2XGTA

Asparaginyl-trna synthetase from brugia malayi complexed with the sulphamoyl analogue of asparaginyl-adenylate
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
427
Chain Sequence
VKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPNGHELIADFWKIIGNAPPGGIDNVLNASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAQDNTLTESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC
publication title A Hybrid Structural Model of the Complete Brugia Malayi Cytoplasmic Asparaginyl-tRNA Synthetase.
pubmed doi rcsb
source organism Brugia malayi
molecule tags Ligase
total genus 128
structure length 427
sequence length 435
chains with identical sequence B
ec nomenclature ec 6.1.1.4: Leucine--tRNA ligase.
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2xgtA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2xgtA02
3J80i 3LGJA 5DLQE 1KQSA 2JQOA 1GD7A 3V7RA 3GDEA 4XU0A 5C3EG 3VQWA 3E0EA 4OONA 4DAYB 12ASA 1EQRA 4Q15A 4IOCA 2HHHL 2ZZGA 2JEBI 4YHHL 3H0GH 4DR2L 3A74A 4PMWA 3B6YA 4PG3A 1E22A 1LYLA 3RACA 4P75C 4WI1A 2ZNIA 4MZ9A 5JJIA 4HWTA 4DR5L 1WOCA 3WQZA 1V1QA 1LUZA 3RUXA 5C44G 4DV1Q 3K7AH 1SE8A 3KJOA 4CH5A 2AMCB 1EIFA 2IY5A 1VQFA 5C3EH 3TS0A 2JA8G 4JI4Q 4ALPA 4E51A 4AYBE 4X64Q 1E1TA 3KF6B 2UUAQ 2VZAA 1YFRA 4POGA 2WAQG 1YJWA 2E1HA 2C35B 1A0IA 4LFAQ 2R92G 1S40A 5C44H 4YCUA 2NZOA 1BVSA 2DU7A 1VQKA 4RG1A 2JA8H 1Q46A 4OXPA 1WU7A 2PMEA 4XIGS 2N78A 3QNEA 1Q1EA 4QY7A 1YFTA 3I7FA 4G85A 2UUBL 1TWGH 4YREA 4JV5L 1VQCA 1Z7MA 2E8GA 2PNHA 2GVBA 2UXCL 4XU3A 1NMGA 2K14A 3F2BA 1YJNA 4A3CG 2K50A 5C4XG 3NETA 4HJ7A 4LUZA 4OO1I 1U0LA 4G84A 5K1PA 3J81i 3HOVG 4B3SL 1YBYA 3PCOA 3RGLA 1Q1BA 4LW1A 4JI2L 1VQ6A 2HHHQ 4L5TA 1NYQA 2JA6G 3HY0A 4DUZL 4DV7Q 1NJ8A 5M3FG 2Q7EA 1TWCH 2OTLA 1EFWA 1HH2P 3F8TA 1OTCA 1VQ5A 3HOWG 3FJPA 3QTCA 1T9HA 3OTOL 4H2SA 1HNZL 4HIDA 3HOVH 4A3LH 4DK6C 1Q7YC 5F5WA 4NXNL 1PYSB 1X2HA 5ELNA 3CCRA 1NJIC 2JA6H 4YRNA 2A1AA 1Q82C 4L5QA 1PHJA 3GTMH 1IBKL 2E2IH 1SLJA 3CQZH 5LMUQ 5M3FH 4LF8Q 2DUDA 4KR2A 1HZBA 1OXSC 4ZTZB 4HA8A 3RF1A 4BA1I 5E3IA 3CCSA 4IO9A 4GKJL 5HGQA 3L1AA 2B29A 4YWMA 4AQYL 4POFA 2PQAA 1BBWA 2E65A 1NJ5A 3L4GA 1PH7A 4UP7A 1YJ9A 4BXXG 4XTYA 4X62L 3MF1A 2LXKA 2LXJA 2F52A 1AE2A 4BY1G 2NVQH 4PZ8A 4JG2A 2R7ZG 3S24A 2HQLA 2VS1A 4X66L 4A3BG 1PH6A 4IFDI 3REUA 4APVA 1USYA 4JI1L 4DR6Q 2MO0A 3HKZE 4P3OA 3M4PA 4H2XB 1KAWA 3CCQA 1EIYB 2UXBL 1ADJA 2C7IA 3HFZB 3TUPA 2BA1A 4QIWE 1I94Q 2CQOA 4JYAL 4DUZQ 4XTVA 2RHQB 4R4TA 4JBWA 1KC8C 2E5AA 1GVPA 1RIQA 1Z9FA 3UFGA 1UE1A 1Y1VH 2AWNA 4A3FH 1D7QA 4DNIA 1VQJA 1UWVA 4P71C 3NEMA 4LFBL 4R4IA 4DR1L 1PH8A 4NXNQ 4DV2L 4RMFA 2VQFL 2ODRD 3J80c 2QA4A 3KOJA 4AH6A 2CCZA 4A3IG 5JEAG 3EBEA 3NBHB 4HIMA 1BKBA 1NY4A 1QF6A 3CC7A 4YRSA 1XPUA 2CJ9A 2EJ9A 4LF7L 1XPRA 3BZCA 1JB7A 2DDZA 1KMMA 2DEQA 4PZ6A 5EAYA 2PMZE 4LF5L 1TWHH 3OW2A 2IT1A 1UE7A 3I56A 3I55A 4X62Q 2I4MA 1VQ7A 5C52B 4HWOA 4X65L 2I4NA 1B7YA 4LNSA 4YY3Q 3HKSA 1P8LA 1BBUA 1X6OA 3KDFB 3EN2A 1S3OA 2ODRC 2ALYA 1YNXA 4ME3A 4X66Q 4JI5Q 4GN5A 2CKZB 2Z6KC 3JAMi 4XTUA 3RLOA 4O0AA 1P16A 3WWVA 4EQ5A 2AHOB 4OWXB 3PIPA 2CJBA 1AE3A 4JYAQ 4GNXC 1HTTA 2KHIA 1U5KA 4R4CA 4DV1L 4XTZA 4OWTB 4KHZA 3UDIA 4H2YA 1V43A 3RKYA 4LF4L 1HR0Q 2D0PA 1NJ2A 1X54A 4JI4L 2QHTA 1OXUA 4JI6L 3PUVA 1NJ1A 4X64L 2UUAL 4LF6Q 1MKHA 2N3SA 1HC7A 5GQOA 4DR1Q 2ZR2A 2HNIA 4R1JA 4DAMA 3H3VI 2L15A 4GOPC 2AMCA 3HTZA 1JT8A 5C51B 3PV0A 2NN6I 4LFAL 3CCJA 4DV4L 4JCVE 1WYDA 2WB1G 3KF6A 1NE3A 4FDBA 2J3MA 4A4IA 2EXDA 3GTPH 1GO3E 1X3FA 3TRZA 4LF5Q 3ERRA 3S15H 1CUKA 4JI0Q 2FXQA 5IY0A 2VL6A 1KMNA 2JEAI 1NTGA 4UY8C 4YROA 2ZTCA 2VNUD 2MFIA 3S2DH 4CH4A 3K81C 1GGMA 3V7SA 2I5LX 2ZCEA 4DV0L 3V8KA 1YITA 3DSQA 4O2DA 3A7AA 1WFQA 1PYBA 2WAQE 4P71A 1QUQB 1SESA 4DV7L 4TVAB 3QO8A 4A3JH 4GKKL 4TQUS 2R7FA 1K8AC 3VQYA 2E10A 4A93G 4HWSA 5GADC 1OXVA 3AYHB 1PH3A 3W5OA 2ZIMA 4YCVA 1VQ8A 2DXTA 3KLWA 4DPGA 4TWAA 5IT9c 4XTCS 4CS2A 5JJKA 1N36L 4IOAA 1B76A 3KJPA 3HRIA 2OTJA 3RZDH 4LF4Q 1C9OA 2VY3A 4DV5L 3LC0A 2EAYA 1H4TA 1LTLA 4P3PA 4JI6Q 4A75A 3UE0A 2RF4A 3CXCA 1PV4A 3REXA 2ES2A 1Q8KA 5LMUL 1WNLA 4LF8L 1K3RA 4A93H 4ZIBA 2OCEA 1VQZA 4YYEA 4QJFA 2ZZFA 2ZT6A 1PH2A 4GN4B 4DV4Q 3RNUA 4YRJA 1PYSA 4A3MH 4A3DH 5C53B 1FYFA 2I4OA 1EWIA 4L5SA 3F1ZA 3T1HQ 2ZT5A 3UDFA 4DV6Q 1N8RC 4C3JH 4KI0A 1L2FA 1HR0W 4IPDA 4L5RC 4XU1A 3CMEA 3OYYA 1YI2A 4TQDA 1WLEA 2DVEA 3MEFA 3S1MH 3M85A 2AKWA 3BZKA 1JJCB 5FLMH 2B63H 4DV3L 1E7ZA 2ZINA 3TREA 5K1XA 2EIFA 4DR6L 2DZ9A 4XTWA 1WCMH 4NXMQ 3KFUA 2HIVA 1FGUA 3RL6A 1HNXL 4GLVB 4A3LG 2Y0SG 1XJVA 1SRUA 1KXLA 4DV0Q 5LMNQ 1I94L 1EVKA 3D31A 1VCIA 2VW9A 3HOYH 2K52A 4GKKQ 2ZT8A 3A5ZB 3F2DA 2YTYA 4OWWB 3MEYA 4JI3L 1NJ6A 1N32Q 2CIMA 4H2XA 3T1YQ 1EIYA 2JJQA 4R4OA 4KQEA 3R07A 1CKNB 4HJ5A 1MJCA 1N36Q 4IPGA 2P0LA 2R6GA 1O7IA 1VQBA 2NVYH 2RHQA 2OQKA 4DV5Q 4ZTUB 3L0OA 1ATIA 3BJUA 4MNOA 2ATWA 3PUXA 2ID0A 5IP7H 3ICAA 1CSPA 4HIOA 2ZZEA 2DKGA 4C2MH 2ZIOA 1KHIA 3S16H 3IALA 3J7ZC 3ERSX 1S72A 1M1KC 1L1OC 3JAMc 3PZCA 4PHCA 4KR3A 1G5HA 3CC4A 1I50H 4GNXB 1K83H 1QVCA 2R93H 2Q2HA 1VS0A 2YU9H 3HFVA 1VQAA 3GTLH 3A5YA 1NNHA 2OQ0A 2ZTEA 1HXDA 2EL9A 4YY3L 2QEXA 3PO2G 4P74C 4DR4Q 4P75A 1EQQA 4JC0A 3TEHB 2K4KA 2YV5A 4DR3Q 1VQ4A 3V8JA 1E24A 4MTNA 3RN2A 4DV3Q 4JI5L 1Y1VG 1HZAA 4BBRG 3PCOB 1VQOA 1I5FA 2Q2IA 4A3FG 1X56A 4JBJA 1HNXQ 4GOPB 1NMFA 2E64A 4TTVA 4OLFA 2I5MX 4LFCQ 1XMQQ 3KDFA 1XNRQ 1PFSA 5M3MH 3OD1A 3PO2H 1SN8A 1KIXA 3D0FA 1OXTA 1EUJA 3G48A 3UGTA 3S1NH 2IHFA 3BFMA 4JI3Q 1VQHA 3GTKH 1HR0L 3FKIG 2RHSB 1IBMQ 2JA9A 4QGUA 1SR3A 4BBRH 2XGTA 1E1OA 4LF6L 4X5OA 3A31A 4JBMA 2R7DA 2PI2A 2KCMA 3TS2A 4YRCA 3J7A5 2JA5H 4LNQA 3E9IA 2ZTGA 3P8VA 3GTOH 2YTXA 1QVFA 5C4JH 3RKWA 1N34Q 5LMNW 4HJ9A 3W3SA 2DQ3A 2VQEQ 1HZ9A 3G6EA 2YTVA 1W2BA 3FKIH 5IYDH 2KHJA 1YHQA 1PH5A 2GVAA 2BH8A 3CMQA 3I2ZA 1BIBA 2A8VA 3TEGA 3CD6A 4LWCA 3IRBA 4JI0L 3GTJH 5IYCG 2ZJRA 3V7CA 2E5LQ 2E41A 2UUCL 2QHUA 2ZXFA 4AIMA 4HJAA 2JE6I 4YRFA 3MXNB 1UE6A 4A3EH 1SFOH 1QVGA 5FLXc 2YYZA 2UU9L 1FVIA 3S1QH 1C7YA 2DGYA 1J5EQ 4P3NA 5M5XH 1TWFH 3K0XA 3PF4A 4A3KH 1HNWL 1EOVA 1X01A 3ZJYC 2ZJQA 4JI8Q 4EX5A 3CMAA 3HXWA 3AFPA 5IE8A 5K36G 3I4NH 1XPOA 1SMXA 1UE5A 4UP8A 1YEZA 5IYCH 2WB1E 2K75A 2ZJPA 3VQVA 2EWNA 1EYGA 4DKAC 1CSQA 3HXXA 3M4OH 2QHSA 5C0XJ 1QUQA 4TVAA 2DJZA 2IX1A 1FL0A 1AH9A 1VQLA 3UGQA 1YZ6A 3A5UA 2ZM6Q 1GKHA 2Q2TA 3HOUH 4BY7G 4GLAC 2NZHA 3K8AA 5AJ3Q 2DU5A 1QE0A 3CW2C 4IPHA 1ADYA 3STBD 4JI7L 3VBBA 2ARTA 2Q5HA 3RLFA 1K9MC 4B3RQ 1IZ6A 3GO5A 4C3HH 2KCTA 3J81c 3AEVA 2ZTDA 4XU2A 3V8LA 3P8YA 3T1HL 3GD7A 4DK3C 1KL9A 4DV6L 4KLKA 1KRSA 4NCXA 2NVXH 2FYKA 4BY7H 2E2HH 5GAHC 2VUMG 4A3JG 3F2CA 1FJGQ 11ASA 2EJFA 2HT1A 3S17H 4B3ML 2AWOA 3A32A 2UUCQ 1QZHA 2ASBA 3ICEA 2H5XA 3IKLA 4LUVA 1Z7NA 3STBC 5GAEC 4YRIA 3HOZG 4NXML 2KBNA 2UU9Q 4BW9A 3U58A 4PZ7A 5LMNL 1HNWQ 4GLXA 3ULLA 2ZGWA 3CPWA 4Q6GA 2DTHA 3ER0A 3UDGA 1YGBA 1JJCA 2LSSA 5IYBH 2VUMH 1B70B 1KOGA 1L1OB 4YDQA 3M7NA 3S14H 3LSSA 1X9NA 4DUYQ 2QGQA 1N32L 1XTDA 2C8MA 3T1YL 1EVLA 1BIAA 4WJ3M 3HOZH 1N9WA 3L7ZC 4A3MG 2ZT7A 1H4VB 4A3DG 5IWAQ 1PH4A 4NB3A 2MNAA 3CPFA 3H3VH 2ARSA 3A7RA 1HZCA 1G6PA 2XTIA 2DZCA 3KYHC 3A5ZA 2BA0A 1K0RA 3K80C 1A62A 1YFSA 2D0OA 5KNNA 1USYC 3Q8DA 4OX9Q 1X3GA 3PUYA 2IHEA 3U4ZA 1VQDA 1CKNA 1VQ9A 2Q7GA 1Q81C 2E3CA 4JI7Q 5FLMG 2B63G 1PH9A 2DTOA 5BR8Q 2Y0SE 5GROA 4H2UA 1J5WA 4B3TQ 1WCMG 3I4OA 4JBKA 2CFMA 1YHBA 3L2PA 3G71A 4DR7Q 3HXZA 4K86A 3PIOA 3RIRA 2D62A 2Z6KA 3W1BA 1UEBA 3I4MG 1LM0A 1RL2A 3PO3G 3HOYG 1PH1A 4TVYA 4CH3A 3EIVA 4DR4L 1R9TH 3W1GA 3QO7A 4YRTA 4DR3L 1YHAA 1XMOL 1Y14B 4B3MQ 4GNXA 1Y1WG 3G4SA 4P73C 4K0KQ 3CCMA 1JJ2A 2JA7G 1IBLQ 1NBWA 3FP9A 4P72C 4AYBG 1XNQQ 4C3IH 5HY6A 3CCUA 3M3YH 1G5IA 4LFCL 1XMQL 1RIPA 1XNRL 1YVCA 2MO1A 3TEHA 3I4MH 2R92H 4YRRA 5JJLA 3U50C 3PO3H 1B8AA 4YRMA 5IP7G 3RR5A 1VQIA 2ARUA 1JMCA 2I5HA 1KRTA 2ZNJA 3CC2A 4YRPA 4GOPA 2PMFA 1JJGA 1Y1WH 3S2HH 4YHHQ 3AFQA 3IG2A 4DR2Q 1IBML 2G4CA 1Q86C 2IY5B 2JA7H 3HFZA 1QZGA 1C0AA 4DR5Q 2V1CC 2WFWA 2CGHA 3LSQA 2QHVA 2R93G 4IJHA 4A3CH 5C4XH 4OO1G 2Q7HA 1NYRA 2K5HA 3RKXA 3TQYA 4YCWA 3J81j 3PF5A 1N34L 1PA6A 3CF5A 2RHSA 5FJ8G 4IPCA 3QO5A 1V9PA 4YRGA 2VQEL 4DQ2A 4H2VA 3CCLA 4RQFA 1X55A 1PVOA 3HXUA 3HY1A 3ULJA 4JOIC 1MJEA 1X2GA 4K88A 4TVWA 5H1SE 3HOWH 2I4LA 4OP0A 3PUWA 2E5LL 5M3MG 4H2TA 1CKMA 3EFRA 2K5VA 3A7UA 2AKWB 4Y7NH 5FJ8H 4HIKA 3PUZA 4LF9L 2CWAA 1E3PA 4YRQA 3VQXA 1Z47A 1XMOQ 3JC66 1VQMA 2N49A 1J5EL 4BBSG 3RLNA 4HJ8A 2UUBQ 4CH6A 1K73C 1H4QA 2NVTH 4JI8L 4JV5Q 4RDXA 5M5WH 3E9HA 2F3IA 1D8LA 1ASZA 2UXCQ 2JA5G 3NENA 3DM3A 3SGIA 4YWLA 5GAGC 1L0WA 5J3BA 3UH0A 4CS4A 3IKMB 5C0XI 4A76A 2DQ0A 4B3SQ 4EO4A 1VQEA 1N33L 4BXXH 4KHPL 3S1RH 4JI2Q 3H15A 4GS3A 3RN5A 5IYDG 4BBSH 4QQBX 3CCEA 1SROA 4BY1H 2ZM6L 3RZOH 2PI2E 3PSIA 3CCVA 2R7ZH 5AJ3L 4IFDG 1X65A 4HVCA 4A3BH 2UXDL 1KD1C 2P5IA 1WJJA 3OTOQ 4A3GG 2MQHA 5C0XG 1HNZQ 1JE5A 3HRKA 4QL5A 3G1ZA 4A3EG 4LUOA 1WPYA 4B3RL 3K7UC 3CP0A 4XEOA 3HKZG 3DLLA 4TQFA 2PQAB 4YRLA 1H4SA 3MF2A 2GN5A 3UE1A 4P73A 4A3KG 3L4GB 4YRKA 1IBKQ 4HWPA 4P72A 3A0JA 1X3EA 4RQEA 1G291 1DGSA 3UDXA 1IYJB 2K5NA 2N8NA 1FJGL 3I4NG 3U4VA 4GKJQ 4A3GH 4AQYQ 4X6AH 3HOXG 2ZR3A 4LF9Q 4XEMA 4YPFA 1M90C 4WJ4A 1I6HH 5M5YH 2Q5IA 3GTGH 2Z0SA 2JK8A 2F4VL 1TWAH 3AQQA 4L87A 1K8GA 4A3IH 2IX0A 1CKOA 4YP0A 3HOUG 1SRYA 5ELOA 2KENA 2HIXA 1OXXK 4DUYL 4WF2A 2CJAA 2DTIA 3FHWA 4JI1Q 4IFDJ 4Y52H 1IXRA 3HOXH 1MIUA 4UP9A 5IP9G 3GTQH 1N33Q 1WI5A 5IWAL 2UXBQ 4KHPQ 1TXYA 3PGZA 2CWPA 4R4QA 3HXYA 2EJGA 2OWOA 1B70A 4IJLA 4CS3A 4YWKA 1L1OA 3BU2A 1A8VA 4K87A 1WQ7A 4H2WA 1IL2A 1G51A 1VQNA 4OX9L 1GM5A 4BWAA 1A63A 4JOIA 2DXUA 5JEAJ 2UXDQ 3VDYA 2E2JH 3HXVA 1HJPA 1J6QA 1VQPA 3M4QA 4P74A 5BR8L 4NPSA 4LFBQ 5IP9H 2BH2A 4BA2I 4XTXA 1VQGA 4B3TL 2J3LA 4DV2Q 1Q12A 1H95A 4DR7L 3L2ZA 4J15A 1ASYA 1W3SA 2VQFQ 2WP8J 2I0QA 1W66A 3KF8B 2Q2UA 1SETA 1SERA 5IYBG 1B7YB 3P8TA 3ULPA 5E7NA 2A19A 4LF7Q 4HWRA 3M9BA 4UPAA 3NELA 3H0GG 4K0KL 4GN3B 3EFSA 2ALYB 1WQWA 2EQSA 1IBLL 4H02A 2RCNA 1YB3A 2B3GA 3CAMA 1XNQL 4X65Q 2F4VQ 2NN6G 1I3QH 1YIJA
chains in the Genus database with same CATH superfamily
3J80i 2AQ2B 3LGJA 5DLQE 1KQSA 2JQOA 2K04A 1BDOA 1GD7A 4BWGB 4CHTB 2DN8A 1G6ZA 1FNUA 3S2DB 3NUCA 3V7RA 2WB1B 3GDEA 4XU0A 2Q8TA 3UI2A 5C3EG 2Z9HA 2M9VA 4NMZA 3VQWA 3E0EA 5KGUA 3D3RA 4OONA 5DNFA 4XT3B 4DAYB 2FMCA 3ERQA 4ZRZA 12ASA 1EQRA 4Q15A 2PW7A 4IOCA 2HHHL 2ZZGA 1SAPA 2JEBI 2K5DA 1F9QA 4YHHL 3H0GH 4O42A 4DR2L 3A74A 4PMWA 3T4AC 3B6YA 1BF4A 4UDUC 4PG3A 5C5MA 2FFKB 1E22A 1LYLA 3I73A 3RACA 4P75C 1SNMA 4WI1A 4MZ9A 2ZNIA 4QF4A 4RH6A 4L8JA 1VF7A 2F0VA 4A3JB 2QKIC 5JJIA 2RVLA 4HWTA 4DR5L 2LY7A 3LNNA 1WOCA 3WQZA 2NN6H 4FXKC 4C1NK 1V1QA 5D3IB 4C1NI 5BN4A 3VYTA 1BCPC 1LUZA 3CRKC 1TS5A 5CV7A 3RUXA 5C44G 4DV1Q 3K7AH 3U9OA 1EIHA 4H44C 2A8EA 3IFTA 1SE8A 3KJOA 1I4XA 4FF4A 4CH5A 2AMCB 1EIFA 2IY5A 1VQFA 5C3EH 1AZPA 3VYRA 3N52A 3TS0A 3RZDB 1TS4A 1EU4A 2X6GA 2JA8G 4JI4Q 1WTXA 4ALPA 4ZUIA 1NUCA 4E51A 1HUNA 3TMEA 4AYBE 4X64Q 1E1TA 3KF6B 2UUAQ 2VZAA 1YFRA 4RGTA 1IYUA 4POGA 3LX0A 3QOLA 1PZID 1ILPA 2WAQG 4ZKCB 1YJWA 1TY2A 2E1HA 4CKEA 2C35B 4A93B 1Q8IA 3NTIA 1GUOA 1STYA 3MEHA 1A0IA 4U673 3J7AF 4LFAQ 2R92G 1S40A 3AB9A 2XRSD 4JW0A 5C44H 3MFYA 4YCUA 2NZOA 1BVSA 4A3MB 2DU7A 1EFID 1TVXA 5ELEA 4A3DB 5KYLA 1VQKA 4RG1A 4K5VA 4RAUC 2JA8H 1Q46A 1AP0A 4RGOS 4OXPA 1WU7A 2PMEA 4XIGS 4LVKA 2N78A 3QNEA 1Q1EA 4QY7A 4C3JB 1YFTA 4LVIA 3I7FA 4G85A 2UUBL 1DJRD 1TWGH 1LTAD 1VDZA 3MA2B 4YREA 1TS3A 4JV5L 1VQCA 2QW7A 2F4IA 1U9RA 5KIXA 2IX3A 1I4QA 1Z7MA 4M8AA 2E8GA 2PNHA 2WKDA 5ELDA 2GVBA 5A2QL 2UXCL 4XU3A 1NMGA 2K14A 3F2BA 1YJNA 4A3CG 3FPPA 3S1MB 1G8ZD 2F0HA 2K50A 5C4XG 3DEPA 2B63B 3BDCA 4IUTA 1EEFD 4I7ZC 4HJ7A 3NETA 2NTSA 3KBGA 4LUZA 4OO1I 1U0LA 4G84A 5K1PA 5EPJA 3J81i 1ENAA 1BBXC 3HOVG 4ZYSA 1WCMB 1PZKD 4B3SL 1YBYA 3DM1A 3PCOA 3RGLA 2RCFA 3BVMA 1Q1BA 1EY5A 4LW1A 4JI2L 3G6JB 1VQ6A 2HHHQ 1VMCA 3IL8A 4L5TA 1NYQA 2JA6G 3HY0A 1MI2A 4DUZL 1STGA 2J7ZA 5FLXL 5IGGA 4DV7Q 1NJ8A 1AZQA 3OMGA 5KRUA 5M3FG 4PNYA 2Q7EA 1TWCH 1D5XC 1EFWA 1HH2P 2OTLA 3F8TA 4DXFA 4N9TA 2MHVA 3SK8A 4KMUC 1EYCA 1OTCA 1Q90A 1VQ5A 3HOWG 1ZEQX 3FJPA 5IGFA 2L12A 3QTCA 1FGBD 1T9HA 2EVBA 3OTOL 1EEID 5HGTA 4CJ2C 4H2SA 1HNZL 3DMUA 3QB3A 3QR8A 1EZ8A 1VF5C 2B2YA 1LACA 4HN7A 4HIDA 3HOVH 4A3LH 3HGBA 4CDEC 3SVMA 4YIJA 4DK6C 2NVYB 1Q7YC 1MHWC 4O1NA 5F5WA 4NXNL 1PYSB 1TS2A 2TMPA 1V1PB 1X2HA 1IHZA 1CQFA 3SXHA 4KJOA 5ELNA 3CCRA 1NJIC 2JA6H 4YRNA 1EQTA 2A1AA 1Q82C 5K5PA 4L5QA 2F1MA 4DU9A 4K8IA 1PHJA 3GTMH 1IBKL 2E2IH 1SLJA 3CQZH 3NTHA 5LMUQ 1QILA 5M3FH 4LF8Q 5CORA 2DUDA 4KR2A 1CZGA 1HZBA 1OXSC 4RHRA 4C2MB 4HA8A 2NWGA 3RF1A 4ZTZB 4BA1I 5E3IA 3CCSA 4IO9A 5FO9B 5HGQA 4GKJL 1ESFA 3L1AA 2B29A 3TZDA 4HEDA 3S16B 4YWMA 1LTID 4AQYL 4POFA 2PQAA 1BBWA 2BDOA 1I4PA 1JWMD 2E65A 1XXGA 1NJ5A 3L4GA 1PH7A 4UP7A 1YJ9A 4F87A 1WTOA 4BXXG 1I50B 4XTYA 2WIIB 5EKKA 4X62L 3TSSA 1PXUA 1K83B 4HSVA 3MF1A 1K8MA 3A8KE 2LXKA 2LXJA 3MAQA 3P7JA 1KDAA 3PMFA 2F0SA 2F52A 1AE2A 4ZQ3A 4BY1G 1SNCA 2NVQH 3CKIB 2CH4A 4PZ8A 2EZVA 2NS6A 4JG2A 2R7ZG 2E2DC 2QCPX 3S24A 2HQLA 2VS1A 4X66L 4A3BG 1PH6A 4IFDI 3REUA 1EWHA 3QJYA 2Z8LA 4H7BA 4APVA 1USYA 1SYGA 4JI1L 3I91A 3SK4A 4DR6Q 2MO0A 3HKZE 4DGZA 3PIO3 1LTTD 4P3OA 3M4PA 2KHSA 4H2XB 2B2WA 4J1MA 1KAWA 2OXPA 2B39A 5EBDA 4RA8A 3CCQA 1EIYB 2UXBL 1ADJA 2C7IA 2EJFC 3HFZB 3TUPA 2BA1A 4ODGA 4QIWE 1CI3M 3Q0AA 4HMIA 1I94Q 2CQOA 5IOCA 4JYAL 1J9OA 3ND8A 3BYYB 4DUZQ 4KTAA 4XTVA 2RHQB 5M3MB 4R4TA 3PO2B 4JBWA 4LMQD 3RD4A 1KC8C 2E5AA 1GVPA 1RIQA 3S1NB 1Z9FA 5CV6A 3UFGA 4R9WA 4DNRB 1GUNA 3V05A 2KA7A 1UE1A 1SYEA 2ZXRA 1Y1VH 1IYVA 3URYA 4F7XA 3NWTA 2AWNA 4A3FH 1PLFA 1LTGD 1D7QA 3SE0A 4BBRB 4DNIA 1VQJA 1B1ZA 3D6WA 1UWVA 4P71C 4M1UB 3NEMA 4LFBL 3E6ZX 4R4IA 3R8BA 4DR1L 1PH8A 4NXNQ 4DV2L 1SDFA 4RMFA 1Y8NB 3VYSA 2VQFL 1ZKOA 3GTOB 2ODRD 3OIPA 3J80c 5C4JB 2QA4A 3KOJA 1EY7A 4AH6A 1JB3A 2CCZA 4X3SA 4A3IG 5JEAG 3EBEA 3NBHB 4HIMA 1BKBA 1NY4A 1G2SA 1QF6A 1HUMA 3CC7A 4YRSA 1QG7A 1XPUA 5NUCA 1GUWA 2CJ9A 3NTKA 2EJ9A 1L0XB 4LF7L 1XTCD 1PFNA 1XPRA 5EKIA 3BZCA 1JB7A 4WFN3 1KMMA 2DDZA 2DEQA 4PQXA 3FKIB 4PZ6A 5ELBA 4B9WA 5EAYA 4L6TB 1LTBD 2PMZE 2PO4A 3R2IA 4LF5L 1TWHH 5BN5A 2L5TA 3GP7A 3OW2A 1BCPB 2IT1A 1UE7A 5IT9E 3I56A 3MQZA 3I55A 4X62Q 3KF8A 3FPUB 2A5HA 1VQ7A 2I4MA 3K5LA 3GTJB 2A73B 5C52B 4KV6A 2XVSA 4HWOA 1H9SA 4X65L 2I4NA 1B7YA 4LNSA 2RDHA 4YY3Q 3HKSA 5DM63 2K32A 1PMRA 1TIID 3C1EA 1P8LA 1RHPA 1BBUA 1X6OA 1TR5A 2KQ3A 3KDFB 3EN2A 1S3OA 5ISRA 2ODRC 4ILWA 1WTPA 1SFOB 2ALYA 2F0IA 4BS9A 1JQYD 1YNXA 2PZUA 3HKZB 4ME3A 4X66Q 4JI5Q 1D6EC 2IPKD 3S1QB 4GN5A 2CKZB 3H94A 2Z6KC 4TKOB 3WOEA 3JAMi 4XTUA 1E2WA 3RLOA 4O0AA 4Q5VA 5M5XB 1TWFB 3TP6A 3SEBA 1P16A 4A3KB 1JWUD 3WWVA 1KAAA 3MFGA 4EQ5A 1F9PA 4IUVA 2AHOB 2ZT9C 4OWXB 1XYIA 1TU2B 2HUGA 2XWBB 4IUPA 2K5QA 3HRZC 3PIPA 2CJBA 1AE3A 4ZCKA 2E74C 5I9OA 4JYAQ 3I3CA 5KEEA 2KCNA 4GNXC 1HRJA 1MSHA 1CK1A 1SEBD 5DEHA 5EJWA 1HTTA 2KHIA 4DAYA 1U5KA 1SYCA 4R4CA 4C56C 5E4XA 4DV1L 4XTZA 4OWTB 3KK7A 4KHZA 1STNA 3UDIA 1SYBA 2VB3X 4J6HA 1K3BC 1V43A 4H2YA 3NHHA 5ELFA 3RKYA 4LF4L 3M4OB 1HA6A 1HR0Q 2D0PA 1NJ2A 2XWJB 1X54A 4JI4L 2QHTA 1OXUA 1EYAA 4JI6L 3PUVA 5HURA 2D2CC 1FD7D 1NJ1A 2DNCA 4X64L 2UUAL 4LF6Q 1MKHA 2EOTA 2N3SA 1HC7A 5GQOA 4DR1Q 1D5MC 5K36H 4QUCA 2ZR2A 3M4YA 1EOTA 1I6VC 2HNIA 1F2YA 3OW7A 4R1JA 4DAMA 2L15A 3H3VI 3OIQA 4OIJA 1DYQA 1HQMC 4GOPC 2AMCA 3HTZA 1JT8A 5C51B 3PV0A 1JC7A 1ESRA 1M8AA 2NN6I 4LFAL 3CCJA 4DV4L 1R4PB 4JCVE 2N88A 1WYDA 2B2UC 2WB1G 3TZUA 2BCOA 3QIAA 5EBCA 3TP7A 1H9MA 2L9HA 3KF6A 1NE3A 4C3HB 4FDBA 4FF3A 2J3MA 4A4IA 1ZXTA 1DOKA 2EXDA 3GTPH 1GO3E 2EYHA 1OO9B 1X3FA 3EJIA 4LK1C 2ICEC 3TRZA 3TP8A 4LF5Q 3ERRA 3GV3A 3S15H 1CUKA 4JI0Q 3I70A 2HD3A 1I4GA 2NVXB 1JE4A 2FXQA 4BY7B 5IY0A 2VL6A 1KMNA 2DY8A 2JEAI 1B50A 1NTGA 4UY8C 1LT6D 3S17B 2A68D 4YROA 2ZTCA 2VNUD 3ONAB 4QB4A 2MFIA 3S2DH 3CRLC 5JAVA 4CH4A 4XXEA 3K81C 4NP5A 4K5WA 5E3FA 1AEXA 1GGMA 1SNDA 3V7SA 2I5LX 5FKAC 4RGMA 4HCEA 2RDFA 5DM73 2ZCEA 1BQQT 4DV0L 1S5DD 4N8X1 1DD2A 2EYOA 5CC4A 5I2YA 3V8KA 1YITA 4LVMA 2KJXA 3DSQA 4O2DA 3A7AA 2BOSA 1WFQA 5IIFA 4RFBA 1PYBA 1E2VA 2WAQE 1F2MA 2JYOA 4P71A 1QUQB 1SESA 1R4QB 3C1FA 4DV7L 4V0BA 4TVAB 3QO8A 3OPOA 4A3JH 4GKKL 4B9XA 4TQUS 2R7FA 1K8AC 3VQYA 2E10A 2VUMB 4A93G 4HWSA 5GADC 4F88A 1OXVA 3AYHB 1PH3A 3S14B 3W5OA 2F03A 3C2PA 2ZIMA 3MHBA 4YCVA 1VQ8A 2DXTA 3KLWA 3I8ZA 4CKBA 4DPGA 4TWAA 5IT9c 5J22A 4XTCS 4CS2A 5JJKA 4DA2A 1N36L 4IOAA 2B2TA 3KJPA 1B76A 2A68C 3HRIA 1QOHA 2OTJA 4MN3A 4OIKA 3VA5A 3HOZB 3RZDH 4LF4Q 1C9OA 2ICIA 2VY3A 5CYUA 3T16A 4DV5L 3LC0A 5M9OA 2K5WA 2EAYA 1II3A 4C3JG 1H4TA 1LTLA 1LTSD 4JI6Q 5I9PA 4P3PA 4TRDA 2V4DA 5I4DA 4A75A 3UE0A 2RF4A 3SDZA 3CXCA 2L0CA 1O7LA 4HCSA 1PV4A 3REXA 3EQLC 1NR2A 2NB0A 2ES2A 1F2LA 1Q8KA 1DOLA 2E76C 5LMUL 1LV9A 1WNLA 4LF8L 4JPBW 4N9PA 1K3RA 4UHVA 4A93H 4ZIBA 4KKUA 2OCEA 1IKLA 1CFMA 1VQZA 4QJFA 1DZ1A 4YYEA 2ZZFA 2ZT6A 1G2TA 4IQZA 3V96A 3BG3A 4CJ1B 1O7ZA 1PH2A 1ET6A 4GN4B 4I65A 4DV4Q 3RNUA 3DUZA 1AFPA 5D3DA 4YRJA 1PYSA 4ABNA 4A3MH 1V1PA 4A3DH 1WTHA 2K28A 5C53B 1FYFA 2I4OA 1GHJA 4WORA 5TSSA 1EWIA 4L5SA 3F1ZA 3T1HQ 4PV1C 3HP3A 2ZT5A 3UDFA 1RTOA 2L4NA 4DV6Q 1N8RC 4C3JH 5T1IA 4KI0A 1UAPA 1L2FA 1HR0W 4IPDA 4KKSA 1RF2D 2NUCA 4L5RC 1JICA 4XU1A 5ELCA 1D1KA 3CMEA 1ICWA 1QE6A 3OYYA 1GUSA 3FRPB 1YI2A 3BVGA 1MD2D 1QNUA 4CDFC 4TQDA 3D8GA 1WLEA 1EY6A 2DVEA 3MEFA 3S1MH 3M85A 2AKWA 3BZKA 1R9TB 1RKNA 1JJCB 5FLMH 2B63H 4DV3L 1E7ZA 4MTKA 2ZINA 1FR3A 3TREA 5K1XA 2RKSA 3H91A 2EIFA 2MUYA 4DR6L 4EQOA 2DZ9A 3TDQA 1M4VA 4XTWA 1WCMH 4NXMQ 3KFUA 1I4HA 2HIVA 1FGUA 3RL6A 1HNXL 2F0WA 3VR5A 4GLVB 2F0EA 4A3LG 2Y0SG 1XJVA 2K01A 3M7GA 3EROA 3J80E 1SRUA 1KXLA 4DV0Q 4C3IB 1KDBA 5LMNQ 4HMJA 3M3YB 2M2LA 1I94L 1EVKA 3D31A 1VCIA 4K2KA 3VR6A 4KK7A 5COYA 2VW9A 3HOYH 3I4MB 2R92B 3BDOA 2K52A 1PYWD 3DWQA 3PO3B 3HOYB 4GKKQ 2ZT8A 4IALA 3A5ZB 3F2DA 2YTYA 1HXYD 4OWWB 3MEYA 4JI3L 1NJ6A 1N32Q 5BN3A 2CIMA 4H2XA 5JPMC 3T1YQ 2AQ1B 1EIYA 2MJ8A 2JJQA 1Y1WB 4R4OA 5KNCA 3S2HB 4KQEA 3R07A 1CKNB 2ZXPA 1MJCA 4HJ5A 4IPGA 1N36Q 2P0LA 4HT4A 2R6GA 1O7IA 1GUGA 2SNMA 4NW2A 2JA7B 1VQBA 2B2VA 1A3UA 2NVYH 2PQEA 1X32A 3Q22A 2RHQA 4AYBB 1STAA 2OQKA 4KD3A 4DV5Q 4ZTUB 3L0OA 3MXUA 1ATIA 2K03A 5CV5A 4XDXA 4DK1A 5FLXE 3FMCA 1S5BD 3BJUA 3GQBA 4IURA 4MNOA 1A3VA 5C4XB 1UNSA 2ATWA 3PUXA 2ID0A 2D9UA 5IP7H 1DM0B 4P2CB 3K6OA 3ICAA 1CSPA 2O2LD 1JORA 4HIOA 1KABA 1W6KA 2ZZEA 2DKGA 4C2MH 2NYZD 4X3UA 1SBBB 1BO0A 1WD1A 2ZIOA 3SK5A 1CM9A 2O4XA 1CQVA 5JJZA 1QJOA 1KHIA 3S16H 3BZDB 3J7ZC 3IALA 3ERSX 1S72A 1M1KC 2Z4HA 1L1OC 3JAMc 3PZCA 3RUZA 4PHCA 4V190 4KR3A 4RCOA 4KY5A 1KLGD 1G5HA 2WACA 3CC4A 1I50H 1TQOA 1I4RA 3BS1A 4GNXB 1F9SA 3TN2A 1K83H 1QVCA 3MWYW 3K5MA 2R93H 2Q2HA 4IZ8A 1VS0A 2C5CA 2OEOA 3NBHA 2YU9H 3HFVA 1VQAA 5FO8B 4XYQA 3GTLH 2R93B 1NNHA 3A5YA 1SNQA 2OQ0A 2ZTEA 1HXDA 2YU9B 2Z1CA 2EL9A 3GTLB 1JCKB 4YY3L 2QEXA 1Y69U 3PO2G 3H3VC 1PRTD 4EVOA 4P74C 1ZYRD 1CA5A 4DR4Q 1JR0D 1SJED 4P75A 1EQQA 2PW5A 4Y7NB 4JC0A 4XYOA 3TEHB 2K4KA 2YV5A 4DR3Q 2A6ED 1VQ4A 3V8JA 1E24A 4MTNA 2BDNA 1ET9A 4FF2A 3RN2A 4OGQC 1O7YA 4DV3Q 2HCCA 4JI5L 2MPMA 1Y1VG 2B8GA 1HZAA 4BBRG 3PCOB 1STHA 1VQOA 1I5FA 4EGVA 2Q2IA 4A3FG 1X56A 1U4RA 4KJNA 4JBJA 1Z7TA 1HNXQ 3CHBD 4GOPB 5E4WC 2NVTB 1NMFA 2E64A 1KNAA 1QWYA 4TTVA 1S5FD 4OLFA 2I5MX 5M5WB 4LFCQ 1XMQQ 3KDFA 1XNRQ 5KNDA 1PFSA 1DOMA 4CGYB 2I07B 2CQAA 1E0BA 5M3MH 3J81E 4FYDA 1J8IA 3OD1A 1RTNA 2QILA 3PO2H 4RWSC 1SN8A 1KIXA 3D0FA 2WV6D 3QO2A 1OXTA 4J8QA 1EUJA 2EPBA 3G48A 1B9NA 3UGTA 4DNTB 3A55A 3S1NH 4MIUA 1NR4A 2IHFA 3R2TA 3BFMA 4JI3Q 1KTKA 1PRTC 1VQHA 4HTHA 1ZYRC 3GTKH 1HR0L 3S1RB 3FKIG 2RHSB 3GTKB 1IBMQ 2JA9A 3TBIB 4QGUA 2A6EC 1SR3A 4BBRH 2XGTA 4LAAA 4BBSB 1E1OA 4LF6L 4X5OA 3A31A 4JBMA 2R7DA 2PI2A 2KCMA 3I90A 4WRDA 4BY1B 4RGNA 3TS2A 3RZOB 3TP5A 4YRCA 3J7A5 1B3QA 2EY1A 5I2XA 2JA5H 3NBIA 4LNQA 1WTVA 3E9IA 2L11A 2R7ZB 2ZTGA 2JA5B 3P8VA 3GTOH 1RJTA 2JXMB 2YTXA 1QVFA 5C4JH 2BE5D 1YNJD 3RKWA 3DHQA 1N34Q 4DF7A 5LMNW 4HJ9A 2IJ0A 2OT2A 1BOSA 2F0UA 3W3SA 1B4OA 1U4PA 2DQ3A 2VQEQ 2F0LA 4FO2A 3VR3A 1HZ9A 3G6EA 4UAIA 2YTVA 1W2BA 3FKIH 1EWCA 2F0GA 2R3ZA 5FOBB 5IYDH 1D2BA 2KHJA 1YHQA 1PTOD 1PH5A 2GVAA 2BH8A 3CMQA 3PQIA 3I2ZA 1BIBA 2A8VA 3TEGA 2X6LA 4Q0FA 2A6HD 1CA6A 3CD6A 4LWCA 5J39A 3C3LA 3OMCA 3IRBA 4JI0L 4NKLA 3SK6A 3GTJH 3A8IE 3ZYYX 5IYCG 2ZJRA 3V7CA 2Q8RE 2E5LQ 2E41A 2UUCL 2QHUA 2ZXFA 5C0XH 4AIMA 4HJAA 2JE6I 2K1BA 4G7ZC 4A3GB 4RKLA 1DONA 4YRFA 1AN8A 3MXNB 3RMHA 5IGDA 4X3KA 1UE6A 2F0NA 4A3EH 1SFOH 1QVGA 5FLXc 3D4RA 2YYZA 1SMYD 2BE5C 1YNJC 1H9KA 2UU9L 4RKBA 5KYIA 4A3EB 4KN4C 4WJWA 1FVIA 3S1QH 1I6HB 5M5YB 1EY0A 1C7YA 4PMCA 2DGYA 5E1FA 1J5EQ 4P3NA 5M5XH 1TWFH 3K0XA 3GTGB 3PF4A 2HDLA 4A3KH 1HNWL 1EOVA 1X01A 3ZJYC 1ENFA 2ZJQA 4JI8Q 4EX5A 2GA4B 3CMAA 3HXWA 1MGSA 1KDCA 4A3IB 3AFPA 4QIWB 1D5ZC 1PTOC 3SR1A 5IE8A 3AMUA 3H6MA 5K36G 5G3LF 3VA7A 3NPPA 5CV9A 2DJFC 3E3XA 3I4NH 2EXZA 1XPOA 1S5ED 1SMXA 1UE5A 2A6HC 1LO5D 4UP8A 1YEZA 1U4MA 5IYCH 3BYTB 3I4NB 2WB1E 5EPKA 3L3OC 3KUPA 2K75A 1H9RA 2ZJPA 3VQVA 1B44D 1HHVA 2QDLA 3HOXB 2JSOA 2EWNA 1EYGA 4FXGC 3LWUA 4DKAC 1CSQA 3HXXA 4C3HG 3GTQB 3M4OH 2QHSA 1T5XD 2NTTA 5C0XJ 1A3TA 1QUQA 3T53B 4TVAA 2DJZA 2IX1A 2PZWA 2EYMA 4NDXA 1FL0A 1SMYC 1AH9A 5JVG3 3OHXC 1PFMA 4XT1B 1VQLA 3UGQA 1YZ6A 3A5UA 2ZM6Q 1GKHA 2Q2TA 3HOUH 4BY7G 4GLAC 2NZHA 3K8AA 5JVH3 2EY5A 3HOUB 1X3PA 5AJ3Q 3EA6A 3CU7A 1QE0A 2DU5A 3CW2C 4IPHA 4CDDC 1C48A 3X3MA 1ADYA 3STBD 4CDCC 4JI7L 3X3NA 3VBBA 2ARTA 2Q5HA 1LLRD 4KHVA 3T13A 2E2JB 4G4KA 3RLFA 1K9MC 1A6XA 4DAVA 2PZTA 4B3RQ 1PZJD 1IZ6A 3GO5A 4C3HH 2KCTA 3J81c 3AEVA 2KOLA 2ZTDA 4QMGA 3FDTA 4XU2A 2L1BA 2F0KA 3V8LA 3P8YA 2PMZB 1NCVA 5JPNC 3T1HL 3GD7A 3P1HA 4DK3C 1KL9A 3OWFA 4DV6L 2QEJC 4KLKA 3I72A 2KECA 1KRSA 1Z6HA 4XQNA 4NCXA 2CVRA 2NVXH 2FYKA 4BY7H 2E2HH 5GAHC 2VUMG 5G3LD 4A3JG 2B2YC 3IFDA 4G7OC 1EY9A 3F2CA 1FJGQ 4Z9CB 11ASA 2E2HB 2EJFA 2HT1A 3S17H 1SE2A 1HPCA 2AWOA 4B3ML 3A32A 5EKLA 2F0MA 2UUCQ 1QZHA 1F9RA 2ASBA 3ICEA 4LVLA 1O78A 2H5XA 2SNSA 3IKLA 2HDMA 2MGSA 4LUVA 2QF7A 1Z7NA 3STBC 1EY4A 5GAEC 4YRIA 4HSPA 2ZXOA 4ZLTF 3HOZG 2NBFA 3ND9A 4QUFA 4NXML 4X3TA 2KBNA 2UU9Q 1ML0D 5I6WA 3BVZA 3C46A 1YNND 2AUJD 3U9SA 5LL6S 4BW9A 3U58A 1TY0A 1XX8A 3K0YA 4FNFA 2G9HD 4PZ7A 5LMNL 1HNWQ 1I3QB 4GLXA 1JOQA 2SDFA 5L37A 3ULLA 1GJXA 2ZGWA 3CPWA 4Q6GA 3OSOA 2DTHA 3ER0A 2OF1A 3UDGA 2EYPA 1YGBA 1JJCA 2LSSA 5IYBH 3GV6A 5IODA 5C5LA 2VUMH 1B70B 2M00A 1KOGA 3JAME 1L1OB 1GOZA 4YDQA 1X3QA 2IL8A 3M7NA 1JOOA 3MTSA 3S14H 3LSSA 1X9NA 4DUYQ 2QGQA 1N32L 4EQNA 1SNPA 1XTDA 2PNRC 2C8MA 2J4XA 3T1YL 1EVLA 2CH4W 1BIAA 3H0GB 4DN4M 4WJ3M 3HOZH 1N9WA 3L7ZC 4A3MG 4K2LA 1EYDA 4H0LC 2ZT7A 3D4WA 5C4ZA 4A3DG 1H4VB 5IWAQ 1PH4A 4NB3A 4OEMB 2MNAA 1A2TA 3CPFA 3H3VH 2O5JC 2ARSA 3A7RA 1HZCA 1A15A 3EFXD 5A35A 2SEBD 2XTIA 1G6PA 2DZCA 3KYHC 1SE3A 2J0TD 3MZ5A 3A5ZA 2BA0A 1KNEA 1K0RA 1A62A 3K80C 3K58A 1YNNC 1YFSA 2AQ3B 2D0OA 5KNNA 1USYC 3Q8DA 4OX9Q 3DXJC 3K59A 4RCNA 1X3GA 5EPLA 3PUYA 3K7AB 4KY6A 2G5DA 3VR4A 2IHEA 1FNVA 3U4ZA 4ZK9B 2B2WC 4FP5D 1VQDA 1BR9A 1SSOA 1CKNA 1VQ9A 2Q7GA 1Q81C 2E3CA 5C3EB 4JI7Q 4TSSA 5EGTA 5FLMG 2B63G 2FMMA 5DAUA 1PH9A 3FEWX 3PIP3 2DTOA 5BR8Q 2Y0SE 1STEA 3N6RA 5GROA 4CBVA 4H2UA 1J5WA 4B3TQ 1DCZA 2ENBA 1WCMG 3I4OA 4JBKA 3G7LA 4JVZA 4R8IA 2CFMA 4C3IG 1YHBA 3L2PA 1IKMA 3G71A 4DR7Q 3HXZA 2KCCA 4K86A 3PIOA 3RIRA 2D62A 2Z6KA 3W1BA 1UEBA 2TSSA 3I4MG 1LM0A 1S5CD 1L0YB 1PRTB 4LVJA 1RL2A 3PO3G 3HOYG 1PH1A 4TVYA 4CH3A 2X69A 5C44B 2HCIA 3EIVA 4PMBA 4DR4L 3ITPA 2KUMA 1R9TH 3NXWA 3W1GA 3QO7A 5I6YA 4YRTA 2FHTA 1YHAA 4DR3L 1Y14B 1XMOL 2F3VA 4B3MQ 3DEOA 4HR7B 1WTWA 1UUPA 3J80L 2VXWA 2JA8B 4GNXA 1Y1WG 3G4SA 2A69D 4K0KQ 4P73C 3R3OA 3CCMA 1JJ2A 2B8FA 2JA7G 2N55A 5AFWA 1WTQA 2EYLA 1IBLQ 1NBWA 3FP9A 4P72C 1TWGB 5J1ZA 4AYBG 3A7AB 1B9MA 3K57A 2F0TA 1XNQQ 4C3IH 5HY6A 5T1GA 4IUUA 3CCUA 2H4OA 2WAQB 3M3YH 1G5IA 4ZKBB 4LFCL 1XMQL 2XNAC 1RIPA 1XNRL 1YVCA 2MO1A 3TEHA 3I4MH 2R92H 3NE5B 2EYFA 2LKVA 4YRRA 2XIWA 2WINB 4DXGA 5JJLA 3U50C 3PO3H 1B8AA 4YRMA 2A74C 2NZ1D 1PRTF 5IP7G 1ILQA 3RR5A 1VQIA 5A2QE 2ARUA 1JMCA 1O80A 1SNOA 2R61A 2I5HA 1KRTA 1IL8A 2ZNJA 1WVLA 3CC2A 1HTLD 4YRPA 4GOPA 3P75A 4ULLA 2PMFA 1JJGA 1EIGA 1Y1WH 3S2HH 1F2ZA 4YHHQ 3AFQA 3IG2A 4DR2Q 1IBML 2G4CA 1Q86C 4G57A 2IY5B 1ENCA 5FK9C 2JA7H 3HFZA 2B2UA 3KLSX 5LHY1 1QZGA 1RDPD 2A69C 1ONLA 1C0AA 4ZUJA 5CMDA 4DR5Q 2V1CC 2WFWA 1TWCB 2CGHA 3LSQA 5D14A 2QHVA 4JK1C 2R93G 4IJHA 4A3CH 4EQPA 1TT2A 5C4XH 4OO1G 2Q7HA 1NYRA 5IGEA 3VR2A 2K5HA 3K5NA 3TQYA 2I46A 3RKXA 4YCWA 3J81j 3PF5A 1N34L 1PA6A 4ZAIA 3CF5A 2RHSA 1CTMA 3IKJA 5FJ8G 3K5OA 4F8MA 4G7HC 1H9JA 1NSNS 1GUTA 2K6AA 4KKTA 4IPCA 1LTRD 3QO5A 1V9PA 3MXPA 1V8QA 3HOVB 2CW0D 4YRGA 2Y0SB 2VQEL 4DQ2A 1PTOH 4H2VA 3QOJA 3CCLA 4RQFA 2EJGC 3A7LA 1PTOB 3NP8A 1X55A 1PVOA 2Z4IA 3HXUA 1QNKA 3W2DA 1XWEA 3MXGA 3A56A 2JA6B 3Q23A 3HY1A 3ULJA 1Q3LA 1CHPD 2F0QA 3GTMB 2E2IB 3CQZB 5C3WA 1IW7D 1JWSD 5M3FB 2KEDA 1Y8OB 4JOIC 1BXTA 5IGBA 1MJEA 3LWEA 1X2GA 4K88A 4TVWA 5H1SE 3HOWH 2I4LA 4OP0A 3PUWA 5CGKA 4OO1H 2E5LL 5M3MG 3AU7A 3HOWB 1CKMA 4H2TA 3EFRA 1Y8PB 2K5VA 3A7UA 2AKWB 3HZXA 2MP1A 4GZYC 2WKCA 4Y7NH 5FJ8H 4HIKA 3PUZA 4LF9L 2CWAA 1E3PA 2RBMA 1TKWB 1B3AA 4YRQA 3VQXA 3P20A 1Z47A 1HQRD 4K14A 1XMOQ 4FVMA 4K6DA 3WOFA 3JC66 1QB5D 1NAPA 1VQMA 5KNBA 4MHEA 3D4DA 2N49A 2XN9C 4IUQA 1J5EL 1T5EA 4BBSG 2CW0C 1JOKA 3MC0B 3RLNA 4HJ8A 2UUBQ 2D5DA 1PTOF 2F0JA 2FJ2A 4CH6A 1K73C 3J81L 4FF1A 2NVTH 1H4QA 2EY2A 4JI8L 4JV5Q 4RDXA 5EQ0A 5M5WH 2LS01 1BUVT 3E9HA 2F3IA 2LFNA 1D8LA 5CV8A 2K33A 1ASZA 3WDNA 2UXCQ 2JA5G 2NVQB 4RHSA 2PPBC 4DAPA 3OWEB 2Q8IB 3MXNA 1LT4D 2XSCA 3NENA 2IW3A 3DM3A 3SGIA 4YWLA 1IW7C 3MVVA 5GAGC 1SYFA 1L0WA 2PYKA 5J3BA 5CR3A 1CHQD 4S3SA 3UH0A 1VMPA 4CS4A 2DY7A 3IKMB 5C0XI 4A76A 2DQ0A 4B3SQ 2K05A 1KLUD 1GXDC 4E6IA 4EO4A 1VQEA 4KD4A 1N33L 4BXXH 3IAYA 2EJMA 3QWNA 1FNWA 4QCLA 4KHPL 3S1RH 2L55A 2LMCB 5FO7B 4JI2Q 3H15A 5D65A 2KVMA 3DWAA 1NNXA 4GS3A 3RN5A 5IYDG 2RA4A 4BBSH 5C4HA 4QQBX 3CCEA 5C3XA 1SROA 3FVQA 4BY1H 2ZM6L 3W3AA 3RZOH 2PI2E 2VB2X 3PSIA 1HTPA 3T51B 3CCVA 1EY8A 1CZWA 2AUKA 5AJ3L 2R7ZH 4IFDG 1X65A 2CHBD 1GHKA 3KLRA 4K5XA 2RDGA 4HVCA 4A3BH 1SJHD 1WTRA 2UXDL 4B08A 1KD1C 2P5IA 1WJJA 3OTOQ 1E2ZA 1FYCA 2EY6A 4ME5A 3J7YW 2EYJA 4A3BB 4A3GG 1K8OA 1Y1VB 2RQXA 2MQHA 5C0XG 2K7VA 1HNZQ 1JE5A 3HRKA 4QL5A 3G1ZA 4A3FB 4A3EG 4LUOA 1WPYA 4B3RL 3K7UC 3CP0A 1CT1D 4XEOA 3HKZG 2F0PA 3DLLA 1B2TA 4TQFA 2PQAB 3O13A 2DJGC 4YRLA 1H4SA 3MF2A 4OHJA 2GN5A 3BDLA 5IT9L 3UE1A 4P73A 4A3KG 2H1EA 3L4GB 5C6AA 1W6JA 2F0FA 4H13C 4YRKA 1IBKQ 4HWPA 1MSGA 4P72A 3A0JA 1X3EA 2B2TC 4RQEA 1G291 1DGSA 3UDXA 1IYJB 2K5NA 2N8NA 4IFDH 1FJGL 2KEEA 3I4NG 3U4VA 1U4LA 4K8JA 3DWPA 2EDGA 4GKJQ 4CJ0B 3HS0C 4A3GH 3NK9A 4AQYQ 4X6AH 2DNEA 2JP1A 3HOXG 2ZR3A 1UEAB 3A8JE 2EE1A 4LF9Q 3E5SA 4XEMA 4KN7C 4YPFA 1TWHB 1M90C 1K28A 4WJ4A 1I6HH 5M5YH 2Q5IA 3V2TA 3T56B 3GTGH 2Z0SA 2JK8A 2F4VL 1HA5A 1TWAH 3L9AX 5CV4A 3AQQA 4L87A 3HEJA 1V1OA 1K8GA 1TWAB 4A3IH 2IX0A 5JEAH 1CKOA 4YP0A 3HOUG 2SOBA 1SRYA 4U68A 5ELOA 1SYDA 3NQIA 3Q24A 2KENA 2F3WA 3QG1A 2HIXA 1EZ6A 1OXXK 4DUYL 2O5IC 4WF2A 2CJAA 1SE4A 4XQQA 2DTIA 3FHWA 3F2UA 3I4LA 3E0JA 1SXTA 1PDQA 4JI1Q 4IFDJ 4Y52H 4FXDA 1IXRA 5CBEE 3HOXH 1EL0A 1A2UA 1MIUA 1F77A 4UP9A 1BNZA 5IP9G 3GTQH 1STBA 1G91A 1N33Q 1WI5A 4IUNA 4LJZC 5IWAL 2UXBQ 2FINB 4KHPQ 1TXYA 3PGZA 3HG9A 1BCPF 2CWPA 4R4QA 3HXYA 2EJGA 2OWOA 3EVQA 4OELB 2JN4A 1B70A 4IJLA 4CS3A 4YWKA 1L1OA 2E75C 3KLSA 5IGCA 1MBYA 3BU2A 1A8VA 4K87A 1WQ7A 5JOBA 4H2WA 1IL2A 1G51A 3NQTA 1RCVD 1VQNA 4IN3A 4DFAA 4OX9L 5LL6X 1GM5A 4BWAA 1EQVA 3D6CA 2Z6BA 2QDBA 3H09A 1A63A 4JOIA 3J7AV 1HCZA 2DXUA 5JEAJ 1HFNA 3A54A 2UXDQ 3VDYA 1K0SA 1C4QA 1RODA 2E2JH 3HXVA 3KBXA 1HJPA 1J6QA 1VQPA 3M4QA 4I7AA 4P74A 5BR8L 5CBAE 2XRQD 4NPSA 4LFBQ 5IP9H 2BH2A 2C9OA 4BA2I 3SHLA 1VQGA 4B3TL 4XTXA 2J3LA 1LABA 1RD9D 1QCBD 1S4ZA 4DV2Q 1Q12A 2HQEA 4KY7A 1H95A 1PFBA 1D1IA 2F0OA 1B53A 4DR7L 3L2ZA 4J15A 3NSWA 1ASYA 1W3SA 2VQFQ 2WP8J 2F0DA 2I0QA 1ICFB 1W66A 1C8CA 3NWSA 4L63B 3S9WA 4HAEA 3KF8B 2Q2UA 2G9DA 2PCFB 1SETA 1SERA 5IYBG 1H9SB 2RSOA 2B2VC 1B7YB 3P8TA 3ULPA 1DXMA 5E7NA 5F2DA 2A19A 4LF7Q 4HWRA 3M9BA 4UPAA 4DK0A 2IWHA 1HFGA 4R8NA 3R93A 3GTPB 3NELA 3H0GG 4K0KL 3VYUA 1EU3A 4GN3B 1AW7A 3EFSA 2ALYB 2P5ZX 4ID6A 1WQWA 3OOCA 2EQSA 1IBLL 3S15B 4H02A 2RCNA 1YB3A 2B3GA 3CAMA 1BCPD 1LT5D 1LT3D 4OL7A 1XNQL 4XQJA 4K6LA 4X65Q 2F4VQ 2NN6G 3JAML 1I3QH 4CKCA 2RSNA 3Q6SA 1WD0A 1YIJA 4N8FA
chains in the Genus database with same CATH topology
3J80i 3LGJA 5DLQE 1KQSA 2JQOA 1GD7A 3V7RA 3GDEA 4XU0A 5C3EG 3VQWA 3E0EA 4OONA 4DAYB 12ASA 1EQRA 4Q15A 4IOCA 2HHHL 2ZZGA 2JEBI 4YHHL 3H0GH 4DR2L 3A74A 4PMWA 3B6YA 4PG3A 1E22A 1LYLA 3RACA 4P75C 4WI1A 2ZNIA 4MZ9A 5JJIA 4HWTA 4DR5L 1WOCA 3WQZA 1V1QA 1LUZA 3RUXA 5C44G 4DV1Q 3K7AH 2A8EA 1SE8A 3KJOA 4CH5A 2AMCB 1EIFA 2IY5A 1VQFA 5C3EH 3TS0A 2JA8G 4JI4Q 4ALPA 4E51A 4AYBE 4X64Q 1E1TA 3KF6B 2UUAQ 2VZAA 1YFRA 4POGA 2WAQG 1YJWA 2E1HA 2C35B 1A0IA 4LFAQ 2R92G 1S40A 5C44H 4YCUA 2NZOA 1BVSA 2DU7A 1VQKA 4RG1A 2JA8H 1Q46A 4OXPA 1WU7A 2PMEA 4XIGS 4LVKA 2N78A 3QNEA 1Q1EA 4QY7A 4LVIA 1YFTA 3I7FA 4G85A 2UUBL 1TWGH 4YREA 4JV5L 1VQCA 1Z7MA 2E8GA 2PNHA 2GVBA 2UXCL 4XU3A 1NMGA 2K14A 3F2BA 1YJNA 4A3CG 2K50A 5C4XG 3NETA 4HJ7A 4LUZA 4OO1I 1U0LA 4G84A 5K1PA 3J81i 3HOVG 4B3SL 1YBYA 3PCOA 3RGLA 1Q1BA 4LW1A 4JI2L 1VQ6A 2HHHQ 4L5TA 1NYQA 2JA6G 3HY0A 4DUZL 4DV7Q 1NJ8A 5M3FG 2Q7EA 1TWCH 2OTLA 1EFWA 1HH2P 3F8TA 1OTCA 1VQ5A 3HOWG 3FJPA 3QTCA 1T9HA 3OTOL 4H2SA 1HNZL 4HIDA 3HOVH 4A3LH 4DK6C 1Q7YC 5F5WA 4NXNL 1PYSB 1X2HA 5ELNA 3CCRA 1NJIC 2JA6H 4YRNA 2A1AA 1Q82C 4L5QA 1PHJA 3GTMH 1IBKL 2E2IH 1SLJA 3CQZH 5LMUQ 5M3FH 4LF8Q 2DUDA 4KR2A 1HZBA 1OXSC 4ZTZB 4HA8A 3RF1A 4BA1I 5E3IA 3CCSA 4IO9A 4GKJL 5HGQA 3L1AA 2B29A 4YWMA 4AQYL 4POFA 2PQAA 1BBWA 2E65A 1NJ5A 3L4GA 1PH7A 4UP7A 1YJ9A 4BXXG 4XTYA 4X62L 3MF1A 2LXKA 2LXJA 2F52A 1AE2A 4BY1G 2NVQH 4PZ8A 2NS6A 4JG2A 2R7ZG 3S24A 2HQLA 2VS1A 4X66L 4A3BG 1PH6A 4IFDI 3REUA 4APVA 1USYA 4JI1L 4DR6Q 2MO0A 3HKZE 4P3OA 3M4PA 4H2XB 1KAWA 3CCQA 1EIYB 2UXBL 1ADJA 2C7IA 3HFZB 3TUPA 2BA1A 4QIWE 1I94Q 2CQOA 4JYAL 4DUZQ 4XTVA 2RHQB 4R4TA 4JBWA 1KC8C 2E5AA 1GVPA 1RIQA 1Z9FA 3UFGA 1UE1A 1Y1VH 2AWNA 4A3FH 1D7QA 4DNIA 1VQJA 1UWVA 4P71C 3NEMA 4LFBL 4R4IA 4DR1L 1PH8A 4NXNQ 4DV2L 4RMFA 2VQFL 2ODRD 3J80c 2QA4A 3KOJA 4AH6A 2CCZA 4A3IG 5JEAG 3EBEA 3NBHB 4HIMA 1BKBA 1NY4A 1QF6A 3CC7A 4YRSA 1XPUA 2CJ9A 2EJ9A 4LF7L 1XPRA 3BZCA 1JB7A 2DDZA 1KMMA 2DEQA 4PZ6A 5EAYA 2PMZE 4LF5L 1TWHH 3OW2A 2IT1A 1UE7A 3I56A 3MQZA 3I55A 4X62Q 2I4MA 1VQ7A 5C52B 4HWOA 4X65L 2I4NA 1B7YA 4LNSA 4YY3Q 3HKSA 1P8LA 1BBUA 1X6OA 3KDFB 3EN2A 1S3OA 2ODRC 2ALYA 1YNXA 4ME3A 4X66Q 4JI5Q 4GN5A 2CKZB 2Z6KC 3JAMi 4XTUA 3RLOA 4O0AA 1P16A 3WWVA 4EQ5A 2AHOB 4OWXB 3PIPA 2CJBA 1AE3A 4JYAQ 4GNXC 1HTTA 2KHIA 1U5KA 4R4CA 4DV1L 4XTZA 4OWTB 4KHZA 3UDIA 4H2YA 1V43A 3RKYA 4LF4L 1HR0Q 2D0PA 1NJ2A 1X54A 4JI4L 2QHTA 1OXUA 4JI6L 3PUVA 1NJ1A 4X64L 2UUAL 4LF6Q 1MKHA 2N3SA 1HC7A 5GQOA 4DR1Q 2ZR2A 2HNIA 4R1JA 4DAMA 3H3VI 2L15A 4GOPC 2AMCA 3HTZA 1JT8A 5C51B 3PV0A 2NN6I 4LFAL 3CCJA 4DV4L 4JCVE 1WYDA 2WB1G 3KF6A 1NE3A 4FDBA 2J3MA 4A4IA 2EXDA 3GTPH 1GO3E 1X3FA 3TRZA 4LF5Q 3ERRA 3S15H 1CUKA 4JI0Q 2FXQA 5IY0A 2VL6A 1KMNA 2JEAI 1NTGA 4UY8C 4YROA 2ZTCA 2VNUD 2MFIA 3S2DH 4CH4A 3K81C 1GGMA 3V7SA 2I5LX 2ZCEA 4DV0L 3V8KA 1YITA 4LVMA 3DSQA 4O2DA 3A7AA 1WFQA 1PYBA 2WAQE 4P71A 1QUQB 1SESA 4DV7L 4TVAB 3QO8A 4A3JH 4GKKL 4TQUS 2R7FA 1K8AC 3VQYA 2E10A 4A93G 4HWSA 5GADC 1OXVA 3AYHB 1PH3A 3W5OA 2ZIMA 4YCVA 1VQ8A 2DXTA 3KLWA 4DPGA 4TWAA 5IT9c 4XTCS 4CS2A 5JJKA 1N36L 4IOAA 1B76A 3KJPA 3HRIA 2OTJA 3RZDH 4LF4Q 1C9OA 2VY3A 4DV5L 3LC0A 2EAYA 1H4TA 1LTLA 4P3PA 4JI6Q 4A75A 3UE0A 2RF4A 3CXCA 1PV4A 3REXA 2ES2A 1Q8KA 5LMUL 1WNLA 4LF8L 1K3RA 4A93H 4ZIBA 2OCEA 1VQZA 4YYEA 4QJFA 2ZZFA 2ZT6A 1PH2A 4GN4B 4DV4Q 3RNUA 4YRJA 1PYSA 4A3MH 4A3DH 5C53B 1FYFA 2I4OA 1EWIA 4L5SA 3F1ZA 3T1HQ 2ZT5A 3UDFA 4DV6Q 1N8RC 4C3JH 4KI0A 1L2FA 1HR0W 4IPDA 4L5RC 4XU1A 3CMEA 3OYYA 1YI2A 4TQDA 1WLEA 2DVEA 3MEFA 3S1MH 3M85A 2AKWA 3BZKA 1JJCB 5FLMH 2B63H 4DV3L 1E7ZA 2ZINA 3TREA 5K1XA 2EIFA 4DR6L 2DZ9A 4XTWA 1WCMH 4NXMQ 3KFUA 2HIVA 1FGUA 3RL6A 1HNXL 4GLVB 4A3LG 2Y0SG 1XJVA 1SRUA 1KXLA 4DV0Q 5LMNQ 1I94L 1EVKA 3D31A 1VCIA 2VW9A 3HOYH 2K52A 4GKKQ 2ZT8A 3A5ZB 3F2DA 2YTYA 4OWWB 3MEYA 4JI3L 1NJ6A 1N32Q 2CIMA 4H2XA 3T1YQ 1EIYA 2JJQA 4R4OA 4KQEA 3R07A 1CKNB 4HJ5A 1MJCA 1N36Q 4IPGA 2P0LA 4HT4A 2R6GA 1O7IA 1VQBA 2NVYH 2RHQA 2OQKA 4DV5Q 4ZTUB 3L0OA 1ATIA 3BJUA 4MNOA 2ATWA 3PUXA 2ID0A 5IP7H 3ICAA 1CSPA 4HIOA 2ZZEA 2DKGA 4C2MH 2ZIOA 1KHIA 3S16H 3IALA 3J7ZC 3ERSX 1S72A 1M1KC 1L1OC 3JAMc 3PZCA 4PHCA 4KR3A 1G5HA 3CC4A 1I50H 4GNXB 1K83H 1QVCA 2R93H 2Q2HA 1VS0A 2YU9H 3HFVA 1VQAA 3GTLH 3A5YA 1NNHA 2OQ0A 2ZTEA 1HXDA 2EL9A 4YY3L 2QEXA 3PO2G 4P74C 4DR4Q 4P75A 1EQQA 4JC0A 3TEHB 2K4KA 2YV5A 4DR3Q 1VQ4A 3V8JA 1E24A 4MTNA 3RN2A 4DV3Q 4JI5L 1Y1VG 1HZAA 4BBRG 3PCOB 1VQOA 1I5FA 2Q2IA 4A3FG 1X56A 4JBJA 1HNXQ 4GOPB 1NMFA 2E64A 4TTVA 4OLFA 2I5MX 4LFCQ 1XMQQ 3KDFA 1XNRQ 1PFSA 5M3MH 3OD1A 3PO2H 1SN8A 1KIXA 3D0FA 1OXTA 1EUJA 3G48A 3UGTA 3S1NH 2IHFA 3BFMA 4JI3Q 1VQHA 3GTKH 1HR0L 3FKIG 2RHSB 1IBMQ 2JA9A 4QGUA 1SR3A 4BBRH 2XGTA 1E1OA 4LF6L 4X5OA 3A31A 4JBMA 2R7DA 2PI2A 2KCMA 3TS2A 4YRCA 3J7A5 2JA5H 4LNQA 3E9IA 2ZTGA 3P8VA 3GTOH 2YTXA 1QVFA 5C4JH 3RKWA 1N34Q 5LMNW 4HJ9A 3W3SA 2DQ3A 2VQEQ 1HZ9A 3G6EA 2YTVA 1W2BA 3FKIH 5IYDH 2KHJA 1YHQA 1PH5A 2GVAA 2BH8A 3CMQA 3I2ZA 1BIBA 2A8VA 3TEGA 3CD6A 4LWCA 3IRBA 4JI0L 3GTJH 5IYCG 2ZJRA 3V7CA 2E5LQ 2E41A 2UUCL 2QHUA 2ZXFA 4AIMA 4HJAA 2JE6I 4YRFA 3MXNB 1UE6A 4A3EH 1SFOH 1QVGA 5FLXc 2YYZA 2UU9L 1FVIA 3S1QH 1C7YA 2DGYA 1J5EQ 4P3NA 5M5XH 1TWFH 3K0XA 3PF4A 4A3KH 1HNWL 1EOVA 1X01A 3ZJYC 2ZJQA 4JI8Q 4EX5A 3CMAA 3HXWA 3AFPA 5IE8A 5K36G 3I4NH 1XPOA 1SMXA 1UE5A 4UP8A 1YEZA 5IYCH 2WB1E 2K75A 2ZJPA 3VQVA 2EWNA 1EYGA 4DKAC 1CSQA 3HXXA 3M4OH 2QHSA 5C0XJ 1QUQA 4TVAA 2DJZA 2IX1A 1FL0A 1AH9A 1VQLA 3UGQA 1YZ6A 3A5UA 2ZM6Q 1GKHA 2Q2TA 3HOUH 4BY7G 4GLAC 2NZHA 3K8AA 5AJ3Q 2DU5A 1QE0A 3CW2C 4IPHA 1ADYA 3STBD 4JI7L 3VBBA 2ARTA 2Q5HA 3RLFA 1K9MC 4B3RQ 1IZ6A 3GO5A 4C3HH 2KCTA 3J81c 3AEVA 2ZTDA 4XU2A 3V8LA 3P8YA 3T1HL 3GD7A 4DK3C 1KL9A 4DV6L 4KLKA 1KRSA 4NCXA 2NVXH 2FYKA 4BY7H 2E2HH 5GAHC 2VUMG 4A3JG 3F2CA 1FJGQ 11ASA 2EJFA 2HT1A 3S17H 4B3ML 2AWOA 3A32A 2UUCQ 1QZHA 2ASBA 3ICEA 4LVLA 2H5XA 3IKLA 4LUVA 1Z7NA 3STBC 5GAEC 4YRIA 3HOZG 4NXML 2KBNA 2UU9Q 4BW9A 3U58A 4PZ7A 5LMNL 1HNWQ 4GLXA 3ULLA 2ZGWA 3CPWA 4Q6GA 2DTHA 3ER0A 3UDGA 1YGBA 1JJCA 2LSSA 5IYBH 2VUMH 1B70B 1KOGA 1L1OB 4YDQA 3M7NA 3S14H 3LSSA 1X9NA 4DUYQ 2QGQA 1N32L 1XTDA 2C8MA 3T1YL 1EVLA 1BIAA 4WJ3M 3HOZH 1N9WA 3L7ZC 4A3MG 2ZT7A 1H4VB 4A3DG 5IWAQ 1PH4A 4NB3A 2MNAA 3CPFA 3H3VH 2ARSA 3A7RA 1HZCA 1G6PA 2XTIA 2DZCA 3KYHC 3A5ZA 2BA0A 1K0RA 3K80C 1A62A 1YFSA 2D0OA 5KNNA 1USYC 3Q8DA 4OX9Q 1X3GA 3PUYA 2IHEA 3U4ZA 1VQDA 1CKNA 1VQ9A 2Q7GA 1Q81C 2E3CA 4JI7Q 5FLMG 2B63G 1PH9A 2DTOA 5BR8Q 2Y0SE 5GROA 4H2UA 1J5WA 4B3TQ 1WCMG 3I4OA 4JBKA 2CFMA 1YHBA 3L2PA 3G71A 4DR7Q 3HXZA 4K86A 3PIOA 3RIRA 2D62A 2Z6KA 3W1BA 1UEBA 3I4MG 1LM0A 4LVJA 1RL2A 3PO3G 3HOYG 1PH1A 4TVYA 4CH3A 3EIVA 4DR4L 1R9TH 3W1GA 3QO7A 4YRTA 4DR3L 1YHAA 1XMOL 1Y14B 4B3MQ 4GNXA 1Y1WG 3G4SA 4P73C 4K0KQ 3CCMA 1JJ2A 2JA7G 1IBLQ 1NBWA 3FP9A 4P72C 4AYBG 1XNQQ 4C3IH 5HY6A 3CCUA 3M3YH 1G5IA 4LFCL 1XMQL 1RIPA 1XNRL 1YVCA 2MO1A 3TEHA 3I4MH 2R92H 4YRRA 5JJLA 3U50C 3PO3H 1B8AA 4YRMA 5IP7G 3RR5A 1VQIA 2ARUA 1JMCA 2I5HA 1KRTA 2ZNJA 3CC2A 4YRPA 4GOPA 2PMFA 1JJGA 1Y1WH 3S2HH 4YHHQ 3AFQA 3IG2A 4DR2Q 1IBML 2G4CA 1Q86C 2IY5B 2JA7H 3HFZA 1QZGA 1C0AA 4DR5Q 2V1CC 2WFWA 2CGHA 3LSQA 2QHVA 2R93G 4IJHA 4A3CH 5C4XH 4OO1G 2Q7HA 1NYRA 2K5HA 3RKXA 3TQYA 4YCWA 3J81j 3PF5A 1N34L 1PA6A 3CF5A 2RHSA 5FJ8G 4IPCA 3QO5A 1V9PA 4YRGA 2VQEL 4DQ2A 4H2VA 3CCLA 4RQFA 1X55A 1PVOA 3HXUA 3HY1A 3ULJA 4JOIC 1MJEA 1X2GA 4K88A 4TVWA 5H1SE 3HOWH 2I4LA 4OP0A 3PUWA 2E5LL 5M3MG 4H2TA 1CKMA 3EFRA 2K5VA 3A7UA 2AKWB 4Y7NH 5FJ8H 4HIKA 3PUZA 4LF9L 2CWAA 1E3PA 4YRQA 3VQXA 1Z47A 1XMOQ 3JC66 1VQMA 2N49A 1J5EL 4BBSG 3RLNA 4HJ8A 2UUBQ 4CH6A 1K73C 1H4QA 2NVTH 4JI8L 4JV5Q 4RDXA 5M5WH 3E9HA 2F3IA 1D8LA 1ASZA 2UXCQ 2JA5G 3NENA 3DM3A 3SGIA 4YWLA 5GAGC 1L0WA 5J3BA 3UH0A 4CS4A 3IKMB 5C0XI 4A76A 2DQ0A 4B3SQ 4EO4A 1VQEA 1N33L 4BXXH 4KHPL 3S1RH 4JI2Q 3H15A 4GS3A 3RN5A 5IYDG 4BBSH 4QQBX 3CCEA 1SROA 4BY1H 2ZM6L 3RZOH 2PI2E 3PSIA 3CCVA 2R7ZH 5AJ3L 4IFDG 1X65A 4HVCA 4A3BH 2UXDL 1KD1C 2P5IA 1WJJA 3OTOQ 4A3GG 2MQHA 5C0XG 1HNZQ 1JE5A 3HRKA 4QL5A 3G1ZA 4A3EG 4LUOA 1WPYA 4B3RL 3K7UC 3CP0A 4XEOA 3HKZG 3DLLA 4TQFA 2PQAB 4YRLA 1H4SA 3MF2A 2GN5A 3UE1A 4P73A 4A3KG 3L4GB 4YRKA 1IBKQ 4HWPA 4P72A 3A0JA 1X3EA 4RQEA 1G291 1DGSA 3UDXA 1IYJB 2K5NA 2N8NA 1FJGL 3I4NG 3U4VA 4GKJQ 4A3GH 4AQYQ 4X6AH 3HOXG 2ZR3A 4LF9Q 4XEMA 4YPFA 1M90C 4WJ4A 1I6HH 5M5YH 2Q5IA 3GTGH 2Z0SA 2JK8A 2F4VL 1TWAH 3AQQA 4L87A 1K8GA 4A3IH 2IX0A 1CKOA 4YP0A 3HOUG 1SRYA 5ELOA 2KENA 2HIXA 1OXXK 4DUYL 4WF2A 2CJAA 2DTIA 3FHWA 4JI1Q 4IFDJ 4Y52H 1IXRA 3HOXH 1MIUA 4UP9A 5IP9G 3GTQH 1N33Q 1WI5A 5IWAL 2UXBQ 4KHPQ 1TXYA 3PGZA 2CWPA 4R4QA 3HXYA 2EJGA 2OWOA 1B70A 4IJLA 4CS3A 4YWKA 1L1OA 3BU2A 1A8VA 4K87A 1WQ7A 4H2WA 1IL2A 1G51A 1VQNA 4OX9L 1GM5A 4BWAA 1A63A 4JOIA 2DXUA 5JEAJ 2UXDQ 3VDYA 2E2JH 3HXVA 1HJPA 1J6QA 1VQPA 3M4QA 4P74A 5BR8L 4NPSA 4LFBQ 5IP9H 2BH2A 4BA2I 4XTXA 1VQGA 4B3TL 2J3LA 4DV2Q 1Q12A 1H95A 4DR7L 3L2ZA 4J15A 1ASYA 1W3SA 2VQFQ 2WP8J 2I0QA 1W66A 3KF8B 2Q2UA 1SETA 1SERA 5IYBG 1B7YB 3P8TA 3ULPA 5E7NA 2A19A 4LF7Q 4HWRA 3M9BA 4UPAA 3NELA 3H0GG 4K0KL 4GN3B 3EFSA 2ALYB 1WQWA 2EQSA 1IBLL 4H02A 2RCNA 1YB3A 2B3GA 3CAMA 1XNQL 4X65Q 2F4VQ 2NN6G 1I3QH 1YIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 i;  3LGJ A;  5DLQ E;  1KQS A;  2JQO A;  1GD7 A;  3V7R A;  3GDE A;  4XU0 A;  5C3E G;  3VQW A;  3E0E A;  4OON A;  4DAY B;  12AS A;  1EQR A;  4Q15 A;  4IOC A;  2HHH L;  2ZZG A;  2JEB I;  4YHH L;  3H0G H;  4DR2 L;  3A74 A;  4PMW A;  3B6Y A;  4PG3 A;  1E22 A;  1LYL A;  3RAC A;  4P75 C;  4WI1 A;  2ZNI A;  4MZ9 A;  5JJI A;  4HWT A;  4DR5 L;  1WOC A;  3WQZ A;  1V1Q A;  1LUZ A;  3RUX A;  5C44 G;  4DV1 Q;  3K7A H;  1SE8 A;  3KJO A;  4CH5 A;  2AMC B;  1EIF A;  2IY5 A;  1VQF A;  5C3E H;  3TS0 A;  2JA8 G;  4JI4 Q;  4ALP A;  4E51 A;  4AYB E;  4X64 Q;  1E1T A;  3KF6 B;  2UUA Q;  2VZA A;  1YFR A;  4POG A;  2WAQ G;  1YJW A;  2E1H A;  2C35 B;  1A0I A;  4LFA Q;  2R92 G;  1S40 A;  5C44 H;  4YCU A;  2NZO A;  1BVS A;  2DU7 A;  1VQK A;  4RG1 A;  2JA8 H;  1Q46 A;  4OXP A;  1WU7 A;  2PME A;  4XIG S;  2N78 A;  3QNE A;  1Q1E A;  4QY7 A;  1YFT A;  3I7F A;  4G85 A;  2UUB L;  1TWG H;  4YRE A;  4JV5 L;  1VQC A;  1Z7M A;  2E8G A;  2PNH A;  2GVB A;  2UXC L;  4XU3 A;  1NMG A;  2K14 A;  3F2B A;  1YJN A;  4A3C G;  2K50 A;  5C4X G;  3NET A;  4HJ7 A;  4LUZ A;  4OO1 I;  1U0L A;  4G84 A;  5K1P A;  3J81 i;  3HOV G;  4B3S L;  1YBY A;  3PCO A;  3RGL A;  1Q1B A;  4LW1 A;  4JI2 L;  1VQ6 A;  2HHH Q;  4L5T A;  1NYQ A;  2JA6 G;  3HY0 A;  4DUZ L;  4DV7 Q;  1NJ8 A;  5M3F G;  2Q7E A;  1TWC H;  2OTL A;  1EFW A;  1HH2 P;  3F8T A;  1OTC A;  1VQ5 A;  3HOW G;  3FJP A;  3QTC A;  1T9H A;  3OTO L;  4H2S A;  1HNZ L;  4HID A;  3HOV H;  4A3L H;  4DK6 C;  1Q7Y C;  5F5W A;  4NXN L;  1PYS B;  1X2H A;  5ELN A;  3CCR A;  1NJI C;  2JA6 H;  4YRN A;  2A1A A;  1Q82 C;  4L5Q A;  1PHJ A;  3GTM H;  1IBK L;  2E2I H;  1SLJ A;  3CQZ H;  5LMU Q;  5M3F H;  4LF8 Q;  2DUD A;  4KR2 A;  1HZB A;  1OXS C;  4ZTZ B;  4HA8 A;  3RF1 A;  4BA1 I;  5E3I A;  3CCS A;  4IO9 A;  4GKJ L;  5HGQ A;  3L1A A;  2B29 A;  4YWM A;  4AQY L;  4POF A;  2PQA A;  1BBW A;  2E65 A;  1NJ5 A;  3L4G A;  1PH7 A;  4UP7 A;  1YJ9 A;  4BXX G;  4XTY A;  4X62 L;  3MF1 A;  2LXK A;  2LXJ A;  2F52 A;  1AE2 A;  4BY1 G;  2NVQ H;  4PZ8 A;  4JG2 A;  2R7Z G;  3S24 A;  2HQL A;  2VS1 A;  4X66 L;  4A3B G;  1PH6 A;  4IFD I;  3REU A;  4APV A;  1USY A;  4JI1 L;  4DR6 Q;  2MO0 A;  3HKZ E;  4P3O A;  3M4P A;  4H2X B;  1KAW A;  3CCQ A;  1EIY B;  2UXB L;  1ADJ A;  2C7I A;  3HFZ B;  3TUP A;  2BA1 A;  4QIW E;  1I94 Q;  2CQO A;  4JYA L;  4DUZ Q;  4XTV A;  2RHQ B;  4R4T A;  4JBW A;  1KC8 C;  2E5A A;  1GVP A;  1RIQ A;  1Z9F A;  3UFG A;  1UE1 A;  1Y1V H;  2AWN A;  4A3F H;  1D7Q A;  4DNI A;  1VQJ A;  1UWV A;  4P71 C;  3NEM A;  4LFB L;  4R4I A;  4DR1 L;  1PH8 A;  4NXN Q;  4DV2 L;  4RMF A;  2VQF L;  2ODR D;  3J80 c;  2QA4 A;  3KOJ A;  4AH6 A;  2CCZ A;  4A3I G;  5JEA G;  3EBE A;  3NBH B;  4HIM A;  1BKB A;  1NY4 A;  1QF6 A;  3CC7 A;  4YRS A;  1XPU A;  2CJ9 A;  2EJ9 A;  4LF7 L;  1XPR A;  3BZC A;  1JB7 A;  2DDZ A;  1KMM A;  2DEQ A;  4PZ6 A;  5EAY A;  2PMZ E;  4LF5 L;  1TWH H;  3OW2 A;  2IT1 A;  1UE7 A;  3I56 A;  3I55 A;  4X62 Q;  2I4M A;  1VQ7 A;  5C52 B;  4HWO A;  4X65 L;  2I4N A;  1B7Y A;  4LNS A;  4YY3 Q;  3HKS A;  1P8L A;  1BBU A;  1X6O A;  3KDF B;  3EN2 A;  1S3O A;  2ODR C;  2ALY A;  1YNX A;  4ME3 A;  4X66 Q;  4JI5 Q;  4GN5 A;  2CKZ B;  2Z6K C;  3JAM i;  4XTU A;  3RLO A;  4O0A A;  1P16 A;  3WWV A;  4EQ5 A;  2AHO B;  4OWX B;  3PIP A;  2CJB A;  1AE3 A;  4JYA Q;  4GNX C;  1HTT A;  2KHI A;  1U5K A;  4R4C A;  4DV1 L;  4XTZ A;  4OWT B;  4KHZ A;  3UDI A;  4H2Y A;  1V43 A;  3RKY A;  4LF4 L;  1HR0 Q;  2D0P A;  1NJ2 A;  1X54 A;  4JI4 L;  2QHT A;  1OXU A;  4JI6 L;  3PUV A;  1NJ1 A;  4X64 L;  2UUA L;  4LF6 Q;  1MKH A;  2N3S A;  1HC7 A;  5GQO A;  4DR1 Q;  2ZR2 A;  2HNI A;  4R1J A;  4DAM A;  3H3V I;  2L15 A;  4GOP C;  2AMC A;  3HTZ A;  1JT8 A;  5C51 B;  3PV0 A;  2NN6 I;  4LFA L;  3CCJ A;  4DV4 L;  4JCV E;  1WYD A;  2WB1 G;  3KF6 A;  1NE3 A;  4FDB A;  2J3M A;  4A4I A;  2EXD A;  3GTP H;  1GO3 E;  1X3F A;  3TRZ A;  4LF5 Q;  3ERR A;  3S15 H;  1CUK A;  4JI0 Q;  2FXQ A;  5IY0 A;  2VL6 A;  1KMN A;  2JEA I;  1NTG A;  4UY8 C;  4YRO A;  2ZTC A;  2VNU D;  2MFI A;  3S2D H;  4CH4 A;  3K81 C;  1GGM A;  3V7S A;  2I5L X;  2ZCE A;  4DV0 L;  3V8K A;  1YIT A;  3DSQ A;  4O2D A;  3A7A A;  1WFQ A;  1PYB A;  2WAQ E;  4P71 A;  1QUQ B;  1SES A;  4DV7 L;  4TVA B;  3QO8 A;  4A3J H;  4GKK L;  4TQU S;  2R7F A;  1K8A C;  3VQY A;  2E10 A;  4A93 G;  4HWS A;  5GAD C;  1OXV A;  3AYH B;  1PH3 A;  3W5O A;  2ZIM A;  4YCV A;  1VQ8 A;  2DXT A;  3KLW A;  4DPG A;  4TWA A;  5IT9 c;  4XTC S;  4CS2 A;  5JJK A;  1N36 L;  4IOA A;  1B76 A;  3KJP A;  3HRI A;  2OTJ A;  3RZD H;  4LF4 Q;  1C9O A;  2VY3 A;  4DV5 L;  3LC0 A;  2EAY A;  1H4T A;  1LTL A;  4P3P A;  4JI6 Q;  4A75 A;  3UE0 A;  2RF4 A;  3CXC A;  1PV4 A;  3REX A;  2ES2 A;  1Q8K A;  5LMU L;  1WNL A;  4LF8 L;  1K3R A;  4A93 H;  4ZIB A;  2OCE A;  1VQZ A;  4YYE A;  4QJF A;  2ZZF A;  2ZT6 A;  1PH2 A;  4GN4 B;  4DV4 Q;  3RNU A;  4YRJ A;  1PYS A;  4A3M H;  4A3D H;  5C53 B;  1FYF A;  2I4O A;  1EWI A;  4L5S A;  3F1Z A;  3T1H Q;  2ZT5 A;  3UDF A;  4DV6 Q;  1N8R C;  4C3J H;  4KI0 A;  1L2F A;  1HR0 W;  4IPD A;  4L5R C;  4XU1 A;  3CME A;  3OYY A;  1YI2 A;  4TQD A;  1WLE A;  2DVE A;  3MEF A;  3S1M H;  3M85 A;  2AKW A;  3BZK A;  1JJC B;  5FLM H;  2B63 H;  4DV3 L;  1E7Z A;  2ZIN A;  3TRE A;  5K1X A;  2EIF A;  4DR6 L;  2DZ9 A;  4XTW A;  1WCM H;  4NXM Q;  3KFU A;  2HIV A;  1FGU A;  3RL6 A;  1HNX L;  4GLV B;  4A3L G;  2Y0S G;  1XJV A;  1SRU A;  1KXL A;  4DV0 Q;  5LMN Q;  1I94 L;  1EVK A;  3D31 A;  1VCI A;  2VW9 A;  3HOY H;  2K52 A;  4GKK Q;  2ZT8 A;  3A5Z B;  3F2D A;  2YTY A;  4OWW B;  3MEY A;  4JI3 L;  1NJ6 A;  1N32 Q;  2CIM A;  4H2X A;  3T1Y Q;  1EIY A;  2JJQ A;  4R4O A;  4KQE A;  3R07 A;  1CKN B;  4HJ5 A;  1MJC A;  1N36 Q;  4IPG A;  2P0L A;  2R6G A;  1O7I A;  1VQB A;  2NVY H;  2RHQ A;  2OQK A;  4DV5 Q;  4ZTU B;  3L0O A;  1ATI A;  3BJU A;  4MNO A;  2ATW A;  3PUX A;  2ID0 A;  5IP7 H;  3ICA A;  1CSP A;  4HIO A;  2ZZE A;  2DKG A;  4C2M H;  2ZIO A;  1KHI A;  3S16 H;  3IAL A;  3J7Z C;  3ERS X;  1S72 A;  1M1K C;  1L1O C;  3JAM c;  3PZC A;  4PHC A;  4KR3 A;  1G5H A;  3CC4 A;  1I50 H;  4GNX B;  1K83 H;  1QVC A;  2R93 H;  2Q2H A;  1VS0 A;  2YU9 H;  3HFV A;  1VQA A;  3GTL H;  3A5Y A;  1NNH A;  2OQ0 A;  2ZTE A;  1HXD A;  2EL9 A;  4YY3 L;  2QEX A;  3PO2 G;  4P74 C;  4DR4 Q;  4P75 A;  1EQQ A;  4JC0 A;  3TEH B;  2K4K A;  2YV5 A;  4DR3 Q;  1VQ4 A;  3V8J A;  1E24 A;  4MTN A;  3RN2 A;  4DV3 Q;  4JI5 L;  1Y1V G;  1HZA A;  4BBR G;  3PCO B;  1VQO A;  1I5F A;  2Q2I A;  4A3F G;  1X56 A;  4JBJ A;  1HNX Q;  4GOP B;  1NMF A;  2E64 A;  4TTV A;  4OLF A;  2I5M X;  4LFC Q;  1XMQ Q;  3KDF A;  1XNR Q;  1PFS A;  5M3M H;  3OD1 A;  3PO2 H;  1SN8 A;  1KIX A;  3D0F A;  1OXT A;  1EUJ A;  3G48 A;  3UGT A;  3S1N H;  2IHF A;  3BFM A;  4JI3 Q;  1VQH A;  3GTK H;  1HR0 L;  3FKI G;  2RHS B;  1IBM Q;  2JA9 A;  4QGU A;  1SR3 A;  4BBR H;  2XGT A;  1E1O A;  4LF6 L;  4X5O A;  3A31 A;  4JBM A;  2R7D A;  2PI2 A;  2KCM A;  3TS2 A;  4YRC A;  3J7A 5;  2JA5 H;  4LNQ A;  3E9I A;  2ZTG A;  3P8V A;  3GTO H;  2YTX A;  1QVF A;  5C4J H;  3RKW A;  1N34 Q;  5LMN W;  4HJ9 A;  3W3S A;  2DQ3 A;  2VQE Q;  1HZ9 A;  3G6E A;  2YTV A;  1W2B A;  3FKI H;  5IYD H;  2KHJ A;  1YHQ A;  1PH5 A;  2GVA A;  2BH8 A;  3CMQ A;  3I2Z A;  1BIB A;  2A8V A;  3TEG A;  3CD6 A;  4LWC A;  3IRB A;  4JI0 L;  3GTJ H;  5IYC G;  2ZJR A;  3V7C A;  2E5L Q;  2E41 A;  2UUC L;  2QHU A;  2ZXF A;  4AIM A;  4HJA A;  2JE6 I;  4YRF A;  3MXN B;  1UE6 A;  4A3E H;  1SFO H;  1QVG A;  5FLX c;  2YYZ A;  2UU9 L;  1FVI A;  3S1Q H;  1C7Y A;  2DGY A;  1J5E Q;  4P3N A;  5M5X H;  1TWF H;  3K0X A;  3PF4 A;  4A3K H;  1HNW L;  1EOV A;  1X01 A;  3ZJY C;  2ZJQ A;  4JI8 Q;  4EX5 A;  3CMA A;  3HXW A;  3AFP A;  5IE8 A;  5K36 G;  3I4N H;  1XPO A;  1SMX A;  1UE5 A;  4UP8 A;  1YEZ A;  5IYC H;  2WB1 E;  2K75 A;  2ZJP A;  3VQV A;  2EWN A;  1EYG A;  4DKA C;  1CSQ A;  3HXX A;  3M4O H;  2QHS A;  5C0X J;  1QUQ A;  4TVA A;  2DJZ A;  2IX1 A;  1FL0 A;  1AH9 A;  1VQL A;  3UGQ A;  1YZ6 A;  3A5U A;  2ZM6 Q;  1GKH A;  2Q2T A;  3HOU H;  4BY7 G;  4GLA C;  2NZH A;  3K8A A;  5AJ3 Q;  2DU5 A;  1QE0 A;  3CW2 C;  4IPH A;  1ADY A;  3STB D;  4JI7 L;  3VBB A;  2ART A;  2Q5H A;  3RLF A;  1K9M C;  4B3R Q;  1IZ6 A;  3GO5 A;  4C3H H;  2KCT A;  3J81 c;  3AEV A;  2ZTD A;  4XU2 A;  3V8L A;  3P8Y A;  3T1H L;  3GD7 A;  4DK3 C;  1KL9 A;  4DV6 L;  4KLK A;  1KRS A;  4NCX A;  2NVX H;  2FYK A;  4BY7 H;  2E2H H;  5GAH C;  2VUM G;  4A3J G;  3F2C A;  1FJG Q;  11AS A;  2EJF A;  2HT1 A;  3S17 H;  4B3M L;  2AWO A;  3A32 A;  2UUC Q;  1QZH A;  2ASB A;  3ICE A;  2H5X A;  3IKL A;  4LUV A;  1Z7N A;  3STB C;  5GAE C;  4YRI A;  3HOZ G;  4NXM L;  2KBN A;  2UU9 Q;  4BW9 A;  3U58 A;  4PZ7 A;  5LMN L;  1HNW Q;  4GLX A;  3ULL A;  2ZGW A;  3CPW A;  4Q6G A;  2DTH A;  3ER0 A;  3UDG A;  1YGB A;  1JJC A;  2LSS A;  5IYB H;  2VUM H;  1B70 B;  1KOG A;  1L1O B;  4YDQ A;  3M7N A;  3S14 H;  3LSS A;  1X9N A;  4DUY Q;  2QGQ A;  1N32 L;  1XTD A;  2C8M A;  3T1Y L;  1EVL A;  1BIA A;  4WJ3 M;  3HOZ H;  1N9W A;  3L7Z C;  4A3M G;  2ZT7 A;  1H4V B;  4A3D G;  5IWA Q;  1PH4 A;  4NB3 A;  2MNA A;  3CPF A;  3H3V H;  2ARS A;  3A7R A;  1HZC A;  1G6P A;  2XTI A;  2DZC A;  3KYH C;  3A5Z A;  2BA0 A;  1K0R A;  3K80 C;  1A62 A;  1YFS A;  2D0O A;  5KNN A;  1USY C;  3Q8D A;  4OX9 Q;  1X3G A;  3PUY A;  2IHE A;  3U4Z A;  1VQD A;  1CKN A;  1VQ9 A;  2Q7G A;  1Q81 C;  2E3C A;  4JI7 Q;  5FLM G;  2B63 G;  1PH9 A;  2DTO A;  5BR8 Q;  2Y0S E;  5GRO A;  4H2U A;  1J5W A;  4B3T Q;  1WCM G;  3I4O A;  4JBK A;  2CFM A;  1YHB A;  3L2P A;  3G71 A;  4DR7 Q;  3HXZ A;  4K86 A;  3PIO A;  3RIR A;  2D62 A;  2Z6K A;  3W1B A;  1UEB A;  3I4M G;  1LM0 A;  1RL2 A;  3PO3 G;  3HOY G;  1PH1 A;  4TVY A;  4CH3 A;  3EIV A;  4DR4 L;  1R9T H;  3W1G A;  3QO7 A;  4YRT A;  4DR3 L;  1YHA A;  1XMO L;  1Y14 B;  4B3M Q;  4GNX A;  1Y1W G;  3G4S A;  4P73 C;  4K0K Q;  3CCM A;  1JJ2 A;  2JA7 G;  1IBL Q;  1NBW A;  3FP9 A;  4P72 C;  4AYB G;  1XNQ Q;  4C3I H;  5HY6 A;  3CCU A;  3M3Y H;  1G5I A;  4LFC L;  1XMQ L;  1RIP A;  1XNR L;  1YVC A;  2MO1 A;  3TEH A;  3I4M H;  2R92 H;  4YRR A;  5JJL A;  3U50 C;  3PO3 H;  1B8A A;  4YRM A;  5IP7 G;  3RR5 A;  1VQI A;  2ARU A;  1JMC A;  2I5H A;  1KRT A;  2ZNJ A;  3CC2 A;  4YRP A;  4GOP A;  2PMF A;  1JJG A;  1Y1W H;  3S2H H;  4YHH Q;  3AFQ A;  3IG2 A;  4DR2 Q;  1IBM L;  2G4C A;  1Q86 C;  2IY5 B;  2JA7 H;  3HFZ A;  1QZG A;  1C0A A;  4DR5 Q;  2V1C C;  2WFW A;  2CGH A;  3LSQ A;  2QHV A;  2R93 G;  4IJH A;  4A3C H;  5C4X H;  4OO1 G;  2Q7H A;  1NYR A;  2K5H A;  3RKX A;  3TQY A;  4YCW A;  3J81 j;  3PF5 A;  1N34 L;  1PA6 A;  3CF5 A;  2RHS A;  5FJ8 G;  4IPC A;  3QO5 A;  1V9P A;  4YRG A;  2VQE L;  4DQ2 A;  4H2V A;  3CCL A;  4RQF A;  1X55 A;  1PVO A;  3HXU A;  3HY1 A;  3ULJ A;  4JOI C;  1MJE A;  1X2G A;  4K88 A;  4TVW A;  5H1S E;  3HOW H;  2I4L A;  4OP0 A;  3PUW A;  2E5L L;  5M3M G;  4H2T A;  1CKM A;  3EFR A;  2K5V A;  3A7U A;  2AKW B;  4Y7N H;  5FJ8 H;  4HIK A;  3PUZ A;  4LF9 L;  2CWA A;  1E3P A;  4YRQ A;  3VQX A;  1Z47 A;  1XMO Q;  3JC6 6;  1VQM A;  2N49 A;  1J5E L;  4BBS G;  3RLN A;  4HJ8 A;  2UUB Q;  4CH6 A;  1K73 C;  1H4Q A;  2NVT H;  4JI8 L;  4JV5 Q;  4RDX A;  5M5W H;  3E9H A;  2F3I A;  1D8L A;  1ASZ A;  2UXC Q;  2JA5 G;  3NEN A;  3DM3 A;  3SGI A;  4YWL A;  5GAG C;  1L0W A;  5J3B A;  3UH0 A;  4CS4 A;  3IKM B;  5C0X I;  4A76 A;  2DQ0 A;  4B3S Q;  4EO4 A;  1VQE A;  1N33 L;  4BXX H;  4KHP L;  3S1R H;  4JI2 Q;  3H15 A;  4GS3 A;  3RN5 A;  5IYD G;  4BBS H;  4QQB X;  3CCE A;  1SRO A;  4BY1 H;  2ZM6 L;  3RZO H;  2PI2 E;  3PSI A;  3CCV A;  2R7Z H;  5AJ3 L;  4IFD G;  1X65 A;  4HVC A;  4A3B H;  2UXD L;  1KD1 C;  2P5I A;  1WJJ A;  3OTO Q;  4A3G G;  2MQH A;  5C0X G;  1HNZ Q;  1JE5 A;  3HRK A;  4QL5 A;  3G1Z A;  4A3E G;  4LUO A;  1WPY A;  4B3R L;  3K7U C;  3CP0 A;  4XEO A;  3HKZ G;  3DLL A;  4TQF A;  2PQA B;  4YRL A;  1H4S A;  3MF2 A;  2GN5 A;  3UE1 A;  4P73 A;  4A3K G;  3L4G B;  4YRK A;  1IBK Q;  4HWP A;  4P72 A;  3A0J A;  1X3E A;  4RQE A;  1G29 1;  1DGS A;  3UDX A;  1IYJ B;  2K5N A;  2N8N A;  1FJG L;  3I4N G;  3U4V A;  4GKJ Q;  4A3G H;  4AQY Q;  4X6A H;  3HOX G;  2ZR3 A;  4LF9 Q;  4XEM A;  4YPF A;  1M90 C;  4WJ4 A;  1I6H H;  5M5Y H;  2Q5I A;  3GTG H;  2Z0S A;  2JK8 A;  2F4V L;  1TWA H;  3AQQ A;  4L87 A;  1K8G A;  4A3I H;  2IX0 A;  1CKO A;  4YP0 A;  3HOU G;  1SRY A;  5ELO A;  2KEN A;  2HIX A;  1OXX K;  4DUY L;  4WF2 A;  2CJA A;  2DTI A;  3FHW A;  4JI1 Q;  4IFD J;  4Y52 H;  1IXR A;  3HOX H;  1MIU A;  4UP9 A;  5IP9 G;  3GTQ H;  1N33 Q;  1WI5 A;  5IWA L;  2UXB Q;  4KHP Q;  1TXY A;  3PGZ A;  2CWP A;  4R4Q A;  3HXY A;  2EJG A;  2OWO A;  1B70 A;  4IJL A;  4CS3 A;  4YWK A;  1L1O A;  3BU2 A;  1A8V A;  4K87 A;  1WQ7 A;  4H2W A;  1IL2 A;  1G51 A;  1VQN A;  4OX9 L;  1GM5 A;  4BWA A;  1A63 A;  4JOI A;  2DXU A;  5JEA J;  2UXD Q;  3VDY A;  2E2J H;  3HXV A;  1HJP A;  1J6Q A;  1VQP A;  3M4Q A;  4P74 A;  5BR8 L;  4NPS A;  4LFB Q;  5IP9 H;  2BH2 A;  4BA2 I;  4XTX A;  1VQG A;  4B3T L;  2J3L A;  4DV2 Q;  1Q12 A;  1H95 A;  4DR7 L;  3L2Z A;  4J15 A;  1ASY A;  1W3S A;  2VQF Q;  2WP8 J;  2I0Q A;  1W66 A;  3KF8 B;  2Q2U A;  1SET A;  1SER A;  5IYB G;  1B7Y B;  3P8T A;  3ULP A;  5E7N A;  2A19 A;  4LF7 Q;  4HWR A;  3M9B A;  4UPA A;  3NEL A;  3H0G G;  4K0K L;  4GN3 B;  3EFS A;  2ALY B;  1WQW A;  2EQS A;  1IBL L;  4H02 A;  2RCN A;  1YB3 A;  2B3G A;  3CAM A;  1XNQ L;  4X65 Q;  2F4V Q;  2NN6 G;  1I3Q H;  1YIJ A; 
#chains in the Genus database with same CATH topology
 3J80 i;  2AQ2 B;  3LGJ A;  5DLQ E;  1KQS A;  2JQO A;  2K04 A;  1BDO A;  1GD7 A;  4BWG B;  4CHT B;  2DN8 A;  1G6Z A;  1FNU A;  3S2D B;  3NUC A;  3V7R A;  2WB1 B;  3GDE A;  4XU0 A;  2Q8T A;  3UI2 A;  5C3E G;  2Z9H A;  2M9V A;  4NMZ A;  3VQW A;  3E0E A;  5KGU A;  3D3R A;  4OON A;  5DNF A;  4XT3 B;  4DAY B;  2FMC A;  3ERQ A;  4ZRZ A;  12AS A;  1EQR A;  4Q15 A;  2PW7 A;  4IOC A;  2HHH L;  2ZZG A;  1SAP A;  2JEB I;  2K5D A;  1F9Q A;  4YHH L;  3H0G H;  4O42 A;  4DR2 L;  3A74 A;  4PMW A;  3T4A C;  3B6Y A;  1BF4 A;  4UDU C;  4PG3 A;  5C5M A;  2FFK B;  1E22 A;  1LYL A;  3I73 A;  3RAC A;  4P75 C;  1SNM A;  4WI1 A;  4MZ9 A;  2ZNI A;  4QF4 A;  4RH6 A;  4L8J A;  1VF7 A;  2F0V A;  4A3J B;  2QKI C;  5JJI A;  2RVL A;  4HWT A;  4DR5 L;  2LY7 A;  3LNN A;  1WOC A;  3WQZ A;  2NN6 H;  4FXK C;  4C1N K;  1V1Q A;  5D3I B;  4C1N I;  5BN4 A;  3VYT A;  1BCP C;  1LUZ A;  3CRK C;  1TS5 A;  5CV7 A;  3RUX A;  5C44 G;  4DV1 Q;  3K7A H;  3U9O A;  1EIH A;  4H44 C;  2A8E A;  3IFT A;  1SE8 A;  3KJO A;  1I4X A;  4FF4 A;  4CH5 A;  2AMC B;  1EIF A;  2IY5 A;  1VQF A;  5C3E H;  1AZP A;  3VYR A;  3N52 A;  3TS0 A;  3RZD B;  1TS4 A;  1EU4 A;  2X6G A;  2JA8 G;  4JI4 Q;  1WTX A;  4ALP A;  4ZUI A;  1NUC A;  4E51 A;  1HUN A;  3TME A;  4AYB E;  4X64 Q;  1E1T A;  3KF6 B;  2UUA Q;  2VZA A;  1YFR A;  4RGT A;  1IYU A;  4POG A;  3LX0 A;  3QOL A;  1PZI D;  1ILP A;  2WAQ G;  4ZKC B;  1YJW A;  1TY2 A;  2E1H A;  4CKE A;  2C35 B;  4A93 B;  1Q8I A;  3NTI A;  1GUO A;  1STY A;  3MEH A;  1A0I A;  4U67 3;  3J7A F;  4LFA Q;  2R92 G;  1S40 A;  3AB9 A;  2XRS D;  4JW0 A;  5C44 H;  3MFY A;  4YCU A;  2NZO A;  1BVS A;  4A3M B;  2DU7 A;  1EFI D;  1TVX A;  5ELE A;  4A3D B;  5KYL A;  1VQK A;  4RG1 A;  4K5V A;  4RAU C;  2JA8 H;  1Q46 A;  1AP0 A;  4RGO S;  4OXP A;  1WU7 A;  2PME A;  4XIG S;  4LVK A;  2N78 A;  3QNE A;  1Q1E A;  4QY7 A;  4C3J B;  1YFT A;  4LVI A;  3I7F A;  4G85 A;  2UUB L;  1DJR D;  1TWG H;  1LTA D;  1VDZ A;  3MA2 B;  4YRE A;  1TS3 A;  4JV5 L;  1VQC A;  2QW7 A;  2F4I A;  1U9R A;  5KIX A;  2IX3 A;  1I4Q A;  1Z7M A;  4M8A A;  2E8G A;  2PNH A;  2WKD A;  5ELD A;  2GVB A;  5A2Q L;  2UXC L;  4XU3 A;  1NMG A;  2K14 A;  3F2B A;  1YJN A;  4A3C G;  3FPP A;  3S1M B;  1G8Z D;  2F0H A;  2K50 A;  5C4X G;  3DEP A;  2B63 B;  3BDC A;  4IUT A;  1EEF D;  4I7Z C;  4HJ7 A;  3NET A;  2NTS A;  3KBG A;  4LUZ A;  4OO1 I;  1U0L A;  4G84 A;  5K1P A;  5EPJ A;  3J81 i;  1ENA A;  1BBX C;  3HOV G;  4ZYS A;  1WCM B;  1PZK D;  4B3S L;  1YBY A;  3DM1 A;  3PCO A;  3RGL A;  2RCF A;  3BVM A;  1Q1B A;  1EY5 A;  4LW1 A;  4JI2 L;  3G6J B;  1VQ6 A;  2HHH Q;  1VMC A;  3IL8 A;  4L5T A;  1NYQ A;  2JA6 G;  3HY0 A;  1MI2 A;  4DUZ L;  1STG A;  2J7Z A;  5FLX L;  5IGG A;  4DV7 Q;  1NJ8 A;  1AZQ A;  3OMG A;  5KRU A;  5M3F G;  4PNY A;  2Q7E A;  1TWC H;  1D5X C;  1EFW A;  1HH2 P;  2OTL A;  3F8T A;  4DXF A;  4N9T A;  2MHV A;  3SK8 A;  4KMU C;  1EYC A;  1OTC A;  1Q90 A;  1VQ5 A;  3HOW G;  1ZEQ X;  3FJP A;  5IGF A;  2L12 A;  3QTC A;  1FGB D;  1T9H A;  2EVB A;  3OTO L;  1EEI D;  5HGT A;  4CJ2 C;  4H2S A;  1HNZ L;  3DMU A;  3QB3 A;  3QR8 A;  1EZ8 A;  1VF5 C;  2B2Y A;  1LAC A;  4HN7 A;  4HID A;  3HOV H;  4A3L H;  3HGB A;  4CDE C;  3SVM A;  4YIJ A;  4DK6 C;  2NVY B;  1Q7Y C;  1MHW C;  4O1N A;  5F5W A;  4NXN L;  1PYS B;  1TS2 A;  2TMP A;  1V1P B;  1X2H A;  1IHZ A;  1CQF A;  3SXH A;  4KJO A;  5ELN A;  3CCR A;  1NJI C;  2JA6 H;  4YRN A;  1EQT A;  2A1A A;  1Q82 C;  5K5P A;  4L5Q A;  2F1M A;  4DU9 A;  4K8I A;  1PHJ A;  3GTM H;  1IBK L;  2E2I H;  1SLJ A;  3CQZ H;  3NTH A;  5LMU Q;  1QIL A;  5M3F H;  4LF8 Q;  5COR A;  2DUD A;  4KR2 A;  1CZG A;  1HZB A;  1OXS C;  4RHR A;  4C2M B;  4HA8 A;  2NWG A;  3RF1 A;  4ZTZ B;  4BA1 I;  5E3I A;  3CCS A;  4IO9 A;  5FO9 B;  5HGQ A;  4GKJ L;  1ESF A;  3L1A A;  2B29 A;  3TZD A;  4HED A;  3S16 B;  4YWM A;  1LTI D;  4AQY L;  4POF A;  2PQA A;  1BBW A;  2BDO A;  1I4P A;  1JWM D;  2E65 A;  1XXG A;  1NJ5 A;  3L4G A;  1PH7 A;  4UP7 A;  1YJ9 A;  4F87 A;  1WTO A;  4BXX G;  1I50 B;  4XTY A;  2WII B;  5EKK A;  4X62 L;  3TSS A;  1PXU A;  1K83 B;  4HSV A;  3MF1 A;  1K8M A;  3A8K E;  2LXK A;  2LXJ A;  3MAQ A;  3P7J A;  1KDA A;  3PMF A;  2F0S A;  2F52 A;  1AE2 A;  4ZQ3 A;  4BY1 G;  1SNC A;  2NVQ H;  3CKI B;  2CH4 A;  4PZ8 A;  2EZV A;  2NS6 A;  4JG2 A;  2R7Z G;  2E2D C;  2QCP X;  3S24 A;  2HQL A;  2VS1 A;  4X66 L;  4A3B G;  1PH6 A;  4IFD I;  3REU A;  1EWH A;  3QJY A;  2Z8L A;  4H7B A;  4APV A;  1USY A;  1SYG A;  4JI1 L;  3I91 A;  3SK4 A;  4DR6 Q;  2MO0 A;  3HKZ E;  4DGZ A;  3PIO 3;  1LTT D;  4P3O A;  3M4P A;  2KHS A;  4H2X B;  2B2W A;  4J1M A;  1KAW A;  2OXP A;  2B39 A;  5EBD A;  4RA8 A;  3CCQ A;  1EIY B;  2UXB L;  1ADJ A;  2C7I A;  2EJF C;  3HFZ B;  3TUP A;  2BA1 A;  4ODG A;  4QIW E;  1CI3 M;  3Q0A A;  4HMI A;  1I94 Q;  2CQO A;  5IOC A;  4JYA L;  1J9O A;  3ND8 A;  3BYY B;  4DUZ Q;  4KTA A;  4XTV A;  2RHQ B;  5M3M B;  4R4T A;  3PO2 B;  4JBW A;  4LMQ D;  3RD4 A;  1KC8 C;  2E5A A;  1GVP A;  1RIQ A;  3S1N B;  1Z9F A;  5CV6 A;  3UFG A;  4R9W A;  4DNR B;  1GUN A;  3V05 A;  2KA7 A;  1UE1 A;  1SYE A;  2ZXR A;  1Y1V H;  1IYV A;  3URY A;  4F7X A;  3NWT A;  2AWN A;  4A3F H;  1PLF A;  1LTG D;  1D7Q A;  3SE0 A;  4BBR B;  4DNI A;  1VQJ A;  1B1Z A;  3D6W A;  1UWV A;  4P71 C;  4M1U B;  3NEM A;  4LFB L;  3E6Z X;  4R4I A;  3R8B A;  4DR1 L;  1PH8 A;  4NXN Q;  4DV2 L;  1SDF A;  4RMF A;  1Y8N B;  3VYS A;  2VQF L;  1ZKO A;  3GTO B;  2ODR D;  3OIP A;  3J80 c;  5C4J B;  2QA4 A;  3KOJ A;  1EY7 A;  4AH6 A;  1JB3 A;  2CCZ A;  4X3S A;  4A3I G;  5JEA G;  3EBE A;  3NBH B;  4HIM A;  1BKB A;  1NY4 A;  1G2S A;  1QF6 A;  1HUM A;  3CC7 A;  4YRS A;  1QG7 A;  1XPU A;  5NUC A;  1GUW A;  2CJ9 A;  3NTK A;  2EJ9 A;  1L0X B;  4LF7 L;  1XTC D;  1PFN A;  1XPR A;  5EKI A;  3BZC A;  1JB7 A;  4WFN 3;  1KMM A;  2DDZ A;  2DEQ A;  4PQX A;  3FKI B;  4PZ6 A;  5ELB A;  4B9W A;  5EAY A;  4L6T B;  1LTB D;  2PMZ E;  2PO4 A;  3R2I A;  4LF5 L;  1TWH H;  5BN5 A;  2L5T A;  3GP7 A;  3OW2 A;  1BCP B;  2IT1 A;  1UE7 A;  5IT9 E;  3I56 A;  3MQZ A;  3I55 A;  4X62 Q;  3KF8 A;  3FPU B;  2A5H A;  1VQ7 A;  2I4M A;  3K5L A;  3GTJ B;  2A73 B;  5C52 B;  4KV6 A;  2XVS A;  4HWO A;  1H9S A;  4X65 L;  2I4N A;  1B7Y A;  4LNS A;  2RDH A;  4YY3 Q;  3HKS A;  5DM6 3;  2K32 A;  1PMR A;  1TII D;  3C1E A;  1P8L A;  1RHP A;  1BBU A;  1X6O A;  1TR5 A;  2KQ3 A;  3KDF B;  3EN2 A;  1S3O A;  5ISR A;  2ODR C;  4ILW A;  1WTP A;  1SFO B;  2ALY A;  2F0I A;  4BS9 A;  1JQY D;  1YNX A;  2PZU A;  3HKZ B;  4ME3 A;  4X66 Q;  4JI5 Q;  1D6E C;  2IPK D;  3S1Q B;  4GN5 A;  2CKZ B;  3H94 A;  2Z6K C;  4TKO B;  3WOE A;  3JAM i;  4XTU A;  1E2W A;  3RLO A;  4O0A A;  4Q5V A;  5M5X B;  1TWF B;  3TP6 A;  3SEB A;  1P16 A;  4A3K B;  1JWU D;  3WWV A;  1KAA A;  3MFG A;  4EQ5 A;  1F9P A;  4IUV A;  2AHO B;  2ZT9 C;  4OWX B;  1XYI A;  1TU2 B;  2HUG A;  2XWB B;  4IUP A;  2K5Q A;  3HRZ C;  3PIP A;  2CJB A;  1AE3 A;  4ZCK A;  2E74 C;  5I9O A;  4JYA Q;  3I3C A;  5KEE A;  2KCN A;  4GNX C;  1HRJ A;  1MSH A;  1CK1 A;  1SEB D;  5DEH A;  5EJW A;  1HTT A;  2KHI A;  4DAY A;  1U5K A;  1SYC A;  4R4C A;  4C56 C;  5E4X A;  4DV1 L;  4XTZ A;  4OWT B;  3KK7 A;  4KHZ A;  1STN A;  3UDI A;  1SYB A;  2VB3 X;  4J6H A;  1K3B C;  1V43 A;  4H2Y A;  3NHH A;  5ELF A;  3RKY A;  4LF4 L;  3M4O B;  1HA6 A;  1HR0 Q;  2D0P A;  1NJ2 A;  2XWJ B;  1X54 A;  4JI4 L;  2QHT A;  1OXU A;  1EYA A;  4JI6 L;  3PUV A;  5HUR A;  2D2C C;  1FD7 D;  1NJ1 A;  2DNC A;  4X64 L;  2UUA L;  4LF6 Q;  1MKH A;  2EOT A;  2N3S A;  1HC7 A;  5GQO A;  4DR1 Q;  1D5M C;  5K36 H;  4QUC A;  2ZR2 A;  3M4Y A;  1EOT A;  1I6V C;  2HNI A;  1F2Y A;  3OW7 A;  4R1J A;  4DAM A;  2L15 A;  3H3V I;  3OIQ A;  4OIJ A;  1DYQ A;  1HQM C;  4GOP C;  2AMC A;  3HTZ A;  1JT8 A;  5C51 B;  3PV0 A;  1JC7 A;  1ESR A;  1M8A A;  2NN6 I;  4LFA L;  3CCJ A;  4DV4 L;  1R4P B;  4JCV E;  2N88 A;  1WYD A;  2B2U C;  2WB1 G;  3TZU A;  2BCO A;  3QIA A;  5EBC A;  3TP7 A;  1H9M A;  2L9H A;  3KF6 A;  1NE3 A;  4C3H B;  4FDB A;  4FF3 A;  2J3M A;  4A4I A;  1ZXT A;  1DOK A;  2EXD A;  3GTP H;  1GO3 E;  2EYH A;  1OO9 B;  1X3F A;  3EJI A;  4LK1 C;  2ICE C;  3TRZ A;  3TP8 A;  4LF5 Q;  3ERR A;  3GV3 A;  3S15 H;  1CUK A;  4JI0 Q;  3I70 A;  2HD3 A;  1I4G A;  2NVX B;  1JE4 A;  2FXQ A;  4BY7 B;  5IY0 A;  2VL6 A;  1KMN A;  2DY8 A;  2JEA I;  1B50 A;  1NTG A;  4UY8 C;  1LT6 D;  3S17 B;  2A68 D;  4YRO A;  2ZTC A;  2VNU D;  3ONA B;  4QB4 A;  2MFI A;  3S2D H;  3CRL C;  5JAV A;  4CH4 A;  4XXE A;  3K81 C;  4NP5 A;  4K5W A;  5E3F A;  1AEX A;  1GGM A;  1SND A;  3V7S A;  2I5L X;  5FKA C;  4RGM A;  4HCE A;  2RDF A;  5DM7 3;  2ZCE A;  1BQQ T;  4DV0 L;  1S5D D;  4N8X 1;  1DD2 A;  2EYO A;  5CC4 A;  5I2Y A;  3V8K A;  1YIT A;  4LVM A;  2KJX A;  3DSQ A;  4O2D A;  3A7A A;  2BOS A;  1WFQ A;  5IIF A;  4RFB A;  1PYB A;  1E2V A;  2WAQ E;  1F2M A;  2JYO A;  4P71 A;  1QUQ B;  1SES A;  1R4Q B;  3C1F A;  4DV7 L;  4V0B A;  4TVA B;  3QO8 A;  3OPO A;  4A3J H;  4GKK L;  4B9X A;  4TQU S;  2R7F A;  1K8A C;  3VQY A;  2E10 A;  2VUM B;  4A93 G;  4HWS A;  5GAD C;  4F88 A;  1OXV A;  3AYH B;  1PH3 A;  3S14 B;  3W5O A;  2F03 A;  3C2P A;  2ZIM A;  3MHB A;  4YCV A;  1VQ8 A;  2DXT A;  3KLW A;  3I8Z A;  4CKB A;  4DPG A;  4TWA A;  5IT9 c;  5J22 A;  4XTC S;  4CS2 A;  5JJK A;  4DA2 A;  1N36 L;  4IOA A;  2B2T A;  3KJP A;  1B76 A;  2A68 C;  3HRI A;  1QOH A;  2OTJ A;  4MN3 A;  4OIK A;  3VA5 A;  3HOZ B;  3RZD H;  4LF4 Q;  1C9O A;  2ICI A;  2VY3 A;  5CYU A;  3T16 A;  4DV5 L;  3LC0 A;  5M9O A;  2K5W A;  2EAY A;  1II3 A;  4C3J G;  1H4T A;  1LTL A;  1LTS D;  4JI6 Q;  5I9P A;  4P3P A;  4TRD A;  2V4D A;  5I4D A;  4A75 A;  3UE0 A;  2RF4 A;  3SDZ A;  3CXC A;  2L0C A;  1O7L A;  4HCS A;  1PV4 A;  3REX A;  3EQL C;  1NR2 A;  2NB0 A;  2ES2 A;  1F2L A;  1Q8K A;  1DOL A;  2E76 C;  5LMU L;  1LV9 A;  1WNL A;  4LF8 L;  4JPB W;  4N9P A;  1K3R A;  4UHV A;  4A93 H;  4ZIB A;  4KKU A;  2OCE A;  1IKL A;  1CFM A;  1VQZ A;  4QJF A;  1DZ1 A;  4YYE A;  2ZZF A;  2ZT6 A;  1G2T A;  4IQZ A;  3V96 A;  3BG3 A;  4CJ1 B;  1O7Z A;  1PH2 A;  1ET6 A;  4GN4 B;  4I65 A;  4DV4 Q;  3RNU A;  3DUZ A;  1AFP A;  5D3D A;  4YRJ A;  1PYS A;  4ABN A;  4A3M H;  1V1P A;  4A3D H;  1WTH A;  2K28 A;  5C53 B;  1FYF A;  2I4O A;  1GHJ A;  4WOR A;  5TSS A;  1EWI A;  4L5S A;  3F1Z A;  3T1H Q;  4PV1 C;  3HP3 A;  2ZT5 A;  3UDF A;  1RTO A;  2L4N A;  4DV6 Q;  1N8R C;  4C3J H;  5T1I A;  4KI0 A;  1UAP A;  1L2F A;  1HR0 W;  4IPD A;  4KKS A;  1RF2 D;  2NUC A;  4L5R C;  1JIC A;  4XU1 A;  5ELC A;  1D1K A;  3CME A;  1ICW A;  1QE6 A;  3OYY A;  1GUS A;  3FRP B;  1YI2 A;  3BVG A;  1MD2 D;  1QNU A;  4CDF C;  4TQD A;  3D8G A;  1WLE A;  1EY6 A;  2DVE A;  3MEF A;  3S1M H;  3M85 A;  2AKW A;  3BZK A;  1R9T B;  1RKN A;  1JJC B;  5FLM H;  2B63 H;  4DV3 L;  1E7Z A;  4MTK A;  2ZIN A;  1FR3 A;  3TRE A;  5K1X A;  2RKS A;  3H91 A;  2EIF A;  2MUY A;  4DR6 L;  4EQO A;  2DZ9 A;  3TDQ A;  1M4V A;  4XTW A;  1WCM H;  4NXM Q;  3KFU A;  1I4H A;  2HIV A;  1FGU A;  3RL6 A;  1HNX L;  2F0W A;  3VR5 A;  4GLV B;  2F0E A;  4A3L G;  2Y0S G;  1XJV A;  2K01 A;  3M7G A;  3ERO A;  3J80 E;  1SRU A;  1KXL A;  4DV0 Q;  4C3I B;  1KDB A;  5LMN Q;  4HMJ A;  3M3Y B;  2M2L A;  1I94 L;  1EVK A;  3D31 A;  1VCI A;  4K2K A;  3VR6 A;  4KK7 A;  5COY A;  2VW9 A;  3HOY H;  3I4M B;  2R92 B;  3BDO A;  2K52 A;  1PYW D;  3DWQ A;  3PO3 B;  3HOY B;  4GKK Q;  2ZT8 A;  4IAL A;  3A5Z B;  3F2D A;  2YTY A;  1HXY D;  4OWW B;  3MEY A;  4JI3 L;  1NJ6 A;  1N32 Q;  5BN3 A;  2CIM A;  4H2X A;  5JPM C;  3T1Y Q;  2AQ1 B;  1EIY A;  2MJ8 A;  2JJQ A;  1Y1W B;  4R4O A;  5KNC A;  3S2H B;  4KQE A;  3R07 A;  1CKN B;  2ZXP A;  1MJC A;  4HJ5 A;  4IPG A;  1N36 Q;  2P0L A;  4HT4 A;  2R6G A;  1O7I A;  1GUG A;  2SNM A;  4NW2 A;  2JA7 B;  1VQB A;  2B2V A;  1A3U A;  2NVY H;  2PQE A;  1X32 A;  3Q22 A;  2RHQ A;  4AYB B;  1STA A;  2OQK A;  4KD3 A;  4DV5 Q;  4ZTU B;  3L0O A;  3MXU A;  1ATI A;  2K03 A;  5CV5 A;  4XDX A;  4DK1 A;  5FLX E;  3FMC A;  1S5B D;  3BJU A;  3GQB A;  4IUR A;  4MNO A;  1A3V A;  5C4X B;  1UNS A;  2ATW A;  3PUX A;  2ID0 A;  2D9U A;  5IP7 H;  1DM0 B;  4P2C B;  3K6O A;  3ICA A;  1CSP A;  2O2L D;  1JOR A;  4HIO A;  1KAB A;  1W6K A;  2ZZE A;  2DKG A;  4C2M H;  2NYZ D;  4X3U A;  1SBB B;  1BO0 A;  1WD1 A;  2ZIO A;  3SK5 A;  1CM9 A;  2O4X A;  1CQV A;  5JJZ A;  1QJO A;  1KHI A;  3S16 H;  3BZD B;  3J7Z C;  3IAL A;  3ERS X;  1S72 A;  1M1K C;  2Z4H A;  1L1O C;  3JAM c;  3PZC A;  3RUZ A;  4PHC A;  4V19 0;  4KR3 A;  4RCO A;  4KY5 A;  1KLG D;  1G5H A;  2WAC A;  3CC4 A;  1I50 H;  1TQO A;  1I4R A;  3BS1 A;  4GNX B;  1F9S A;  3TN2 A;  1K83 H;  1QVC A;  3MWY W;  3K5M A;  2R93 H;  2Q2H A;  4IZ8 A;  1VS0 A;  2C5C A;  2OEO A;  3NBH A;  2YU9 H;  3HFV A;  1VQA A;  5FO8 B;  4XYQ A;  3GTL H;  2R93 B;  1NNH A;  3A5Y A;  1SNQ A;  2OQ0 A;  2ZTE A;  1HXD A;  2YU9 B;  2Z1C A;  2EL9 A;  3GTL B;  1JCK B;  4YY3 L;  2QEX A;  1Y69 U;  3PO2 G;  3H3V C;  1PRT D;  4EVO A;  4P74 C;  1ZYR D;  1CA5 A;  4DR4 Q;  1JR0 D;  1SJE D;  4P75 A;  1EQQ A;  2PW5 A;  4Y7N B;  4JC0 A;  4XYO A;  3TEH B;  2K4K A;  2YV5 A;  4DR3 Q;  2A6E D;  1VQ4 A;  3V8J A;  1E24 A;  4MTN A;  2BDN A;  1ET9 A;  4FF2 A;  3RN2 A;  4OGQ C;  1O7Y A;  4DV3 Q;  2HCC A;  4JI5 L;  2MPM A;  1Y1V G;  2B8G A;  1HZA A;  4BBR G;  3PCO B;  1STH A;  1VQO A;  1I5F A;  4EGV A;  2Q2I A;  4A3F G;  1X56 A;  1U4R A;  4KJN A;  4JBJ A;  1Z7T A;  1HNX Q;  3CHB D;  4GOP B;  5E4W C;  2NVT B;  1NMF A;  2E64 A;  1KNA A;  1QWY A;  4TTV A;  1S5F D;  4OLF A;  2I5M X;  5M5W B;  4LFC Q;  1XMQ Q;  3KDF A;  1XNR Q;  5KND A;  1PFS A;  1DOM A;  4CGY B;  2I07 B;  2CQA A;  1E0B A;  5M3M H;  3J81 E;  4FYD A;  1J8I A;  3OD1 A;  1RTN A;  2QIL A;  3PO2 H;  4RWS C;  1SN8 A;  1KIX A;  3D0F A;  2WV6 D;  3QO2 A;  1OXT A;  4J8Q A;  1EUJ A;  2EPB A;  3G48 A;  1B9N A;  3UGT A;  4DNT B;  3A55 A;  3S1N H;  4MIU A;  1NR4 A;  2IHF A;  3R2T A;  3BFM A;  4JI3 Q;  1KTK A;  1PRT C;  1VQH A;  4HTH A;  1ZYR C;  3GTK H;  1HR0 L;  3S1R B;  3FKI G;  2RHS B;  3GTK B;  1IBM Q;  2JA9 A;  3TBI B;  4QGU A;  2A6E C;  1SR3 A;  4BBR H;  2XGT A;  4LAA A;  4BBS B;  1E1O A;  4LF6 L;  4X5O A;  3A31 A;  4JBM A;  2R7D A;  2PI2 A;  2KCM A;  3I90 A;  4WRD A;  4BY1 B;  4RGN A;  3TS2 A;  3RZO B;  3TP5 A;  4YRC A;  3J7A 5;  1B3Q A;  2EY1 A;  5I2X A;  2JA5 H;  3NBI A;  4LNQ A;  1WTV A;  3E9I A;  2L11 A;  2R7Z B;  2ZTG A;  2JA5 B;  3P8V A;  3GTO H;  1RJT A;  2JXM B;  2YTX A;  1QVF A;  5C4J H;  2BE5 D;  1YNJ D;  3RKW A;  3DHQ A;  1N34 Q;  4DF7 A;  5LMN W;  4HJ9 A;  2IJ0 A;  2OT2 A;  1BOS A;  2F0U A;  3W3S A;  1B4O A;  1U4P A;  2DQ3 A;  2VQE Q;  2F0L A;  4FO2 A;  3VR3 A;  1HZ9 A;  3G6E A;  4UAI A;  2YTV A;  1W2B A;  3FKI H;  1EWC A;  2F0G A;  2R3Z A;  5FOB B;  5IYD H;  1D2B A;  2KHJ A;  1YHQ A;  1PTO D;  1PH5 A;  2GVA A;  2BH8 A;  3CMQ A;  3PQI A;  3I2Z A;  1BIB A;  2A8V A;  3TEG A;  2X6L A;  4Q0F A;  2A6H D;  1CA6 A;  3CD6 A;  4LWC A;  5J39 A;  3C3L A;  3OMC A;  3IRB A;  4JI0 L;  4NKL A;  3SK6 A;  3GTJ H;  3A8I E;  3ZYY X;  5IYC G;  2ZJR A;  3V7C A;  2Q8R E;  2E5L Q;  2E41 A;  2UUC L;  2QHU A;  2ZXF A;  5C0X H;  4AIM A;  4HJA A;  2JE6 I;  2K1B A;  4G7Z C;  4A3G B;  4RKL A;  1DON A;  4YRF A;  1AN8 A;  3MXN B;  3RMH A;  5IGD A;  4X3K A;  1UE6 A;  2F0N A;  4A3E H;  1SFO H;  1QVG A;  5FLX c;  3D4R A;  2YYZ A;  1SMY D;  2BE5 C;  1YNJ C;  1H9K A;  2UU9 L;  4RKB A;  5KYI A;  4A3E B;  4KN4 C;  4WJW A;  1FVI A;  3S1Q H;  1I6H B;  5M5Y B;  1EY0 A;  1C7Y A;  4PMC A;  2DGY A;  5E1F A;  1J5E Q;  4P3N A;  5M5X H;  1TWF H;  3K0X A;  3GTG B;  3PF4 A;  2HDL A;  4A3K H;  1HNW L;  1EOV A;  1X01 A;  3ZJY C;  1ENF A;  2ZJQ A;  4JI8 Q;  4EX5 A;  2GA4 B;  3CMA A;  3HXW A;  1MGS A;  1KDC A;  4A3I B;  3AFP A;  4QIW B;  1D5Z C;  1PTO C;  3SR1 A;  5IE8 A;  3AMU A;  3H6M A;  5K36 G;  5G3L F;  3VA7 A;  3NPP A;  5CV9 A;  2DJF C;  3E3X A;  3I4N H;  2EXZ A;  1XPO A;  1S5E D;  1SMX A;  1UE5 A;  2A6H C;  1LO5 D;  4UP8 A;  1YEZ A;  1U4M A;  5IYC H;  3BYT B;  3I4N B;  2WB1 E;  5EPK A;  3L3O C;  3KUP A;  2K75 A;  1H9R A;  2ZJP A;  3VQV A;  1B44 D;  1HHV A;  2QDL A;  3HOX B;  2JSO A;  2EWN A;  1EYG A;  4FXG C;  3LWU A;  4DKA C;  1CSQ A;  3HXX A;  4C3H G;  3GTQ B;  3M4O H;  2QHS A;  1T5X D;  2NTT A;  5C0X J;  1A3T A;  1QUQ A;  3T53 B;  4TVA A;  2DJZ A;  2IX1 A;  2PZW A;  2EYM A;  4NDX A;  1FL0 A;  1SMY C;  1AH9 A;  5JVG 3;  3OHX C;  1PFM A;  4XT1 B;  1VQL A;  3UGQ A;  1YZ6 A;  3A5U A;  2ZM6 Q;  1GKH A;  2Q2T A;  3HOU H;  4BY7 G;  4GLA C;  2NZH A;  3K8A A;  5JVH 3;  2EY5 A;  3HOU B;  1X3P A;  5AJ3 Q;  3EA6 A;  3CU7 A;  1QE0 A;  2DU5 A;  3CW2 C;  4IPH A;  4CDD C;  1C48 A;  3X3M A;  1ADY A;  3STB D;  4CDC C;  4JI7 L;  3X3N A;  3VBB A;  2ART A;  2Q5H A;  1LLR D;  4KHV A;  3T13 A;  2E2J B;  4G4K A;  3RLF A;  1K9M C;  1A6X A;  4DAV A;  2PZT A;  4B3R Q;  1PZJ D;  1IZ6 A;  3GO5 A;  4C3H H;  2KCT A;  3J81 c;  3AEV A;  2KOL A;  2ZTD A;  4QMG A;  3FDT A;  4XU2 A;  2L1B A;  2F0K A;  3V8L A;  3P8Y A;  2PMZ B;  1NCV A;  5JPN C;  3T1H L;  3GD7 A;  3P1H A;  4DK3 C;  1KL9 A;  3OWF A;  4DV6 L;  2QEJ C;  4KLK A;  3I72 A;  2KEC A;  1KRS A;  1Z6H A;  4XQN A;  4NCX A;  2CVR A;  2NVX H;  2FYK A;  4BY7 H;  2E2H H;  5GAH C;  2VUM G;  5G3L D;  4A3J G;  2B2Y C;  3IFD A;  4G7O C;  1EY9 A;  3F2C A;  1FJG Q;  4Z9C B;  11AS A;  2E2H B;  2EJF A;  2HT1 A;  3S17 H;  1SE2 A;  1HPC A;  2AWO A;  4B3M L;  3A32 A;  5EKL A;  2F0M A;  2UUC Q;  1QZH A;  1F9R A;  2ASB A;  3ICE A;  4LVL A;  1O78 A;  2H5X A;  2SNS A;  3IKL A;  2HDM A;  2MGS A;  4LUV A;  2QF7 A;  1Z7N A;  3STB C;  1EY4 A;  5GAE C;  4YRI A;  4HSP A;  2ZXO A;  4ZLT F;  3HOZ G;  2NBF A;  3ND9 A;  4QUF A;  4NXM L;  4X3T A;  2KBN A;  2UU9 Q;  1ML0 D;  5I6W A;  3BVZ A;  3C46 A;  1YNN D;  2AUJ D;  3U9S A;  5LL6 S;  4BW9 A;  3U58 A;  1TY0 A;  1XX8 A;  3K0Y A;  4FNF A;  2G9H D;  4PZ7 A;  5LMN L;  1HNW Q;  1I3Q B;  4GLX A;  1JOQ A;  2SDF A;  5L37 A;  3ULL A;  1GJX A;  2ZGW A;  3CPW A;  4Q6G A;  3OSO A;  2DTH A;  3ER0 A;  2OF1 A;  3UDG A;  2EYP A;  1YGB A;  1JJC A;  2LSS A;  5IYB H;  3GV6 A;  5IOD A;  5C5L A;  2VUM H;  1B70 B;  2M00 A;  1KOG A;  3JAM E;  1L1O B;  1GOZ A;  4YDQ A;  1X3Q A;  2IL8 A;  3M7N A;  1JOO A;  3MTS A;  3S14 H;  3LSS A;  1X9N A;  4DUY Q;  2QGQ A;  1N32 L;  4EQN A;  1SNP A;  1XTD A;  2PNR C;  2C8M A;  2J4X A;  3T1Y L;  1EVL A;  2CH4 W;  1BIA A;  3H0G B;  4DN4 M;  4WJ3 M;  3HOZ H;  1N9W A;  3L7Z C;  4A3M G;  4K2L A;  1EYD A;  4H0L C;  2ZT7 A;  3D4W A;  5C4Z A;  4A3D G;  1H4V B;  5IWA Q;  1PH4 A;  4NB3 A;  4OEM B;  2MNA A;  1A2T A;  3CPF A;  3H3V H;  2O5J C;  2ARS A;  3A7R A;  1HZC A;  1A15 A;  3EFX D;  5A35 A;  2SEB D;  2XTI A;  1G6P A;  2DZC A;  3KYH C;  1SE3 A;  2J0T D;  3MZ5 A;  3A5Z A;  2BA0 A;  1KNE A;  1K0R A;  1A62 A;  3K80 C;  3K58 A;  1YNN C;  1YFS A;  2AQ3 B;  2D0O A;  5KNN A;  1USY C;  3Q8D A;  4OX9 Q;  3DXJ C;  3K59 A;  4RCN A;  1X3G A;  5EPL A;  3PUY A;  3K7A B;  4KY6 A;  2G5D A;  3VR4 A;  2IHE A;  1FNV A;  3U4Z A;  4ZK9 B;  2B2W C;  4FP5 D;  1VQD A;  1BR9 A;  1SSO A;  1CKN A;  1VQ9 A;  2Q7G A;  1Q81 C;  2E3C A;  5C3E B;  4JI7 Q;  4TSS A;  5EGT A;  5FLM G;  2B63 G;  2FMM A;  5DAU A;  1PH9 A;  3FEW X;  3PIP 3;  2DTO A;  5BR8 Q;  2Y0S E;  1STE A;  3N6R A;  5GRO A;  4CBV A;  4H2U A;  1J5W A;  4B3T Q;  1DCZ A;  2ENB A;  1WCM G;  3I4O A;  4JBK A;  3G7L A;  4JVZ A;  4R8I A;  2CFM A;  4C3I G;  1YHB A;  3L2P A;  1IKM A;  3G71 A;  4DR7 Q;  3HXZ A;  2KCC A;  4K86 A;  3PIO A;  3RIR A;  2D62 A;  2Z6K A;  3W1B A;  1UEB A;  2TSS A;  3I4M G;  1LM0 A;  1S5C D;  1L0Y B;  1PRT B;  4LVJ A;  1RL2 A;  3PO3 G;  3HOY G;  1PH1 A;  4TVY A;  4CH3 A;  2X69 A;  5C44 B;  2HCI A;  3EIV A;  4PMB A;  4DR4 L;  3ITP A;  2KUM A;  1R9T H;  3NXW A;  3W1G A;  3QO7 A;  5I6Y A;  4YRT A;  2FHT A;  1YHA A;  4DR3 L;  1Y14 B;  1XMO L;  2F3V A;  4B3M Q;  3DEO A;  4HR7 B;  1WTW A;  1UUP A;  3J80 L;  2VXW A;  2JA8 B;  4GNX A;  1Y1W G;  3G4S A;  2A69 D;  4K0K Q;  4P73 C;  3R3O A;  3CCM A;  1JJ2 A;  2B8F A;  2JA7 G;  2N55 A;  5AFW A;  1WTQ A;  2EYL A;  1IBL Q;  1NBW A;  3FP9 A;  4P72 C;  1TWG B;  5J1Z A;  4AYB G;  3A7A B;  1B9M A;  3K57 A;  2F0T A;  1XNQ Q;  4C3I H;  5HY6 A;  5T1G A;  4IUU A;  3CCU A;  2H4O A;  2WAQ B;  3M3Y H;  1G5I A;  4ZKB B;  4LFC L;  1XMQ L;  2XNA C;  1RIP A;  1XNR L;  1YVC A;  2MO1 A;  3TEH A;  3I4M H;  2R92 H;  3NE5 B;  2EYF A;  2LKV A;  4YRR A;  2XIW A;  2WIN B;  4DXG A;  5JJL A;  3U50 C;  3PO3 H;  1B8A A;  4YRM A;  2A74 C;  2NZ1 D;  1PRT F;  5IP7 G;  1ILQ A;  3RR5 A;  1VQI A;  5A2Q E;  2ARU A;  1JMC A;  1O80 A;  1SNO A;  2R61 A;  2I5H A;  1KRT A;  1IL8 A;  2ZNJ A;  1WVL A;  3CC2 A;  1HTL D;  4YRP A;  4GOP A;  3P75 A;  4ULL A;  2PMF A;  1JJG A;  1EIG A;  1Y1W H;  3S2H H;  1F2Z A;  4YHH Q;  3AFQ A;  3IG2 A;  4DR2 Q;  1IBM L;  2G4C A;  1Q86 C;  4G57 A;  2IY5 B;  1ENC A;  5FK9 C;  2JA7 H;  3HFZ A;  2B2U A;  3KLS X;  5LHY 1;  1QZG A;  1RDP D;  2A69 C;  1ONL A;  1C0A A;  4ZUJ A;  5CMD A;  4DR5 Q;  2V1C C;  2WFW A;  1TWC B;  2CGH A;  3LSQ A;  5D14 A;  2QHV A;  4JK1 C;  2R93 G;  4IJH A;  4A3C H;  4EQP A;  1TT2 A;  5C4X H;  4OO1 G;  2Q7H A;  1NYR A;  5IGE A;  3VR2 A;  2K5H A;  3K5N A;  3TQY A;  2I46 A;  3RKX A;  4YCW A;  3J81 j;  3PF5 A;  1N34 L;  1PA6 A;  4ZAI A;  3CF5 A;  2RHS A;  1CTM A;  3IKJ A;  5FJ8 G;  3K5O A;  4F8M A;  4G7H C;  1H9J A;  1NSN S;  1GUT A;  2K6A A;  4KKT A;  4IPC A;  1LTR D;  3QO5 A;  1V9P A;  3MXP A;  1V8Q A;  3HOV B;  2CW0 D;  4YRG A;  2Y0S B;  2VQE L;  4DQ2 A;  1PTO H;  4H2V A;  3QOJ A;  3CCL A;  4RQF A;  2EJG C;  3A7L A;  1PTO B;  3NP8 A;  1X55 A;  1PVO A;  2Z4I A;  3HXU A;  1QNK A;  3W2D A;  1XWE A;  3MXG A;  3A56 A;  2JA6 B;  3Q23 A;  3HY1 A;  3ULJ A;  1Q3L A;  1CHP D;  2F0Q A;  3GTM B;  2E2I B;  3CQZ B;  5C3W A;  1IW7 D;  1JWS D;  5M3F B;  2KED A;  1Y8O B;  4JOI C;  1BXT A;  5IGB A;  1MJE A;  3LWE A;  1X2G A;  4K88 A;  4TVW A;  5H1S E;  3HOW H;  2I4L A;  4OP0 A;  3PUW A;  5CGK A;  4OO1 H;  2E5L L;  5M3M G;  3AU7 A;  3HOW B;  1CKM A;  4H2T A;  3EFR A;  1Y8P B;  2K5V A;  3A7U A;  2AKW B;  3HZX A;  2MP1 A;  4GZY C;  2WKC A;  4Y7N H;  5FJ8 H;  4HIK A;  3PUZ A;  4LF9 L;  2CWA A;  1E3P A;  2RBM A;  1TKW B;  1B3A A;  4YRQ A;  3VQX A;  3P20 A;  1Z47 A;  1HQR D;  4K14 A;  1XMO Q;  4FVM A;  4K6D A;  3WOF A;  3JC6 6;  1QB5 D;  1NAP A;  1VQM A;  5KNB A;  4MHE A;  3D4D A;  2N49 A;  2XN9 C;  4IUQ A;  1J5E L;  1T5E A;  4BBS G;  2CW0 C;  1JOK A;  3MC0 B;  3RLN A;  4HJ8 A;  2UUB Q;  2D5D A;  1PTO F;  2F0J A;  2FJ2 A;  4CH6 A;  1K73 C;  3J81 L;  4FF1 A;  2NVT H;  1H4Q A;  2EY2 A;  4JI8 L;  4JV5 Q;  4RDX A;  5EQ0 A;  5M5W H;  2LS0 1;  1BUV T;  3E9H A;  2F3I A;  2LFN A;  1D8L A;  5CV8 A;  2K33 A;  1ASZ A;  3WDN A;  2UXC Q;  2JA5 G;  2NVQ B;  4RHS A;  2PPB C;  4DAP A;  3OWE B;  2Q8I B;  3MXN A;  1LT4 D;  2XSC A;  3NEN A;  2IW3 A;  3DM3 A;  3SGI A;  4YWL A;  1IW7 C;  3MVV A;  5GAG C;  1SYF A;  1L0W A;  2PYK A;  5J3B A;  5CR3 A;  1CHQ D;  4S3S A;  3UH0 A;  1VMP A;  4CS4 A;  2DY7 A;  3IKM B;  5C0X I;  4A76 A;  2DQ0 A;  4B3S Q;  2K05 A;  1KLU D;  1GXD C;  4E6I A;  4EO4 A;  1VQE A;  4KD4 A;  1N33 L;  4BXX H;  3IAY A;  2EJM A;  3QWN A;  1FNW A;  4QCL A;  4KHP L;  3S1R H;  2L55 A;  2LMC B;  5FO7 B;  4JI2 Q;  3H15 A;  5D65 A;  2KVM A;  3DWA A;  1NNX A;  4GS3 A;  3RN5 A;  5IYD G;  2RA4 A;  4BBS H;  5C4H A;  4QQB X;  3CCE A;  5C3X A;  1SRO A;  3FVQ A;  4BY1 H;  2ZM6 L;  3W3A A;  3RZO H;  2PI2 E;  2VB2 X;  3PSI A;  1HTP A;  3T51 B;  3CCV A;  1EY8 A;  1CZW A;  2AUK A;  5AJ3 L;  2R7Z H;  4IFD G;  1X65 A;  2CHB D;  1GHK A;  3KLR A;  4K5X A;  2RDG A;  4HVC A;  4A3B H;  1SJH D;  1WTR A;  2UXD L;  4B08 A;  1KD1 C;  2P5I A;  1WJJ A;  3OTO Q;  1E2Z A;  1FYC A;  2EY6 A;  4ME5 A;  3J7Y W;  2EYJ A;  4A3B B;  4A3G G;  1K8O A;  1Y1V B;  2RQX A;  2MQH A;  5C0X G;  2K7V A;  1HNZ Q;  1JE5 A;  3HRK A;  4QL5 A;  3G1Z A;  4A3F B;  4A3E G;  4LUO A;  1WPY A;  4B3R L;  3K7U C;  3CP0 A;  1CT1 D;  4XEO A;  3HKZ G;  2F0P A;  3DLL A;  1B2T A;  4TQF A;  2PQA B;  3O13 A;  2DJG C;  4YRL A;  1H4S A;  3MF2 A;  4OHJ A;  2GN5 A;  3BDL A;  5IT9 L;  3UE1 A;  4P73 A;  4A3K G;  2H1E A;  3L4G B;  5C6A A;  1W6J A;  2F0F A;  4H13 C;  4YRK A;  1IBK Q;  4HWP A;  1MSG A;  4P72 A;  3A0J A;  1X3E A;  2B2T C;  4RQE A;  1G29 1;  1DGS A;  3UDX A;  1IYJ B;  2K5N A;  2N8N A;  4IFD H;  1FJG L;  2KEE A;  3I4N G;  3U4V A;  1U4L A;  4K8J A;  3DWP A;  2EDG A;  4GKJ Q;  4CJ0 B;  3HS0 C;  4A3G H;  3NK9 A;  4AQY Q;  4X6A H;  2DNE A;  2JP1 A;  3HOX G;  2ZR3 A;  1UEA B;  3A8J E;  2EE1 A;  4LF9 Q;  3E5S A;  4XEM A;  4KN7 C;  4YPF A;  1TWH B;  1M90 C;  1K28 A;  4WJ4 A;  1I6H H;  5M5Y H;  2Q5I A;  3V2T A;  3T56 B;  3GTG H;  2Z0S A;  2JK8 A;  2F4V L;  1HA5 A;  1TWA H;  3L9A X;  5CV4 A;  3AQQ A;  4L87 A;  3HEJ A;  1V1O A;  1K8G A;  1TWA B;  4A3I H;  2IX0 A;  5JEA H;  1CKO A;  4YP0 A;  3HOU G;  2SOB A;  1SRY A;  4U68 A;  5ELO A;  1SYD A;  3NQI A;  3Q24 A;  2KEN A;  2F3W A;  3QG1 A;  2HIX A;  1EZ6 A;  1OXX K;  4DUY L;  2O5I C;  4WF2 A;  2CJA A;  1SE4 A;  4XQQ A;  2DTI A;  3FHW A;  3F2U A;  3I4L A;  3E0J A;  1SXT A;  1PDQ A;  4JI1 Q;  4IFD J;  4Y52 H;  4FXD A;  1IXR A;  5CBE E;  3HOX H;  1EL0 A;  1A2U A;  1MIU A;  1F77 A;  4UP9 A;  1BNZ A;  5IP9 G;  3GTQ H;  1STB A;  1G91 A;  1N33 Q;  1WI5 A;  4IUN A;  4LJZ C;  5IWA L;  2UXB Q;  2FIN B;  4KHP Q;  1TXY A;  3PGZ A;  3HG9 A;  1BCP F;  2CWP A;  4R4Q A;  3HXY A;  2EJG A;  2OWO A;  3EVQ A;  4OEL B;  2JN4 A;  1B70 A;  4IJL A;  4CS3 A;  4YWK A;  1L1O A;  2E75 C;  3KLS A;  5IGC A;  1MBY A;  3BU2 A;  1A8V A;  4K87 A;  1WQ7 A;  5JOB A;  4H2W A;  1IL2 A;  1G51 A;  3NQT A;  1RCV D;  1VQN A;  4IN3 A;  4DFA A;  4OX9 L;  5LL6 X;  1GM5 A;  4BWA A;  1EQV A;  3D6C A;  2Z6B A;  2QDB A;  3H09 A;  1A63 A;  4JOI A;  3J7A V;  1HCZ A;  2DXU A;  5JEA J;  1HFN A;  3A54 A;  2UXD Q;  3VDY A;  1K0S A;  1C4Q A;  1ROD A;  2E2J H;  3HXV A;  3KBX A;  1HJP A;  1J6Q A;  1VQP A;  3M4Q A;  4I7A A;  4P74 A;  5BR8 L;  5CBA E;  2XRQ D;  4NPS A;  4LFB Q;  5IP9 H;  2BH2 A;  2C9O A;  4BA2 I;  3SHL A;  1VQG A;  4B3T L;  4XTX A;  2J3L A;  1LAB A;  1RD9 D;  1QCB D;  1S4Z A;  4DV2 Q;  1Q12 A;  2HQE A;  4KY7 A;  1H95 A;  1PFB A;  1D1I A;  2F0O A;  1B53 A;  4DR7 L;  3L2Z A;  4J15 A;  3NSW A;  1ASY A;  1W3S A;  2VQF Q;  2WP8 J;  2F0D A;  2I0Q A;  1ICF B;  1W66 A;  1C8C A;  3NWS A;  4L63 B;  3S9W A;  4HAE A;  3KF8 B;  2Q2U A;  2G9D A;  2PCF B;  1SET A;  1SER A;  5IYB G;  1H9S B;  2RSO A;  2B2V C;  1B7Y B;  3P8T A;  3ULP A;  1DXM A;  5E7N A;  5F2D A;  2A19 A;  4LF7 Q;  4HWR A;  3M9B A;  4UPA A;  4DK0 A;  2IWH A;  1HFG A;  4R8N A;  3R93 A;  3GTP B;  3NEL A;  3H0G G;  4K0K L;  3VYU A;  1EU3 A;  4GN3 B;  1AW7 A;  3EFS A;  2ALY B;  2P5Z X;  4ID6 A;  1WQW A;  3OOC A;  2EQS A;  1IBL L;  3S15 B;  4H02 A;  2RCN A;  1YB3 A;  2B3G A;  3CAM A;  1BCP D;  1LT5 D;  1LT3 D;  4OL7 A;  1XNQ L;  4XQJ A;  4K6L A;  4X65 Q;  2F4V Q;  2NN6 G;  3JAM L;  1I3Q H;  4CKC A;  2RSN A;  3Q6S A;  1WD0 A;  1YIJ A;  4N8F A; 
#chains in the Genus database with same CATH homology
 3J80 i;  3LGJ A;  5DLQ E;  1KQS A;  2JQO A;  1GD7 A;  3V7R A;  3GDE A;  4XU0 A;  5C3E G;  3VQW A;  3E0E A;  4OON A;  4DAY B;  12AS A;  1EQR A;  4Q15 A;  4IOC A;  2HHH L;  2ZZG A;  2JEB I;  4YHH L;  3H0G H;  4DR2 L;  3A74 A;  4PMW A;  3B6Y A;  4PG3 A;  1E22 A;  1LYL A;  3RAC A;  4P75 C;  4WI1 A;  2ZNI A;  4MZ9 A;  5JJI A;  4HWT A;  4DR5 L;  1WOC A;  3WQZ A;  1V1Q A;  1LUZ A;  3RUX A;  5C44 G;  4DV1 Q;  3K7A H;  2A8E A;  1SE8 A;  3KJO A;  4CH5 A;  2AMC B;  1EIF A;  2IY5 A;  1VQF A;  5C3E H;  3TS0 A;  2JA8 G;  4JI4 Q;  4ALP A;  4E51 A;  4AYB E;  4X64 Q;  1E1T A;  3KF6 B;  2UUA Q;  2VZA A;  1YFR A;  4POG A;  2WAQ G;  1YJW A;  2E1H A;  2C35 B;  1A0I A;  4LFA Q;  2R92 G;  1S40 A;  5C44 H;  4YCU A;  2NZO A;  1BVS A;  2DU7 A;  1VQK A;  4RG1 A;  2JA8 H;  1Q46 A;  4OXP A;  1WU7 A;  2PME A;  4XIG S;  4LVK A;  2N78 A;  3QNE A;  1Q1E A;  4QY7 A;  4LVI A;  1YFT A;  3I7F A;  4G85 A;  2UUB L;  1TWG H;  4YRE A;  4JV5 L;  1VQC A;  1Z7M A;  2E8G A;  2PNH A;  2GVB A;  2UXC L;  4XU3 A;  1NMG A;  2K14 A;  3F2B A;  1YJN A;  4A3C G;  2K50 A;  5C4X G;  3NET A;  4HJ7 A;  4LUZ A;  4OO1 I;  1U0L A;  4G84 A;  5K1P A;  3J81 i;  3HOV G;  4B3S L;  1YBY A;  3PCO A;  3RGL A;  1Q1B A;  4LW1 A;  4JI2 L;  1VQ6 A;  2HHH Q;  4L5T A;  1NYQ A;  2JA6 G;  3HY0 A;  4DUZ L;  4DV7 Q;  1NJ8 A;  5M3F G;  2Q7E A;  1TWC H;  2OTL A;  1EFW A;  1HH2 P;  3F8T A;  1OTC A;  1VQ5 A;  3HOW G;  3FJP A;  3QTC A;  1T9H A;  3OTO L;  4H2S A;  1HNZ L;  4HID A;  3HOV H;  4A3L H;  4DK6 C;  1Q7Y C;  5F5W A;  4NXN L;  1PYS B;  1X2H A;  5ELN A;  3CCR A;  1NJI C;  2JA6 H;  4YRN A;  2A1A A;  1Q82 C;  4L5Q A;  1PHJ A;  3GTM H;  1IBK L;  2E2I H;  1SLJ A;  3CQZ H;  5LMU Q;  5M3F H;  4LF8 Q;  2DUD A;  4KR2 A;  1HZB A;  1OXS C;  4ZTZ B;  4HA8 A;  3RF1 A;  4BA1 I;  5E3I A;  3CCS A;  4IO9 A;  4GKJ L;  5HGQ A;  3L1A A;  2B29 A;  4YWM A;  4AQY L;  4POF A;  2PQA A;  1BBW A;  2E65 A;  1NJ5 A;  3L4G A;  1PH7 A;  4UP7 A;  1YJ9 A;  4BXX G;  4XTY A;  4X62 L;  3MF1 A;  2LXK A;  2LXJ A;  2F52 A;  1AE2 A;  4BY1 G;  2NVQ H;  4PZ8 A;  2NS6 A;  4JG2 A;  2R7Z G;  3S24 A;  2HQL A;  2VS1 A;  4X66 L;  4A3B G;  1PH6 A;  4IFD I;  3REU A;  4APV A;  1USY A;  4JI1 L;  4DR6 Q;  2MO0 A;  3HKZ E;  4P3O A;  3M4P A;  4H2X B;  1KAW A;  3CCQ A;  1EIY B;  2UXB L;  1ADJ A;  2C7I A;  3HFZ B;  3TUP A;  2BA1 A;  4QIW E;  1I94 Q;  2CQO A;  4JYA L;  4DUZ Q;  4XTV A;  2RHQ B;  4R4T A;  4JBW A;  1KC8 C;  2E5A A;  1GVP A;  1RIQ A;  1Z9F A;  3UFG A;  1UE1 A;  1Y1V H;  2AWN A;  4A3F H;  1D7Q A;  4DNI A;  1VQJ A;  1UWV A;  4P71 C;  3NEM A;  4LFB L;  4R4I A;  4DR1 L;  1PH8 A;  4NXN Q;  4DV2 L;  4RMF A;  2VQF L;  2ODR D;  3J80 c;  2QA4 A;  3KOJ A;  4AH6 A;  2CCZ A;  4A3I G;  5JEA G;  3EBE A;  3NBH B;  4HIM A;  1BKB A;  1NY4 A;  1QF6 A;  3CC7 A;  4YRS A;  1XPU A;  2CJ9 A;  2EJ9 A;  4LF7 L;  1XPR A;  3BZC A;  1JB7 A;  2DDZ A;  1KMM A;  2DEQ A;  4PZ6 A;  5EAY A;  2PMZ E;  4LF5 L;  1TWH H;  3OW2 A;  2IT1 A;  1UE7 A;  3I56 A;  3MQZ A;  3I55 A;  4X62 Q;  2I4M A;  1VQ7 A;  5C52 B;  4HWO A;  4X65 L;  2I4N A;  1B7Y A;  4LNS A;  4YY3 Q;  3HKS A;  1P8L A;  1BBU A;  1X6O A;  3KDF B;  3EN2 A;  1S3O A;  2ODR C;  2ALY A;  1YNX A;  4ME3 A;  4X66 Q;  4JI5 Q;  4GN5 A;  2CKZ B;  2Z6K C;  3JAM i;  4XTU A;  3RLO A;  4O0A A;  1P16 A;  3WWV A;  4EQ5 A;  2AHO B;  4OWX B;  3PIP A;  2CJB A;  1AE3 A;  4JYA Q;  4GNX C;  1HTT A;  2KHI A;  1U5K A;  4R4C A;  4DV1 L;  4XTZ A;  4OWT B;  4KHZ A;  3UDI A;  4H2Y A;  1V43 A;  3RKY A;  4LF4 L;  1HR0 Q;  2D0P A;  1NJ2 A;  1X54 A;  4JI4 L;  2QHT A;  1OXU A;  4JI6 L;  3PUV A;  1NJ1 A;  4X64 L;  2UUA L;  4LF6 Q;  1MKH A;  2N3S A;  1HC7 A;  5GQO A;  4DR1 Q;  2ZR2 A;  2HNI A;  4R1J A;  4DAM A;  3H3V I;  2L15 A;  4GOP C;  2AMC A;  3HTZ A;  1JT8 A;  5C51 B;  3PV0 A;  2NN6 I;  4LFA L;  3CCJ A;  4DV4 L;  4JCV E;  1WYD A;  2WB1 G;  3KF6 A;  1NE3 A;  4FDB A;  2J3M A;  4A4I A;  2EXD A;  3GTP H;  1GO3 E;  1X3F A;  3TRZ A;  4LF5 Q;  3ERR A;  3S15 H;  1CUK A;  4JI0 Q;  2FXQ A;  5IY0 A;  2VL6 A;  1KMN A;  2JEA I;  1NTG A;  4UY8 C;  4YRO A;  2ZTC A;  2VNU D;  2MFI A;  3S2D H;  4CH4 A;  3K81 C;  1GGM A;  3V7S A;  2I5L X;  2ZCE A;  4DV0 L;  3V8K A;  1YIT A;  4LVM A;  3DSQ A;  4O2D A;  3A7A A;  1WFQ A;  1PYB A;  2WAQ E;  4P71 A;  1QUQ B;  1SES A;  4DV7 L;  4TVA B;  3QO8 A;  4A3J H;  4GKK L;  4TQU S;  2R7F A;  1K8A C;  3VQY A;  2E10 A;  4A93 G;  4HWS A;  5GAD C;  1OXV A;  3AYH B;  1PH3 A;  3W5O A;  2ZIM A;  4YCV A;  1VQ8 A;  2DXT A;  3KLW A;  4DPG A;  4TWA A;  5IT9 c;  4XTC S;  4CS2 A;  5JJK A;  1N36 L;  4IOA A;  1B76 A;  3KJP A;  3HRI A;  2OTJ A;  3RZD H;  4LF4 Q;  1C9O A;  2VY3 A;  4DV5 L;  3LC0 A;  2EAY A;  1H4T A;  1LTL A;  4P3P A;  4JI6 Q;  4A75 A;  3UE0 A;  2RF4 A;  3CXC A;  1PV4 A;  3REX A;  2ES2 A;  1Q8K A;  5LMU L;  1WNL A;  4LF8 L;  1K3R A;  4A93 H;  4ZIB A;  2OCE A;  1VQZ A;  4YYE A;  4QJF A;  2ZZF A;  2ZT6 A;  1PH2 A;  4GN4 B;  4DV4 Q;  3RNU A;  4YRJ A;  1PYS A;  4A3M H;  4A3D H;  5C53 B;  1FYF A;  2I4O A;  1EWI A;  4L5S A;  3F1Z A;  3T1H Q;  2ZT5 A;  3UDF A;  4DV6 Q;  1N8R C;  4C3J H;  4KI0 A;  1L2F A;  1HR0 W;  4IPD A;  4L5R C;  4XU1 A;  3CME A;  3OYY A;  1YI2 A;  4TQD A;  1WLE A;  2DVE A;  3MEF A;  3S1M H;  3M85 A;  2AKW A;  3BZK A;  1JJC B;  5FLM H;  2B63 H;  4DV3 L;  1E7Z A;  2ZIN A;  3TRE A;  5K1X A;  2EIF A;  4DR6 L;  2DZ9 A;  4XTW A;  1WCM H;  4NXM Q;  3KFU A;  2HIV A;  1FGU A;  3RL6 A;  1HNX L;  4GLV B;  4A3L G;  2Y0S G;  1XJV A;  1SRU A;  1KXL A;  4DV0 Q;  5LMN Q;  1I94 L;  1EVK A;  3D31 A;  1VCI A;  2VW9 A;  3HOY H;  2K52 A;  4GKK Q;  2ZT8 A;  3A5Z B;  3F2D A;  2YTY A;  4OWW B;  3MEY A;  4JI3 L;  1NJ6 A;  1N32 Q;  2CIM A;  4H2X A;  3T1Y Q;  1EIY A;  2JJQ A;  4R4O A;  4KQE A;  3R07 A;  1CKN B;  4HJ5 A;  1MJC A;  1N36 Q;  4IPG A;  2P0L A;  4HT4 A;  2R6G A;  1O7I A;  1VQB A;  2NVY H;  2RHQ A;  2OQK A;  4DV5 Q;  4ZTU B;  3L0O A;  1ATI A;  3BJU A;  4MNO A;  2ATW A;  3PUX A;  2ID0 A;  5IP7 H;  3ICA A;  1CSP A;  4HIO A;  2ZZE A;  2DKG A;  4C2M H;  2ZIO A;  1KHI A;  3S16 H;  3IAL A;  3J7Z C;  3ERS X;  1S72 A;  1M1K C;  1L1O C;  3JAM c;  3PZC A;  4PHC A;  4KR3 A;  1G5H A;  3CC4 A;  1I50 H;  4GNX B;  1K83 H;  1QVC A;  2R93 H;  2Q2H A;  1VS0 A;  2YU9 H;  3HFV A;  1VQA A;  3GTL H;  3A5Y A;  1NNH A;  2OQ0 A;  2ZTE A;  1HXD A;  2EL9 A;  4YY3 L;  2QEX A;  3PO2 G;  4P74 C;  4DR4 Q;  4P75 A;  1EQQ A;  4JC0 A;  3TEH B;  2K4K A;  2YV5 A;  4DR3 Q;  1VQ4 A;  3V8J A;  1E24 A;  4MTN A;  3RN2 A;  4DV3 Q;  4JI5 L;  1Y1V G;  1HZA A;  4BBR G;  3PCO B;  1VQO A;  1I5F A;  2Q2I A;  4A3F G;  1X56 A;  4JBJ A;  1HNX Q;  4GOP B;  1NMF A;  2E64 A;  4TTV A;  4OLF A;  2I5M X;  4LFC Q;  1XMQ Q;  3KDF A;  1XNR Q;  1PFS A;  5M3M H;  3OD1 A;  3PO2 H;  1SN8 A;  1KIX A;  3D0F A;  1OXT A;  1EUJ A;  3G48 A;  3UGT A;  3S1N H;  2IHF A;  3BFM A;  4JI3 Q;  1VQH A;  3GTK H;  1HR0 L;  3FKI G;  2RHS B;  1IBM Q;  2JA9 A;  4QGU A;  1SR3 A;  4BBR H;  2XGT A;  1E1O A;  4LF6 L;  4X5O A;  3A31 A;  4JBM A;  2R7D A;  2PI2 A;  2KCM A;  3TS2 A;  4YRC A;  3J7A 5;  2JA5 H;  4LNQ A;  3E9I A;  2ZTG A;  3P8V A;  3GTO H;  2YTX A;  1QVF A;  5C4J H;  3RKW A;  1N34 Q;  5LMN W;  4HJ9 A;  3W3S A;  2DQ3 A;  2VQE Q;  1HZ9 A;  3G6E A;  2YTV A;  1W2B A;  3FKI H;  5IYD H;  2KHJ A;  1YHQ A;  1PH5 A;  2GVA A;  2BH8 A;  3CMQ A;  3I2Z A;  1BIB A;  2A8V A;  3TEG A;  3CD6 A;  4LWC A;  3IRB A;  4JI0 L;  3GTJ H;  5IYC G;  2ZJR A;  3V7C A;  2E5L Q;  2E41 A;  2UUC L;  2QHU A;  2ZXF A;  4AIM A;  4HJA A;  2JE6 I;  4YRF A;  3MXN B;  1UE6 A;  4A3E H;  1SFO H;  1QVG A;  5FLX c;  2YYZ A;  2UU9 L;  1FVI A;  3S1Q H;  1C7Y A;  2DGY A;  1J5E Q;  4P3N A;  5M5X H;  1TWF H;  3K0X A;  3PF4 A;  4A3K H;  1HNW L;  1EOV A;  1X01 A;  3ZJY C;  2ZJQ A;  4JI8 Q;  4EX5 A;  3CMA A;  3HXW A;  3AFP A;  5IE8 A;  5K36 G;  3I4N H;  1XPO A;  1SMX A;  1UE5 A;  4UP8 A;  1YEZ A;  5IYC H;  2WB1 E;  2K75 A;  2ZJP A;  3VQV A;  2EWN A;  1EYG A;  4DKA C;  1CSQ A;  3HXX A;  3M4O H;  2QHS A;  5C0X J;  1QUQ A;  4TVA A;  2DJZ A;  2IX1 A;  1FL0 A;  1AH9 A;  1VQL A;  3UGQ A;  1YZ6 A;  3A5U A;  2ZM6 Q;  1GKH A;  2Q2T A;  3HOU H;  4BY7 G;  4GLA C;  2NZH A;  3K8A A;  5AJ3 Q;  2DU5 A;  1QE0 A;  3CW2 C;  4IPH A;  1ADY A;  3STB D;  4JI7 L;  3VBB A;  2ART A;  2Q5H A;  3RLF A;  1K9M C;  4B3R Q;  1IZ6 A;  3GO5 A;  4C3H H;  2KCT A;  3J81 c;  3AEV A;  2ZTD A;  4XU2 A;  3V8L A;  3P8Y A;  3T1H L;  3GD7 A;  4DK3 C;  1KL9 A;  4DV6 L;  4KLK A;  1KRS A;  4NCX A;  2NVX H;  2FYK A;  4BY7 H;  2E2H H;  5GAH C;  2VUM G;  4A3J G;  3F2C A;  1FJG Q;  11AS A;  2EJF A;  2HT1 A;  3S17 H;  4B3M L;  2AWO A;  3A32 A;  2UUC Q;  1QZH A;  2ASB A;  3ICE A;  4LVL A;  2H5X A;  3IKL A;  4LUV A;  1Z7N A;  3STB C;  5GAE C;  4YRI A;  3HOZ G;  4NXM L;  2KBN A;  2UU9 Q;  4BW9 A;  3U58 A;  4PZ7 A;  5LMN L;  1HNW Q;  4GLX A;  3ULL A;  2ZGW A;  3CPW A;  4Q6G A;  2DTH A;  3ER0 A;  3UDG A;  1YGB A;  1JJC A;  2LSS A;  5IYB H;  2VUM H;  1B70 B;  1KOG A;  1L1O B;  4YDQ A;  3M7N A;  3S14 H;  3LSS A;  1X9N A;  4DUY Q;  2QGQ A;  1N32 L;  1XTD A;  2C8M A;  3T1Y L;  1EVL A;  1BIA A;  4WJ3 M;  3HOZ H;  1N9W A;  3L7Z C;  4A3M G;  2ZT7 A;  1H4V B;  4A3D G;  5IWA Q;  1PH4 A;  4NB3 A;  2MNA A;  3CPF A;  3H3V H;  2ARS A;  3A7R A;  1HZC A;  1G6P A;  2XTI A;  2DZC A;  3KYH C;  3A5Z A;  2BA0 A;  1K0R A;  3K80 C;  1A62 A;  1YFS A;  2D0O A;  5KNN A;  1USY C;  3Q8D A;  4OX9 Q;  1X3G A;  3PUY A;  2IHE A;  3U4Z A;  1VQD A;  1CKN A;  1VQ9 A;  2Q7G A;  1Q81 C;  2E3C A;  4JI7 Q;  5FLM G;  2B63 G;  1PH9 A;  2DTO A;  5BR8 Q;  2Y0S E;  5GRO A;  4H2U A;  1J5W A;  4B3T Q;  1WCM G;  3I4O A;  4JBK A;  2CFM A;  1YHB A;  3L2P A;  3G71 A;  4DR7 Q;  3HXZ A;  4K86 A;  3PIO A;  3RIR A;  2D62 A;  2Z6K A;  3W1B A;  1UEB A;  3I4M G;  1LM0 A;  4LVJ A;  1RL2 A;  3PO3 G;  3HOY G;  1PH1 A;  4TVY A;  4CH3 A;  3EIV A;  4DR4 L;  1R9T H;  3W1G A;  3QO7 A;  4YRT A;  4DR3 L;  1YHA A;  1XMO L;  1Y14 B;  4B3M Q;  4GNX A;  1Y1W G;  3G4S A;  4P73 C;  4K0K Q;  3CCM A;  1JJ2 A;  2JA7 G;  1IBL Q;  1NBW A;  3FP9 A;  4P72 C;  4AYB G;  1XNQ Q;  4C3I H;  5HY6 A;  3CCU A;  3M3Y H;  1G5I A;  4LFC L;  1XMQ L;  1RIP A;  1XNR L;  1YVC A;  2MO1 A;  3TEH A;  3I4M H;  2R92 H;  4YRR A;  5JJL A;  3U50 C;  3PO3 H;  1B8A A;  4YRM A;  5IP7 G;  3RR5 A;  1VQI A;  2ARU A;  1JMC A;  2I5H A;  1KRT A;  2ZNJ A;  3CC2 A;  4YRP A;  4GOP A;  2PMF A;  1JJG A;  1Y1W H;  3S2H H;  4YHH Q;  3AFQ A;  3IG2 A;  4DR2 Q;  1IBM L;  2G4C A;  1Q86 C;  2IY5 B;  2JA7 H;  3HFZ A;  1QZG A;  1C0A A;  4DR5 Q;  2V1C C;  2WFW A;  2CGH A;  3LSQ A;  2QHV A;  2R93 G;  4IJH A;  4A3C H;  5C4X H;  4OO1 G;  2Q7H A;  1NYR A;  2K5H A;  3RKX A;  3TQY A;  4YCW A;  3J81 j;  3PF5 A;  1N34 L;  1PA6 A;  3CF5 A;  2RHS A;  5FJ8 G;  4IPC A;  3QO5 A;  1V9P A;  4YRG A;  2VQE L;  4DQ2 A;  4H2V A;  3CCL A;  4RQF A;  1X55 A;  1PVO A;  3HXU A;  3HY1 A;  3ULJ A;  4JOI C;  1MJE A;  1X2G A;  4K88 A;  4TVW A;  5H1S E;  3HOW H;  2I4L A;  4OP0 A;  3PUW A;  2E5L L;  5M3M G;  4H2T A;  1CKM A;  3EFR A;  2K5V A;  3A7U A;  2AKW B;  4Y7N H;  5FJ8 H;  4HIK A;  3PUZ A;  4LF9 L;  2CWA A;  1E3P A;  4YRQ A;  3VQX A;  1Z47 A;  1XMO Q;  3JC6 6;  1VQM A;  2N49 A;  1J5E L;  4BBS G;  3RLN A;  4HJ8 A;  2UUB Q;  4CH6 A;  1K73 C;  1H4Q A;  2NVT H;  4JI8 L;  4JV5 Q;  4RDX A;  5M5W H;  3E9H A;  2F3I A;  1D8L A;  1ASZ A;  2UXC Q;  2JA5 G;  3NEN A;  3DM3 A;  3SGI A;  4YWL A;  5GAG C;  1L0W A;  5J3B A;  3UH0 A;  4CS4 A;  3IKM B;  5C0X I;  4A76 A;  2DQ0 A;  4B3S Q;  4EO4 A;  1VQE A;  1N33 L;  4BXX H;  4KHP L;  3S1R H;  4JI2 Q;  3H15 A;  4GS3 A;  3RN5 A;  5IYD G;  4BBS H;  4QQB X;  3CCE A;  1SRO A;  4BY1 H;  2ZM6 L;  3RZO H;  2PI2 E;  3PSI A;  3CCV A;  2R7Z H;  5AJ3 L;  4IFD G;  1X65 A;  4HVC A;  4A3B H;  2UXD L;  1KD1 C;  2P5I A;  1WJJ A;  3OTO Q;  4A3G G;  2MQH A;  5C0X G;  1HNZ Q;  1JE5 A;  3HRK A;  4QL5 A;  3G1Z A;  4A3E G;  4LUO A;  1WPY A;  4B3R L;  3K7U C;  3CP0 A;  4XEO A;  3HKZ G;  3DLL A;  4TQF A;  2PQA B;  4YRL A;  1H4S A;  3MF2 A;  2GN5 A;  3UE1 A;  4P73 A;  4A3K G;  3L4G B;  4YRK A;  1IBK Q;  4HWP A;  4P72 A;  3A0J A;  1X3E A;  4RQE A;  1G29 1;  1DGS A;  3UDX A;  1IYJ B;  2K5N A;  2N8N A;  1FJG L;  3I4N G;  3U4V A;  4GKJ Q;  4A3G H;  4AQY Q;  4X6A H;  3HOX G;  2ZR3 A;  4LF9 Q;  4XEM A;  4YPF A;  1M90 C;  4WJ4 A;  1I6H H;  5M5Y H;  2Q5I A;  3GTG H;  2Z0S A;  2JK8 A;  2F4V L;  1TWA H;  3AQQ A;  4L87 A;  1K8G A;  4A3I H;  2IX0 A;  1CKO A;  4YP0 A;  3HOU G;  1SRY A;  5ELO A;  2KEN A;  2HIX A;  1OXX K;  4DUY L;  4WF2 A;  2CJA A;  2DTI A;  3FHW A;  4JI1 Q;  4IFD J;  4Y52 H;  1IXR A;  3HOX H;  1MIU A;  4UP9 A;  5IP9 G;  3GTQ H;  1N33 Q;  1WI5 A;  5IWA L;  2UXB Q;  4KHP Q;  1TXY A;  3PGZ A;  2CWP A;  4R4Q A;  3HXY A;  2EJG A;  2OWO A;  1B70 A;  4IJL A;  4CS3 A;  4YWK A;  1L1O A;  3BU2 A;  1A8V A;  4K87 A;  1WQ7 A;  4H2W A;  1IL2 A;  1G51 A;  1VQN A;  4OX9 L;  1GM5 A;  4BWA A;  1A63 A;  4JOI A;  2DXU A;  5JEA J;  2UXD Q;  3VDY A;  2E2J H;  3HXV A;  1HJP A;  1J6Q A;  1VQP A;  3M4Q A;  4P74 A;  5BR8 L;  4NPS A;  4LFB Q;  5IP9 H;  2BH2 A;  4BA2 I;  4XTX A;  1VQG A;  4B3T L;  2J3L A;  4DV2 Q;  1Q12 A;  1H95 A;  4DR7 L;  3L2Z A;  4J15 A;  1ASY A;  1W3S A;  2VQF Q;  2WP8 J;  2I0Q A;  1W66 A;  3KF8 B;  2Q2U A;  1SET A;  1SER A;  5IYB G;  1B7Y B;  3P8T A;  3ULP A;  5E7N A;  2A19 A;  4LF7 Q;  4HWR A;  3M9B A;  4UPA A;  3NEL A;  3H0G G;  4K0K L;  4GN3 B;  3EFS A;  2ALY B;  1WQW A;  2EQS A;  1IBL L;  4H02 A;  2RCN A;  1YB3 A;  2B3G A;  3CAM A;  1XNQ L;  4X65 Q;  2F4V Q;  2NN6 G;  1I3Q H;  1YIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...