2XGUA

Structure of the n-terminal domain of capsid protein from rabbit endogenous lentivirus (relik)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
PIMLRGGRQEYEPVGPGLIAAWLKQVQEHGLTHPATITYFGVISINFTSVDINMLLNVTPGFAAEKQLVIDKIKEKAIAWDEMHPPPPADAAGPVPLTSDQIRGIGLSPEEAAGPRFADARTLYRTWVLEALQECQRTISPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of Prehistoric Lentiviruses Uncovers an Ancient Molecular Interface.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Viral protein
molecule keywords RELIK CAPSID N-TERMINAL DOMAIN
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2xguA00
4NX4C 1EM9A 1P7NA 2GOLB 4J93A 4LQWC 2WLVA 2GONA 4PH2A 4U0CA 5HGKA 5HGOA 3BP9A 1L6NA 4XFXA 2WLVB 4U0AA 1M9XC 4XROA 4B4NA 1GWPA 1M9CC 5HGNA 4PH3A 2XGYA 2X82A 4U0DA 1E6JP 2XDEA 2M8NA 2M8PA 3MGEA 2PWMA 4QNBA 2EIAA 4XFYA 4DGAC 5JPAA 4U0BA 2LF4A 2Y4ZA 5HGMA 2JPRA 1M9EC 1M9FC 2M8LA 4DGEC 1G03A 1M9DC 4INBA 1D1DA 2V4XA 1AK4C 1M9YC 3NTEA 3H47A 2PWOA 4U0EA 2XGVA 4WYMA 4XRQA 4E91A 4E92A 2XGUA 1EIAA 3H4EA 4XFZA 3P05A 1U7KA 4HTWA 4PH0A 1AFVA 2X83A 5HGLA 2PXRC 4U0FA 2KGFA 1QRJA 2X2DD
chains in the Genus database with same CATH superfamily
4NX4C 1EM9A 1P7NA 2GOLB 4J93A 4LQWC 2WLVA 2GONA 4PH2A 4U0CA 5HGKA 5HGOA 3BP9A 1L6NA 4XFXA 2WLVB 4U0AA 1M9XC 4XROA 4B4NA 1GWPA 1M9CC 5HGNA 4PH3A 2XGYA 2X82A 4U0DA 1E6JP 2XDEA 2M8NA 2M8PA 3MGEA 2PWMA 4QNBA 2EIAA 4XFYA 4DGAC 5JPAA 4U0BA 2LF4A 2Y4ZA 5HGMA 2JPRA 1M9EC 1M9FC 2M8LA 4DGEC 1G03A 1M9DC 4INBA 1D1DA 2V4XA 1AK4C 1M9YC 3NTEA 3H47A 2PWOA 4U0EA 2XGVA 4WYMA 4XRQA 4E91A 4E92A 2XGUA 1EIAA 3H4EA 4XFZA 3P05A 1U7KA 4HTWA 4PH0A 1AFVA 2X83A 5HGLA 2PXRC 4U0FA 2KGFA 1QRJA 2X2DD
chains in the Genus database with same CATH topology
4NX4C 1EM9A 1P7NA 2GOLB 4J93A 4LQWC 2WLVA 2GONA 4PH2A 4U0CA 5HGKA 5HGOA 3BP9A 1L6NA 4XFXA 2WLVB 4U0AA 1M9XC 4XROA 4B4NA 1GWPA 1M9CC 5HGNA 4PH3A 2XGYA 2X82A 4U0DA 1E6JP 2XDEA 2M8NA 2M8PA 3MGEA 2PWMA 4QNBA 2EIAA 4XFYA 4DGAC 5JPAA 4U0BA 2LF4A 2Y4ZA 5HGMA 2JPRA 1M9EC 1M9FC 2M8LA 4DGEC 1G03A 1M9DC 4INBA 1D1DA 2V4XA 1AK4C 1M9YC 3NTEA 3H47A 2PWOA 4U0EA 2XGVA 4WYMA 4XRQA 4E91A 4E92A 2XGUA 1EIAA 3H4EA 4XFZA 3P05A 1U7KA 4HTWA 4PH0A 1AFVA 2X83A 5HGLA 2PXRC 4U0FA 2KGFA 1QRJA 2X2DD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NX4 C;  1EM9 A;  1P7N A;  2GOL B;  4J93 A;  4LQW C;  2WLV A;  2GON A;  4PH2 A;  4U0C A;  5HGK A;  5HGO A;  3BP9 A;  1L6N A;  4XFX A;  2WLV B;  4U0A A;  1M9X C;  4XRO A;  4B4N A;  1GWP A;  1M9C C;  5HGN A;  4PH3 A;  2XGY A;  2X82 A;  4U0D A;  1E6J P;  2XDE A;  2M8N A;  2M8P A;  3MGE A;  2PWM A;  4QNB A;  2EIA A;  4XFY A;  4DGA C;  5JPA A;  4U0B A;  2LF4 A;  2Y4Z A;  5HGM A;  2JPR A;  1M9E C;  1M9F C;  2M8L A;  4DGE C;  1G03 A;  1M9D C;  4INB A;  1D1D A;  2V4X A;  1AK4 C;  1M9Y C;  3NTE A;  3H47 A;  2PWO A;  4U0E A;  2XGV A;  4WYM A;  4XRQ A;  4E91 A;  4E92 A;  2XGU A;  1EIA A;  3H4E A;  4XFZ A;  3P05 A;  1U7K A;  4HTW A;  4PH0 A;  1AFV A;  2X83 A;  5HGL A;  2PXR C;  4U0F A;  2KGF A;  1QRJ A;  2X2D D; 
#chains in the Genus database with same CATH topology
 4NX4 C;  1EM9 A;  1P7N A;  2GOL B;  4J93 A;  4LQW C;  2WLV A;  2GON A;  4PH2 A;  4U0C A;  5HGK A;  5HGO A;  3BP9 A;  1L6N A;  4XFX A;  2WLV B;  4U0A A;  1M9X C;  4XRO A;  4B4N A;  1GWP A;  1M9C C;  5HGN A;  4PH3 A;  2XGY A;  2X82 A;  4U0D A;  1E6J P;  2XDE A;  2M8N A;  2M8P A;  3MGE A;  2PWM A;  4QNB A;  2EIA A;  4XFY A;  4DGA C;  5JPA A;  4U0B A;  2LF4 A;  2Y4Z A;  5HGM A;  2JPR A;  1M9E C;  1M9F C;  2M8L A;  4DGE C;  1G03 A;  1M9D C;  4INB A;  1D1D A;  2V4X A;  1AK4 C;  1M9Y C;  3NTE A;  3H47 A;  2PWO A;  4U0E A;  2XGV A;  4WYM A;  4XRQ A;  4E91 A;  4E92 A;  2XGU A;  1EIA A;  3H4E A;  4XFZ A;  3P05 A;  1U7K A;  4HTW A;  4PH0 A;  1AFV A;  2X83 A;  5HGL A;  2PXR C;  4U0F A;  2KGF A;  1QRJ A;  2X2D D; 
#chains in the Genus database with same CATH homology
 4NX4 C;  1EM9 A;  1P7N A;  2GOL B;  4J93 A;  4LQW C;  2WLV A;  2GON A;  4PH2 A;  4U0C A;  5HGK A;  5HGO A;  3BP9 A;  1L6N A;  4XFX A;  2WLV B;  4U0A A;  1M9X C;  4XRO A;  4B4N A;  1GWP A;  1M9C C;  5HGN A;  4PH3 A;  2XGY A;  2X82 A;  4U0D A;  1E6J P;  2XDE A;  2M8N A;  2M8P A;  3MGE A;  2PWM A;  4QNB A;  2EIA A;  4XFY A;  4DGA C;  5JPA A;  4U0B A;  2LF4 A;  2Y4Z A;  5HGM A;  2JPR A;  1M9E C;  1M9F C;  2M8L A;  4DGE C;  1G03 A;  1M9D C;  4INB A;  1D1D A;  2V4X A;  1AK4 C;  1M9Y C;  3NTE A;  3H47 A;  2PWO A;  4U0E A;  2XGV A;  4WYM A;  4XRQ A;  4E91 A;  4E92 A;  2XGU A;  1EIA A;  3H4E A;  4XFZ A;  3P05 A;  1U7K A;  4HTW A;  4PH0 A;  1AFV A;  2X83 A;  5HGL A;  2PXR C;  4U0F A;  2KGF A;  1QRJ A;  2X2D D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...