2XGTA

Asparaginyl-trna synthetase from brugia malayi complexed with the sulphamoyl analogue of asparaginyl-adenylate
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
427
Chain Sequence
b'VKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPNGHELIADFWKIIGNAPPGGIDNVLNASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAQDNTLTESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC
publication title A Hybrid Structural Model of the Complete Brugia Malayi Cytoplasmic Asparaginyl-tRNA Synthetase.
pubmed doi rcsb
source organism Brugia malayi
molecule tags Ligase
total genus 128
structure length 427
sequence length 435
chains with identical sequence B
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2xgtA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2xgtA02
4BBRG 3S1MH 1HNXQ 1USYC 2E5LL 2MO0A 1YBYA 1E22A 2E1HA 1VQ8A 1VQDA 3L4GB 3HOVH 1PHJA 5ELOA 2YU9H 2XTIA 1WI5A 3E0EA 3GO5A 4YY3L 2D0PA 1VQ9A 4X64L 4TVAA 1S72A 1SRUA 1HNWL 3KDFB 1XMQL 2RF4A 2R7FA 1Y1VH 3S17H 2Z6KC 3I4NH 4JI8Q 4H2UA 4BXXG 4GLAC 3GTJH 1OTCA 3S1QH 2I4NA 4XTVA 2J3LA 5JJIA 3HOYH 4RDXA 1DGSA 2UUCQ 4B3TQ 2HQLA 5IP9G 2ZT6A 1N32Q 1QVCA 3SGIA 2BH2A 1RIPA 3CP0A 5FJ8H 2D0OA 2HT1A 1Y1WG 2DTHA 4P72A 3GTMH 3CMAA 2I5HA 2UU9Q 3GTOH 4LFCQ 4AH6A 2Q2TA 3M3YH 3IRBA 2E3CA 5FLMG 1V9PA 2KENA 2CWAA 4JI2L 1NNHA 4JBMA 4X62L 3P8VA 4DAMA 1XPUA 3MEYA 3VDYA 1UE7A 3V8KA 3MF1A 1EIYA 2WAQG 4P73A 3K81C 4YRJA 4DV2L 4JI4L 3M4PA 1OXXK 4XEMA 1W66A 5IWAQ 1A8VA 4WJ3M 2DU5A 5IYCH 5GQOA 2CCZA 3RLOA 3HOXG 2QHVA 4DR6Q 4H2SA 4P3NA 2ZJPA 1XNQL 2K4KA 3FJPA 4DR2L 5C4XH 1IBMQ 4DV5Q 2ZNJA 2QHTA 4L5SA 2D62A 4PZ6A 3VQVA 1AH9A 2UU9L 4BY1H 1X54A 4H2XA 1W2BA 4OX9Q 1E1TA 2VQFQ 4K0KQ 1HNZQ 3OW2A 3HXVA 1ATIA 4UY8C 4XTZA 1X2GA 4C3IH 4A76A 4FDBA 3PO2H 2PMFA 1EFWA 4R1JA 3ZJYC 3F1ZA 3I4OA 2RHQB 2Z6KA 4LUOA 4WJ4A 3CC4A 2DZ9A 1NJ1A 4OXPA 4OONA 2Q7GA 3P8TA 3UDXA 5HGQA 1K3RA 3AFPA 4NXNL 3TEHA 4RQFA 4JI3Q 3HFZA 4YCUA 2E41A 4YWKA 2ZCEA 4X5OA 1RIQA 5M3FH 4DV3L 2KBNA 2JEBI 1HR0W 3J81c 4QQBX 1VQAA 3W5OA 1NYRA 3DM3A 2ASBA 3HTZA 1IBML 4DV5L 3G48A 4LFAL 3CCSA 2K14A 4LF9Q 3HXWA 2VS1A 1VQBA 1WPYA 3A5ZB 4X66L 1N34Q 4DV7L 1OXSC 3IG2A 4PMWA 2VUMH 2F4VL 4R4TA 1LYLA 3M85A 1HR0L 2UUBL 4LUVA 3RR5A 1E7ZA 1PYSA 4L5TA 4AQYQ 5C52B 4HWSA 3UDIA 3JAMi 4B3SL 2N78A 3RIRA 4JI5Q 1H4VB 3BFMA 1G5IA 2L15A 1S40A 1SLJA 1NTGA 2KHIA 2JJQA 3J7ZC 1S3OA 2AWNA 2VZAA 5IYDG 4JI6L 3QNEA 4L5QA 4L5RC 2RHSA 1D8LA 2OQKA 3Q8DA 3HOZG 4A3CH 1IBKQ 2EJGA 3CW2C 3V8LA 4A3GH 5K1XA 2QA4A 2QHSA 2ARUA 1YHBA 1X56A 4Q15A 3PV0A 1B70A 1D7QA 4LF9L 1TWGH 4UP7A 4A3EG 4X65Q 3PCOB 2K5NA 1SRYA 4H02A 3F8TA 3L0OA 4ME3A 4UPAA 2ZZEA 2ZIOA 1BBUA 2VW9A 4JI1Q 1JJCB 2UUAQ 1PA6A 4BBRH 1V43A 1QF6A 2QHUA 4KHPQ 5GADC 1KQSA 1QVGA 4YRPA 1E1OA 2Q2HA 2ZT8A 3RACA 1SR3A 2YTVA 3HKSA 1PVOA 3PGZA 1CKMA 4LUZA 1YFSA 4R4OA 3VQXA 2YYZA 4JOIC 4B3ML 2UXBL 4AIMA 11ASA 4NXML 5E3IA 3HKZG 2IHFA 4IJLA 3FHWA 4YRNA 4QIWE 3V7RA 3PUZA 1VQJA 4E51A 4YDQA 4DAYB 2E2JH 1EOVA 3AEVA 3QO8A 1EWIA 4JI0L 4BXXH 1C9OA 3AFQA 3WQZA 4DK6C 1I5FA 4DV4Q 3RLFA 1Q46A 1EIFA 1OXVA 1SMXA 3S14H 2ZT5A 3KJOA 1JB7A 4DV1Q 5IP9H 2KHJA 2P0LA 2EL9A 4JI1L 1VQMA 1Y1WH 1E24A 5GROA 4IPDA 1PH1A 4HIKA 3A5UA 1HH2P 1HJPA 4YRSA 5AJ3Q 4HWOA 3KF8B 1EVKA 4LF8L 4XU0A 2IX0A 3PCOA 5FLMH 2IHEA 3M7NA 4TVAB 3F2DA 3T1HL 1X3FA 3W1GA 2PQAB 1XTDA 3STBD 1T9HA 2CIMA 4UP9A 4OWTB 1JJCA 4RQEA 1C0AA 2R93G 3I55A 4HWPA 2I5LX 1K8GA 3PSIA 4QL5A 2ATWA 3W1BA 3HFVA 2DU7A 3H3VH 2ZNIA 1L2FA 3HOXH 3KOJA 4QGUA 3RKXA 5LMUL 3LSQA 3EBEA 3A7AA 1NY4A 3UE0A 1XMOQ 4PG3A 2JA7G 1R9TH 2YTYA 1UWVA 4ALPA 3F2BA 1IL2A 2A1AA 4IPGA 1HTTA 1JJGA 1I94Q 3UGTA 4JOIA 1GM5A 3RLNA 1H4TA 1KL9A 2PI2E 3ER0A 3HOUG 2Z0SA 5AJ3L 1SN8A 3PZCA 3VQWA 4TTVA 4NPSA 1PV4A 2HHHL 1PH4A 1A62A 4KHZA 5HY6A 3L2PA 4RG1A 2I4MA 1QZGA 4H2TA 1KRSA 4NCXA 1BBWA 1HZBA 1VQNA 3BZCA 2B63G 1EIYB 1KD1C 3MXNB 1VQLA 1Z47A 3BU2A 2ODRD 4DUYQ 4DR7L 5F5WA 4XU1A 1Y14B 5ELNA 3DSQA 5C44G 2RCNA 3K7UC 3CD6A 1IYJB 4DNIA 2K50A 1GD7A 2K75A 1IZ6A 2V1CC 2WB1G 4WI1A 2PQAA 5LMNL 3CC7A 1ASYA 1PH3A 4LF4L 3H3VI 1FJGQ 3CMQA 4YHHL 2JA8G 1UEBA 1GVPA 3R07A 4DR4Q 5JEAG 1WFQA 4DV6Q 4H2XB 3J81j 3HXYA 5IT9c 3KF6A 1X6OA 1HZCA 2JQOA 4LNQA 1KMNA 2ZXFA 4BY7G 4GNXC 4JC0A 1QZHA 4MZ9A 4EX5A 2EQSA 2CKZB 3HY1A 1K8AC 1Q12A 1HNXL 5K1PA 1OXUA 2Y0SG 2E2HH 4GKKQ 3CPWA 2ZTGA 4LFBQ 1YHAA 2J3MA 1P8LA 3TEHB 3I7FA 3HFZB 4YRIA 5K36G 3HXXA 5J3BA 1PH5A 1KC8C 1UE1A 1G51A 3I2ZA 1CKNB 4EO4A 1KAWA 2IY5B 4LNSA 3RF1A 5C53B 5IYDH 1TXYA 1LM0A 4XTCS 1YVCA 2CQOA 5JJLA 2I4OA 5JEAJ 4P3OA 2ZZGA 4DV0Q 3HOZH 1IXRA 5M5YH 2NVYH 1KIXA 3U4VA 1WYDA 3ULPA 2OWOA 4X6AH 4LF5Q 2QGQA 4JI8L 2R7DA 2WB1E 3CCEA 2ZJQA 3OD1A 4A3EH 2LXKA 3HY0A 4XTWA 1EQQA 5KNNA 1USYA 2UUCL 4YCVA 4B3TL 1PYSB 2AKWA 3UE1A 2ID0A 2E8GA 1N32L 4DR1Q 1I6HH 1HC7A 3K8AA 2Q7HA 2N3SA 4C2MH 2CFMA 1JMCA 3J81i 1N33Q 4XTXA 4BBSG 4HWRA 5C3EG 2R7ZG 3ICEA 3EFSA 5C4JH 3UGQA 3UDGA 2DTIA 3P8YA 3L1AA 2FXQA 2CJBA 1B7YA 3MEFA 4LFCL 2CJAA 1Z7NA 1NBWA 2Y0SE 4DR3Q 3CCVA 3RN5A 2RHSB 3RKWA 1NJ2A 3S16H 1G5HA 2DXUA 4NB3A 4LF6Q 2EJ9A 5IP7G 1I50H 5JJKA 2EJFA 1L1OC 4K87A 1QVFA 1TWAH 1WNLA 1LTLA 1PH9A 1B70B 3A5YA 4LF5L 2NVTH 4A3LG 1BIAA 2ZZFA 1CKNA 5IWAL 3TEGA 4QJFA 1NJ5A 2IY5A 4GNXA 2ZTEA 4JI7Q 1PH6A 4DR6L 1Q1EA 1L1OB 4IOAA 4HA8A 3S1RH 4P71C 1VQCA 1VCIA 3WWVA 3RKYA 3CCUA 2AHOB 1PH7A 1KMMA 4OO1G 1G6PA 2HIVA 2E2IH 4JBKA 2ZT7A 3TQYA 2P5IA 3REUA 5IE8A 4AYBG 4A3MG 1XNRQ 4OX9L 2VQFL 4K0KL 1HNZL 4A3IG 2G4CA 4DR3L 4KR3A 2LSSA 3D31A 2A8VA 3FP9A 2R93H 3H0GG 3J80c 3A74A 2ZINA 1WU7A 2AWOA 1X3GA 1CKOA 3G4SA 4CH4A 4YPFA 3GD7A 2UXCQ 3EIVA 4YWLA 4CH3A 5H1SE 1X65A 3NENA 4JI3L 5FJ8G 3QTCA 1GKHA 1X3EA 3TREA 1M1KC 2AMCA 2JA9A 3FKIH 4Q6GA 1WQWA 4IJHA 3BJUA 4K88A 1YHQA 1J6QA 4C3HH 3M9BA 2A19A 3IKLA 2EIFA 2JA7H 1EQRA 1YEZA 3OTOQ 1NJIC 3ULLA 2FYKA 5IYBG 2EWNA 1VQFA 2VNUD 2I4LA 3V7SA 1IBLQ 4POGA 3OYYA 4IFDG 3HOUH 4YRQA 1RL2A 5BR8Q 1N34L 1C7YA 3GTPH 1KHIA 4YRGA 1WCMG 3S15H 1UE6A 4CH5A 4G85A 1L1OA 4TQDA 3PIOA 2NZOA 2JA5G 4C3JH 4AQYL 3AQQA 3CC2A 4AYBE 3PUXA 1VQ6A 4GOPC 2B63H 2VQEQ 4JI5L 3ULJA 1PYBA 3HXUA 4YYEA 2UXCL 3QO7A 3D0FA 3GDEA 2JA6G 4KQEA 4GN4B 5C44H 4DR5Q 1MIUA 1XJVA 1NMFA 4ZTUB 2ZR3A 3QO5A 3ERRA 1JE5A 1NE3A 4JYAQ 2OQ0A 2DGYA 3CCLA 4IFDJ 1IBKL 4DK3C 1N9WA 2HIXA 4OWWB 4XIGS 2JA8H 2E5AA 2JK8A 4GKJQ 4XTYA 3S24A 1Q81C 3A32A 4A93G 4X65L 1N36Q 2E64A 4YROA 5EAYA 5M5XH 4HIOA 4BY7H 2PI2A 3NEMA 2UUAL 2XGTA 3CMEA 2JE6I 4DUZQ 4LWCA 2K52A 4KHPL 1J5EQ 4A3KG 4ZTZB 2OTJA 4B3RQ 4XEOA 2N49A 1QUQA 3CCQA 3EFRA 3BZKA 2B3GA 1V1QA 4JV5Q 2NN6G 3GTQH 4EQ5A 3PUVA 2HNIA 4JG2A 4DPGA 3AYHB 1M90C 3G71A 1GO3E 4K86A 4CS3A 4YRLA 4A3FG 4BA2I 4DV4L 3KF6B 1VQHA 2IT1A 4YRRA 3PUYA 1VQ7A 1Q1BA 4PHCA 3A31A 12ASA 2BA1A 2ALYB 5GAEC 4DV1L 1SERA 2WP8J 4YY3Q 2E10A 4KLKA 4X64Q 2EAYA 4BBSH 5C3EH 2R7ZH 1Q7YC 3A7UA 1XMQQ 1A63A 1WQ7A 2DUDA 3UH0A 3W3SA 4RMFA 3CQZH 2ZM6Q 4Y7NH 1Q8KA 3LGJA 2C7IA 5LMNW 4APVA 1UE5A 1FVIA 1BIBA 3L2ZA 4BWAA 5IP7H 1HXDA 3ICAA 1WJJA 3S2HH 2Q7EA 3GTGH 3E9IA 3G6EA 1WOCA 1NYQA 1X9NA 1VQKA 3LSSA 2DTOA 3NETA 2I0QA 4P75C 2Q2UA 4A3LH 4HWTA 1YGBA 1MKHA 2MQHA 3I4MG 4HJ8A 4IPHA 3M4OH 2AKWB 2I5MX 5C0XG 4R4IA 1XMOL 1XPRA 4O0AA 3HOWG 4JI2Q 1SESA 4X62Q 3CXCA 2ARSA 4R4QA 4YP0A 4DKAC 2R92G 3NBHB 1B7YB 1I94L 4G84A 1X01A 1YI2A 1K0RA 5M5WH 2ZR2A 4A3MH 2ZM6L 4DV2Q 4JI4Q 4J15A 4A3IH 3RGLA 3KYHC 1Q86C 4TWAA 4DQ2A 2ALYA 3TS2A 3H0GH 3CAMA 1XNQQ 4PZ8A 4JBJA 2YV5A 4O2DA 1XPOA 4MTNA 4DR2Q 4TVYA 2VL6A 4IOCA 3GTLH 2C8MA 4DUYL 5C0XJ 1ADJA 4A3JG 1HZ9A 4GNXB 1JJ2A 3A0JA 2Q5IA 1HZAA 2OTLA 1VQZA 1NMGA 2DQ0A 2ZGWA 4YRKA 1VQIA 4A75A 1FJGL 4A3BG 2ZTDA 3A7RA 1A0IA 5IYBH 1SFOH 3EN2A 2E65A 4DR4L 2CGHA 4DV6L 1YFRA 5GAGC 5M3MG 4NXNQ 1VS0A 4HJAA 1WCMH 1PH2A 4A4IA 4OO1I 3L4GA 4BW9A 4DV3Q 1FYFA 2NZHA 3PF5A 2JA5H 4HVCA 5E7NA 1YJWA 1G291 4GKKL 4LFBL 4P74C 4P75A 2JA6H 3S1NH 3KDFA 1H4QA 3H15A 4LFAQ 1JT8A 2AMCB 3U4ZA 1EUJA 4KI0A 4GLVB 1TWHH 1MJCA 3MF2A 1N8RC 2DQ3A 5GAHC 3PO3G 3STBC 3K80C 4X66Q 4A3DG 4LF7Q 2ZJRA 4DV7Q 1YZ6A 1AE3A 2F4VQ 4DV0L 3RL6A 1B8AA 4QY7A 3VQYA 2H5XA 1HR0Q 2UUBQ 3J80i 3TS0A 3KJPA 2NVQH 4B3SQ 2JEAI 1H4SA 2Q5HA 2IX1A 5IY0A 4A93H 2F52A 1WLEA 3CCJA 3HOVG 3L7ZC 1YIJA 1K83H 1K9MC 2CWPA 3GTKH 4POFA 1AE2A 1CUKA 4JCVE 2Q2IA 3T1YQ 4JI6Q 3HRKA 2EXDA 4DR1L 3KFUA 4HIDA 4IFDI 1N33L 4A3KH 3UDFA 2WAQE 3HXZA 3IKMB 1Y1VG 2GVAA 1FGUA 3I4NG 4OP0A 4XTUA 2PMZE 2NVXH 1X2HA 3LC0A 1VQPA 4LF6L 3V8JA 4LF7L 1TWFH 3RN2A 3HOYG 2OCEA 4YRTA 2ODRC 2ZIMA 2F3IA 2N8NA 4HIMA 4P3PA 4A3FH 3TUPA 1X55A 3J7A5 1NJ6A 3I56A 4JI7L 1TWCH 1O7IA 4IO9A 2DEQA 1VQGA 1K73C 4B3MQ 1VQ4A 1PH8A 2UXBQ 4P74A 3CPFA 3M4QA 4NXMQ 2MFIA 3T1YL 1ASZA 1E3PA 4HJ5A 3RZDH 1YJ9A 2YTXA 4WF2A 1QUQB 4KR2A 2DKGA 3CF5A 4CH6A 4H2WA 2RHQA 4YRMA 2K5VA 2B29A 4XU2A 4JI0Q 1XNRL 2DVEA 4R4CA 5IYCG 2WFWA 4L87A 1YNXA 3CCMA 4LW1A 4CS2A 3HRIA 1SROA 3E9HA 4GN3B 2KCMA 3JAMc 2GN5A 2NN6I 5C4XG 1QE0A 3U50C 3B6YA 4IPCA 3S2DH 2DDZA 1Z9FA 1VQOA 2LXJA 4GLXA 3RNUA 1B76A 1FL0A 4OLFA 2PNHA 3I4MH 1VQEA 3REXA 4P71A 4TQFA 4BY1G 1MJEA 2C35B 4ZIBA 4HJ7A 4GOPB 4LF8Q 3A5ZA 3T1HQ 3G1ZA 1YFTA 3HOWH 1BVSA 3OTOL 3U58A 4YRFA 4Y52H 3PO2G 2DZCA 5DLQE 2R92H 2K5HA 2R6GA 4GS3A 1IBLL 1BKBA 1I3QH 1KOGA 1ADYA 1Q82C 2PMEA 3RZOH 1YJNA 1Z7MA 5BR8L 3PF4A 4H2VA 2KCTA 2UXDQ 5M3FG 5LMUQ 4TVWA 3DLLA 1U0LA 1KRTA 1W3SA 1J5WA 2VQEL 1NJ8A 4OWXB 4YCWA 3UFGA 2ARTA 4A3JH 1VQ5A 4DR5L 4CS4A 1YB3A 2BH8A 2BA0A 3ERSX 3NELA 1H95A 4MNOA 4JYAL 2ZTCA 2MO1A 1PFSA 4YRCA 2HHHQ 2CJ9A 2VUMG 4XU3A 4TQUS 1GGMA 4A3BH 1SETA 4YREA 3K7AH 2E5LQ 1SE8A 4HJ9A 5FLXc 4GKJL 4JBWA 1P16A 1KXLA 1EVLA 4H2YA 5M3MH 5C0XI 3RUXA 2DJZA 1N36L 4DR7Q 4P72C 4UP8A 1CSQA 1EYGA 3F2CA 2ES2A 4GOPA 3HKZE 2GVBA 1L0WA 1LUZA 1CSPA 2VY3A 1YITA 2UXDL 2DXTA 3K0XA 3FKIG 4DUZL 4GN5A 1OXTA 3PUWA 5LMNQ 3IALA 1HNWQ 1J5EL 4LF4Q 4BA1I 4A3CG 4B3RL 3TRZA 4YHHQ 4A3GG 4JV5L 4YWMA 1U5KA 3PO3H 4P73C 4PZ7A 3PIPA 3KLWA 3V7CA 4A3DH 3CCRA 3VBBA 2MNAA 2QEXA 5C51B 3JC66
chains in the Genus database with same CATH superfamily
1K8MA 4BBRG 2ICIA 3S1MH 1JC7A 1HNXQ 1USYC 2E5LL 5M3MB 1KDBA 2MO0A 1ZYRD 1YBYA 2B2UC 1E22A 2E1HA 5LHY1 4DA2A 3Q24A 1VQ8A 1VQDA 5EKKA 2KECA 3L4GB 3HOVH 1PHJA 1ICFB 2F0WA 3BZDB 5ELOA 2YU9H 2XTIA 1QE6A 1WI5A 2TMPA 4CJ0B 3E0EA 5C3EB 2Q8TA 1A6XA 3JAML 3GO5A 1V1PB 2KOLA 2ZXPA 3NTKA 4K2LA 2OF1A 2D0PA 4YY3L 1VQ9A 1PZID 4X64L 2FINB 4TVAA 1JORA 2K7VA 1S72A 1BF4A 2F0NA 4Y7NB 2HD3A 1SRUA 1EZ8A 1I6VC 1HNWL 4YIJA 4R8IA 3KDFB 1G2SA 1XMQL 2EYHA 2RF4A 3MFGA 4HMJA 2XWJB 2O5IC 2EE1A 2R7FA 1Y1VH 3S17H 2Z6KC 4EQNA 3I4NH 2EJFC 1PRTB 4JI8Q 3FDTA 1EY6A 1U4LA 4A3DB 4H2UA 4BXXG 3MVVA 2PW7A 3LWUA 1SSOA 4GLAC 3GTGB 3GTJH 1OTCA 3S1QH 2I4NA 4XTVA 2J3LA 3RMHA 5JJIA 1BCPB 3OMGA 5DEHA 3HOYH 3S1MB 4RDXA 1DGSA 2UUCQ 4B3TQ 2K28A 2HQLA 3I91A 3AMUA 1XXGA 2EYOA 5IP9G 2ZT6A 1N32Q 1QVCA 1Y8PB 3SGIA 2B2TC 2QF7A 1X3QA 2BH2A 1RIPA 4JPBW 2RDHA 3CP0A 5FJ8H 2D0OA 2HT1A 1Y1WG 5CC4A 2DTHA 1WTQA 4P72A 3HOVB 3KBGA 3GTMH 4RHSA 2XIWA 2O5JC 2K5WA 3CMAA 2I5HA 2YU9B 2UU9Q 3GTOH 4EVOA 1S4ZA 1QNKA 1HUMA 1KLUD 4LFCQ 4AH6A 2Q2TA 3M3YH 3IRBA 1CHQD 1H9RA 1PTOF 3R2TA 2E3CA 5FLMG 3RUZA 3VA7A 4H7BA 1V9PA 4P2CB 1RODA 3E5SA 4H0LC 2KENA 2CWAA 4JI2L 1NNHA 3C1FA 1Y1VB 4JBMA 1GHKA 2J0TD 4X62L 3P8VA 3S17B 4DAMA 3EROA 1XPUA 1FYCA 3I4NB 5JOBA 3MEYA 2EYMA 1A3UA 3VDYA 1UE7A 3V8KA 3MF1A 1J8IA 3NUCA 3SHLA 2B8GA 3BDOA 4CKBA 3GTJB 3S1QB 2WAQG 4P73A 1RCVD 1EIYA 3K81C 4YRJA 5D3IB 3K5NA 3BYTB 5IOCA 4DV2L 3H0GB 1FNVA 3BYYB 3TZDA 4JI4L 3M4PA 1OXXK 4XEMA 1W66A 5IWAQ 1A8VA 1LLRD 4WJ3M 2B2WA 3HOYB 2DU5A 5IYCH 5CV8A 4RWSC 5GQOA 2H1EA 2CCZA 3RLOA 3HOXG 2QCPX 2QHVA 3J7AF 4DR6Q 4H2SA 4P3NA 2ZJPA 5ELEA 1XNQL 2K4KA 1PLFA 5FLXL 3FJPA 4DR2L 5IIFA 3IKJA 4OELB 2B2UA 5C4XH 1IBMQ 4DV5Q 3SK4A 2ZNJA 2QHTA 1DD2A 4L5SA 5T1IA 3K5LA 2D62A 2L4NA 4PZ6A 3VQVA 4FO2A 1HA5A 3Q22A 3M3YB 1AH9A 2UU9L 4KN4C 4BY1H 2DNCA 1EWHA 1X54A 4H2XA 1W2BA 1BDOA 4OX9Q 1E1TA 2VQFQ 4K0KQ 1HNZQ 1H9MA 4N8X1 3OW2A 3HXVA 4XDXA 4FXKC 4BWGB 1ATIA 4UY8C 3T53B 4XTZA 1X2GA 4C3IH 4A76A 4FDBA 3PO2H 1HA6A 2PMFA 1EFWA 4R1JA 5FO7B 4ZUJA 3SK8A 3F1ZA 3ZJYC 3I4OA 2RHQB 2Z6KA 3LNNA 5EKLA 1WTRA 4LUOA 4WJ4A 1WCMB 3CC4A 2DZ9A 2JSOA 1NJ1A 4OXPA 4OONA 2Q7GA 1B50A 3P8TA 4H44C 3UDXA 5HGQA 1K3RA 3AFPA 4NXNL 3TEHA 4TRDA 3H91A 4RQFA 4JI3Q 5BN4A 3HFZA 1H9SA 4YCUA 2E41A 4YWKA 1EEFD 5EPKA 5JAVA 2ZCEA 4NKLA 1F2YA 4J1MA 4X5OA 4LVKA 1RIQA 5M3FH 4DV3L 1CZWA 3A56A 5LL6S 4ZLTF 2G5DA 2WV6D 2JA6B 5C4XB 2KBNA 2JEBI 4ULLA 2B2TA 1HR0W 3J81c 4QQBX 1VQAA 4HMIA 4KY6A 2A6EC 2EYLA 2NTTA 1VMCA 3W5OA 1WTWA 1NYRA 1STBA 3DM3A 3NQIA 5JJZA 4X3TA 3OPOA 2ASBA 3QR8A 5DM63 1IBML 3HTZA 4DV5L 3G48A 4LFAL 4BY1B 3CCSA 2RVLA 2K14A 3MXPA 4LF9Q 3HXWA 2JN4A 2VS1A 4X3SA 1S5ED 1TS2A 1K8OA 2ZXRA 1VQBA 1WPYA 3A5ZB 1DONA 4X66L 1N34Q 4S3SA 5ELBA 1OXSC 4DV7L 1CT1D 3IG2A 4PMWA 5IGEA 4HCSA 2F0JA 2VUMH 2F4VL 3PO2B 5CYUA 4R4TA 3NTHA 4MHEA 2E2DC 4DAPA 2EYFA 1LYLA 3M85A 1EYDA 3IFTA 1SMYC 5D65A 1HR0L 4LUVA 3RR5A 1E7ZA 2UUBL 4A93B 1PYSA 5IGBA 1TKWB 3E0JA 4L5TA 4AQYQ 1PTOH 2FHTA 4FP5D 3K5OA 5C52B 4HWSA 3UDIA 3X3NA 3JAMi 3BDLA 2N78A 3DMUA 4M1UB 5DNFA 3Q0AA 4B3SL 1ZYRC 3RIRA 4JI5Q 1H4VB 1F9QA 3E3XA 5C5MA 5KNCA 3BFMA 4FNFA 1G5IA 1F2MA 4K5XA 2L15A 2HCIA 1E0BA 1S40A 5M3FB 1SLJA 4CDCC 1NTGA 1DYQA 2FFKB 5JVH3 2PZUA 2KHIA 5BN5A 2JJQA 3J7ZC 4FF1A 1S3OA 4XQJA 2AWNA 4ILWA 2VZAA 5IYDG 1GUWA 4G7OC 2CW0D 4JI6L 4IUUA 3QNEA 4L5QA 4L5RC 2RHSA 2K5DA 1D8LA 2OQKA 3Q8DA 1PTOC 3HOZG 4A3CH 1IBKQ 2NVXB 2EJGA 3CW2C 3V8LA 3PIO3 4A3GH 3FMCA 5K1XA 3D8GA 2QA4A 1WTOA 2QHSA 2ARUA 1YHBA 3OOCA 1X56A 4Q15A 3PV0A 2K32A 1B70A 1D7QA 2SNSA 4LF9L 1EWCA 1TWGH 4UP7A 4A3EG 4X65Q 2VUMB 2I07B 1JWMD 1KTKA 2QDLA 3PCOB 1NR4A 2K5NA 1SRYA 2MUYA 2OT2A 4H02A 3F8TA 3L0OA 2PYKA 4ME3A 4UPAA 2ZZEA 4K6LA 3Q23A 1JB3A 2ZIOA 5ELDA 1BBUA 5EPJA 2VW9A 3NPPA 4JI1Q 5EKIA 1JJCB 4OIJA 2UUAQ 2F0VA 1PA6A 4BBRH 3OWEB 1V43A 2K6AA 5C5LA 1QF6A 2QHUA 2EY1A 1SNPA 4KHPQ 4IUVA 1UUPA 1FR3A 2ICEC 5GADC 1KQSA 1QVGA 3J7AV 4YRPA 1E1OA 2Q2HA 1QJOA 2ZT8A 3RACA 1SR3A 2F0UA 1LT3D 2YTVA 2M2LA 4DAVA 3HKSA 1PVOA 3PGZA 1CKMA 4LUZA 1YFSA 4R4OA 3VQXA 2YYZA 3RZDB 4JOIC 2RDGA 3I8ZA 4B3ML 4CJ1B 1V8QA 2UXBL 3WOFA 1O7YA 1ZXTA 5KRUA 4AIMA 11ASA 4NXML 5E3IA 1I4PA 3HKZG 1JR0D 5I6WA 2IHFA 4IJLA 3FHWA 4A3GB 4YRNA 4QIWE 2DNEA 1SJED 1FD7D 1NR2A 3V7RA 1JOOA 3PUZA 2XNAC 3HP3A 1B9NA 1VQJA 3N52A 5A35A 4CKCA 4E51A 4YDQA 4DAYB 2E2JH 2XN9C 1EOVA 1MSHA 3AEVA 1CFMA 2WKDA 1TWGB 3QO8A 1EWIA 3TP6A 3TP8A 4JI0L 4BXXH 1AW7A 1Q3LA 1C9OA 1VMPA 3CRKC 1U4MA 3HS0C 3AFQA 4V0BA 3WQZA 2F0HA 4DK6C 5KYLA 4XQQA 1I5FA 4DV4Q 3RLFA 1Q46A 1EIFA 1OXVA 2E76C 1SMXA 3S14H 2KEEA 2ZT5A 3DXJC 4BBRB 4H13C 3KJOA 1JB7A 4GZYC 2RKSA 4DV1Q 4CDDC 5CMDA 3NXWA 5IP9H 2KHJA 1I4QA 2P0LA 5G3LF 2EL9A 3D6CA 1Y8NB 4JI1L 4LVJA 4K14A 1VQMA 1A2TA 3T56B 1ML0D 1Y1WH 1E24A 4K8IA 5GROA 3ZYYX 3NWSA 3D3RA 4IPDA 1HCZA 1PH1A 4HIKA 3A5UA 1HH2P 1HJPA 1ENCA 3DEPA 1EY7A 4ZK9B 5L37A 3D4RA 4YRSA 5AJ3Q 4HWOA 3KF8B 3D6WA 1F9RA 2L11A 1EVKA 2HDLA 3ND8A 4LF8L 4XU0A 2IX0A 4KD3A 4RKLA 3MXUA 3J81L 3PCOA 3TZUA 4CDFC 2A69C 2EYJA 5CORA 4XQNA 2IHEA 5FLMH 3M7NA 4TVAB 3KK7A 3F2DA 3T1HL 1X3FA 3W1GA 2PQAB 4WJWA 1XTDA 3STBD 1T9HA 2CIMA 2A5HA 2F0DA 1STNA 4UP9A 3TSSA 4OWTB 1JJCA 4RQEA 1C0AA 2R93G 3MA2B 2E2JB 3RZOB 1HXYD 3I55A 4HWPA 3TBIB 3RD4A 4ZKBB 2I5LX 2OEOA 1K8GA 3PSIA 4QL5A 1UAPA 2ATWA 3W1BA 3DEOA 4F7XA 3HFVA 2DU7A 4CKEA 1KLGD 2IX3A 1HPCA 5ELFA 3H3VH 2NUCA 3S14B 3CRLC 1MGSA 2KUMA 5D14A 1V1OA 2ZNIA 2L55A 1L2FA 5IODA 5A2QL 3HOXH 3KOJA 1IKMA 4QGUA 1AP0A 4J8QA 3RKXA 5J22A 5LMUL 2RA4A 4IURA 5JPNC 3LSQA 2EZVA 3EBEA 1EQVA 2J4XA 4IN3A 4R9WA 2K05A 5DM73 3QO2A 3A7AA 1Y1WB 2X6LA 2BOSA 1NY4A 3UE0A 1I4RA 1XMOQ 4C3HG 3PMFA 4LVMA 4PG3A 1F77A 3C3LA 1I4GA 2JA7G 5E1FA 1R9TH 4DAYA 2YTYA 1UWVA 1SE3A 4ALPA 3F2BA 1LT4D 1IL2A 2A1AA 4IPGA 1HTTA 4FF2A 2SEBD 4L6TB 1JJGA 1PZJD 1I94Q 3UGTA 4JOIA 1GM5A 1PFBA 1D1IA 1L0XB 4RCNA 3RLNA 1H4TA 4DK0A 1KL9A 2PI2E 3ER0A 3NE5B 3HOUG 2WACA 2Z0SA 5AJ3L 1SN8A 3K7AB 3PZCA 3VQWA 4PMCA 4TTVA 4NPSA 3K58A 2PZTA 1LTRD 1TU2B 1PV4A 2HHHL 1PH4A 1A62A 3W3AA 4KHZA 1MD2D 5HY6A 3L2PA 4RG1A 2I4MA 1QZGA 4H2TA 3LWEA 1KRSA 1G91A 4NCXA 1BBWA 1HZBA 4C3JG 1VQNA 4DXFA 5IGFA 2WAQB 3BZCA 4ZQ3A 2B63G 1EIYB 4KKUA 2D9UA 1KD1C 3MXNB 4OGQC 1D1KA 1VQLA 1Z47A 3BU2A 5CBEE 4DUYQ 2F3WA 2ODRD 1XX8A 4DR7L 5F5WA 1B44D 3J80E 2EY5A 2PMZB 3SDZA 1Y14B 5EGTA 4XU1A 5ELNA 3DSQA 1TS5A 3KF8A 5C44G 2RCNA 3K7UC 3CD6A 3ONAB 4U68A 3PQIA 1IYJB 4DNIA 2K50A 3OWFA 1GD7A 2K75A 1WVLA 1AN8A 2F4IA 1IZ6A 2V1CC 2CW0C 2WB1G 4FYDA 4WI1A 2PQAA 5LMNL 4N8FA 3VA5A 1SJHD 2ZT9C 3CC7A 1PH3A 1ASYA 1R9TB 4LF4L 3VR5A 1YNJD 3H3VI 3I3CA 1FJGQ 4RGNA 2A6HC 3CMQA 3PO3B 4YHHL 2F0SA 2JA8G 1G2TA 1UEBA 1GVPA 3R07A 2XSCA 4DR4Q 5JEAG 1WFQA 4KTAA 4DV6Q 1UEAB 3MC0B 4H2XB 3WOEA 3J81j 3HXYA 1Q8IA 1GHJA 5IT9c 4OL7A 3K57A 1J9OA 3KF6A 4ABNA 1X6OA 1HZCA 1SDFA 2JQOA 4EQPA 4KKSA 4LNQA 1KMNA 2ZXFA 4BY7G 1TR5A 4GNXC 3SVMA 4JC0A 1QZHA 1K0SA 4MZ9A 1NSNS 4EX5A 2EQSA 2CKZB 4N9PA 3HY1A 1LTAD 1K8AC 5J1ZA 1Q12A 1KABA 1HNXL 2RSNA 5K1PA 1OXUA 2Y0SG 2E2HH 1R4PB 4GKKQ 3CPWA 2ZTGA 4LFBQ 1YHAA 2J3MA 4LAAA 1P8LA 1KNEA 3TEHB 3I7FA 3HFZB 4ZUIA 4YRIA 5K36G 1H9SB 3HXXA 5J3BA 1PH5A 1EYCA 1UE1A 2B2VA 1KC8C 3QWNA 1G51A 3I2ZA 1CKNB 4EO4A 1KAWA 2SNMA 2IY5B 4LNSA 3RF1A 5C53B 5IYDH 2EOTA 4RA8A 5KGUA 4BS9A 1TXYA 3BDCA 1LM0A 4XTCS 3ITPA 4LJZC 1GUNA 1UNSA 1YVCA 2CQOA 4QUFA 5JJLA 2I4OA 1DXMA 5JEAJ 4P3OA 2EVBA 2ZZGA 2RDFA 4DV0Q 3HOZH 1MI2A 1IXRA 2NBFA 5M5YH 2NVYH 3KLSX 1KIXA 3MXNA 3U4VA 1WYDA 3ULPA 2OWOA 4X6AH 3IAYA 4LF5Q 2K33A 2QGQA 4JI8L 3Q6SA 2R7DA 2WB1E 3CCEA 2ZJQA 3OD1A 1HFGA 4NW2A 1B1ZA 1ENAA 4A3EH 2LXKA 3HY0A 1IL8A 4XTWA 2WKCA 4DK1A 1EQQA 3I72A 5KNNA 1ICWA 2DN8A 2IW3A 1CHPD 1USYA 3SE0A 2UUCL 1EY9A 1ET9A 4YCVA 4B3TL 1PYSB 2E2HB 2AKWA 1PFNA 3UE1A 3GTMB 2HCCA 2ID0A 2E8GA 1N32L 1IW7C 4DR1Q 3HZXA 1I6HH 1HC7A 3K8AA 3GTOB 2Q7HA 5M9OA 2N3SA 4F8MA 1SNQA 4C2MH 2CFMA 5KIXA 3J81i 1SNMA 1JMCA 1N33Q 4XTXA 3URYA 4BBSG 4QIWB 4HWRA 3OMCA 5C3EG 3UI2A 2R7ZG 4CBVA 2L9HA 3ICEA 3EFSA 3S9WA 3DWQA 4NMZA 3HG9A 5C4JH 3UGQA 3UDGA 2DTIA 3P8YA 3L1AA 2WINB 2FXQA 2CJBA 1B2TA 1B7YA 5COYA 1ET6A 4KMUC 3MEFA 5F2DA 1AEXA 4LFCL 2CJAA 3C1EA 4XXEA 1Z7NA 1NBWA 2Y0SE 4DR3Q 3CCVA 3D4WA 3P20A 3RN5A 4G7ZC 2RHSB 3RKWA 1NJ2A 3HOZB 3S16H 3WDNA 3R2IA 1G5HA 2DXUA 3R8BA 2NB0A 4NB3A 4LF6Q 2EJ9A 5IP7G 2D5DA 5M5YB 5KYIA 2NVYB 1I50H 5JJKA 2EJFA 1L1OC 5CV4A 4K87A 4JVZA 1WTXA 4E6IA 1QVFA 1TWAH 4DU9A 1TY0A 1LTLA 4B9WA 3M4YA 1PH9A 1WNLA 1B70B 4QUCA 4A3EB 3A5YA 4B9XA 2PCFB 4LF5L 2PNRC 2NVTH 2O2LD 4A3LG 1BIAA 2A68C 2K5QA 2ZZFA 1CKNA 5IWAL 3TEGA 4QJFA 1ESFA 2XRSD 1NJ5A 2M00A 4GNXA 2IY5A 3EQLC 2ZTEA 4JI7Q 2BE5C 2EXZA 1Z7TA 1PH6A 4DR6L 3K0YA 1Q1EA 1I6HB 1L1OB 4IOAA 4C2MB 4HA8A 3S1RH 4P71C 1VQCA 1VCIA 3WWVA 1EQTA 3RKYA 1WTPA 3CCUA 2AHOB 5CV7A 1PH7A 1TS3A 1KMMA 4OO1G 1G6PA 1PFMA 2HIVA 2E2IH 4JBKA 2ZT7A 4ZCKA 3TQYA 4F88A 2P5IA 1B9MA 3REUA 5IE8A 1DOKA 1I4XA 3SK6A 4AYBG 2B8FA 5EBDA 5I9PA 1CZGA 4C3IB 3NBIA 4A3MG 5IGCA 3S16B 1XNRQ 4OX9L 2VQFL 4K0KL 3HKZB 1HNZL 2MHVA 4FF3A 4A3IG 2G4CA 4I7AA 2R3ZA 1I50B 3SR1A 4DR3L 4KR3A 2LSSA 3D31A 2A8VA 1DZ1A 3FP9A 3QIAA 3OW7A 3FPUB 2R93H 3H0GG 1TWAB 3A74A 3J80c 2ZINA 1WU7A 2AWOA 1CKOA 1X3GA 3G4SA 4CH4A 1EL0A 4YPFA 2HQEA 3GD7A 1XTCD 3MZ5A 2UXCQ 4N9TA 3EIVA 4YWLA 3T13A 1EY0A 4CH3A 3MHBA 3HGBA 1X65A 5H1SE 1NCVA 1STGA 3C46A 3AU7A 3NENA 1TVXA 4JI3L 5IT9L 1ZKOA 1T5EA 4KJNA 5FJ8G 3QTCA 2L0CA 1GKHA 1X3EA 3TREA 1M1KC 4KY5A 2AMCA 2JA9A 2R61A 3FKIH 1GJXA 4Q6GA 1CA5A 1QCBD 2B2YC 2VB3X 2Z6BA 1WQWA 2V4DA 4IJHA 3BJUA 1PRTD 2LMCB 4MTKA 4K88A 1YHQA 1J6QA 3W2DA 3DM1A 4C3HH 3M9BA 2E2IB 2A19A 3IKLA 3DWAA 2EIFA 1YNJC 2RSOA 4WRDA 2JA7H 1EQRA 1YEZA 3OTOQ 1E2WA 4B08A 2E75C 1NJIC 3FEWX 3ULLA 2FYKA 1BCPD 1JOKA 5BN3A 1VDZA 5IYBG 2EWNA 1VQFA 2BDOA 1A3VA 1SYGA 3DHQA 2VNUD 2I4LA 3V7SA 4XT3B 4JK1C 4C1NI 3GP7A 1BR9A 1IBLQ 4POGA 3VYSA 4HSPA 4KJOA 3OYYA 4IFDG 3HOUH 4YRQA 1RL2A 5BR8Q 2DJFC 1N34L 1C7YA 3GTPH 1KHIA 1PTOB 4YRGA 5CR3A 2R93B 1WCMG 2AQ2B 2KHSA 3S15H 2KQ3A 1UE6A 4CH5A 4G85A 4IALA 1L1OA 4TQDA 1HRJA 3PIOA 1RHPA 2NZOA 2PQEA 2JA5G 2K03A 4C3JH 4AQYL 3AQQA 3CC2A 4AYBE 3PUXA 1VQ6A 4GOPC 2XWBB 1VF7A 3KUPA 2B63H 1A3TA 1BO0A 2VQEQ 2JXMB 4JI5L 3ULJA 4LMQD 2P5ZX 1PYBA 1M4VA 3HXUA 4YYEA 2UXCL 3QO7A 3D0FA 2XVSA 3GDEA 2JA6G 1LO5D 3FKIB 5I6YA 4KQEA 4GN4B 5C44H 4DR5Q 3A7LA 1MIUA 1GUGA 1NUCA 1XJVA 1NMFA 4ZTUB 2IWHA 3V05A 2ZR3A 2NZ1D 4NP5A 3QO5A 3A7AB 3ERRA 4C3HB 1ILQA 1JE5A 5CV6A 1NE3A 4JYAQ 1BCPF 3GV6A 2F0PA 5I9OA 2OQ0A 1DM0B 2DGYA 5FKAC 2LY7A 3CCLA 4IFDJ 1DOLA 1RDPD 1O7LA 1IBKL 4DK3C 1O7ZA 1N9WA 2HIXA 1TY2A 4OWWB 1M8AA 4XIGS 5K5PA 3K5MA 2JA8H 2E5AA 2JK8A 2EY6A 5I2YA 1CA6A 4GKJQ 4RH6A 4XTYA 1GOZA 1QILA 3K6OA 3S24A 3HOUB 1QWYA 1S5FD 1Q81C 5JEAH 3A32A 4DFAA 1SNCA 4C56C 4A93G 4QMGA 2F0LA 4XYQA 4X65L 2X6GA 3S15B 1N36Q 5EJWA 2E64A 4YROA 3KBXA 5EAYA 1SEBD 5M5XH 4HIOA 4BY7H 2F0OA 2PI2A 4QF4A 1K28A 4C3JB 5FOBB 3NEMA 2VXWA 2UUAL 2XGTA 3CMEA 2JE6I 4DUZQ 4LWCA 2K52A 2PPBC 4KHPL 2MGSA 1J5EQ 4A3KG 1W6KA 2X69A 3VYRA 4ZTZB 2OTJA 1G8ZD 1H9KA 4F87A 4B3RQ 5C44B 5E4WC 4XEOA 5K36H 2N49A 1QUQA 1NNXA 3CCQA 3EFRA 4O1NA 4K5WA 3BZKA 2NS6A 2B3GA 2L5TA 2WB1B 1V1QA 4JV5Q 3FRPB 2NN6G 3VR6A 5TSSA 1SAPA 4PQXA 3GTQH 3QB3A 2D2CC 3PUVA 4EQ5A 5KEEA 4UDUC 3I73A 1QG7A 1GXDC 1BOSA 2HNIA 3H6MA 1STEA 2F0IA 2A74C 4JG2A 4DPGA 4HR7B 3AYHB 2QDBA 1M90C 3G71A 1GO3E 3CKIB 4K86A 2LFNA 2Q8RE 4CS3A 3NK9A 4G7HC 4YRLA 3LX0A 3P1HA 1F9PA 4A3FG 2JP1A 4BA2I 5IGGA 1B4OA 5M5XB 3EVQA 4DV4L 3KF6B 1LACA 1VQHA 4BY7B 2IT1A 4YRRA 4FXGC 3PUYA 1VQ7A 1Q1BA 3QJYA 4PHCA 1EU4A 12ASA 3A31A 1FNWA 1JWUD 5CV5A 3J80L 1RD9D 2BA1A 2Y0SB 3T16A 2ALYB 5GAEC 4DV1L 1SERA 2QKIC 2BCOA 2WP8J 1CK1A 4YY3Q 3PIP3 4KLKA 2E10A 4X64Q 2EAYA 3KLRA 2AQ1B 4BBSH 5C3EH 2CH4A 4K2KA 2R7ZH 2A6ED 3T4AC 1Q7YC 2G9HD 3A7UA 1XMQQ 4V190 3MAQA 1A63A 1WQ7A 2EYPA 5KNDA 2DUDA 3UH0A 1W6JA 3W3SA 4RMFA 3CQZH 2ZM6Q 4Y7NH 1Q8KA 3MQZA 3LGJA 3EA6A 3GTQB 4WFN3 1R4QB 2C5CA 2C7IA 1RKNA 5LMNW 1EY8A 4DXGA 1SYFA 3OIQA 1UE5A 4APVA 1FVIA 1BIBA 5CBAE 3L2ZA 4BWAA 2EDGA 5IP7H 3TN2A 1STHA 1HXDA 3ICAA 1CM9A 3F2UA 4MIUA 1WJJA 1HTPA 3S2HH 1LTBD 2Q7EA 3EFXD 1PXUA 3GTGH 3VYTA 1GUTA 1SYDA 2DJGC 3E9IA 3G6EA 1LT6D 1C8CA 1WOCA 2KEDA 4G57A 1NYQA 1SMYD 3U9SA 2Z9HA 4O42A 1X9NA 5I4DA 1VQKA 2DTOA 3LSSA 3NETA 3HOXB 2ZXOA 2I0QA 4P75C 2Q2UA 3A8KE 4A3LH 1EOTA 3NSWA 4HWTA 1YGBA 1PMRA 2A8EA 5HGTA 1MKHA 2MQHA 2A73B 5DAUA 5A2QE 3I4MG 4HSVA 4HJ8A 4IPHA 3M4OH 2F0GA 3NHHA 2AKWB 4IZ8A 1U9RA 4XT1B 1JQYD 3SEBA 3L3OC 1PRTC 2I5MX 5IGDA 5C0XG 4R4IA 4BBSB 2MJ8A 4C1NK 1XMOL 2Z8LA 2R7ZB 5C3WA 1XPRA 4O0AA 3HOWG 4JI2Q 4OO1H 2HDMA 3BVMA 4X3UA 1SESA 1BCPC 1SNOA 4X62Q 3CXCA 3CQZB 4R4QA 2ARSA 4FVMA 1TT2A 4YP0A 4DKAC 1PTOD 2R92G 3NBHB 1B7YB 1I94L 4G84A 3J7YW 3CU7A 1YI2A 1X01A 1I4HA 2IJ0A 1K0RA 5M5WH 1OO9B 2ZR2A 4A3MH 3NP8A 2ZM6L 4DV2Q 1VF5C 4I65A 2AUKA 4JI4Q 1ENFA 4J15A 3SK5A 1S5CD 2EJMA 3DWPA 4RCOA 4A3IH 3BVZA 3S2HB 3RGLA 1XWEA 3KYHC 1Q86C 4TWAA 4DQ2A 1WTHA 4L63B 2ALYA 1GUOA 2Z4HA 4KN7C 3N6RA 3H0GH 1BBXC 3TS2A 1D5ZC 3CAMA 1QNUA 1XNQQ 4PZ8A 4JBJA 4KHVA 1U4PA 2YV5A 3QOLA 4O2DA 4RAUC 1XPOA 4MTNA 4DR2Q 1BUVT 3BS1A 2N55A 4TVYA 3SXHA 4UAIA 3OSOA 2VL6A 1SYCA 4IOCA 3GTLH 2C8MA 1HTLD 4DUYL 2IL8A 4ZAIA 1CI3M 5HURA 5C0XJ 1ADJA 2I46A 4A3JG 3M4OB 1HZ9A 4TKOB 4GNXB 1JJ2A 3A0JA 3GV3A 1EFID 3JAME 1O80A 2Q5IA 1PDQA 1X3PA 1RJTA 1IYVA 2RQXA 1HZAA 2OTLA 3L9AX 2F3VA 2MP1A 1ONLA 3OIPA 4KKTA 5E4XA 1VQZA 1KNAA 4IUQA 2XRQD 3TDQA 1NMGA 2DQ0A 5T1GA 3TMEA 2ZGWA 3NQTA 4YRKA 1VQIA 2F0KA 3TP7A 1KDAA 4A75A 1FJGL 1JWSD 4A3BG 2ZTDA 3A7RA 1EIGA 1A0IA 5IYBH 4AYBB 1SFOH 1IHZA 5M5WB 4A3MB 3EN2A 4ME5A 2E65A 4J6HA 3NTIA 4DR4L 2CGHA 4DV6L 4OIKA 4A3IB 4IFDH 1YFRA 5GAGC 5M3MG 4NXNQ 3MWYW 4HEDA 1VS0A 4HJAA 1F2LA 1WCMH 1PH2A 4A4IA 1AZQA 4OO1I 3L4GA 4BW9A 4FXDA 1EZ6A 4DV3Q 1LTSD 1SYBA 1FYFA 2NZHA 3PF5A 3P75A 2JA5H 1SE4A 4TSSA 4NDXA 4HVCA 5E7NA 1V1PA 1T5XD 1YJWA 1G291 3GTLB 4GKKL 4LFBL 4IUNA 4P74C 4P75A 1KAAA 4K6DA 4L8JA 1LT5D 1ZEQX 4KK7A 5FO9B 2LS01 4PV1C 2F0MA 2JA6H 3S1NH 3KDFA 3NBHA 1H4QA 1SBBB 4KV6A 3H15A 4LFAQ 1JT8A 2AMCB 3U4ZA 4HAEA 4IQZA 1EUJA 4KI0A 3H94A 4GLVB 3R3OA 1TWHH 1HQMC 2EJGC 1HQRD 1MJCA 1WD1A 1Y8OB 3MF2A 5FK9C 1N8RC 2DQ3A 2PW5A 1A2UA 5GAHC 3PO3G 3STBC 2N88A 3NWTA 2F03A 3K80C 4X66Q 3HRZC 4A3DG 4LF7Q 4HCEA 2ZJRA 4DV7Q 1YZ6A 1AE3A 2F4VQ 4DV0L 1JCKB 2A69D 3RL6A 1D6EC 1SFOB 1B8AA 3ERQA 4QY7A 3A8IE 3VQYA 2H5XA 5FO8B 1HR0Q 2UUBQ 4G4KA 3X3MA 3FPPA 3J80i 3TS0A 1H9JA 3KJPA 2NVQH 3MEHA 3I70A 4B3SQ 1D2BA 2JEAI 1WD0A 1H4SA 2Q5HA 2IX1A 5IY0A 4A93H 2K1BA 3VR4A 2F52A 1WLEA 4ODGA 2KCCA 1EU3A 3CCJA 2TSSA 2PO4A 1IYUA 3HOVG 3L7ZC 5FLXE 1YIJA 2JA5B 1K83H 3H09A 1K9MC 2RCFA 2CWPA 3GTKH 4POFA 1AE2A 1CQFA 1CUKA 4JCVE 2Q2IA 3T1YQ 4JI6Q 3HRKA 2EXDA 5C4JB 4DR1L 3KFUA 4HIDA 1HFNA 1YNND 4DF7A 1AFPA 1HHVA 2K04A 4IFDI 1N33L 3S1NB 4A3KH 3UDFA 2WAQE 3HXZA 3CHBD 4LVIA 2ENBA 1TWHB 1C48A 3IKMB 1Y1VG 2GVAA 1FGUA 4RFBA 1GUSA 1S5BD 2KJXA 3I4NG 4OP0A 4XTUA 5J39A 2PMZE 2F1MA 2NN6H 2NVXH 2IPKD 1RTOA 1X2HA 2F0FA 4CDEC 4Q5VA 3LC0A 1EYAA 1VQPA 4LF6L 1BNZA 1O78A 1EEID 3V8JA 3A55A 5EQ0A 4HN7A 4LF7L 2QW7A 2SDFA 1TWFH 3RN2A 3HOYG 2RBMA 2NVQB 2NVTB 2OCEA 4DNTB 4ID6A 4YRTA 4DGZA 1D5XC 2ODRC 2ZIMA 1DOMA 3BG3A 4ZRZA 2F3IA 3MTSA 1SXTA 3V96A 1JOQA 5E3FA 2N8NA 4HIMA 2FMCA 4P3PA 4A3FH 4U673 1ILPA 5ISRA 4IUTA 3E6ZX 3FVQA 3TUPA 1X55A 1FGBD 1K83B 3J7A5 1B3QA 1NJ6A 2KA7A 3QOJA 5NUCA 3S1RB 1LV9A 3I56A 1SYEA 4JI7L 5I2XA 4MN3A 3GTKB 1TWCH 1O7IA 1CQVA 1LTTD 3DUZA 2CVRA 4IO9A 2DEQA 3TP5A 2L12A 1VQGA 4CJ2C 4LK1C 1K73C 4B3MQ 4UHVA 3BVGA 5AFWA 4A3KB 2L1BA 2B39A 1VQ4A 5JVG3 1PH8A 2UXBQ 2GA4B 4P74A 3CPFA 2AQ3B 3M4QA 4NXMQ 2MFIA 2M9VA 3T1YL 1ASZA 1EY5A 1E3PA 1LTID 4HJ5A 3RZDH 3G6JB 1YJ9A 2YTXA 4WF2A 1QUQB 3P7JA 2NYZD 2O4XA 2DKGA 4KR2A 1II3A 3CF5A 4CH6A 4CGYB 4H2WA 2RHQA 4K5VA 2BDNA 4YRMA 1FNUA 2A6HD 1NAPA 1MHWC 2K5VA 2B29A 4XU2A 4JI0Q 2CHBD 3QG1A 1XNRL 2DVEA 4RKBA 1KDCA 1X32A 5D3DA 1L0YB 2F0TA 4KD4A 3EJIA 3VR3A 1TWFB 4R4CA 5IYCG 2WFWA 2E74C 4L87A 1YNXA 3CCMA 4LW1A 4CS2A 3HRIA 1SROA 3E9HA 4GN3B 2KCMA 3JAMc 1BXTA 4A3FB 2Z4IA 2DY7A 2GN5A 3G7LA 2NN6I 5C4XG 2G9DA 1QE0A 3U50C 3B6YA 1E2VA 4IPCA 1RTNA 5IT9E 3S2DH 2DDZA 1Z9FA 1VQOA 2LXJA 1PRTF 4GLXA 2K01A 1TWCB 3RNUA 1B76A 1FL0A 4OLFA 2WIIB 2PNHA 3I4MH 1VQEA 3REXA 5G3LD 4P71A 1S5DD 5ELCA 4TQFA 5C4ZA 4BY1G 1MJEA 4PMBA 2C35B 4ZIBA 2VB2X 2JA7B 4HJ7A 4GOPB 4LF8Q 4RGMA 5KNBA 5JPMC 5C0XH 2QEJC 1F2ZA 3A5ZA 4IUPA 3T1HQ 3G1ZA 1YFTA 4ZKCB 3HOWH 1BVSA 3OTOL 2H4OA 3GQBA 3U58A 4C3IG 1A15A 2KVMA 4YRFA 4Y52H 3PO2G 3GTPB 2DZCA 1QOHA 5DLQE 2R92H 2K5HA 4XYOA 2R6GA 4QB4A 4GS3A 1IBLL 1BKBA 1I3QH 1KOGA 4RGTA 1ADYA 1Q82C 2DY8A 4OEMB 2PMEA 3RZOH 1YJNA 1Z7MA 5BR8L 3MXGA 5EBCA 3PF4A 2SOBA 1JICA 3IFDA 4H2VA 5EPLA 2KCTA 1SNDA 2FJ2A 1C4QA 4M8AA 2UXDQ 2B63B 1E2ZA 1EY4A 5M3FG 1STAA 5LMUQ 4TVWA 3DLLA 1U0LA 3ND9A 1LTGD 1Q90A 3R93A 1KRTA 1RF2D 1W3SA 3A54A 1J5WA 2EPBA 3S2DB 2VQEL 1DCZA 1NJ8A 1MSGA 2NTSA 2OXPA 4OWXB 4YCWA 1G6ZA 3UFGA 1IW7D 4Z9CB 4CHTB 1BQQT 1CTMA 3I4MB 2ARTA 3I90A 2B2YA 3K59A 4A3JH 5CGKA 3VYUA 1VQ5A 1F9SA 4DR5L 1Z6HA 4CS4A 1TS4A 1EIHA 1YB3A 1D5MC 2BH8A 4KY7A 2BA0A 2EY2A 3ERSX 3V2TA 4EQOA 3NELA 1DJRD 4QCLA 4MNOA 3HOWB 1H95A 4JYAL 2ZTCA 2FMMA 2JA8B 2MO1A 4HTHA 1PFSA 2F0QA 4RHRA 4YRCA 1LABA 2HHHQ 2CJ9A 5CV9A 1STYA 2VUMG 2LKVA 4XU3A 2KCNA 1WTVA 4TQUS 1GGMA 4A3BH 2R92B 1SETA 4YREA 3K7AH 2E5LQ 1SE8A 4Q0FA 4HJ9A 1I3QB 5FLXc 4GKJL 4HT4A 5C3XA 4ZYSA 4JBWA 1XYIA 1P16A 2HUGA 4K8JA 1KXLA 2PZWA 1EVLA 4H2YA 3MFYA 3T51B 2QILA 3M7GA 4DN4M 5M3MH 5C0XI 3RUXA 1K3BC 1N36L 1AZPA 1JE4A 2DJZA 4OHJA 3HEJA 4DR7Q 2Q8IB 4P72C 1B3AA 1IKLA 1CSQA 4UP8A 4RGOS 3AB9A 1EYGA 2A68D 3F2CA 2ES2A 4GOPA 3HKZE 2GVBA 1B53A 1L0WA 1LUZA 4FF4A 1CSPA 2VY3A 1YITA 2J7ZA 2UXDL 2DXTA 3K0XA 2B2VC 1PYWD 1U4RA 3FKIG 1MBYA 2BE5D 3VR2A 4DUZL 3D4DA 4GN5A 1OXTA 3KLSA 3PUWA 5LMNQ 3U9OA 3IALA 1YNNC 1HNWQ 3I4LA 4I7ZC 3IL8A 1J5EL 2CH4W 4DNRB 2Z1CA 4A3JB 2JYOA 2F0EA 4LF4Q 1TQOA 4BA1I 3OHXC 4A3CG 4B3RL 3TRZA 2NWGA 5C6AA 5LL6X 2CQAA 4YHHQ 4A3GG 5C4HA 4WORA 4EGVA 1ESRA 3J81E 4X3KA 4JV5L 3O13A 4YWMA 1U5KA 3PO3H 3H3VC 4P73C 3C2PA 4LVLA 4PZ7A 3PIPA 3KLWA 3V7CA 2AUJD 4A3DH 4JW0A 4PNYA 3CCRA 2MPMA 4A3BB 1TIID 2B2WC 3VBBA 1SE2A 1QB5D 1PZKD 4R8NA 2MNAA 2QEXA 1Y69U 5C51B 3A8JE 3JC66 1HUNA 2C9OA
chains in the Genus database with same CATH topology
4BBRG 3S1MH 1HNXQ 1USYC 2E5LL 2MO0A 1YBYA 1E22A 2E1HA 1VQ8A 1VQDA 3L4GB 3HOVH 1PHJA 5ELOA 2YU9H 2XTIA 1WI5A 3E0EA 3GO5A 4YY3L 2D0PA 1VQ9A 4X64L 4TVAA 1S72A 1SRUA 1HNWL 3KDFB 1XMQL 2RF4A 2R7FA 1Y1VH 3S17H 2Z6KC 3I4NH 4JI8Q 4H2UA 4BXXG 4GLAC 3GTJH 1OTCA 3S1QH 2I4NA 4XTVA 2J3LA 5JJIA 3HOYH 4RDXA 1DGSA 2UUCQ 4B3TQ 2HQLA 5IP9G 2ZT6A 1N32Q 1QVCA 3SGIA 2BH2A 1RIPA 3CP0A 5FJ8H 2D0OA 2HT1A 1Y1WG 2DTHA 4P72A 3GTMH 3CMAA 2I5HA 2UU9Q 3GTOH 4LFCQ 4AH6A 2Q2TA 3M3YH 3IRBA 2E3CA 5FLMG 1V9PA 2KENA 2CWAA 4JI2L 1NNHA 4JBMA 4X62L 3P8VA 4DAMA 1XPUA 3MEYA 3VDYA 1UE7A 3V8KA 3MF1A 1EIYA 2WAQG 4P73A 3K81C 4YRJA 4DV2L 4JI4L 3M4PA 1OXXK 4XEMA 1W66A 5IWAQ 1A8VA 4WJ3M 2DU5A 5IYCH 5GQOA 2CCZA 3RLOA 3HOXG 2QHVA 4DR6Q 4H2SA 4P3NA 2ZJPA 1XNQL 2K4KA 3FJPA 4DR2L 5C4XH 1IBMQ 4DV5Q 2ZNJA 2QHTA 4L5SA 2D62A 4PZ6A 3VQVA 1AH9A 2UU9L 4BY1H 1X54A 4H2XA 1W2BA 4OX9Q 1E1TA 2VQFQ 4K0KQ 1HNZQ 3OW2A 3HXVA 1ATIA 4UY8C 4XTZA 1X2GA 4C3IH 4A76A 4FDBA 3PO2H 2PMFA 1EFWA 4R1JA 3ZJYC 3F1ZA 3I4OA 2RHQB 2Z6KA 4LUOA 4WJ4A 3CC4A 2DZ9A 1NJ1A 4OXPA 4OONA 2Q7GA 3P8TA 3UDXA 5HGQA 1K3RA 3AFPA 4NXNL 3TEHA 4RQFA 4JI3Q 3HFZA 4YCUA 2E41A 4YWKA 2ZCEA 4X5OA 4LVKA 1RIQA 5M3FH 4DV3L 2KBNA 2JEBI 1HR0W 3J81c 4QQBX 1VQAA 3W5OA 1NYRA 3DM3A 2ASBA 3HTZA 1IBML 4DV5L 3G48A 4LFAL 3CCSA 2K14A 4LF9Q 3HXWA 2VS1A 1VQBA 1WPYA 3A5ZB 4X66L 1N34Q 4DV7L 1OXSC 3IG2A 4PMWA 2VUMH 2F4VL 4R4TA 1LYLA 3M85A 1HR0L 2UUBL 4LUVA 3RR5A 1E7ZA 1PYSA 4L5TA 4AQYQ 5C52B 4HWSA 3UDIA 3JAMi 4B3SL 2N78A 3RIRA 4JI5Q 1H4VB 3BFMA 1G5IA 2L15A 1S40A 1SLJA 1NTGA 2KHIA 2JJQA 3J7ZC 1S3OA 2AWNA 2VZAA 5IYDG 4JI6L 3QNEA 4L5QA 4L5RC 2RHSA 1D8LA 2OQKA 3Q8DA 3HOZG 4A3CH 1IBKQ 2EJGA 3CW2C 3V8LA 4A3GH 5K1XA 2QA4A 2QHSA 2ARUA 1YHBA 1X56A 4Q15A 3PV0A 1B70A 1D7QA 4LF9L 1TWGH 4UP7A 4A3EG 4X65Q 3PCOB 2K5NA 1SRYA 4H02A 3F8TA 3L0OA 4ME3A 4UPAA 2ZZEA 2ZIOA 1BBUA 2VW9A 4JI1Q 1JJCB 2UUAQ 1PA6A 4BBRH 1V43A 1QF6A 2QHUA 4KHPQ 5GADC 1KQSA 1QVGA 4YRPA 1E1OA 2Q2HA 2ZT8A 3RACA 1SR3A 2YTVA 3HKSA 1PVOA 3PGZA 1CKMA 4LUZA 1YFSA 4R4OA 3VQXA 2YYZA 4JOIC 4B3ML 2UXBL 4AIMA 11ASA 4NXML 5E3IA 3HKZG 2IHFA 4IJLA 3FHWA 4YRNA 4QIWE 3V7RA 3PUZA 1VQJA 4E51A 4YDQA 4DAYB 2E2JH 1EOVA 3AEVA 3QO8A 1EWIA 4JI0L 4BXXH 1C9OA 3AFQA 3WQZA 4DK6C 1I5FA 4DV4Q 3RLFA 1Q46A 1EIFA 1OXVA 1SMXA 3S14H 2ZT5A 3KJOA 1JB7A 4DV1Q 5IP9H 2KHJA 2P0LA 2EL9A 4JI1L 4LVJA 1VQMA 1Y1WH 1E24A 5GROA 4IPDA 1PH1A 4HIKA 3A5UA 1HH2P 1HJPA 4YRSA 5AJ3Q 4HWOA 3KF8B 1EVKA 4LF8L 4XU0A 2IX0A 3PCOA 5FLMH 2IHEA 3M7NA 4TVAB 3F2DA 3T1HL 1X3FA 3W1GA 2PQAB 1XTDA 3STBD 1T9HA 2CIMA 4UP9A 4OWTB 1JJCA 4RQEA 1C0AA 2R93G 3I55A 4HWPA 2I5LX 1K8GA 3PSIA 4QL5A 2ATWA 3W1BA 3HFVA 2DU7A 3H3VH 2ZNIA 1L2FA 3HOXH 3KOJA 4QGUA 3RKXA 5LMUL 3LSQA 3EBEA 3A7AA 1NY4A 3UE0A 1XMOQ 4LVMA 4PG3A 2JA7G 1R9TH 2YTYA 1UWVA 4ALPA 3F2BA 1IL2A 2A1AA 4IPGA 1HTTA 1JJGA 1I94Q 3UGTA 4JOIA 1GM5A 3RLNA 1H4TA 1KL9A 2PI2E 3ER0A 3HOUG 2Z0SA 5AJ3L 1SN8A 3PZCA 3VQWA 4TTVA 4NPSA 1PV4A 2HHHL 1PH4A 1A62A 4KHZA 5HY6A 3L2PA 4RG1A 2I4MA 1QZGA 4H2TA 1KRSA 4NCXA 1BBWA 1HZBA 1VQNA 3BZCA 2B63G 1EIYB 1KD1C 3MXNB 1VQLA 1Z47A 3BU2A 2ODRD 4DUYQ 4DR7L 5F5WA 4XU1A 1Y14B 5ELNA 3DSQA 5C44G 2RCNA 3K7UC 3CD6A 1IYJB 4DNIA 2K50A 1GD7A 2K75A 1IZ6A 2V1CC 2WB1G 4WI1A 2PQAA 5LMNL 3CC7A 1ASYA 1PH3A 4LF4L 3H3VI 1FJGQ 3CMQA 4YHHL 2JA8G 1UEBA 1GVPA 3R07A 4DR4Q 5JEAG 1WFQA 4DV6Q 4H2XB 3J81j 3HXYA 5IT9c 3KF6A 1X6OA 1HZCA 2JQOA 4LNQA 1KMNA 2ZXFA 4BY7G 4GNXC 4JC0A 1QZHA 4MZ9A 4EX5A 2EQSA 2CKZB 3HY1A 1K8AC 1Q12A 1HNXL 5K1PA 1OXUA 2Y0SG 2E2HH 4GKKQ 3CPWA 2ZTGA 4LFBQ 1YHAA 2J3MA 1P8LA 3TEHB 3I7FA 3HFZB 4YRIA 5K36G 3HXXA 5J3BA 1PH5A 1KC8C 1UE1A 1G51A 3I2ZA 1CKNB 4EO4A 1KAWA 2IY5B 4LNSA 3RF1A 5C53B 5IYDH 1TXYA 1LM0A 4XTCS 1YVCA 2CQOA 5JJLA 2I4OA 5JEAJ 4P3OA 2ZZGA 4DV0Q 3HOZH 1IXRA 5M5YH 2NVYH 1KIXA 3U4VA 1WYDA 3ULPA 2OWOA 4X6AH 4LF5Q 2QGQA 4JI8L 2R7DA 2WB1E 3CCEA 2ZJQA 3OD1A 4A3EH 2LXKA 3HY0A 4XTWA 1EQQA 5KNNA 1USYA 2UUCL 4YCVA 4B3TL 1PYSB 2AKWA 3UE1A 2ID0A 2E8GA 1N32L 4DR1Q 1I6HH 1HC7A 3K8AA 2Q7HA 2N3SA 4C2MH 2CFMA 1JMCA 3J81i 1N33Q 4XTXA 4BBSG 4HWRA 5C3EG 2R7ZG 3ICEA 3EFSA 5C4JH 3UGQA 3UDGA 2DTIA 3P8YA 3L1AA 2FXQA 2CJBA 1B7YA 3MEFA 4LFCL 2CJAA 1Z7NA 1NBWA 2Y0SE 4DR3Q 3CCVA 3RN5A 2RHSB 3RKWA 1NJ2A 3S16H 1G5HA 2DXUA 4NB3A 4LF6Q 2EJ9A 5IP7G 1I50H 5JJKA 2EJFA 1L1OC 4K87A 1QVFA 1TWAH 1WNLA 1LTLA 1PH9A 1B70B 3A5YA 4LF5L 2NVTH 4A3LG 1BIAA 2ZZFA 1CKNA 5IWAL 3TEGA 4QJFA 1NJ5A 2IY5A 4GNXA 2ZTEA 4JI7Q 1PH6A 4DR6L 1Q1EA 1L1OB 4IOAA 4HA8A 3S1RH 4P71C 1VQCA 1VCIA 3WWVA 3RKYA 3CCUA 2AHOB 1PH7A 1KMMA 4OO1G 1G6PA 2HIVA 2E2IH 4JBKA 2ZT7A 3TQYA 2P5IA 3REUA 5IE8A 4AYBG 4A3MG 1XNRQ 4OX9L 2VQFL 4K0KL 1HNZL 4A3IG 2G4CA 4DR3L 4KR3A 2LSSA 3D31A 2A8VA 3FP9A 2R93H 3H0GG 3J80c 3A74A 2ZINA 1WU7A 2AWOA 1X3GA 1CKOA 3G4SA 4CH4A 4YPFA 3GD7A 2UXCQ 3EIVA 4YWLA 4CH3A 5H1SE 1X65A 3NENA 4JI3L 5FJ8G 3QTCA 1GKHA 1X3EA 3TREA 1M1KC 2AMCA 2JA9A 3FKIH 4Q6GA 1WQWA 4IJHA 3BJUA 4K88A 1YHQA 1J6QA 4C3HH 3M9BA 2A19A 3IKLA 2EIFA 2JA7H 1EQRA 1YEZA 3OTOQ 1NJIC 3ULLA 2FYKA 5IYBG 2EWNA 1VQFA 2VNUD 2I4LA 3V7SA 1IBLQ 4POGA 3OYYA 4IFDG 3HOUH 4YRQA 1RL2A 5BR8Q 1N34L 1C7YA 3GTPH 1KHIA 4YRGA 1WCMG 3S15H 1UE6A 4CH5A 4G85A 1L1OA 4TQDA 3PIOA 2NZOA 2JA5G 4C3JH 4AQYL 3AQQA 3CC2A 4AYBE 3PUXA 1VQ6A 4GOPC 2B63H 2VQEQ 4JI5L 3ULJA 1PYBA 3HXUA 4YYEA 2UXCL 3QO7A 3D0FA 3GDEA 2JA6G 4KQEA 4GN4B 5C44H 4DR5Q 1MIUA 1XJVA 1NMFA 4ZTUB 2ZR3A 3QO5A 3ERRA 1JE5A 1NE3A 4JYAQ 2OQ0A 2DGYA 3CCLA 4IFDJ 1IBKL 4DK3C 1N9WA 2HIXA 4OWWB 4XIGS 2JA8H 2E5AA 2JK8A 4GKJQ 4XTYA 3S24A 1Q81C 3A32A 4A93G 4X65L 1N36Q 2E64A 4YROA 5EAYA 5M5XH 4HIOA 4BY7H 2PI2A 3NEMA 2UUAL 2XGTA 3CMEA 2JE6I 4DUZQ 4LWCA 2K52A 4KHPL 1J5EQ 4A3KG 4ZTZB 2OTJA 4B3RQ 4XEOA 2N49A 1QUQA 3CCQA 3EFRA 3BZKA 2NS6A 2B3GA 1V1QA 4JV5Q 2NN6G 3GTQH 4EQ5A 3PUVA 2HNIA 4JG2A 4DPGA 3AYHB 1M90C 3G71A 1GO3E 4K86A 4CS3A 4YRLA 4A3FG 4BA2I 4DV4L 3KF6B 1VQHA 2IT1A 4YRRA 3PUYA 1VQ7A 1Q1BA 4PHCA 3A31A 12ASA 2BA1A 2ALYB 5GAEC 4DV1L 1SERA 2WP8J 4YY3Q 2E10A 4KLKA 4X64Q 2EAYA 4BBSH 5C3EH 2R7ZH 1Q7YC 3A7UA 1XMQQ 1A63A 1WQ7A 2DUDA 3UH0A 3W3SA 4RMFA 3CQZH 2ZM6Q 4Y7NH 1Q8KA 3MQZA 3LGJA 2C7IA 5LMNW 4APVA 1UE5A 1FVIA 1BIBA 3L2ZA 4BWAA 5IP7H 1HXDA 3ICAA 1WJJA 3S2HH 2Q7EA 3GTGH 3E9IA 3G6EA 1WOCA 1NYQA 1X9NA 1VQKA 3LSSA 2DTOA 3NETA 2I0QA 4P75C 2Q2UA 4A3LH 4HWTA 1YGBA 2A8EA 1MKHA 2MQHA 3I4MG 4HJ8A 4IPHA 3M4OH 2AKWB 2I5MX 5C0XG 4R4IA 1XMOL 1XPRA 4O0AA 3HOWG 4JI2Q 1SESA 4X62Q 3CXCA 2ARSA 4R4QA 4YP0A 4DKAC 2R92G 3NBHB 1B7YB 1I94L 4G84A 1X01A 1YI2A 1K0RA 5M5WH 2ZR2A 4A3MH 2ZM6L 4DV2Q 4JI4Q 4J15A 4A3IH 3RGLA 3KYHC 1Q86C 4TWAA 4DQ2A 2ALYA 3TS2A 3H0GH 3CAMA 1XNQQ 4PZ8A 4JBJA 2YV5A 4O2DA 1XPOA 4MTNA 4DR2Q 4TVYA 2VL6A 4IOCA 3GTLH 2C8MA 4DUYL 5C0XJ 1ADJA 4A3JG 1HZ9A 4GNXB 1JJ2A 3A0JA 2Q5IA 1HZAA 2OTLA 1VQZA 1NMGA 2DQ0A 2ZGWA 4YRKA 1VQIA 4A75A 1FJGL 4A3BG 2ZTDA 3A7RA 1A0IA 5IYBH 1SFOH 3EN2A 2E65A 4DR4L 2CGHA 4DV6L 1YFRA 5GAGC 5M3MG 4NXNQ 1VS0A 4HJAA 1WCMH 1PH2A 4A4IA 4OO1I 3L4GA 4BW9A 4DV3Q 1FYFA 2NZHA 3PF5A 2JA5H 4HVCA 5E7NA 1YJWA 1G291 4GKKL 4LFBL 4P74C 4P75A 2JA6H 3S1NH 3KDFA 1H4QA 3H15A 4LFAQ 1JT8A 2AMCB 3U4ZA 1EUJA 4KI0A 4GLVB 1TWHH 1MJCA 3MF2A 1N8RC 2DQ3A 5GAHC 3PO3G 3STBC 3K80C 4X66Q 4A3DG 4LF7Q 2ZJRA 4DV7Q 1YZ6A 1AE3A 2F4VQ 4DV0L 3RL6A 1B8AA 4QY7A 3VQYA 2H5XA 1HR0Q 2UUBQ 3J80i 3TS0A 3KJPA 2NVQH 4B3SQ 2JEAI 1H4SA 2Q5HA 2IX1A 5IY0A 4A93H 2F52A 1WLEA 3CCJA 3HOVG 3L7ZC 1YIJA 1K83H 1K9MC 2CWPA 3GTKH 4POFA 1AE2A 1CUKA 4JCVE 2Q2IA 3T1YQ 4JI6Q 3HRKA 2EXDA 4DR1L 3KFUA 4HIDA 4IFDI 1N33L 4A3KH 3UDFA 2WAQE 3HXZA 4LVIA 3IKMB 1Y1VG 2GVAA 1FGUA 3I4NG 4OP0A 4XTUA 2PMZE 2NVXH 1X2HA 3LC0A 1VQPA 4LF6L 3V8JA 4LF7L 1TWFH 3RN2A 3HOYG 2OCEA 4YRTA 2ODRC 2ZIMA 2F3IA 2N8NA 4HIMA 4P3PA 4A3FH 3TUPA 1X55A 3J7A5 1NJ6A 3I56A 4JI7L 1TWCH 1O7IA 4IO9A 2DEQA 1VQGA 1K73C 4B3MQ 1VQ4A 1PH8A 2UXBQ 4P74A 3CPFA 3M4QA 4NXMQ 2MFIA 3T1YL 1ASZA 1E3PA 4HJ5A 3RZDH 1YJ9A 2YTXA 4WF2A 1QUQB 4KR2A 2DKGA 3CF5A 4CH6A 4H2WA 2RHQA 4YRMA 2K5VA 2B29A 4XU2A 4JI0Q 1XNRL 2DVEA 4R4CA 5IYCG 2WFWA 4L87A 1YNXA 3CCMA 4LW1A 4CS2A 3HRIA 1SROA 3E9HA 4GN3B 2KCMA 3JAMc 2GN5A 2NN6I 5C4XG 1QE0A 3U50C 3B6YA 4IPCA 3S2DH 2DDZA 1Z9FA 1VQOA 2LXJA 4GLXA 3RNUA 1B76A 1FL0A 4OLFA 2PNHA 3I4MH 1VQEA 3REXA 4P71A 4TQFA 4BY1G 1MJEA 2C35B 4ZIBA 4HJ7A 4GOPB 4LF8Q 3A5ZA 3T1HQ 3G1ZA 1YFTA 3HOWH 1BVSA 3OTOL 3U58A 4YRFA 4Y52H 3PO2G 2DZCA 5DLQE 2R92H 2K5HA 2R6GA 4GS3A 1IBLL 1BKBA 1I3QH 1KOGA 1ADYA 1Q82C 2PMEA 3RZOH 1YJNA 1Z7MA 5BR8L 3PF4A 4H2VA 2KCTA 2UXDQ 5M3FG 5LMUQ 4TVWA 3DLLA 1U0LA 1KRTA 1W3SA 1J5WA 2VQEL 1NJ8A 4OWXB 4YCWA 3UFGA 2ARTA 4A3JH 1VQ5A 4DR5L 4CS4A 1YB3A 2BH8A 2BA0A 3ERSX 3NELA 1H95A 4MNOA 4JYAL 2ZTCA 2MO1A 1PFSA 4YRCA 2HHHQ 2CJ9A 2VUMG 4XU3A 4TQUS 1GGMA 4A3BH 1SETA 4YREA 3K7AH 2E5LQ 1SE8A 4HJ9A 5FLXc 4GKJL 4HT4A 4JBWA 1P16A 1KXLA 1EVLA 4H2YA 5M3MH 5C0XI 3RUXA 2DJZA 1N36L 4DR7Q 4P72C 4UP8A 1CSQA 1EYGA 3F2CA 2ES2A 4GOPA 3HKZE 2GVBA 1L0WA 1LUZA 1CSPA 2VY3A 1YITA 2UXDL 2DXTA 3K0XA 3FKIG 4DUZL 4GN5A 1OXTA 3PUWA 5LMNQ 3IALA 1HNWQ 1J5EL 4LF4Q 4BA1I 4A3CG 4B3RL 3TRZA 4YHHQ 4A3GG 4JV5L 4YWMA 1U5KA 3PO3H 4P73C 4LVLA 4PZ7A 3PIPA 3KLWA 3V7CA 4A3DH 3CCRA 3VBBA 2MNAA 2QEXA 5C51B 3JC66
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBR G;  3S1M H;  1HNX Q;  1USY C;  2E5L L;  2MO0 A;  1YBY A;  1E22 A;  2E1H A;  1VQ8 A;  1VQD A;  3L4G B;  3HOV H;  1PHJ A;  5ELO A;  2YU9 H;  2XTI A;  1WI5 A;  3E0E A;  3GO5 A;  4YY3 L;  2D0P A;  1VQ9 A;  4X64 L;  4TVA A;  1S72 A;  1SRU A;  1HNW L;  3KDF B;  1XMQ L;  2RF4 A;  2R7F A;  1Y1V H;  3S17 H;  2Z6K C;  3I4N H;  4JI8 Q;  4H2U A;  4BXX G;  4GLA C;  3GTJ H;  1OTC A;  3S1Q H;  2I4N A;  4XTV A;  2J3L A;  5JJI A;  3HOY H;  4RDX A;  1DGS A;  2UUC Q;  4B3T Q;  2HQL A;  5IP9 G;  2ZT6 A;  1N32 Q;  1QVC A;  3SGI A;  2BH2 A;  1RIP A;  3CP0 A;  5FJ8 H;  2D0O A;  2HT1 A;  1Y1W G;  2DTH A;  4P72 A;  3GTM H;  3CMA A;  2I5H A;  2UU9 Q;  3GTO H;  4LFC Q;  4AH6 A;  2Q2T A;  3M3Y H;  3IRB A;  2E3C A;  5FLM G;  1V9P A;  2KEN A;  2CWA A;  4JI2 L;  1NNH A;  4JBM A;  4X62 L;  3P8V A;  4DAM A;  1XPU A;  3MEY A;  3VDY A;  1UE7 A;  3V8K A;  3MF1 A;  1EIY A;  2WAQ G;  4P73 A;  3K81 C;  4YRJ A;  4DV2 L;  4JI4 L;  3M4P A;  1OXX K;  4XEM A;  1W66 A;  5IWA Q;  1A8V A;  4WJ3 M;  2DU5 A;  5IYC H;  5GQO A;  2CCZ A;  3RLO A;  3HOX G;  2QHV A;  4DR6 Q;  4H2S A;  4P3N A;  2ZJP A;  1XNQ L;  2K4K A;  3FJP A;  4DR2 L;  5C4X H;  1IBM Q;  4DV5 Q;  2ZNJ A;  2QHT A;  4L5S A;  2D62 A;  4PZ6 A;  3VQV A;  1AH9 A;  2UU9 L;  4BY1 H;  1X54 A;  4H2X A;  1W2B A;  4OX9 Q;  1E1T A;  2VQF Q;  4K0K Q;  1HNZ Q;  3OW2 A;  3HXV A;  1ATI A;  4UY8 C;  4XTZ A;  1X2G A;  4C3I H;  4A76 A;  4FDB A;  3PO2 H;  2PMF A;  1EFW A;  4R1J A;  3ZJY C;  3F1Z A;  3I4O A;  2RHQ B;  2Z6K A;  4LUO A;  4WJ4 A;  3CC4 A;  2DZ9 A;  1NJ1 A;  4OXP A;  4OON A;  2Q7G A;  3P8T A;  3UDX A;  5HGQ A;  1K3R A;  3AFP A;  4NXN L;  3TEH A;  4RQF A;  4JI3 Q;  3HFZ A;  4YCU A;  2E41 A;  4YWK A;  2ZCE A;  4X5O A;  1RIQ A;  5M3F H;  4DV3 L;  2KBN A;  2JEB I;  1HR0 W;  3J81 c;  4QQB X;  1VQA A;  3W5O A;  1NYR A;  3DM3 A;  2ASB A;  3HTZ A;  1IBM L;  4DV5 L;  3G48 A;  4LFA L;  3CCS A;  2K14 A;  4LF9 Q;  3HXW A;  2VS1 A;  1VQB A;  1WPY A;  3A5Z B;  4X66 L;  1N34 Q;  4DV7 L;  1OXS C;  3IG2 A;  4PMW A;  2VUM H;  2F4V L;  4R4T A;  1LYL A;  3M85 A;  1HR0 L;  2UUB L;  4LUV A;  3RR5 A;  1E7Z A;  1PYS A;  4L5T A;  4AQY Q;  5C52 B;  4HWS A;  3UDI A;  3JAM i;  4B3S L;  2N78 A;  3RIR A;  4JI5 Q;  1H4V B;  3BFM A;  1G5I A;  2L15 A;  1S40 A;  1SLJ A;  1NTG A;  2KHI A;  2JJQ A;  3J7Z C;  1S3O A;  2AWN A;  2VZA A;  5IYD G;  4JI6 L;  3QNE A;  4L5Q A;  4L5R C;  2RHS A;  1D8L A;  2OQK A;  3Q8D A;  3HOZ G;  4A3C H;  1IBK Q;  2EJG A;  3CW2 C;  3V8L A;  4A3G H;  5K1X A;  2QA4 A;  2QHS A;  2ARU A;  1YHB A;  1X56 A;  4Q15 A;  3PV0 A;  1B70 A;  1D7Q A;  4LF9 L;  1TWG H;  4UP7 A;  4A3E G;  4X65 Q;  3PCO B;  2K5N A;  1SRY A;  4H02 A;  3F8T A;  3L0O A;  4ME3 A;  4UPA A;  2ZZE A;  2ZIO A;  1BBU A;  2VW9 A;  4JI1 Q;  1JJC B;  2UUA Q;  1PA6 A;  4BBR H;  1V43 A;  1QF6 A;  2QHU A;  4KHP Q;  5GAD C;  1KQS A;  1QVG A;  4YRP A;  1E1O A;  2Q2H A;  2ZT8 A;  3RAC A;  1SR3 A;  2YTV A;  3HKS A;  1PVO A;  3PGZ A;  1CKM A;  4LUZ A;  1YFS A;  4R4O A;  3VQX A;  2YYZ A;  4JOI C;  4B3M L;  2UXB L;  4AIM A;  11AS A;  4NXM L;  5E3I A;  3HKZ G;  2IHF A;  4IJL A;  3FHW A;  4YRN A;  4QIW E;  3V7R A;  3PUZ A;  1VQJ A;  4E51 A;  4YDQ A;  4DAY B;  2E2J H;  1EOV A;  3AEV A;  3QO8 A;  1EWI A;  4JI0 L;  4BXX H;  1C9O A;  3AFQ A;  3WQZ A;  4DK6 C;  1I5F A;  4DV4 Q;  3RLF A;  1Q46 A;  1EIF A;  1OXV A;  1SMX A;  3S14 H;  2ZT5 A;  3KJO A;  1JB7 A;  4DV1 Q;  5IP9 H;  2KHJ A;  2P0L A;  2EL9 A;  4JI1 L;  1VQM A;  1Y1W H;  1E24 A;  5GRO A;  4IPD A;  1PH1 A;  4HIK A;  3A5U A;  1HH2 P;  1HJP A;  4YRS A;  5AJ3 Q;  4HWO A;  3KF8 B;  1EVK A;  4LF8 L;  4XU0 A;  2IX0 A;  3PCO A;  5FLM H;  2IHE A;  3M7N A;  4TVA B;  3F2D A;  3T1H L;  1X3F A;  3W1G A;  2PQA B;  1XTD A;  3STB D;  1T9H A;  2CIM A;  4UP9 A;  4OWT B;  1JJC A;  4RQE A;  1C0A A;  2R93 G;  3I55 A;  4HWP A;  2I5L X;  1K8G A;  3PSI A;  4QL5 A;  2ATW A;  3W1B A;  3HFV A;  2DU7 A;  3H3V H;  2ZNI A;  1L2F A;  3HOX H;  3KOJ A;  4QGU A;  3RKX A;  5LMU L;  3LSQ A;  3EBE A;  3A7A A;  1NY4 A;  3UE0 A;  1XMO Q;  4PG3 A;  2JA7 G;  1R9T H;  2YTY A;  1UWV A;  4ALP A;  3F2B A;  1IL2 A;  2A1A A;  4IPG A;  1HTT A;  1JJG A;  1I94 Q;  3UGT A;  4JOI A;  1GM5 A;  3RLN A;  1H4T A;  1KL9 A;  2PI2 E;  3ER0 A;  3HOU G;  2Z0S A;  5AJ3 L;  1SN8 A;  3PZC A;  3VQW A;  4TTV A;  4NPS A;  1PV4 A;  2HHH L;  1PH4 A;  1A62 A;  4KHZ A;  5HY6 A;  3L2P A;  4RG1 A;  2I4M A;  1QZG A;  4H2T A;  1KRS A;  4NCX A;  1BBW A;  1HZB A;  1VQN A;  3BZC A;  2B63 G;  1EIY B;  1KD1 C;  3MXN B;  1VQL A;  1Z47 A;  3BU2 A;  2ODR D;  4DUY Q;  4DR7 L;  5F5W A;  4XU1 A;  1Y14 B;  5ELN A;  3DSQ A;  5C44 G;  2RCN A;  3K7U C;  3CD6 A;  1IYJ B;  4DNI A;  2K50 A;  1GD7 A;  2K75 A;  1IZ6 A;  2V1C C;  2WB1 G;  4WI1 A;  2PQA A;  5LMN L;  3CC7 A;  1ASY A;  1PH3 A;  4LF4 L;  3H3V I;  1FJG Q;  3CMQ A;  4YHH L;  2JA8 G;  1UEB A;  1GVP A;  3R07 A;  4DR4 Q;  5JEA G;  1WFQ A;  4DV6 Q;  4H2X B;  3J81 j;  3HXY A;  5IT9 c;  3KF6 A;  1X6O A;  1HZC A;  2JQO A;  4LNQ A;  1KMN A;  2ZXF A;  4BY7 G;  4GNX C;  4JC0 A;  1QZH A;  4MZ9 A;  4EX5 A;  2EQS A;  2CKZ B;  3HY1 A;  1K8A C;  1Q12 A;  1HNX L;  5K1P A;  1OXU A;  2Y0S G;  2E2H H;  4GKK Q;  3CPW A;  2ZTG A;  4LFB Q;  1YHA A;  2J3M A;  1P8L A;  3TEH B;  3I7F A;  3HFZ B;  4YRI A;  5K36 G;  3HXX A;  5J3B A;  1PH5 A;  1KC8 C;  1UE1 A;  1G51 A;  3I2Z A;  1CKN B;  4EO4 A;  1KAW A;  2IY5 B;  4LNS A;  3RF1 A;  5C53 B;  5IYD H;  1TXY A;  1LM0 A;  4XTC S;  1YVC A;  2CQO A;  5JJL A;  2I4O A;  5JEA J;  4P3O A;  2ZZG A;  4DV0 Q;  3HOZ H;  1IXR A;  5M5Y H;  2NVY H;  1KIX A;  3U4V A;  1WYD A;  3ULP A;  2OWO A;  4X6A H;  4LF5 Q;  2QGQ A;  4JI8 L;  2R7D A;  2WB1 E;  3CCE A;  2ZJQ A;  3OD1 A;  4A3E H;  2LXK A;  3HY0 A;  4XTW A;  1EQQ A;  5KNN A;  1USY A;  2UUC L;  4YCV A;  4B3T L;  1PYS B;  2AKW A;  3UE1 A;  2ID0 A;  2E8G A;  1N32 L;  4DR1 Q;  1I6H H;  1HC7 A;  3K8A A;  2Q7H A;  2N3S A;  4C2M H;  2CFM A;  1JMC A;  3J81 i;  1N33 Q;  4XTX A;  4BBS G;  4HWR A;  5C3E G;  2R7Z G;  3ICE A;  3EFS A;  5C4J H;  3UGQ A;  3UDG A;  2DTI A;  3P8Y A;  3L1A A;  2FXQ A;  2CJB A;  1B7Y A;  3MEF A;  4LFC L;  2CJA A;  1Z7N A;  1NBW A;  2Y0S E;  4DR3 Q;  3CCV A;  3RN5 A;  2RHS B;  3RKW A;  1NJ2 A;  3S16 H;  1G5H A;  2DXU A;  4NB3 A;  4LF6 Q;  2EJ9 A;  5IP7 G;  1I50 H;  5JJK A;  2EJF A;  1L1O C;  4K87 A;  1QVF A;  1TWA H;  1WNL A;  1LTL A;  1PH9 A;  1B70 B;  3A5Y A;  4LF5 L;  2NVT H;  4A3L G;  1BIA A;  2ZZF A;  1CKN A;  5IWA L;  3TEG A;  4QJF A;  1NJ5 A;  2IY5 A;  4GNX A;  2ZTE A;  4JI7 Q;  1PH6 A;  4DR6 L;  1Q1E A;  1L1O B;  4IOA A;  4HA8 A;  3S1R H;  4P71 C;  1VQC A;  1VCI A;  3WWV A;  3RKY A;  3CCU A;  2AHO B;  1PH7 A;  1KMM A;  4OO1 G;  1G6P A;  2HIV A;  2E2I H;  4JBK A;  2ZT7 A;  3TQY A;  2P5I A;  3REU A;  5IE8 A;  4AYB G;  4A3M G;  1XNR Q;  4OX9 L;  2VQF L;  4K0K L;  1HNZ L;  4A3I G;  2G4C A;  4DR3 L;  4KR3 A;  2LSS A;  3D31 A;  2A8V A;  3FP9 A;  2R93 H;  3H0G G;  3J80 c;  3A74 A;  2ZIN A;  1WU7 A;  2AWO A;  1X3G A;  1CKO A;  3G4S A;  4CH4 A;  4YPF A;  3GD7 A;  2UXC Q;  3EIV A;  4YWL A;  4CH3 A;  5H1S E;  1X65 A;  3NEN A;  4JI3 L;  5FJ8 G;  3QTC A;  1GKH A;  1X3E A;  3TRE A;  1M1K C;  2AMC A;  2JA9 A;  3FKI H;  4Q6G A;  1WQW A;  4IJH A;  3BJU A;  4K88 A;  1YHQ A;  1J6Q A;  4C3H H;  3M9B A;  2A19 A;  3IKL A;  2EIF A;  2JA7 H;  1EQR A;  1YEZ A;  3OTO Q;  1NJI C;  3ULL A;  2FYK A;  5IYB G;  2EWN A;  1VQF A;  2VNU D;  2I4L A;  3V7S A;  1IBL Q;  4POG A;  3OYY A;  4IFD G;  3HOU H;  4YRQ A;  1RL2 A;  5BR8 Q;  1N34 L;  1C7Y A;  3GTP H;  1KHI A;  4YRG A;  1WCM G;  3S15 H;  1UE6 A;  4CH5 A;  4G85 A;  1L1O A;  4TQD A;  3PIO A;  2NZO A;  2JA5 G;  4C3J H;  4AQY L;  3AQQ A;  3CC2 A;  4AYB E;  3PUX A;  1VQ6 A;  4GOP C;  2B63 H;  2VQE Q;  4JI5 L;  3ULJ A;  1PYB A;  3HXU A;  4YYE A;  2UXC L;  3QO7 A;  3D0F A;  3GDE A;  2JA6 G;  4KQE A;  4GN4 B;  5C44 H;  4DR5 Q;  1MIU A;  1XJV A;  1NMF A;  4ZTU B;  2ZR3 A;  3QO5 A;  3ERR A;  1JE5 A;  1NE3 A;  4JYA Q;  2OQ0 A;  2DGY A;  3CCL A;  4IFD J;  1IBK L;  4DK3 C;  1N9W A;  2HIX A;  4OWW B;  4XIG S;  2JA8 H;  2E5A A;  2JK8 A;  4GKJ Q;  4XTY A;  3S24 A;  1Q81 C;  3A32 A;  4A93 G;  4X65 L;  1N36 Q;  2E64 A;  4YRO A;  5EAY A;  5M5X H;  4HIO A;  4BY7 H;  2PI2 A;  3NEM A;  2UUA L;  2XGT A;  3CME A;  2JE6 I;  4DUZ Q;  4LWC A;  2K52 A;  4KHP L;  1J5E Q;  4A3K G;  4ZTZ B;  2OTJ A;  4B3R Q;  4XEO A;  2N49 A;  1QUQ A;  3CCQ A;  3EFR A;  3BZK A;  2B3G A;  1V1Q A;  4JV5 Q;  2NN6 G;  3GTQ H;  4EQ5 A;  3PUV A;  2HNI A;  4JG2 A;  4DPG A;  3AYH B;  1M90 C;  3G71 A;  1GO3 E;  4K86 A;  4CS3 A;  4YRL A;  4A3F G;  4BA2 I;  4DV4 L;  3KF6 B;  1VQH A;  2IT1 A;  4YRR A;  3PUY A;  1VQ7 A;  1Q1B A;  4PHC A;  3A31 A;  12AS A;  2BA1 A;  2ALY B;  5GAE C;  4DV1 L;  1SER A;  2WP8 J;  4YY3 Q;  2E10 A;  4KLK A;  4X64 Q;  2EAY A;  4BBS H;  5C3E H;  2R7Z H;  1Q7Y C;  3A7U A;  1XMQ Q;  1A63 A;  1WQ7 A;  2DUD A;  3UH0 A;  3W3S A;  4RMF A;  3CQZ H;  2ZM6 Q;  4Y7N H;  1Q8K A;  3LGJ A;  2C7I A;  5LMN W;  4APV A;  1UE5 A;  1FVI A;  1BIB A;  3L2Z A;  4BWA A;  5IP7 H;  1HXD A;  3ICA A;  1WJJ A;  3S2H H;  2Q7E A;  3GTG H;  3E9I A;  3G6E A;  1WOC A;  1NYQ A;  1X9N A;  1VQK A;  3LSS A;  2DTO A;  3NET A;  2I0Q A;  4P75 C;  2Q2U A;  4A3L H;  4HWT A;  1YGB A;  1MKH A;  2MQH A;  3I4M G;  4HJ8 A;  4IPH A;  3M4O H;  2AKW B;  2I5M X;  5C0X G;  4R4I A;  1XMO L;  1XPR A;  4O0A A;  3HOW G;  4JI2 Q;  1SES A;  4X62 Q;  3CXC A;  2ARS A;  4R4Q A;  4YP0 A;  4DKA C;  2R92 G;  3NBH B;  1B7Y B;  1I94 L;  4G84 A;  1X01 A;  1YI2 A;  1K0R A;  5M5W H;  2ZR2 A;  4A3M H;  2ZM6 L;  4DV2 Q;  4JI4 Q;  4J15 A;  4A3I H;  3RGL A;  3KYH C;  1Q86 C;  4TWA A;  4DQ2 A;  2ALY A;  3TS2 A;  3H0G H;  3CAM A;  1XNQ Q;  4PZ8 A;  4JBJ A;  2YV5 A;  4O2D A;  1XPO A;  4MTN A;  4DR2 Q;  4TVY A;  2VL6 A;  4IOC A;  3GTL H;  2C8M A;  4DUY L;  5C0X J;  1ADJ A;  4A3J G;  1HZ9 A;  4GNX B;  1JJ2 A;  3A0J A;  2Q5I A;  1HZA A;  2OTL A;  1VQZ A;  1NMG A;  2DQ0 A;  2ZGW A;  4YRK A;  1VQI A;  4A75 A;  1FJG L;  4A3B G;  2ZTD A;  3A7R A;  1A0I A;  5IYB H;  1SFO H;  3EN2 A;  2E65 A;  4DR4 L;  2CGH A;  4DV6 L;  1YFR A;  5GAG C;  5M3M G;  4NXN Q;  1VS0 A;  4HJA A;  1WCM H;  1PH2 A;  4A4I A;  4OO1 I;  3L4G A;  4BW9 A;  4DV3 Q;  1FYF A;  2NZH A;  3PF5 A;  2JA5 H;  4HVC A;  5E7N A;  1YJW A;  1G29 1;  4GKK L;  4LFB L;  4P74 C;  4P75 A;  2JA6 H;  3S1N H;  3KDF A;  1H4Q A;  3H15 A;  4LFA Q;  1JT8 A;  2AMC B;  3U4Z A;  1EUJ A;  4KI0 A;  4GLV B;  1TWH H;  1MJC A;  3MF2 A;  1N8R C;  2DQ3 A;  5GAH C;  3PO3 G;  3STB C;  3K80 C;  4X66 Q;  4A3D G;  4LF7 Q;  2ZJR A;  4DV7 Q;  1YZ6 A;  1AE3 A;  2F4V Q;  4DV0 L;  3RL6 A;  1B8A A;  4QY7 A;  3VQY A;  2H5X A;  1HR0 Q;  2UUB Q;  3J80 i;  3TS0 A;  3KJP A;  2NVQ H;  4B3S Q;  2JEA I;  1H4S A;  2Q5H A;  2IX1 A;  5IY0 A;  4A93 H;  2F52 A;  1WLE A;  3CCJ A;  3HOV G;  3L7Z C;  1YIJ A;  1K83 H;  1K9M C;  2CWP A;  3GTK H;  4POF A;  1AE2 A;  1CUK A;  4JCV E;  2Q2I A;  3T1Y Q;  4JI6 Q;  3HRK A;  2EXD A;  4DR1 L;  3KFU A;  4HID A;  4IFD I;  1N33 L;  4A3K H;  3UDF A;  2WAQ E;  3HXZ A;  3IKM B;  1Y1V G;  2GVA A;  1FGU A;  3I4N G;  4OP0 A;  4XTU A;  2PMZ E;  2NVX H;  1X2H A;  3LC0 A;  1VQP A;  4LF6 L;  3V8J A;  4LF7 L;  1TWF H;  3RN2 A;  3HOY G;  2OCE A;  4YRT A;  2ODR C;  2ZIM A;  2F3I A;  2N8N A;  4HIM A;  4P3P A;  4A3F H;  3TUP A;  1X55 A;  3J7A 5;  1NJ6 A;  3I56 A;  4JI7 L;  1TWC H;  1O7I A;  4IO9 A;  2DEQ A;  1VQG A;  1K73 C;  4B3M Q;  1VQ4 A;  1PH8 A;  2UXB Q;  4P74 A;  3CPF A;  3M4Q A;  4NXM Q;  2MFI A;  3T1Y L;  1ASZ A;  1E3P A;  4HJ5 A;  3RZD H;  1YJ9 A;  2YTX A;  4WF2 A;  1QUQ B;  4KR2 A;  2DKG A;  3CF5 A;  4CH6 A;  4H2W A;  2RHQ A;  4YRM A;  2K5V A;  2B29 A;  4XU2 A;  4JI0 Q;  1XNR L;  2DVE A;  4R4C A;  5IYC G;  2WFW A;  4L87 A;  1YNX A;  3CCM A;  4LW1 A;  4CS2 A;  3HRI A;  1SRO A;  3E9H A;  4GN3 B;  2KCM A;  3JAM c;  2GN5 A;  2NN6 I;  5C4X G;  1QE0 A;  3U50 C;  3B6Y A;  4IPC A;  3S2D H;  2DDZ A;  1Z9F A;  1VQO A;  2LXJ A;  4GLX A;  3RNU A;  1B76 A;  1FL0 A;  4OLF A;  2PNH A;  3I4M H;  1VQE A;  3REX A;  4P71 A;  4TQF A;  4BY1 G;  1MJE A;  2C35 B;  4ZIB A;  4HJ7 A;  4GOP B;  4LF8 Q;  3A5Z A;  3T1H Q;  3G1Z A;  1YFT A;  3HOW H;  1BVS A;  3OTO L;  3U58 A;  4YRF A;  4Y52 H;  3PO2 G;  2DZC A;  5DLQ E;  2R92 H;  2K5H A;  2R6G A;  4GS3 A;  1IBL L;  1BKB A;  1I3Q H;  1KOG A;  1ADY A;  1Q82 C;  2PME A;  3RZO H;  1YJN A;  1Z7M A;  5BR8 L;  3PF4 A;  4H2V A;  2KCT A;  2UXD Q;  5M3F G;  5LMU Q;  4TVW A;  3DLL A;  1U0L A;  1KRT A;  1W3S A;  1J5W A;  2VQE L;  1NJ8 A;  4OWX B;  4YCW A;  3UFG A;  2ART A;  4A3J H;  1VQ5 A;  4DR5 L;  4CS4 A;  1YB3 A;  2BH8 A;  2BA0 A;  3ERS X;  3NEL A;  1H95 A;  4MNO A;  4JYA L;  2ZTC A;  2MO1 A;  1PFS A;  4YRC A;  2HHH Q;  2CJ9 A;  2VUM G;  4XU3 A;  4TQU S;  1GGM A;  4A3B H;  1SET A;  4YRE A;  3K7A H;  2E5L Q;  1SE8 A;  4HJ9 A;  5FLX c;  4GKJ L;  4JBW A;  1P16 A;  1KXL A;  1EVL A;  4H2Y A;  5M3M H;  5C0X I;  3RUX A;  2DJZ A;  1N36 L;  4DR7 Q;  4P72 C;  4UP8 A;  1CSQ A;  1EYG A;  3F2C A;  2ES2 A;  4GOP A;  3HKZ E;  2GVB A;  1L0W A;  1LUZ A;  1CSP A;  2VY3 A;  1YIT A;  2UXD L;  2DXT A;  3K0X A;  3FKI G;  4DUZ L;  4GN5 A;  1OXT A;  3PUW A;  5LMN Q;  3IAL A;  1HNW Q;  1J5E L;  4LF4 Q;  4BA1 I;  4A3C G;  4B3R L;  3TRZ A;  4YHH Q;  4A3G G;  4JV5 L;  4YWM A;  1U5K A;  3PO3 H;  4P73 C;  4PZ7 A;  3PIP A;  3KLW A;  3V7C A;  4A3D H;  3CCR A;  3VBB A;  2MNA A;  2QEX A;  5C51 B;  3JC6 6; 
#chains in the Genus database with same CATH topology
 1K8M A;  4BBR G;  2ICI A;  3S1M H;  1JC7 A;  1HNX Q;  1USY C;  2E5L L;  5M3M B;  1KDB A;  2MO0 A;  1ZYR D;  1YBY A;  2B2U C;  1E22 A;  2E1H A;  5LHY 1;  4DA2 A;  3Q24 A;  1VQ8 A;  1VQD A;  5EKK A;  2KEC A;  3L4G B;  3HOV H;  1PHJ A;  1ICF B;  2F0W A;  3BZD B;  5ELO A;  2YU9 H;  2XTI A;  1QE6 A;  1WI5 A;  2TMP A;  4CJ0 B;  3E0E A;  5C3E B;  2Q8T A;  1A6X A;  3JAM L;  3GO5 A;  1V1P B;  2KOL A;  2ZXP A;  3NTK A;  4K2L A;  2OF1 A;  2D0P A;  4YY3 L;  1VQ9 A;  1PZI D;  4X64 L;  2FIN B;  4TVA A;  1JOR A;  2K7V A;  1S72 A;  1BF4 A;  2F0N A;  4Y7N B;  2HD3 A;  1SRU A;  1EZ8 A;  1I6V C;  1HNW L;  4YIJ A;  4R8I A;  3KDF B;  1G2S A;  1XMQ L;  2EYH A;  2RF4 A;  3MFG A;  4HMJ A;  2XWJ B;  2O5I C;  2EE1 A;  2R7F A;  1Y1V H;  3S17 H;  2Z6K C;  4EQN A;  3I4N H;  2EJF C;  1PRT B;  4JI8 Q;  3FDT A;  1EY6 A;  1U4L A;  4A3D B;  4H2U A;  4BXX G;  3MVV A;  2PW7 A;  3LWU A;  1SSO A;  4GLA C;  3GTG B;  3GTJ H;  1OTC A;  3S1Q H;  2I4N A;  4XTV A;  2J3L A;  3RMH A;  5JJI A;  1BCP B;  3OMG A;  5DEH A;  3HOY H;  3S1M B;  4RDX A;  1DGS A;  2UUC Q;  4B3T Q;  2K28 A;  2HQL A;  3I91 A;  3AMU A;  1XXG A;  2EYO A;  5IP9 G;  2ZT6 A;  1N32 Q;  1QVC A;  1Y8P B;  3SGI A;  2B2T C;  2QF7 A;  1X3Q A;  2BH2 A;  1RIP A;  4JPB W;  2RDH A;  3CP0 A;  5FJ8 H;  2D0O A;  2HT1 A;  1Y1W G;  5CC4 A;  2DTH A;  1WTQ A;  4P72 A;  3HOV B;  3KBG A;  3GTM H;  4RHS A;  2XIW A;  2O5J C;  2K5W A;  3CMA A;  2I5H A;  2YU9 B;  2UU9 Q;  3GTO H;  4EVO A;  1S4Z A;  1QNK A;  1HUM A;  1KLU D;  4LFC Q;  4AH6 A;  2Q2T A;  3M3Y H;  3IRB A;  1CHQ D;  1H9R A;  1PTO F;  3R2T A;  2E3C A;  5FLM G;  3RUZ A;  3VA7 A;  4H7B A;  1V9P A;  4P2C B;  1ROD A;  3E5S A;  4H0L C;  2KEN A;  2CWA A;  4JI2 L;  1NNH A;  3C1F A;  1Y1V B;  4JBM A;  1GHK A;  2J0T D;  4X62 L;  3P8V A;  3S17 B;  4DAM A;  3ERO A;  1XPU A;  1FYC A;  3I4N B;  5JOB A;  3MEY A;  2EYM A;  1A3U A;  3VDY A;  1UE7 A;  3V8K A;  3MF1 A;  1J8I A;  3NUC A;  3SHL A;  2B8G A;  3BDO A;  4CKB A;  3GTJ B;  3S1Q B;  2WAQ G;  4P73 A;  1RCV D;  1EIY A;  3K81 C;  4YRJ A;  5D3I B;  3K5N A;  3BYT B;  5IOC A;  4DV2 L;  3H0G B;  1FNV A;  3BYY B;  3TZD A;  4JI4 L;  3M4P A;  1OXX K;  4XEM A;  1W66 A;  5IWA Q;  1A8V A;  1LLR D;  4WJ3 M;  2B2W A;  3HOY B;  2DU5 A;  5IYC H;  5CV8 A;  4RWS C;  5GQO A;  2H1E A;  2CCZ A;  3RLO A;  3HOX G;  2QCP X;  2QHV A;  3J7A F;  4DR6 Q;  4H2S A;  4P3N A;  2ZJP A;  5ELE A;  1XNQ L;  2K4K A;  1PLF A;  5FLX L;  3FJP A;  4DR2 L;  5IIF A;  3IKJ A;  4OEL B;  2B2U A;  5C4X H;  1IBM Q;  4DV5 Q;  3SK4 A;  2ZNJ A;  2QHT A;  1DD2 A;  4L5S A;  5T1I A;  3K5L A;  2D62 A;  2L4N A;  4PZ6 A;  3VQV A;  4FO2 A;  1HA5 A;  3Q22 A;  3M3Y B;  1AH9 A;  2UU9 L;  4KN4 C;  4BY1 H;  2DNC A;  1EWH A;  1X54 A;  4H2X A;  1W2B A;  1BDO A;  4OX9 Q;  1E1T A;  2VQF Q;  4K0K Q;  1HNZ Q;  1H9M A;  4N8X 1;  3OW2 A;  3HXV A;  4XDX A;  4FXK C;  4BWG B;  1ATI A;  4UY8 C;  3T53 B;  4XTZ A;  1X2G A;  4C3I H;  4A76 A;  4FDB A;  3PO2 H;  1HA6 A;  2PMF A;  1EFW A;  4R1J A;  5FO7 B;  4ZUJ A;  3SK8 A;  3F1Z A;  3ZJY C;  3I4O A;  2RHQ B;  2Z6K A;  3LNN A;  5EKL A;  1WTR A;  4LUO A;  4WJ4 A;  1WCM B;  3CC4 A;  2DZ9 A;  2JSO A;  1NJ1 A;  4OXP A;  4OON A;  2Q7G A;  1B50 A;  3P8T A;  4H44 C;  3UDX A;  5HGQ A;  1K3R A;  3AFP A;  4NXN L;  3TEH A;  4TRD A;  3H91 A;  4RQF A;  4JI3 Q;  5BN4 A;  3HFZ A;  1H9S A;  4YCU A;  2E41 A;  4YWK A;  1EEF D;  5EPK A;  5JAV A;  2ZCE A;  4NKL A;  1F2Y A;  4J1M A;  4X5O A;  4LVK A;  1RIQ A;  5M3F H;  4DV3 L;  1CZW A;  3A56 A;  5LL6 S;  4ZLT F;  2G5D A;  2WV6 D;  2JA6 B;  5C4X B;  2KBN A;  2JEB I;  4ULL A;  2B2T A;  1HR0 W;  3J81 c;  4QQB X;  1VQA A;  4HMI A;  4KY6 A;  2A6E C;  2EYL A;  2NTT A;  1VMC A;  3W5O A;  1WTW A;  1NYR A;  1STB A;  3DM3 A;  3NQI A;  5JJZ A;  4X3T A;  3OPO A;  2ASB A;  3QR8 A;  5DM6 3;  1IBM L;  3HTZ A;  4DV5 L;  3G48 A;  4LFA L;  4BY1 B;  3CCS A;  2RVL A;  2K14 A;  3MXP A;  4LF9 Q;  3HXW A;  2JN4 A;  2VS1 A;  4X3S A;  1S5E D;  1TS2 A;  1K8O A;  2ZXR A;  1VQB A;  1WPY A;  3A5Z B;  1DON A;  4X66 L;  1N34 Q;  4S3S A;  5ELB A;  1OXS C;  4DV7 L;  1CT1 D;  3IG2 A;  4PMW A;  5IGE A;  4HCS A;  2F0J A;  2VUM H;  2F4V L;  3PO2 B;  5CYU A;  4R4T A;  3NTH A;  4MHE A;  2E2D C;  4DAP A;  2EYF A;  1LYL A;  3M85 A;  1EYD A;  3IFT A;  1SMY C;  5D65 A;  1HR0 L;  4LUV A;  3RR5 A;  1E7Z A;  2UUB L;  4A93 B;  1PYS A;  5IGB A;  1TKW B;  3E0J A;  4L5T A;  4AQY Q;  1PTO H;  2FHT A;  4FP5 D;  3K5O A;  5C52 B;  4HWS A;  3UDI A;  3X3N A;  3JAM i;  3BDL A;  2N78 A;  3DMU A;  4M1U B;  5DNF A;  3Q0A A;  4B3S L;  1ZYR C;  3RIR A;  4JI5 Q;  1H4V B;  1F9Q A;  3E3X A;  5C5M A;  5KNC A;  3BFM A;  4FNF A;  1G5I A;  1F2M A;  4K5X A;  2L15 A;  2HCI A;  1E0B A;  1S40 A;  5M3F B;  1SLJ A;  4CDC C;  1NTG A;  1DYQ A;  2FFK B;  5JVH 3;  2PZU A;  2KHI A;  5BN5 A;  2JJQ A;  3J7Z C;  4FF1 A;  1S3O A;  4XQJ A;  2AWN A;  4ILW A;  2VZA A;  5IYD G;  1GUW A;  4G7O C;  2CW0 D;  4JI6 L;  4IUU A;  3QNE A;  4L5Q A;  4L5R C;  2RHS A;  2K5D A;  1D8L A;  2OQK A;  3Q8D A;  1PTO C;  3HOZ G;  4A3C H;  1IBK Q;  2NVX B;  2EJG A;  3CW2 C;  3V8L A;  3PIO 3;  4A3G H;  3FMC A;  5K1X A;  3D8G A;  2QA4 A;  1WTO A;  2QHS A;  2ARU A;  1YHB A;  3OOC A;  1X56 A;  4Q15 A;  3PV0 A;  2K32 A;  1B70 A;  1D7Q A;  2SNS A;  4LF9 L;  1EWC A;  1TWG H;  4UP7 A;  4A3E G;  4X65 Q;  2VUM B;  2I07 B;  1JWM D;  1KTK A;  2QDL A;  3PCO B;  1NR4 A;  2K5N A;  1SRY A;  2MUY A;  2OT2 A;  4H02 A;  3F8T A;  3L0O A;  2PYK A;  4ME3 A;  4UPA A;  2ZZE A;  4K6L A;  3Q23 A;  1JB3 A;  2ZIO A;  5ELD A;  1BBU A;  5EPJ A;  2VW9 A;  3NPP A;  4JI1 Q;  5EKI A;  1JJC B;  4OIJ A;  2UUA Q;  2F0V A;  1PA6 A;  4BBR H;  3OWE B;  1V43 A;  2K6A A;  5C5L A;  1QF6 A;  2QHU A;  2EY1 A;  1SNP A;  4KHP Q;  4IUV A;  1UUP A;  1FR3 A;  2ICE C;  5GAD C;  1KQS A;  1QVG A;  3J7A V;  4YRP A;  1E1O A;  2Q2H A;  1QJO A;  2ZT8 A;  3RAC A;  1SR3 A;  2F0U A;  1LT3 D;  2YTV A;  2M2L A;  4DAV A;  3HKS A;  1PVO A;  3PGZ A;  1CKM A;  4LUZ A;  1YFS A;  4R4O A;  3VQX A;  2YYZ A;  3RZD B;  4JOI C;  2RDG A;  3I8Z A;  4B3M L;  4CJ1 B;  1V8Q A;  2UXB L;  3WOF A;  1O7Y A;  1ZXT A;  5KRU A;  4AIM A;  11AS A;  4NXM L;  5E3I A;  1I4P A;  3HKZ G;  1JR0 D;  5I6W A;  2IHF A;  4IJL A;  3FHW A;  4A3G B;  4YRN A;  4QIW E;  2DNE A;  1SJE D;  1FD7 D;  1NR2 A;  3V7R A;  1JOO A;  3PUZ A;  2XNA C;  3HP3 A;  1B9N A;  1VQJ A;  3N52 A;  5A35 A;  4CKC A;  4E51 A;  4YDQ A;  4DAY B;  2E2J H;  2XN9 C;  1EOV A;  1MSH A;  3AEV A;  1CFM A;  2WKD A;  1TWG B;  3QO8 A;  1EWI A;  3TP6 A;  3TP8 A;  4JI0 L;  4BXX H;  1AW7 A;  1Q3L A;  1C9O A;  1VMP A;  3CRK C;  1U4M A;  3HS0 C;  3AFQ A;  4V0B A;  3WQZ A;  2F0H A;  4DK6 C;  5KYL A;  4XQQ A;  1I5F A;  4DV4 Q;  3RLF A;  1Q46 A;  1EIF A;  1OXV A;  2E76 C;  1SMX A;  3S14 H;  2KEE A;  2ZT5 A;  3DXJ C;  4BBR B;  4H13 C;  3KJO A;  1JB7 A;  4GZY C;  2RKS A;  4DV1 Q;  4CDD C;  5CMD A;  3NXW A;  5IP9 H;  2KHJ A;  1I4Q A;  2P0L A;  5G3L F;  2EL9 A;  3D6C A;  1Y8N B;  4JI1 L;  4LVJ A;  4K14 A;  1VQM A;  1A2T A;  3T56 B;  1ML0 D;  1Y1W H;  1E24 A;  4K8I A;  5GRO A;  3ZYY X;  3NWS A;  3D3R A;  4IPD A;  1HCZ A;  1PH1 A;  4HIK A;  3A5U A;  1HH2 P;  1HJP A;  1ENC A;  3DEP A;  1EY7 A;  4ZK9 B;  5L37 A;  3D4R A;  4YRS A;  5AJ3 Q;  4HWO A;  3KF8 B;  3D6W A;  1F9R A;  2L11 A;  1EVK A;  2HDL A;  3ND8 A;  4LF8 L;  4XU0 A;  2IX0 A;  4KD3 A;  4RKL A;  3MXU A;  3J81 L;  3PCO A;  3TZU A;  4CDF C;  2A69 C;  2EYJ A;  5COR A;  4XQN A;  2IHE A;  5FLM H;  3M7N A;  4TVA B;  3KK7 A;  3F2D A;  3T1H L;  1X3F A;  3W1G A;  2PQA B;  4WJW A;  1XTD A;  3STB D;  1T9H A;  2CIM A;  2A5H A;  2F0D A;  1STN A;  4UP9 A;  3TSS A;  4OWT B;  1JJC A;  4RQE A;  1C0A A;  2R93 G;  3MA2 B;  2E2J B;  3RZO B;  1HXY D;  3I55 A;  4HWP A;  3TBI B;  3RD4 A;  4ZKB B;  2I5L X;  2OEO A;  1K8G A;  3PSI A;  4QL5 A;  1UAP A;  2ATW A;  3W1B A;  3DEO A;  4F7X A;  3HFV A;  2DU7 A;  4CKE A;  1KLG D;  2IX3 A;  1HPC A;  5ELF A;  3H3V H;  2NUC A;  3S14 B;  3CRL C;  1MGS A;  2KUM A;  5D14 A;  1V1O A;  2ZNI A;  2L55 A;  1L2F A;  5IOD A;  5A2Q L;  3HOX H;  3KOJ A;  1IKM A;  4QGU A;  1AP0 A;  4J8Q A;  3RKX A;  5J22 A;  5LMU L;  2RA4 A;  4IUR A;  5JPN C;  3LSQ A;  2EZV A;  3EBE A;  1EQV A;  2J4X A;  4IN3 A;  4R9W A;  2K05 A;  5DM7 3;  3QO2 A;  3A7A A;  1Y1W B;  2X6L A;  2BOS A;  1NY4 A;  3UE0 A;  1I4R A;  1XMO Q;  4C3H G;  3PMF A;  4LVM A;  4PG3 A;  1F77 A;  3C3L A;  1I4G A;  2JA7 G;  5E1F A;  1R9T H;  4DAY A;  2YTY A;  1UWV A;  1SE3 A;  4ALP A;  3F2B A;  1LT4 D;  1IL2 A;  2A1A A;  4IPG A;  1HTT A;  4FF2 A;  2SEB D;  4L6T B;  1JJG A;  1PZJ D;  1I94 Q;  3UGT A;  4JOI A;  1GM5 A;  1PFB A;  1D1I A;  1L0X B;  4RCN A;  3RLN A;  1H4T A;  4DK0 A;  1KL9 A;  2PI2 E;  3ER0 A;  3NE5 B;  3HOU G;  2WAC A;  2Z0S A;  5AJ3 L;  1SN8 A;  3K7A B;  3PZC A;  3VQW A;  4PMC A;  4TTV A;  4NPS A;  3K58 A;  2PZT A;  1LTR D;  1TU2 B;  1PV4 A;  2HHH L;  1PH4 A;  1A62 A;  3W3A A;  4KHZ A;  1MD2 D;  5HY6 A;  3L2P A;  4RG1 A;  2I4M A;  1QZG A;  4H2T A;  3LWE A;  1KRS A;  1G91 A;  4NCX A;  1BBW A;  1HZB A;  4C3J G;  1VQN A;  4DXF A;  5IGF A;  2WAQ B;  3BZC A;  4ZQ3 A;  2B63 G;  1EIY B;  4KKU A;  2D9U A;  1KD1 C;  3MXN B;  4OGQ C;  1D1K A;  1VQL A;  1Z47 A;  3BU2 A;  5CBE E;  4DUY Q;  2F3W A;  2ODR D;  1XX8 A;  4DR7 L;  5F5W A;  1B44 D;  3J80 E;  2EY5 A;  2PMZ B;  3SDZ A;  1Y14 B;  5EGT A;  4XU1 A;  5ELN A;  3DSQ A;  1TS5 A;  3KF8 A;  5C44 G;  2RCN A;  3K7U C;  3CD6 A;  3ONA B;  4U68 A;  3PQI A;  1IYJ B;  4DNI A;  2K50 A;  3OWF A;  1GD7 A;  2K75 A;  1WVL A;  1AN8 A;  2F4I A;  1IZ6 A;  2V1C C;  2CW0 C;  2WB1 G;  4FYD A;  4WI1 A;  2PQA A;  5LMN L;  4N8F A;  3VA5 A;  1SJH D;  2ZT9 C;  3CC7 A;  1PH3 A;  1ASY A;  1R9T B;  4LF4 L;  3VR5 A;  1YNJ D;  3H3V I;  3I3C A;  1FJG Q;  4RGN A;  2A6H C;  3CMQ A;  3PO3 B;  4YHH L;  2F0S A;  2JA8 G;  1G2T A;  1UEB A;  1GVP A;  3R07 A;  2XSC A;  4DR4 Q;  5JEA G;  1WFQ A;  4KTA A;  4DV6 Q;  1UEA B;  3MC0 B;  4H2X B;  3WOE A;  3J81 j;  3HXY A;  1Q8I A;  1GHJ A;  5IT9 c;  4OL7 A;  3K57 A;  1J9O A;  3KF6 A;  4ABN A;  1X6O A;  1HZC A;  1SDF A;  2JQO A;  4EQP A;  4KKS A;  4LNQ A;  1KMN A;  2ZXF A;  4BY7 G;  1TR5 A;  4GNX C;  3SVM A;  4JC0 A;  1QZH A;  1K0S A;  4MZ9 A;  1NSN S;  4EX5 A;  2EQS A;  2CKZ B;  4N9P A;  3HY1 A;  1LTA D;  1K8A C;  5J1Z A;  1Q12 A;  1KAB A;  1HNX L;  2RSN A;  5K1P A;  1OXU A;  2Y0S G;  2E2H H;  1R4P B;  4GKK Q;  3CPW A;  2ZTG A;  4LFB Q;  1YHA A;  2J3M A;  4LAA A;  1P8L A;  1KNE A;  3TEH B;  3I7F A;  3HFZ B;  4ZUI A;  4YRI A;  5K36 G;  1H9S B;  3HXX A;  5J3B A;  1PH5 A;  1EYC A;  1UE1 A;  2B2V A;  1KC8 C;  3QWN A;  1G51 A;  3I2Z A;  1CKN B;  4EO4 A;  1KAW A;  2SNM A;  2IY5 B;  4LNS A;  3RF1 A;  5C53 B;  5IYD H;  2EOT A;  4RA8 A;  5KGU A;  4BS9 A;  1TXY A;  3BDC A;  1LM0 A;  4XTC S;  3ITP A;  4LJZ C;  1GUN A;  1UNS A;  1YVC A;  2CQO A;  4QUF A;  5JJL A;  2I4O A;  1DXM A;  5JEA J;  4P3O A;  2EVB A;  2ZZG A;  2RDF A;  4DV0 Q;  3HOZ H;  1MI2 A;  1IXR A;  2NBF A;  5M5Y H;  2NVY H;  3KLS X;  1KIX A;  3MXN A;  3U4V A;  1WYD A;  3ULP A;  2OWO A;  4X6A H;  3IAY A;  4LF5 Q;  2K33 A;  2QGQ A;  4JI8 L;  3Q6S A;  2R7D A;  2WB1 E;  3CCE A;  2ZJQ A;  3OD1 A;  1HFG A;  4NW2 A;  1B1Z A;  1ENA A;  4A3E H;  2LXK A;  3HY0 A;  1IL8 A;  4XTW A;  2WKC A;  4DK1 A;  1EQQ A;  3I72 A;  5KNN A;  1ICW A;  2DN8 A;  2IW3 A;  1CHP D;  1USY A;  3SE0 A;  2UUC L;  1EY9 A;  1ET9 A;  4YCV A;  4B3T L;  1PYS B;  2E2H B;  2AKW A;  1PFN A;  3UE1 A;  3GTM B;  2HCC A;  2ID0 A;  2E8G A;  1N32 L;  1IW7 C;  4DR1 Q;  3HZX A;  1I6H H;  1HC7 A;  3K8A A;  3GTO B;  2Q7H A;  5M9O A;  2N3S A;  4F8M A;  1SNQ A;  4C2M H;  2CFM A;  5KIX A;  3J81 i;  1SNM A;  1JMC A;  1N33 Q;  4XTX A;  3URY A;  4BBS G;  4QIW B;  4HWR A;  3OMC A;  5C3E G;  3UI2 A;  2R7Z G;  4CBV A;  2L9H A;  3ICE A;  3EFS A;  3S9W A;  3DWQ A;  4NMZ A;  3HG9 A;  5C4J H;  3UGQ A;  3UDG A;  2DTI A;  3P8Y A;  3L1A A;  2WIN B;  2FXQ A;  2CJB A;  1B2T A;  1B7Y A;  5COY A;  1ET6 A;  4KMU C;  3MEF A;  5F2D A;  1AEX A;  4LFC L;  2CJA A;  3C1E A;  4XXE A;  1Z7N A;  1NBW A;  2Y0S E;  4DR3 Q;  3CCV A;  3D4W A;  3P20 A;  3RN5 A;  4G7Z C;  2RHS B;  3RKW A;  1NJ2 A;  3HOZ B;  3S16 H;  3WDN A;  3R2I A;  1G5H A;  2DXU A;  3R8B A;  2NB0 A;  4NB3 A;  4LF6 Q;  2EJ9 A;  5IP7 G;  2D5D A;  5M5Y B;  5KYI A;  2NVY B;  1I50 H;  5JJK A;  2EJF A;  1L1O C;  5CV4 A;  4K87 A;  4JVZ A;  1WTX A;  4E6I A;  1QVF A;  1TWA H;  4DU9 A;  1TY0 A;  1LTL A;  4B9W A;  3M4Y A;  1PH9 A;  1WNL A;  1B70 B;  4QUC A;  4A3E B;  3A5Y A;  4B9X A;  2PCF B;  4LF5 L;  2PNR C;  2NVT H;  2O2L D;  4A3L G;  1BIA A;  2A68 C;  2K5Q A;  2ZZF A;  1CKN A;  5IWA L;  3TEG A;  4QJF A;  1ESF A;  2XRS D;  1NJ5 A;  2M00 A;  4GNX A;  2IY5 A;  3EQL C;  2ZTE A;  4JI7 Q;  2BE5 C;  2EXZ A;  1Z7T A;  1PH6 A;  4DR6 L;  3K0Y A;  1Q1E A;  1I6H B;  1L1O B;  4IOA A;  4C2M B;  4HA8 A;  3S1R H;  4P71 C;  1VQC A;  1VCI A;  3WWV A;  1EQT A;  3RKY A;  1WTP A;  3CCU A;  2AHO B;  5CV7 A;  1PH7 A;  1TS3 A;  1KMM A;  4OO1 G;  1G6P A;  1PFM A;  2HIV A;  2E2I H;  4JBK A;  2ZT7 A;  4ZCK A;  3TQY A;  4F88 A;  2P5I A;  1B9M A;  3REU A;  5IE8 A;  1DOK A;  1I4X A;  3SK6 A;  4AYB G;  2B8F A;  5EBD A;  5I9P A;  1CZG A;  4C3I B;  3NBI A;  4A3M G;  5IGC A;  3S16 B;  1XNR Q;  4OX9 L;  2VQF L;  4K0K L;  3HKZ B;  1HNZ L;  2MHV A;  4FF3 A;  4A3I G;  2G4C A;  4I7A A;  2R3Z A;  1I50 B;  3SR1 A;  4DR3 L;  4KR3 A;  2LSS A;  3D31 A;  2A8V A;  1DZ1 A;  3FP9 A;  3QIA A;  3OW7 A;  3FPU B;  2R93 H;  3H0G G;  1TWA B;  3A74 A;  3J80 c;  2ZIN A;  1WU7 A;  2AWO A;  1CKO A;  1X3G A;  3G4S A;  4CH4 A;  1EL0 A;  4YPF A;  2HQE A;  3GD7 A;  1XTC D;  3MZ5 A;  2UXC Q;  4N9T A;  3EIV A;  4YWL A;  3T13 A;  1EY0 A;  4CH3 A;  3MHB A;  3HGB A;  1X65 A;  5H1S E;  1NCV A;  1STG A;  3C46 A;  3AU7 A;  3NEN A;  1TVX A;  4JI3 L;  5IT9 L;  1ZKO A;  1T5E A;  4KJN A;  5FJ8 G;  3QTC A;  2L0C A;  1GKH A;  1X3E A;  3TRE A;  1M1K C;  4KY5 A;  2AMC A;  2JA9 A;  2R61 A;  3FKI H;  1GJX A;  4Q6G A;  1CA5 A;  1QCB D;  2B2Y C;  2VB3 X;  2Z6B A;  1WQW A;  2V4D A;  4IJH A;  3BJU A;  1PRT D;  2LMC B;  4MTK A;  4K88 A;  1YHQ A;  1J6Q A;  3W2D A;  3DM1 A;  4C3H H;  3M9B A;  2E2I B;  2A19 A;  3IKL A;  3DWA A;  2EIF A;  1YNJ C;  2RSO A;  4WRD A;  2JA7 H;  1EQR A;  1YEZ A;  3OTO Q;  1E2W A;  4B08 A;  2E75 C;  1NJI C;  3FEW X;  3ULL A;  2FYK A;  1BCP D;  1JOK A;  5BN3 A;  1VDZ A;  5IYB G;  2EWN A;  1VQF A;  2BDO A;  1A3V A;  1SYG A;  3DHQ A;  2VNU D;  2I4L A;  3V7S A;  4XT3 B;  4JK1 C;  4C1N I;  3GP7 A;  1BR9 A;  1IBL Q;  4POG A;  3VYS A;  4HSP A;  4KJO A;  3OYY A;  4IFD G;  3HOU H;  4YRQ A;  1RL2 A;  5BR8 Q;  2DJF C;  1N34 L;  1C7Y A;  3GTP H;  1KHI A;  1PTO B;  4YRG A;  5CR3 A;  2R93 B;  1WCM G;  2AQ2 B;  2KHS A;  3S15 H;  2KQ3 A;  1UE6 A;  4CH5 A;  4G85 A;  4IAL A;  1L1O A;  4TQD A;  1HRJ A;  3PIO A;  1RHP A;  2NZO A;  2PQE A;  2JA5 G;  2K03 A;  4C3J H;  4AQY L;  3AQQ A;  3CC2 A;  4AYB E;  3PUX A;  1VQ6 A;  4GOP C;  2XWB B;  1VF7 A;  3KUP A;  2B63 H;  1A3T A;  1BO0 A;  2VQE Q;  2JXM B;  4JI5 L;  3ULJ A;  4LMQ D;  2P5Z X;  1PYB A;  1M4V A;  3HXU A;  4YYE A;  2UXC L;  3QO7 A;  3D0F A;  2XVS A;  3GDE A;  2JA6 G;  1LO5 D;  3FKI B;  5I6Y A;  4KQE A;  4GN4 B;  5C44 H;  4DR5 Q;  3A7L A;  1MIU A;  1GUG A;  1NUC A;  1XJV A;  1NMF A;  4ZTU B;  2IWH A;  3V05 A;  2ZR3 A;  2NZ1 D;  4NP5 A;  3QO5 A;  3A7A B;  3ERR A;  4C3H B;  1ILQ A;  1JE5 A;  5CV6 A;  1NE3 A;  4JYA Q;  1BCP F;  3GV6 A;  2F0P A;  5I9O A;  2OQ0 A;  1DM0 B;  2DGY A;  5FKA C;  2LY7 A;  3CCL A;  4IFD J;  1DOL A;  1RDP D;  1O7L A;  1IBK L;  4DK3 C;  1O7Z A;  1N9W A;  2HIX A;  1TY2 A;  4OWW B;  1M8A A;  4XIG S;  5K5P A;  3K5M A;  2JA8 H;  2E5A A;  2JK8 A;  2EY6 A;  5I2Y A;  1CA6 A;  4GKJ Q;  4RH6 A;  4XTY A;  1GOZ A;  1QIL A;  3K6O A;  3S24 A;  3HOU B;  1QWY A;  1S5F D;  1Q81 C;  5JEA H;  3A32 A;  4DFA A;  1SNC A;  4C56 C;  4A93 G;  4QMG A;  2F0L A;  4XYQ A;  4X65 L;  2X6G A;  3S15 B;  1N36 Q;  5EJW A;  2E64 A;  4YRO A;  3KBX A;  5EAY A;  1SEB D;  5M5X H;  4HIO A;  4BY7 H;  2F0O A;  2PI2 A;  4QF4 A;  1K28 A;  4C3J B;  5FOB B;  3NEM A;  2VXW A;  2UUA L;  2XGT A;  3CME A;  2JE6 I;  4DUZ Q;  4LWC A;  2K52 A;  2PPB C;  4KHP L;  2MGS A;  1J5E Q;  4A3K G;  1W6K A;  2X69 A;  3VYR A;  4ZTZ B;  2OTJ A;  1G8Z D;  1H9K A;  4F87 A;  4B3R Q;  5C44 B;  5E4W C;  4XEO A;  5K36 H;  2N49 A;  1QUQ A;  1NNX A;  3CCQ A;  3EFR A;  4O1N A;  4K5W A;  3BZK A;  2NS6 A;  2B3G A;  2L5T A;  2WB1 B;  1V1Q A;  4JV5 Q;  3FRP B;  2NN6 G;  3VR6 A;  5TSS A;  1SAP A;  4PQX A;  3GTQ H;  3QB3 A;  2D2C C;  3PUV A;  4EQ5 A;  5KEE A;  4UDU C;  3I73 A;  1QG7 A;  1GXD C;  1BOS A;  2HNI A;  3H6M A;  1STE A;  2F0I A;  2A74 C;  4JG2 A;  4DPG A;  4HR7 B;  3AYH B;  2QDB A;  1M90 C;  3G71 A;  1GO3 E;  3CKI B;  4K86 A;  2LFN A;  2Q8R E;  4CS3 A;  3NK9 A;  4G7H C;  4YRL A;  3LX0 A;  3P1H A;  1F9P A;  4A3F G;  2JP1 A;  4BA2 I;  5IGG A;  1B4O A;  5M5X B;  3EVQ A;  4DV4 L;  3KF6 B;  1LAC A;  1VQH A;  4BY7 B;  2IT1 A;  4YRR A;  4FXG C;  3PUY A;  1VQ7 A;  1Q1B A;  3QJY A;  4PHC A;  1EU4 A;  12AS A;  3A31 A;  1FNW A;  1JWU D;  5CV5 A;  3J80 L;  1RD9 D;  2BA1 A;  2Y0S B;  3T16 A;  2ALY B;  5GAE C;  4DV1 L;  1SER A;  2QKI C;  2BCO A;  2WP8 J;  1CK1 A;  4YY3 Q;  3PIP 3;  4KLK A;  2E10 A;  4X64 Q;  2EAY A;  3KLR A;  2AQ1 B;  4BBS H;  5C3E H;  2CH4 A;  4K2K A;  2R7Z H;  2A6E D;  3T4A C;  1Q7Y C;  2G9H D;  3A7U A;  1XMQ Q;  4V19 0;  3MAQ A;  1A63 A;  1WQ7 A;  2EYP A;  5KND A;  2DUD A;  3UH0 A;  1W6J A;  3W3S A;  4RMF A;  3CQZ H;  2ZM6 Q;  4Y7N H;  1Q8K A;  3MQZ A;  3LGJ A;  3EA6 A;  3GTQ B;  4WFN 3;  1R4Q B;  2C5C A;  2C7I A;  1RKN A;  5LMN W;  1EY8 A;  4DXG A;  1SYF A;  3OIQ A;  1UE5 A;  4APV A;  1FVI A;  1BIB A;  5CBA E;  3L2Z A;  4BWA A;  2EDG A;  5IP7 H;  3TN2 A;  1STH A;  1HXD A;  3ICA A;  1CM9 A;  3F2U A;  4MIU A;  1WJJ A;  1HTP A;  3S2H H;  1LTB D;  2Q7E A;  3EFX D;  1PXU A;  3GTG H;  3VYT A;  1GUT A;  1SYD A;  2DJG C;  3E9I A;  3G6E A;  1LT6 D;  1C8C A;  1WOC A;  2KED A;  4G57 A;  1NYQ A;  1SMY D;  3U9S A;  2Z9H A;  4O42 A;  1X9N A;  5I4D A;  1VQK A;  2DTO A;  3LSS A;  3NET A;  3HOX B;  2ZXO A;  2I0Q A;  4P75 C;  2Q2U A;  3A8K E;  4A3L H;  1EOT A;  3NSW A;  4HWT A;  1YGB A;  1PMR A;  2A8E A;  5HGT A;  1MKH A;  2MQH A;  2A73 B;  5DAU A;  5A2Q E;  3I4M G;  4HSV A;  4HJ8 A;  4IPH A;  3M4O H;  2F0G A;  3NHH A;  2AKW B;  4IZ8 A;  1U9R A;  4XT1 B;  1JQY D;  3SEB A;  3L3O C;  1PRT C;  2I5M X;  5IGD A;  5C0X G;  4R4I A;  4BBS B;  2MJ8 A;  4C1N K;  1XMO L;  2Z8L A;  2R7Z B;  5C3W A;  1XPR A;  4O0A A;  3HOW G;  4JI2 Q;  4OO1 H;  2HDM A;  3BVM A;  4X3U A;  1SES A;  1BCP C;  1SNO A;  4X62 Q;  3CXC A;  3CQZ B;  4R4Q A;  2ARS A;  4FVM A;  1TT2 A;  4YP0 A;  4DKA C;  1PTO D;  2R92 G;  3NBH B;  1B7Y B;  1I94 L;  4G84 A;  3J7Y W;  3CU7 A;  1YI2 A;  1X01 A;  1I4H A;  2IJ0 A;  1K0R A;  5M5W H;  1OO9 B;  2ZR2 A;  4A3M H;  3NP8 A;  2ZM6 L;  4DV2 Q;  1VF5 C;  4I65 A;  2AUK A;  4JI4 Q;  1ENF A;  4J15 A;  3SK5 A;  1S5C D;  2EJM A;  3DWP A;  4RCO A;  4A3I H;  3BVZ A;  3S2H B;  3RGL A;  1XWE A;  3KYH C;  1Q86 C;  4TWA A;  4DQ2 A;  1WTH A;  4L63 B;  2ALY A;  1GUO A;  2Z4H A;  4KN7 C;  3N6R A;  3H0G H;  1BBX C;  3TS2 A;  1D5Z C;  3CAM A;  1QNU A;  1XNQ Q;  4PZ8 A;  4JBJ A;  4KHV A;  1U4P A;  2YV5 A;  3QOL A;  4O2D A;  4RAU C;  1XPO A;  4MTN A;  4DR2 Q;  1BUV T;  3BS1 A;  2N55 A;  4TVY A;  3SXH A;  4UAI A;  3OSO A;  2VL6 A;  1SYC A;  4IOC A;  3GTL H;  2C8M A;  1HTL D;  4DUY L;  2IL8 A;  4ZAI A;  1CI3 M;  5HUR A;  5C0X J;  1ADJ A;  2I46 A;  4A3J G;  3M4O B;  1HZ9 A;  4TKO B;  4GNX B;  1JJ2 A;  3A0J A;  3GV3 A;  1EFI D;  3JAM E;  1O80 A;  2Q5I A;  1PDQ A;  1X3P A;  1RJT A;  1IYV A;  2RQX A;  1HZA A;  2OTL A;  3L9A X;  2F3V A;  2MP1 A;  1ONL A;  3OIP A;  4KKT A;  5E4X A;  1VQZ A;  1KNA A;  4IUQ A;  2XRQ D;  3TDQ A;  1NMG A;  2DQ0 A;  5T1G A;  3TME A;  2ZGW A;  3NQT A;  4YRK A;  1VQI A;  2F0K A;  3TP7 A;  1KDA A;  4A75 A;  1FJG L;  1JWS D;  4A3B G;  2ZTD A;  3A7R A;  1EIG A;  1A0I A;  5IYB H;  4AYB B;  1SFO H;  1IHZ A;  5M5W B;  4A3M B;  3EN2 A;  4ME5 A;  2E65 A;  4J6H A;  3NTI A;  4DR4 L;  2CGH A;  4DV6 L;  4OIK A;  4A3I B;  4IFD H;  1YFR A;  5GAG C;  5M3M G;  4NXN Q;  3MWY W;  4HED A;  1VS0 A;  4HJA A;  1F2L A;  1WCM H;  1PH2 A;  4A4I A;  1AZQ A;  4OO1 I;  3L4G A;  4BW9 A;  4FXD A;  1EZ6 A;  4DV3 Q;  1LTS D;  1SYB A;  1FYF A;  2NZH A;  3PF5 A;  3P75 A;  2JA5 H;  1SE4 A;  4TSS A;  4NDX A;  4HVC A;  5E7N A;  1V1P A;  1T5X D;  1YJW A;  1G29 1;  3GTL B;  4GKK L;  4LFB L;  4IUN A;  4P74 C;  4P75 A;  1KAA A;  4K6D A;  4L8J A;  1LT5 D;  1ZEQ X;  4KK7 A;  5FO9 B;  2LS0 1;  4PV1 C;  2F0M A;  2JA6 H;  3S1N H;  3KDF A;  3NBH A;  1H4Q A;  1SBB B;  4KV6 A;  3H15 A;  4LFA Q;  1JT8 A;  2AMC B;  3U4Z A;  4HAE A;  4IQZ A;  1EUJ A;  4KI0 A;  3H94 A;  4GLV B;  3R3O A;  1TWH H;  1HQM C;  2EJG C;  1HQR D;  1MJC A;  1WD1 A;  1Y8O B;  3MF2 A;  5FK9 C;  1N8R C;  2DQ3 A;  2PW5 A;  1A2U A;  5GAH C;  3PO3 G;  3STB C;  2N88 A;  3NWT A;  2F03 A;  3K80 C;  4X66 Q;  3HRZ C;  4A3D G;  4LF7 Q;  4HCE A;  2ZJR A;  4DV7 Q;  1YZ6 A;  1AE3 A;  2F4V Q;  4DV0 L;  1JCK B;  2A69 D;  3RL6 A;  1D6E C;  1SFO B;  1B8A A;  3ERQ A;  4QY7 A;  3A8I E;  3VQY A;  2H5X A;  5FO8 B;  1HR0 Q;  2UUB Q;  4G4K A;  3X3M A;  3FPP A;  3J80 i;  3TS0 A;  1H9J A;  3KJP A;  2NVQ H;  3MEH A;  3I70 A;  4B3S Q;  1D2B A;  2JEA I;  1WD0 A;  1H4S A;  2Q5H A;  2IX1 A;  5IY0 A;  4A93 H;  2K1B A;  3VR4 A;  2F52 A;  1WLE A;  4ODG A;  2KCC A;  1EU3 A;  3CCJ A;  2TSS A;  2PO4 A;  1IYU A;  3HOV G;  3L7Z C;  5FLX E;  1YIJ A;  2JA5 B;  1K83 H;  3H09 A;  1K9M C;  2RCF A;  2CWP A;  3GTK H;  4POF A;  1AE2 A;  1CQF A;  1CUK A;  4JCV E;  2Q2I A;  3T1Y Q;  4JI6 Q;  3HRK A;  2EXD A;  5C4J B;  4DR1 L;  3KFU A;  4HID A;  1HFN A;  1YNN D;  4DF7 A;  1AFP A;  1HHV A;  2K04 A;  4IFD I;  1N33 L;  3S1N B;  4A3K H;  3UDF A;  2WAQ E;  3HXZ A;  3CHB D;  4LVI A;  2ENB A;  1TWH B;  1C48 A;  3IKM B;  1Y1V G;  2GVA A;  1FGU A;  4RFB A;  1GUS A;  1S5B D;  2KJX A;  3I4N G;  4OP0 A;  4XTU A;  5J39 A;  2PMZ E;  2F1M A;  2NN6 H;  2NVX H;  2IPK D;  1RTO A;  1X2H A;  2F0F A;  4CDE C;  4Q5V A;  3LC0 A;  1EYA A;  1VQP A;  4LF6 L;  1BNZ A;  1O78 A;  1EEI D;  3V8J A;  3A55 A;  5EQ0 A;  4HN7 A;  4LF7 L;  2QW7 A;  2SDF A;  1TWF H;  3RN2 A;  3HOY G;  2RBM A;  2NVQ B;  2NVT B;  2OCE A;  4DNT B;  4ID6 A;  4YRT A;  4DGZ A;  1D5X C;  2ODR C;  2ZIM A;  1DOM A;  3BG3 A;  4ZRZ A;  2F3I A;  3MTS A;  1SXT A;  3V96 A;  1JOQ A;  5E3F A;  2N8N A;  4HIM A;  2FMC A;  4P3P A;  4A3F H;  4U67 3;  1ILP A;  5ISR A;  4IUT A;  3E6Z X;  3FVQ A;  3TUP A;  1X55 A;  1FGB D;  1K83 B;  3J7A 5;  1B3Q A;  1NJ6 A;  2KA7 A;  3QOJ A;  5NUC A;  3S1R B;  1LV9 A;  3I56 A;  1SYE A;  4JI7 L;  5I2X A;  4MN3 A;  3GTK B;  1TWC H;  1O7I A;  1CQV A;  1LTT D;  3DUZ A;  2CVR A;  4IO9 A;  2DEQ A;  3TP5 A;  2L12 A;  1VQG A;  4CJ2 C;  4LK1 C;  1K73 C;  4B3M Q;  4UHV A;  3BVG A;  5AFW A;  4A3K B;  2L1B A;  2B39 A;  1VQ4 A;  5JVG 3;  1PH8 A;  2UXB Q;  2GA4 B;  4P74 A;  3CPF A;  2AQ3 B;  3M4Q A;  4NXM Q;  2MFI A;  2M9V A;  3T1Y L;  1ASZ A;  1EY5 A;  1E3P A;  1LTI D;  4HJ5 A;  3RZD H;  3G6J B;  1YJ9 A;  2YTX A;  4WF2 A;  1QUQ B;  3P7J A;  2NYZ D;  2O4X A;  2DKG A;  4KR2 A;  1II3 A;  3CF5 A;  4CH6 A;  4CGY B;  4H2W A;  2RHQ A;  4K5V A;  2BDN A;  4YRM A;  1FNU A;  2A6H D;  1NAP A;  1MHW C;  2K5V A;  2B29 A;  4XU2 A;  4JI0 Q;  2CHB D;  3QG1 A;  1XNR L;  2DVE A;  4RKB A;  1KDC A;  1X32 A;  5D3D A;  1L0Y B;  2F0T A;  4KD4 A;  3EJI A;  3VR3 A;  1TWF B;  4R4C A;  5IYC G;  2WFW A;  2E74 C;  4L87 A;  1YNX A;  3CCM A;  4LW1 A;  4CS2 A;  3HRI A;  1SRO A;  3E9H A;  4GN3 B;  2KCM A;  3JAM c;  1BXT A;  4A3F B;  2Z4I A;  2DY7 A;  2GN5 A;  3G7L A;  2NN6 I;  5C4X G;  2G9D A;  1QE0 A;  3U50 C;  3B6Y A;  1E2V A;  4IPC A;  1RTN A;  5IT9 E;  3S2D H;  2DDZ A;  1Z9F A;  1VQO A;  2LXJ A;  1PRT F;  4GLX A;  2K01 A;  1TWC B;  3RNU A;  1B76 A;  1FL0 A;  4OLF A;  2WII B;  2PNH A;  3I4M H;  1VQE A;  3REX A;  5G3L D;  4P71 A;  1S5D D;  5ELC A;  4TQF A;  5C4Z A;  4BY1 G;  1MJE A;  4PMB A;  2C35 B;  4ZIB A;  2VB2 X;  2JA7 B;  4HJ7 A;  4GOP B;  4LF8 Q;  4RGM A;  5KNB A;  5JPM C;  5C0X H;  2QEJ C;  1F2Z A;  3A5Z A;  4IUP A;  3T1H Q;  3G1Z A;  1YFT A;  4ZKC B;  3HOW H;  1BVS A;  3OTO L;  2H4O A;  3GQB A;  3U58 A;  4C3I G;  1A15 A;  2KVM A;  4YRF A;  4Y52 H;  3PO2 G;  3GTP B;  2DZC A;  1QOH A;  5DLQ E;  2R92 H;  2K5H A;  4XYO A;  2R6G A;  4QB4 A;  4GS3 A;  1IBL L;  1BKB A;  1I3Q H;  1KOG A;  4RGT A;  1ADY A;  1Q82 C;  2DY8 A;  4OEM B;  2PME A;  3RZO H;  1YJN A;  1Z7M A;  5BR8 L;  3MXG A;  5EBC A;  3PF4 A;  2SOB A;  1JIC A;  3IFD A;  4H2V A;  5EPL A;  2KCT A;  1SND A;  2FJ2 A;  1C4Q A;  4M8A A;  2UXD Q;  2B63 B;  1E2Z A;  1EY4 A;  5M3F G;  1STA A;  5LMU Q;  4TVW A;  3DLL A;  1U0L A;  3ND9 A;  1LTG D;  1Q90 A;  3R93 A;  1KRT A;  1RF2 D;  1W3S A;  3A54 A;  1J5W A;  2EPB A;  3S2D B;  2VQE L;  1DCZ A;  1NJ8 A;  1MSG A;  2NTS A;  2OXP A;  4OWX B;  4YCW A;  1G6Z A;  3UFG A;  1IW7 D;  4Z9C B;  4CHT B;  1BQQ T;  1CTM A;  3I4M B;  2ART A;  3I90 A;  2B2Y A;  3K59 A;  4A3J H;  5CGK A;  3VYU A;  1VQ5 A;  1F9S A;  4DR5 L;  1Z6H A;  4CS4 A;  1TS4 A;  1EIH A;  1YB3 A;  1D5M C;  2BH8 A;  4KY7 A;  2BA0 A;  2EY2 A;  3ERS X;  3V2T A;  4EQO A;  3NEL A;  1DJR D;  4QCL A;  4MNO A;  3HOW B;  1H95 A;  4JYA L;  2ZTC A;  2FMM A;  2JA8 B;  2MO1 A;  4HTH A;  1PFS A;  2F0Q A;  4RHR A;  4YRC A;  1LAB A;  2HHH Q;  2CJ9 A;  5CV9 A;  1STY A;  2VUM G;  2LKV A;  4XU3 A;  2KCN A;  1WTV A;  4TQU S;  1GGM A;  4A3B H;  2R92 B;  1SET A;  4YRE A;  3K7A H;  2E5L Q;  1SE8 A;  4Q0F A;  4HJ9 A;  1I3Q B;  5FLX c;  4GKJ L;  4HT4 A;  5C3X A;  4ZYS A;  4JBW A;  1XYI A;  1P16 A;  2HUG A;  4K8J A;  1KXL A;  2PZW A;  1EVL A;  4H2Y A;  3MFY A;  3T51 B;  2QIL A;  3M7G A;  4DN4 M;  5M3M H;  5C0X I;  3RUX A;  1K3B C;  1N36 L;  1AZP A;  1JE4 A;  2DJZ A;  4OHJ A;  3HEJ A;  4DR7 Q;  2Q8I B;  4P72 C;  1B3A A;  1IKL A;  1CSQ A;  4UP8 A;  4RGO S;  3AB9 A;  1EYG A;  2A68 D;  3F2C A;  2ES2 A;  4GOP A;  3HKZ E;  2GVB A;  1B53 A;  1L0W A;  1LUZ A;  4FF4 A;  1CSP A;  2VY3 A;  1YIT A;  2J7Z A;  2UXD L;  2DXT A;  3K0X A;  2B2V C;  1PYW D;  1U4R A;  3FKI G;  1MBY A;  2BE5 D;  3VR2 A;  4DUZ L;  3D4D A;  4GN5 A;  1OXT A;  3KLS A;  3PUW A;  5LMN Q;  3U9O A;  3IAL A;  1YNN C;  1HNW Q;  3I4L A;  4I7Z C;  3IL8 A;  1J5E L;  2CH4 W;  4DNR B;  2Z1C A;  4A3J B;  2JYO A;  2F0E A;  4LF4 Q;  1TQO A;  4BA1 I;  3OHX C;  4A3C G;  4B3R L;  3TRZ A;  2NWG A;  5C6A A;  5LL6 X;  2CQA A;  4YHH Q;  4A3G G;  5C4H A;  4WOR A;  4EGV A;  1ESR A;  3J81 E;  4X3K A;  4JV5 L;  3O13 A;  4YWM A;  1U5K A;  3PO3 H;  3H3V C;  4P73 C;  3C2P A;  4LVL A;  4PZ7 A;  3PIP A;  3KLW A;  3V7C A;  2AUJ D;  4A3D H;  4JW0 A;  4PNY A;  3CCR A;  2MPM A;  4A3B B;  1TII D;  2B2W C;  3VBB A;  1SE2 A;  1QB5 D;  1PZK D;  4R8N A;  2MNA A;  2QEX A;  1Y69 U;  5C51 B;  3A8J E;  3JC6 6;  1HUN A;  2C9O A; 
#chains in the Genus database with same CATH homology
 4BBR G;  3S1M H;  1HNX Q;  1USY C;  2E5L L;  2MO0 A;  1YBY A;  1E22 A;  2E1H A;  1VQ8 A;  1VQD A;  3L4G B;  3HOV H;  1PHJ A;  5ELO A;  2YU9 H;  2XTI A;  1WI5 A;  3E0E A;  3GO5 A;  4YY3 L;  2D0P A;  1VQ9 A;  4X64 L;  4TVA A;  1S72 A;  1SRU A;  1HNW L;  3KDF B;  1XMQ L;  2RF4 A;  2R7F A;  1Y1V H;  3S17 H;  2Z6K C;  3I4N H;  4JI8 Q;  4H2U A;  4BXX G;  4GLA C;  3GTJ H;  1OTC A;  3S1Q H;  2I4N A;  4XTV A;  2J3L A;  5JJI A;  3HOY H;  4RDX A;  1DGS A;  2UUC Q;  4B3T Q;  2HQL A;  5IP9 G;  2ZT6 A;  1N32 Q;  1QVC A;  3SGI A;  2BH2 A;  1RIP A;  3CP0 A;  5FJ8 H;  2D0O A;  2HT1 A;  1Y1W G;  2DTH A;  4P72 A;  3GTM H;  3CMA A;  2I5H A;  2UU9 Q;  3GTO H;  4LFC Q;  4AH6 A;  2Q2T A;  3M3Y H;  3IRB A;  2E3C A;  5FLM G;  1V9P A;  2KEN A;  2CWA A;  4JI2 L;  1NNH A;  4JBM A;  4X62 L;  3P8V A;  4DAM A;  1XPU A;  3MEY A;  3VDY A;  1UE7 A;  3V8K A;  3MF1 A;  1EIY A;  2WAQ G;  4P73 A;  3K81 C;  4YRJ A;  4DV2 L;  4JI4 L;  3M4P A;  1OXX K;  4XEM A;  1W66 A;  5IWA Q;  1A8V A;  4WJ3 M;  2DU5 A;  5IYC H;  5GQO A;  2CCZ A;  3RLO A;  3HOX G;  2QHV A;  4DR6 Q;  4H2S A;  4P3N A;  2ZJP A;  1XNQ L;  2K4K A;  3FJP A;  4DR2 L;  5C4X H;  1IBM Q;  4DV5 Q;  2ZNJ A;  2QHT A;  4L5S A;  2D62 A;  4PZ6 A;  3VQV A;  1AH9 A;  2UU9 L;  4BY1 H;  1X54 A;  4H2X A;  1W2B A;  4OX9 Q;  1E1T A;  2VQF Q;  4K0K Q;  1HNZ Q;  3OW2 A;  3HXV A;  1ATI A;  4UY8 C;  4XTZ A;  1X2G A;  4C3I H;  4A76 A;  4FDB A;  3PO2 H;  2PMF A;  1EFW A;  4R1J A;  3ZJY C;  3F1Z A;  3I4O A;  2RHQ B;  2Z6K A;  4LUO A;  4WJ4 A;  3CC4 A;  2DZ9 A;  1NJ1 A;  4OXP A;  4OON A;  2Q7G A;  3P8T A;  3UDX A;  5HGQ A;  1K3R A;  3AFP A;  4NXN L;  3TEH A;  4RQF A;  4JI3 Q;  3HFZ A;  4YCU A;  2E41 A;  4YWK A;  2ZCE A;  4X5O A;  4LVK A;  1RIQ A;  5M3F H;  4DV3 L;  2KBN A;  2JEB I;  1HR0 W;  3J81 c;  4QQB X;  1VQA A;  3W5O A;  1NYR A;  3DM3 A;  2ASB A;  3HTZ A;  1IBM L;  4DV5 L;  3G48 A;  4LFA L;  3CCS A;  2K14 A;  4LF9 Q;  3HXW A;  2VS1 A;  1VQB A;  1WPY A;  3A5Z B;  4X66 L;  1N34 Q;  4DV7 L;  1OXS C;  3IG2 A;  4PMW A;  2VUM H;  2F4V L;  4R4T A;  1LYL A;  3M85 A;  1HR0 L;  2UUB L;  4LUV A;  3RR5 A;  1E7Z A;  1PYS A;  4L5T A;  4AQY Q;  5C52 B;  4HWS A;  3UDI A;  3JAM i;  4B3S L;  2N78 A;  3RIR A;  4JI5 Q;  1H4V B;  3BFM A;  1G5I A;  2L15 A;  1S40 A;  1SLJ A;  1NTG A;  2KHI A;  2JJQ A;  3J7Z C;  1S3O A;  2AWN A;  2VZA A;  5IYD G;  4JI6 L;  3QNE A;  4L5Q A;  4L5R C;  2RHS A;  1D8L A;  2OQK A;  3Q8D A;  3HOZ G;  4A3C H;  1IBK Q;  2EJG A;  3CW2 C;  3V8L A;  4A3G H;  5K1X A;  2QA4 A;  2QHS A;  2ARU A;  1YHB A;  1X56 A;  4Q15 A;  3PV0 A;  1B70 A;  1D7Q A;  4LF9 L;  1TWG H;  4UP7 A;  4A3E G;  4X65 Q;  3PCO B;  2K5N A;  1SRY A;  4H02 A;  3F8T A;  3L0O A;  4ME3 A;  4UPA A;  2ZZE A;  2ZIO A;  1BBU A;  2VW9 A;  4JI1 Q;  1JJC B;  2UUA Q;  1PA6 A;  4BBR H;  1V43 A;  1QF6 A;  2QHU A;  4KHP Q;  5GAD C;  1KQS A;  1QVG A;  4YRP A;  1E1O A;  2Q2H A;  2ZT8 A;  3RAC A;  1SR3 A;  2YTV A;  3HKS A;  1PVO A;  3PGZ A;  1CKM A;  4LUZ A;  1YFS A;  4R4O A;  3VQX A;  2YYZ A;  4JOI C;  4B3M L;  2UXB L;  4AIM A;  11AS A;  4NXM L;  5E3I A;  3HKZ G;  2IHF A;  4IJL A;  3FHW A;  4YRN A;  4QIW E;  3V7R A;  3PUZ A;  1VQJ A;  4E51 A;  4YDQ A;  4DAY B;  2E2J H;  1EOV A;  3AEV A;  3QO8 A;  1EWI A;  4JI0 L;  4BXX H;  1C9O A;  3AFQ A;  3WQZ A;  4DK6 C;  1I5F A;  4DV4 Q;  3RLF A;  1Q46 A;  1EIF A;  1OXV A;  1SMX A;  3S14 H;  2ZT5 A;  3KJO A;  1JB7 A;  4DV1 Q;  5IP9 H;  2KHJ A;  2P0L A;  2EL9 A;  4JI1 L;  4LVJ A;  1VQM A;  1Y1W H;  1E24 A;  5GRO A;  4IPD A;  1PH1 A;  4HIK A;  3A5U A;  1HH2 P;  1HJP A;  4YRS A;  5AJ3 Q;  4HWO A;  3KF8 B;  1EVK A;  4LF8 L;  4XU0 A;  2IX0 A;  3PCO A;  5FLM H;  2IHE A;  3M7N A;  4TVA B;  3F2D A;  3T1H L;  1X3F A;  3W1G A;  2PQA B;  1XTD A;  3STB D;  1T9H A;  2CIM A;  4UP9 A;  4OWT B;  1JJC A;  4RQE A;  1C0A A;  2R93 G;  3I55 A;  4HWP A;  2I5L X;  1K8G A;  3PSI A;  4QL5 A;  2ATW A;  3W1B A;  3HFV A;  2DU7 A;  3H3V H;  2ZNI A;  1L2F A;  3HOX H;  3KOJ A;  4QGU A;  3RKX A;  5LMU L;  3LSQ A;  3EBE A;  3A7A A;  1NY4 A;  3UE0 A;  1XMO Q;  4LVM A;  4PG3 A;  2JA7 G;  1R9T H;  2YTY A;  1UWV A;  4ALP A;  3F2B A;  1IL2 A;  2A1A A;  4IPG A;  1HTT A;  1JJG A;  1I94 Q;  3UGT A;  4JOI A;  1GM5 A;  3RLN A;  1H4T A;  1KL9 A;  2PI2 E;  3ER0 A;  3HOU G;  2Z0S A;  5AJ3 L;  1SN8 A;  3PZC A;  3VQW A;  4TTV A;  4NPS A;  1PV4 A;  2HHH L;  1PH4 A;  1A62 A;  4KHZ A;  5HY6 A;  3L2P A;  4RG1 A;  2I4M A;  1QZG A;  4H2T A;  1KRS A;  4NCX A;  1BBW A;  1HZB A;  1VQN A;  3BZC A;  2B63 G;  1EIY B;  1KD1 C;  3MXN B;  1VQL A;  1Z47 A;  3BU2 A;  2ODR D;  4DUY Q;  4DR7 L;  5F5W A;  4XU1 A;  1Y14 B;  5ELN A;  3DSQ A;  5C44 G;  2RCN A;  3K7U C;  3CD6 A;  1IYJ B;  4DNI A;  2K50 A;  1GD7 A;  2K75 A;  1IZ6 A;  2V1C C;  2WB1 G;  4WI1 A;  2PQA A;  5LMN L;  3CC7 A;  1ASY A;  1PH3 A;  4LF4 L;  3H3V I;  1FJG Q;  3CMQ A;  4YHH L;  2JA8 G;  1UEB A;  1GVP A;  3R07 A;  4DR4 Q;  5JEA G;  1WFQ A;  4DV6 Q;  4H2X B;  3J81 j;  3HXY A;  5IT9 c;  3KF6 A;  1X6O A;  1HZC A;  2JQO A;  4LNQ A;  1KMN A;  2ZXF A;  4BY7 G;  4GNX C;  4JC0 A;  1QZH A;  4MZ9 A;  4EX5 A;  2EQS A;  2CKZ B;  3HY1 A;  1K8A C;  1Q12 A;  1HNX L;  5K1P A;  1OXU A;  2Y0S G;  2E2H H;  4GKK Q;  3CPW A;  2ZTG A;  4LFB Q;  1YHA A;  2J3M A;  1P8L A;  3TEH B;  3I7F A;  3HFZ B;  4YRI A;  5K36 G;  3HXX A;  5J3B A;  1PH5 A;  1KC8 C;  1UE1 A;  1G51 A;  3I2Z A;  1CKN B;  4EO4 A;  1KAW A;  2IY5 B;  4LNS A;  3RF1 A;  5C53 B;  5IYD H;  1TXY A;  1LM0 A;  4XTC S;  1YVC A;  2CQO A;  5JJL A;  2I4O A;  5JEA J;  4P3O A;  2ZZG A;  4DV0 Q;  3HOZ H;  1IXR A;  5M5Y H;  2NVY H;  1KIX A;  3U4V A;  1WYD A;  3ULP A;  2OWO A;  4X6A H;  4LF5 Q;  2QGQ A;  4JI8 L;  2R7D A;  2WB1 E;  3CCE A;  2ZJQ A;  3OD1 A;  4A3E H;  2LXK A;  3HY0 A;  4XTW A;  1EQQ A;  5KNN A;  1USY A;  2UUC L;  4YCV A;  4B3T L;  1PYS B;  2AKW A;  3UE1 A;  2ID0 A;  2E8G A;  1N32 L;  4DR1 Q;  1I6H H;  1HC7 A;  3K8A A;  2Q7H A;  2N3S A;  4C2M H;  2CFM A;  1JMC A;  3J81 i;  1N33 Q;  4XTX A;  4BBS G;  4HWR A;  5C3E G;  2R7Z G;  3ICE A;  3EFS A;  5C4J H;  3UGQ A;  3UDG A;  2DTI A;  3P8Y A;  3L1A A;  2FXQ A;  2CJB A;  1B7Y A;  3MEF A;  4LFC L;  2CJA A;  1Z7N A;  1NBW A;  2Y0S E;  4DR3 Q;  3CCV A;  3RN5 A;  2RHS B;  3RKW A;  1NJ2 A;  3S16 H;  1G5H A;  2DXU A;  4NB3 A;  4LF6 Q;  2EJ9 A;  5IP7 G;  1I50 H;  5JJK A;  2EJF A;  1L1O C;  4K87 A;  1QVF A;  1TWA H;  1WNL A;  1LTL A;  1PH9 A;  1B70 B;  3A5Y A;  4LF5 L;  2NVT H;  4A3L G;  1BIA A;  2ZZF A;  1CKN A;  5IWA L;  3TEG A;  4QJF A;  1NJ5 A;  2IY5 A;  4GNX A;  2ZTE A;  4JI7 Q;  1PH6 A;  4DR6 L;  1Q1E A;  1L1O B;  4IOA A;  4HA8 A;  3S1R H;  4P71 C;  1VQC A;  1VCI A;  3WWV A;  3RKY A;  3CCU A;  2AHO B;  1PH7 A;  1KMM A;  4OO1 G;  1G6P A;  2HIV A;  2E2I H;  4JBK A;  2ZT7 A;  3TQY A;  2P5I A;  3REU A;  5IE8 A;  4AYB G;  4A3M G;  1XNR Q;  4OX9 L;  2VQF L;  4K0K L;  1HNZ L;  4A3I G;  2G4C A;  4DR3 L;  4KR3 A;  2LSS A;  3D31 A;  2A8V A;  3FP9 A;  2R93 H;  3H0G G;  3J80 c;  3A74 A;  2ZIN A;  1WU7 A;  2AWO A;  1X3G A;  1CKO A;  3G4S A;  4CH4 A;  4YPF A;  3GD7 A;  2UXC Q;  3EIV A;  4YWL A;  4CH3 A;  5H1S E;  1X65 A;  3NEN A;  4JI3 L;  5FJ8 G;  3QTC A;  1GKH A;  1X3E A;  3TRE A;  1M1K C;  2AMC A;  2JA9 A;  3FKI H;  4Q6G A;  1WQW A;  4IJH A;  3BJU A;  4K88 A;  1YHQ A;  1J6Q A;  4C3H H;  3M9B A;  2A19 A;  3IKL A;  2EIF A;  2JA7 H;  1EQR A;  1YEZ A;  3OTO Q;  1NJI C;  3ULL A;  2FYK A;  5IYB G;  2EWN A;  1VQF A;  2VNU D;  2I4L A;  3V7S A;  1IBL Q;  4POG A;  3OYY A;  4IFD G;  3HOU H;  4YRQ A;  1RL2 A;  5BR8 Q;  1N34 L;  1C7Y A;  3GTP H;  1KHI A;  4YRG A;  1WCM G;  3S15 H;  1UE6 A;  4CH5 A;  4G85 A;  1L1O A;  4TQD A;  3PIO A;  2NZO A;  2JA5 G;  4C3J H;  4AQY L;  3AQQ A;  3CC2 A;  4AYB E;  3PUX A;  1VQ6 A;  4GOP C;  2B63 H;  2VQE Q;  4JI5 L;  3ULJ A;  1PYB A;  3HXU A;  4YYE A;  2UXC L;  3QO7 A;  3D0F A;  3GDE A;  2JA6 G;  4KQE A;  4GN4 B;  5C44 H;  4DR5 Q;  1MIU A;  1XJV A;  1NMF A;  4ZTU B;  2ZR3 A;  3QO5 A;  3ERR A;  1JE5 A;  1NE3 A;  4JYA Q;  2OQ0 A;  2DGY A;  3CCL A;  4IFD J;  1IBK L;  4DK3 C;  1N9W A;  2HIX A;  4OWW B;  4XIG S;  2JA8 H;  2E5A A;  2JK8 A;  4GKJ Q;  4XTY A;  3S24 A;  1Q81 C;  3A32 A;  4A93 G;  4X65 L;  1N36 Q;  2E64 A;  4YRO A;  5EAY A;  5M5X H;  4HIO A;  4BY7 H;  2PI2 A;  3NEM A;  2UUA L;  2XGT A;  3CME A;  2JE6 I;  4DUZ Q;  4LWC A;  2K52 A;  4KHP L;  1J5E Q;  4A3K G;  4ZTZ B;  2OTJ A;  4B3R Q;  4XEO A;  2N49 A;  1QUQ A;  3CCQ A;  3EFR A;  3BZK A;  2NS6 A;  2B3G A;  1V1Q A;  4JV5 Q;  2NN6 G;  3GTQ H;  4EQ5 A;  3PUV A;  2HNI A;  4JG2 A;  4DPG A;  3AYH B;  1M90 C;  3G71 A;  1GO3 E;  4K86 A;  4CS3 A;  4YRL A;  4A3F G;  4BA2 I;  4DV4 L;  3KF6 B;  1VQH A;  2IT1 A;  4YRR A;  3PUY A;  1VQ7 A;  1Q1B A;  4PHC A;  3A31 A;  12AS A;  2BA1 A;  2ALY B;  5GAE C;  4DV1 L;  1SER A;  2WP8 J;  4YY3 Q;  2E10 A;  4KLK A;  4X64 Q;  2EAY A;  4BBS H;  5C3E H;  2R7Z H;  1Q7Y C;  3A7U A;  1XMQ Q;  1A63 A;  1WQ7 A;  2DUD A;  3UH0 A;  3W3S A;  4RMF A;  3CQZ H;  2ZM6 Q;  4Y7N H;  1Q8K A;  3MQZ A;  3LGJ A;  2C7I A;  5LMN W;  4APV A;  1UE5 A;  1FVI A;  1BIB A;  3L2Z A;  4BWA A;  5IP7 H;  1HXD A;  3ICA A;  1WJJ A;  3S2H H;  2Q7E A;  3GTG H;  3E9I A;  3G6E A;  1WOC A;  1NYQ A;  1X9N A;  1VQK A;  3LSS A;  2DTO A;  3NET A;  2I0Q A;  4P75 C;  2Q2U A;  4A3L H;  4HWT A;  1YGB A;  2A8E A;  1MKH A;  2MQH A;  3I4M G;  4HJ8 A;  4IPH A;  3M4O H;  2AKW B;  2I5M X;  5C0X G;  4R4I A;  1XMO L;  1XPR A;  4O0A A;  3HOW G;  4JI2 Q;  1SES A;  4X62 Q;  3CXC A;  2ARS A;  4R4Q A;  4YP0 A;  4DKA C;  2R92 G;  3NBH B;  1B7Y B;  1I94 L;  4G84 A;  1X01 A;  1YI2 A;  1K0R A;  5M5W H;  2ZR2 A;  4A3M H;  2ZM6 L;  4DV2 Q;  4JI4 Q;  4J15 A;  4A3I H;  3RGL A;  3KYH C;  1Q86 C;  4TWA A;  4DQ2 A;  2ALY A;  3TS2 A;  3H0G H;  3CAM A;  1XNQ Q;  4PZ8 A;  4JBJ A;  2YV5 A;  4O2D A;  1XPO A;  4MTN A;  4DR2 Q;  4TVY A;  2VL6 A;  4IOC A;  3GTL H;  2C8M A;  4DUY L;  5C0X J;  1ADJ A;  4A3J G;  1HZ9 A;  4GNX B;  1JJ2 A;  3A0J A;  2Q5I A;  1HZA A;  2OTL A;  1VQZ A;  1NMG A;  2DQ0 A;  2ZGW A;  4YRK A;  1VQI A;  4A75 A;  1FJG L;  4A3B G;  2ZTD A;  3A7R A;  1A0I A;  5IYB H;  1SFO H;  3EN2 A;  2E65 A;  4DR4 L;  2CGH A;  4DV6 L;  1YFR A;  5GAG C;  5M3M G;  4NXN Q;  1VS0 A;  4HJA A;  1WCM H;  1PH2 A;  4A4I A;  4OO1 I;  3L4G A;  4BW9 A;  4DV3 Q;  1FYF A;  2NZH A;  3PF5 A;  2JA5 H;  4HVC A;  5E7N A;  1YJW A;  1G29 1;  4GKK L;  4LFB L;  4P74 C;  4P75 A;  2JA6 H;  3S1N H;  3KDF A;  1H4Q A;  3H15 A;  4LFA Q;  1JT8 A;  2AMC B;  3U4Z A;  1EUJ A;  4KI0 A;  4GLV B;  1TWH H;  1MJC A;  3MF2 A;  1N8R C;  2DQ3 A;  5GAH C;  3PO3 G;  3STB C;  3K80 C;  4X66 Q;  4A3D G;  4LF7 Q;  2ZJR A;  4DV7 Q;  1YZ6 A;  1AE3 A;  2F4V Q;  4DV0 L;  3RL6 A;  1B8A A;  4QY7 A;  3VQY A;  2H5X A;  1HR0 Q;  2UUB Q;  3J80 i;  3TS0 A;  3KJP A;  2NVQ H;  4B3S Q;  2JEA I;  1H4S A;  2Q5H A;  2IX1 A;  5IY0 A;  4A93 H;  2F52 A;  1WLE A;  3CCJ A;  3HOV G;  3L7Z C;  1YIJ A;  1K83 H;  1K9M C;  2CWP A;  3GTK H;  4POF A;  1AE2 A;  1CUK A;  4JCV E;  2Q2I A;  3T1Y Q;  4JI6 Q;  3HRK A;  2EXD A;  4DR1 L;  3KFU A;  4HID A;  4IFD I;  1N33 L;  4A3K H;  3UDF A;  2WAQ E;  3HXZ A;  4LVI A;  3IKM B;  1Y1V G;  2GVA A;  1FGU A;  3I4N G;  4OP0 A;  4XTU A;  2PMZ E;  2NVX H;  1X2H A;  3LC0 A;  1VQP A;  4LF6 L;  3V8J A;  4LF7 L;  1TWF H;  3RN2 A;  3HOY G;  2OCE A;  4YRT A;  2ODR C;  2ZIM A;  2F3I A;  2N8N A;  4HIM A;  4P3P A;  4A3F H;  3TUP A;  1X55 A;  3J7A 5;  1NJ6 A;  3I56 A;  4JI7 L;  1TWC H;  1O7I A;  4IO9 A;  2DEQ A;  1VQG A;  1K73 C;  4B3M Q;  1VQ4 A;  1PH8 A;  2UXB Q;  4P74 A;  3CPF A;  3M4Q A;  4NXM Q;  2MFI A;  3T1Y L;  1ASZ A;  1E3P A;  4HJ5 A;  3RZD H;  1YJ9 A;  2YTX A;  4WF2 A;  1QUQ B;  4KR2 A;  2DKG A;  3CF5 A;  4CH6 A;  4H2W A;  2RHQ A;  4YRM A;  2K5V A;  2B29 A;  4XU2 A;  4JI0 Q;  1XNR L;  2DVE A;  4R4C A;  5IYC G;  2WFW A;  4L87 A;  1YNX A;  3CCM A;  4LW1 A;  4CS2 A;  3HRI A;  1SRO A;  3E9H A;  4GN3 B;  2KCM A;  3JAM c;  2GN5 A;  2NN6 I;  5C4X G;  1QE0 A;  3U50 C;  3B6Y A;  4IPC A;  3S2D H;  2DDZ A;  1Z9F A;  1VQO A;  2LXJ A;  4GLX A;  3RNU A;  1B76 A;  1FL0 A;  4OLF A;  2PNH A;  3I4M H;  1VQE A;  3REX A;  4P71 A;  4TQF A;  4BY1 G;  1MJE A;  2C35 B;  4ZIB A;  4HJ7 A;  4GOP B;  4LF8 Q;  3A5Z A;  3T1H Q;  3G1Z A;  1YFT A;  3HOW H;  1BVS A;  3OTO L;  3U58 A;  4YRF A;  4Y52 H;  3PO2 G;  2DZC A;  5DLQ E;  2R92 H;  2K5H A;  2R6G A;  4GS3 A;  1IBL L;  1BKB A;  1I3Q H;  1KOG A;  1ADY A;  1Q82 C;  2PME A;  3RZO H;  1YJN A;  1Z7M A;  5BR8 L;  3PF4 A;  4H2V A;  2KCT A;  2UXD Q;  5M3F G;  5LMU Q;  4TVW A;  3DLL A;  1U0L A;  1KRT A;  1W3S A;  1J5W A;  2VQE L;  1NJ8 A;  4OWX B;  4YCW A;  3UFG A;  2ART A;  4A3J H;  1VQ5 A;  4DR5 L;  4CS4 A;  1YB3 A;  2BH8 A;  2BA0 A;  3ERS X;  3NEL A;  1H95 A;  4MNO A;  4JYA L;  2ZTC A;  2MO1 A;  1PFS A;  4YRC A;  2HHH Q;  2CJ9 A;  2VUM G;  4XU3 A;  4TQU S;  1GGM A;  4A3B H;  1SET A;  4YRE A;  3K7A H;  2E5L Q;  1SE8 A;  4HJ9 A;  5FLX c;  4GKJ L;  4HT4 A;  4JBW A;  1P16 A;  1KXL A;  1EVL A;  4H2Y A;  5M3M H;  5C0X I;  3RUX A;  2DJZ A;  1N36 L;  4DR7 Q;  4P72 C;  4UP8 A;  1CSQ A;  1EYG A;  3F2C A;  2ES2 A;  4GOP A;  3HKZ E;  2GVB A;  1L0W A;  1LUZ A;  1CSP A;  2VY3 A;  1YIT A;  2UXD L;  2DXT A;  3K0X A;  3FKI G;  4DUZ L;  4GN5 A;  1OXT A;  3PUW A;  5LMN Q;  3IAL A;  1HNW Q;  1J5E L;  4LF4 Q;  4BA1 I;  4A3C G;  4B3R L;  3TRZ A;  4YHH Q;  4A3G G;  4JV5 L;  4YWM A;  1U5K A;  3PO3 H;  4P73 C;  4LVL A;  4PZ7 A;  3PIP A;  3KLW A;  3V7C A;  4A3D H;  3CCR A;  3VBB A;  2MNA A;  2QEX A;  5C51 B;  3JC6 6; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...