2XH3A

Extracellular nuclease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
205
structure length
179
Chain Sequence
TVSSKLLPFTANYQLQLGELDNLNRATFSHIQLQDRHETSSWVMNRGHLVGYQFCGLNDEPRNLVAMTAWLATGAYSGANDSNPEGMLYYENRLDSWLALHPDFWLDYKVTPIYSGNEVVPRQIELQYVGIDSSGELLTIRLNSNKESIDENGVTTVILENSAPNINLDYLNGTATPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Characterization of a Prophage-Encoded Extracellular DNase from Streptococcus Pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Hydrolase
molecule keywords SPD1 NUCLEASE
total genus 40
structure length 179
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.1.21.1: Deoxyribonuclease I.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13930 Endonuclea_NS_2 DNA/RNA non-specific endonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 2xh3A00
3NKRA 5DLTA 3NKNA 5KXAA 5IJSA 4GTXA 2XH3A 4B56A 4QGOA 5L0BA 3ISMA 4A1NA 4ZG6A 3WAXA 3OWVA 3WAVA 1G8TA 3NKQA 3NKMA 5DLWA 1QL0A 5LIAA 3NKOA 4ZG9A 4E3YA 4ZGAA 5L0EA 5LQQA 5GKCA 1QAEA 5L0KA 5GKPA 4GTZA 2XGRA 2O3BA 5DLVA 1SMNA 3WAYA 4GTWA 3WAWA 3S5BA 5IJQA 4QH0A 4QN0A 3NKPA 4GTYA 2XRGA 5INHA 4ZG7A 5HRTA 1ZM8A 2XR9A
chains in the Genus database with same CATH superfamily
3NKRA 5DLTA 3NKNA 5KXAA 5IJSA 4GTXA 2XH3A 4B56A 4QGOA 5L0BA 3ISMA 4A1NA 4ZG6A 3WAXA 3OWVA 3WAVA 1G8TA 3NKQA 3NKMA 5DLWA 1QL0A 5LIAA 3NKOA 4ZG9A 4E3YA 4ZGAA 5L0EA 5LQQA 5GKCA 1QAEA 5L0KA 5GKPA 4GTZA 2XGRA 2O3BA 5DLVA 1SMNA 3WAYA 4GTWA 3WAWA 3S5BA 5IJQA 4QH0A 4QN0A 3NKPA 4GTYA 2XRGA 5INHA 4ZG7A 5HRTA 1ZM8A 2XR9A
chains in the Genus database with same CATH topology
3NKRA 5DLTA 3NKNA 5KXAA 5IJSA 4GTXA 2XH3A 4B56A 4QGOA 5L0BA 3ISMA 4A1NA 4ZG6A 3WAXA 3OWVA 3WAVA 1G8TA 3NKQA 3NKMA 5DLWA 1QL0A 5LIAA 3NKOA 4ZG9A 4E3YA 4ZGAA 5L0EA 5LQQA 5GKCA 1QAEA 5L0KA 5GKPA 4GTZA 2XGRA 2O3BA 5DLVA 1SMNA 3WAYA 4GTWA 3WAWA 3S5BA 5IJQA 4QH0A 4QN0A 3NKPA 4GTYA 2XRGA 5INHA 4ZG7A 5HRTA 1ZM8A 2XR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NKR A;  5DLT A;  3NKN A;  5KXA A;  5IJS A;  4GTX A;  2XH3 A;  4B56 A;  4QGO A;  5L0B A;  3ISM A;  4A1N A;  4ZG6 A;  3WAX A;  3OWV A;  3WAV A;  1G8T A;  3NKQ A;  3NKM A;  5DLW A;  1QL0 A;  5LIA A;  3NKO A;  4ZG9 A;  4E3Y A;  4ZGA A;  5L0E A;  5LQQ A;  5GKC A;  1QAE A;  5L0K A;  5GKP A;  4GTZ A;  2XGR A;  2O3B A;  5DLV A;  1SMN A;  3WAY A;  4GTW A;  3WAW A;  3S5B A;  5IJQ A;  4QH0 A;  4QN0 A;  3NKP A;  4GTY A;  2XRG A;  5INH A;  4ZG7 A;  5HRT A;  1ZM8 A;  2XR9 A; 
#chains in the Genus database with same CATH topology
 3NKR A;  5DLT A;  3NKN A;  5KXA A;  5IJS A;  4GTX A;  2XH3 A;  4B56 A;  4QGO A;  5L0B A;  3ISM A;  4A1N A;  4ZG6 A;  3WAX A;  3OWV A;  3WAV A;  1G8T A;  3NKQ A;  3NKM A;  5DLW A;  1QL0 A;  5LIA A;  3NKO A;  4ZG9 A;  4E3Y A;  4ZGA A;  5L0E A;  5LQQ A;  5GKC A;  1QAE A;  5L0K A;  5GKP A;  4GTZ A;  2XGR A;  2O3B A;  5DLV A;  1SMN A;  3WAY A;  4GTW A;  3WAW A;  3S5B A;  5IJQ A;  4QH0 A;  4QN0 A;  3NKP A;  4GTY A;  2XRG A;  5INH A;  4ZG7 A;  5HRT A;  1ZM8 A;  2XR9 A; 
#chains in the Genus database with same CATH homology
 3NKR A;  5DLT A;  3NKN A;  5KXA A;  5IJS A;  4GTX A;  2XH3 A;  4B56 A;  4QGO A;  5L0B A;  3ISM A;  4A1N A;  4ZG6 A;  3WAX A;  3OWV A;  3WAV A;  1G8T A;  3NKQ A;  3NKM A;  5DLW A;  1QL0 A;  5LIA A;  3NKO A;  4ZG9 A;  4E3Y A;  4ZGA A;  5L0E A;  5LQQ A;  5GKC A;  1QAE A;  5L0K A;  5GKP A;  4GTZ A;  2XGR A;  2O3B A;  5DLV A;  1SMN A;  3WAY A;  4GTW A;  3WAW A;  3S5B A;  5IJQ A;  4QH0 A;  4QN0 A;  3NKP A;  4GTY A;  2XRG A;  5INH A;  4ZG7 A;  5HRT A;  1ZM8 A;  2XR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...