH 1VQPA 4L5TA 4XTZA 1Q8KA 4P71A 1EFWA 1PVOA 3TEHA 1CKMA 1TWGH 3NELA 1LUZA 2NZOA 4DR3L 4P71C 4XU2A 4LNSA 3GTQH 4XTUA 4DR4Q 5JJKA 1EVLA 4KR2A 1N36Q 3W1GA 3RLOA 2ODRD 1N32Q 5EAYA 2CGHA 4A3IH 4BY7H 4X66Q 4A3FG 2OWOA 4HWOA 2PI2A 4GKKL 3IG2A 1BBWA 2F52A 1NJ8A 3TS0A 1E3PA 3S15H 2DUDA 4YRJA 1XPOA 4YRKA 4XTYA 3RACA 1VQKA 1EOVA 1SESA 1LTLA 3L7ZC 3RL6A 3RZDH 4OLFA 1SN8A 4TWAA 3T1HL 5E3IA 2EJFA 1KXLA 1CKOA 4X66L 4GOPC 3G4SA 1HC7A 2JA6G 1I5FA 4X65Q 1ASZA 5GAEC 2ZZGA 3RKYA 4BY1H 4GN4B 1I94L 2HHHQ 5KNNA 3L2PA 4LF6L 2AMCA 3HXZA 3HOWH 4P74C 2ZINA 1L1OB 4A3BH 5GQOA 5M3MH 1X3GA 3HOVG 4LFCL 4Y52H 1X3EA 4GOPB 1X65A 3RN2A 1PA6A 4OWTB 3GTKH 3M85A 1K8GA 2G4CA 4R4IA 4JI0Q 4RQEA 4YP0A 3CCRA 3J7ZC 1NYQA 3PF5A 5LMNQ 4A93G 4YWLA 1PH8A 4DR1Q 3KDFA 2JA5G 2FYKA 2ZR3A 2OCEA 1EVKA 4JBMA 3AQQA 2KHIA 3S1RH 2ZJPA 4JBJA 1V43A 3PSIA 3MF1A 5C53B 2VW9A 1SFOH 4YRFA 1Y1VH 1R9TH 4H2TA 3H3VI 3K7AH 2OTLA 1XNQQ 1NJ2A 4LF9L 3BZKA 5H1SE 4DR1L 1KMNA 2I4MA 4AIMA 4JI0L 1IBLQ 3L1AA 2WFWA 4YRNA 2DGYA 3I4OA 3GTMH 2LXKA 2LXJA 2MQHA 4JI8Q 3W3SA 2I4OA 2BA0A 4XU0A 2VS1A 1HNWL 1TWHH 3KF6B 2PI2E 3P8YA 1NTGA 3FHWA 2VUMH 3AYHB 3A7AA 1U0LA 1VQGA 2AWOA 3GTOH 1N33Q 2QHUA 2Q5HA 5BR8Q 1X2GA 5JEAG 4DR7L 4R4OA 4A3EG 4DQ2A 3HOXG 2EIFA 4DV5L 2NN6I 5HY6A 2NVYH 4QIWE 2E1HA 4YROA 3QTCA 3ULJA 4O2DA 3FP9A 3KJPA 3RF1A 5IWAQ 1VQ5A 1NJ5A 1HJPA 3L2ZA 3JC66 4JBWA 3OYYA 3KLWA 2YTYA 1XNRQ 1H4TA 2KCTA 3L0OA 1E22A 3NETA 1H4VB 1VQOA 3MEFA 1EUJA 3E9IA 4P73A 2ZZEA 4A76A 4A3DH 1VQ6A 3GTGH 4BBRG 4TTVA 2ZM6L 4JI2L 4A3JG 2KHJA 4KHPQ 2JA5H 4P75A 4XU1A 4DPGA 1TWAH 1N8RC 4LF5L 2E2IH 1YVCA 1IBKQ 2E10A 3G6EA 2JEAI 2E5AA 4L87A 3M7NA 1HXDA 2RHQB 3ICEA 1UE5A 2F4VL 3AFQA 3JAMi 4AYBG 3UGQA 3HXVA 4YCUA 4PZ8A 2E2JH 4P74A 2WAQG 1EQRA 1NMGA 4JBKA 3M9BA 1IBML 3CP0A 4B3SQ 5E7NA 3EIVA 4DV1Q 1WI5A 2P0LA 3V8LA 2PNHA 1JJCA 4LUZA 1FGUA 1KD1C 3GTLH 1B7YA 4P75C 1Y1WG 1XNQL 5ELOA 4TVYA 1B70B 5C3EH 3UDIA 1EYGA 3UE1A 5FLMH 3CPWA 3J7A5 2A1AA 5FLMG 4NXMQ 2ZXFA 4J15A 4YWMA 3P8VA 2WP8J 2ZTEA 2E5LL 3REUA 4HA8A 4P73C 1EIFA 4YHHQ 2R92G 1FL0A 1JMCA 5IYCG 2K4KA 1DGSA 1A8VA 1VQEA 3VBBA 1J5WA 2HIVA 1W66A 3GTJH 4KHZA 3HOUH 3TREA 1J6QA 1Q12A 4JI5L 3SGIA 3UDXA 3T1HQ 1WJJA 2VZAA 3RR5A 1SE8A 4JCVE 1N34Q 5C0XJ 5K36G 2WAQE 2F4VQ 3IRBA 3A74A 5IYDG 4RQFA 2NVQH 2CWPA 4A3KH 4LWCA 3PO2H 4GN5A 4YDQA 2DXTA 1HNZQ 3VQWA 1OXUA 3F2BA 1KHIA 1O7IA 1Q86C 2NVXH 3I55A 4QGUA 4RG1A 1ATIA 5M5YH 2CJAA 3ERRA 3RZOH 3PGZA 1GVPA 4GN3B 3RNUA 2EJGA 3V8KA 1CSPA 1W2BA 1X01A 1PV4A 3CC7A 4QQBX 4IPHA 3HKZG 4PZ6A 3F1ZA 3PUZA 4NXNL 4YRMA 5IE8A 2HIXA 3OTOL 3REXA 2K52A 12ASA 2VQFL 1YBYA 3L4GA 2VY3A 1K73C 3K7UC 1NJIC 3QO7A 2MO0A 4BW9A 4GNXB 1QVCA 1B8AA 1MJEA 1XPRA 2HQLA 3S1MH 4P3PA 4CS2A 2JA6H 1N32L 4H2UA 4BA2I 5AJ3Q 5LMUQ 4E51A 3F2CA 1P16A 3LSSA 4CH5A 4KI0A 3H0GH 3NEMA 2EL9A 1FYFA 1NBWA 5ELNA 3PIPA 1VQFA 3HXYA 3HRKA 5C51B 4IOCA 4X62Q 4ZIBA 4DR2L 5IYCH 1YNXA 5HGQA 4DV4L 2I5LX 1Z9FA 4XEMA 4B3ML 1S3OA 1YHAA 1KC8C 3UGTA 1NJ6A 3CPFA 2DJZA 5C52B 1QE0A 1JB7A 2E65A 3TUPA 2IY5B 5C4JH 1VS0A 1EIYA 3OW2A 1C9OA 3QO5A 4DAYB 4KLKA 2UUBL 1PH9A 2ARTA 3I4MG 4LFBL 2VL6A 1PH4A 2VQEQ 2UUAQ 3V7RA 4DK3C 3K0XA 4LNQA 2VQEL 2UUAL 3T1YL 1X6OA 4Q15A 1QVGA 4DV4Q 2ATWA 5IT9c 4X62L 4YYEA 1G291 2K14A 3BJUA 1J5EQ 4EX5A 1H4QA 1VQCA 1JJ2A 2ZJRA 4A93H 3HKSA 1X3FA 11ASA 4C3HH 4B3RQ 4OO1I 1E24A 1WCMH 1MJCA 2OTJA 4GLXA 1PH5A 2ALYA 1UEBA 2HHHL 3PCOA 3FKIH 1QUQB 2NN6G 2NZHA 1BIBA 1B76A 5K1PA 3I2ZA 2DDZA 4BA1I 3HOZG 4DR5Q 3A7UA 3EFRA 3AFPA 4DKAC 5IYBG 4AQYL 4IJHA 2WB1E 3D0FA 2ALYB 3MXNB 4MNOA 1D8LA 4H2VA 1VQJA 3RN5A 5C4XG 4JI3L 2DZCA 1TWFH 3M4PA 1VQAA 1CKNA 3CXCA 2BA1A 1X2HA 3A5YA 3CMQA 3G1ZA 3CCLA 4HVCA 4LFAQ 1QZGA 1MIUA 3J80c 2QHVA 4YRSA 4LFAL 1GGMA 1Z7MA 3BZCA 1YFTA 4R4CA 5M3FG 3TS2A 4JI1Q 5BR8L 5IP7H 5K1XA 3OTOQ 3W1BA 3S17H 2BH2A 4JI3Q 2EAYA 1USYA 1X9NA 2JA7G 2AHOB 1JT8A 1WPYA 2FXQA 5C3EG 3UDFA 1SERA 1VQMA 3G48A 4NB3A 5C0XI 3I4MH 5M5XH 3V7CA 4JOIC 1HNXL 4OP0A 2DTOA 2B63G 1EQQA 4A3CG 2UU9L 4HIOA 5M5WH 1CSQA 4DR5L 2Q2IA 3GTPH 4YWKA 5GROA 1SR3A 3CC2A 3UDGA 4IPDA 3H3VH 2VNUD 3NBHB 4ME3A 2ODRC 4HWSA 2R7ZH 5GAGC 2Z6KC 1YI2A 4B3SL 4R4TA 1K9MC 3PUYA 4A3MH 1VQDA 3PO3G 5LMNW 2Q2TA 4BBSG 2DEQA 4WI1A 3PO3H 4AYBE 1NNHA 2JA8G 3S2HH 1J5EL 4QY7A 3WWVA 4A3LG 1NYRA 1YJNA 3KFUA 3CCJA 2I4NA 1LYLA 2PMEA 3I56A 2IHFA 2B29A 3MEYA 1IBKL 2ARUA 4PZ7A 4TVAA 2J3MA 1X55A 5LMUL 4O0AA 4LF4L 2HT1A 3PIOA 1CKNB 3S24A 4TQDA 3A31A 1HZAA 3E0EA 4AH6A 4L5SA 1K8AC 4LFBQ 4PG3A 1XMOL 2Q2HA 1EWIA 2ARSA 1GD7A 1HZBA 1BKBA 1B7YB 1PH6A 4HJ8A 4P3NA 4APVA 3OD1A 3CD6A 4XU3A 2ZT5A 4LF6Q 2Z0SA 1QF6A 1QUQA 2K5NA 2N78A 3IKMB 3LC0A 4JI7L 4TQFA 3HY0A 5M3MG 5IP7G 1NJ1A 4DK6C 1N36L 4DUYL 4JG2A 1KRSA 3RGLA 1SRYA 4YCWA 1VCIA 1PH2A 4YRGA 2YV5A 1VQLA 4NXNQ 5IYBH 2E3CA 1Q7YC 3KF6A 4P72C 4L5RC 2CCZA 1V1QA 5IWAL 1BIAA 2QEXA 3EN2A 3CCQA 4X64Q 2AKWB 4H2SA 2A19A 3F2DA 3HRIA 3BFMA 5GADC 1KIXA 3HOVH 3CCMA 4DV2L 2DZ9A 1G5IA 2ZR2A 2UXCQ 3RLNA 5F5WA 4WJ3M 1SMXA 2ZNJA 4DR3Q 3HKZE 3W5OA 2E5LQ 1USYC 5DLQE 4PHCA 4BY7G 4B3RL 3M4QA 3K8AA 1WU7A 3A5ZB 1PHJA 1N34L 4X5OA 1L0WA 1MKHA 4JI4L 4HWTA 4IJLA 3S1NH 2GN5A 4XTVA 4A3KG 4JI5Q 5FJ8G 3HTZA 5FJ8H 2EWNA 4C3JH 4XEOA 3I7FA 4MZ9A 4CH3A 3NENA 2K75A 2UXBL 3TEGA 2LSSA 4UY8C 2JQOA 4LFCQ 3CAMA 3CMEA 4DV6Q 4GOPA 1JE5A 1PYBA 3I4NG 2IX0A 2R92H 2ZIMA 4UP8A 4BXXG 4EQ5A 3DLLA 1XMOQ 3CCVA 1OXTA 5IY0A 2J3LA 1IBLL 2GVBA 4LF5Q 2PQAA 1AH9A 2P5IA 3PUWA 4HWPA 2QA4A 4A3LH 1WOCA 4JV5Q 4YRIA 1YFSA 4LF9Q 5JEAJ 2R7FA 2B3GA 3G71A 3RIRA 4A3EH 1C7YA 2VQFQ 2UXDL 2Y0SE 1IYJB 1X56A 4DV3L 2YU9H 4K0KL 2YYZA 1I50H 3KYHC 4K86A 2KBNA 3VDYA 3TRZA 1CUKA 4DR6Q 1S72A 2UUCQ 1K0RA 2JA8H 1HR0W 1G51A 3CC4A 3IKLA 4NPSA 4H2XA 4X6AH 4X65L 4JI2Q 3U58A 1GO3E 1YHQA 4H2WA 2IHEA 1PYSB 4WF2A 1AE3A 1IL2A 4P3OA 4YRTA 4YY3Q 1HZCA 1H4SA 4OWXB 2RHQA 2XTIA 3ERSX 1VQIA 5C44G 1KL9A 3J80i 2JE6I 2DQ3A 2EJ9A 3RKXA 2QHSA 4A3IG 1X54A 3B6YA 3J81i 4TVAB 3TEHB 2ZTGA 4HIKA 4OXPA 1WQWA 1W3SA 1YIJA 1VQ8A 4JI8L 1T9HA 2ZTDA 4LUOA 1Q1EA 3E9HA 2WB1G 4DV0Q 4JC0A 4ZTZB 3KOJA 4JV5L 4MTNA 2Y0SG 1HZ9A 2B63H 1KRTA 3UE0A 1A63A 2I0QA 4B3TL 4DR7Q 2C7IA 2D62A 4A3BG 4XTWA 2BH8A 2NVTH 1WYDA 2CFMA 1Q46A 4DR6L 2CWAA 3ULLA 3QO8A 4GNXC 1WFQA 4A3MG 1FVIA 1XJVA 2PMFA 1N9WA 4C3IH 4A75A 2MFIA 3V8JA 2RF4A 1XPUA 1QVFA 2DU7A 2HNIA 1RL2A 4GLVB 4QL5A 2GVAA 4GNXA 5C4XH 2R93G 4UP9A 4H2YA 1NY4A 4RDXA 3MF2A 4EO4A 4L5QA 4YHHL 3ULPA 1KQSA 4OX9Q 2I4LA 1NMFA 1YJ9A 4Q6GA 4JI4Q 2YTXA 1ADYA 1M1KC 4YPFA 4CS3A 3ICAA 1VQHA 4P72A 1HNWQ 2MO1A 4CH6A 2CKZB 3STBD 4HIMA 1XMQL 2DKGA
chains in the Genus database with same CATH superfamily
1V9PA 3R3OA 1O80A 1WD1A 4RA8A 3VYTA 4IO9A 3H6MA 4B3TQ 3VR6A 2A8VA 2L1BA 1WLEA 1ICFB 4ZLTF 1F9QA 1QOHA 2CHBD 1BBUA 3ND8A 3J7YW 2LKVA 5J3BA 4LF8Q 3MAQA 1Y8PB 3MXPA 2PZUA 1X3PA 3PV0A 5KEEA 5LHY1 4O42A 4FDBA 1ZYRD 5FO9B 1VQZA 1CM9A 1H9MA 5CORA 4LW1A 5LL6S 4OIKA 2AKWA 3GD7A 2ICEC 1A2TA 1PFBA 3K81C 1EY7A 4H02A 4G7ZC 2O2LD 1E1OA 4UPAA 3PZCA 3EBEA 4ZAIA 3C1FA 1A3VA 1ESFA 3CQZH 1VQNA 3ERQA 2YTVA 1EIYB 3MXGA 2C8MA 5D3IB 3S14H 1UE7A 4BXXH 1XNRL 3L4GB 3PCOB 2I5HA 4G85A 3PUXA 1U4MA 1JWMD 1NNXA 2RKSA 3HOZB 1YB3A 1T5XD 2KCMA 1JC7A 3DM3A 1Q1BA 2N55A 2QKIC 1O7ZA 1S40A 4R9WA 2DVEA 2UXCL 4H2XB 3D3RA 3D4RA 3A55A 1DOLA 4KJNA 2K5DA 5KRUA 3J81j 1Y8NB 4TSSA 4K2KA 1MBYA 4CS4A 3TDQA 1WCMG 3VQYA 4DV1L 4OO1G 2ZNIA 2RA4A 3LSQA 2D0PA 3FKIG 5GAHC 2G5DA 3H0GB 3TMEA 4A3GG 1T5EA 1WQ7A 2IY5A 3TQYA 1HNXQ 3J80E 2L9HA 3HFVA 4K87A 3UH0A 1PYWD 1NR2A 4YRRA 1SRUA 1F2ZA 1LACA 1I4HA 1I4GA 3S1QH 2EYLA 3CMAA 2EY6A 1TWCB 1Y1VG 4XTXA 2E2DC 2OT2A 3GO5A 4YRLA 2H5XA 1YITA 1YJWA 3BDOA 2C35B 4A3DG 1IXRA 1STAA 1ESRA 3VQXA 3RLFA 2FJ2A 3OIPA 4RGTA 2ZCEA 1CTMA 2Q5IA 3EFSA 2HCCA 2F3WA 2DXUA 1HUMA 3H3VC 2R61A 3A7AB 4ZYSA 1U4LA 4JOIA 1GUGA 3CQZB 3RUXA 1YHBA 4YRQA 3A8JE 1EQVA 1GUOA 2AMCB 1RTNA 4YY3L 4XIGS 2QGQA 1U5KA 1EQTA 2Q7HA 2AWNA 2SNMA 2NZ1D 3RKWA 1LM0A 2PZTA 4OONA 1Q82C 3BDCA 4OGQC 1SAPA 1KLGD 1BCPD 1H9SA 2R6GA 1SLJA 4CJ0B 4JPBW 1N33L 2EXDA 5FKAC 3TZDA 1QZHA 4ALPA 2ZXPA 2R7ZB 1HNZL 5T1GA 1XXGA 4MIUA 1A62A 2D5DA 1JQYD 2UUCL 1HCZA 3I4NB 3CU7A 3DSQA 1E2WA 1E1TA 1EY4A 3I91A 5IOCA 5IT9L 4NCXA 2MHVA 5M3FH 2KCNA 4QF4A 2F0PA 4R4QA 3TP7A 4DNIA 2CW0D 4A3DB 2SOBA 1C48A 1TWCH 4PV1C 1DCZA 2UXDQ 1PYSA 1B53A 2EVBA 2K50A 4POFA 3UFGA 2DTIA 1Z47A 4X3TA 4BY1G 1KLUD 1SETA 1YNND 4ID6A 4GKJQ 3T1YQ 4YRPA 2IX1A 2CQOA 4BWAA 4XQJA 4POGA 2ZTCA 4K88A 3SDZA 4KR3A 2OEOA 2Z6BA 4CH4A 1PH3A 3GTMB 3H0GG 4A3GB 4IUNA 4IQZA 5FO8B 1G5HA 1QWYA 3KLRA 3U4ZA 2O4XA 5C5LA 3HOWG 1HR0Q 3S2DH 4LF7Q 4F87A 2B2YA 3EJIA 1VQ9A 3V2TA 3KDFB 3L9AX 1HHVA 3PO3B 2CJBA 3AEVA 3S1RB 2UUBQ 3CF5A 4KQEA 1BQQT 1WVLA 3I4NH 3NSWA 3ZJYC 2R7ZG 3NQTA 3U9OA 1I4RA 2ZT6A 3EVQA 2CIMA 2L55A 3Q24A 4HJAA 4LVKA 2R7DA 3A7RA 1FJGL 1SYBA 1XTDA 2WIIB 5IP9G 2CJ9A 3QIAA 2ID0A 4DV7Q 5IT9E 4BBSH 1G6PA 4DUZQ 1SNPA 1I94Q 1FYCA 3GTKB 4A3JH 1HR0L 4HJ9A 4JI1L 1BCPC 2X6GA 4ZCKA 2EY1A 3JAMc 4B3MQ 3FJPA 4JYAQ 5E4XA 1VQ7A 4YCVA 2L15A 1F2LA 3A5UA 4IFDI 1SROA 4AYBB 1B3AA 3DMUA 4GKJL 2V1CC 3RD4A 4DV7L 3MFYA 2HDLA 4HIDA 2OQKA 4IFDJ 1IBMQ 1B3QA 3C1EA 4RMFA 1J8IA 1ADJA 4N8FA 5K5PA 3PF4A 1UAPA 3CCEA 1I6HH 5DNFA 2EQSA 3HXWA 1AW7A 4MTKA 5M3FB 4LVMA 2N8NA 1KAWA 2E41A 4FXGC 2MNAA 1P8LA 4DV6L 3S16H 4B9XA 2DKGA 5C6AA 4C2MH 3A5ZA 4A3FB 1M90C 4X3UA 1HH2P 3ZYYX 4QUFA 4MHEA 4A3FH 4OX9L 4DA2A 2DU5A 5EBDA 4DUYQ 3ER0A 1B9MA 1B1ZA 3J81c 4KD3A 3K80C 1OXSC 1UWVA 2JA7H 1WTOA 3QR8A 4JI7Q 4KHPL 2TMPA 3LGJA 4DV5Q 2PMZE 3Q8DA 3GDEA 5C4HA 1D7QA 3M3YH 3PO2G 2RCNA 4UP7A 3U9SA 3MTSA 3S1QB 4DR2Q 1GKHA 4DV0L 1TVXA 1ENCA 1ASYA 4HCSA 1DZ1A 1SMYC 3STBC 3HXUA 4WJ4A 1Z7TA 2JJQA 5KNBA 3KF8B 2F3IA 1TQOA 1PH7A 4XXEA 4A4IA 1JJGA 1L1OA 2B2TA 3A0JA 3SK4A 3URYA 2K5HA 2OQ0A 4DAMA 1A0IA 3FRPB 3GTOB 1BCPF 3VQVA 2JK8A 3OWEB 1K3RA 4IZ8A 3R07A 1JJCB 2NB0A 4I65A 5FLXc 5JJLA 2ZGWA 1TKWB 2RHSB 3JAML 3MQZA 4AQYQ 2E8GA 1L2FA 1Y1WH 4V190 2N49A 1Z7NA 4RCOA 5JJIA 3HOZH 3HOXH 1TS2A 4GKKQ 3AB9A 1MD2D 3MXUA 5AJ3L 1UE1A 3H15A 4G84A 4BBRH 3HOUG 1Y14B 2DQ0A 3VYRA 3KJOA 2ZT7A 1SSOA 1VQBA 3D4WA 2IPKD 4DV2Q 2ZZFA 5KNDA 2Z6KA 1KMMA 1TXYA 1LABA 3BDLA 2RHSA 2Q7EA 2XGTA 4HJ7A 1E7ZA 1GXDC 4O1NA 4DNTB 1KDCA 4DR4L 2F1MA 3I72A 1K83H 2CH4A 2JA9A 4OO1H 4HCEA 2Q2UA 1TS4A 1STNA 1XX8A 3E3XA 4QJFA 1S5DD 1K8MA 2J4XA 5I6WA 3HXXA 4TVWA 2LMCB 3CCUA 2N3SA 5M9OA 1HQRD 1RIQA 4LJZC 1CQFA 1HTLD 1YFRA 4OWWB 4R1JA 5E1FA 2PQAB 2ZXRA 3I3CA 1UEAB 4LK1C 2ES2A 3S14B 1H9KA 1LT4D 2F0NA 2FMCA 3U4VA 5IP9H 4F7XA 2ASBA 1KABA 5IGBA 2ZIOA 2DNEA 2KENA 5CGKA 1OXXK 1Q81C 5DAUA 1UE6A 5C0XG 4KN4C 3P8TA 4C1NK 1SNQA 3R8BA 1JOOA 4IFDG 2K5QA 4MN3A 2A6HC 1B70A 4HN7A 3VR4A 1RJTA 4C2MB 4LF8L 3T51B 2XRSD 2L11A 1CA6A 4HWRA 3QO2A 4FVMA 4ULLA 4GLAC 2Q7GA 3U50C 2K5VA 4JYAL 3CW2C 4C3HB 4LF4Q 4YREA 1TWHB 1L1OC 2B2TC 1PH1A 2R93H 1OXVA 1YZ6A 3GQBA 5CV7A 5FO7B 3S15B 1C0AA 3DEPA 4KY5A 4X3SA 4DUZL 1XMQQ 5E3FA 3HOYH 1ILPA 3P75A 1OTCA 2EYFA 1HTTA 1PFMA 4A3EB 1CA5A 3WQZA 1GHJA 1GM5A 4XTCS 1IZ6A 2EY5A 3FPUB 1WNLA 2ZT8A 1SXTA 2D0OA 1BF4A 4DXGA 2XRQD 2WKCA 1BVSA 4FF3A 2HUGA 4RKLA 5IGDA 2E2HH 2J0TD 3PUVA 1RIPA 2L4NA 4JW0A 4PMWA 4NXML 4ZTUB 5C44H 4Y7NH 1S4ZA 3C46A 4DV3Q 4K0KQ 2JEBI 4JI6L 2EYMA 2O5IC 4G7OC 3F8TA 2DTHA 1YEZA 2EYJA 2SEBD 4ODGA 3T56B 2JSOA 2ZJQA 2UXBQ 3HFZB 5JVH3 3CCSA 3IALA 4LUVA 4FO2A 1AE2A 3IAYA 4LF7L 1YGBA 4GS3A 4K6DA 3ITPA 4IUTA 3HY1A 5M5XB 4HJ5A 2EE1A 1KOGA 1PZID 4X3KA 3HOYG 5IIFA 5LMNL 3D31A 3NBIA 2ZM6Q 2E64A 4IPCA 3GTLB 3A32A 2QHTA 4IPGA 3HFZA 4TQUS 3M4OH 4IOAA 3BS1A 3V7SA 4A3CH 1H9JA 1I3QH 4X64L 3QNEA 3BU2A 2VUMG 1L0XB 1PFSA 1STGA 1NE3A 2I5MX 2UU9Q 4QUCA 3OIQA 1FJGQ 4YRCA 1VQ4A 4JI6Q 4A3GH 1EY0A 4HMIA 1H95A 2IT1A 5IYDH 1VQPA 4L5TA 4XTZA 1Q8KA 4P71A 1EFWA 1PVOA 3TEHA 1CKMA 1TWGH 3NELA 4C1NI 3OSOA 1XYIA 1VMPA 1PMRA 2RBMA 2NVXB 1LUZA 2NZOA 4DR3L 1MHWC 3FVQA 4P71C 4I7ZC 3VYUA 2JA6B 4XU2A 1IW7C 4LNSA 3GTQH 1RKNA 4XTUA 4DR4Q 1SYGA 5JJKA 1EVLA 1CQVA 4KR2A 1EEID 2BDNA 1EY8A 1N36Q 2A8EA 3W1GA 3I90A 3J7AV 3RLOA 2ODRD 1N32Q 4NDXA 5EAYA 1E2VA 1S5BD 5E4WC 3K59A 2CGHA 4A3IH 1LTBD 1NSNS 4BY7H 4X66Q 4A3FG 1EU4A 2OWOA 4HWOA 2K32A 2PI2A 4GKKL 3IG2A 4CDEC 1BBWA 1FD7D 2F52A 1NJ8A 4PMCA 5KGUA 1LO5D 1EY6A 3TS0A 1E3PA 2B2WA 5IGGA 1SE3A 3R2TA 3S15H 2DUDA 4YRJA 1XPOA 1OO9B 4YRKA 4XTYA 3MWYW 3BYTB 3RACA 4ME5A 2Q8IB 1SNDA 4RGMA 1VQKA 1EOVA 5M3MB 4C56C 1SESA 1LTLA 3L7ZC 3J81E 3RL6A 2B2YC 2EYPA 3RZDH 4EQOA 4OLFA 1A6XA 4NW2A 4KMUC 5DM73 1SN8A 3SK8A 4TWAA 2RCFA 3T1HL 1QG7A 3HEJA 1R4QB 5E3IA 2EJFA 4FF4A 2ENBA 1KXLA 4LVJA 1CKOA 2NBFA 5CR3A 4X66L 3H94A 4GOPC 1K0SA 3G4SA 2K1BA 1HC7A 4F8MA 3PIO3 2JA6G 1I5FA 5EGTA 1D6EC 2HD3A 4X65Q 1ASZA 5GAEC 4IUQA 4ZKBB 2ZZGA 3RKYA 1HFGA 3PIP3 1WD0A 4BY1H 1AZQA 4J8QA 4GN4B 3X3MA 1I94L 3P1HA 2HHHQ 2AQ2B 5DEHA 3DM1A 5KNNA 4XT1B 1IKLA 3L2PA 4LF6L 3RZOB 2L12A 2AMCA 3HXZA 3HOWH 4CHTB 4P74C 2PPBC 2ZINA 1L1OB 3C2PA 4A3BH 5GQOA 5M3MH 2IWHA 1SYDA 1X3GA 4KJOA 3S2HB 5EPJA 3HOVG 4N9TA 3CKIB 3I73A 2FMMA 5EPKA 5CV9A 3AMUA 4Y52H 1X3EA 4GOPB 1EL0A 1HA6A 1X65A 3RN2A 1PA6A 4OWTB 3GTKH 3NTKA 3M85A 1K8GA 1IKMA 4S3SA 2A6EC 5I4DA 4R4IA 3K58A 4JI0Q 2G4CA 4RQEA 4YP0A 3CCRA 1F9RA 3J7ZC 1NYQA 3KLSA 1O78A 4KKUA 2FFKB 3PF5A 4BS9A 5LMNQ 1GHKA 4A93G 4FXKC 4YWLA 1GOZA 1PH8A 4DR1Q 3KDFA 2JA5G 2FYKA 2ZR3A 2OCEA 1EVKA 4JBMA 3AQQA 4OHJA 2KHIA 3S1RH 2XIWA 3SE0A 3GTQB 4JK1C 2ZJPA 1TS5A 2NN6H 2K7VA 4JBJA 4ZRZA 1V43A 3PSIA 3MF1A 5C53B 2VW9A 4LMQD 2K5WA 1SFOH 4L8JA 4YRFA 1Y1VH 1R9TH 2PMZB 4H2TA 1KNEA 5CV8A 3H3VI 1BR9A 1CFMA 4KY6A 3K7AH 4M8AA 1ZEQX 1A3UA 3A7LA 2OTLA 1XNQQ 1NJ2A 4LF9L 1SBBB 3BZKA 2RDGA 2H4OA 3R2IA 4P2CB 5H1SE 3DHQA 4DR1L 1KAAA 3Q0AA 2LS01 2HQEA 1KMNA 1HQMC 2I4MA 3T4AC 1S5FD 4AIMA 3WOEA 4JI0L 2Q8RE 1IBLQ 3L1AA 2WFWA 4YRNA 2DGYA 2B8GA 5AFWA 1Y8OB 3I4OA 1BBXC 3GTMH 2LXKA 3T16A 1DJRD 2LXJA 2MQHA 4JI8Q 3W3SA 2I4OA 2BA0A 3MA2B 4XU0A 2VS1A 1SEBD 4GZYC 2KUMA 1HNWL 1TWHH 3KF6B 1LTRD 1HFNA 2PI2E 3P8YA 1BCPB 1NTGA 3FHWA 2VUMH 1SE2A 3AYHB 2BDOA 3NTIA 3A7AA 3HG9A 2A6ED 1U0LA 5FLXL 3LX0A 1VQGA 2AWOA 2MP1A 3GTOH 2KCCA 1V1PB 4C3JB 1N33Q 2QHUA 2WACA 2Q5HA 5BR8Q 5IGEA 2F0TA 1X2GA 1QNUA 5JEAG 4DR7L 2ICIA 4R4OA 4A3EG 4DQ2A 3HOXG 2F0FA 2EIFA 4DV5L 2NN6I 1EIHA 5HY6A 1ICWA 1LV9A 1LT3D 3E0JA 2NVYH 3K5LA 2YU9B 1KNAA 1ZKOA 5EKLA 5EKKA 4QIWE 1FNWA 2E1HA 4YROA 2BE5D 3GTPB 3ULJA 3QTCA 4O2DA 1IL8A 4L6TB 4ILWA 1LTSD 3FP9A 3KJPA 1TY0A 5IWAQ 1VQ5A 1NJ5A 2RSNA 2QDBA 3RF1A 1HJPA 1D5MC 3L2ZA 4N9PA 3JC66 1SYEA 2VXWA 3SXHA 5I2XA 4JBWA 3D6CA 4R8IA 3OYYA 3KLWA 2YTYA 5KNCA 3NBHA 1XNRQ 1H4TA 5ELFA 2KECA 4XYOA 2KCTA 4EGVA 4DAPA 3L0OA 1DM0B 2A5HA 5D3DA 1E22A 1JWUD 3NETA 1DD2A 1H4VB 1I3QB 2F0MA 1L0YB 2JN4A 4HMJA 1VQOA 3MEFA 1EUJA 3HOXB 3M4YA 3E9IA 3TP8A 4P73A 3K5MA 2ZZEA 4A76A 1IHZA 4A3DH 1Y1VB 1R9TB 1VQ6A 1FNUA 1FNVA 3GTGH 2M9VA 2F0SA 4M1UB 4BBRG 3PMFA 4TTVA 2ZM6L 4JI2L 4K5XA 4A3JG 1DXMA 2KHJA 4KHPQ 2JA5H 4P75A 4XU1A 3JAME 4DPGA 1TWAH 3NXWA 4CJ1B 1N8RC 3KK7A 4LF5L 2Z4IA 3Q22A 2E2IH 5DM63 1YVCA 1IBKQ 2E10A 3AU7A 3FEWX 2L5TA 3G6EA 2JXMB 5M5YB 5JVG3 5CBAE 4HR7B 4H44C 2EOTA 1I6VC 2F0QA 2JEAI 2E5AA 4L87A 3VA5A 3M7NA 1HXDA 1K8OA 4KTAA 2QW7A 4R8NA 1DOMA 1I4XA 2RHQB 5EBCA 3RMHA 3ICEA 1UE5A 2F4VL 1RDPD 3AFQA 1D2BA 1ET6A 2F0KA 3JAMi 4AYBG 1W6KA 3UGQA 5C5MA 3HXVA 5IGCA 1EU3A 4YCUA 1HA5A 2F0WA 4PZ8A 5JJZA 2E2JH 3Q23A 3S1NB 4P74A 1HTPA 2SDFA 2WAQG 3DWAA 1EQRA 5EJWA 1NMGA 4JBKA 5J39A 3M9BA 1IBML 3CP0A 4B3SQ 5E7NA 3EIVA 1EYAA 5CMDA 4DV1Q 1M8AA 1BO0A 1RTOA 1WI5A 1J9OA 5EPLA 2P0LA 1AEXA 3GP7A 4RHSA 3V8LA 3DUZA 2KVMA 2PNHA 1JJCA 2EJFC 2KEEA 4LUZA 2PZWA 1FGUA 4Q5VA 2B2UC 1KD1C 3V96A 3GTLH 1B7YA 2Z9HA 1F2YA 4P75C 1Y1WG 5TSSA 1XNQL 5ELOA 5HURA 4OIJA 4TVYA 1B70B 3SHLA 5C3EH 3UDIA 3BVZA 1EYGA 5G3LF 1Q8IA 2K28A 2EJGC 5JPNC 4RFBA 3UE1A 2EZVA 5FLMH 2G9DA 3CPWA 3J7A5 3A8IE 2A1AA 5FLMG 4NXMQ 2ZXFA 2A74C 3TP6A 4WFN3 4CGYB 5HGTA 4KK7A 4J15A 4YWMA 1PRTC 5JOBA 3P8VA 3IFTA 1PTOH 2RDFA 2WP8J 2ZTEA 4QMGA 3R93A 2E5LL 3REUA 1O7LA 4OELB 4HA8A 4P73C 1EIFA 2AUJD 4YHHQ 1FL0A 2R92G 1JB3A 1SNOA 1JMCA 3K6OA 3K5NA 5IYCG 2EYOA 2K4KA 4A3KB 1B4OA 1DGSA 4PNYA 1A8VA 1VQEA 2KJXA 3VBBA 1J5WA 5CV5A 2K6AA 2HIVA 1W66A 3GTJH 3A8KE 4KHZA 3HOUH 2O5JC 3TREA 1J6QA 3NP8A 2X6LA 1LTID 2FHTA 1Q12A 3O13A 4JI5L 2F3VA 1Y1WB 5C4XB 2E75C 3SGIA 3UDXA 4C3HG 5FLXE 2E74C 3T1HQ 5ELCA 1QJOA 1WJJA 2EPBA 1LT6D 2VZAA 1K3BC 2MUYA 3RR5A 1SE8A 4JCVE 1QE6A 1EIGA 1QNKA 1N34Q 1GUTA 5C0XJ 1Q3LA 5K36G 2WAQE 4NMZA 2F4VQ 3IRBA 3A74A 5IYDG 1KTKA 2J7ZA 2B63B 4RQFA 2NVQH 2CWPA 4A3KH 1LLRD 4LWCA 3PO2H 2F0EA 2NS6A 4GN5A 1M4VA 4YDQA 2DXTA 1HNZQ 3V05A 4YIJA 4IUPA 4J1MA 3VQWA 4WJWA 1OXUA 1EYCA 3F2BA 5C4JB 1KHIA 1O7IA 1Q86C 2AUKA 2NVXH 2MPMA 3I55A 2EXZA 4QGUA 3S1MB 3BG3A 4RG1A 1ATIA 5M5YH 1WTVA 2CJAA 2F03A 3ERRA 3RZOH 3PGZA 1GVPA 4GN3B 1BXTA 3RNUA 2NWGA 2EJGA 3V8KA 1CSPA 1W2BA 1K28A 4HSPA 1X01A 1PV4A 3CC7A 2WINB 2Y0SB 4EVOA 4QQBX 4ZUJA 3ONAB 4IPHA 3HKZG 2A6HD 4PZ6A 2A68C 5LL6X 1JICA 3F1ZA 3PUZA 4LVIA 4NXNL 1WTRA 4YRMA 2F0IA 3X3NA 3P7JA 5IE8A 1U9RA 2HIXA 3OTOL 3REXA 4IUUA 2K52A 1KDAA 4RGOS 2F0UA 4BY7B 12ASA 2VQFL 3KUPA 1YBYA 3TP5A 3L4GA 3N52A 2VY3A 1K73C 3K7UC 1NJIC 3QO7A 2MO0A 3WOFA 2I07B 4CKBA 4QB4A 4BW9A 4GNXB 1QVCA 1B8AA 1MJEA 1XPRA 2HQLA 3S1MH 4P3PA 1HXYD 1AN8A 4CS2A 3KBXA 3QJYA 4IN3A 5C44B 4HT4A 2JA6H 1N32L 4H2UA 2K03A 2DN8A 3M3YB 4BA2I 5AJ3Q 5LMUQ 3GV6A 4N8X1 2RSOA 4E51A 3F2CA 5CV6A 4IURA 1P16A 3IFDA 1QCBD 1A2UA 3LSSA 4CH5A 4KI0A 3N6RA 3KF8A 3H0GH 3I8ZA 1JOKA 3NEMA 3LNNA 3MFGA 2DY8A 2EL9A 1FYFA 1PZJD 2EDGA 4RKBA 3UI2A 1NBWA 3G6JB 5ELNA 3PIPA 1VQFA 4XQNA 3OPOA 3HXYA 3HRKA 5T1IA 5C51B 4PQXA 3QOLA 1JWSD 4IOCA 4X62Q 1A15A 3WDNA 4ZIBA 2E76C 4DR2L 3FPPA 1JR0D 3HZXA 5JPMC 1YNXA 5IYCH 1ET9A 1V1OA 5HGQA 1H9RA 1PLFA 2I5LX 1Z9FA 4DV4L 4XEMA 3NPPA 4B3ML 1S3OA 1YHAA 2F0LA 1KC8C 1PTOF 1WCMB 2BCOA 3UGTA 2F0HA 1AFPA 1DONA 3CRKC 1NJ6A 1S5CD 3CPFA 2DJGC 2KA7A 5EKIA 2A68D 2DJZA 5C52B 1QE0A 1JB7A 1E2ZA 2E65A 3TUPA 3J81L 2IY5B 1IW7D 4DGZA 2XWBB 1GUWA 5C4JH 1VS0A 2E2HB 4UAIA 1R4PB 4LAAA 1WTQA 5K36H 2CQAA 1EZ6A 3BVGA 1EIYA 5A35A 1U4PA 4ZKCB 2Z8LA 1PXUA 3OWFA 1WTXA 3OW2A 2DNCA 1C9OA 3QO5A 3T13A 4DAYB 2CVRA 1SJHD 1WTWA 4KLKA 2UUBL 1HRJA 1PH9A 2ARTA 2R93B 3I4MG 5FK9C 4LFBL 2VL6A 1PH4A 2OXPA 2R3ZA 2VQEQ 2UUAQ 1II3A 5D65A 2I46A 3V7RA 4DK3C 3K0XA 4FF1A 4DFAA 4LNQA 2VQEL 2UUAL 3T1YL 1X6OA 4B9WA 4Q15A 1QVGA 4DV4Q 2ATWA 2E2JB 2AQ1B 5IT9c 4X62L 3G7LA 3HOYB 4YYEA 1D5ZC 1G291 2K14A 3BJUA 4WRDA 2ZT9C 1J5EQ 3EQLC 4DNRB 4EX5A 2C9OA 3GTGB 1H4QA 1VQCA 1JJ2A 4QCLA 2ZJRA 1DYQA 2CW0C 4A93H 3HKSA 1X3FA 11ASA 4C3HH 1FR3A 4B3RQ 4OO1I 3J7AF 2A69C 1E24A 1WCMH 3HOVB 1B44D 1MJCA 3M7GA 2OTJA 5KYIA 4GLXA 1PH5A 4CDDC 1RCVD 3MXNA 1UEBA 3QG1A 1LTTD 3VR5A 2ALYA 1TWAB 4KD4A 2HHHL 1LTGD 3PCOA 3FKIH 1QUQB 2NN6G 4KKSA 2NZHA 2RDHA 1BIBA 1B76A 2DY7A 5K1PA 3C3LA 3I2ZA 4H0LC 2DDZA 2DJFC 5CYUA 4BA1I 4DR5Q 3HOZG 3A7UA 1B9NA 4K5VA 1EZ8A 3EFRA 1ENFA 3AFPA 4DKAC 2FINB 5IYBG 4AQYL 2LFNA 3A54A 4IJHA 2D2CC 4Z9CB 5ELDA 2XVSA 2WB1E 2EYHA 5L37A 3D0FA 2ALYB 3MXNB 4MNOA 2RVLA 2KQ3A 1D8LA 1PZKD 1BNZA 4H2VA 1VQJA 1C8CA 1FGBD 1Z6HA 3RN5A 5C4XG 4JI3L 2DZCA 1TWFH 3M4PA 1VQAA 1EWHA 4CDFC 5KIXA 1CKNA 1PTOD 3CXCA 3NQIA 1D5XC 2B2UA 2B8FA 2XNAC 2JA7B 2BA1A 1X2HA 4IUVA 3BZDB 3A5YA 3CMQA 3G1ZA 3CCLA 4HVCA 4DF7A 4LFAQ 4H7BA 1QZGA 1MIUA 1O7YA 3J80c 3EROA 2QHVA 4YRSA 1G6ZA 4K8JA 4A3BB 3LWUA 4ZUIA 2IJ0A 4DK0A 1JORA 5NUCA 4LFAL 1GGMA 1Z7MA 3BZCA 1YFTA 3EA6A 4R4CA 5M3FG 3TS2A 4JI1Q 2JA8B 5BR8L 2MJ8A 5IP7H 2P5ZX 5K1XA 2WB1B 3OTOQ 3W1BA 3S17H 2BH2A 4JI3Q 5JEAH 1SNMA 2EAYA 1USYA 1X9NA 1V8QA 1RODA 1G8ZD 1PRTB 3OMCA 2JA7G 2AHOB 2A69D 2G9HD 4K6LA 1JT8A 4CKCA 1WPYA 3K7AB 3P20A 2FXQA 5C3EG 3UDFA 1SERA 1VQMA 3G48A 4NB3A 5C0XI 4QIWB 3OOCA 3I4MH 1XTCD 4CDCC 5M5XH 4C3IG 3V7CA 4JOIC 1HNXL 1D1KA 2LY7A 2DTOA 1STBA 4OP0A 3MZ5A 4L63B 1EQQA 2B63G 4A3CG 2UU9L 1EY5A 3H91A 4HIOA 4B08A 5M5WH 1CSQA 3VR2A 1A3TA 3TSSA 4DR5L 3H09A 2Q2IA 1H9SB 3GTPH 4YWKA 5GROA 1SR3A 2PW5A 3CC2A 3UDGA 1UUPA 2WAQB 3GTJB 3D4DA 4IPDA 3H3VH 2VNUD 3NBHB 1I50B 4ME3A 2ODRC 3VR3A 4HAEA 3PO2B 1TU2B 4U673 4WORA 2R7ZH 4HWSA 2QILA 5GAGC 4DN4M 4RH6A 2Z6KC 1CZWA 2SNSA 1YI2A 4B3SL 1SYFA 4R4TA 4HSVA 4I7AA 1HPCA 1ZXTA 2B39A 1K9MC 3PUYA 5A2QE 1IYUA 1VF7A 4G4KA 4A3MH 1VQDA 2NUCA 1SNCA 1SYCA 5LMNW 2Q2TA 3PO3G 4BBSG 2DEQA 5F2DA 4WI1A 3PO3H 1PTOC 4AYBE 1NNHA 4LVLA 1AP0A 2JA8G 3S2HH 1J5EL 4QY7A 3WWVA 4A3LG 1NYRA 1SJED 1TS3A 4Y7NB 1YJNA 3KFUA 1VDZA 2N88A 3CCJA 2I4NA 1LYLA 2D9UA 5A2QL 4A3JB 3L3OC 3K57A 2PMEA 3I56A 2IHFA 2B29A 3MEYA 1IBKL 4RCNA 2QCPX 2ARUA 4PZ7A 4TVAA 2J3MA 1X55A 2V4DA 5C3WA 5LMUL 4FXDA 1VF5C 4O0AA 2F0VA 4LF4L 2RQXA 1EWCA 1AZPA 1ILQA 2HT1A 3PIOA 1CKNB 3PQIA 3S24A 3A31A 4TQDA 3RUZA 1HZAA 3E0EA 5C0XH 4AH6A 2L0CA 4L5SA 1K8AC 4LFBQ 3HP3A 3S17B 4PG3A 4UHVA 1CHQD 1XMOL 4KV6A 4DK1A 5JAVA 3E5SA 1G2TA 2Q2HA 1EWIA 3Q6SA 5IODA 2ARSA 1GD7A 1HZBA 5BN5A 1BKBA 1B7YB 2F0JA 1PH6A 4HJ8A 2Q8TA 1U4RA 4P3NA 4FYDA 4APVA 1Q90A 3OD1A 1MSGA 3CD6A 4XU3A 2ZT5A 4FNFA 4LF6Q 1TY2A 2Z4HA 4XT3B 3F2UA 2Z0SA 2Z1CA 3MEHA 1QF6A 1QUQA 2BOSA 4NKLA 2K5NA 5I2YA 1BOSA 2E2IB 2N78A 2WV6D 3D6WA 3IKMB 1ONLA 3CHBD 4XQQA 3LC0A 4JI7L 1D1IA 1S5ED 2JA5B 4TQFA 1NAPA 3NUCA 3HOWB 2NTSA 3HY0A 5M3MG 4E6IA 5IP7G 3NHHA 4DK6C 1NJ1A 2HCIA 1N36L 4DUYL 1G2SA 4JG2A 4KKTA 4EQPA 1KRSA 3RGLA 4BBRB 3HKZB 1SRYA 4BY1B 4YCWA 2KEDA 1VCIA 2QDLA 2C5CA 4RAUC 1PH2A 1HUNA 1STYA 4YRGA 2X69A 2YV5A 3NE5B 1VQLA 4NXNQ 5IYBH 3FKIB 2E3CA 2IX3A 1Q7YC 1E0BA 3KF6A 4P72C 2MGSA 5I9OA 4L5RC 2CCZA 3KLSX 3SK6A 4KHVA 4CBVA 1V1QA 5IWAL 1BIAA 2QEXA 2M2LA 3EN2A 3CCQA 4A3IB 4X64Q 2AKWB 4H2SA 2A19A 3F2DA 4G7HC 3HRIA 3BFMA 5GADC 1KIXA 3MC0B 4HTHA 3HOVH 3IKJA 2A73B 1X3QA 3CCMA 4DV2L 2DZ9A 1G5IA 2ZR2A 1NR4A 3MVVA 2UXCQ 5IGFA 3QB3A 1PRTD 3RLNA 5F5WA 4DAYA 4WJ3M 1SMXA 2ZNJA 1SFOB 2H1EA 3VYSA 4DR3Q 4KN7C 3HKZE 4CJ2C 3HGBA 3W5OA 2E5LQ 1QILA 1BDOA 1C4QA 1K83B 2PCFB 1USYC 3NK9A 5DLQE 4PHCA 3FMCA 3RZDB 4BY7G 4B3RL 3M4QA 1JCKB 3K8AA 1JE4A 4CKEA 1WU7A 3A5ZB 1PHJA 2PO4A 1STEA 3TZUA 1MSHA 1N34L 3BVMA 4X5OA 1L0WA 4J6HA 1VMCA 1MKHA 4JI4L 4HWTA 4IJLA 3S1NH 1ENAA 1ZYRC 2GN5A 4A3KG 4JI5Q 4XTVA 4K2LA 2NVQB 5CBEE 5FJ8G 3HTZA 4XYQA 1SDFA 3DWQA 5FJ8H 3T53B 2EWNA 3QWNA 4C3JH 1BUVT 4XEOA 3I7FA 4PMBA 4MZ9A 4CH3A 3DXJC 3NENA 2AQ3B 2K75A 4UDUC 2PW7A 2UXBL 2LSSA 3TEGA 4UY8C 1CT1D 2JQOA 4LFCQ 3CAMA 3GV3A 3CMEA 4JVZA 4DV6Q 4GOPA 2M00A 1JE5A 2PYKA 1PYBA 2XN9C 2BE5C 3I4NG 2IX0A 2R92H 3QOJA 2ZIMA 2GA4B 4UP8A 4BXXG 4NP5A 4EQ5A 1PFNA 3DLLA 4RHRA 3I4MB 1XMOQ 3CCVA 4ABNA 5J1ZA 2NYZD 3VA7A 1OXTA 5IY0A 4RWSC 3E6ZX 2J3LA 3NWSA 3BYYB 1IBLL 3I4LA 2GVBA 3S16B 2B2WC 1CZGA 5COYA 4LF5Q 2XSCA 2PQAA 1YNJC 1AH9A 2P5IA 3PUWA 4HWPA 5BN3A 2QA4A 4A3LH 1WOCA 4JV5Q 4C3IB 4YRIA 3S2DB 4A3MB 1YFSA 4LF9Q 5JEAJ 2R7FA 2B2VA 2B3GA 4OEMB 5C3EB 3G71A 4K8IA 2B2VC 3RIRA 4A3EH 1C7YA 2F0DA 2VQFQ 2UXDL 2Y0SE 1IYJB 1X56A 2VB3X 5EQ0A 4DV3L 2YU9H 4K0KL 2JP1A 2TSSA 4HEDA 2R92B 2YYZA 2NVTB 3K5OA 1I50H 3KYHC 4TKOB 4K86A 2KBNA 1B2TA 3VDYA 3TRZA 1CUKA 4DR6Q 4FF2A 1S72A 2UUCQ 1SE4A 1TWFB 2WKDA 1K0RA 2K01A 1RD9D 2JA8H 4IALA 1EFID 3I70A 1HR0W 1G51A 3CC4A 4BBSB 3FDTA 3IKLA 3ND9A 1CHPD 1G91A 4NPSA 4H2XA 4X6AH 1QB5D 3CRLC 4TRDA 4X65L 4JI2Q 3U58A 5I9PA 3HRZC 1GO3E 1YHQA 1CI3M 2PQEA 4H2WA 2IHEA 1GUNA 3W2DA 1PYSB 4WF2A 2IL8A 1WTPA 1Y69U 1STHA 1AE3A 1IL2A 4P3OA 2K04A 4YY3Q 1HZCA 5CV4A 5BN4A 4YRTA 1H4SA 4OWXB 3OHXC 1I4QA 2RHQA 2XTIA 2KHSA 3ERSX 4FP5D 1VQIA 2HDMA 5C44G 1KL9A 1TWGB 3J80i 2JE6I 2DQ3A 2EJ9A 3RKXA 1PDQA 1YNNC 2QHSA 3W3AA 1B50A 4A3IG 1X54A 3B6YA 3TBIB 3J81i 4U68A 1PRTF 4TVAB 3OW7A 3TEHB 3SK5A 1UNSA 3DEOA 2F0GA 4G57A 2ZTGA 4HIKA 4OXPA 1WQWA 1DOKA 3SEBA 1W3SA 1WTHA 1IYVA 1YIJA 1VQ8A 1YNJD 2NTTA 4JI8L 2CH4W 1T9HA 4RGNA 2ZTDA 4LUOA 1EYDA 4DXFA 1Q1EA 3E9HA 2JYOA 2WB1G 4DV0Q 4K5WA 5ELBA 1RF2D 4C3JG 1XWEA 4JC0A 4ZTZB 1V1PA 2F4IA 1F77A 3KOJA 2EJMA 4JV5L 4MTNA 1TIID 2Y0SG 1HZ9A 3TN2A 2B63H 1KRTA 3UE0A 1A63A 2I0QA 4B3TL 1F9SA 3DWPA 4DR7Q 2C7IA 2D62A 4V0BA 1JOQA 4A3BG 4XTWA 2NVYB 2BH8A 3HOUB 2K05A 1I4PA 4Q0FA 1EY9A 1GUSA 2NVTH 4XDXA 3M4OB 3MHBA 1WYDA 2CFMA 2F0OA 1Q46A 4ZK9B 5I6YA 1W6JA 3IL8A 1TR5A 2XWJB 5D14A 3SVMA 2QF7A 4DR6L 2CWAA 1X32A 1GJXA 1CK1A 3ULLA 3QO8A 4GNXC 3NWTA 1WFQA 4A3MG 1F2MA 1FVIA 1XJVA 4EQNA 2KOLA 3SR1A 4K14A 2PMFA 1F9PA 1MI2A 1N9WA 4C3IH 4A75A 4F88A 2MFIA 3NTHA 3V8JA 2RF4A 5J22A 3OMGA 3J80L 2ZXOA 4KY7A 2OF1A 1XPUA 3A56A 1RHPA 1QVFA 1PTOB 2K33A 2DU7A 1NCVA 1RL2A 4DU9A 2HNIA 4GLVB 1TT2A 4QL5A 2GVAA 4GNXA 1LT5D 5C4XH 2QEJC 1I6HB 5CC4A 5M5WB 2R93G 2VUMB 2EY2A 3EFXD 4UP9A 4H2YA 1NY4A 4RDXA 1EOTA 1EEFD 1MGSA 3MF2A 4EO4A 4L5QA 4YHHL 3ULPA 1KQSA 3KBGA 4OX9Q 4ZQ3A 2I4LA 5C4ZA 2IW3A 1NMFA 5ELEA 1YJ9A 4Q6GA 4JI4Q 2YTXA 1LTAD 3D8GA 3K0YA 4BWGB 5C3XA 5KYLA 1ADYA 1NUCA 5G3LD 1M1KC 4YPFA 3HS0C 4CS3A 5ISRA 3ICAA 1VQHA 4IFDH 4H13C 4OL7A 1ML0D 4DAVA 4P72A 1HNWQ 2MO1A 3S9WA 2PNRC 4CH6A 3LWEA 4A93B 5FOBB 1KDBA 2CKZB 2VB2X 1SMYD 3STBD 4HIMA 1XMQL 4LFCL
chains in the Genus database with same CATH topology
1V9PA 4IO9A 4B3TQ 2A8VA 1WLEA 1BBUA 5J3BA 4LF8Q 3PV0A 4FDBA 1VQZA 4LW1A 2AKWA 3GD7A 3K81C 4H02A 1E1OA 4UPAA 3PZCA 3EBEA 3CQZH 1VQNA 2YTVA 1EIYB 2C8MA 3S14H 1UE7A 4BXXH 1XNRL 3L4GB 3PCOB 2I5HA 4G85A 3PUXA 1YB3A 2KCMA 3DM3A 1Q1BA 1S40A 2DVEA 2UXCL 4H2XB 3J81j 4CS4A 1WCMG 3VQYA 4DV1L 4OO1G 2ZNIA 3LSQA 2D0PA 3FKIG 5GAHC 4A3GG 1WQ7A 2IY5A 3TQYA 1HNXQ 3UH0A 3HFVA 4K87A 4YRRA 1SRUA 3S1QH 3CMAA 1Y1VG 4XTXA 3GO5A 4YRLA 2H5XA 1YITA 1YJWA 2C35B 4A3DG 1IXRA 3VQXA 3RLFA 2ZCEA 2Q5IA 3EFSA 2DXUA 4JOIA 3RUXA 1YHBA 4YRQA 2AMCB 4YY3L 4XIGS 2QGQA 1U5KA 2Q7HA 2AWNA 3RKWA 1LM0A 4OONA 1Q82C 2R6GA 1SLJA 1N33L 2EXDA 1QZHA 4ALPA 1HNZL 1A62A 2UUCL 3DSQA 1E1TA 4NCXA 5M3FH 4R4QA 4DNIA 1TWCH 2UXDQ 1PYSA 4POFA 2K50A 3UFGA 2DTIA 1Z47A 4BY1G 1SETA 4GKJQ 3T1YQ 4YRPA 2IX1A 2CQOA 4BWAA 4POGA 2ZTCA 4K88A 4KR3A 4CH4A 1PH3A 3H0GG 1G5HA 3U4ZA 3HOWG 1HR0Q 3S2DH 4LF7Q 1VQ9A 3KDFB 2CJBA 3AEVA 2UUBQ 3CF5A 4KQEA 3I4NH 2R7ZG 3ZJYC 2ZT6A 2CIMA 4HJAA 4LVKA 2R7DA 3A7RA 1FJGL 1XTDA 5IP9G 2CJ9A 2ID0A 4DV7Q 4BBSH 1G6PA 4DUZQ 1I94Q 4A3JH 1HR0L 4HJ9A 4JI1L 3JAMc 4B3MQ 3FJPA 4JYAQ 1VQ7A 4YCVA 2L15A 3A5UA 4IFDI 1SROA 4GKJL 2V1CC 4DV7L 4HIDA 2OQKA 4IFDJ 1IBMQ 4RMFA 1ADJA 3PF4A 3CCEA 1I6HH 2EQSA 3HXWA 4LVMA 2N8NA 1KAWA 2E41A 2MNAA 1P8LA 4DV6L 3S16H 3A5ZA 4C2MH 1M90C 1HH2P 4OX9L 4A3FH 2DU5A 4DUYQ 3ER0A 3J81c 3K80C 1OXSC 1UWVA 2JA7H 4KHPL 4JI7Q 3LGJA 4DV5Q 2PMZE 3Q8DA 3GDEA 1D7QA 3M3YH 3PO2G 2RCNA 4UP7A 4DR2Q 1GKHA 4DV0L 1ASYA 3STBC 3HXUA 4WJ4A 2JJQA 3KF8B 2F3IA 1PH7A 4A4IA 1JJGA 1L1OA 3A0JA 2K5HA 2OQ0A 4DAMA 1A0IA 3VQVA 2JK8A 1K3RA 3R07A 1JJCB 5FLXc 5JJLA 2ZGWA 2RHSB 3MQZA 4AQYQ 2E8GA 1L2FA 1Y1WH 2N49A 1Z7NA 5JJIA 3HOZH 3HOXH 4GKKQ 5AJ3L 1UE1A 3H15A 4G84A 4BBRH 3HOUG 1Y14B 2DQ0A 3KJOA 2ZT7A 1VQBA 4DV2Q 2ZZFA 2Z6KA 1KMMA 1TXYA 2Q7EA 2RHSA 2XGTA 4HJ7A 1E7ZA 4DR4L 1K83H 2JA9A 2Q2UA 4QJFA 3HXXA 4TVWA 3CCUA 2N3SA 1RIQA 1YFRA 4OWWB 4R1JA 2PQAB 2ES2A 2ASBA 3U4VA 5IP9H 2ZIOA 2KENA 1Q81C 1OXXK 1UE6A 5C0XG 3P8TA 4IFDG 1B70A 4LF8L 4HWRA 4GLAC 2Q7GA 3U50C 2K5VA 4JYAL 3CW2C 4LF4Q 4YREA 1L1OC 1PH1A 2R93H 1OXVA 1YZ6A 1C0AA 4DUZL 1XMQQ 3HOYH 1OTCA 1HTTA 3WQZA 1GM5A 4XTCS 1IZ6A 1WNLA 2ZT8A 2D0OA 1BVSA 2E2HH 3PUVA 1RIPA 4PMWA 4ZTUB 4NXML 5C44H 4Y7NH 4DV3Q 4K0KQ 2JEBI 4JI6L 3F8TA 2DTHA 1YEZA 2ZJQA 2UXBQ 3HFZB 3IALA 3CCSA 4LUVA 1AE2A 4LF7L 1YGBA 4GS3A 3HY1A 4HJ5A 1KOGA 3HOYG 5LMNL 3D31A 2ZM6Q 2E64A 4IPCA 3A32A 2QHTA 4IPGA 3HFZA 4TQUS 3M4OH 4IOAA 3V7SA 4A3CH 1I3QH 4X64L 3QNEA 3BU2A 2VUMG 1PFSA 1NE3A 2I5MX 2UU9Q 1FJGQ 4YRCA 1VQ4A 4JI6Q 4A3GH 1H95A 2IT1A 5IYDH 1VQPA 4L5TA 4XTZA 1Q8KA 4P71A 1EFWA 1PVOA 3TEHA 1CKMA 1TWGH 3NELA 1LUZA 2NZOA 4DR3L 4P71C 4XU2A 4LNSA 3GTQH 4XTUA 4DR4Q 5JJKA 1EVLA 4KR2A 1N36Q 2A8EA 3W1GA 3RLOA 2ODRD 1N32Q 5EAYA 2CGHA 4A3IH 4BY7H 4X66Q 4A3FG 2OWOA 4HWOA 2PI2A 4GKKL 3IG2A 1BBWA 2F52A 1NJ8A 3TS0A 1E3PA 3S15H 2DUDA 4YRJA 1XPOA 4YRKA 4XTYA 3RACA 1VQKA 1EOVA 1SESA 1LTLA 3L7ZC 3RL6A 3RZDH 4OLFA 1SN8A 4TWAA 3T1HL 5E3IA 2EJFA 1KXLA 4LVJA 1CKOA 4X66L 4GOPC 3G4SA 1HC7A 2JA6G 1I5FA 4X65Q 1ASZA 5GAEC 2ZZGA 3RKYA 4BY1H 4GN4B 1I94L 2HHHQ 5KNNA 3L2PA 4LF6L 2AMCA 3HXZA 3HOWH 4P74C 2ZINA 1L1OB 4A3BH 5GQOA 5M3MH 1X3GA 3HOVG 4LFCL 4Y52H 1X3EA 4GOPB 1X65A 3RN2A 1PA6A 4OWTB 3GTKH 3M85A 1K8GA 2G4CA 4R4IA 4JI0Q 4RQEA 4YP0A 3CCRA 3J7ZC 1NYQA 3PF5A 5LMNQ 4A93G 4YWLA 1PH8A 4DR1Q 3KDFA 2JA5G 2FYKA 2ZR3A 2OCEA 1EVKA 4JBMA 3AQQA 2KHIA 3S1RH 2ZJPA 4JBJA 1V43A 3PSIA 3MF1A 5C53B 2VW9A 1SFOH 4YRFA 1Y1VH 1R9TH 4H2TA 3H3VI 3K7AH 2OTLA 1XNQQ 1NJ2A 4LF9L 3BZKA 5H1SE 4DR1L 1KMNA 2I4MA 4AIMA 4JI0L 1IBLQ 3L1AA 2WFWA 4YRNA 2DGYA 3I4OA 3GTMH 2LXKA 2LXJA 2MQHA 4JI8Q 3W3SA 2I4OA 2BA0A 4XU0A 2VS1A 1HNWL 1TWHH 3KF6B 2PI2E 3P8YA 1NTGA 3FHWA 2VUMH 3AYHB 3A7AA 1U0LA 1VQGA 2AWOA 3GTOH 1N33Q 2QHUA 2Q5HA 5BR8Q 1X2GA 5JEAG 4DR7L 4R4OA 4A3EG 4DQ2A 3HOXG 2EIFA 4DV5L 2NN6I 5HY6A 2NVYH 4QIWE 2E1HA 4YROA 3QTCA 3ULJA 4O2DA 3FP9A 3KJPA 3RF1A 5IWAQ 1VQ5A 1NJ5A 1HJPA 3L2ZA 3JC66 4JBWA 3OYYA 3KLWA 2YTYA 1XNRQ 1H4TA 2KCTA 3L0OA 1E22A 3NETA 1H4VB 1VQOA 3MEFA 1EUJA 3E9IA 4P73A 2ZZEA 4A76A 4A3DH 1VQ6A 3GTGH 4BBRG 4TTVA 2ZM6L 4JI2L 4A3JG 2KHJA 4KHPQ 2JA5H 4P75A 4XU1A 4DPGA 1TWAH 1N8RC 4LF5L 2E2IH 1YVCA 1IBKQ 2E10A 3G6EA 2JEAI 2E5AA 4L87A 3M7NA 1HXDA 2RHQB 3ICEA 1UE5A 2F4VL 3AFQA 3JAMi 4AYBG 3UGQA 3HXVA 4YCUA 4PZ8A 2E2JH 4P74A 2WAQG 1EQRA 1NMGA 4JBKA 3M9BA 1IBML 3CP0A 4B3SQ 5E7NA 3EIVA 4DV1Q 1WI5A 2P0LA 3V8LA 2PNHA 1JJCA 4LUZA 1FGUA 1KD1C 3GTLH 1B7YA 4P75C 1Y1WG 1XNQL 5ELOA 4TVYA 1B70B 5C3EH 3UDIA 1EYGA 3UE1A 5FLMH 3CPWA 3J7A5 2A1AA 5FLMG 4NXMQ 2ZXFA 4J15A 4YWMA 3P8VA 2WP8J 2ZTEA 2E5LL 3REUA 4HA8A 4P73C 1EIFA 4YHHQ 2R92G 1FL0A 1JMCA 5IYCG 2K4KA 1DGSA 1A8VA 1VQEA 3VBBA 1J5WA 2HIVA 1W66A 3GTJH 4KHZA 3HOUH 3TREA 1J6QA 1Q12A 4JI5L 3SGIA 3UDXA 3T1HQ 1WJJA 2VZAA 3RR5A 1SE8A 4JCVE 1N34Q 5C0XJ 5K36G 2WAQE 2F4VQ 3IRBA 3A74A 5IYDG 4RQFA 2NVQH 2CWPA 4A3KH 4LWCA 3PO2H 2NS6A 4GN5A 4YDQA 2DXTA 1HNZQ 3VQWA 1OXUA 3F2BA 1KHIA 1O7IA 1Q86C 2NVXH 3I55A 4QGUA 4RG1A 1ATIA 5M5YH 2CJAA 3ERRA 3RZOH 3PGZA 1GVPA 4GN3B 3RNUA 2EJGA 3V8KA 1CSPA 1W2BA 1X01A 1PV4A 3CC7A 4QQBX 4IPHA 3HKZG 4PZ6A 3F1ZA 3PUZA 4LVIA 4NXNL 4YRMA 5IE8A 2HIXA 3OTOL 3REXA 2K52A 12ASA 2VQFL 1YBYA 3L4GA 2VY3A 1K73C 3K7UC 1NJIC 3QO7A 2MO0A 4BW9A 4GNXB 1QVCA 1B8AA 1MJEA 1XPRA 2HQLA 3S1MH 4P3PA 4CS2A 4HT4A 2JA6H 1N32L 4H2UA 4BA2I 5AJ3Q 5LMUQ 4E51A 3F2CA 1P16A 3LSSA 4CH5A 4KI0A 3H0GH 3NEMA 2EL9A 1FYFA 1NBWA 5ELNA 3PIPA 1VQFA 3HXYA 3HRKA 5C51B 4IOCA 4X62Q 4ZIBA 4DR2L 5IYCH 1YNXA 5HGQA 4DV4L 2I5LX 1Z9FA 4XEMA 4B3ML 1S3OA 1YHAA 1KC8C 3UGTA 1NJ6A 3CPFA 2DJZA 5C52B 1QE0A 1JB7A 2E65A 3TUPA 2IY5B 5C4JH 1VS0A 1EIYA 3OW2A 1C9OA 3QO5A 4DAYB 4KLKA 2UUBL 1PH9A 2ARTA 3I4MG 4LFBL 2VL6A 1PH4A 2VQEQ 2UUAQ 3V7RA 4DK3C 3K0XA 4LNQA 2VQEL 2UUAL 3T1YL 1X6OA 4Q15A 1QVGA 4DV4Q 2ATWA 5IT9c 4X62L 4YYEA 1G291 2K14A 3BJUA 1J5EQ 4EX5A 1H4QA 1VQCA 1JJ2A 2ZJRA 4A93H 3HKSA 1X3FA 11ASA 4C3HH 4B3RQ 4OO1I 1E24A 1WCMH 1MJCA 2OTJA 4GLXA 1PH5A 2ALYA 1UEBA 2HHHL 3PCOA 3FKIH 1QUQB 2NN6G 2NZHA 1BIBA 1B76A 5K1PA 3I2ZA 2DDZA 4BA1I 3HOZG 4DR5Q 3A7UA 3EFRA 3AFPA 4DKAC 5IYBG 4AQYL 4IJHA 2WB1E 3D0FA 2ALYB 3MXNB 4MNOA 1D8LA 4H2VA 1VQJA 3RN5A 5C4XG 4JI3L 2DZCA 1TWFH 3M4PA 1VQAA 1CKNA 3CXCA 2BA1A 1X2HA 3A5YA 3CMQA 3G1ZA 3CCLA 4HVCA 4LFAQ 1QZGA 1MIUA 3J80c 2QHVA 4YRSA 4LFAL 1GGMA 1Z7MA 3BZCA 1YFTA 4R4CA 5M3FG 3TS2A 4JI1Q 5BR8L 5IP7H 5K1XA 3OTOQ 3W1BA 3S17H 2BH2A 4JI3Q 2EAYA 1USYA 1X9NA 2JA7G 2AHOB 1JT8A 1WPYA 2FXQA 5C3EG 3UDFA 1SERA 1VQMA 3G48A 4NB3A 5C0XI 3I4MH 5M5XH 3V7CA 4JOIC 1HNXL 4OP0A 2DTOA 2B63G 1EQQA 4A3CG 2UU9L 4HIOA 5M5WH 1CSQA 4DR5L 2Q2IA 3GTPH 4YWKA 5GROA 1SR3A 3CC2A 3UDGA 4IPDA 3H3VH 2VNUD 3NBHB 4ME3A 2ODRC 4HWSA 2R7ZH 5GAGC 2Z6KC 1YI2A 4B3SL 4R4TA 1K9MC 3PUYA 4A3MH 1VQDA 3PO3G 5LMNW 2Q2TA 4BBSG 2DEQA 4WI1A 3PO3H 4AYBE 1NNHA 4LVLA 2JA8G 3S2HH 1J5EL 4QY7A 3WWVA 4A3LG 1NYRA 1YJNA 3KFUA 3CCJA 2I4NA 1LYLA 2PMEA 3I56A 2IHFA 2B29A 3MEYA 1IBKL 2ARUA 4PZ7A 4TVAA 2J3MA 1X55A 5LMUL 4O0AA 4LF4L 2HT1A 3PIOA 1CKNB 3S24A 4TQDA 3A31A 1HZAA 3E0EA 4AH6A 4L5SA 1K8AC 4LFBQ 4PG3A 1XMOL 2Q2HA 1EWIA 2ARSA 1GD7A 1HZBA 1BKBA 1B7YB 1PH6A 4HJ8A 4P3NA 4APVA 3OD1A 3CD6A 4XU3A 2ZT5A 4LF6Q 2Z0SA 1QF6A 1QUQA 2K5NA 2N78A 3IKMB 3LC0A 4JI7L 4TQFA 3HY0A 5M3MG 5IP7G 1NJ1A 4DK6C 1N36L 4DUYL 4JG2A 1KRSA 3RGLA 1SRYA 4YCWA 1VCIA 1PH2A 4YRGA 2YV5A 1VQLA 4NXNQ 5IYBH 2E3CA 1Q7YC 3KF6A 4P72C 4L5RC 2CCZA 1V1QA 5IWAL 1BIAA 2QEXA 3EN2A 3CCQA 4X64Q 2AKWB 4H2SA 2A19A 3F2DA 3HRIA 3BFMA 5GADC 1KIXA 3HOVH 3CCMA 4DV2L 2DZ9A 1G5IA 2ZR2A 2UXCQ 3RLNA 5F5WA 4WJ3M 1SMXA 2ZNJA 4DR3Q 3HKZE 3W5OA 2E5LQ 1USYC 5DLQE 4PHCA 4BY7G 4B3RL 3M4QA 3K8AA 1WU7A 3A5ZB 1PHJA 1N34L 4X5OA 1L0WA 1MKHA 4JI4L 4HWTA 4IJLA 3S1NH 2GN5A 4XTVA 4A3KG 4JI5Q 5FJ8G 3HTZA 5FJ8H 2EWNA 4C3JH 4XEOA 3I7FA 4MZ9A 4CH3A 3NENA 2K75A 2UXBL 3TEGA 2LSSA 4UY8C 2JQOA 4LFCQ 3CAMA 3CMEA 4DV6Q 4GOPA 1JE5A 1PYBA 3I4NG 2IX0A 2R92H 2ZIMA 4UP8A 4BXXG 4EQ5A 3DLLA 1XMOQ 3CCVA 1OXTA 5IY0A 2J3LA 1IBLL 2GVBA 4LF5Q 2PQAA 1AH9A 2P5IA 3PUWA 4HWPA 2QA4A 4A3LH 1WOCA 4JV5Q 4YRIA 1YFSA 4LF9Q 5JEAJ 2R7FA 2B3GA 3G71A 3RIRA 4A3EH 1C7YA 2VQFQ 2UXDL 2Y0SE 1IYJB 1X56A 4DV3L 2YU9H 4K0KL 2YYZA 1I50H 3KYHC 4K86A 2KBNA 3VDYA 3TRZA 1CUKA 4DR6Q 1S72A 2UUCQ 1K0RA 2JA8H 1HR0W 1G51A 3CC4A 3IKLA 4NPSA 4H2XA 4X6AH 4X65L 4JI2Q 3U58A 1GO3E 1YHQA 4H2WA 2IHEA 1PYSB 4WF2A 1AE3A 1IL2A 4P3OA 4YRTA 4YY3Q 1HZCA 1H4SA 4OWXB 2RHQA 2XTIA 3ERSX 1VQIA 5C44G 1KL9A 3J80i 2JE6I 2DQ3A 2EJ9A 3RKXA 2QHSA 4A3IG 1X54A 3B6YA 3J81i 4TVAB 3TEHB 2ZTGA 4HIKA 4OXPA 1WQWA 1W3SA 1YIJA 1VQ8A 4JI8L 1T9HA 2ZTDA 4LUOA 1Q1EA 3E9HA 2WB1G 4DV0Q 4JC0A 4ZTZB 3KOJA 4JV5L 4MTNA 2Y0SG 1HZ9A 2B63H 1KRTA 3UE0A 1A63A 2I0QA 4B3TL 4DR7Q 2C7IA 2D62A 4A3BG 4XTWA 2BH8A 2NVTH 1WYDA 2CFMA 1Q46A 4DR6L 2CWAA 3ULLA 3QO8A 4GNXC 1WFQA 4A3MG 1FVIA 1XJVA 2PMFA 1N9WA 4C3IH 4A75A 2MFIA 3V8JA 2RF4A 1XPUA 1QVFA 2DU7A 2HNIA 1RL2A 4GLVB 4QL5A 2GVAA 4GNXA 5C4XH 2R93G 4UP9A 4H2YA 1NY4A 4RDXA 3MF2A 4EO4A 4L5QA 4YHHL 3ULPA 1KQSA 4OX9Q 2I4LA 1NMFA 1YJ9A 4Q6GA 4JI4Q 2YTXA 1ADYA 1M1KC 4YPFA 4CS3A 3ICAA 1VQHA 4P72A 1HNWQ 2MO1A 4CH6A 2CKZB 3STBD 4HIMA 1XMQL 2DKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9P A;  4IO9 A;  4B3T Q;  2A8V A;  1WLE A;  1BBU A;  5J3B A;  4LF8 Q;  3PV0 A;  4FDB A;  1VQZ A;  4LW1 A;  2AKW A;  3GD7 A;  3K81 C;  4H02 A;  1E1O A;  4UPA A;  3PZC A;  3EBE A;  3CQZ H;  1VQN A;  2YTV A;  1EIY B;  2C8M A;  3S14 H;  1UE7 A;  4BXX H;  1XNR L;  3L4G B;  3PCO B;  2I5H A;  4G85 A;  3PUX A;  1YB3 A;  2KCM A;  3DM3 A;  1Q1B A;  1S40 A;  2DVE A;  2UXC L;  4H2X B;  3J81 j;  4CS4 A;  1WCM G;  3VQY A;  4DV1 L;  4OO1 G;  2ZNI A;  3LSQ A;  2D0P A;  3FKI G;  5GAH C;  4A3G G;  1WQ7 A;  2IY5 A;  3TQY A;  1HNX Q;  3UH0 A;  3HFV A;  4K87 A;  4YRR A;  1SRU A;  3S1Q H;  3CMA A;  1Y1V G;  4XTX A;  3GO5 A;  4YRL A;  2H5X A;  1YIT A;  1YJW A;  2C35 B;  4A3D G;  1IXR A;  3VQX A;  3RLF A;  2ZCE A;  2Q5I A;  3EFS A;  2DXU A;  4JOI A;  3RUX A;  1YHB A;  4YRQ A;  2AMC B;  4YY3 L;  4XIG S;  2QGQ A;  1U5K A;  2Q7H A;  2AWN A;  3RKW A;  1LM0 A;  4OON A;  1Q82 C;  2R6G A;  1SLJ A;  1N33 L;  2EXD A;  1QZH A;  4ALP A;  1HNZ L;  1A62 A;  2UUC L;  3DSQ A;  1E1T A;  4NCX A;  5M3F H;  4R4Q A;  4DNI A;  1TWC H;  2UXD Q;  1PYS A;  4POF A;  2K50 A;  3UFG A;  2DTI A;  1Z47 A;  4BY1 G;  1SET A;  4GKJ Q;  3T1Y Q;  4YRP A;  2IX1 A;  2CQO A;  4BWA A;  4POG A;  2ZTC A;  4K88 A;  4KR3 A;  4CH4 A;  1PH3 A;  3H0G G;  1G5H A;  3U4Z A;  3HOW G;  1HR0 Q;  3S2D H;  4LF7 Q;  1VQ9 A;  3KDF B;  2CJB A;  3AEV A;  2UUB Q;  3CF5 A;  4KQE A;  3I4N H;  2R7Z G;  3ZJY C;  2ZT6 A;  2CIM A;  4HJA A;  2R7D A;  3A7R A;  1FJG L;  1XTD A;  5IP9 G;  2CJ9 A;  2ID0 A;  4DV7 Q;  4BBS H;  1G6P A;  4DUZ Q;  1I94 Q;  4A3J H;  1HR0 L;  4HJ9 A;  4JI1 L;  3JAM c;  4B3M Q;  3FJP A;  4JYA Q;  1VQ7 A;  4YCV A;  2L15 A;  3A5U A;  4IFD I;  1SRO A;  4GKJ L;  2V1C C;  4DV7 L;  4HID A;  2OQK A;  4IFD J;  1IBM Q;  4RMF A;  1ADJ A;  3PF4 A;  3CCE A;  1I6H H;  2EQS A;  3HXW A;  2N8N A;  1KAW A;  2E41 A;  2MNA A;  1P8L A;  4DV6 L;  3S16 H;  3A5Z A;  4C2M H;  1M90 C;  1HH2 P;  4OX9 L;  4A3F H;  2DU5 A;  4DUY Q;  3ER0 A;  3J81 c;  3K80 C;  1OXS C;  1UWV A;  2JA7 H;  4KHP L;  4JI7 Q;  3LGJ A;  4DV5 Q;  2PMZ E;  3Q8D A;  3GDE A;  1D7Q A;  3M3Y H;  3PO2 G;  2RCN A;  4UP7 A;  4DR2 Q;  1GKH A;  4DV0 L;  1ASY A;  3STB C;  3HXU A;  4WJ4 A;  2JJQ A;  3KF8 B;  2F3I A;  1PH7 A;  4A4I A;  1JJG A;  1L1O A;  3A0J A;  2K5H A;  2OQ0 A;  4DAM A;  1A0I A;  3VQV A;  2JK8 A;  1K3R A;  3R07 A;  1JJC B;  5FLX c;  5JJL A;  2ZGW A;  2RHS B;  4AQY Q;  2E8G A;  1L2F A;  1Y1W H;  2N49 A;  1Z7N A;  5JJI A;  3HOZ H;  3HOX H;  4GKK Q;  5AJ3 L;  1UE1 A;  3H15 A;  4G84 A;  4BBR H;  3HOU G;  1Y14 B;  2DQ0 A;  3KJO A;  2ZT7 A;  1VQB A;  4DV2 Q;  2ZZF A;  2Z6K A;  1KMM A;  1TXY A;  2Q7E A;  2RHS A;  2XGT A;  4HJ7 A;  1E7Z A;  4DR4 L;  1K83 H;  2JA9 A;  2Q2U A;  4QJF A;  3HXX A;  4TVW A;  3CCU A;  2N3S A;  1RIQ A;  1YFR A;  4OWW B;  4R1J A;  2PQA B;  2ES2 A;  2ASB A;  3U4V A;  5IP9 H;  2ZIO A;  2KEN A;  1Q81 C;  1OXX K;  1UE6 A;  5C0X G;  3P8T A;  4IFD G;  1B70 A;  4LF8 L;  4HWR A;  4GLA C;  2Q7G A;  3U50 C;  2K5V A;  4JYA L;  3CW2 C;  4LF4 Q;  4YRE A;  1L1O C;  1PH1 A;  2R93 H;  1OXV A;  1YZ6 A;  1C0A A;  4DUZ L;  1XMQ Q;  3HOY H;  1OTC A;  1HTT A;  3WQZ A;  1GM5 A;  4XTC S;  1IZ6 A;  1WNL A;  2ZT8 A;  2D0O A;  1BVS A;  2E2H H;  3PUV A;  1RIP A;  4PMW A;  4ZTU B;  4NXM L;  5C44 H;  4Y7N H;  4DV3 Q;  4K0K Q;  2JEB I;  4JI6 L;  3F8T A;  2DTH A;  1YEZ A;  2ZJQ A;  2UXB Q;  3HFZ B;  3IAL A;  3CCS A;  4LUV A;  1AE2 A;  4LF7 L;  1YGB A;  4GS3 A;  3HY1 A;  4HJ5 A;  1KOG A;  3HOY G;  5LMN L;  3D31 A;  2ZM6 Q;  2E64 A;  4IPC A;  3A32 A;  2QHT A;  4IPG A;  3HFZ A;  4TQU S;  3M4O H;  4IOA A;  3V7S A;  4A3C H;  1I3Q H;  4X64 L;  3QNE A;  3BU2 A;  2VUM G;  1PFS A;  1NE3 A;  2I5M X;  2UU9 Q;  1FJG Q;  4YRC A;  1VQ4 A;  4JI6 Q;  4A3G H;  1H95 A;  2IT1 A;  5IYD H;  1VQP A;  4L5T A;  4XTZ A;  1Q8K A;  4P71 A;  1EFW A;  1PVO A;  3TEH A;  1CKM A;  1TWG H;  3NEL A;  1LUZ A;  2NZO A;  4DR3 L;  4P71 C;  4XU2 A;  4LNS A;  3GTQ H;  4XTU A;  4DR4 Q;  5JJK A;  1EVL A;  4KR2 A;  1N36 Q;  3W1G A;  3RLO A;  2ODR D;  1N32 Q;  5EAY A;  2CGH A;  4A3I H;  4BY7 H;  4X66 Q;  4A3F G;  2OWO A;  4HWO A;  2PI2 A;  4GKK L;  3IG2 A;  1BBW A;  2F52 A;  1NJ8 A;  3TS0 A;  1E3P A;  3S15 H;  2DUD A;  4YRJ A;  1XPO A;  4YRK A;  4XTY A;  3RAC A;  1VQK A;  1EOV A;  1SES A;  1LTL A;  3L7Z C;  3RL6 A;  3RZD H;  4OLF A;  1SN8 A;  4TWA A;  3T1H L;  5E3I A;  2EJF A;  1KXL A;  1CKO A;  4X66 L;  4GOP C;  3G4S A;  1HC7 A;  2JA6 G;  1I5F A;  4X65 Q;  1ASZ A;  5GAE C;  2ZZG A;  3RKY A;  4BY1 H;  4GN4 B;  1I94 L;  2HHH Q;  5KNN A;  3L2P A;  4LF6 L;  2AMC A;  3HXZ A;  3HOW H;  4P74 C;  2ZIN A;  1L1O B;  4A3B H;  5GQO A;  5M3M H;  1X3G A;  3HOV G;  4LFC L;  4Y52 H;  1X3E A;  4GOP B;  1X65 A;  3RN2 A;  1PA6 A;  4OWT B;  3GTK H;  3M85 A;  1K8G A;  2G4C A;  4R4I A;  4JI0 Q;  4RQE A;  4YP0 A;  3CCR A;  3J7Z C;  1NYQ A;  3PF5 A;  5LMN Q;  4A93 G;  4YWL A;  1PH8 A;  4DR1 Q;  3KDF A;  2JA5 G;  2FYK A;  2ZR3 A;  2OCE A;  1EVK A;  4JBM A;  3AQQ A;  2KHI A;  3S1R H;  2ZJP A;  4JBJ A;  1V43 A;  3PSI A;  3MF1 A;  5C53 B;  2VW9 A;  1SFO H;  4YRF A;  1Y1V H;  1R9T H;  4H2T A;  3H3V I;  3K7A H;  2OTL A;  1XNQ Q;  1NJ2 A;  4LF9 L;  3BZK A;  5H1S E;  4DR1 L;  1KMN A;  2I4M A;  4AIM A;  4JI0 L;  1IBL Q;  3L1A A;  2WFW A;  4YRN A;  2DGY A;  3I4O A;  3GTM H;  2LXK A;  2LXJ A;  2MQH A;  4JI8 Q;  3W3S A;  2I4O A;  2BA0 A;  4XU0 A;  2VS1 A;  1HNW L;  1TWH H;  3KF6 B;  2PI2 E;  3P8Y A;  1NTG A;  3FHW A;  2VUM H;  3AYH B;  3A7A A;  1U0L A;  1VQG A;  2AWO A;  3GTO H;  1N33 Q;  2QHU A;  2Q5H A;  5BR8 Q;  1X2G A;  5JEA G;  4DR7 L;  4R4O A;  4A3E G;  4DQ2 A;  3HOX G;  2EIF A;  4DV5 L;  2NN6 I;  5HY6 A;  2NVY H;  4QIW E;  2E1H A;  4YRO A;  3QTC A;  3ULJ A;  4O2D A;  3FP9 A;  3KJP A;  3RF1 A;  5IWA Q;  1VQ5 A;  1NJ5 A;  1HJP A;  3L2Z A;  3JC6 6;  4JBW A;  3OYY A;  3KLW A;  2YTY A;  1XNR Q;  1H4T A;  2KCT A;  3L0O A;  1E22 A;  3NET A;  1H4V B;  1VQO A;  3MEF A;  1EUJ A;  3E9I A;  4P73 A;  2ZZE A;  4A76 A;  4A3D H;  1VQ6 A;  3GTG H;  4BBR G;  4TTV A;  2ZM6 L;  4JI2 L;  4A3J G;  2KHJ A;  4KHP Q;  2JA5 H;  4P75 A;  4XU1 A;  4DPG A;  1TWA H;  1N8R C;  4LF5 L;  2E2I H;  1YVC A;  1IBK Q;  2E10 A;  3G6E A;  2JEA I;  2E5A A;  4L87 A;  3M7N A;  1HXD A;  2RHQ B;  3ICE A;  1UE5 A;  2F4V L;  3AFQ A;  3JAM i;  4AYB G;  3UGQ A;  3HXV A;  4YCU A;  4PZ8 A;  2E2J H;  4P74 A;  2WAQ G;  1EQR A;  1NMG A;  4JBK A;  3M9B A;  1IBM L;  3CP0 A;  4B3S Q;  5E7N A;  3EIV A;  4DV1 Q;  1WI5 A;  2P0L A;  3V8L A;  2PNH A;  1JJC A;  4LUZ A;  1FGU A;  1KD1 C;  3GTL H;  1B7Y A;  4P75 C;  1Y1W G;  1XNQ L;  5ELO A;  4TVY A;  1B70 B;  5C3E H;  3UDI A;  1EYG A;  3UE1 A;  5FLM H;  3CPW A;  3J7A 5;  2A1A A;  5FLM G;  4NXM Q;  2ZXF A;  4J15 A;  4YWM A;  3P8V A;  2WP8 J;  2ZTE A;  2E5L L;  3REU A;  4HA8 A;  4P73 C;  1EIF A;  4YHH Q;  2R92 G;  1FL0 A;  1JMC A;  5IYC G;  2K4K A;  1DGS A;  1A8V A;  1VQE A;  3VBB A;  1J5W A;  2HIV A;  1W66 A;  3GTJ H;  4KHZ A;  3HOU H;  3TRE A;  1J6Q A;  1Q12 A;  4JI5 L;  3SGI A;  3UDX A;  3T1H Q;  1WJJ A;  2VZA A;  3RR5 A;  1SE8 A;  4JCV E;  1N34 Q;  5C0X J;  5K36 G;  2WAQ E;  2F4V Q;  3IRB A;  3A74 A;  5IYD G;  4RQF A;  2NVQ H;  2CWP A;  4A3K H;  4LWC A;  3PO2 H;  4GN5 A;  4YDQ A;  2DXT A;  1HNZ Q;  3VQW A;  1OXU A;  3F2B A;  1KHI A;  1O7I A;  1Q86 C;  2NVX H;  3I55 A;  4QGU A;  4RG1 A;  1ATI A;  5M5Y H;  2CJA A;  3ERR A;  3RZO H;  3PGZ A;  1GVP A;  4GN3 B;  3RNU A;  2EJG A;  3V8K A;  1CSP A;  1W2B A;  1X01 A;  1PV4 A;  3CC7 A;  4QQB X;  4IPH A;  3HKZ G;  4PZ6 A;  3F1Z A;  3PUZ A;  4NXN L;  4YRM A;  5IE8 A;  2HIX A;  3OTO L;  3REX A;  2K52 A;  12AS A;  2VQF L;  1YBY A;  3L4G A;  2VY3 A;  1K73 C;  3K7U C;  1NJI C;  3QO7 A;  2MO0 A;  4BW9 A;  4GNX B;  1QVC A;  1B8A A;  1MJE A;  1XPR A;  2HQL A;  3S1M H;  4P3P A;  4CS2 A;  2JA6 H;  1N32 L;  4H2U A;  4BA2 I;  5AJ3 Q;  5LMU Q;  4E51 A;  3F2C A;  1P16 A;  3LSS A;  4CH5 A;  4KI0 A;  3H0G H;  3NEM A;  2EL9 A;  1FYF A;  1NBW A;  5ELN A;  3PIP A;  1VQF A;  3HXY A;  3HRK A;  5C51 B;  4IOC A;  4X62 Q;  4ZIB A;  4DR2 L;  5IYC H;  1YNX A;  5HGQ A;  4DV4 L;  2I5L X;  1Z9F A;  4XEM A;  4B3M L;  1S3O A;  1YHA A;  1KC8 C;  3UGT A;  1NJ6 A;  3CPF A;  2DJZ A;  5C52 B;  1QE0 A;  1JB7 A;  2E65 A;  3TUP A;  2IY5 B;  5C4J H;  1VS0 A;  1EIY A;  3OW2 A;  1C9O A;  3QO5 A;  4DAY B;  4KLK A;  2UUB L;  1PH9 A;  2ART A;  3I4M G;  4LFB L;  2VL6 A;  1PH4 A;  2VQE Q;  2UUA Q;  3V7R A;  4DK3 C;  3K0X A;  4LNQ A;  2VQE L;  2UUA L;  3T1Y L;  1X6O A;  4Q15 A;  1QVG A;  4DV4 Q;  2ATW A;  5IT9 c;  4X62 L;  4YYE A;  1G29 1;  2K14 A;  3BJU A;  1J5E Q;  4EX5 A;  1H4Q A;  1VQC A;  1JJ2 A;  2ZJR A;  4A93 H;  3HKS A;  1X3F A;  11AS A;  4C3H H;  4B3R Q;  4OO1 I;  1E24 A;  1WCM H;  1MJC A;  2OTJ A;  4GLX A;  1PH5 A;  2ALY A;  1UEB A;  2HHH L;  3PCO A;  3FKI H;  1QUQ B;  2NN6 G;  2NZH A;  1BIB A;  1B76 A;  5K1P A;  3I2Z A;  2DDZ A;  4BA1 I;  3HOZ G;  4DR5 Q;  3A7U A;  3EFR A;  3AFP A;  4DKA C;  5IYB G;  4AQY L;  4IJH A;  2WB1 E;  3D0F A;  2ALY B;  3MXN B;  4MNO A;  1D8L A;  4H2V A;  1VQJ A;  3RN5 A;  5C4X G;  4JI3 L;  2DZC A;  1TWF H;  3M4P A;  1VQA A;  1CKN A;  3CXC A;  2BA1 A;  1X2H A;  3A5Y A;  3CMQ A;  3G1Z A;  3CCL A;  4HVC A;  4LFA Q;  1QZG A;  1MIU A;  3J80 c;  2QHV A;  4YRS A;  4LFA L;  1GGM A;  1Z7M A;  3BZC A;  1YFT A;  4R4C A;  5M3F G;  3TS2 A;  4JI1 Q;  5BR8 L;  5IP7 H;  5K1X A;  3OTO Q;  3W1B A;  3S17 H;  2BH2 A;  4JI3 Q;  2EAY A;  1USY A;  1X9N A;  2JA7 G;  2AHO B;  1JT8 A;  1WPY A;  2FXQ A;  5C3E G;  3UDF A;  1SER A;  1VQM A;  3G48 A;  4NB3 A;  5C0X I;  3I4M H;  5M5X H;  3V7C A;  4JOI C;  1HNX L;  4OP0 A;  2DTO A;  2B63 G;  1EQQ A;  4A3C G;  2UU9 L;  4HIO A;  5M5W H;  1CSQ A;  4DR5 L;  2Q2I A;  3GTP H;  4YWK A;  5GRO A;  1SR3 A;  3CC2 A;  3UDG A;  4IPD A;  3H3V H;  2VNU D;  3NBH B;  4ME3 A;  2ODR C;  4HWS A;  2R7Z H;  5GAG C;  2Z6K C;  1YI2 A;  4B3S L;  4R4T A;  1K9M C;  3PUY A;  4A3M H;  1VQD A;  3PO3 G;  5LMN W;  2Q2T A;  4BBS G;  2DEQ A;  4WI1 A;  3PO3 H;  4AYB E;  1NNH A;  2JA8 G;  3S2H H;  1J5E L;  4QY7 A;  3WWV A;  4A3L G;  1NYR A;  1YJN A;  3KFU A;  3CCJ A;  2I4N A;  1LYL A;  2PME A;  3I56 A;  2IHF A;  2B29 A;  3MEY A;  1IBK L;  2ARU A;  4PZ7 A;  4TVA A;  2J3M A;  1X55 A;  5LMU L;  4O0A A;  4LF4 L;  2HT1 A;  3PIO A;  1CKN B;  3S24 A;  4TQD A;  3A31 A;  1HZA A;  3E0E A;  4AH6 A;  4L5S A;  1K8A C;  4LFB Q;  4PG3 A;  1XMO L;  2Q2H A;  1EWI A;  2ARS A;  1GD7 A;  1HZB A;  1BKB A;  1B7Y B;  1PH6 A;  4HJ8 A;  4P3N A;  4APV A;  3OD1 A;  3CD6 A;  4XU3 A;  2ZT5 A;  4LF6 Q;  2Z0S A;  1QF6 A;  1QUQ A;  2K5N A;  2N78 A;  3IKM B;  3LC0 A;  4JI7 L;  4TQF A;  3HY0 A;  5M3M G;  5IP7 G;  1NJ1 A;  4DK6 C;  1N36 L;  4DUY L;  4JG2 A;  1KRS A;  3RGL A;  1SRY A;  4YCW A;  1VCI A;  1PH2 A;  4YRG A;  2YV5 A;  1VQL A;  4NXN Q;  5IYB H;  2E3C A;  1Q7Y C;  3KF6 A;  4P72 C;  4L5R C;  2CCZ A;  1V1Q A;  5IWA L;  1BIA A;  2QEX A;  3EN2 A;  3CCQ A;  4X64 Q;  2AKW B;  4H2S A;  2A19 A;  3F2D A;  3HRI A;  3BFM A;  5GAD C;  1KIX A;  3HOV H;  3CCM A;  4DV2 L;  2DZ9 A;  1G5I A;  2ZR2 A;  2UXC Q;  3RLN A;  5F5W A;  4WJ3 M;  1SMX A;  2ZNJ A;  4DR3 Q;  3HKZ E;  3W5O A;  2E5L Q;  1USY C;  5DLQ E;  4PHC A;  4BY7 G;  4B3R L;  3M4Q A;  3K8A A;  1WU7 A;  3A5Z B;  1PHJ A;  1N34 L;  4X5O A;  1L0W A;  1MKH A;  4JI4 L;  4HWT A;  4IJL A;  3S1N H;  2GN5 A;  4XTV A;  4A3K G;  4JI5 Q;  5FJ8 G;  3HTZ A;  5FJ8 H;  2EWN A;  4C3J H;  4XEO A;  3I7F A;  4MZ9 A;  4CH3 A;  3NEN A;  2K75 A;  2UXB L;  3TEG A;  2LSS A;  4UY8 C;  2JQO A;  4LFC Q;  3CAM A;  3CME A;  4DV6 Q;  4GOP A;  1JE5 A;  1PYB A;  3I4N G;  2IX0 A;  2R92 H;  2ZIM A;  4UP8 A;  4BXX G;  4EQ5 A;  3DLL A;  1XMO Q;  3CCV A;  1OXT A;  5IY0 A;  2J3L A;  1IBL L;  2GVB A;  4LF5 Q;  2PQA A;  1AH9 A;  2P5I A;  3PUW A;  4HWP A;  2QA4 A;  4A3L H;  1WOC A;  4JV5 Q;  4YRI A;  1YFS A;  4LF9 Q;  5JEA J;  2R7F A;  2B3G A;  3G71 A;  3RIR A;  4A3E H;  1C7Y A;  2VQF Q;  2UXD L;  2Y0S E;  1IYJ B;  1X56 A;  4DV3 L;  2YU9 H;  4K0K L;  2YYZ A;  1I50 H;  3KYH C;  4K86 A;  2KBN A;  3VDY A;  3TRZ A;  1CUK A;  4DR6 Q;  1S72 A;  2UUC Q;  1K0R A;  2JA8 H;  1HR0 W;  1G51 A;  3CC4 A;  3IKL A;  4NPS A;  4H2X A;  4X6A H;  4X65 L;  4JI2 Q;  3U58 A;  1GO3 E;  1YHQ A;  4H2W A;  2IHE A;  1PYS B;  4WF2 A;  1AE3 A;  1IL2 A;  4P3O A;  4YRT A;  4YY3 Q;  1HZC A;  1H4S A;  4OWX B;  2RHQ A;  2XTI A;  3ERS X;  1VQI A;  5C44 G;  1KL9 A;  3J80 i;  2JE6 I;  2DQ3 A;  2EJ9 A;  3RKX A;  2QHS A;  4A3I G;  1X54 A;  3B6Y A;  3J81 i;  4TVA B;  3TEH B;  2ZTG A;  4HIK A;  4OXP A;  1WQW A;  1W3S A;  1YIJ A;  1VQ8 A;  4JI8 L;  1T9H A;  2ZTD A;  4LUO A;  1Q1E A;  3E9H A;  2WB1 G;  4DV0 Q;  4JC0 A;  4ZTZ B;  3KOJ A;  4JV5 L;  4MTN A;  2Y0S G;  1HZ9 A;  2B63 H;  1KRT A;  3UE0 A;  1A63 A;  2I0Q A;  4B3T L;  4DR7 Q;  2C7I A;  2D62 A;  4A3B G;  4XTW A;  2BH8 A;  2NVT H;  1WYD A;  2CFM A;  1Q46 A;  4DR6 L;  2CWA A;  3ULL A;  3QO8 A;  4GNX C;  1WFQ A;  4A3M G;  1FVI A;  1XJV A;  2PMF A;  1N9W A;  4C3I H;  4A75 A;  2MFI A;  3V8J A;  2RF4 A;  1XPU A;  1QVF A;  2DU7 A;  2HNI A;  1RL2 A;  4GLV B;  4QL5 A;  2GVA A;  4GNX A;  5C4X H;  2R93 G;  4UP9 A;  4H2Y A;  1NY4 A;  4RDX A;  3MF2 A;  4EO4 A;  4L5Q A;  4YHH L;  3ULP A;  1KQS A;  4OX9 Q;  2I4L A;  1NMF A;  1YJ9 A;  4Q6G A;  4JI4 Q;  2YTX A;  1ADY A;  1M1K C;  4YPF A;  4CS3 A;  3ICA A;  1VQH A;  4P72 A;  1HNW Q;  2MO1 A;  4CH6 A;  2CKZ B;  3STB D;  4HIM A;  1XMQ L;  2DKG A; 
#chains in the Genus database with same CATH topology
 1V9P A;  3R3O A;  1O80 A;  1WD1 A;  4RA8 A;  3VYT A;  4IO9 A;  3H6M A;  4B3T Q;  3VR6 A;  2A8V A;  2L1B A;  1WLE A;  1ICF B;  4ZLT F;  1F9Q A;  1QOH A;  2CHB D;  1BBU A;  3ND8 A;  3J7Y W;  2LKV A;  5J3B A;  4LF8 Q;  3MAQ A;  1Y8P B;  3MXP A;  2PZU A;  1X3P A;  3PV0 A;  5KEE A;  5LHY 1;  4O42 A;  4FDB A;  1ZYR D;  5FO9 B;  1VQZ A;  1CM9 A;  1H9M A;  5COR A;  4LW1 A;  5LL6 S;  4OIK A;  2AKW A;  3GD7 A;  2ICE C;  1A2T A;  1PFB A;  3K81 C;  1EY7 A;  4H02 A;  4G7Z C;  2O2L D;  1E1O A;  4UPA A;  3PZC A;  3EBE A;  4ZAI A;  3C1F A;  1A3V A;  1ESF A;  3CQZ H;  1VQN A;  3ERQ A;  2YTV A;  1EIY B;  3MXG A;  2C8M A;  5D3I B;  3S14 H;  1UE7 A;  4BXX H;  1XNR L;  3L4G B;  3PCO B;  2I5H A;  4G85 A;  3PUX A;  1U4M A;  1JWM D;  1NNX A;  2RKS A;  3HOZ B;  1YB3 A;  1T5X D;  2KCM A;  1JC7 A;  3DM3 A;  1Q1B A;  2N55 A;  2QKI C;  1O7Z A;  1S40 A;  4R9W A;  2DVE A;  2UXC L;  4H2X B;  3D3R A;  3D4R A;  3A55 A;  1DOL A;  4KJN A;  2K5D A;  5KRU A;  3J81 j;  1Y8N B;  4TSS A;  4K2K A;  1MBY A;  4CS4 A;  3TDQ A;  1WCM G;  3VQY A;  4DV1 L;  4OO1 G;  2ZNI A;  2RA4 A;  3LSQ A;  2D0P A;  3FKI G;  5GAH C;  2G5D A;  3H0G B;  3TME A;  4A3G G;  1T5E A;  1WQ7 A;  2IY5 A;  3TQY A;  1HNX Q;  3J80 E;  2L9H A;  3HFV A;  4K87 A;  3UH0 A;  1PYW D;  1NR2 A;  4YRR A;  1SRU A;  1F2Z A;  1LAC A;  1I4H A;  1I4G A;  3S1Q H;  2EYL A;  3CMA A;  2EY6 A;  1TWC B;  1Y1V G;  4XTX A;  2E2D C;  2OT2 A;  3GO5 A;  4YRL A;  2H5X A;  1YIT A;  1YJW A;  3BDO A;  2C35 B;  4A3D G;  1IXR A;  1STA A;  1ESR A;  3VQX A;  3RLF A;  2FJ2 A;  3OIP A;  4RGT A;  2ZCE A;  1CTM A;  2Q5I A;  3EFS A;  2HCC A;  2F3W A;  2DXU A;  1HUM A;  3H3V C;  2R61 A;  3A7A B;  4ZYS A;  1U4L A;  4JOI A;  1GUG A;  3CQZ B;  3RUX A;  1YHB A;  4YRQ A;  3A8J E;  1EQV A;  1GUO A;  2AMC B;  1RTN A;  4YY3 L;  4XIG S;  2QGQ A;  1U5K A;  1EQT A;  2Q7H A;  2AWN A;  2SNM A;  2NZ1 D;  3RKW A;  1LM0 A;  2PZT A;  4OON A;  1Q82 C;  3BDC A;  4OGQ C;  1SAP A;  1KLG D;  1BCP D;  1H9S A;  2R6G A;  1SLJ A;  4CJ0 B;  4JPB W;  1N33 L;  2EXD A;  5FKA C;  3TZD A;  1QZH A;  4ALP A;  2ZXP A;  2R7Z B;  1HNZ L;  5T1G A;  1XXG A;  4MIU A;  1A62 A;  2D5D A;  1JQY D;  2UUC L;  1HCZ A;  3I4N B;  3CU7 A;  3DSQ A;  1E2W A;  1E1T A;  1EY4 A;  3I91 A;  5IOC A;  5IT9 L;  4NCX A;  2MHV A;  5M3F H;  2KCN A;  4QF4 A;  2F0P A;  4R4Q A;  3TP7 A;  4DNI A;  2CW0 D;  4A3D B;  2SOB A;  1C48 A;  1TWC H;  4PV1 C;  1DCZ A;  2UXD Q;  1PYS A;  1B53 A;  2EVB A;  2K50 A;  4POF A;  3UFG A;  2DTI A;  1Z47 A;  4X3T A;  4BY1 G;  1KLU D;  1SET A;  1YNN D;  4ID6 A;  4GKJ Q;  3T1Y Q;  4YRP A;  2IX1 A;  2CQO A;  4BWA A;  4XQJ A;  4POG A;  2ZTC A;  4K88 A;  3SDZ A;  4KR3 A;  2OEO A;  2Z6B A;  4CH4 A;  1PH3 A;  3GTM B;  3H0G G;  4A3G B;  4IUN A;  4IQZ A;  5FO8 B;  1G5H A;  1QWY A;  3KLR A;  3U4Z A;  2O4X A;  5C5L A;  3HOW G;  1HR0 Q;  3S2D H;  4LF7 Q;  4F87 A;  2B2Y A;  3EJI A;  1VQ9 A;  3V2T A;  3KDF B;  3L9A X;  1HHV A;  3PO3 B;  2CJB A;  3AEV A;  3S1R B;  2UUB Q;  3CF5 A;  4KQE A;  1BQQ T;  1WVL A;  3I4N H;  3NSW A;  3ZJY C;  2R7Z G;  3NQT A;  3U9O A;  1I4R A;  2ZT6 A;  3EVQ A;  2CIM A;  2L55 A;  3Q24 A;  4HJA A;  4LVK A;  2R7D A;  3A7R A;  1FJG L;  1SYB A;  1XTD A;  2WII B;  5IP9 G;  2CJ9 A;  3QIA A;  2ID0 A;  4DV7 Q;  5IT9 E;  4BBS H;  1G6P A;  4DUZ Q;  1SNP A;  1I94 Q;  1FYC A;  3GTK B;  4A3J H;  1HR0 L;  4HJ9 A;  4JI1 L;  1BCP C;  2X6G A;  4ZCK A;  2EY1 A;  3JAM c;  4B3M Q;  3FJP A;  4JYA Q;  5E4X A;  1VQ7 A;  4YCV A;  2L15 A;  1F2L A;  3A5U A;  4IFD I;  1SRO A;  4AYB B;  1B3A A;  3DMU A;  4GKJ L;  2V1C C;  3RD4 A;  4DV7 L;  3MFY A;  2HDL A;  4HID A;  2OQK A;  4IFD J;  1IBM Q;  1B3Q A;  3C1E A;  4RMF A;  1J8I A;  1ADJ A;  4N8F A;  5K5P A;  3PF4 A;  1UAP A;  3CCE A;  1I6H H;  5DNF A;  2EQS A;  3HXW A;  1AW7 A;  4MTK A;  5M3F B;  4LVM A;  2N8N A;  1KAW A;  2E41 A;  4FXG C;  2MNA A;  1P8L A;  4DV6 L;  3S16 H;  4B9X A;  2DKG A;  5C6A A;  4C2M H;  3A5Z A;  4A3F B;  1M90 C;  4X3U A;  1HH2 P;  3ZYY X;  4QUF A;  4MHE A;  4A3F H;  4OX9 L;  4DA2 A;  2DU5 A;  5EBD A;  4DUY Q;  3ER0 A;  1B9M A;  1B1Z A;  3J81 c;  4KD3 A;  3K80 C;  1OXS C;  1UWV A;  2JA7 H;  1WTO A;  3QR8 A;  4JI7 Q;  4KHP L;  2TMP A;  3LGJ A;  4DV5 Q;  2PMZ E;  3Q8D A;  3GDE A;  5C4H A;  1D7Q A;  3M3Y H;  3PO2 G;  2RCN A;  4UP7 A;  3U9S A;  3MTS A;  3S1Q B;  4DR2 Q;  1GKH A;  4DV0 L;  1TVX A;  1ENC A;  1ASY A;  4HCS A;  1DZ1 A;  1SMY C;  3STB C;  3HXU A;  4WJ4 A;  1Z7T A;  2JJQ A;  5KNB A;  3KF8 B;  2F3I A;  1TQO A;  1PH7 A;  4XXE A;  4A4I A;  1JJG A;  1L1O A;  2B2T A;  3A0J A;  3SK4 A;  3URY A;  2K5H A;  2OQ0 A;  4DAM A;  1A0I A;  3FRP B;  3GTO B;  1BCP F;  3VQV A;  2JK8 A;  3OWE B;  1K3R A;  4IZ8 A;  3R07 A;  1JJC B;  2NB0 A;  4I65 A;  5FLX c;  5JJL A;  2ZGW A;  1TKW B;  2RHS B;  3JAM L;  3MQZ A;  4AQY Q;  2E8G A;  1L2F A;  1Y1W H;  4V19 0;  2N49 A;  1Z7N A;  4RCO A;  5JJI A;  3HOZ H;  3HOX H;  1TS2 A;  4GKK Q;  3AB9 A;  1MD2 D;  3MXU A;  5AJ3 L;  1UE1 A;  3H15 A;  4G84 A;  4BBR H;  3HOU G;  1Y14 B;  2DQ0 A;  3VYR A;  3KJO A;  2ZT7 A;  1SSO A;  1VQB A;  3D4W A;  2IPK D;  4DV2 Q;  2ZZF A;  5KND A;  2Z6K A;  1KMM A;  1TXY A;  1LAB A;  3BDL A;  2RHS A;  2Q7E A;  2XGT A;  4HJ7 A;  1E7Z A;  1GXD C;  4O1N A;  4DNT B;  1KDC A;  4DR4 L;  2F1M A;  3I72 A;  1K83 H;  2CH4 A;  2JA9 A;  4OO1 H;  4HCE A;  2Q2U A;  1TS4 A;  1STN A;  1XX8 A;  3E3X A;  4QJF A;  1S5D D;  1K8M A;  2J4X A;  5I6W A;  3HXX A;  4TVW A;  2LMC B;  3CCU A;  2N3S A;  5M9O A;  1HQR D;  1RIQ A;  4LJZ C;  1CQF A;  1HTL D;  1YFR A;  4OWW B;  4R1J A;  5E1F A;  2PQA B;  2ZXR A;  3I3C A;  1UEA B;  4LK1 C;  2ES2 A;  3S14 B;  1H9K A;  1LT4 D;  2F0N A;  2FMC A;  3U4V A;  5IP9 H;  4F7X A;  2ASB A;  1KAB A;  5IGB A;  2ZIO A;  2DNE A;  2KEN A;  5CGK A;  1OXX K;  1Q81 C;  5DAU A;  1UE6 A;  5C0X G;  4KN4 C;  3P8T A;  4C1N K;  1SNQ A;  3R8B A;  1JOO A;  4IFD G;  2K5Q A;  4MN3 A;  2A6H C;  1B70 A;  4HN7 A;  3VR4 A;  1RJT A;  4C2M B;  4LF8 L;  3T51 B;  2XRS D;  2L11 A;  1CA6 A;  4HWR A;  3QO2 A;  4FVM A;  4ULL A;  4GLA C;  2Q7G A;  3U50 C;  2K5V A;  4JYA L;  3CW2 C;  4C3H B;  4LF4 Q;  4YRE A;  1TWH B;  1L1O C;  2B2T C;  1PH1 A;  2R93 H;  1OXV A;  1YZ6 A;  3GQB A;  5CV7 A;  5FO7 B;  3S15 B;  1C0A A;  3DEP A;  4KY5 A;  4X3S A;  4DUZ L;  1XMQ Q;  5E3F A;  3HOY H;  1ILP A;  3P75 A;  1OTC A;  2EYF A;  1HTT A;  1PFM A;  4A3E B;  1CA5 A;  3WQZ A;  1GHJ A;  1GM5 A;  4XTC S;  1IZ6 A;  2EY5 A;  3FPU B;  1WNL A;  2ZT8 A;  1SXT A;  2D0O A;  1BF4 A;  4DXG A;  2XRQ D;  2WKC A;  1BVS A;  4FF3 A;  2HUG A;  4RKL A;  5IGD A;  2E2H H;  2J0T D;  3PUV A;  1RIP A;  2L4N A;  4JW0 A;  4PMW A;  4NXM L;  4ZTU B;  5C44 H;  4Y7N H;  1S4Z A;  3C46 A;  4DV3 Q;  4K0K Q;  2JEB I;  4JI6 L;  2EYM A;  2O5I C;  4G7O C;  3F8T A;  2DTH A;  1YEZ A;  2EYJ A;  2SEB D;  4ODG A;  3T56 B;  2JSO A;  2ZJQ A;  2UXB Q;  3HFZ B;  5JVH 3;  3CCS A;  3IAL A;  4LUV A;  4FO2 A;  1AE2 A;  3IAY A;  4LF7 L;  1YGB A;  4GS3 A;  4K6D A;  3ITP A;  4IUT A;  3HY1 A;  5M5X B;  4HJ5 A;  2EE1 A;  1KOG A;  1PZI D;  4X3K A;  3HOY G;  5IIF A;  5LMN L;  3D31 A;  3NBI A;  2ZM6 Q;  2E64 A;  4IPC A;  3GTL B;  3A32 A;  2QHT A;  4IPG A;  3HFZ A;  4TQU S;  3M4O H;  4IOA A;  3BS1 A;  3V7S A;  4A3C H;  1H9J A;  1I3Q H;  4X64 L;  3QNE A;  3BU2 A;  2VUM G;  1L0X B;  1PFS A;  1STG A;  1NE3 A;  2I5M X;  2UU9 Q;  4QUC A;  3OIQ A;  1FJG Q;  4YRC A;  1VQ4 A;  4JI6 Q;  4A3G H;  1EY0 A;  4HMI A;  1H95 A;  2IT1 A;  5IYD H;  1VQP A;  4L5T A;  4XTZ A;  1Q8K A;  4P71 A;  1EFW A;  1PVO A;  3TEH A;  1CKM A;  1TWG H;  3NEL A;  4C1N I;  3OSO A;  1XYI A;  1VMP A;  1PMR A;  2RBM A;  2NVX B;  1LUZ A;  2NZO A;  4DR3 L;  1MHW C;  3FVQ A;  4P71 C;  4I7Z C;  3VYU A;  2JA6 B;  4XU2 A;  1IW7 C;  4LNS A;  3GTQ H;  1RKN A;  4XTU A;  4DR4 Q;  1SYG A;  5JJK A;  1EVL A;  1CQV A;  4KR2 A;  1EEI D;  2BDN A;  1EY8 A;  1N36 Q;  2A8E A;  3W1G A;  3I90 A;  3J7A V;  3RLO A;  2ODR D;  1N32 Q;  4NDX A;  5EAY A;  1E2V A;  1S5B D;  5E4W C;  3K59 A;  2CGH A;  4A3I H;  1LTB D;  1NSN S;  4BY7 H;  4X66 Q;  4A3F G;  1EU4 A;  2OWO A;  4HWO A;  2K32 A;  2PI2 A;  4GKK L;  3IG2 A;  4CDE C;  1BBW A;  1FD7 D;  2F52 A;  1NJ8 A;  4PMC A;  5KGU A;  1LO5 D;  1EY6 A;  3TS0 A;  1E3P A;  2B2W A;  5IGG A;  1SE3 A;  3R2T A;  3S15 H;  2DUD A;  4YRJ A;  1XPO A;  1OO9 B;  4YRK A;  4XTY A;  3MWY W;  3BYT B;  3RAC A;  4ME5 A;  2Q8I B;  1SND A;  4RGM A;  1VQK A;  1EOV A;  5M3M B;  4C56 C;  1SES A;  1LTL A;  3L7Z C;  3J81 E;  3RL6 A;  2B2Y C;  2EYP A;  3RZD H;  4EQO A;  4OLF A;  1A6X A;  4NW2 A;  4KMU C;  5DM7 3;  1SN8 A;  3SK8 A;  4TWA A;  2RCF A;  3T1H L;  1QG7 A;  3HEJ A;  1R4Q B;  5E3I A;  2EJF A;  4FF4 A;  2ENB A;  1KXL A;  4LVJ A;  1CKO A;  2NBF A;  5CR3 A;  4X66 L;  3H94 A;  4GOP C;  1K0S A;  3G4S A;  2K1B A;  1HC7 A;  4F8M A;  3PIO 3;  2JA6 G;  1I5F A;  5EGT A;  1D6E C;  2HD3 A;  4X65 Q;  1ASZ A;  5GAE C;  4IUQ A;  4ZKB B;  2ZZG A;  3RKY A;  1HFG A;  3PIP 3;  1WD0 A;  4BY1 H;  1AZQ A;  4J8Q A;  4GN4 B;  3X3M A;  1I94 L;  3P1H A;  2HHH Q;  2AQ2 B;  5DEH A;  3DM1 A;  5KNN A;  4XT1 B;  1IKL A;  3L2P A;  4LF6 L;  3RZO B;  2L12 A;  2AMC A;  3HXZ A;  3HOW H;  4CHT B;  4P74 C;  2PPB C;  2ZIN A;  1L1O B;  3C2P A;  4A3B H;  5GQO A;  5M3M H;  2IWH A;  1SYD A;  1X3G A;  4KJO A;  3S2H B;  5EPJ A;  3HOV G;  4N9T A;  3CKI B;  3I73 A;  2FMM A;  5EPK A;  5CV9 A;  3AMU A;  4Y52 H;  1X3E A;  4GOP B;  1EL0 A;  1HA6 A;  1X65 A;  3RN2 A;  1PA6 A;  4OWT B;  3GTK H;  3NTK A;  3M85 A;  1K8G A;  1IKM A;  4S3S A;  2A6E C;  5I4D A;  4R4I A;  3K58 A;  4JI0 Q;  2G4C A;  4RQE A;  4YP0 A;  3CCR A;  1F9R A;  3J7Z C;  1NYQ A;  3KLS A;  1O78 A;  4KKU A;  2FFK B;  3PF5 A;  4BS9 A;  5LMN Q;  1GHK A;  4A93 G;  4FXK C;  4YWL A;  1GOZ A;  1PH8 A;  4DR1 Q;  3KDF A;  2JA5 G;  2FYK A;  2ZR3 A;  2OCE A;  1EVK A;  4JBM A;  3AQQ A;  4OHJ A;  2KHI A;  3S1R H;  2XIW A;  3SE0 A;  3GTQ B;  4JK1 C;  2ZJP A;  1TS5 A;  2NN6 H;  2K7V A;  4JBJ A;  4ZRZ A;  1V43 A;  3PSI A;  3MF1 A;  5C53 B;  2VW9 A;  4LMQ D;  2K5W A;  1SFO H;  4L8J A;  4YRF A;  1Y1V H;  1R9T H;  2PMZ B;  4H2T A;  1KNE A;  5CV8 A;  3H3V I;  1BR9 A;  1CFM A;  4KY6 A;  3K7A H;  4M8A A;  1ZEQ X;  1A3U A;  3A7L A;  2OTL A;  1XNQ Q;  1NJ2 A;  4LF9 L;  1SBB B;  3BZK A;  2RDG A;  2H4O A;  3R2I A;  4P2C B;  5H1S E;  3DHQ A;  4DR1 L;  1KAA A;  3Q0A A;  2LS0 1;  2HQE A;  1KMN A;  1HQM C;  2I4M A;  3T4A C;  1S5F D;  4AIM A;  3WOE A;  4JI0 L;  2Q8R E;  1IBL Q;  3L1A A;  2WFW A;  4YRN A;  2DGY A;  2B8G A;  5AFW A;  1Y8O B;  3I4O A;  1BBX C;  3GTM H;  2LXK A;  3T16 A;  1DJR D;  2LXJ A;  2MQH A;  4JI8 Q;  3W3S A;  2I4O A;  2BA0 A;  3MA2 B;  4XU0 A;  2VS1 A;  1SEB D;  4GZY C;  2KUM A;  1HNW L;  1TWH H;  3KF6 B;  1LTR D;  1HFN A;  2PI2 E;  3P8Y A;  1BCP B;  1NTG A;  3FHW A;  2VUM H;  1SE2 A;  3AYH B;  2BDO A;  3NTI A;  3A7A A;  3HG9 A;  2A6E D;  1U0L A;  5FLX L;  3LX0 A;  1VQG A;  2AWO A;  2MP1 A;  3GTO H;  2KCC A;  1V1P B;  4C3J B;  1N33 Q;  2QHU A;  2WAC A;  2Q5H A;  5BR8 Q;  5IGE A;  2F0T A;  1X2G A;  1QNU A;  5JEA G;  4DR7 L;  2ICI A;  4R4O A;  4A3E G;  4DQ2 A;  3HOX G;  2F0F A;  2EIF A;  4DV5 L;  2NN6 I;  1EIH A;  5HY6 A;  1ICW A;  1LV9 A;  1LT3 D;  3E0J A;  2NVY H;  3K5L A;  2YU9 B;  1KNA A;  1ZKO A;  5EKL A;  5EKK A;  4QIW E;  1FNW A;  2E1H A;  4YRO A;  2BE5 D;  3GTP B;  3ULJ A;  3QTC A;  4O2D A;  1IL8 A;  4L6T B;  4ILW A;  1LTS D;  3FP9 A;  3KJP A;  1TY0 A;  5IWA Q;  1VQ5 A;  1NJ5 A;  2RSN A;  2QDB A;  3RF1 A;  1HJP A;  1D5M C;  3L2Z A;  4N9P A;  3JC6 6;  1SYE A;  2VXW A;  3SXH A;  5I2X A;  4JBW A;  3D6C A;  4R8I A;  3OYY A;  3KLW A;  2YTY A;  5KNC A;  3NBH A;  1XNR Q;  1H4T A;  5ELF A;  2KEC A;  4XYO A;  2KCT A;  4EGV A;  4DAP A;  3L0O A;  1DM0 B;  2A5H A;  5D3D A;  1E22 A;  1JWU D;  3NET A;  1DD2 A;  1H4V B;  1I3Q B;  2F0M A;  1L0Y B;  2JN4 A;  4HMJ A;  1VQO A;  3MEF A;  1EUJ A;  3HOX B;  3M4Y A;  3E9I A;  3TP8 A;  4P73 A;  3K5M A;  2ZZE A;  4A76 A;  1IHZ A;  4A3D H;  1Y1V B;  1R9T B;  1VQ6 A;  1FNU A;  1FNV A;  3GTG H;  2M9V A;  2F0S A;  4M1U B;  4BBR G;  3PMF A;  4TTV A;  2ZM6 L;  4JI2 L;  4K5X A;  4A3J G;  1DXM A;  2KHJ A;  4KHP Q;  2JA5 H;  4P75 A;  4XU1 A;  3JAM E;  4DPG A;  1TWA H;  3NXW A;  4CJ1 B;  1N8R C;  3KK7 A;  4LF5 L;  2Z4I A;  3Q22 A;  2E2I H;  5DM6 3;  1YVC A;  1IBK Q;  2E10 A;  3AU7 A;  3FEW X;  2L5T A;  3G6E A;  2JXM B;  5M5Y B;  5JVG 3;  5CBA E;  4HR7 B;  4H44 C;  2EOT A;  1I6V C;  2F0Q A;  2JEA I;  2E5A A;  4L87 A;  3VA5 A;  3M7N A;  1HXD A;  1K8O A;  4KTA A;  2QW7 A;  4R8N A;  1DOM A;  1I4X A;  2RHQ B;  5EBC A;  3RMH A;  3ICE A;  1UE5 A;  2F4V L;  1RDP D;  3AFQ A;  1D2B A;  1ET6 A;  2F0K A;  3JAM i;  4AYB G;  1W6K A;  3UGQ A;  5C5M A;  3HXV A;  5IGC A;  1EU3 A;  4YCU A;  1HA5 A;  2F0W A;  4PZ8 A;  5JJZ A;  2E2J H;  3Q23 A;  3S1N B;  4P74 A;  1HTP A;  2SDF A;  2WAQ G;  3DWA A;  1EQR A;  5EJW A;  1NMG A;  4JBK A;  5J39 A;  3M9B A;  1IBM L;  3CP0 A;  4B3S Q;  5E7N A;  3EIV A;  1EYA A;  5CMD A;  4DV1 Q;  1M8A A;  1BO0 A;  1RTO A;  1WI5 A;  1J9O A;  5EPL A;  2P0L A;  1AEX A;  3GP7 A;  4RHS A;  3V8L A;  3DUZ A;  2KVM A;  2PNH A;  1JJC A;  2EJF C;  2KEE A;  4LUZ A;  2PZW A;  1FGU A;  4Q5V A;  2B2U C;  1KD1 C;  3V96 A;  3GTL H;  1B7Y A;  2Z9H A;  1F2Y A;  4P75 C;  1Y1W G;  5TSS A;  1XNQ L;  5ELO A;  5HUR A;  4OIJ A;  4TVY A;  1B70 B;  3SHL A;  5C3E H;  3UDI A;  3BVZ A;  1EYG A;  5G3L F;  1Q8I A;  2K28 A;  2EJG C;  5JPN C;  4RFB A;  3UE1 A;  2EZV A;  5FLM H;  2G9D A;  3CPW A;  3J7A 5;  3A8I E;  2A1A A;  5FLM G;  4NXM Q;  2ZXF A;  2A74 C;  3TP6 A;  4WFN 3;  4CGY B;  5HGT A;  4KK7 A;  4J15 A;  4YWM A;  1PRT C;  5JOB A;  3P8V A;  3IFT A;  1PTO H;  2RDF A;  2WP8 J;  2ZTE A;  4QMG A;  3R93 A;  2E5L L;  3REU A;  1O7L A;  4OEL B;  4HA8 A;  4P73 C;  1EIF A;  2AUJ D;  4YHH Q;  1FL0 A;  2R92 G;  1JB3 A;  1SNO A;  1JMC A;  3K6O A;  3K5N A;  5IYC G;  2EYO A;  2K4K A;  4A3K B;  1B4O A;  1DGS A;  4PNY A;  1A8V A;  1VQE A;  2KJX A;  3VBB A;  1J5W A;  5CV5 A;  2K6A A;  2HIV A;  1W66 A;  3GTJ H;  3A8K E;  4KHZ A;  3HOU H;  2O5J C;  3TRE A;  1J6Q A;  3NP8 A;  2X6L A;  1LTI D;  2FHT A;  1Q12 A;  3O13 A;  4JI5 L;  2F3V A;  1Y1W B;  5C4X B;  2E75 C;  3SGI A;  3UDX A;  4C3H G;  5FLX E;  2E74 C;  3T1H Q;  5ELC A;  1QJO A;  1WJJ A;  2EPB A;  1LT6 D;  2VZA A;  1K3B C;  2MUY A;  3RR5 A;  1SE8 A;  4JCV E;  1QE6 A;  1EIG A;  1QNK A;  1N34 Q;  1GUT A;  5C0X J;  1Q3L A;  5K36 G;  2WAQ E;  4NMZ A;  2F4V Q;  3IRB A;  3A74 A;  5IYD G;  1KTK A;  2J7Z A;  2B63 B;  4RQF A;  2NVQ H;  2CWP A;  4A3K H;  1LLR D;  4LWC A;  3PO2 H;  2F0E A;  2NS6 A;  4GN5 A;  1M4V A;  4YDQ A;  2DXT A;  1HNZ Q;  3V05 A;  4YIJ A;  4IUP A;  4J1M A;  3VQW A;  4WJW A;  1OXU A;  1EYC A;  3F2B A;  5C4J B;  1KHI A;  1O7I A;  1Q86 C;  2AUK A;  2NVX H;  2MPM A;  3I55 A;  2EXZ A;  4QGU A;  3S1M B;  3BG3 A;  4RG1 A;  1ATI A;  5M5Y H;  1WTV A;  2CJA A;  2F03 A;  3ERR A;  3RZO H;  3PGZ A;  1GVP A;  4GN3 B;  1BXT A;  3RNU A;  2NWG A;  2EJG A;  3V8K A;  1CSP A;  1W2B A;  1K28 A;  4HSP A;  1X01 A;  1PV4 A;  3CC7 A;  2WIN B;  2Y0S B;  4EVO A;  4QQB X;  4ZUJ A;  3ONA B;  4IPH A;  3HKZ G;  2A6H D;  4PZ6 A;  2A68 C;  5LL6 X;  1JIC A;  3F1Z A;  3PUZ A;  4LVI A;  4NXN L;  1WTR A;  4YRM A;  2F0I A;  3X3N A;  3P7J A;  5IE8 A;  1U9R A;  2HIX A;  3OTO L;  3REX A;  4IUU A;  2K52 A;  1KDA A;  4RGO S;  2F0U A;  4BY7 B;  12AS A;  2VQF L;  3KUP A;  1YBY A;  3TP5 A;  3L4G A;  3N52 A;  2VY3 A;  1K73 C;  3K7U C;  1NJI C;  3QO7 A;  2MO0 A;  3WOF A;  2I07 B;  4CKB A;  4QB4 A;  4BW9 A;  4GNX B;  1QVC A;  1B8A A;  1MJE A;  1XPR A;  2HQL A;  3S1M H;  4P3P A;  1HXY D;  1AN8 A;  4CS2 A;  3KBX A;  3QJY A;  4IN3 A;  5C44 B;  4HT4 A;  2JA6 H;  1N32 L;  4H2U A;  2K03 A;  2DN8 A;  3M3Y B;  4BA2 I;  5AJ3 Q;  5LMU Q;  3GV6 A;  4N8X 1;  2RSO A;  4E51 A;  3F2C A;  5CV6 A;  4IUR A;  1P16 A;  3IFD A;  1QCB D;  1A2U A;  3LSS A;  4CH5 A;  4KI0 A;  3N6R A;  3KF8 A;  3H0G H;  3I8Z A;  1JOK A;  3NEM A;  3LNN A;  3MFG A;  2DY8 A;  2EL9 A;  1FYF A;  1PZJ D;  2EDG A;  4RKB A;  3UI2 A;  1NBW A;  3G6J B;  5ELN A;  3PIP A;  1VQF A;  4XQN A;  3OPO A;  3HXY A;  3HRK A;  5T1I A;  5C51 B;  4PQX A;  3QOL A;  1JWS D;  4IOC A;  4X62 Q;  1A15 A;  3WDN A;  4ZIB A;  2E76 C;  4DR2 L;  3FPP A;  1JR0 D;  3HZX A;  5JPM C;  1YNX A;  5IYC H;  1ET9 A;  1V1O A;  5HGQ A;  1H9R A;  1PLF A;  2I5L X;  1Z9F A;  4DV4 L;  4XEM A;  3NPP A;  4B3M L;  1S3O A;  1YHA A;  2F0L A;  1KC8 C;  1PTO F;  1WCM B;  2BCO A;  3UGT A;  2F0H A;  1AFP A;  1DON A;  3CRK C;  1NJ6 A;  1S5C D;  3CPF A;  2DJG C;  2KA7 A;  5EKI A;  2A68 D;  2DJZ A;  5C52 B;  1QE0 A;  1JB7 A;  1E2Z A;  2E65 A;  3TUP A;  3J81 L;  2IY5 B;  1IW7 D;  4DGZ A;  2XWB B;  1GUW A;  5C4J H;  1VS0 A;  2E2H B;  4UAI A;  1R4P B;  4LAA A;  1WTQ A;  5K36 H;  2CQA A;  1EZ6 A;  3BVG A;  1EIY A;  5A35 A;  1U4P A;  4ZKC B;  2Z8L A;  1PXU A;  3OWF A;  1WTX A;  3OW2 A;  2DNC A;  1C9O A;  3QO5 A;  3T13 A;  4DAY B;  2CVR A;  1SJH D;  1WTW A;  4KLK A;  2UUB L;  1HRJ A;  1PH9 A;  2ART A;  2R93 B;  3I4M G;  5FK9 C;  4LFB L;  2VL6 A;  1PH4 A;  2OXP A;  2R3Z A;  2VQE Q;  2UUA Q;  1II3 A;  5D65 A;  2I46 A;  3V7R A;  4DK3 C;  3K0X A;  4FF1 A;  4DFA A;  4LNQ A;  2VQE L;  2UUA L;  3T1Y L;  1X6O A;  4B9W A;  4Q15 A;  1QVG A;  4DV4 Q;  2ATW A;  2E2J B;  2AQ1 B;  5IT9 c;  4X62 L;  3G7L A;  3HOY B;  4YYE A;  1D5Z C;  1G29 1;  2K14 A;  3BJU A;  4WRD A;  2ZT9 C;  1J5E Q;  3EQL C;  4DNR B;  4EX5 A;  2C9O A;  3GTG B;  1H4Q A;  1VQC A;  1JJ2 A;  4QCL A;  2ZJR A;  1DYQ A;  2CW0 C;  4A93 H;  3HKS A;  1X3F A;  11AS A;  4C3H H;  1FR3 A;  4B3R Q;  4OO1 I;  3J7A F;  2A69 C;  1E24 A;  1WCM H;  3HOV B;  1B44 D;  1MJC A;  3M7G A;  2OTJ A;  5KYI A;  4GLX A;  1PH5 A;  4CDD C;  1RCV D;  3MXN A;  1UEB A;  3QG1 A;  1LTT D;  3VR5 A;  2ALY A;  1TWA B;  4KD4 A;  2HHH L;  1LTG D;  3PCO A;  3FKI H;  1QUQ B;  2NN6 G;  4KKS A;  2NZH A;  2RDH A;  1BIB A;  1B76 A;  2DY7 A;  5K1P A;  3C3L A;  3I2Z A;  4H0L C;  2DDZ A;  2DJF C;  5CYU A;  4BA1 I;  4DR5 Q;  3HOZ G;  3A7U A;  1B9N A;  4K5V A;  1EZ8 A;  3EFR A;  1ENF A;  3AFP A;  4DKA C;  2FIN B;  5IYB G;  4AQY L;  2LFN A;  3A54 A;  4IJH A;  2D2C C;  4Z9C B;  5ELD A;  2XVS A;  2WB1 E;  2EYH A;  5L37 A;  3D0F A;  2ALY B;  3MXN B;  4MNO A;  2RVL A;  2KQ3 A;  1D8L A;  1PZK D;  1BNZ A;  4H2V A;  1VQJ A;  1C8C A;  1FGB D;  1Z6H A;  3RN5 A;  5C4X G;  4JI3 L;  2DZC A;  1TWF H;  3M4P A;  1VQA A;  1EWH A;  4CDF C;  5KIX A;  1CKN A;  1PTO D;  3CXC A;  3NQI A;  1D5X C;  2B2U A;  2B8F A;  2XNA C;  2JA7 B;  2BA1 A;  1X2H A;  4IUV A;  3BZD B;  3A5Y A;  3CMQ A;  3G1Z A;  3CCL A;  4HVC A;  4DF7 A;  4LFA Q;  4H7B A;  1QZG A;  1MIU A;  1O7Y A;  3J80 c;  3ERO A;  2QHV A;  4YRS A;  1G6Z A;  4K8J A;  4A3B B;  3LWU A;  4ZUI A;  2IJ0 A;  4DK0 A;  1JOR A;  5NUC A;  4LFA L;  1GGM A;  1Z7M A;  3BZC A;  1YFT A;  3EA6 A;  4R4C A;  5M3F G;  3TS2 A;  4JI1 Q;  2JA8 B;  5BR8 L;  2MJ8 A;  5IP7 H;  2P5Z X;  5K1X A;  2WB1 B;  3OTO Q;  3W1B A;  3S17 H;  2BH2 A;  4JI3 Q;  5JEA H;  1SNM A;  2EAY A;  1USY A;  1X9N A;  1V8Q A;  1ROD A;  1G8Z D;  1PRT B;  3OMC A;  2JA7 G;  2AHO B;  2A69 D;  2G9H D;  4K6L A;  1JT8 A;  4CKC A;  1WPY A;  3K7A B;  3P20 A;  2FXQ A;  5C3E G;  3UDF A;  1SER A;  1VQM A;  3G48 A;  4NB3 A;  5C0X I;  4QIW B;  3OOC A;  3I4M H;  1XTC D;  4CDC C;  5M5X H;  4C3I G;  3V7C A;  4JOI C;  1HNX L;  1D1K A;  2LY7 A;  2DTO A;  1STB A;  4OP0 A;  3MZ5 A;  4L63 B;  1EQQ A;  2B63 G;  4A3C G;  2UU9 L;  1EY5 A;  3H91 A;  4HIO A;  4B08 A;  5M5W H;  1CSQ A;  3VR2 A;  1A3T A;  3TSS A;  4DR5 L;  3H09 A;  2Q2I A;  1H9S B;  3GTP H;  4YWK A;  5GRO A;  1SR3 A;  2PW5 A;  3CC2 A;  3UDG A;  1UUP A;  2WAQ B;  3GTJ B;  3D4D A;  4IPD A;  3H3V H;  2VNU D;  3NBH B;  1I50 B;  4ME3 A;  2ODR C;  3VR3 A;  4HAE A;  3PO2 B;  1TU2 B;  4U67 3;  4WOR A;  2R7Z H;  4HWS A;  2QIL A;  5GAG C;  4DN4 M;  4RH6 A;  2Z6K C;  1CZW A;  2SNS A;  1YI2 A;  4B3S L;  1SYF A;  4R4T A;  4HSV A;  4I7A A;  1HPC A;  1ZXT A;  2B39 A;  1K9M C;  3PUY A;  5A2Q E;  1IYU A;  1VF7 A;  4G4K A;  4A3M H;  1VQD A;  2NUC A;  1SNC A;  1SYC A;  5LMN W;  2Q2T A;  3PO3 G;  4BBS G;  2DEQ A;  5F2D A;  4WI1 A;  3PO3 H;  1PTO C;  4AYB E;  1NNH A;  4LVL A;  1AP0 A;  2JA8 G;  3S2H H;  1J5E L;  4QY7 A;  3WWV A;  4A3L G;  1NYR A;  1SJE D;  1TS3 A;  4Y7N B;  1YJN A;  3KFU A;  1VDZ A;  2N88 A;  3CCJ A;  2I4N A;  1LYL A;  2D9U A;  5A2Q L;  4A3J B;  3L3O C;  3K57 A;  2PME A;  3I56 A;  2IHF A;  2B29 A;  3MEY A;  1IBK L;  4RCN A;  2QCP X;  2ARU A;  4PZ7 A;  4TVA A;  2J3M A;  1X55 A;  2V4D A;  5C3W A;  5LMU L;  4FXD A;  1VF5 C;  4O0A A;  2F0V A;  4LF4 L;  2RQX A;  1EWC A;  1AZP A;  1ILQ A;  2HT1 A;  3PIO A;  1CKN B;  3PQI A;  3S24 A;  3A31 A;  4TQD A;  3RUZ A;  1HZA A;  3E0E A;  5C0X H;  4AH6 A;  2L0C A;  4L5S A;  1K8A C;  4LFB Q;  3HP3 A;  3S17 B;  4PG3 A;  4UHV A;  1CHQ D;  1XMO L;  4KV6 A;  4DK1 A;  5JAV A;  3E5S A;  1G2T A;  2Q2H A;  1EWI A;  3Q6S A;  5IOD A;  2ARS A;  1GD7 A;  1HZB A;  5BN5 A;  1BKB A;  1B7Y B;  2F0J A;  1PH6 A;  4HJ8 A;  2Q8T A;  1U4R A;  4P3N A;  4FYD A;  4APV A;  1Q90 A;  3OD1 A;  1MSG A;  3CD6 A;  4XU3 A;  2ZT5 A;  4FNF A;  4LF6 Q;  1TY2 A;  2Z4H A;  4XT3 B;  3F2U A;  2Z0S A;  2Z1C A;  3MEH A;  1QF6 A;  1QUQ A;  2BOS A;  4NKL A;  2K5N A;  5I2Y A;  1BOS A;  2E2I B;  2N78 A;  2WV6 D;  3D6W A;  3IKM B;  1ONL A;  3CHB D;  4XQQ A;  3LC0 A;  4JI7 L;  1D1I A;  1S5E D;  2JA5 B;  4TQF A;  1NAP A;  3NUC A;  3HOW B;  2NTS A;  3HY0 A;  5M3M G;  4E6I A;  5IP7 G;  3NHH A;  4DK6 C;  1NJ1 A;  2HCI A;  1N36 L;  4DUY L;  1G2S A;  4JG2 A;  4KKT A;  4EQP A;  1KRS A;  3RGL A;  4BBR B;  3HKZ B;  1SRY A;  4BY1 B;  4YCW A;  2KED A;  1VCI A;  2QDL A;  2C5C A;  4RAU C;  1PH2 A;  1HUN A;  1STY A;  4YRG A;  2X69 A;  2YV5 A;  3NE5 B;  1VQL A;  4NXN Q;  5IYB H;  3FKI B;  2E3C A;  2IX3 A;  1Q7Y C;  1E0B A;  3KF6 A;  4P72 C;  2MGS A;  5I9O A;  4L5R C;  2CCZ A;  3KLS X;  3SK6 A;  4KHV A;  4CBV A;  1V1Q A;  5IWA L;  1BIA A;  2QEX A;  2M2L A;  3EN2 A;  3CCQ A;  4A3I B;  4X64 Q;  2AKW B;  4H2S A;  2A19 A;  3F2D A;  4G7H C;  3HRI A;  3BFM A;  5GAD C;  1KIX A;  3MC0 B;  4HTH A;  3HOV H;  3IKJ A;  2A73 B;  1X3Q A;  3CCM A;  4DV2 L;  2DZ9 A;  1G5I A;  2ZR2 A;  1NR4 A;  3MVV A;  2UXC Q;  5IGF A;  3QB3 A;  1PRT D;  3RLN A;  5F5W A;  4DAY A;  4WJ3 M;  1SMX A;  2ZNJ A;  1SFO B;  2H1E A;  3VYS A;  4DR3 Q;  4KN7 C;  3HKZ E;  4CJ2 C;  3HGB A;  3W5O A;  2E5L Q;  1QIL A;  1BDO A;  1C4Q A;  1K83 B;  2PCF B;  1USY C;  3NK9 A;  5DLQ E;  4PHC A;  3FMC A;  3RZD B;  4BY7 G;  4B3R L;  3M4Q A;  1JCK B;  3K8A A;  1JE4 A;  4CKE A;  1WU7 A;  3A5Z B;  1PHJ A;  2PO4 A;  1STE A;  3TZU A;  1MSH A;  1N34 L;  3BVM A;  4X5O A;  1L0W A;  4J6H A;  1VMC A;  1MKH A;  4JI4 L;  4HWT A;  4IJL A;  3S1N H;  1ENA A;  1ZYR C;  2GN5 A;  4A3K G;  4JI5 Q;  4XTV A;  4K2L A;  2NVQ B;  5CBE E;  5FJ8 G;  3HTZ A;  4XYQ A;  1SDF A;  3DWQ A;  5FJ8 H;  3T53 B;  2EWN A;  3QWN A;  4C3J H;  1BUV T;  4XEO A;  3I7F A;  4PMB A;  4MZ9 A;  4CH3 A;  3DXJ C;  3NEN A;  2AQ3 B;  2K75 A;  4UDU C;  2PW7 A;  2UXB L;  2LSS A;  3TEG A;  4UY8 C;  1CT1 D;  2JQO A;  4LFC Q;  3CAM A;  3GV3 A;  3CME A;  4JVZ A;  4DV6 Q;  4GOP A;  2M00 A;  1JE5 A;  2PYK A;  1PYB A;  2XN9 C;  2BE5 C;  3I4N G;  2IX0 A;  2R92 H;  3QOJ A;  2ZIM A;  2GA4 B;  4UP8 A;  4BXX G;  4NP5 A;  4EQ5 A;  1PFN A;  3DLL A;  4RHR A;  3I4M B;  1XMO Q;  3CCV A;  4ABN A;  5J1Z A;  2NYZ D;  3VA7 A;  1OXT A;  5IY0 A;  4RWS C;  3E6Z X;  2J3L A;  3NWS A;  3BYY B;  1IBL L;  3I4L A;  2GVB A;  3S16 B;  2B2W C;  1CZG A;  5COY A;  4LF5 Q;  2XSC A;  2PQA A;  1YNJ C;  1AH9 A;  2P5I A;  3PUW A;  4HWP A;  5BN3 A;  2QA4 A;  4A3L H;  1WOC A;  4JV5 Q;  4C3I B;  4YRI A;  3S2D B;  4A3M B;  1YFS A;  4LF9 Q;  5JEA J;  2R7F A;  2B2V A;  2B3G A;  4OEM B;  5C3E B;  3G71 A;  4K8I A;  2B2V C;  3RIR A;  4A3E H;  1C7Y A;  2F0D A;  2VQF Q;  2UXD L;  2Y0S E;  1IYJ B;  1X56 A;  2VB3 X;  5EQ0 A;  4DV3 L;  2YU9 H;  4K0K L;  2JP1 A;  2TSS A;  4HED A;  2R92 B;  2YYZ A;  2NVT B;  3K5O A;  1I50 H;  3KYH C;  4TKO B;  4K86 A;  2KBN A;  1B2T A;  3VDY A;  3TRZ A;  1CUK A;  4DR6 Q;  4FF2 A;  1S72 A;  2UUC Q;  1SE4 A;  1TWF B;  2WKD A;  1K0R A;  2K01 A;  1RD9 D;  2JA8 H;  4IAL A;  1EFI D;  3I70 A;  1HR0 W;  1G51 A;  3CC4 A;  4BBS B;  3FDT A;  3IKL A;  3ND9 A;  1CHP D;  1G91 A;  4NPS A;  4H2X A;  4X6A H;  1QB5 D;  3CRL C;  4TRD A;  4X65 L;  4JI2 Q;  3U58 A;  5I9P A;  3HRZ C;  1GO3 E;  1YHQ A;  1CI3 M;  2PQE A;  4H2W A;  2IHE A;  1GUN A;  3W2D A;  1PYS B;  4WF2 A;  2IL8 A;  1WTP A;  1Y69 U;  1STH A;  1AE3 A;  1IL2 A;  4P3O A;  2K04 A;  4YY3 Q;  1HZC A;  5CV4 A;  5BN4 A;  4YRT A;  1H4S A;  4OWX B;  3OHX C;  1I4Q A;  2RHQ A;  2XTI A;  2KHS A;  3ERS X;  4FP5 D;  1VQI A;  2HDM A;  5C44 G;  1KL9 A;  1TWG B;  3J80 i;  2JE6 I;  2DQ3 A;  2EJ9 A;  3RKX A;  1PDQ A;  1YNN C;  2QHS A;  3W3A A;  1B50 A;  4A3I G;  1X54 A;  3B6Y A;  3TBI B;  3J81 i;  4U68 A;  1PRT F;  4TVA B;  3OW7 A;  3TEH B;  3SK5 A;  1UNS A;  3DEO A;  2F0G A;  4G57 A;  2ZTG A;  4HIK A;  4OXP A;  1WQW A;  1DOK A;  3SEB A;  1W3S A;  1WTH A;  1IYV A;  1YIJ A;  1VQ8 A;  1YNJ D;  2NTT A;  4JI8 L;  2CH4 W;  1T9H A;  4RGN A;  2ZTD A;  4LUO A;  1EYD A;  4DXF A;  1Q1E A;  3E9H A;  2JYO A;  2WB1 G;  4DV0 Q;  4K5W A;  5ELB A;  1RF2 D;  4C3J G;  1XWE A;  4JC0 A;  4ZTZ B;  1V1P A;  2F4I A;  1F77 A;  3KOJ A;  2EJM A;  4JV5 L;  4MTN A;  1TII D;  2Y0S G;  1HZ9 A;  3TN2 A;  2B63 H;  1KRT A;  3UE0 A;  1A63 A;  2I0Q A;  4B3T L;  1F9S A;  3DWP A;  4DR7 Q;  2C7I A;  2D62 A;  4V0B A;  1JOQ A;  4A3B G;  4XTW A;  2NVY B;  2BH8 A;  3HOU B;  2K05 A;  1I4P A;  4Q0F A;  1EY9 A;  1GUS A;  2NVT H;  4XDX A;  3M4O B;  3MHB A;  1WYD A;  2CFM A;  2F0O A;  1Q46 A;  4ZK9 B;  5I6Y A;  1W6J A;  3IL8 A;  1TR5 A;  2XWJ B;  5D14 A;  3SVM A;  2QF7 A;  4DR6 L;  2CWA A;  1X32 A;  1GJX A;  1CK1 A;  3ULL A;  3QO8 A;  4GNX C;  3NWT A;  1WFQ A;  4A3M G;  1F2M A;  1FVI A;  1XJV A;  4EQN A;  2KOL A;  3SR1 A;  4K14 A;  2PMF A;  1F9P A;  1MI2 A;  1N9W A;  4C3I H;  4A75 A;  4F88 A;  2MFI A;  3NTH A;  3V8J A;  2RF4 A;  5J22 A;  3OMG A;  3J80 L;  2ZXO A;  4KY7 A;  2OF1 A;  1XPU A;  3A56 A;  1RHP A;  1QVF A;  1PTO B;  2K33 A;  2DU7 A;  1NCV A;  1RL2 A;  4DU9 A;  2HNI A;  4GLV B;  1TT2 A;  4QL5 A;  2GVA A;  4GNX A;  1LT5 D;  5C4X H;  2QEJ C;  1I6H B;  5CC4 A;  5M5W B;  2R93 G;  2VUM B;  2EY2 A;  3EFX D;  4UP9 A;  4H2Y A;  1NY4 A;  4RDX A;  1EOT A;  1EEF D;  1MGS A;  3MF2 A;  4EO4 A;  4L5Q A;  4YHH L;  3ULP A;  1KQS A;  3KBG A;  4OX9 Q;  4ZQ3 A;  2I4L A;  5C4Z A;  2IW3 A;  1NMF A;  5ELE A;  1YJ9 A;  4Q6G A;  4JI4 Q;  2YTX A;  1LTA D;  3D8G A;  3K0Y A;  4BWG B;  5C3X A;  5KYL A;  1ADY A;  1NUC A;  5G3L D;  1M1K C;  4YPF A;  3HS0 C;  4CS3 A;  5ISR A;  3ICA A;  1VQH A;  4IFD H;  4H13 C;  4OL7 A;  1ML0 D;  4DAV A;  4P72 A;  1HNW Q;  2MO1 A;  3S9W A;  2PNR C;  4CH6 A;  3LWE A;  4A93 B;  5FOB B;  1KDB A;  2CKZ B;  2VB2 X;  1SMY D;  3STB D;  4HIM A;  1XMQ L;  4LFC L; 
#chains in the Genus database with same CATH homology
 1V9P A;  4IO9 A;  4B3T Q;  2A8V A;  1WLE A;  1BBU A;  5J3B A;  4LF8 Q;  3PV0 A;  4FDB A;  1VQZ A;  4LW1 A;  2AKW A;  3GD7 A;  3K81 C;  4H02 A;  1E1O A;  4UPA A;  3PZC A;  3EBE A;  3CQZ H;  1VQN A;  2YTV A;  1EIY B;  2C8M A;  3S14 H;  1UE7 A;  4BXX H;  1XNR L;  3L4G B;  3PCO B;  2I5H A;  4G85 A;  3PUX A;  1YB3 A;  2KCM A;  3DM3 A;  1Q1B A;  1S40 A;  2DVE A;  2UXC L;  4H2X B;  3J81 j;  4CS4 A;  1WCM G;  3VQY A;  4DV1 L;  4OO1 G;  2ZNI A;  3LSQ A;  2D0P A;  3FKI G;  5GAH C;  4A3G G;  1WQ7 A;  2IY5 A;  3TQY A;  1HNX Q;  3UH0 A;  3HFV A;  4K87 A;  4YRR A;  1SRU A;  3S1Q H;  3CMA A;  1Y1V G;  4XTX A;  3GO5 A;  4YRL A;  2H5X A;  1YIT A;  1YJW A;  2C35 B;  4A3D G;  1IXR A;  3VQX A;  3RLF A;  2ZCE A;  2Q5I A;  3EFS A;  2DXU A;  4JOI A;  3RUX A;  1YHB A;  4YRQ A;  2AMC B;  4YY3 L;  4XIG S;  2QGQ A;  1U5K A;  2Q7H A;  2AWN A;  3RKW A;  1LM0 A;  4OON A;  1Q82 C;  2R6G A;  1SLJ A;  1N33 L;  2EXD A;  1QZH A;  4ALP A;  1HNZ L;  1A62 A;  2UUC L;  3DSQ A;  1E1T A;  4NCX A;  5M3F H;  4R4Q A;  4DNI A;  1TWC H;  2UXD Q;  1PYS A;  4POF A;  2K50 A;  3UFG A;  2DTI A;  1Z47 A;  4BY1 G;  1SET A;  4GKJ Q;  3T1Y Q;  4YRP A;  2IX1 A;  2CQO A;  4BWA A;  4POG A;  2ZTC A;  4K88 A;  4KR3 A;  4CH4 A;  1PH3 A;  3H0G G;  1G5H A;  3U4Z A;  3HOW G;  1HR0 Q;  3S2D H;  4LF7 Q;  1VQ9 A;  3KDF B;  2CJB A;  3AEV A;  2UUB Q;  3CF5 A;  4KQE A;  3I4N H;  2R7Z G;  3ZJY C;  2ZT6 A;  2CIM A;  4HJA A;  4LVK A;  2R7D A;  3A7R A;  1FJG L;  1XTD A;  5IP9 G;  2CJ9 A;  2ID0 A;  4DV7 Q;  4BBS H;  1G6P A;  4DUZ Q;  1I94 Q;  4A3J H;  1HR0 L;  4HJ9 A;  4JI1 L;  3JAM c;  4B3M Q;  3FJP A;  4JYA Q;  1VQ7 A;  4YCV A;  2L15 A;  3A5U A;  4IFD I;  1SRO A;  4GKJ L;  2V1C C;  4DV7 L;  4HID A;  2OQK A;  4IFD J;  1IBM Q;  4RMF A;  1ADJ A;  3PF4 A;  3CCE A;  1I6H H;  2EQS A;  3HXW A;  4LVM A;  2N8N A;  1KAW A;  2E41 A;  2MNA A;  1P8L A;  4DV6 L;  3S16 H;  3A5Z A;  4C2M H;  1M90 C;  1HH2 P;  4OX9 L;  4A3F H;  2DU5 A;  4DUY Q;  3ER0 A;  3J81 c;  3K80 C;  1OXS C;  1UWV A;  2JA7 H;  4KHP L;  4JI7 Q;  3LGJ A;  4DV5 Q;  2PMZ E;  3Q8D A;  3GDE A;  1D7Q A;  3M3Y H;  3PO2 G;  2RCN A;  4UP7 A;  4DR2 Q;  1GKH A;  4DV0 L;  1ASY A;  3STB C;  3HXU A;  4WJ4 A;  2JJQ A;  3KF8 B;  2F3I A;  1PH7 A;  4A4I A;  1JJG A;  1L1O A;  3A0J A;  2K5H A;  2OQ0 A;  4DAM A;  1A0I A;  3VQV A;  2JK8 A;  1K3R A;  3R07 A;  1JJC B;  5FLX c;  5JJL A;  2ZGW A;  2RHS B;  3MQZ A;  4AQY Q;  2E8G A;  1L2F A;  1Y1W H;  2N49 A;  1Z7N A;  5JJI A;  3HOZ H;  3HOX H;  4GKK Q;  5AJ3 L;  1UE1 A;  3H15 A;  4G84 A;  4BBR H;  3HOU G;  1Y14 B;  2DQ0 A;  3KJO A;  2ZT7 A;  1VQB A;  4DV2 Q;  2ZZF A;  2Z6K A;  1KMM A;  1TXY A;  2Q7E A;  2RHS A;  2XGT A;  4HJ7 A;  1E7Z A;  4DR4 L;  1K83 H;  2JA9 A;  2Q2U A;  4QJF A;  3HXX A;  4TVW A;  3CCU A;  2N3S A;  1RIQ A;  1YFR A;  4OWW B;  4R1J A;  2PQA B;  2ES2 A;  2ASB A;  3U4V A;  5IP9 H;  2ZIO A;  2KEN A;  1Q81 C;  1OXX K;  1UE6 A;  5C0X G;  3P8T A;  4IFD G;  1B70 A;  4LF8 L;  4HWR A;  4GLA C;  2Q7G A;  3U50 C;  2K5V A;  4JYA L;  3CW2 C;  4LF4 Q;  4YRE A;  1L1O C;  1PH1 A;  2R93 H;  1OXV A;  1YZ6 A;  1C0A A;  4DUZ L;  1XMQ Q;  3HOY H;  1OTC A;  1HTT A;  3WQZ A;  1GM5 A;  4XTC S;  1IZ6 A;  1WNL A;  2ZT8 A;  2D0O A;  1BVS A;  2E2H H;  3PUV A;  1RIP A;  4PMW A;  4ZTU B;  4NXM L;  5C44 H;  4Y7N H;  4DV3 Q;  4K0K Q;  2JEB I;  4JI6 L;  3F8T A;  2DTH A;  1YEZ A;  2ZJQ A;  2UXB Q;  3HFZ B;  3IAL A;  3CCS A;  4LUV A;  1AE2 A;  4LF7 L;  1YGB A;  4GS3 A;  3HY1 A;  4HJ5 A;  1KOG A;  3HOY G;  5LMN L;  3D31 A;  2ZM6 Q;  2E64 A;  4IPC A;  3A32 A;  2QHT A;  4IPG A;  3HFZ A;  4TQU S;  3M4O H;  4IOA A;  3V7S A;  4A3C H;  1I3Q H;  4X64 L;  3QNE A;  3BU2 A;  2VUM G;  1PFS A;  1NE3 A;  2I5M X;  2UU9 Q;  1FJG Q;  4YRC A;  1VQ4 A;  4JI6 Q;  4A3G H;  1H95 A;  2IT1 A;  5IYD H;  1VQP A;  4L5T A;  4XTZ A;  1Q8K A;  4P71 A;  1EFW A;  1PVO A;  3TEH A;  1CKM A;  1TWG H;  3NEL A;  1LUZ A;  2NZO A;  4DR3 L;  4P71 C;  4XU2 A;  4LNS A;  3GTQ H;  4XTU A;  4DR4 Q;  5JJK A;  1EVL A;  4KR2 A;  1N36 Q;  2A8E A;  3W1G A;  3RLO A;  2ODR D;  1N32 Q;  5EAY A;  2CGH A;  4A3I H;  4BY7 H;  4X66 Q;  4A3F G;  2OWO A;  4HWO A;  2PI2 A;  4GKK L;  3IG2 A;  1BBW A;  2F52 A;  1NJ8 A;  3TS0 A;  1E3P A;  3S15 H;  2DUD A;  4YRJ A;  1XPO A;  4YRK A;  4XTY A;  3RAC A;  1VQK A;  1EOV A;  1SES A;  1LTL A;  3L7Z C;  3RL6 A;  3RZD H;  4OLF A;  1SN8 A;  4TWA A;  3T1H L;  5E3I A;  2EJF A;  1KXL A;  4LVJ A;  1CKO A;  4X66 L;  4GOP C;  3G4S A;  1HC7 A;  2JA6 G;  1I5F A;  4X65 Q;  1ASZ A;  5GAE C;  2ZZG A;  3RKY A;  4BY1 H;  4GN4 B;  1I94 L;  2HHH Q;  5KNN A;  3L2P A;  4LF6 L;  2AMC A;  3HXZ A;  3HOW H;  4P74 C;  2ZIN A;  1L1O B;  4A3B H;  5GQO A;  5M3M H;  1X3G A;  3HOV G;  4LFC L;  4Y52 H;  1X3E A;  4GOP B;  1X65 A;  3RN2 A;  1PA6 A;  4OWT B;  3GTK H;  3M85 A;  1K8G A;  2G4C A;  4R4I A;  4JI0 Q;  4RQE A;  4YP0 A;  3CCR A;  3J7Z C;  1NYQ A;  3PF5 A;  5LMN Q;  4A93 G;  4YWL A;  1PH8 A;  4DR1 Q;  3KDF A;  2JA5 G;  2FYK A;  2ZR3 A;  2OCE A;  1EVK A;  4JBM A;  3AQQ A;  2KHI A;  3S1R H;  2ZJP A;  4JBJ A;  1V43 A;  3PSI A;  3MF1 A;  5C53 B;  2VW9 A;  1SFO H;  4YRF A;  1Y1V H;  1R9T H;  4H2T A;  3H3V I;  3K7A H;  2OTL A;  1XNQ Q;  1NJ2 A;  4LF9 L;  3BZK A;  5H1S E;  4DR1 L;  1KMN A;  2I4M A;  4AIM A;  4JI0 L;  1IBL Q;  3L1A A;  2WFW A;  4YRN A;  2DGY A;  3I4O A;  3GTM H;  2LXK A;  2LXJ A;  2MQH A;  4JI8 Q;  3W3S A;  2I4O A;  2BA0 A;  4XU0 A;  2VS1 A;  1HNW L;  1TWH H;  3KF6 B;  2PI2 E;  3P8Y A;  1NTG A;  3FHW A;  2VUM H;  3AYH B;  3A7A A;  1U0L A;  1VQG A;  2AWO A;  3GTO H;  1N33 Q;  2QHU A;  2Q5H A;  5BR8 Q;  1X2G A;  5JEA G;  4DR7 L;  4R4O A;  4A3E G;  4DQ2 A;  3HOX G;  2EIF A;  4DV5 L;  2NN6 I;  5HY6 A;  2NVY H;  4QIW E;  2E1H A;  4YRO A;  3QTC A;  3ULJ A;  4O2D A;  3FP9 A;  3KJP A;  3RF1 A;  5IWA Q;  1VQ5 A;  1NJ5 A;  1HJP A;  3L2Z A;  3JC6 6;  4JBW A;  3OYY A;  3KLW A;  2YTY A;  1XNR Q;  1H4T A;  2KCT A;  3L0O A;  1E22 A;  3NET A;  1H4V B;  1VQO A;  3MEF A;  1EUJ A;  3E9I A;  4P73 A;  2ZZE A;  4A76 A;  4A3D H;  1VQ6 A;  3GTG H;  4BBR G;  4TTV A;  2ZM6 L;  4JI2 L;  4A3J G;  2KHJ A;  4KHP Q;  2JA5 H;  4P75 A;  4XU1 A;  4DPG A;  1TWA H;  1N8R C;  4LF5 L;  2E2I H;  1YVC A;  1IBK Q;  2E10 A;  3G6E A;  2JEA I;  2E5A A;  4L87 A;  3M7N A;  1HXD A;  2RHQ B;  3ICE A;  1UE5 A;  2F4V L;  3AFQ A;  3JAM i;  4AYB G;  3UGQ A;  3HXV A;  4YCU A;  4PZ8 A;  2E2J H;  4P74 A;  2WAQ G;  1EQR A;  1NMG A;  4JBK A;  3M9B A;  1IBM L;  3CP0 A;  4B3S Q;  5E7N A;  3EIV A;  4DV1 Q;  1WI5 A;  2P0L A;  3V8L A;  2PNH A;  1JJC A;  4LUZ A;  1FGU A;  1KD1 C;  3GTL H;  1B7Y A;  4P75 C;  1Y1W G;  1XNQ L;  5ELO A;  4TVY A;  1B70 B;  5C3E H;  3UDI A;  1EYG A;  3UE1 A;  5FLM H;  3CPW A;  3J7A 5;  2A1A A;  5FLM G;  4NXM Q;  2ZXF A;  4J15 A;  4YWM A;  3P8V A;  2WP8 J;  2ZTE A;  2E5L L;  3REU A;  4HA8 A;  4P73 C;  1EIF A;  4YHH Q;  2R92 G;  1FL0 A;  1JMC A;  5IYC G;  2K4K A;  1DGS A;  1A8V A;  1VQE A;  3VBB A;  1J5W A;  2HIV A;  1W66 A;  3GTJ H;  4KHZ A;  3HOU H;  3TRE A;  1J6Q A;  1Q12 A;  4JI5 L;  3SGI A;  3UDX A;  3T1H Q;  1WJJ A;  2VZA A;  3RR5 A;  1SE8 A;  4JCV E;  1N34 Q;  5C0X J;  5K36 G;  2WAQ E;  2F4V Q;  3IRB A;  3A74 A;  5IYD G;  4RQF A;  2NVQ H;  2CWP A;  4A3K H;  4LWC A;  3PO2 H;  2NS6 A;  4GN5 A;  4YDQ A;  2DXT A;  1HNZ Q;  3VQW A;  1OXU A;  3F2B A;  1KHI A;  1O7I A;  1Q86 C;  2NVX H;  3I55 A;  4QGU A;  4RG1 A;  1ATI A;  5M5Y H;  2CJA A;  3ERR A;  3RZO H;  3PGZ A;  1GVP A;  4GN3 B;  3RNU A;  2EJG A;  3V8K A;  1CSP A;  1W2B A;  1X01 A;  1PV4 A;  3CC7 A;  4QQB X;  4IPH A;  3HKZ G;  4PZ6 A;  3F1Z A;  3PUZ A;  4LVI A;  4NXN L;  4YRM A;  5IE8 A;  2HIX A;  3OTO L;  3REX A;  2K52 A;  12AS A;  2VQF L;  1YBY A;  3L4G A;  2VY3 A;  1K73 C;  3K7U C;  1NJI C;  3QO7 A;  2MO0 A;  4BW9 A;  4GNX B;  1QVC A;  1B8A A;  1MJE A;  1XPR A;  2HQL A;  3S1M H;  4P3P A;  4CS2 A;  4HT4 A;  2JA6 H;  1N32 L;  4H2U A;  4BA2 I;  5AJ3 Q;  5LMU Q;  4E51 A;  3F2C A;  1P16 A;  3LSS A;  4CH5 A;  4KI0 A;  3H0G H;  3NEM A;  2EL9 A;  1FYF A;  1NBW A;  5ELN A;  3PIP A;  1VQF A;  3HXY A;  3HRK A;  5C51 B;  4IOC A;  4X62 Q;  4ZIB A;  4DR2 L;  5IYC H;  1YNX A;  5HGQ A;  4DV4 L;  2I5L X;  1Z9F A;  4XEM A;  4B3M L;  1S3O A;  1YHA A;  1KC8 C;  3UGT A;  1NJ6 A;  3CPF A;  2DJZ A;  5C52 B;  1QE0 A;  1JB7 A;  2E65 A;  3TUP A;  2IY5 B;  5C4J H;  1VS0 A;  1EIY A;  3OW2 A;  1C9O A;  3QO5 A;  4DAY B;  4KLK A;  2UUB L;  1PH9 A;  2ART A;  3I4M G;  4LFB L;  2VL6 A;  1PH4 A;  2VQE Q;  2UUA Q;  3V7R A;  4DK3 C;  3K0X A;  4LNQ A;  2VQE L;  2UUA L;  3T1Y L;  1X6O A;  4Q15 A;  1QVG A;  4DV4 Q;  2ATW A;  5IT9 c;  4X62 L;  4YYE A;  1G29 1;  2K14 A;  3BJU A;  1J5E Q;  4EX5 A;  1H4Q A;  1VQC A;  1JJ2 A;  2ZJR A;  4A93 H;  3HKS A;  1X3F A;  11AS A;  4C3H H;  4B3R Q;  4OO1 I;  1E24 A;  1WCM H;  1MJC A;  2OTJ A;  4GLX A;  1PH5 A;  2ALY A;  1UEB A;  2HHH L;  3PCO A;  3FKI H;  1QUQ B;  2NN6 G;  2NZH A;  1BIB A;  1B76 A;  5K1P A;  3I2Z A;  2DDZ A;  4BA1 I;  3HOZ G;  4DR5 Q;  3A7U A;  3EFR A;  3AFP A;  4DKA C;  5IYB G;  4AQY L;  4IJH A;  2WB1 E;  3D0F A;  2ALY B;  3MXN B;  4MNO A;  1D8L A;  4H2V A;  1VQJ A;  3RN5 A;  5C4X G;  4JI3 L;  2DZC A;  1TWF H;  3M4P A;  1VQA A;  1CKN A;  3CXC A;  2BA1 A;  1X2H A;  3A5Y A;  3CMQ A;  3G1Z A;  3CCL A;  4HVC A;  4LFA Q;  1QZG A;  1MIU A;  3J80 c;  2QHV A;  4YRS A;  4LFA L;  1GGM A;  1Z7M A;  3BZC A;  1YFT A;  4R4C A;  5M3F G;  3TS2 A;  4JI1 Q;  5BR8 L;  5IP7 H;  5K1X A;  3OTO Q;  3W1B A;  3S17 H;  2BH2 A;  4JI3 Q;  2EAY A;  1USY A;  1X9N A;  2JA7 G;  2AHO B;  1JT8 A;  1WPY A;  2FXQ A;  5C3E G;  3UDF A;  1SER A;  1VQM A;  3G48 A;  4NB3 A;  5C0X I;  3I4M H;  5M5X H;  3V7C A;  4JOI C;  1HNX L;  4OP0 A;  2DTO A;  2B63 G;  1EQQ A;  4A3C G;  2UU9 L;  4HIO A;  5M5W H;  1CSQ A;  4DR5 L;  2Q2I A;  3GTP H;  4YWK A;  5GRO A;  1SR3 A;  3CC2 A;  3UDG A;  4IPD A;  3H3V H;  2VNU D;  3NBH B;  4ME3 A;  2ODR C;  4HWS A;  2R7Z H;  5GAG C;  2Z6K C;  1YI2 A;  4B3S L;  4R4T A;  1K9M C;  3PUY A;  4A3M H;  1VQD A;  3PO3 G;  5LMN W;  2Q2T A;  4BBS G;  2DEQ A;  4WI1 A;  3PO3 H;  4AYB E;  1NNH A;  4LVL A;  2JA8 G;  3S2H H;  1J5E L;  4QY7 A;  3WWV A;  4A3L G;  1NYR A;  1YJN A;  3KFU A;  3CCJ A;  2I4N A;  1LYL A;  2PME A;  3I56 A;  2IHF A;  2B29 A;  3MEY A;  1IBK L;  2ARU A;  4PZ7 A;  4TVA A;  2J3M A;  1X55 A;  5LMU L;  4O0A A;  4LF4 L;  2HT1 A;  3PIO A;  1CKN B;  3S24 A;  4TQD A;  3A31 A;  1HZA A;  3E0E A;  4AH6 A;  4L5S A;  1K8A C;  4LFB Q;  4PG3 A;  1XMO L;  2Q2H A;  1EWI A;  2ARS A;  1GD7 A;  1HZB A;  1BKB A;  1B7Y B;  1PH6 A;  4HJ8 A;  4P3N A;  4APV A;  3OD1 A;  3CD6 A;  4XU3 A;  2ZT5 A;  4LF6 Q;  2Z0S A;  1QF6 A;  1QUQ A;  2K5N A;  2N78 A;  3IKM B;  3LC0 A;  4JI7 L;  4TQF A;  3HY0 A;  5M3M G;  5IP7 G;  1NJ1 A;  4DK6 C;  1N36 L;  4DUY L;  4JG2 A;  1KRS A;  3RGL A;  1SRY A;  4YCW A;  1VCI A;  1PH2 A;  4YRG A;  2YV5 A;  1VQL A;  4NXN Q;  5IYB H;  2E3C A;  1Q7Y C;  3KF6 A;  4P72 C;  4L5R C;  2CCZ A;  1V1Q A;  5IWA L;  1BIA A;  2QEX A;  3EN2 A;  3CCQ A;  4X64 Q;  2AKW B;  4H2S A;  2A19 A;  3F2D A;  3HRI A;  3BFM A;  5GAD C;  1KIX A;  3HOV H;  3CCM A;  4DV2 L;  2DZ9 A;  1G5I A;  2ZR2 A;  2UXC Q;  3RLN A;  5F5W A;  4WJ3 M;  1SMX A;  2ZNJ A;  4DR3 Q;  3HKZ E;  3W5O A;  2E5L Q;  1USY C;  5DLQ E;  4PHC A;  4BY7 G;  4B3R L;  3M4Q A;  3K8A A;  1WU7 A;  3A5Z B;  1PHJ A;  1N34 L;  4X5O A;  1L0W A;  1MKH A;  4JI4 L;  4HWT A;  4IJL A;  3S1N H;  2GN5 A;  4XTV A;  4A3K G;  4JI5 Q;  5FJ8 G;  3HTZ A;  5FJ8 H;  2EWN A;  4C3J H;  4XEO A;  3I7F A;  4MZ9 A;  4CH3 A;  3NEN A;  2K75 A;  2UXB L;  3TEG A;  2LSS A;  4UY8 C;  2JQO A;  4LFC Q;  3CAM A;  3CME A;  4DV6 Q;  4GOP A;  1JE5 A;  1PYB A;  3I4N G;  2IX0 A;  2R92 H;  2ZIM A;  4UP8 A;  4BXX G;  4EQ5 A;  3DLL A;  1XMO Q;  3CCV A;  1OXT A;  5IY0 A;  2J3L A;  1IBL L;  2GVB A;  4LF5 Q;  2PQA A;  1AH9 A;  2P5I A;  3PUW A;  4HWP A;  2QA4 A;  4A3L H;  1WOC A;  4JV5 Q;  4YRI A;  1YFS A;  4LF9 Q;  5JEA J;  2R7F A;  2B3G A;  3G71 A;  3RIR A;  4A3E H;  1C7Y A;  2VQF Q;  2UXD L;  2Y0S E;  1IYJ B;  1X56 A;  4DV3 L;  2YU9 H;  4K0K L;  2YYZ A;  1I50 H;  3KYH C;  4K86 A;  2KBN A;  3VDY A;  3TRZ A;  1CUK A;  4DR6 Q;  1S72 A;  2UUC Q;  1K0R A;  2JA8 H;  1HR0 W;  1G51 A;  3CC4 A;  3IKL A;  4NPS A;  4H2X A;  4X6A H;  4X65 L;  4JI2 Q;  3U58 A;  1GO3 E;  1YHQ A;  4H2W A;  2IHE A;  1PYS B;  4WF2 A;  1AE3 A;  1IL2 A;  4P3O A;  4YRT A;  4YY3 Q;  1HZC A;  1H4S A;  4OWX B;  2RHQ A;  2XTI A;  3ERS X;  1VQI A;  5C44 G;  1KL9 A;  3J80 i;  2JE6 I;  2DQ3 A;  2EJ9 A;  3RKX A;  2QHS A;  4A3I G;  1X54 A;  3B6Y A;  3J81 i;  4TVA B;  3TEH B;  2ZTG A;  4HIK A;  4OXP A;  1WQW A;  1W3S A;  1YIJ A;  1VQ8 A;  4JI8 L;  1T9H A;  2ZTD A;  4LUO A;  1Q1E A;  3E9H A;  2WB1 G;  4DV0 Q;  4JC0 A;  4ZTZ B;  3KOJ A;  4JV5 L;  4MTN A;  2Y0S G;  1HZ9 A;  2B63 H;  1KRT A;  3UE0 A;  1A63 A;  2I0Q A;  4B3T L;  4DR7 Q;  2C7I A;  2D62 A;  4A3B G;  4XTW A;  2BH8 A;  2NVT H;  1WYD A;  2CFM A;  1Q46 A;  4DR6 L;  2CWA A;  3ULL A;  3QO8 A;  4GNX C;  1WFQ A;  4A3M G;  1FVI A;  1XJV A;  2PMF A;  1N9W A;  4C3I H;  4A75 A;  2MFI A;  3V8J A;  2RF4 A;  1XPU A;  1QVF A;  2DU7 A;  2HNI A;  1RL2 A;  4GLV B;  4QL5 A;  2GVA A;  4GNX A;  5C4X H;  2R93 G;  4UP9 A;  4H2Y A;  1NY4 A;  4RDX A;  3MF2 A;  4EO4 A;  4L5Q A;  4YHH L;  3ULP A;  1KQS A;  4OX9 Q;  2I4L A;  1NMF A;  1YJ9 A;  4Q6G A;  4JI4 Q;  2YTX A;  1ADY A;  1M1K C;  4YPF A;  4CS3 A;  3ICA A;  1VQH A;  4P72 A;  1HNW Q;  2MO1 A;  4CH6 A;  2CKZ B;  3STB D;  4HIM A;  1XMQ L;  2DKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...