2XGUA

Structure of the n-terminal domain of capsid protein from rabbit endogenous lentivirus (relik)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'PIMLRGGRQEYEPVGPGLIAAWLKQVQEHGLTHPATITYFGVISINFTSVDINMLLNVTPGFAAEKQLVIDKIKEKAIAWDEMHPPPPADAAGPVPLTSDQIRGIGLSPEEAAGPRFADARTLYRTWVLEALQECQRTISPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RELIK CAPSID N-TERMINAL DOMAIN
publication title Structural and Functional Analysis of Prehistoric Lentiviruses Uncovers an Ancient Molecular Interface.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Viral protein
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2xguA00
4XRQA 2Y4ZA 2X2DD 1U7KA 5HGOA 5HGLA 2PXRC 4J93A 2WLVA 2JPRA 2X83A 4INBA 4LQWC 4U0DA 4PH0A 4B4NA 1M9DC 1P7NA 2GOLB 1M9CC 2GONA 4HTWA 5JPAA 4XFXA 1EM9A 1M9XC 2PWMA 2XGYA 4XROA 4NX4C 4E92A 2M8PA 1AK4C 4WYMA 3BP9A 2XGVA 3MGEA 1M9EC 4U0AA 4U0CA 4PH2A 3P05A 2M8NA 4QNBA 2LF4A 1QRJA 1D1DA 1EIAA 5HGNA 1M9FC 2WLVB 4U0BA 5HGMA 1AFVA 4E91A 4PH3A 2PWOA 4XFYA 1GWPA 1L6NA 1M9YC 1E6JP 2XDEA 3NTEA 4XFZA 1G03A 2KGFA 2M8LA 2X82A 2EIAA 4DGAC 2V4XA 4DGEC 3H47A 4U0EA 3H4EA 5HGKA 4U0FA 2XGUA
chains in the Genus database with same CATH superfamily
4XRQA 2Y4ZA 2X2DD 1U7KA 5HGOA 5HGLA 2PXRC 4J93A 2WLVA 2JPRA 2X83A 4INBA 4LQWC 4U0DA 4PH0A 4B4NA 1M9DC 1P7NA 2GOLB 1M9CC 2GONA 4HTWA 5JPAA 4XFXA 1EM9A 1M9XC 2PWMA 2XGYA 4XROA 4NX4C 4E92A 2M8PA 1AK4C 4WYMA 3BP9A 2XGVA 3MGEA 1M9EC 4U0AA 4U0CA 4PH2A 3P05A 2M8NA 4QNBA 2LF4A 1QRJA 1D1DA 1EIAA 5HGNA 1M9FC 2WLVB 4U0BA 5HGMA 1AFVA 4E91A 4PH3A 2PWOA 4XFYA 1GWPA 1L6NA 1M9YC 1E6JP 2XDEA 3NTEA 4XFZA 1G03A 2KGFA 2M8LA 2X82A 2EIAA 4DGAC 2V4XA 4DGEC 3H47A 4U0EA 3H4EA 5HGKA 4U0FA 2XGUA
chains in the Genus database with same CATH topology
4XRQA 2Y4ZA 2X2DD 1U7KA 5HGOA 5HGLA 2PXRC 4J93A 2WLVA 2JPRA 2X83A 4INBA 4LQWC 4U0DA 4PH0A 4B4NA 1M9DC 1P7NA 2GOLB 1M9CC 2GONA 4HTWA 5JPAA 4XFXA 1EM9A 1M9XC 2PWMA 2XGYA 4XROA 4NX4C 4E92A 2M8PA 1AK4C 4WYMA 3BP9A 2XGVA 3MGEA 1M9EC 4U0AA 4U0CA 4PH2A 3P05A 2M8NA 4QNBA 2LF4A 1QRJA 1D1DA 1EIAA 5HGNA 1M9FC 2WLVB 4U0BA 5HGMA 1AFVA 4E91A 4PH3A 2PWOA 4XFYA 1GWPA 1L6NA 1M9YC 1E6JP 2XDEA 3NTEA 4XFZA 1G03A 2KGFA 2M8LA 2X82A 2EIAA 4DGAC 2V4XA 4DGEC 3H47A 4U0EA 3H4EA 5HGKA 4U0FA 2XGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRQ A;  2Y4Z A;  2X2D D;  1U7K A;  5HGO A;  5HGL A;  2PXR C;  4J93 A;  2WLV A;  2JPR A;  2X83 A;  4INB A;  4LQW C;  4U0D A;  4PH0 A;  4B4N A;  1M9D C;  1P7N A;  2GOL B;  1M9C C;  2GON A;  4HTW A;  5JPA A;  4XFX A;  1EM9 A;  1M9X C;  2PWM A;  2XGY A;  4XRO A;  4NX4 C;  4E92 A;  2M8P A;  1AK4 C;  4WYM A;  3BP9 A;  2XGV A;  3MGE A;  1M9E C;  4U0A A;  4U0C A;  4PH2 A;  3P05 A;  2M8N A;  4QNB A;  2LF4 A;  1QRJ A;  1D1D A;  1EIA A;  5HGN A;  1M9F C;  2WLV B;  4U0B A;  5HGM A;  1AFV A;  4E91 A;  4PH3 A;  2PWO A;  4XFY A;  1GWP A;  1L6N A;  1M9Y C;  1E6J P;  2XDE A;  3NTE A;  4XFZ A;  1G03 A;  2KGF A;  2M8L A;  2X82 A;  2EIA A;  4DGA C;  2V4X A;  4DGE C;  3H47 A;  4U0E A;  3H4E A;  5HGK A;  4U0F A;  2XGU A; 
#chains in the Genus database with same CATH topology
 4XRQ A;  2Y4Z A;  2X2D D;  1U7K A;  5HGO A;  5HGL A;  2PXR C;  4J93 A;  2WLV A;  2JPR A;  2X83 A;  4INB A;  4LQW C;  4U0D A;  4PH0 A;  4B4N A;  1M9D C;  1P7N A;  2GOL B;  1M9C C;  2GON A;  4HTW A;  5JPA A;  4XFX A;  1EM9 A;  1M9X C;  2PWM A;  2XGY A;  4XRO A;  4NX4 C;  4E92 A;  2M8P A;  1AK4 C;  4WYM A;  3BP9 A;  2XGV A;  3MGE A;  1M9E C;  4U0A A;  4U0C A;  4PH2 A;  3P05 A;  2M8N A;  4QNB A;  2LF4 A;  1QRJ A;  1D1D A;  1EIA A;  5HGN A;  1M9F C;  2WLV B;  4U0B A;  5HGM A;  1AFV A;  4E91 A;  4PH3 A;  2PWO A;  4XFY A;  1GWP A;  1L6N A;  1M9Y C;  1E6J P;  2XDE A;  3NTE A;  4XFZ A;  1G03 A;  2KGF A;  2M8L A;  2X82 A;  2EIA A;  4DGA C;  2V4X A;  4DGE C;  3H47 A;  4U0E A;  3H4E A;  5HGK A;  4U0F A;  2XGU A; 
#chains in the Genus database with same CATH homology
 4XRQ A;  2Y4Z A;  2X2D D;  1U7K A;  5HGO A;  5HGL A;  2PXR C;  4J93 A;  2WLV A;  2JPR A;  2X83 A;  4INB A;  4LQW C;  4U0D A;  4PH0 A;  4B4N A;  1M9D C;  1P7N A;  2GOL B;  1M9C C;  2GON A;  4HTW A;  5JPA A;  4XFX A;  1EM9 A;  1M9X C;  2PWM A;  2XGY A;  4XRO A;  4NX4 C;  4E92 A;  2M8P A;  1AK4 C;  4WYM A;  3BP9 A;  2XGV A;  3MGE A;  1M9E C;  4U0A A;  4U0C A;  4PH2 A;  3P05 A;  2M8N A;  4QNB A;  2LF4 A;  1QRJ A;  1D1D A;  1EIA A;  5HGN A;  1M9F C;  2WLV B;  4U0B A;  5HGM A;  1AFV A;  4E91 A;  4PH3 A;  2PWO A;  4XFY A;  1GWP A;  1L6N A;  1M9Y C;  1E6J P;  2XDE A;  3NTE A;  4XFZ A;  1G03 A;  2KGF A;  2M8L A;  2X82 A;  2EIA A;  4DGA C;  2V4X A;  4DGE C;  3H47 A;  4U0E A;  3H4E A;  5HGK A;  4U0F A;  2XGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...